3CKWA

Crystal structure of sterile 20-like kinase 3 (mst3, stk24)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
279
structure length
255
Chain Sequence
PEELFTKLEKIGEVFKGIDNRTQKVVAIKIIDLEEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase 24
publication title Crystal structure of sterile 20-like kinase 3 (MST3, STK24).
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 255
sequence length 279
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ckwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ckwA01
5I9XA 3G6GA 3PYYA 1M7QA 3F2AA 5FWKK 4OTFA 3TZMA 3HAVA 4XV1A 3AT2A 4PMPA 5I9YA 3LIJA 3UNJA 4C62A 3QHRA 4ONAA 3L9LA 3FAAA 3P7BA 2GDOA 3QQHA 1B39A 2UW0A 5AIRA 5ACBC 4CTCA 2OF2A 4E6AA 1XH8A 4YGAA 3Q32A 5EQYA 1JLUE 2OH4A 1B6CB 1OL5A 3LFBA 5G1XA 4BDAA 2JKQA 2WTWA 4WSQA 4DBNA 4DEBA 1DI8A 4MBIA 3LFAA 4JS8A 4WNOA 5CVGA 4QTAA 3PY1A 3VS6A 3WE8A 4GT5A 4YNEA 2F7EE 4S34A 2NPQA 4BWKA 3EH9A 1YXSA 4G3FA 4L9IA 3R8LA 3EN5A 5JRSA 4ZY4A 4CYJA 5CF6A 2HZNA 4UX9A 3MB7A 4C36A 3K5VA 4RVKA 3RPYA 2O3PA 5LXMA 3OWKA 3F3WA 4FKGA 5HLNA 2OU7A 2HXQA 4IADA 1K2PA 5CASA 2G1TA 3N9XA 4F9AA 4PL5A 5LVPA 2XIZA 1F0QA 5CF5A 5CZHA 3FMLA 3KN5A 2QU6A 2OXXA 3Q9WA 3QKMA 4NTSA 5EHLA 1H07A 4IH8A 3GQLA 4N6YA 4EOSA 3FMJA 3IW4A 5BVKA 4OAUC 2CCHA 4QP8A 4MNEA 4X3JA 2BAQA 3UODA 3A7HA 1F3MC 4USDA 2GNLA 2DS1A 2F2CB 4FV7A 1O6YA 4DH7A 3HDNA 3VS1A 4HGTA 5DT0A 1W7HA 4DITA 4PDSA 5TOZA 3V8TA 4F1TA 4KSQA 4BCGA 4L45A 4YTFA 3R7VA 3NUUA 4L42A 5AP7A 3UMXA 4CKIA 2XVDA 4I4EA 4WSYA 2HXLA 3OY3A 4KSPA 4ARKA 3EL7A 4ZSJA 2Y0AA 4NZWB 2PVFA 3E7OA 1H01A 4F08A 3QX4A 5M4UA 3KC3A 2PWLA 5CQUA 2WGJA 1YWNA 3BHYA 5DMZA 2OK1A 3DBQA 1NA7A 4AE9A 3TUBA 2A0CX 5DT4A 3LMHA 3GENA 3HA6A 5HVKA 2CSNA 5CXHA 5EM5A 2YWPA 2QC6A 3C50A 3FHIA 3FPMA 4FGBA 5EDPA 5FBOA 4DTAA 3CS9A 1U59A 4U6RA 2YM4A 3EQRA 4ZXTA 4HVDA 3CSVA 2ETKA 4PNKA 2JKKA 1JOWB 3ZLYA 1KE7A 4ENXA 5KHWA 3LPBA 4MQ2A 4FGRA 3ALOA 4TNDA 5KMOA 3TKUA 4B4LA 4HJOA 3FLNC 3MI9A 2ITUA 3NYVA 4L8MA 4MWIA 3WBLA 4YMJA 2WIPA 3DBFA 3NZ0A 4O0VA 3DXQA 4HYSA 2OW3A 3EN4A 3MH3A 4ITJA 4R8QA 1CTPE 5KBQA 3FXWA 4GU9A 3QFVA 4L53A 3A60A 2R5TA 3BU5A 4RGJA 4JG8A 4YJOA 5L3AA 4D2VA 5L2SA 4ANBA 3QALE 2C5XA 4H1MA 3VHKA 1H1QA 4KRDA 4EQCA 5IA0A 2C6KA 4FICA 2C1AA 2W1ZA 4G3DA 1XJDA 5M07A 4O83A 4TTHB 2BRHA 3AGMA 4E4MA 5EM8A 1K9AA 4DT8A 5IUHA 1YKRA 5AAGA 1YI3A 4PY1A 4RFMA 4GU6A 3UG1A 4AW2A 1Q5KA 4C59A 4C02A 1LP4A 3Q2MA 4FIGA 4G2FA 4IEBA 4QQCA 4UMTA 4CKRA 5I5ZA 1CM8A 2XYNA 4B99A 4U3ZA 5LCKA 2R64A 5TO8A 3BV2A 4J96A 2VTHA 3IG7A 3ZSGA 4DG0E 1R3CA 2O65A 3CIKA 2VTRA 3Q60A 3D14A 4UALA 4RJ3A 3RK5A 3H3CA 3C4CA 3ETAA 3LQ8A 4MCVA 4V0GB 3DNDA 4X2FA 5LVLA 2YJSA 3OS3A 1V1KA 4LQMA 3UP2A 1JPAA 1YHSA 3FZPA 2IJMA 1JWHA 3LJ2A 4O7YA 3COIA 1ZYLA 3MWUA 3BEGA 3KFAA 1A9UA 1YDTE 3C4ZA 4IM0A 2RKUA 4BKZA 5IG1A 3F3UA 4UV0A 3IGGA 4HYUA 4XP3A 4EORA 2R3FA 2ITNA 2PZIA 4M3QA 3HUCA 3GU7A 3U4UA 1M2PA 2OF4A 4FKLA 2GPHA 1HOWA 4NU1A 1GOLA 1ZMWA 4FV8A 2PE1A 4N6ZA 5I3RA 4L7FA 5LMKA 2W9ZB 2VTIA 2C5NA 4XHKB 1PYXA 1O6LA 2JFMA 3ZOSA 3BGQA 3HECA 4J53A 3MH0A 4EHZA 5FRIA 3HMOA 1IA9A 3R9HA 2OIBA 5HBJA 2B9JA 1U54A 2EB2A 3KB7A 4RJ6A 4FYOA 5AR3A 5HBEA 3DK6A 3ORTA 3FYJX 3VJOA 3NIEA 4EOMA 3TV7A 2F4JA 4J8MA 4YHFA 3WARA 4EBVA 4O21A 4IAYA 2X4ZA 4PV0A 4FKUA 4I5PA 5E8WA 2WMBA 5CAUA 4BRXA 1YOMA 2WOUA 2GQSA 2Z60A 1OIRA 3GI3A 1J3HA 3AXWA 3SVVA 4Y8DA 2PY3A 4DEGA 5CU2A 2XYUA 3DZOA 4RX8A 4RWLA 1H26A 5KUPA 3R2YA 4N0SA 1OKVA 3PA4A 3NUSA 4XX9A 3HL7A 1PXMA 4FIFA 2REIA 1H28A 3W8LA 5K0XA 3MESA 5ANJA 2CMWA 3HGKA 1ZOHA 5IMXA 3U8WA 2C6DA 4IVDA 5T6KA 3W8QA 4K18A 2VX3A 4CXAA 3VBTA 4AZVA 5JK3A 4W4YA 4CGAA 3DZQA 4LMUA 4G6OA 2BRMA 2B9HA 3DLSA 2JKOA 3LMGA 2YITA 4XG8A 2DYLA 4M67A 4D2TA 4E6QA 1NY3A 4CG8A 5LVOA 4NM5A 3OFMA 4F7NA 2ZYBA 3VS3A 4A07A 3IDCA 4A9UA 3ODYX 1H0VA 3OT8A 4MK0A 1OKWA 2R3LA 3ZO3A 4HVGA 1NT2A 5HX6A 2WMTA 1VZOA 1U4DA 4ZJJA 5HESA 5GIPE 4L44A 5JH6A 2I7QA 3V3VA 1GZKA 1IA8A 2YERA 4ANSA 4KAOA 4BHZA 4UWBA 4IIRA 4OUCA 4EH2A 4IFCA 5E7RA 3VRYA 2X39A 2VWIA 3K2LA 5FGKA 2I0VA 5DBXA 1YQJA 4IXPA 5HI2A 4EC8A 3C1XA 4QO9A 4CZUA 3EHAA 2BZKB 1WBNA 2BZIB 4WBOA 4J7BA 4TYIA 3H10A 3DDPA 5J95A 3SOCA 5AR5A 1Q8WA 5H2UA 3VS4A 5KMIA 4E20A 5EKNA 2OJ9A 2R2PA 4TWOA 3ZFMA 3ZHPC 4HYIA 2X6DA 5GNKA 1GIHA 3FI8A 1G8SA 5CAQA 4C38A 3G9NA 4E6DA 2X9FA 5CI7A 2BPMA 3SGCA 3A7JA 1ZYCA 2W99B 2WELA 3QXOA 5D12A 5CF4A 1GY3A 5E4HA 2C4GA 3CLYA 4YBKA 2OGVA 3U9NA 4ZIMA 4PUZA 3ULZA 1YOJA 4HGSA 4W8DA 4O0WA 4EUTA 2J6MA 3VBWA 1MRUA 2F9GA 2JDTA 4PQNA 3IQ7A 2AUHA 5AWMA 5D9HA 5H9BA 4YO4A 3QTSA 1BKXA 3HP2A 1OBGA 4L3JA 4OTIA 3NMUF 2VTMA 4QP9A 4XP0A 4XRLA 4MXAA 3P5KA 4IMYA 3COKA 5DHJA 3VF8A 4ZJVA 2CKPA 3EYHA 4AS0A 2OFUA 3OC1A 3KN6A 2YAKA 2UVXA 1KSWA 4K0YA 4G34A 4LL0A 3VUTA 4ANNA 3DFCB 3R30A 2X4FA 4D0WA 3QRKA 4EONA 3Q9YA 3C13A 2CNVA 2VTLA 3H9RA 3MW1A 3FMEA 3DFAA 4MBLA 4QTBA 4D5KA 2ITYA 2QO7A 3E3BX 4D4YA 2A2AA 5FDXA 4EWQA 1STCE 3R04A 1G5SA 4O0RA 3U55A 3NVMB 1YDRE 3QRUA 4G5JA 4JQEA 4H58A 2X2LA 5FD2A 3V51A 3HV7A 3OY1A 4QYYA 4IDVA 4M13A 4MF1A 2YEXA 3I5ZA 4LYNA 1Q3WA 3VQUA 3F9NA 2V5QA 3VO3A 4RIWA 3V5JA 2QG5A 2IVUA 2UZDA 