3CKWA

Crystal structure of sterile 20-like kinase 3 (mst3, stk24)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
279
structure length
255
Chain Sequence
b'PEELFTKLEKIGEVFKGIDNRTQKVVAIKIIDLEEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase 24
publication title Crystal structure of sterile 20-like kinase 3 (MST3, STK24).
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 255
sequence length 279
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ckwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ckwA01
4EWHA 2WQNA 3P7CA 4X2FA 3CPCA 3EQRA 3FXZA 4FT0A 4DHFA 2G9XA 4UMUA 4C3PA 5CSHA 3SLSA 4S32A 5HG5A 3ZOSA 5CTPA 3OXTA 2X7GA 4E26A 4S2ZA 5A46A 5HO8A 4D2WA 5AA9A 1SYKA 2RFDA 5E8WA 4BIDA 3AT2A 4B9DA 3GOPA 3Q6WA 4UMTA 4QTAA 4XV2A 4TYHA 2OF4A 3QD3A 4D4VA 3HV7A 3ETAA 2FB8A 1MRVA 4DEDA 4A07A 4DG3E 5IEVA 2B0QA 5HG7A 5M53A 3Q4UA 3D5UA 3R2BA 4ZTQA 3NIZA 1PMNA 1S9JA 2J0KA 2FUMA 5E8UA 2XK4A 4BZNA 3JY9A 3G6HA 1PXJA 1JWHA 3NUUA 3KCKA 2XZSA 1FVVA 5AP5A 4WT6A 4E4XA 4BICA 2XP2A 5DT3A 3TTIA 2XEZA 2QI8A 2R9SA 1R3CA 3M2WA 3R63A 5G1XA 5J7HA 3G33A 4KAOA 1XH9A 2GQRA 3DBFA 4O6EA 3HP2A 2REIA 4FICA 3U9CA 4QP9A 4CZUA 1XQZA 2B54A 3NLBA 4I23A 4I5CA 3DGKA 1OKVA 2ZJWA 2VN9A 4FTOA 1Q8YA 4ASEA 5LWMA 2UZDA 5K4JA 5EOLA 3F5GA 4IVCA 4MYGA 4AZVA 3O23A 3LMGA 3NAYA 5JT2A 3C4CA 5D7AA 3QC4A 3EN7A 3EN5A 3QCQA 4F7SA 4EQUA 3BYSA 5CF8A 2OFUA 3IGOA 4EOSA 2CN8A 2R2PA 5CSWA 3NNWA 2XH5A 2IZUA 4I5PA 2B9JA 3QU0A 1Y8GA 1XJDA 2XYNA 2P2IA 2X0GA 2NPQA 4FOCA 4MD7E 4E20A 2RL5A 4LGHA 3NUXA 4HGLA 4FG8A 4L7SA 4P4CA 4O0WA 5HD4A 1IG1A 3PYYA 4C7TA 3EMGA 4DGNA 3UODA 3VF8A 2C30A 3COMA 4TNDA 2X1NA 3R00A 3DK7A 5AP0A 5I5ZA 3C51A 4LYNA 4OT6A 3UYSA 3MVHA 3FMJA 5E8TA 4HPUE 5DR6A 3NZ0A 4MBLA 5EHOA 3ATTA 4M3QA 5K3YA 2G15A 3ZRKA 4ITIA 2I0HA 1BLXA 4PV0A 3VS5A 4BN1A 4E4NA 1MUOA 2C4GA 3ENHA 3PY3A 2C5XA 4WNPA 3MVLA 4LUEA 1MRYA 4EOMA 3FZOA 2ERZE 3K5UA 3ODYX 3ZFYA 3Q6UA 5BVEA 4LRMA 5FEDA 4BBEA 2EWAA 4BCNA 5L8LA 3TUDA 2QLQA 4KABA 5AUVA 1HCLA 3ZRLA 3TACA 1W82A 4BDKA 4IAKA 2CDZA 2JKOA 1IEPA 4S31A 4C2WA 3BEGA 1YXVA 3FI8A 3QX2A 4JS8A 4K11A 2OJJA 5H8BA 4OAVB 3EH9A 4D58A 4HGEA 4QMYA 4QMSA 3PWDA 3TUCA 3DFCB 4Z16A 5EDPA 3BELA 2PVKA 2WQBA 4L01A 1OZ1A 1Y6AA 1W84A 1OMWA 4U79A 4L3PA 3F6XA 2WQOA 1OBGA 4DEAA 2JIIA 5AR8A 1L3RE 5HE0A 4O0XA 4RIYB 4BGGA 3O51A 4G6NA 2PZIA 2GS6A 1GAGA 5H2UA 3R9DA 4UY9A 3VS3A 3EWHA 3H3CA 5J79A 3VHKA 2WB8A 3NW6A 2DWBA 4IDTA 3QFVA 1T45A 3EL8A 4MNEB 2XYUA 4B8LA 3ZSIA 5JFXA 5GIOE 1QPEA 1VEBA 3L1SA 4ZLOA 3R71A 4IB5A 4KS7A 3OS3A 4J97A 4E4MA 4EEVA 5CT0A 4UWYA 5HVJA 4C4IA 3OZ6A 4WNOA 2PMOX 3TZMA 3WE4A 4AGWA 4D9UA 5DT0A 3LIJA 1KE8A 4YNEA 3FQSA 2B9IA 4D0XA 4ZJJA 3ORPA 4O7RA 4DLJA 4AP7A 2OW3A 5C4KA 3QCSA 1G5SA 3E93A 2QNJA 4LGGA 3SKCA 3ZS5A 5E8YA 5A4EA 5I9YA 2XJ1A 5FRIA 4RJ3A 2CLQA 3FMNA 4I4FA 3TKUA 4F9CA 4JAIA 5LVPA 2HZ4A 3P7AA 3KA0A 1DAYA 2ERKA 4HGSA 5A6NA 3QTXA 4RX8A 4IAAA 3IS5A 1Q5KA 2CHLA 1W0XC 2JDRA 3HZTA 4KIKB 2Q83A 4DCEA 5BVOA 4BCIA 1YWNA 3H9RA 2OH4A 4MK0A 3RGFA 3KRJA 3UQCA 4JG6A 1SMHA 2F9GA 3KULA 3MI9A 3OWLA 4O7NA 4RLLA 3LVPA 3U6HA 3LZBA 5HZNA 2GHLA 4FKGA 4O0RA 4F6WA 1JBPE 1URCA 