4FG8A 4FV5A 4GFOA 4UYAA 3UE4A 5M53A 1MQBA 3Q4ZA 3FY2A 3PPKA 3QQGA 5B2KA 1B38A 1CDKA 2VO0A 2CKEA 1JBPE 2PMNX 2OWBA 5HOAA 1XBBA 4G6NA 1UV5A 3MBLA 4RT7A 4ACMA 4XV9A 5HD4A 4IE9A 3UZRA 2CGXA 2PZ5A 5C26A 1KOBA 3ZBFA 3KXNA 2XK6A 3DXNA 4F70A 4ZMFA 2W96B 3EMGA 3UVQA 3LFQA 3THBA 2KTYA 2J0MB 4E5WA 4AP7A 4CV9A 1YHWA 2CLQA 3CD3A 3Q52A 3SW4A 4AF3A 3VUGA 4EOLA 4M12A 3QL8A 1KE9A 2WMAA 4EH4A 4X21A 4ZJIA 4F0GA 5CAVA 4ZTHA 3MTLA 3E7VA 4AUAA 4R3PA 3ULIA 5EM7A 3C7QA 2X7GA 4L01A 2XUUA 5DGZA 1Q4LA 2VWUA 2XNOA 4PL4A 2XEYA 4LG4A 4TYHB 3I79A 4X2NA 3NAXA 2NP8A 4AAAA 2YIXA 3E87A 5FTQA 4CT1A 3R00A 2VZ6A 2GFCA 5JQ5A 2WPAA 4W4VA 5D11A 3HLLA 3LM0A 3ZO1A 4YNOA 3ORKA 3TACA 4ASZA 2G15A 2CHLA 2RF9A 4HCVA 2QD9A 1WBPA 3NRMA 5FP6A 1ND4A 3TIYA 4EOKA 5HIDA 1Y57A 3OW4A 3BZ3A 4FZ7A 5L8LA 4FSMA 3U9CA 4DTBA 4FV4A 2I40A 4I41A 1LEZA 1DAYA 2X0GA 5J9YA 5LARA 4EOPA 4NW5A 4DGOA 4EC9A 3A7IA 2AC3A 2P2HA 5J87A 5FTOA 5BVOA 4Z55A 3F82A 2IZTA 4JDHA 4K9YA 2QNJA 3ROYA 2QKWB 1ATPE 2UZUE 4CYIA 2OIQA 4EOQA 4JIAA 2OZAA 1KE5A 3AD5A 3SRVA 3JXWA 2OJGA 4RWKA 3KXZA 4XG3A 1ZLTA 1ZOEA 4ZAUA 3DXPA 3TI1A 3UGCA 1XO2B 2ZV2A 4GSBA 4M97A 5EH0A 5A6OA 4FNWA 5BPYA 2WQBA 3TJDA 3Q4UA 4FT0A 4XCUA 4BDEA 3PP0A 4USFA 1YVJA 2NNWB 2IVSA 1YXXA 4FTCA 3FZRA 3HRBA 3JY9A 2QHNA 3CY3A 5DE2A 2YM3A 3IW6A 1Q41A 5FG8A 3DB6A 4CFFA 1LUFA 3OXIA 2CLXA 5ETCA 4NEUA 3Q5ZA 2JIUA 3M11A 2R4BA 2QI8A 4AZWA 3FYKX 4D0XA 4LFIA 4ALUA 3FSFA 3CPCA 4NFNA 5HTCA 3FXXA 3R7GA 2Z02A 1FINA 5EI6A 5K0KA 4ZLYA 5IEYA 3F5XA 1ZYJA 4EH8A 4WRSA 3TEIA 2BZHB 3NSZA 5BYLA 4JQ7A 4G17A 1REKA 4FKRA 2VTSA 3N4VA 4WO5A 3LXPA 4E7WA 3DJ5A 3Q6UA 1YWRA 2HZ0A 3PWDA 2ZMCA 5FBNC 2VNYA 5BMSA 2CGUA 4CMOA 5BUJA 3P08A 5D7AA 3R1QA 2O64A 3LLAA 2F49A 4TYJA 3DS6A 2CGWA 3MJ2A 4ZS0A 2JDVA 2QOCA 2XNBA 1PMVA 3HRCA 3QZHA 1HCLA 2Z7RA 4RC4A 5BUIA 4RJ7A 4IB3A 1VJYA 3CQEA 4GVJA 4HPUE 4LOQA 4YURA 2CN5A 2IW6A 1RDQE 3NUPA 4NIFA 2H34A 3B8QA 4P5ZA 1I44A 4FZ6A 5M55A 5EYMA 1PXNA 2PHKA 4MWHA 1XH5A 2B55A 3MFRA 3PIXA 3OOMA 4U8ZA 1T45A 3IO7A 4QPMA 1PJKA 3NEWA 4JDKA 4QMZA 4AZSA 2BALA 4H3PA 4YJRA 3SXFA 4DN5A 1FGKA 3C4XA 3RMFA 3NCGA 5AP4A 2W5HA 2Y4IC 3FWQA 3OBGA 4RJ5A 4W8EA 4FEVA 4EK8A 5DOSA 3K5UA 5KMJA 2VTNA 3SOAA 3OUNB 1Y91A 4R6VA 2JEDA 3VC4A 4ZP5A 3E63A 5HCZA 3R7UA 3OCSA 4FA2A 5IDPA 3CTJA 4FG7A 4J99A 3GT8A 3DNEA 4TWPA 4ACGA 5IQIA 5HGIA 4H1JA 3ZXTA 2CJMA 2CKOA 2YJRA 4FSUA 5M51A 4PF4A 3VBXA 2GS7A 4V04A 5L4QA 2Q83A 3ACJA 1FVTA 4UXQA 2IG7A 4LUDA 4FI1A 4KS8A 4IZ7A 4LRJA 4A9SA 5E91A 5KKRB 5AA8A 3R7EA 1XBAA 1QMZA 4GW8A 3VBQA 3RNIA 3MN3A 3Q4CA 4YLLA 3PSDA 4OT5A 3L9NA 4FUXA 3V5QA 4FTRA 4U0IA 3ZMMA 4UWCA 5GZ9A 5IUIA 3R9NA 4F99A 4R1YA 4Y5HA 5FEEA 4AG8A 3RNYA 5J5TA 5KX8A 3I7BA 3AMAA 4A9YA 3D5UA 4CCUA 3LHJA 4YC8A 3ENHA 3NX8A 3JVRA 2YM6A 3DV3A 4HVSA 4CFVA 5EQEA 4GK2A 3MA6A 4XG7A 3T9TA 3ZEPA 4IB5A 3TNIA 4A4LA 4G1WA 3UP7A 3OWLA 5CSPA 1FGIA 3DAEA 3P7AA 2XKEA 3QRTA 4FL1A 3PY0A 4H05A 2WMUA 3AC3A 4DT9A 4DGNA 3R8PA 1IRKA 2O2UA 4C61A 3A7GA 1PMUA 2JDOA 2RG6A 3BYUA 4BDJA 4QYFA 4Q9SA 4AXAA 1H8FA 4DH1A 4JR7A 1L8TA 4WD5A 3BI6A 3C0IA 3TM0A 3IW7A 3G90X 3KGAA 4QMYA 1J7UA 2CKQA 4FKPA 4YHTA 3VUIA 5EW3A 2UW8A 2C3LA 3D0EA 5GHVA 1J91A 3CY2A 5AP5A 2PTKA 5H8EA 3TUCA 4ZMEA 4RIXA 4K2RA 2PMLX 4FYNA 3AC2A 1UA2A 4YO6A 4E1ZA 4GYIA 2JITA 5DEYA 4IAIA 5B2LA 3NCZA 2GQRA 4M66A 2P3GX 4Q5HA 4QOXA 2UZLA 3IW5A 5FTGA 4FSZA 4M84A 3WF6A 5ANKA 4B9DA 4D9UA 3PIYA 4ITHA 2ZDUA 3ORMA 4KRCA 5EW9A 4DFNA 4I5MA 2ITXA 5EKOA 4FSQA 1A48A 3RHKA 3W2PA 4EK3A 4FVQA 3DPKA 4L43A 5AAEA 1P4FA 2YA9A 3WZEA 3KK9A 4FTJA 4O81A 1LPUA 4EKLA 2O8YA 1TQIA 3K3JA 4K6ZA 3LAUA 5TF9A 4ZTNA 3CJFA 4EK4A 4JBPA 4O91A 2QOIA 1Q8YA 2C3KA 1JQHA 2BRGA 4WHZA 3BHVA 3U51A 3EZVA 4IB1A 3BX5A 3VRZA 1A06A 5EOLA 5CNNA 3ZDIA 3DCVA 4FKOA 4J98A 2XNGA 3U6IA 1SVEA 2P0CA 5ETAA 4DCEA 3HAMA 4F9CA 3REPA 4FKWA 4YJQA 4EZ3A 3DKFA 3G0EA 1DS5A 3O17A 3UJGA 2UW5A 1ZY4A 4IAZA 5CYIA 4FC0A 4DGMA 4JJRA 1GJOA 5CU6A 3UQGA 4EJNA 4B0GA 2XZSA 3FLYA 5ETIA 5HZNA 4NYEA 1XHAA 4B6LA 3D5WA 2H6DA 4Z7HA 2WNTA 2VWVA 3QCQA 4QP6A 4BBEA 5J9LA 3VHEA 3D5XA 3R22A 1PXJA 2C30A 4I0RA 5CSWA 2J2IB 3DAJA 5HE2A 4FVRA 4IJPA 4Z7GA 4E5AX 5I3OA 3RAIA 3RTPA 4F6UA 3O8UA 3W2SA 3FHRA 2ZV9A 4QMXA 4MBJA 3LMIA 2P2IA 2DQ7X 3V01A 2WB8A 2VWXA 2YIQA 4IZYA 2A19B 4AGDA 3NNVA 4MXZA 4BGQA 4F6SA 3F69A 3NVKI 4EI4A 5JGAA 3E88A 4C4FA 4JRNA 4XBUA 3SXSA 4QMQA 2W4OA 4FR4A 4GFMA 2H8HA 3ZC5A 3ZONA 4WG3A 5HLWA 3AT3A 4RRVA 2FA2A 2WFYA 3QF9A 4E4XA 3Q9XA 3L9PA 4C34A 2OJIA 4KIKA 4NJ3A 4GCJA 3EN9A 1UWHA 3UNZA 3PJ1A 2X8EA 5HORA 1IAHA 4V05A 2GTMA 2C0IA 3I6UA 3U6HA 4YPDA 4NT4A 2XNPA 4BYIA 4M0ZA 4FL2A 4YZNA 2UW4A 2WTJA 1OL6A 3MY1A 2IW8A 4D9TA 1ZMVA 3V6RA 1QPDA 2YM7A 5HG9A 4E4LA 4Y95A 2VTAA 3BHTA 4D55A 2IN6A 1M7NA 4M69A 2JBPA 3NW7A 2RFSA 2UZOA 2PE0A 3EIDA 4RLKA 4BGHA 4XS2A 4AE6A 4FF8A 3VN9A 1OZ1A 3Q96A 4D58A 4QMMA 5D41A 1W98A 4E26A 3P9JA 1FPUA 3NUNA 4NCTC 1JKTA 4IAAA 4ALVA 4FV9A 4DH3A 4UYNA 2X1NA 3LJ0A 4G9CA 3W16A 3GCVA 1M17A 3EN7A 4FIHA 1M14A 1UVRA 5E8TA 5JKGA 1UU8A 3QTUA 4UEUA 5I4NA 1MUOA 3VVHA 1OL7A 3WZJA 4TYGA 5HIBA 4NH1A 4PTEA 2Z8CA 2WHBA 4XLVA 4U7ZA 2IPXA 3MH2A 3ZTXA 2VUWA 3U6JA 4JG6A 2W5AA 4LUEA 4DFYA 2PU8A 4LGHA 1AGWA 5HHWA 3MA3A 4FSYA 3ZRLA 3PJ2A 3MFUA 4O2ZA 3UQCA 4D1XA 5IA2A 2PVMA 2HELA 5EFQA 4FIIA 1XH7A 4WNPA 4RIWB 3EFLA 3KF4A 5M09A 4C4HA 2UW9A 2XP2A 1J1BA 5KMLA 2EU9A 2VTTA 5DRBA 4GRBA 4U81A 4QP3A 1W8CA 1YOLA 1IASA 4JAJA 2PVLA 2ONLA 2QOHA 4ID7A 5IKWA 1E1VA 2YCSA 2OG8A 4NW6A 4CZYB 1JVPP 4GK4A 4CD0A 5HNIX 5J1VA 2J0JA 2ZAZA 2ZVAA 5CX9A 2RL5A 4GK3A 4ANLA 5IQDA 2I1MA 3FLSA 3PA5A 5IZFA 2R9SA 1OMWA 3P7CA 4RVMA 5AV3A 1OI9A 4XH6A 4YZ9A 4JBQA 3UVRA 3WIKA 1ZY5A 3BIZA 4X7QA 2PULA 1REJA 4XEYA 3PXFA 1BUHA 2BCJA 3POOA 5IH5A 3RWPA 2OXDA 4GIHA 5KMMA 3U54A 5AUXA 2VNWA 5DPVA 5C4LA 4P90A 3GBZA 3DKOA 3A4PA 4PNIA 3PUPA 3LQ3A 2XIXA 5AV1A 4O86A 2XF0A 4TL0A 1R1WA 2UVZA 2XKFA 3QTQA 5AUZA 5CEPA 4AN2A 3QQLA 3ORNA 4XV3A 4D2RA 5LJJA 3ALNA 4HOKA 2PZPA 3GU5A 3R63A 4AGCA 4EQMA 1YHVA 2C5OA 4TY1A 5EQPA 5AJQA 2UZEA 4NTTA 3S4QA 5HTBA 3S0OA 5FQDC 1PHKA 3Q2JA 2RG5A 3HYHA 1WCCA 4OTGA 3UMWA 5I0BA 5HBHA 3CPBA 3TIZA 4BTKA 5FDPA 5LWMA 3QC9A 4NSTA 1R0PA 4APPA 4MHAA 2OZAB 4O7LA 2WTDA 4QP7A 3I81A 5AEPA 4IWDA 3P1AA 5AAFA 4XG6A 3QCSA 5AR2A 3OCGA 1SNUA 3OBJA 4IM2A 3GC9A 3LZBA 3FKLA 3V5LA 1Q8ZA 3AC4A 4QMNA 1U5RA 5L2IA 1H27A 2X2KA 3SX9A 2WEIA 2W1GA 3RPSA 3TG1A 3QBNA 3QRIA 3BV3A 5HG7A 3E8EA 5ACKA 2BAJA 3RZBA 4CV8A 2FSOX 3C5IA 4RLLA 4YJNA 5JEBA 4DCAA 4EOJA 3TV4A 4EZ7A 2YZAA 3MY0A 5B0XA 4Q9ZA 4JVGA 4A4OA 4I93A 3NLBA 3RAKA 4CFMA 5AM6A 1M2QA 1BL6A 4LGGA 1WBVA 4QMTA 3AD4A 3BCEA 3LXNA 2YLEA 4RQKA 4DEHA 4EL9A 2EWAA 3C5UA 3JUHA 3ZS5A 3U4WA 4MH7A 2A4LA 3MSSA 4ZSEA 5BX0A 5LMBA 1PXPA 1CMKE 3ZZEA 4CSVA 2PVRA 2W1HA 4IVBA 2WIHA 4B8LA 4QQTA 3ZFYA 1NVQA 3FMNA 3T3UA 4QMWA 2V55A 2GHGA 3JPVA 2NRUA 4CKJA 4O6EA 1ZARA 3UZPA 3LXKA 4AZFA 2C0OA 3D9VA 5HICA 4GYGA 5AR4A 1SZMA 3PSCA 1JSVA 2IVTA 4WIHA 2QOLA 2WMVA 4I0SA 4BHNA 1S9IA 2XCKA 5C8MA 4ZZNA 2OSCA 1XQZA 3VF9A 3FMHA 4E73A 1XH4A 3WZDA 3NUXA 2XCHA 2UZTA 4C4GA 5C8KA 2P4IA 4NIFB 1H0WA 3PRFA 3ORXA 2G9XA 3MGYA 3FC1X 4JR3A 4KINA 1P4OA 2EXEA 4YLJA 3UIMA 4ACCA 2XNMA 3TKIA 4BIBA 2VO3A 2BRBA 2YCFA 4F7JA 3FLWA 5E1SA 3W10A 1YXUA 2W1IA 3F3VA 3LCKA 3EKKA 5HIEA 5JFVA 4YC3A 4M8TA 3UOKA 2RSVA 3WF7A 5JZNA 3ROCA 4X3FA 3PE1A 4G31A 1TQMA 3PTGA 3S1HA 1IR3A 3QGYA 4GUBA 3V8SA 3QWJA 4I0TA 3ORZA 4RC3A 4FSNA 3FI4A 4L46A 2QKRA 3FZ1A 3EQGA 5CTPA 3R9RA 2C3JA 4RX9A 4C8BA 4PPBA 3EL8A 3O8PA 1ZMUA 4QYEA 2B52A 4K11A 4D2PA 2ITVA 1NXKA 4GG5A 3FI2A 3E62A 4EZ5A 4QNYA 3FSKA 2UV2A 3R71A 4TRLA 1DI9A 3QZFA 4TKSA 4YSJA 2ACXA 3G5DA 4BCQA 3F7ZA 2R0UA 3R1NA 1BI8A 4AN3A 3JR1A 4QYHA 4FNXA 2WTKB 3QQUA 3O7LD 5IA4A 2W1DA 4UMPA 2J4ZA 3GP0A 4BCKA 5AR8A 3KULA 3ZM4A 2Z7SA 4ZEGA 1WBWA 5BMMA 5EI8A 3N51A 5DN3A 2XBJA 5JZJA 3EN6A 2QO9A 4O7VA 3LCDA 3KCKA 3SV0A 2ERZE 3R1SA 1TKIA 3AC1A 4U44A 1ZYSA 3NDMA 5HG8A 2CPKE 4YJSA 2R7IA 4GMYA 4BI0A 3EWHA 3VIDA 4DLIA 2W0JA 3HV4A 3NAYA 4BYJA 1KE6A 2XK8A 3HV3A 4PTGA 5M57A 3BHHA 3ZCLA 3EQCA 3TZ8A 2X81A 4Q2AA 4O7NA 1OECA 4CNHA 4CLJA 3Q4TA 4IVCA 2XH5A 2QR8A 4DYMA 1Q99A 4Q5EA 1M52A 4XJ0A 2PSQA 3PDTA 3QWKA 1UU3A 2ESMA 2JFLA 5AP1A 1ERKA 4DFLA 2X7FA 4RIYB 3MS9A 4NJDA 2XNEA 5DR6A 3F3TA 3FPQA 5JN2A 2R3MA 1LR4A 1GAGA 5M08A 3O2MA 4FSWA 3MVMA 3H9FA 1QPEA 2PK9A 5F1ZA 4WG5A 3R2BA 5ANOA 4RX5A 3UQFA 5DVRA 4YTIA 2NO3A 4AOIA 4BZOA 5EYCA 5LQFA 4KKGA 2VGOA 2YACA 2V0DA 3ACKA 3F66A 4K33A 5A6NA 3PZEA 1QL6A 4C3PA 5BNJA 3QCXA 3QX2A 4G3CA 3QZGA 4F0FA 2X2MA 4RIXB 2R3OA 2BFYA 3GB2A 4J97A 2YCQA 5ETFA 1R0EA 2FSTX 2VRXA 4LM5A 4AQCA 4F64A 5AADA 1UNLA 4YTHA 3DDQA 2YHVA 3Q9ZA 3WILA 2XK9A 2WEVA 4RZWA 4PX6A 2F7ZE 3DK7A 3PG1A 3UZTA 5M56A 3RVGA 3KXHA 1WFCA 4RJ4A 4TYEA 5AUTA 5IQGA 1PXLA 4OTDA 4CFXA 2ITPA 1H1WA 4R78A 2ITQA 4MD9E 3UTOA 3KXMA 4FT7A 3GOPA 4O0XA 1FOTA 3C4FA 3DBEA 3LFDA 4IFGA 5F9EA 4RSSA 3G2FA 3GU8A 3OROA 4R5SA 3LOKA 1GZNA 3SKCA 1FBNA 4XLIA 1X8BA 4PDYA 2C6IA 2QVSE 2R3PA 3TKHA 5CU3A 1GNGA 4APCA 3SG9A 4UB7A 4CVAA 4W9WA 3VUMA 1OL1A 4YZBA 1OIUA 4KS7A 5K4IA 4L67A 3AT4A 4TZRA 4DEAA 1FQ1B 5CF8A 3R01A 2V22A 3DTCA 3RK9A 4EQUA 2O5KA 2HCKA 4N57A 3D2KA 2FSLX 4XG2A 3VW8A 2PUNA 4PP9A 4RQVA 3R8UA 3BE9A 2VU3A 4FTUA 4KKEA 5A54A 1KOAA 3N4UA 4DEEA 1XWSA 4EBWA 4BN1A 1KE8A 4EHEA 5JFXA 2A1AB 3COHA 3DJ6A 3MVHA 1S9JA 2E9NA 4MNFA 1URCA 4RZVA 5CI6A 3UDBA 3W2CA 3DKGA 5LVMA 5CT0A 4YJUA 4I1ZA 5CEKA 5A9UA 5HO8A 3ORIA 2X9EA 5HVYA 4FMQA 4AU8A 5IEVA 3M2WA 2DWBA 2W1CA 2B54A 3L8SA 4GKIA 3RGFA 3R0TA 2BDJA 4R77A 4FTAA 5CEIA 4S33A 3R7YA 2HY0A 2CDZA 4QD6A 4FOCA 3V5TA 5IQAA 4ERKA 3IONA 4U9AA 4C35A 5CQWA 2V7OA 3S95A 3ZH8A 4BB4A 2ITZA 5DH3A 2W05A 4L7SA 1J7LA 2JAVA 3LCTA 3KXXA 5TT7A 4O7TA 3UNKA 4DFZE 2HOGA 4O7WA 4FIEA 3SLSA 3LCSA 4UWYA 2BTRA 4QP4A 2CN8A 1OL2A 2QONA 3CBLA 5CSXA 3TT0A 4E4NA 2QU5A 3OZ6A 3R73A 2E9OA 3VBVA 3V5WA 3ZXZA 3VBYA 1K3AA 2PE2A 3F3ZA 3QD0A 4BTMA 3CTHA 4QQJA 3RPRA 1M2RA 2IVVA 3R21A 4F1OA 5CEOA 1JSUA 4V0GA 2JLDA 3MH1A 5FXSA 5HEZA 5AUUA 4FX3A 4EOIA 3RHXA 1MRVA 1WBTA 4OBPA 4QRCA 2EB3A 2Y6MA 4I20A 5FUTA 5CNOA 3T8OA 1I09A 2RFNA 1CSNA 2UUEA 4MAOA 3VS2A 4PDOA 4E93A 4IZ5A 4X0MA 3QQFA 3QLFA 3MB6A 3MVJA 3RPOA 2W4JA 4NL0A 5IQFA 3QKKA 4MNEB 4PTCA 3LVPA 5A14A 4IANA 3DGKA 3OD6X 4KBCA 4C3RA 2GTNA 2C5VA 3D7ZA 3F5PA 