2I40A 4KKGA 2YAAA 3Q9YA 3QRIA 4W9WA 4FSMA 3UIUA 4D4RA 3ZM9A 4RWIA 2GFSA 2W1HA 3ZFMA 2FGIA 3HMOA 2NP8A 3C5IA 4L00A 3BZ3A 4A9YA 3A62A 1BKXA 1KV1A 4BFMA 1NY3A 4YUQA 4GKHA 3EHAA 4GEOA 4NTTA 3H9FA 3TN8A 2WMWA 3F5XA 4DEEA 4EH8A 3ENMA 2UVZA 1OIUA 1V0BA 2W5HA 4YHTA 4X3FC 3V6SA 2WFYA 5DGZA 4A4OA 3PP1A 4S34A 1KWPA 3HRBA 3PXRA 1FMKA 3DZOA 5HIDA 4U43A 2ZDUA 3NSZA 4GCJA 5TT7A 3PXQA 2FSOX 4H3BA 4UYAA 2Z7LA 4HOKA 2R3IA 3VNTA 3VUGA 2B55A 1Q8WA 3OHTA 4X3FA 2W06A 3ZLYA 1H08A 5C8NA 3N4TA 1SVGA 2F2UA 2XNPA 3IDPA 3Q04A 1PMVA 3R04A 3R1QA 3D94A 5DBXA 5KKRB 4BKYA 3PE2A 2RGPA 3LXNA 3FPQA 3BYVA 4ZAUA 4EWQA 4BB4A 5J1VA 3K54A 3ZFXA 3W2PA 3I0QA 4RFYA 5BYYA 2W1DA 3CQUA 3SVVA 3TV7A 3Q4TA 4OBOA 3EQHA 2PMIA 4IVAA 5KBRA 1LR4A 4M14A 5ANEA 3GCSA 3MBLA 3BHUA 5LMAA 1GZNA 5I3OA 4PMSA 1RJBA 2BZHB 5AA8A 3AT4A 2WGJA 1KE5A 3OEZA 3AMYA 4K33A 4LRJA 3W2CA 1UVRA 1R1WA 4FV4A 2WTKC 1O6LA 4AW5A 3LLTA 4CZYB 3RHKA 4IH8A 3FJQE 1XBAA 3FLYA 4I94A 4QMVA 3QWKA 2BZIB 2YIWA 2O0UA 2R3JA 3GU5A 5T68A 3U8WA 4QP2A 3NWWA 4PDSA 5DFPA 4H1JA 3GOKA 1W8CA 2QHNA 2DS1A 3OG7A 3OXZA 3PA3A 4PUZA 4YHJA 5HO6A 2Y6MA 5A14A 4HCVA 3R7OA 4FTRA 3F5UA 4EOLA 3AOXA 4CFFA 3FZRA 1VYZA 3KXMA 4OTPA 4RC2A 4QQJA 4C62A 1J7UA 2ZV9A 1MQBA 2YABA 4K8AA 2P3GX 4BC6A 1W83A 4BCMA 3LXLA 4MBIA 3VN9A 4YTHA 5IG1A 4OTDA 4BTKA 4DTAA 3RK5A 5JMSA 3IW6A 3QALE 4I5HA 1MP8A 1CKJA 3DTCA 4MXYA 4ENXA 3MIAA 1PMEA 2XF0A 3BLQA 2CJMA 4NCTA 4LV5A 4O2ZA 5E8ZA 2NO3A 3JYAA 4FT7A 5FM3A 2W17A 4RC3A 3HYHA 3TIYA 4EBWA 1G8AA 2JFMA 4CT1A 3KRLA 2GNFA 3O8PA 3H30A 2Z02A 4KB8A 3NGAA 1UU9A 4G5PA 4B0GA 4FK6A 4QYFA 4EC9A 3NMUF 3V51A 2WHBA 4UN0C 5AMNA 5AM7A 3EYGA 3P08A 4KSPA 1ZMWA 1UU7A 2VWBA 4H3PA 5L2QA 4ZZOA 3HRCA 4E5AX 1JSVA 3GCUA 3WZEA 2F2CB 3GB2A 2QG5A 2X8EA 3UZRA 3U6JA 4OTFA 1J91A 3ODZX 4FNZA 2GFCA 3HV6A 4ASXA 5JSMA 3NVKI 3IW8A 2BHEA 4D55A 1OBDA 1U46A 3VF9A 2PUPA 4YC3A 4C4FA 1FOTA 2O64A 1BL7A 4F0GA 2DUVA 3G2FA 3MFRA 4RPVA 5BVDA 3UNKA 4XH6A 1BX6A 3RZFA 4H05A 4R6VA 2ITXA 3ZO3A 4APCA 4CV8A 5CF6A 2WIHA 5KMKA 3UZTA 3UG1A 2ETMA 3E62A 2HZ0A 4ALVA 1W7HA 2HIWA 3TIZA 4DT8A 3PE1A 5E7RA 4AW0A 2VRXA 4TTHB 3MH2A 1IR3A 2GNLA 1YHVA 4NKAA 3VJNA 3R21A 2BCJA 4ITHA 2C3JA 3D7ZA 4TWPA 3MFUA 5CAPA 1Y8YA 2HXLA 5IDPA 4OLIA 2YDJA 3C0IA 4MXZA 5B2LA 5CSVA 2VGPA 3MJ1A 5ANJA 3V5JA 3SG8A 3UVRA 1FVRA 4AGUA 2PVNA 4YNOA 4AS0A 4F7NA 2C0TA 3ZUTA 4JLCA 3QUDA 5BX0A 5IMXA 3F88A 3I81A 4FL1A 4ANSA 3REPA 3PLAE 5EDRA 3PXFA 5HX6A 4HYSA 2X2LA 2PVLA 3EQDA 3FLQA 5A4LA 5EQEA 4L8MA 3PSCA 5EM6A 5LCKA 4YTCA 4FF8A 4HCTA 4C61A 4RQKA 4F99A 5M07A 4CLIA 2E9VA 3GC7A 4X2GA 4I20A 4CTCA 2WMAA 1DS5A 3DNEA 5EI8A 4DEBA 1WFCA 4A4XA 3QYWA 2JBOA 4NM5A 3FKNA 3WZKA 1U4DA 1ZWSA 3CP9A 5A4QA 2BALA 4C57A 3UDBA 3BLHA 4WSYA 4C35A 4CYJA 1ZYCA 2VWVA 2ZVAA 1CTPE 3L8XA 3R1NA 4IJPA 3OY3A 4LI5A 4NWMA 4YO6A 5IA3A 3HA6A 4Q9ZA 4AX8A 2VWZA 5JQ5A 5K4IA 4JX3A 3TDWA 1M14A 4BYIA 4ERKA 4GJ2A 1E1VA 2C0IA 3GP0A 4QMZA 4U80A 2C6TA 2ZM1A 3FDNA 4UB7A 3PA4A 4WSQA 4HVSA 4OTHA 4J1RA 4O21A 4X0MA 4RIWA 4NJDA 3ZXTA 1PW2A 3O7LB 2PSQA 1ZOHA 4NW5A 3MB7A 3VUMA 1PYEA 1TQIA 5GINE 2E9OA 2ITQA 3R0TA 3CPBA 4XG8A 3SW7A 4RA5A 5DIAA 4PNIA 5CSXA 2OH0E 3PRFA 3FMDA 4ANNA 