4NUSA 4RMZA 5A3XA 3RK7A 5AA9A 3WZKA 2CNQA 3VW6A 3FEGA 4YJVA 3TDVA 2QLUA 2OI4X 4KABA 5TKDA 4IX6A 2J0LA 3PVBA 4FK6A 2PPQA 4I21A 2PUIA 3UO5A 3FMDA 1IAJA 1MRYA 4FV6A 3TCPA 1H25A 4II5A 4ANOA 2LAVA 5L6WL 4YZMA 4BTFA 3G9LX 1Q3DA 4DE4A 3CQWA 4BFMA 4L52A 5CZIA 2Z2WA 3LE6A 4J1RA 2C0TA 3A4OX 4IM3A 4HVIA 4O82A 1WBOA 4JRVA 3VNTA 2G2IA 3F5UA 4L3PA 2WKMA 3ATSA 3FE3A 3L8XA 4NM0A 5J79A 3TNQB 4HCUA 1FVRA 4QP2A 4WUNA 3ZUUA 5AV0A 3VS0A 3PRIA 3PIZA 5HNBA 2WO6A 3QTIA 1YRPA 3R6XA 2YCRA 3ZLSA 2EUFB 4YC6A 4FOBA 4EUUA 4FTOA 4TT7A 4PMMA 3SHEA 4FT3A 2W9FB 2R3HA 1J1CA 4IJ9A 3MPAA 2XEZA 3MIYA 5BVFA 1J7IA 3QXPA 4FTIA 5HCXA 1ZAOA 4PMTA 4F0IA 1XH6A 1WAKA 4I24A 3BU3A 3TWJA 4DEIA 1BI7A 3QYWA 4YSMA 3LJ1A 1OPJA 2QG7A 4OR5A 4U5JA 4KWPA 2UW3A 5TR6A 3FDNA 2XBAA 2CCIA 4L3LA 4QMOA 3BU6A 1PMNA 3SDJA 4DAWA 3NR9A 3OT3A 4NM3A 4FEWA 1FVVA 4DA5A 3CKWA 1Y6BA 1NVSA 1HCKA 1RJBA 5CS6A 2Z7LA 4OW8A 1FMOE 4ACDA 2XKDA 4AA5A 5CSVA 3A99A 3UG2A 4UMUA 3PG3A 3AD6A 2QOOA 1OKZA 1UNHA 4JBVA 3Q53A 3ZUVA 4QTDA 4AT3A 3ID6C 3EQDA 3TV6A 3C0GA 3SG8A 3IDPA 3ZUTA 3GCQA 4XP2A 1SNXA 4FTMA 4JNWA 3QA0A 4BDGA 3EKNA 2JKMA 3QUDA 4IAFA 5L8KA 5E8XA 2FSMX 2LGCA 4E5BA 3LCOA 4OAVB 5AFVA 3I7CA 4GH2A 4CG9A 3IPHA 4F1MA 5ANDA 3O71A 1Y8YA 5J5SA 5CLPA 3NNWA 2QQ7A 1YWVA 4MEDA 4U45A 2HY81 3LLTA 5FM3A 1T46A 4JOAA 4BF2A 2R7BA 3DBCA 4D5HA 2QCSA 5JFSA 5BQ0A 3OEFX 3FUPA 2YISA 3A2CA 3DQXA 3G51A 3P79A 3P86A 4L00A 5AUYA 2C1BA 4AGUA 2B0QA 3D4QA 3QZIA 2P33A 4WOVA 4Y85A 4TXCA 4DFBA 4IX3A 2BFXA 3UIUA 3DJ7A 2OJFE 3DU8A 4EKKA 3OP5A 4UMRA 3AOXA 4FKIA 5HQ0A 5KKRC 3M42A 3UIXA 1U46A 3OOGA 3OG7A 4R7BA 1CKPA 1W82A 2O0UA 3HV6A 1Q24A 1PKGA 4F63A 5AP6A 4R3RA 2GSFA 3IOKA 3TN8A 1BL7A 3P78A 4LV5A 3DBDA 4O22A 4O1OA 3W32A 4FKSA 2Y4PA 4JG7A 2BR1A 4FV2A 3EFJA 5A4TA 4N70A 3A8XA 4D1SA 2WMRA 3GUBA 3V5PA 3C4WA 1KV2A 1U54B 5BVEA 2YIYA 4R1VA 2BROA 4D4SA 2F7XE 2YAAA 5I9ZA 4MXOA 5L6PA 3G0FA 1QPJA 3Q3BA 1UNGA 1H1RA 2W5BA 3QQJA 2XA4A 3ZSHA 2R3RA 2WU7A 2YZLA 4O96A 1WMKA 4Y46A 2VWWA 1JSTA 3HZTA 4F7LA 5KBRA 1ZRZA 4AT5A 4D4VA 3FY0A 4RBLA 4XV2A 4AA0A 4EJ7A 3GCUA 4O0TA 5LVNA 5LMKC 4GIIA 2X8IA 3UO6A 3GC0A 3KMMA 5IA1A 3CR0A 3DT1A 4C57A 3RKBA 5AV2A 5J8IA 4AOTA 2I0YA 2J51A 3MDYA 3Q5IA 4BKJA 4FZDB 3QUEA 3PPZA 4NM7A 5D1JA 3WYYA 4IACA 3BYSA 4L68A 4EOOA 2XM8A 4WBBB 2GS2A 1G3NA 3R9DA 3WE4A 2GNHA 2BTSA 3OXZA 3NWWA 5ICPA 3UYSA 3OCTA 4GEOA 5K5XA 3OTUA 3ZRKA 4TW9A 3BLHA 3KREA 5HE0A 2WQMA 4P7EA 2WU6A 4AZTA 4A7CA 3ELJA 4FIJA 4WRGA 5CVHA 4CT2A 5L6OA 4RC2A 1MQ4A 2E9VA 3RZFA 2R3QA 3OVVA 4FT9A 4ZSLA 4BCOA 4IDTA 4QMPA 3UC3A 4F7SA 3L9MA 3MIAA 1V0BA 4NWMA 5E1EA 5I9UA 3P4KA 5C27A 4A9RA 2HWPA 5EOBA 5HTIA 4BY9E 4QP1A 3ZBXA 3O50A 3VS7A 3DY7A 3AMYA 3R7OA 3QKLA 5HLPA 4XYFA 5EHYA 3EQBA 5EW8A 2BRNA 4MXXA 2GMXA 2HWOA 5J9ZA 4Y5QA 1OIYA 5EHOA 5F4NA 4WG4A 2VAGA 3AG9A 4ZY6A 2EXCX 2Q0NA 3VS5A 1AD5A 1Y6AA 3ERKA 4U41A 3LM5A 1CKIA 3KRRA 3FQHA 5M44A 3H30A 3QGWA 3OUKA 4S32A 1KV1A 4BWPA 3F6XA 3PXRA 2J90A 3TUDA 4NKAA 3EQIA 4IW0A 4G3GA 2B53A 3KULB 3GOKA 4ENYA 1IEPA 4GFGA 1WZYA 4F9WA 3ET7A 3NYOA 1YXTA 3A61A 1NW1A 3B2TA 3EOCA 2YDJA 3OF0A 4N4SA 3BGPA 3LFSA 4JXFA 5HKMA 5E8YA 2F57A 2VGPA 3TJCA 4A06A 4XOZA 3K3IA 4BC6A 1H1PA 3UVPA 2XK4A 3PZHA 2I6LA 4B8MA 1ZOGA 4GS6A 3T3VA 3BWFA 3FZOA 1KWPA 3EFKA 2VTQA 1Z5MA 5HX8A 3IGOA 2R3IA 1W84A 3GC8A 2JD5A 3FQEA 2DUVA 4EHGA 3QHWA 1SYKA 3H0ZA 4UZDA 4RX7A 3RWQA 3ANQA 1SVGA 5DRDA 1PXIA 2IO6A 1UU7A 4FTNA 2J5FA 1E1XA 4MVFA 4AFJA 4C33A 3N4TA 3SW7A 3KMUA 3ANRA 4JBOA 3OWJA 2J0KA 3BYMA 2G2FA 4MYGA 3NUAA 5EYKA 4RWJA 4UBAA 1V0PA 2OIDA 2O63A 4DGGA 3H4JA 1PMEA 3HEGA 3IECA 1QPCA 2VTPA 2BUJA 3I60A 3WZUA 3BPRA 5M4FA 2FUMA 2OLCA 4I4FA 4XOYA 3FJQE 2GHLA 3E92A 2XS0A 1XH9A 1LEWA 3BLQA 2ZMDA 4AX8A 3UPZA 2XJ1A 3I1AA 3UOLA 3NYNA 3FZSA 4AWIA 1ZYDA 3NW5A 5DA3A 5DEWA 2XIKA 4ZTQA 2H96A 3NYXA 4MD8E 5AUVA 4TWNA 2ETMA 4U97A 3C4EA 3PJ3A 2OKRA 4TWCA 4FV1A 1RW8A 2XRWA 5KMNA 4EH3A 2XB7A 4YUQA 1H24A 4FV3A 3QA8A 4IQ6A 3A62A 3KXGA 1SVHA 1Z9XA 2FH9A 2JIVA 4FSTA 4UMQA 4XNEA 4RJ8A 3RP9A 3ZRMA 5CVFA 4O0SA 4UY9A 4BCIA 2JGZA 3D94A 4BDHA 1VYZA 5CWZA 4UN0C 4X2JA 4AT4A 4ZY5A 4CZTA 2C6EA 4KKHA 4BDIA 1TQPA 4FBXA 3OCBA 3ZC6A 4HW7A 5AX9A 3R7IA 5E9EA 3PVUA 5EYDA 2B9IA 2JDRA 4HPTE 5T68A 4FV0A 2ZB0A 4LGDA 3PWYA 3FQSA 1UKIA 1MP8A 3PFQA 5H8BA 3I5NA 2C3IB 3E8DA 3OEZA 3QTRA 5F94A 3SC1A 1ZZ2A 2F2UA 3TZ9A 3DTWA 4FKVA 4CEGA 4DG3E 5E8SA 2BVAA 5E90A 2VO6A 3FZTA 5TE0A 3MFTA 2RGPA 4RA5A 4BVUA 3MPMA 1Q97A 4YJTA 3QTXA 4RA4A 4W9XA 4CLIA 4EYJA 1YI4A 1IG1A 3QU0A 2X6EA 4QMLA 4BCMA 3TNPC 4ZTLA 2B4SB 4G3EA 4MTAA 3OXTA 2BDFA 3OHTA 4J8NA 4G5PA 3RINA 5HD7A 4CMUA 4G16A 4MXYA 3CXWA 4ZZOA 4EH9A 5GJGA 4BZNA 3WIGA 3OTVA 3PJCA 2QR7A 2GQGA 4FKJA 4CTBA 4F4PA 2BKKA 3T9IA 2Y7JA 4JQ8A 3RI1A 3ATTA 2PMIA 4A9TA 3LQ5A 2FO0A 2SRCA 4HGLA 5IU2A 3PXYA 4LMNA 3I0QA 3W33A 5AV4A 5DI1A 3MVLA 3RAWA 3W2QA 4O1PA 3MTFA 4DINA 3DQWA 1G8AA 4QNAA 5CY3A 2R3NA 3HDMA 3FMKA 3RAHA 4FKTA 5KE0A 2PVHA 2B9FA 4R5YA 4ZS4A 4DFXE 5JRQA 3D83A 4JAIA 4OTWA 3SRVB 3ZO4A 2ZJWA 4JI9A 1TVOA 4J52A 4PRJA 4EEVA 3PPJA 4H3QA 1RQQA 3E93A 1SM2A 2HYYA 3AC5A 3LFFA 5M06A 3QD3A 1CKJA 2WQNA 2GNGA 4FZFB 5KZIA 2OH0E 1Q8TA 2HW6A 4KBAA 4M68A 5AUWA 4IB0A 5GJDA 3P0MA 4BCJA 1XKKA 2VX1A 4O0UA 5M4IA 4U3YA 4BI2A 3CP9A 3EQPA 3HP5A 4NK9A 1JKKA 3H0YA 5L2QA 3GXLA 5ITAA 2HAKA 3OW3A 3PP1A 4FEXA 4XMOA 4R7HA 3QYZA 3IDBA 3KRWA 4S31A 3RBWA 2ITOA 2WXVA 5AIKA 5FXQA 3HX4A 5CT7A 5EK7A 2RFEA 2OBJA 2QLQA 3I4BA 5GJFA 1W83A 3B8RA 1XBCA 2G01A 3L8PA 3A7FA 4LRKA 3UPXA 3O23A 3HVCA 4O7RA 4RIOA 2OICA 4TNBA 4XG9A 2J9MA 4H36A 4MKCA 4AZEA 2W7XA 5JQ8A 3MY5A 3MJ1A 4GL9A 4M14A 4RFYA 5IDNA 2AYPA 3KA0A 2GNIA 5KHXA 3NUYA 4ZTSA 3P23A 3VAPA 2PZYA 4F09A 5IPJA 2R3KA 4FNYA 2IZSA 4CQGA 1YXVA 2ERKA 3KCFA 2XM9A 1V0OA 2C68A 2BHHA 3VWAA 4Z16A 2R0IA 4IWOA 2WAJA 4RVLA 3FLQA 4WT6A 3UOHA 4ZLOA 5KNJA 3G6HA 4O84A 4YZDA 4P5QA 2QOKA 3CJGA 3ORPA 5CENA 5IUGA 1BMKA 2FB8A 2UW6A 4CQEA 3PVWA 5CAPA 5BUEA 4I5CA 3S3IA 2VWBA 3BBTB 4G6LA 1VYWA 2IZRA 2RFDA 5DT3A 4DGLC 4F9BA 4QMSA 4I3ZA 5C9CA 2XK3A 2JIIA 3IK3A 3SXRA 4F65A 2ZM3A 4PWNA 1ZZLA 2E9UA 3AQVA 1QCFA 3BE2A 4BZDA 4U80A 3ODZX 4BDBA 1Y8GA 3S2PA 4YPSA 3GVUA 4MQ1A 1UU9A 4R3CA 4KA3A 2BIKB 2X8DA 2UZVA 3O7LB 3PE2A 3D7TA 4FK3A 4W4WA 5HU3A 3QTWA 2C6TA 4RG0A 4OTHA 4I6BA 5FEDA 3QD2B 4LV8A 2VWYA 3HMIA 5AR7A 2WTIA 5KCVA 5JGBA 2WMXA 2AC5A 3PXZA 4D28A 5D10A 1R39A 5K4JA 3FXZA 3GNIB 2B7AA 2VN9A 2QOFA 4V01A 3EB0A 3RPVA 1PXKA 3PXKA 4MX9A 4D1ZA 3RCJA 3TTIA 3GFEA 5HU9A 5IH6A 5J7BA 4WA9A 3EQFA 4HGEA 3RM7A 2JDSA 3DAKA 4XUFA 4BBMA 3NNUA 4AW5A 3KRLA 4O2PA 4ASXA 4AW0A 4TPTA 2C47A 3R8MA 5DR2A 3OMVA 5C1QB 2PMOX 2C6LA 3GU6A 3II5A 4P2KA 4C2VA 5A4EA 5JMSA 5EI2A 4KIOA 3HMNA 2VTOA 3O51A 2WTVA 4P4CA 1OKYA 3FMMA 4W4XA 3HRFA 3BRBA 3R9OA 3WF8A 5IQCA 4O6LA 5C8NA 4FTKA 2IW9A 4OTPA 4TN6A 3CGOA 1OM1A 4ZK5A 5E92A 5EM6A 3VULA 1OITA 3BHUA 4EK5A 4BR3A 2HW7A 2EXMA 2H9VA 4AACA 2KULA 2WD1A 2WTKC 3UBDA 1Q61A 3KVWA 2OO8X 4O7ZA 3COMA 3KMWA 4KIPA 4ASEA 2QODA 4BCHA 4HCTA 4BL1A 4NCTA 4OLIA 3PLSA 4J95A 4JIKA 4YR8A 5CALA 2HK5A 4C0TA 2ITWA 5K3YA 2HENA 4NFMA 5BYZA 2Y6OA 4BICA 3KK8A 3O8TA 4MXCA 2FVDA 5CANA 2PZRA 2WTCA 4LOOA 1WBSA 2I0EA 1O6KA 3C0HA 3R02A 4AN9A 5KMKA 3EYGA 2GHMA 4C58A 4AFEA 5C4KA 1FMKA 4C4IA 4PPAA 2Y9QA 4BCFA 4FG9A 2YWVA 3KRJA 4I6HA 4GT4A 3KU2A 4OTRA 4ZTMA 4FE2A 4F6WA 3VQHA 4KD1A 3ENMA 3D5VA 4FTTA 2IWIA 5BYYA 3I6WA 3QCYA 5GZ8A 4WKQA 2C69A 2GCDA 3FKNA 2CGVA 4FSRA 3IOPA 4XG4A 5F20A 5KZ0A 4BCPA 1P2AA 4CCBA 3HNGA 1GZ8A 4BDCA 5L8JA 4YTCA 5J7HA 5AP2A 3HV5A 4BIEA 4DH8A 4OT6A 2NRYA 4X2GA 4Y73A 4BIDA 5IMEA 3UOJA 1JAMA 4IAKA 4RWIA 3DOGA 5F95A 2XRUA 2XJ0A 1Q62A 4QMVA 3G15A 2UZBA 1Z57A 4OBOA 4IC7A 5I9VA 1OBDA 3HKOA 4WNMA 4IX4A 3BEAA 4I6FA 1NVRA 4PP7A 3F2RA 3ZSIA 2BILB 3EQHA 1PYEA 2BAKA 1WVYA 4E3CA 3ZLWA 5FEQA 3CE3A 4KIQA 5GZAA 4HVHA 1URWA 3SAYA 2ZDTA 4GKHA 1AQ1A 4BDDA 1W0XC 3B2WA 3QD4A 4QT1A 5AP3A 3TXOA 4D4RA 5LOHA 5AMNA 5ANIA 2E2BA 4E8AA 1YI6A 2VX0A 3LW0A 2XIRA 3BLRA 4C4EA 3F88A 5FP5A 1H1SA 4D2WA 4LOPA 2C5YA 5HE1A 4BBFA 1APME 3LKMA 3FBVA 4CMTA 3L1SA 1PKDA 5M4CA 2W06A 2PVKA 3O96A 2VTJA 5DG5A 2ZOQA 4FODA 4HZSA 4DBXA 2YLFA 3JS2A 1WVWA 3E64A 4EH5A 3MFSA 3JVSA 5E8VA 3GGFA 4CRSA 5DNRA 2HIWA 3HA8A 3I0OA 4U43A 5IH4A 3AMBA 1OVEA 4UZHA 5BVWA 1F5QA 3BYOA 3BBWA 4KIKB 2W4KA 3V8WA 4BTJA 3L8VA 3QC4A 2YDIA 2UW7A 4FZAB 3R8ZA 5DFPA 4LL5A 4FEUA 1JNKA 4QQ5A 1H4LA 5ANEA 4HNIA 3VUDA 2PYWA 2YDKA 1YDSE 3UO4A 4PL3A 1PY5A 2B1PA 4HZRA 4FT5A 3NGAA 2ETRA 3C9WA 2PVNA 3TL8A 2WOTA 5I9WA 4M15A 2XNNA 2PVJA 3E3PA 4ZZMA 5DLSA 2YIRA 3QTZA 2I0HA 2J0IA 4GVAA 4M69B 5IQHA 3S00A 4CFWA 5B7VA 5BVNA 2PUUA 5CAOA 5K5NA 3F61A 3LFNA 4USEA 3K54A 3OWPA 4IHPA 3RALA 3R83A 2A27A 3H9OA 3KF7A 3PXQA 5JSMA 4PDPA 4R7IA 3GC7A 4UXLA 4EK6A 2ITTA 1OGUA 3E8NA 1WVXA 3F7WA 3FKOA 4ACHA 4EWHA 3ZFXA 5HE3A 2W17A 4F9YA 2GU8A 5KO1A 2Q0BA 4OGRA 3KY2A 1GIJA 3FC2A 5ANGA 3VUKA 2OZOA 4O0YA 2QOQA 3WI6A 5A4QA 2YM5A 3KL8A 5CSHA 2RIOA 3KQ7A 4PPCA 5K9IA 4GT3A 3SQQA 2QHMA 3W2OA 3NNXA 4J71A 2XJ2A 1VEBA 4WNKA 4IWPA 4AW1A 4C7TA 2W1EA 4GG7A 3AGLA 4GUEA 4YU2A 1DM2A 1VR2A 3BQRA 3JYAA 4RPVA 5E8ZA 3ZYAA 4Z3VA 5E8UA 4JDIA 1RE8A 3FV8A 4I94A 2C6MA 3E8CA 4CFNA 4FEQA 3ITZA 2OXYA 3BKBA 4M7IA 3A8WA 5FM2A 3D2IA 3ZO2A 3R1YA 2YABA 5J1WA 5LMAA 1H08A 2J50A 3QQKA 3W55A 2G2HA 1P14A 1R78A 1UWJA 3TNHA 3VJNA 2YM8A 4JT3A 3V6SA 2YFXA 4XRJA 1JKLA 4IVAA 3NIZA 1BLXA 3U87A 2BZJA 3Q04A 4ZOGA 3RM6A 2WMQA 4X2KA 3MV5A 3IS5A 5H3QA 3E5AA 4O38A 5AM7A 3HUBA 3MPTA 1KUTA 4K1BA 4FTLA 5GINE 5IA5A 1Q8UA 4A4XA 3D15A 3FL5A 3JY0A 4RVTA 4YJPA 5CXZA 3GQIA 3DKCA 4QYGA 4QTEA 2PVYA 4MD7E 2R3JA 2XIYA 3LFCA 2UVYA 2Y4IB 3WYXA 3TDWA 2EVAA 1L3RE 3CQUA 2J5EA 3KRXA 4QPSA 3WF9A 2HZ4A 3PJ8A 5AX3A 3UC4A 4AA4A 3UIBA 4HYHA 3NW6A 4QTCA 5FXRA 3HMMA 5HO7A 5IQBA 5JGDA 4PMSA 1PF8A 4H39A 1GZOA 4ALWA 1DAWA 4O27B 2ONLC 2IZUA 2V7AA 4JDJA 1O9UA 3NS9A 3RJCA 2J7TA 4BI1A 1EH4A 3ZM9A 4YBJA 4GV1A 4GJ3A 3CEKA 4FUYA 4DEDA 2Y8OA 3FLZA 4OBQA 5IF1A 2QOBA 4EHVA 4FVPA 4BDKA 4EH7A 3W18A 3SA0A 5A4LA 5C01A 3TZ7A 3GCSA 3EFWA 3GCPA 4M0YA 3WF5A 4KNBA 4ZSAA 5B2MA 2FGIA 2HZIA 3DA6A 3G33A 4I92A 4O7SA 4KBKA 3SD0A 3RCDA 4K77A 3KEXA 4DF3A 5DIAA 3CKXA 5JT2A 5IA3A 3EJ1A 4Y83A 3BQCA 2YN8A 3CC6A 1OUKA 4U79A 2WZJA 3KKVA 2OFVA 4X6QC 2GNFA 2GNJA 3M1SA 4KUJA 2BDWA 5FLFA 1OB3A 2R3GA 4YZCA 