3CTHA 3P0MA 3QTIA 5F94A 1JQHA 3GEQA 3LFBA 2WOUA 2LAVA 2F49A 3CIKA 3NW7A 4O96A 4WA9A 3IW7A 3VBWA 4DTBA 2VTHA 4C36A 5EK7A 1CM8A 4FKLA 2C6LA 2B7AA 2V22A 3EQBA 4BDBA 2W4KA 2O65A 2OJFE 3LCTA 3ORTA 3U4UA 5GJDA 5BNJA 5L8KA 2ACXA 1PF8A 4BBFA 4G3FA 2HW7A 1XWSA 3CGFA 4O0VA 5LMKC 2CNVA 3TNQB 2PMLX 4FL2A 4RWKA 4YJVA 1YXSA 3S1HA 2WMUA 2YWVA 3TT0A 5I4NA 2OF2A 3ZHPC 5I3RA 3FYKX 2HK5A 2B53A 3KULB 4IM2A 2VU3A 3DDQA 3WARA 4AFJA 5HGIA 2WMQA 5LMKA 3V5LA 3PPJA 3QTUA 4F08A 4L42A 4ANMA 5FBNC 1ZRZA 4EHGA 5AV4A 4LFIA 5L2WA 2PVMA 2WU6A 2ZV2A 3OOMA 3I5NA 4FNYA 5CT7A 3MVMA 5FDPA 3KXHA 2C5VA 2R3NA 5JQ8A 1XHAA 4KRCA 4EQCA 3DXQA 3HVCA 2R7BA 3U54A 1A9UA 3HLLA 5J5SA 3U4WA 2R4BA 3CCNA 4ANQA 1MQ4A 3A8WA 3ZUUA 3TTJA 1LEZA 3BE9A 5C1QB 3JPVA 3ALNA 4J7BA 2VTSA 3TNPC 3R28A 4LUDA 3UNZA 1O6KA 4CFWA 4ASDA 5DH3A 2W0JA 4FC0A 4NM7A 4BCHA 2JKKA 4ERWA 5HNIX 4BWXA 5FXQA 1K2PA 4MNEA 4WD5A 4CCUA 5E91A 4O7YA 2A4LA 3BV2A 4IEBA 3R7GA 2JBPA 2OK1A 3O17A 4D4YA 4QP6A 3AMAA 4DAWA 4XLIA 1OIRA 3BI6A 3D9VA 4CLJA 3R9RA 4X2NA 2R0UA 3CEKA 5C27A 1DAWA 4JT3A 2C1BA 3QCYA 4OW8A 3WE8A 4C0TA 3BQRA 3PZHA 4U44A 3UBDA 3MPTA 3PJ1A 3GXLA 2X8DA 4TT7A 2QD9A 4BDAA 4ZTSA 4NT4A 5IA0A 3FWQA 3OWKA 1DI8A 4NTSA 3R8UA 2ZAZA 3ZMMA 4R3RA 2H6DA 4LQMA 4CV9A 5J5TA 3VS2A 3Q60A 3ANRA 5CEQA 4C37A 4CMOA 3O71A 3VC4A 4QMWA 3HMPA 5DWRA 4KIKA 2I7QA 1H25A 4FG9A 2OIBA 2QQ7A 4XV1A 3OT3A 3UC3A 3FMEA 4K1BA 2IPXA 1P5EA 2W9ZB 3RCJA 2I0YA 4E6DA 5DT4A 2VTLA 2ZM3A 4FEVA 3MVJA 3QX4A 2I0VA 1M2QA 4ZMEA 3I6WA 2ESMA 1Y6BA 5FLFA 3COHA 5HCYA 3VBYA 2DYLA 2WELA 3F2RA 4YJNA 4L7FA 2BHHA 2C6OA 3FLWA 3FMHA 3RAHA 5BUJA 3ZLWA 3UO5A 3VAPA 5ANIA 4O0YA 4FNXA 2OIDA 2OJGA 5HCXA 2WTIA 4QQ5A 4BIBA 3DBEA 3CGOA 3ZSHA 4RBLA 5D7VA 4PY1A 4FTUA 3RM7A 2F4JA 4QMQA 3UOJA 2JAVA 3FZ1A 4AWIA 2PZRA 4FEUA 4BZOA 2WQEA 3NNVA 5JZNA 3PVWA 5DEYA 5FXSA 4D2RA 3L8PA 3ZUVA 4E6CA 5ETAA 4FKRA 2WEIA 4Y83A 3RP9A 1GZOA 3TXOA 4C4JA 3QCXA 3DQWA 2HWPA 2JAMA 2QCSA 3BGZA 5CU4A 2XKFA 4GS6A 5KKRC 2OBJA 2IN6A 3D15A 4E7WA 4WIHA 4U41A 4U97A 4YZDA 2W99B 2CGVA 2YIXA 4HCUA 5CEMA 4EUUA 5IQIA 4MNFA 5G6VA 3HDNA 3OW3A 3ROYA 4RRVA 2JITA 4GVJA 2GDOA 4P2KA 4L6QA 5KMNA 2H96A 3LE6A 4UMQA 1JSTA 4GFOA 2C68A 4G6LA 4HVIA 5AP7A 4ZTMA 3CQEA 2HENA 3KRXA 4C58A 1ZYSA 1SVHA 5AV0A 3LPBA 3I4BA 3AGMA 4OUCA 3QQUA 4JXFA 1M2PA 3S00A 1UA2A 2YLEA 4ACCA 2OLCA 4O86A 4DFNA 2PVHA 4CRSA 2CKPA 4GT5A 4L53A 4PPCA 1ND4A 3QC9A 2G2HA 3ELJA 2GMXA 3ZBXA 4FIJA 1J3HA 2W5BA 1YOJA 4HZSA 2BFYA 3QHRA 4J71A 4O0SA 5CLPA 2YISA 4QPMA 4GFGA 4AT3A 4O1PA 4DE4A 2VV9A 3Q96A 4FTJA 3UJGA 4O81A 2VTQA 4Y46A 2YCQA 4G31A 5GJGA 3ET7A 2Z60A 3G0EA 4YC8A 1UWJA 2FH9A 2XKEA 5J8IA 2HWOA 4DF3A 2J5FA 2PU8A 1ZYLA 2JGZA 5HOAA 3MFTA 3PP0A 3V5WA 5ETCA 2CKQA 1PXKA 4XP3A 1J1CA 2HCKA 3UVQA 5HQ0A 3NUPA 4JRNA 2OJIA 3SDJA 5IEXA 5CU6A 3V5QA 5IZFA 4W4YA 5AR5A 3G9LX 4EH2A 4FZ7A 3OT8A 2HYYA 4O6LA 4FK3A 3S95A 4M66A 3KRRA 5C8MA 3QAME 4MD9E 5DEWA 2QR7A 4GK4A 3GC9A 4DBXA 4W4XA 1STCE 4I6FA 3RBWA 3UTOA 1IAJA 5CXHA 5JFSA 1LPUA 3LM5A 3TKIA 1VYWA 4PP9A 3FMKA 4BCKA 2JDOA 3V01A 3Q5ZA 4GT4A 3A7IA 3QTZA 2UZVA 4AA0A 4CFMA 3MESA 3KN5A 5IEYA 5ACKA 1PJKA 2I6LA 4L3LA 5FP5A 4ARKA 3QWJA 4NKSA 