4EYMA 4JL9A 1PW2A 2WMSA 5T3QA 5CEMA 4YLKA 1SMHA 4DG2E 4BWXA 5A4CA 3IW8A 4I23A 3BGZA 1UKHA 2ZM4A 5LWNA 2VO7A 3CTQA 1ZXEA 3ORLA 4YP8A 3MYGA 4C2WA 1JKSA 3WOWA 3VUHA 5CEQA 3V04A 3TTJA 5GIOE 3BWJA 3Q6WA 3PY3A 4YHJA 5IEXA 4LRMA 2PL0A 1OPKA 4IZAA 1ZWSA 3O0GA 4ZLZA 5LCJA 2FYSA 3F2NA 4I6QA 4ORKA 4GJ2A 4ASDA 3C51A 4Z9LA 2XK7A 4RIYA 4G9RA 3ZZWA 4FKQA 3LFEA 3ZLXA 3BYVA 1H00A 1OUYA 2BIYA 3PA3A 4FL3A 4IX5A 4AGWA 4EH6A 4BGGA 3GU4A 3ZEWA 3ZDUA 2ZB1A 2ZV7A 4WUAA 2VV9A 1XR1A 2X7OA 5EG3A 2BKZA 4E6CA 5D7VA 4LI5A 3GFWA 4JX7A 2V62A 1PRYA 4BCNA 5L2WA 1U5QA 4H3BA 2ZV8A 5A46A 4X6RA 4QPAA 1E9HA 2JAMA 3NPCA 5EDRA 3IKAA 4JX3A 3QLGA 4QMUA 4B7TA 5HG5A 4D2SA 4IBMA 4NKSA 2UZWE 4FTQA 3LXLA 3DLZA 3QUPA 2Z7QA 3TNWA 3W2RA 5DYJA 4DC2A 1YW2A 1BYGA 3CD8A 3PSBA 4DFUA 4KB8A 4X3FB 3KVXA 3FL4A 4DLJA 3HMPA 2XKCA 4ITIA 4S2ZA 4ZSGA 4ERWA 2BMCA 5JFWA 2C6OA 4ANMA 4C3FA 4Y72A 4DTKA 4MF0A 2OJJA 4OTQA 5CU4A 5CU0A 4AOJA 5IISA 3D7TB 5HCYA 4U42A 2QO2A 4BDFA 2CNUA 5G6VA 5IQEA 3PLAE 5HNGA 4DHFA 3UYTA 2JC6A 3DK3A 3QAME 2W1FA 4C37A 5DR9A 4CFUA 1OPLA 1P5EA 2VD5A 4XBRA 3R28A 3GEQA 4JLCA 4IWQA 1GIIA 5BVDA 2WMWA 2BHEA 4X3FC 4I22A 5C03A 2VWZA 5DWRA 5HO6A 5L2TA 5HVJA 2PUPA 4ZTRA 2QURA 3BELA 2ZM1A 5H8GA 5EDQA 4S30A 3CGFA 3FI3A 3ZU7A 4FNZA 3R8VA 3W1FA 4C4JA 4RFZA 3CCNA 2WQEA 2XMYA 4TYHA 3QRJA 5AP0A 4L6QA 3POZA 3EZRA 2JBOA 3DB8A 4CRLA 3F5GA 2WQOA 2P55A 2GFSA 1BX6A 2GS6A 4IC8A 3PVGA 1OIQA 4I5HA 2UZNA 1PXOA 2YIWA 4U40A 4HNFA 4ANQA 3AC8A 4K8AA 4BKYA 4DH5A 2E9PA
chains in the Genus database with same CATH superfamily
5I9XA 3G6GA 3PYYA 1M7QA 3F2AA 5FWKK 4OTFA 3TZMA 3HAVA 4XV1A 3AT2A 4PMPA 5I9YA 3LIJA 3UNJA 4C62A 3QHRA 4ONAA 3L9LA 3FAAA 3P7BA 2GDOA 3QQHA 1B39A 2UW0A 5AIRA 5ACBC 4CTCA 2OF2A 4E6AA 1XH8A 4YGAA 3Q32A 5EQYA 1JLUE 2OH4A 1B6CB 1OL5A 3LFBA 5G1XA 4BDAA 2JKQA 2WTWA 4WSQA 4DBNA 4DEBA 1DI8A 4MBIA 3LFAA 4JS8A 4WNOA 5CVGA 4QTAA 3PY1A 3VS6A 3WE8A 4GT5A 4YNEA 2F7EE 4S34A 2NPQA 4BWKA 3EH9A 1YXSA 4G3FA 4L9IA 3R8LA 3EN5A 5JRSA 4ZY4A 4CYJA 5CF6A 2HZNA 4UX9A 3MB7A 4C36A 3K5VA 4RVKA 3RPYA 2O3PA 5LXMA 3OWKA 3F3WA 4FKGA 5HLNA 2OU7A 2HXQA 4IADA 1K2PA 5CASA 2G1TA 3N9XA 4F9AA 4PL5A 5LVPA 2XIZA 1F0QA 5CF5A 5CZHA 3FMLA 3KN5A 2QU6A 2OXXA 3Q9WA 3QKMA 4NTSA 5EHLA 1H07A 4IH8A 3GQLA 4N6YA 4EOSA 3FMJA 3IW4A 5BVKA 4OAUC 2CCHA 4QP8A 4MNEA 4X3JA 2BAQA 3UODA 3A7HA 1F3MC 4USDA 2GNLA 2DS1A 2F2CB 4FV7A 1O6YA 4DH7A 3HDNA 3VS1A 4HGTA 5DT0A 1W7HA 4DITA 4PDSA 5TOZA 3V8TA 4F1TA 4KSQA 4BCGA 4L45A 4YTFA 3R7VA 3NUUA 4L42A 5AP7A 3UMXA 4CKIA 2XVDA 4I4EA 4WSYA 2HXLA 3OY3A 4KSPA 4ARKA 3EL7A 4ZSJA 2Y0AA 4NZWB 2PVFA 3E7OA 1H01A 4F08A 3QX4A 5M4UA 3KC3A 2PWLA 5CQUA 2WGJA 1YWNA 3BHYA 5DMZA 2OK1A 3DBQA 1NA7A 4AE9A 3TUBA 2A0CX 5DT4A 3LMHA 3GENA 3HA6A 5HVKA 2CSNA 5CXHA 5EM5A 2YWPA 2QC6A 3C50A 3FHIA 3FPMA 4FGBA 5EDPA 5FBOA 4DTAA 3CS9A 1U59A 4U6RA 2YM4A 3EQRA 4ZXTA 4HVDA 3CSVA 2ETKA 4PNKA 2JKKA 1JOWB 3ZLYA 1KE7A 4ENXA 5KHWA 3LPBA 4MQ2A 4FGRA 3ALOA 4TNDA 5KMOA 3TKUA 4B4LA 4HJOA 3FLNC 3MI9A 2ITUA 3NYVA 4L8MA 4MWIA 3WBLA 4YMJA 2WIPA 3DBFA 3NZ0A 4O0VA 3DXQA 4HYSA 2OW3A 3EN4A 3MH3A 4ITJA 4R8QA 1CTPE 5KBQA 3FXWA 4GU9A 3QFVA 4L53A 3A60A 2R5TA 3BU5A 4RGJA 4JG8A 4YJOA 5L3AA 4D2VA 5L2SA 4ANBA 3QALE 2C5XA 4H1MA 3VHKA 1H1QA 4KRDA 4EQCA 5IA0A 2C6KA 4FICA 2C1AA 2W1ZA 4G3DA 1XJDA 5M07A 4O83A 4TTHB 2BRHA 3AGMA 4E4MA 5EM8A 1K9AA 4DT8A 5IUHA 1YKRA 5AAGA 1YI3A 4PY1A 4RFMA 4GU6A 3UG1A 4AW2A 1Q5KA 4C59A 4C02A 1LP4A 3Q2MA 4FIGA 4G2FA 4IEBA 4QQCA 4UMTA 4CKRA 5I5ZA 1CM8A 2XYNA 3TMOA 4B99A 4U3ZA 5LCKA 2R64A 5TO8A 3BV2A 4J96A 2VTHA 3IG7A 3ZSGA 4DG0E 1R3CA 2O65A 3CIKA 2VTRA 3Q60A 3D14A 4UALA 4RJ3A 3RK5A 3H3CA 3C4CA 3ETAA 3LQ8A 4MCVA 4V0GB 3DNDA 4X2FA 5LVLA 2YJSA 3OS3A 1V1KA 4LQMA 3UP2A 1JPAA 1YHSA 3FZPA 2IJMA 1JWHA 3LJ2A 4O7YA 3COIA 1ZYLA 3MWUA 3BEGA 3KFAA 1A9UA 1YDTE 3C4ZA 4IM0A 2RKUA 4BKZA 5IG1A 3F3UA 3UDTA 4UV0A 3IGGA 4HYUA 4XP3A 4EORA 2R3FA 1OGYA 2ITNA 2PZIA 4M3QA 3HUCA 3GU7A 3U4UA 1M2PA 2OF4A 4FKLA 2GPHA 1HOWA 4NU1A 1GOLA 1ZMWA 4FV8A 2PE1A 4N6ZA 5I3RA 4L7FA 5LMKA 2W9ZB 2VTIA 2C5NA 4XHKB 1PYXA 4O4CA 1O6LA 2JFMA 3ZOSA 3BGQA 3HECA 4J53A 3MH0A 4EHZA 5FRIA 3HMOA 1IA9A 3R9HA 2OIBA 5HBJA 2B9JA 1U54A 2EB2A 3KB7A 3W0NA 4RJ6A 4FYOA 5AR3A 5HBEA 3DK6A 3ORTA 3FYJX 3VJOA 3NIEA 4EOMA 3TV7A 2F4JA 4J8MA 4YHFA 3WARA 4EBVA 4O21A 4IAYA 2X4ZA 4PV0A 4FKUA 4I5PA 5E8WA 2WMBA 5CAUA 4BRXA 1YOMA 2WOUA 2GQSA 2Z60A 1OIRA 3GI3A 1J3HA 3AXWA 3SVVA 4DHJA 4Y8DA 2PY3A 4DEGA 5CU2A 2XYUA 3DZOA 4RX8A 4RWLA 1H26A 5KUPA 3R2YA 4N0SA 1OKVA 3PA4A 3NUSA 4XX9A 3HL7A 1PXMA 4FIFA 2REIA 1H28A 3W8LA 5K0XA 3MESA 5ANJA 2CMWA 3HGKA 1ZOHA 5IMXA 3U8WA 2C6DA 4IVDA 5T6KA 3W8QA 4K18A 2VX3A 4CXAA 3VBTA 4AZVA 5JK3A 4W4YA 4CGAA 3DZQA 4LMUA 4G6OA 2BRMA 2B9HA 3DLSA 2JKOA 3LMGA 2YITA 4XG8A 2DYLA 4M67A 4D2TA 4E6QA 1NY3A 4CG8A 5LVOA 4NM5A 3OFMA 4F7NA 2ZYBA 3VS3A 4A07A 3IDCA 4A9UA 3ODYX 1H0VA 3OT8A 4MK0A 1OKWA 2R3LA 3ZO3A 4HVGA 1NT2A 5HX6A 2WMTA 1VZOA 1U4DA 4ZJJA 5HESA 5GIPE 4L44A 5JH6A 2I7QA 3V3VA 3PUFC 1GZKA 1IA8A 2YERA 4ANSA 1VLRA 4KAOA 4BHZA 4UWBA 4IIRA 4OUCA 4EH2A 4IFCA 5E7RA 3VRYA 2X39A 2VWIA 3K2LA 5FGKA 2I0VA 5DBXA 1YQJA 4IXPA 