3R73A 3VUTA 4BDGA 4WBBB 4CQGA 3R83A 4XG7A 2B9HA 3AGLA 5HTIA 3LOKA 2ITNA 3PPZA 4MVFA 1NVRA 3JVRA 5AIKA 1FGKA 2QONA 3OD6X 3CJFA 4HW7A 5D9HA 2PZPA 3UIMA 3LJ0A 3EN4A 4FYNA 4NL0A 1WMKA 2EB3A 5AAFA 5LQFA 4TW9A 2O63A 3KFAA 3E88A 4XNEA 1YRPA 1PKGA 3H9OA 3GCQA 3HMNA 4GG7A 4DLIA 4KA3A 2XEYA 4I92A 2C47A 2YITA 4FV2A 2XIZA 2XNGA 3CBLA 3EIDA 5LCJA 4RIWB 1YW2A 4R7IA 4RVTA 4HVGA 4QTDA 4CYIA 2F57A 3DLSA 4CEGA 4DINA 3C4EA 1M52A 5GZ8A 1E9HA 2UZLA 4CG9A 2XNMA 4FKPA 3GC8A 3R9OA 4DH3A 3VO3A 3UG2A 5AJQA 1ZMVA 4ACGA 4FSWA 4E73A 5GZAA 1VJYA 1UU8A 4HGTA 2C5OA 3C7QA 5DLSA 3HP5A 4L9IA 3NUNA 4M84A 5IUIA 3O2MA 4ZY5A 4EH5A 5BMSA 5K9IA 5FGKA 4HVDA 5CVHA 4IZAA 4DGGA 3PSBA 5GNKA 3B8QA 4F6UA 5KE0A 4FTIA 4YO4A 3DDPA 1R39A 3TWJA 3C0GA 4MXXA 3KXGA 4IQ6A 4ZMFA 2BTSA 3F66A 3EL7A 4O7VA 1OL6A 4FSNA 1PHKA 2CCIA 4QYYA 4G3DA 4NW6A 4IB1A 1R0EA 1H4LA 3E8DA 3GVUA 4O2PA 4BYJA 5HNGA 4KIOA 5CZIA 3DY7A 5DVRA 3WI6A 3VHEA 1W98A 5TKDA 5HU9A 1YWVA 3RK9A 4DCAA 1VZOA 4IWOA 3BWFA 3QQJA 2R3LA 3Q5IA 5EM7A 2XK3A 1SZMA 2XK7A 2VWXA 4I1ZA 4IFCA 5M09A 3TJDA 3D4QA 3D7TA 3UZPA 5EQYA 3PSDA 1XO2B 4IHPA 3VW8A 1Q99A 1OPKA 1WVXA 3DJ5A 3D14A 4WHZA 4J98A 4YLKA 2KULA 3CS9A 4UMRA 3BHTA 3D83A 3HMMA 5AP2A 1WAKA 3IW4A 2YLFA 1BL6A 5CWZA 3FL4A 3G90X 5CS6A 5D1JA 4A06A 3VULA 3GBZA 5I9XA 2VAGA 5EHYA 4FG7A 2PYWA 4OTIA 4JNWA 3H0YA 2QHMA 5IA4A 4XJ0A 3CY2A 4KSQA 3SOCA 3O7LD 3FSKA 4IFGA 3ZO4A 1H07A 2C6IA 3QTWA 4AZEA 3V8WA 1ZY4A 1QMZA 3QL8A 3BKBA 1OUYA 1YHSA 4UBAA 2JDVA 3MSSA 4PNKA 4UYNA 1CKIA 2XBAA 1ZMUA 4ZSGA 2ZM4A 3PG3A 3CKXA 4NIFA 3W8LA 5LVMA 2VTTA 3C9WA 4R7HA 2X9EA 4ZSJA 5LVLA 4M0YA 4LOOA 2ZB0A 4MF1A 4J52A 4Y95A 3G15A 3FE3A 4FKQA 3P5KA 4R1VA 4BCOA 4F70A 4E93A 3G51A 4U9AA 3FL5A 5HLPA 2PPQA 5FQDC 4JAJA 1H26A 4EKLA 1ERKA 4QT1A 3RTPA 4BKZA 2RF9A 3I5ZA 3ZXZA 5DHJA 4CSVA 5J9YA 2BIYA 3MGYA 4ZIMA 3FQEA 1DM2A 4D28A 2YIRA 2XA4A 3RM6A 5LWNA 2FA2A 3JS2A 5IH6A 3U87A 3DU8A 3ORIA 4RJ7A 3PWYA 3NRMA 3BYOA 2Z8CA 3RHXA 3TDVA 4QP1A 3ZYAA 1EH4A 2XIXA 5JGDA 1QL6A 2EXCX 3DBQA 3RALA 1YDSE 4IZ5A 4X7QA 3T9IA 3P78A 3UIBA 4CXAA 5FTGA 2UW3A 4DGOA 3NYOA 1Q8UA 4FTKA 3R9NA 3NPCA 4PF4A 3E7VA 5EW8A 3FZSA 4QMXA 5EW3A 3W16A 4V05A 5CU2A 5ITAA 1IAHA 4XRJA 4JBPA 4FZFB 3NYNA 4MD8E 4EBVA 3PA5A 4YBJA 5DE2A 2BIKB 1FPUA 1IA8A 4QNAA 2PK9A 2FVDA 5FTQA 5CNOA 5M4CA 2BTRA 3I79A 4KBAA 4D1SA 3ORZA 3LXKA 3W33A 2CPKE 2UZWE 3LJ1A 4HYHA 3HUBA 4F1MA 2XJ2A 2VD5A 2PWLA 1Q8ZA 3KMUA 3KN6A 3ZRMA 4ZK5A 4AZWA 4YLLA 5JFWA 4JX7A 4XV3A 2GNJA 5IQAA 4PDOA 1P4OA 2OJ9A 3DKGA 3DKCA 3NYXA 4CFUA 1SNXA 4BCGA 3LCOA 5M51A 3O8TA 1YXUA 4N57A 2GQGA 5KMIA 2XMYA 4IAYA 5F1ZA 4IC8A 4ZTNA 5KX8A 3M1SA 1PXPA 4XBUA 4BWPA 1WBNA 4QMMA 4YMJA 3IECA 5CF4A 3F61A 5J1WA 5D12A 5M4IA 4B6LA 4TYGA 3G6GA 5T6KA 4TY1A 4NFNA 3JXWA 4IBMA 2R3GA 2XUUA 4GW8A 4QYEA 4FT9A 3FSFA 4WO5A 4XG4A 5HE3A 4AG8A 3TNIA 4FOBA 5H9BA 2QU6A 4CD0A 3NIEA 1ZOEA 4ZSAA 2F7ZE 2RIOA 3H4JA 4IZYA 4R1YA 1PY5A 3R7IA 3BRBA 4WG4A 2XNEA 2FYSA 2J0IA 3KF4A 3P23A 4M8TA 5IA2A 4O82A 1NA7A 4YJPA 3R7EA 4AT5A 4U8ZA 5EYKA 3R1YA 3CJGA 4RMZA 3OROA 3UP2A 1VR2A 3TJCA 2WMTA 4GKIA 3ITZA 4DH8A 3OC1A 3UO4A 2XCHA 1UKHA 3BE2A 2J6MA 4BR3A 5DR2A 5EDQA 5AUYA 2QOOA 3L9PA 