5HI2A 4EC8A 3C1XA 4QO9A 4CZUA 3EHAA 4AAYA 2BZKB 1WBNA 2BZIB 4WBOA 4J7BA 4TYIA 2XARA 3H10A 3DDPA 5J95A 3SOCA 5AR5A 1Q8WA 5H2UA 3VS4A 5KMIA 4E20A 5EKNA 2OJ9A 2R2PA 4TWOA 3ZFMA 3ZHPC 4HYIA 2X6DA 5GNKA 1GIHA 3FI8A 1G8SA 5CAQA 4C38A 3G9NA 4E6DA 2X9FA 5CI7A 2BPMA 3SGCA 3A7JA 1ZYCA 2W99B 2WELA 3QXOA 5D12A 5CF4A 1GY3A 5E4HA 2C4GA 3CLYA 4YBKA 2OGVA 3U9NA 4ZIMA 4PUZA 3ULZA 1YOJA 4HGSA 4W8DA 4O0WA 4EUTA 2J6MA 3VBWA 1MRUA 2F9GA 2JDTA 4PQNA 4AXCA 3IQ7A 2AUHA 5AWMA 5D9HA 5H9BA 4YO4A 3QTSA 1BKXA 3HP2A 1OBGA 4L3JA 4OTIA 3NMUF 2VTMA 4QP9A 4XP0A 4XRLA 4MXAA 3P5KA 4IMYA 3COKA 5DHJA 3VF8A 4ZJVA 2CKPA 3EYHA 4AS0A 2OFUA 3OC1A 3KN6A 2YAKA 2UVXA 1KSWA 4K0YA 4G34A 4LL0A 3VUTA 4ANNA 3DFCB 3R30A 2X4FA 4D0WA 3QRKA 4EONA 3Q9YA 3C13A 2CNVA 2VTLA 3H9RA 3MW1A 3FMEA 3DFAA 4MBLA 4QTBA 3KIOC 4D5KA 4DDGA 2ITYA 2QO7A 3E3BX 4D4YA 2A2AA 5FDXA 4EWQA 1STCE 3R04A 1G5SA 4O0RA 3U55A 3NVMB 1YDRE 3QRUA 4G5JA 4JQEA 4H58A 2X2LA 5FD2A 3V51A 3HV7A 3OY1A 4QYYA 4IDVA 4M13A 4MF1A 2YEXA 3I5ZA 3W0PA 4LYNA 1Q3WA 3VQUA 3F9NA 2V5QA 3VO3A 4RIWA 3P5JC 3V5JA 2QG5A 2IVUA 2UZDA 4FG8A 4FV5A 4GFOA 4UYAA 3UE4A 5M53A 1MQBA 3Q4ZA 3FY2A 3PPKA 3QQGA 5B2KA 1B38A 1CDKA 2VO0A 2CKEA 1JBPE 2PMNX 2OWBA 5HOAA 1XBBA 4G6NA 1UV5A 3MBLA 4RT7A 4ACMA 4XV9A 5HD4A 4IE9A 3UZRA 2CGXA 2PZ5A 5C26A 1KOBA 3ZBFA 3KXNA 2XK6A 3DXNA 4F70A 4ZMFA 2W96B 3EMGA 3UVQA 3LFQA 3THBA 2KTYA 2J0MB 4E5WA 4AP7A 4CV9A 1YHWA 2CLQA 3CD3A 3Q52A 3SW4A 4AF3A 3VUGA 4EOLA 4M12A 3QL8A 1KE9A 2WMAA 4EH4A 4X21A 4ZJIA 4F0GA 5CAVA 4ZTHA 3MTLA 3E7VA 4AUAA 4R3PA 3ULIA 5EM7A 3C7QA 3W0SA 2X7GA 4L01A 2XUUA 5DGZA 1Q4LA 2VWUA 2XNOA 4PL4A 2XEYA 4LG4A 4TYHB 3I79A 4X2NA 3NAXA 2NP8A 4AAAA 2YIXA 3E87A 5FTQA 4CT1A 3R00A 2VZ6A 2GFCA 5JQ5A 2WPAA 4W4VA 5D11A 3HLLA 3LM0A 3ZO1A 4YNOA 3ORKA 3TACA 4ASZA 2G15A 2CHLA 2RF9A 4HCVA 2QD9A 1WBPA 3ML1A 3NRMA 5FP6A 1ND4A 3TIYA 4EOKA 5HIDA 1Y57A 3OW4A 3BZ3A 4FZ7A 5L8LA 4FSMA 3U9CA 4DTBA 4FV4A 2I40A 4I41A 1LEZA 1DAYA 2X0GA 5J9YA 5LARA 4EOPA 4NW5A 4DGOA 4EC9A 3A7IA 2AC3A 2P2HA 5J87A 5FTOA 5BVOA 4Z55A 3F82A 2IZTA 4JDHA 4K9YA 2QNJA 3ROYA 2QKWB 1ATPE 2UZUE 4CYIA 2OIQA 4EOQA 4JIAA 3AKJA 2OZAA 1KE5A 3AD5A 3SRVA 3JXWA 2OJGA 4RWKA 3KXZA 4XG3A 1ZLTA 1ZOEA 4ZAUA 3DXPA 3TI1A 3UGCA 1XO2B 2ZV2A 4GSBA 4M97A 5EH0A 5A6OA 1XMMA 4FNWA 5BPYA 2WQBA 3TJDA 3Q4UA 4FT0A 4XCUA 4BDEA 3PP0A 4USFA 1YVJA 2NNWB 2IVSA 1YXXA 4FTCA 3FZRA 3HRBA 3JY9A 2QHNA 3CY3A 5DE2A 2YM3A 3IW6A 1Q41A 5FG8A 3DB6A 4CFFA 1LUFA 3OXIA 2CLXA 5ETCA 4NEUA 3Q5ZA 2JIUA 3M11A 2R4BA 2QI8A 4AZWA 3FYKX 4D0XA 4LFIA 4ALUA 3FSFA 3CPCA 4NFNA 5HTCA 3FXXA 3R7GA 2Z02A 4O4EA 1FINA 5EI6A 5K0KA 4ZLYA 5IEYA 3F5XA 1ZYJA 4EH8A 4WRSA 3TEIA 2BZHB 3NSZA 5BYLA 4JQ7A 4G17A 1REKA 4FKRA 2VTSA 3N4VA 4WO5A 3LXPA 4E7WA 3DJ5A 3Q6UA 1YWRA 2HZ0A 3PWDA 2ZMCA 5FBNC 2VNYA 5BMSA 2CGUA 4CMOA 5BUJA 3P08A 5D7AA 3R1QA 2O64A 3LLAA 2F49A 4TYJA 3DS6A 2CGWA 3MJ2A 4ZS0A 2JDVA 2QOCA 2XNBA 1PMVA 3HRCA 3QZHA 1HCLA 2Z7RA 4RC4A 5BUIA 4I6LA 4RJ7A 4IB3A 1VJYA 3CQEA 4GVJA 4HPUE 4LOQA 4YURA 2CN5A 2IW6A 1RDQE 3NUPA 4NIFA 2H34A 3B8QA 4P5ZA 1I44A 4FZ6A 1G8KA 5M55A 5EYMA 1PXNA 2PHKA 4MWHA 1XH5A 2B55A 3MFRA 3PIXA 3OOMA 4U8ZA 1T45A 3IO7A 4QPMA 1PJKA 3NEWA 4JDKA 4QMZA 4AZSA 2BALA 4H3PA 4YJRA 3SXFA 4DN5A 1FGKA 3C4XA 3RMFA 3NCGA 5AP4A 2W5HA 2Y4IC 3FWQA 3OBGA 4RJ5A 4W8EA 4FEVA 4EK8A 5DOSA 3K5UA 5KMJA 2VTNA 3SOAA 3OUNB 1Y91A 4R6VA 2JEDA 3VC4A 4ZP5A 3E63A 5HCZA 3R7UA 3OCSA 4FA2A 5IDPA 3CTJA 4FG7A 4J99A 3GT8A 3DNEA 4TWPA 4ACGA 5IQIA 5HGIA 4H1JA 3ZXTA 2CJMA 2CKOA 2YJRA 4FSUA 5M51A 4PF4A 3VBXA 2GS7A 4V04A 5L4QA 2Q83A 3ACJA 1FVTA 4UXQA 2IG7A 4LUDA 4FI1A 4KS8A 4IZ7A 4LRJA 1W2DA 4A9SA 5E91A 5KKRB 5AA8A 3R7EA 1XBAA 1QMZA 4GW8A 3VBQA 3RNIA 3MN3A 3Q4CA 4YLLA 3PSDA 4OT5A 3L9NA 4FUXA 3V5QA 4FTRA 4U0IA 3ZMMA 4UWCA 5GZ9A 5IUIA 3R9NA 4F99A 4R1YA 4Y5HA 5FEEA 4AG8A 3RNYA 5J5TA 5KX8A 3I7BA 3AMAA 4A9YA 3D5UA 4CCUA 3LHJA 4YC8A 3ENHA 3NX8A 3JVRA 2YM6A 3DV3A 4HVSA 4CFVA 5EQEA 4GK2A 2ZFYA 3MA6A 4XG7A 3T9TA 3ZEPA 4IB5A 3TNIA 4A4LA 4G1WA 3UP7A 3OWLA 5CSPA 1FGIA 3DAEA 3P7AA 2XKEA 3QRTA 4FL1A 2XALA 3PY0A 4H05A 2WMUA 3AC3A 4DT9A 4DGNA 3R8PA 1IRKA 2O2UA 2X0OA 4C61A 3A7GA 1PMUA 2JDOA 2RG6A 3BYUA 4BDJA 4QYFA 4Q9SA 4AXAA 1H8FA 4DH1A 4JR7A 1L8TA 4WD5A 3BI6A 3C0IA 3TM0A 3IW7A 3G90X 3KGAA 4QMYA 1J7UA 2CKQA 4FKPA 4YHTA 3VUIA 5EW3A 2UW8A 2C3LA 3D0EA 5GHVA 1J91A 3CY2A 5AP5A 2PTKA 5H8EA 3TUCA 4ZMEA 4RIXA 4K2RA 2PMLX 4FYNA 3AC2A 1UA2A 4YO6A 4E1ZA 4GYIA 2JITA 5DEYA 4IAIA 5B2LA 3NCZA 2GQRA 2NYAA 4M66A 2P3GX 4Q5HA 4QOXA 2UZLA 3IW5A 5FTGA 4FSZA 4M84A 3WF6A 5ANKA 4B9DA 4D9UA 3PIYA 4ITHA 2ZDUA 3ORMA 4KRCA 5EW9A 4DFNA 4I5MA 2ITXA 5EKOA 4FSQA 1A48A 3RHKA 3W2PA 4EK3A 4FVQA 3DPKA 4L43A 5AAEA 1P4FA 2YA9A 3WZEA 3KK9A 4FTJA 4O81A 1LPUA 4EKLA 2O8YA 1TQIA 3K3JA 4K6ZA 3LAUA 5TF9A 4ZTNA 3CJFA 4EK4A 4JBPA 4O91A 2QOIA 1Q8YA 2C3KA 1JQHA 2BRGA 4WHZA 3BHVA 3U51A 3EZVA 4IB1A 3BX5A 3VRZA 1A06A 5EOLA 5CNNA 3W0OA 3ZDIA 3DCVA 4FKOA 4J98A 2XNGA 3U6IA 1SVEA 2P0CA 5ETAA 4DCEA 3HAMA 4F9CA 3REPA 4FKWA 4YJQA 4EZ3A 3DKFA 3G0EA 1DS5A 3O17A 3UJGA 2UW5A 1ZY4A 4IAZA 5CYIA 4FC0A 4DGMA 4JJRA 1GJOA 1TFFA 5CU6A 3UQGA 4EJNA 4B0GA 2XZSA 3FLYA 5ETIA 5HZNA 4NYEA 1XHAA 4B6LA 3D5WA 2H6DA 4Z7HA 2WNTA 2VWVA 3QCQA 4QP6A 4BBEA 5J9LA 3VHEA 3D5XA 3R22A 1PXJA 2C30A 4I0RA 5CSWA 2J2IB 3DAJA 5HE2A 4FVRA 4IJPA 4Z7GA 4E5AX 5I3OA 3W0RA 3RAIA 3RTPA 1ST4A 4F6UA 3O8UA 3W2SA 3FHRA 2ZV9A 4QMXA 4MBJA 3LMIA 2P2IA 2DQ7X 3V01A 2WB8A 2VWXA 2YIQA 4IZYA 2A19B 4AGDA 3NNVA 4MXZA 4BGQA 4F6SA 3F69A 3NVKI 4EI4A 5JGAA 3E88A 4C4FA 4JRNA 4XBUA 3SXSA 4QMQA 2W4OA 4FR4A 4GFMA 2H8HA 3ZC5A 3ZONA 4WG3A 5HLWA 3AT3A 4RRVA 2FA2A 2WFYA 3QF9A 4E4XA 3Q9XA 3L9PA 4C34A 2OJIA 4KIKA 4NJ3A 4GCJA 3EN9A 1UWHA 3UNZA 3PJ1A 2X8EA 5HORA 1IAHA 4V05A 2GTMA 2C0IA 3I6UA 3U6HA 4YPDA 4NT4A 2XNPA 4BYIA 4M0ZA 4FL2A 4YZNA 2UW4A 2WTJA 1OL6A 3MY1A 2IW8A 4D9TA 1ZMVA 3V6RA 1QPDA 2YM7A 5HG9A 4E4LA 4Y95A 2VTAA 3BHTA 4D55A 2IN6A 1M7NA 4M69A 2JBPA 3NW7A 2RFSA 2UZOA 2PE0A 3EIDA 4RLKA 4BGHA 4XS2A 4AE6A 4FF8A 3VN9A 1OZ1A 3Q96A 4D58A 4QMMA 5D41A 1W98A 4E26A 3P9JA 1FPUA 1TZDA 3NUNA 4NCTC 1JKTA 4IAAA 4ALVA 4FV9A 4DH3A 4UYNA 2X1NA 3LJ0A 4G9CA 3W16A 3GCVA 1M17A 3EN7A 4FIHA 1M14A 1UVRA 5E8TA 5JKGA 1UU8A 3QTUA 4UEUA 5I4NA 1MUOA 3VVHA 1OL7A 3WZJA 4TYGA 4BJJB 5HIBA 4NH1A 4PTEA 2Z8CA 2WHBA 4XLVA 4U7ZA 2IPXA 3MH2A 3ZTXA 2VUWA 3U6JA 4JG6A 2W5AA 4LUEA 4DFYA 2PU8A 4LGHA 1AGWA 5HHWA 3MA3A 4FSYA 3ZRLA 3PJ2A 3MFUA 4O2ZA 3UQCA 4D1XA 5IA2A 2PVMA 2HELA 5EFQA 4FIIA 1XH7A 4WNPA 4RIWB 3EFLA 3KF4A 5M09A 4C4HA 2UW9A 2XP2A 1J1BA 5KMLA 2EU9A 2VTTA 5DRBA 4GRBA 4U81A 4QP3A 1W8CA 1YOLA 1IASA 4JAJA 4DDIA 2PVLA 1XMLA 2ONLA 2QOHA 4ID7A 5IKWA 1E1VA 2YCSA 2OG8A 4NW6A 4CZYB 4QDVA 1JVPP 4GK4A 2AQXA 4CD0A 5HNIX 2J0JA 2ZAZA 2ZVAA 5J1VA 5CX9A 2RL5A 4GK3A 4ANLA 5IQDA 2I1MA 3FLSA 3PA5A 5IZFA 2R9SA 1OMWA 3P7CA 4RVMA 5AV3A 1OI9A 4XH6A 4YZ9A 4JBQA 3UVRA 3WIKA 1ZY5A 3BIZA 4X7QA 2PULA 1REJA 4XEYA 3PXFA 1BUHA 2BCJA 3POOA 5IH5A 3RWPA 2OXDA 4GIHA 5KMMA 3U54A 4O4DA 5AUXA 2VNWA 5DPVA 5C4LA 4P90A 3GBZA 3DKOA 3A4PA 4PNIA 3PUPA 3LQ3A 2XIXA 5AV1A 4O86A 2XF0A 4TL0A 1R1WA 2UVZA 2XKFA 3QTQA 5AUZA 5CEPA 4AN2A 3QQLA 3ORNA 4XV3A 4D2RA 5LJJA 1G8JA 3ALNA 4HOKA 2PZPA 3GU5A 3R63A 4AGCA 4EQMA 1YHVA 2C5OA 4TY1A 5EQPA 5AJQA 2UZEA 4NTTA 3S4QA 5HTBA 3S0OA 5FQDC 1PHKA 3Q2JA 2RG5A 3HYHA 1WCCA 4OTGA 3UMWA 5I0BA 5HBHA 3CPBA 3TIZA 4BTKA 5FDPA 5LWMA 3QC9A 4NSTA 1R0PA 4APPA 4MHAA 2OZAB 4O7LA 2WTDA 4QP7A 3I81A 5AEPA 4IWDA 3P1AA 5AAFA 4XG6A 3QCSA 5AR2A 3OCGA 1SNUA 3OBJA 4IM2A 3GC9A 3LZBA 3FKLA 3V5LA 1Q8ZA 3AC4A 4QMNA 1U5RA 5L2IA 1H27A 2X2KA 3SX9A 2WEIA 2W1GA 3RPSA 3TG1A 3QBNA 3QRIA 3BV3A 5HG7A 3E8EA 5ACKA 2BAJA 3RZBA 4CV8A 2FSOX 3C5IA 4RLLA 4YJNA 5JEBA 4DCAA 4EOJA 3TV4A 4EZ7A 2YZAA 3MY0A 5B0XA 4Q9ZA 4JVGA 4A4OA 4I93A 3NLBA 3RAKA 4CFMA 5AM6A 1M2QA 1BL6A 4LGGA 1WBVA 4QMTA 3AD4A 3BCEA 3LXNA 2YLEA 4RQKA 4DEHA 4EL9A 2EWAA 3C5UA 3JUHA 3ZS5A 3U4WA 4MH7A 2A4LA 3MSSA 4ZSEA 5BX0A 5LMBA 1PXPA 1CMKE 3ZZEA 4CSVA 2PVRA 2W1HA 4IVBA 2WIHA 4B8LA 4QQTA 3ZFYA 1NVQA 3FMNA 3T3UA 4QMWA 2V55A 2GHGA 3JPVA 2NRUA 4CKJA 4O6EA 1ZARA 3UZPA 3LXKA 4AZFA 2C0OA 3D9VA 5HICA 4GYGA 5AR4A 1SZMA 3PSCA 4AQKA 1JSVA 2IVTA 4WIHA 2QOLA 3BL9A 2WMVA 4I0SA 4BHNA 1S9IA 2XCKA 5C8MA 4ZZNA 2OSCA 1XQZA 3VF9A 3FMHA 4E73A 1XH4A 3WZDA 3NUXA 2XCHA 2UZTA 4C4GA 5C8KA 2P4IA 4NIFB 1H0WA 3PRFA 3ORXA 2G9XA 3MGYA 3FC1X 4JR3A 4KINA 1P4OA 2EXEA 4YLJA 3UIMA 4ACCA 2XNMA 3TKIA 4BIBA 2VO3A 2BRBA 2YCFA 4F7JA 3FLWA 5E1SA 3W10A 1YXUA 2W1IA 3F3VA 3LCKA 3EKKA 5HIEA 5JFVA 4YC3A 4M8TA 3UOKA 2RSVA 3WF7A 5JZNA 3ROCA 4X3FA 3PE1A 4G31A 1TQMA 3PTGA 3S1HA 1IR3A 3QGYA 4GUBA 3V8SA 3QWJA 4I0TA 3ORZA 4RC3A 4FSNA 3FI4A 4L46A 2QKRA 3FZ1A 3EQGA 5CTPA 3R9RA 2C3JA 4RX9A 4C8BA 4PPBA 3EL8A 3O8PA 1ZMUA 4QYEA 2B52A 4K11A 4D2PA 2ITVA 1NXKA 4GG5A 4JMQA 3FI2A 3E62A 4EZ5A 4QNYA 3FSKA 2UV2A 3R71A 4TRLA 1DI9A 3QZFA 4TKSA 4YSJA 2ACXA 3G5DA 4BCQA 3F7ZA 2R0UA 3R1NA 1BI8A 4AN3A 3JR1A 4QYHA 4FNXA 2WTKB 3QQUA 3O7LD 5IA4A 2W1DA 4UMPA 2J4ZA 3GP0A 4BCKA 5AR8A 3KULA 3ZM4A 2Z7SA 4ZEGA 1WBWA 5BMMA 5EI8A 3N51A 5DN3A 2XBJA 5JZJA 3EN6A 2QO9A 4O7VA 3LCDA 3KCKA 3SV0A 2ERZE 3R1SA 1TKIA 3AC1A 4U44A 1ZYSA 3NDMA 5HG8A 2CPKE 4YJSA 2R7IA 4GMYA 4BI0A 3EWHA 3VIDA 4DLIA 2W0JA 3HV4A 3NAYA 4BYJA 1KE6A 2XK8A 3HV3A 4PTGA 5M57A 3BHHA 3ZCLA 3EQCA 3TZ8A 2X81A 4Q2AA 4O7NA 1OECA 4CNHA 4CLJA 3Q4TA 4IVCA 2XH5A 2QR8A 4DYMA 1Q99A 4Q5EA 1M52A 4XJ0A 2PSQA 3PDTA 3QWKA 1UU3A 2ESMA 2JFLA 5AP1A 1ERKA 4DFLA 2X7FA 4RIYB 3MS9A 4NJDA 2XNEA 5DR6A 3F3TA 3FPQA 5JN2A 2R3MA 1LR4A 1GAGA 5M08A 3O2MA 4FSWA 3MVMA 3H9FA 1QPEA 2PK9A 5F1ZA 4WG5A 3R2BA 5ANOA 4RX5A 3UQFA 5DVRA 4YTIA 2NO3A 4AOIA 4BZOA 5EYCA 5LQFA 4KKGA 2VGOA 2YACA 2V0DA 3ACKA 3F66A 4K33A 5A6NA 3PZEA 1QL6A 4C3PA 5BNJA 3QCXA 3QX2A 4G3CA 3QZGA 4F0FA 2X2MA 4RIXB 2R3OA 2BFYA 3GB2A 4J97A 2YCQA 5ETFA 1R0EA 2FSTX 2VRXA 4LM5A 4AQCA 4F64A 5AADA 1UNLA 4YTHA 3DDQA 2YHVA 3Q9ZA 3WILA 2XK9A 2WEVA 4RZWA 4PX6A 2F7ZE 3DK7A 3PG1A 3UZTA 5M56A 3RVGA 3KXHA 1WFCA 4RJ4A 4TYEA 5AUTA 5IQGA 1PXLA 4OTDA 4CFXA 2ITPA 1H1WA 4R78A 2ITQA 4MD9E 3UTOA 3KXMA 4FT7A 3GOPA 4O0XA 1FOTA 3C4FA 3DBEA 3LFDA 4IFGA 5F9EA 4RSSA 3G2FA 3GU8A 3OROA 4R5SA 3LOKA 1GZNA 3SKCA 1FBNA 4XLIA 1X8BA 4PDYA 2C6IA 2QVSE 2R3PA 3TKHA 5CU3A 1GNGA 4APCA 3SG9A 4UB7A