4ASZA 3UO6A 2X4ZA 4B4LA 2PUNA 1YDRE 3WIKA 4K9YA 4AW1A 4CKRA 1WBSA 4NSTA 3BU3A 4D9TA 2XNOA 3SV0A 3LMHA 3EJ1A 1AGWA 3BEAA 3MYGA 3LFCA 4QD6A 4V0GA 4FL3A 2JDTA 3KU2A 1A48A 1ATPE 1G3NA 5CQWA 4GYIA 3RNYA 2Y9QA 2Y4PA 5DOSA 3I7BA 3POOA 3HV3A 4EOKA 5HX8A 2FO0A 2YDIA 3OBGA 3ZC5A 4II5A 4NCTC 2W4OA 4UMPA 3R8LA 3PLSA 4EORA 4O7WA 4M97A 1OL5A 1A06A 2XJ0A 2W5AA 3I1AA 3KC3A 3R30A 3O0GA 4YZBA 4H36A 4W4WA 2XIYA 3OCSA 3ULIA 5L2IA 5IQEA 4EONA 4YZCA 5AADA 1YHWA 4RWLA 1OECA 5EI6A 2YHVA 3B2WA 5A4TA 3EKNA 4F65A 5I9WA 2QOHA 4RSSA 3HX4A 3ZU7A 5C4LA 3FAAA 4UALA 2WMXA 4RFZA 3SA0A 3TNHA 1PKDA 3GU6A 4IX4A 4FGBA 2HAKA 4EZ7A 4BDFA 3NUAA 4PTCA 4USFA 4QP3A 4JDJA 4PX6A 3DTWA 2GSFA 4QO9A 3IDBA 5IU2A 3QD4A 4FUYA 3GNIB 4MKCA 2PVFA 4DTKA 1IA9A 2FSLX 5EYCA 4CG8A 3IOPA 4TXCA 4JOAA 3PY1A 5HI2A 5K5XA 5CF5A 3RNIA 4DG2E 3OTUA 3BHYA 4JDHA 1M2RA 2WNTA 5CVGA 4ORKA 4GMYA 4FKSA 4TYIA 2J51A 5KUPA 3ORLA 4G34A 2JD5A 4LOPA 3FPMA 5HVYA 4IW0A 3WYXA 3KB7A 3G0FA 3NAXA 3Q4CA 1GOLA 4MWHA 1GZKA 4MTAA 5JFVA 4C33A 4LRKA 3ZDIA 4XG2A 4YP8A 4YGAA 3RI1A 5BVFA 2CNQA 3VBVA 4ACDA 2YDKA 1U5QA 3F3ZA 3GT8A 4MXCA 4FVQA 4AGDA 2BFXA 3PIYA 4QRCA 3QRKA 3MS9A 5BMMA 1UU3A 4BDIA 5KMLA 4R78A 4RFMA 4XS2A 2BZJA 2VO7A 3NCGA 4YC6A 5EYDA 4OAUC 2GNIA 3AC2A 4DFUA 1J1BA 1H1SA 5AV3A 3ZLSA 3LMIA 1Q4LA 3LFNA 2GTNA 2QOIA 3HRFA 4GL9A 1OL2A 4DFXE 2H34A 3KVWA 4PRJA 4JJRA 3VBQA 1KOAA 4ZP5A 3MH3A 5DMZA 4R3CA 4PPBA 1B38A 1AQ1A 4RX9A 4M13A 4X3JA 3FUPA 5BYZA 4BIEA 4YU2A 3F3WA 3FY2A 4JRVA 3SX9A 4U6RA 3Q32A 5EH0A 4I0TA 3R8ZA 1BUHA 2UW7A 3GFWA 4EKKA 4DFBA 1OIYA 2OIQA 3TZ8A 4E5BA 3ZO1A 4F4PA 1PXOA 1Q61A 4QQCA 3VVHA 5IQCA 5HBEA 3TV4A 4LGDA 5AP6A 5ANOA 5AV1A 3DLZA 3D7TB 4O83A 2JC6A 2VO6A 4UEUA 5HICA 3U9NA 5CASA 4R7BA 4IMYA 2CMWA 4CGAA 2E9NA 2I1MA 3A7JA 4XEYA 3C4WA 3M42A 4USDA 3WZDA 5FP6A 5KZIA 5LMBA 2J0JA 4G1WA 4M69A 5GJFA 3BX5A 1UNLA 3MTFA 4GK2A 2X8IA 4I6BA 2VO0A 4L44A 4AN9A 2C1AA 5DYJA 4JR3A 3QLGA 4KNBA 5EG3A 1Y57A 4BRXA 2YCFA 1RDQE 3E3BX 3GI3A 4KWPA 3RZBA 4H58A 4G3CA 4R77A 2QOKA 4KBKA 4OBQA 4Z7HA 3T8OA 5IQHA 2A2AA 4RZWA 5IUGA 2UW9A 4D2VA 4E6AA 4GH2A 4JBQA 1M7QA 3A4PA 4FE2A 3C50A 2ITPA 3F2NA 3OWJA 3TCPA 4FI1A 3DAEA 5FUTA 3DXNA 4NIFB 3F3UA 4ENYA 4R8QA 4ZSEA 4EH7A 3BHVA 2ONLA 3HUCA 4MXOA 4XCUA 2AC3A 2RFSA 4NM0A 1OITA 4A9RA 4CRLA 4AAAA 4E6QA 3OFMA 1GIIA 5EYMA 5HO7A 2VTOA 4JDIA 1H00A 5CEKA 4IDVA 4PP7A 2WTWA 3QGYA 4Z3VA 2HY0A 4QMTA 4WG5A 4A4LA 3TNWA 4OTQA 2IJMA 2ZV8A 3QUPA 2GPHA 5KMMA 2R3FA 3OP5A 4EH4A 1FGIA 2Y8OA 2YAKA 4G3GA 4BY9E 4RC4A 3QZIA 3RJCA 4IIRA 1SNUA 1AD5A 2XCKA 4BZDA 4IWPA 4FVPA 2YA9A 4UWBA 5HVKA 2R3RA 4C4GA 2WTVA 2P0CA 5CSPA 4TPTA 5I9VA 5BPYA 5J7BA 1JPAA 2J7TA 4YJRA 3IO7A 4QMNA 4RLKA 3V5TA 3R01A 2YN8A 3P1AA 4QMPA 4WNKA 4EL9A 3A7HA 5M56A 2R3MA 4FT5A 2NRUA 2A1AB 2PY3A 2X81A 2BROA 5F9EA 3VW6A 1YOLA 3AC5A 2OWBA 3SC1A 5HTCA 3UPXA 5IQBA 4U5JA 4EC8A 4I6QA 2OU7A 4HYIA 4R5YA 4U7ZA 1FQ1B 2IVUA 3QQFA 1UNHA 2Z7SA 3AT3A 2ITTA 4MHAA 4PL5A 3QD2B 3BLRA 4YJSA 4N70A 4X2KA 1IRKA 2XM8A 4XP0A 2EUFB 3W2QA 4FGRA 4APPA 3EQCA 3HAVA 3I7CA 3VBTA 3PVUA 1V0PA 4KIPA 2W1IA 2VZ6A 4W8DA 4ZXTA 1ZLTA 3COIA 3EOCA 5A9UA 2C3KA 2XIRA 2BRHA 2ZV7A 2WMSA 4C02A 5LXMA 1H1PA 4LL5A 5KMJA 3F82A 5KMOA 4HVHA 2BRMA 4ACHA 3QBNA 2W1CA 4GYGA 4MEDA 2ZB1A 3PIXA 2ZMCA 1PXLA 4Y73A 4E1ZA 3MA6A 3NUSA 2PL0A 4TWOA 4CFNA 2H8HA 4IB3A 5LJJA 2BILB 4L68A 5AR4A 4AN3A 5C8KA 1XR1A 2YZLA 4MH7A 3SQQA 3I60A 3S2PA 3OMVA 4MWIA 5JGAA 2QC6A 3OUNB 2E2BA 4FEWA 5C9CA 3RPSA 4I41A 3DZQA 3SXRA 5AWMA 2UW4A 4FIGA 2PMNX 5FDXA 4FZAB 3EKKA 4EK4A 4FTQA 4JG8A 4F0IA 3QQLA 3K2LA 4GFMA 5AP3A 4K2RA 3DJ7A 1GZ8A 3TKHA 2NRYA 5J87A 2CGXA 3KGAA 3GU8A 5LVOA 3FZTA 3R8MA 3F5PA 2AYPA 5AUTA 1O6YA 1ZXEA 5JEBA 3FEGA 2IW6A 2P2HA 2C69A 2XK9A 4FKUA 2X9FA 5EW9A 4IE9A 5CEOA 4E4LA 3E64A 2UZTA 3DT1A 2BRNA 1WZYA 4J53A 4QNYA 3WIGA 4Z9LA 1PYXA 2YJSA 4F9AA 1H01A 2IWIA 3VS6A 2ZYBA 3A61A 3W32A 5IH5A 4CVAA 5JZJA 2GS7A 4CMTA 2GCDA 2X6DA 3E92A 2IVVA 3E8EA 3OW4A 5JN2A 2Z2WA 3SRVB 4V0GB 2C5YA 3HDMA 3EFLA 3OUKA 4ZTLA 1XH7A 2OG8A 5DRBA 5HESA 1ZARA 2YIQA 3GCPA 4O0TA 1S9IA 5AR7A 3QRTA 2QOFA 4PL3A 5CVFA 1FINA 4HPTE 5EFQA 4AZTA 4IVBA 3NS9A 2B1PA 1WVWA 2PE0A 5L6OA 4RIOA 4XG6A 4L46A 4BCJA 3FKOA 4PL4A 5H3QA 3DK6A 4I93A 5E8SA 2VWUA 5IA5A 5M44A 4OR5A 2RFNA 3LFSA 2QVSE 4DGMA 4USEA 5IPJA 3NCZA 1YWRA 3CTJA 1REKA 2EB2A 3Q53A 4XBRA 4A9TA 3CQWA 3PJ3A 3DXPA 1H1WA 4AA4A 3ZLXA 3ZH8A 1BI8A 2G2IA 3K3IA 5L3AA 5L4QA 2VTNA 2GS2A 2H9VA 3AC1A 1Q97A 3CD3A 3GUBA 4JIAA 5HD7A 3VS4A 1SVEA 4WOVA 3T9TA 4EH3A 1M17A 4KD1A 4C4HA 4I3ZA 4S33A 2B4SB 1Q3DA 3N9XA 3D5VA 4DFLA 4BL1A 4PDYA 2R0IA 5AR2A 3VUIA 3GCVA 5H8GA 4OTRA 3AC8A 3Q2MA 2BAKA 3AD6A 3CLYA 4XHKB 1NT2A 1H24A 3FYJX 4RVMA 2OSCA 4CKIA 3K3JA 4QP4A 3FHIA 1CDKA 2YJRA 3I6UA 1CSNA 3I0OA 3D5WA 4M0ZA 3R7VA 3UOLA 5EQPA 2J5EA 3PPKA 3Q9XA 4MF0A 1Z5MA 3TL8A 3VS0A 5KCVA 4CNHA 3FI4A 1H8FA 3AXWA 3PXKA 4U81A 4BDDA 4H39A 1U5RA 3QF9A 2X2MA 2V7AA 4UWCA 4BI1A 4JVGA 2W1GA 2BMCA 4LOQA 4UXQA 4YLJA 4YTIA 4BDEA 2EVAA 1JKLA 4FTTA 3VS1A 4IXPA 2VWIA 4DBNA 2ITOA 4WRGA 4Z7GA 4YZNA 4BBMA 2CNUA 3Q4ZA 4FV6A 4DG0E 3FC2A 3EZVA 2OZAA 5ETFA 4FEXA 4JI9A 5F4NA 2YZAA 2PE2A 2VTJA 3FI3A 3JY0A 4XRLA 5GZ9A 5HNBA 1QCFA 2NNWB 1WBWA 2YM5A 5L6PA 5DI1A 1YDTE 4XLVA 4OTGA 3SAYA 3UIXA 1OKZA 1YOMA 3BGPA 3QHWA 4XG3A 4QTEA 3O8UA 2JKMA 4L67A 3PRIA 4DEHA 4EK8A 2OKRA 4DFZE 5AAGA 3EFKA 2PHKA 4M67A 4XOYA 2VTPA 3ZONA 1QPDA 4LL0A 4NUSA 5K0KA 2QU5A 3AMBA 4ANOA 2X39A 2GNGA 4FTAA 2WQMA 2OFVA 2O3PA 4UXLA 1LEWA 4Q9SA 3VBXA 5CY3A 3UQGA 1YI6A 3KK9A 4MQ1A 4YSJA 2ETKA 2C6KA 4BVUA 4RJ4A 3CXWA 3QKLA 5BQ0A 4GVAA 3PVBA 3FHRA 3V8SA 3KXZA 2UZOA 3DNDA 4GV1A 4G3EA 1OL1A 4AU8A 3PJCA 3VIDA 5M55A 3QTRA 2SRCA 4YHFA 4KKEA 2BDWA 4FTLA 4QMUA 3VJOA 2CGUA 4YJQA 4M69B 4U3YA 2VTAA 4G16A 4ITJA 2WAJA 3PXZA 4W8EA 3B8RA 3IPHA 1K3AA 4G9RA 5ANGA 5HCZA 4AFEA 3TUBA 3E63A 2PE1A 1YQJA 3P86A 4YR8A 2I0EA 4AT4A 4EHZA 3QXOA 1L8TA 1B39A 4FZ6A 3RPRA 2UVYA 4IB0A 4FV9A 5K5NA 3DKFA 1JNKA 1NVQA 2Z7RA 4FEQA 1MRUA 4ZZMA 5AAEA 2ITVA 4KUJA 4OTWA 4O7ZA 2WTJA 4GSBA 5A3XA 3FZPA 3EFJA 4AA5A 2AC5A 3SXFA 4YPDA 4BCFA 2V62A 3KXXA 5HLWA 3HV5A 3LFAA 4IVDA 3VRZA 4BCQA 4DN5A 3SHEA 1SM2A 1RE8A 2JDSA 2IZTA 2ZDTA 4RX7A 2BPMA 4BTJA 2ZMDA 3HGKA 4CTBA 3PFQA 4OT5A 3A4OX 4QOXA 2Q0NA 3MFSA 4RZVA 4JQEA 1F3MC 5A54A 2A27A 4WUNA 3R22A 5J9LA 4F63A 3LCSA 3UPZA 4FSYA 2C5NA 3M11A 4UX9A 2QKRA 4F1TA 4V04A 3MA3A 3NX8A 2QLUA 2ITZA 3PJ2A 5CU0A 4KKHA 1GNGA 3WZUA 3A99A 3OXIA 4M15A 4D1ZA 5IISA 1KV2A 3FXWA 2G1TA 3IKAA 3IDCA 3OEFX 1QPJA 2QOCA 3LQ5A 3QZHA 4FR4A 4X21A 3VQHA 4CQEA 2RFEA 2IZRA 3IG7A 4YURA 3OCTA 1U54B 1URWA 5LVNA 1WBOA 2HZIA 2CLXA 4DH5A 1OKWA 3F9NA 1OKYA 2W96B 4FKVA 4DFYA 1PXNA 3IOKA 4IANA 3N4UA 3QLFA 1XBBA 5HBHA 4DA5A 3OTVA 4C59A 4TWNA 4EK5A 3UC4A 4ZS4A 2PULA 3DB8A 4K77A 3VUHA 5JK3A 5AUZA 3NR9A 1WCCA 3RPYA 2XKCA 4GUEA 3KF7A 3F7ZA 3AC3A 5HE1A 4RGJA 2CKEA 1J7IA 2QOBA 4IX6A 3PIZA 4FIHA 4LMUA 4NU1A 4F7JA 3DKOA 5HEZA 4QYGA 3DB6A 4YTFA 1YXXA 3RWPA 2VTIA 2V7OA 5EI2A 3QD0A 3S3IA 5HHWA 4G5JA 3FMMA 2WKMA 4M68A 3EQPA 4BHZA 2VUWA 3PVGA 5CAUA 5M06A 3MIYA 2YEXA 2XNBA 3ACJA 4H3QA 1PMUA 3QQGA 5F20A 2V0DA 3ATSA 4RIXA 1JSUA 2RKUA 3DFAA 4FA2A 5AR3A 4C4EA 3QA8A 3II5A 2WU7A 3GU4A 3RVGA 3UOHA 5D11A 5KZ0A 4F9BA 1OVEA 2C3IB 3C4XA 1WBVA 2BAQA 4LV8A 1UKIA 3BCEA 4QP7A 4L52A 2UVXA 3R7UA 2J2IB 4O27B 5IDNA 5IH4A 3JUHA 4PPAA 2F7XE 2BR1A 2O8YA 2UZNA 2UV2A 3QTQA 5DA3A 5M4FA 3SGCA 5CU3A 3TV6A 4AUAA 4C34A 5I0BA 4E8AA 2W05A 3Q9ZA 3CY3A 4OGRA 1F0QA 1YI3A 1XKKA 2VGOA 3QGWA 5E92A 2QOLA 1BI7A 4FKOA 3VUKA 1GY3A 4PMPA 2J0MB 3AD5A 2BVAA 1TQPA 2X7FA 1H1RA 3GQLA 5H8EA 1REJA 3D2IA 4HYUA 2B9FA 5IMEA 3L8SA 4LMNA 3OY1A 2Y4IB 3OCGA 3A2CA 4KS8A 4WRSA 3BBWA 3KK8A 4DT9A 4B99A 3FC1X 4IJ9A 5E8VA 5CEIA 2UW8A 4I5MA 4J96A 3HL7A 3MV5A 2A19B 3UVPA 4N4SA 2YM8A 2W7XA 4FVRA 3EN9A 2O2UA 4FODA 5LARA 2VX3A 3RAIA 4AN2A 2BKKA 4AXAA 3RAWA 2WMBA 1ZZLA 4EUTA 3RPVA 3DBCA 5IF1A 3ORNA 4F9WA 5JRQA 4EK6A 2E9UA 2J90A 4MCVA 4AACA 1OUKA 2IVSA 4QTBA 5IKWA 5TF9A 2ITYA 3CE3A 4I21A 5E90A 2BDJA 3HECA 5ACBC 3ZBFA 4WNMA 1NW1A 4P5QA 1UNGA 3BGQA 4YZMA 1Y91A 2WD1A 3UE4A 3IK3A 4QYHA 5AUWA 3VS7A 1KE6A 3LCDA 3W1FA 4DEGA 5CALA 2YCRA 4MX9A 3WF5A 3AD4A 3BYUA 2UZUE 2ZOQA 4JDKA 4NFMA 2WZJA 3DCVA 5TR6A 5CNNA 1WBTA 3WF7A 4EH6A 1R0PA 4ALWA 4F09A 4QP8A 4ZY6A 4P5ZA 2QKWB 3QZGA 4RA4A 4TWCA 3KMWA 4ALUA 4DEIA 4FSUA 4JIKA 4C2VA 2CN5A 4D5KA 3IONA 4Y5HA 3CC6A 4AZSA 2EXEA 3E7OA 3NW5A 2R64A 3GFEA 3HA8A 3R8PA 4ACMA 5CAVA 5BYLA 2YCSA 3L9LA 4TNBA 2WTCA 3E8CA 4FMQA 2FSMX 4NYEA 3LXPA 4FTMA 5IA1A 3COKA 3T3UA 4FSRA 4FV8A 4JR7A 2P4IA 3GC0A 3NEWA 4YJTA 1XH6A 2VX0A 2YWPA 3BPRA 3HKOA 3LAUA 4FIEA 4M7IA 2BAJA 4IACA 4BTMA 4DC2A 2QO9A 4TN6A 4W4VA 2IZSA 4F1OA 1NVSA 2UW0A 2R3OA 5HBJA 1OI9A 3PXYA 2OGVA 2C3LA 4C38A 1FBNA 2CGWA 2W4JA 3JVSA 3A7FA 2UW5A 4IC7A 4RG0A 4LG4A 1TKIA 2R3QA 4N6YA 4PMMA 1HOWA 4RVKA 4BI0A 2VNYA 2XK8A 1I09A 4EQMA 3UOKA 5J95A 2CKOA 3R02A 3NUYA 1V1KA 4AZFA 4PDPA 4BKJA 5IQDA 4BHNA 3ORXA 5KNJA 3U51A 1XH5A 2GHGA 3RMFA 1FMOE 4D2SA 3V8TA 5C01A 3MY5A 3H10A 4NJ3A 4UZHA 4ZSLA 4EJNA 4IM3A 4U3ZA 5CANA 1IASA 2HELA 4N6ZA 4AGCA 3EQGA 2G2FA 3E87A 2G01A 3QQKA 3QYZA 4XV9A 1JAMA 2BZKB 3T3VA 3W8QA 5AX9A 4JG7A 5CAOA 3NNXA 5CXZA 3KCFA 2YACA 3C5UA 2OZAB 4MXAA 3PG1A 3MH1A 4GJ3A 5ANDA 1PXIA 1OPLA 2OXDA 4HNIA 4J99A 2BRBA 4O0UA 1Z9XA 2UUEA 3ULZA 4R3PA 4BWKA 2XBJA 4K0YA 3SRVA 3TEIA 4EJ7A 1H28A 3MPMA 4D2PA 1WBPA 3GENA 4C3FA 4KINA 4IX3A 4ZJVA 3S4QA 4W9XA 4ZS0A 3GU7A 2ETRA 4O7TA 3MWUA 2R3PA 5B2MA 3ANQA 5CYIA 5JKGA 5BVWA 3UYTA 5HG8A 4NEUA 4K18A 4JQ7A 1BMKA 4ID7A 3W10A 5ICPA 4WG3A 5CAQA 2QOQA 4QMLA 5KO1A 5J9ZA 5M4UA 1OPJA 1ZOGA 5EKOA 3QKMA 5K0XA 5FBOA 2IO6A 2GHMA 4NH1A 4NZWB 2XNNA 4RWJA 4PTEA 4BGHA 3F69A 3KL8A 2FSTX 4XG9A 4GUBA 5HLNA 2KTYA 3BHHA 5L2TA 1Q8TA 3WYYA 4CMUA 4ZTRA 2VTMA 4ZJIA 5M57A 4KBCA 5E1EA 4YJOA 4TYHB 5D10A 4QPAA 4F6SA 2WTDA 4AF3A 1Q62A 5BVNA 2W9FB 4BDCA 2W1FA 2PZ5A 3UMWA 3P79A 4FV1A 3THBA 4A7CA 4DITA 5FXRA 4I0RA 1Q24A 3MTLA 5M08A 4IWQA 4C3RA 4ZLYA 3FMLA 3F2AA 4FUXA 1DI9A 1UWHA 4IAZA 2VX1A 2GQSA 3BIZA 4D4SA 3FLZA 3ZTXA 4FV7A 5HKMA 3FBVA 3WF8A 3DV3A 3LFDA 4L43A 4ZEGA 3TG1A 4I0SA 5HIBA 5EM8A 3V6RA 5I9ZA 1RW8A 2XVDA 3Q2JA 4AE6A 3ALOA 3LHJA 4O1OA 4RJ8A 2OZOA 4ANBA 3ZC6A 5HTBA 4O84A 3D0EA 3RKBA 1TVOA 1P14A 2LGCA 2PVRA 3LQ8A 2YM6A 3WOWA 4FZDB 5B7VA 4CFVA 4BTFA 3C1XA 5E8XA 3C4ZA 4EZ3A 3EZRA 3QZFA 1H0VA 3W2SA 3VWAA 2PUUA 3A7GA 1R78A 3MJ2A 4PQNA 4WUAA 5FG8A 3AC4A 3W2RA 4BF2A 1FVTA 4U40A 3ZM4A 3AQVA 4D2TA 3S0OA 5E9EA 4F64A 3CSVA 3ORKA 4HJOA 2VWYA 5TOZA 1BYGA 4ZZNA 3R1SA 1KSWA 1KE9A 4N0SA 3WILA 2O5KA 3KREA 5DR9A 4TYJA 1LP4A 1X8BA 3ID6C 3IQ7A 4RT7A 3TZ7A 4O91A 4ZY4A 1Q41A 3DS6A 3HV4A 1YKRA 5EOBA 5ETIA 5JGBA 3DBDA 2IW9A 4H1MA 4C8BA 4EI4A 4YBKA 5HIEA 4EHVA 3E3PA 4RJ5A 3CTQA 4FSZA 4GG5A 5EM5A 4Y8DA 3TI1A 3P4KA 5C03A 2JFLA 3V04A 3W18A 2QO7A 5AM6A 4B8MA 2A0CX 3TM0A 3ACKA 5AUUA 1NXKA 2YERA 5FTOA 2IG7A 4O7LA 3UQFA 2Q0BA 3MDYA 3D5XA 3UMXA 4XUFA 4AOIA 3C4FA 2C0OA 2X2KA 3PY0A 3HMIA 5T3QA 2W1EA 1ZAOA 3QUEA 4HNFA 2JKQA 5A4CA 3FI2A 4JBOA 3P7BA 4Y85A 2PVYA 4RX5A 4RIXB 2OXXA 4XP2A 3EN6A 3RK7A 3Q9WA 5CI7A 3Q3BA 1F5QA 2ONLC 4MBJA 4YSMA 2GNHA 5BUEA 3PTGA 3KQ7A 4EOPA 2J0LA 2JIUA 2XIKA 5FWKK 4GRBA 1OL7A 2ITWA 3FQHA 4TYEA 3C0HA 1O9UA 3ROCA 2JEDA 4FX3A 4G6OA 5TE0A 3NDMA 3DAKA 3E5AA 4QPSA 2CCHA 3EFWA 1JLUE 2WPAA 3IGGA 1E1XA 2C6MA 3KY2A 4U45A 1KUTA 3FKLA 3F7WA 4O22A 3HAMA 1APME 4I4EA 5FM2A 4TZRA 1G8SA 2YM3A 4IAIA 2XB7A 3EQFA 4J95A 4NK9A 4PMTA 4XX9A 1ZY5A 5LOHA 4AOJA 1J7LA 4FKIA 1JOWB 2J9MA 2X7OA 4Y72A 4TL0A 2UZBA 2QODA 3OBJA 3KMMA 3OCBA 4V01A 4A9SA 2HY81 3F3VA 5C26A 4EOJA 4AQCA 5F95A 5KHWA 2JLDA 1H1QA 4QTCA 2OICA 3HEGA 1B6CB 1U54A 3KKVA 4FTNA 5CI6A 3R9HA 5IQFA 3R8VA 4KIQA 2XKDA 3BWJA 3B2TA 5EHLA 4I22A 3NVMB 1V0OA 4J8NA 4EZ5A 1U59A 3WBLA 2J4ZA 5BVKA 5FEQA 4AOTA 5IQGA 2R5TA 4Q5EA 3F3TA 3ZZWA 3EYHA 4BI2A 4JL9A 5KHXA 4EHEA 4RJ6A 4CZTA 3EB0A 5HG9A 4F9YA 1ZYJA 1KOBA 2WOTA 2Y7JA 3D2KA 4B7TA 3FLSA 3H0ZA 3L8VA 3R2YA 3ZEPA 2RG5A 2XS0A 3BU6A 4FSTA 3HNGA 1XBCA 3FXXA 3IW5A 3E8NA 3MB6A 4E3CA 4FBXA 3AG9A 4CFXA 2Y0AA 3KEXA 5ANKA 5DRDA 3Q52A 3RCDA 1YVJA 3VRYA 3DAJA 4X6RA 3GQIA 5AUXA 4FKJA 5HORA 4D0WA 5CENA 4L45A 1H0WA 2X6EA 5CQUA 4QQTA 5CEPA 1RQQA 2QO2A 3JR1A 4DYMA 5FD2A 4DGLC 2WMRA 4RIYA 2PVJA 1TQMA 2BRGA 2V5QA 5BUIA 2B52A 3EQIA 4GIHA 3R7YA 3DOGA 4JQ8A 3OOGA 4R5SA 5KBQA 4S30A 5I9UA 4GU9A 2AUHA 5DNRA 2Y4IC 4P7EA 4P90A 4RVLA 3MW1A 2OO8X 2YIYA 2IW8A 2XRUA 3W55A 3WF6A 4O38A 1CMKE 4ZOGA 1OB3A 3SW4A 1CKPA 1JVPP 2E9PA 1XH8A 3G9NA 4MQ2A 3DA6A 4YPSA 4FSQA 3DK3A 5IUHA 1LUFA 3RINA 1JKTA 2WIPA 2YM4A 3O96A 4I24A 4X3FB 3U55A 3ZSGA 4ANLA 4BCPA 4Q2AA 3V3VA 5HU3A 3A60A 3ZDUA 2Y6OA 3L9MA 2J50A 3KXNA 5GIPE 3LKMA 2RSVA 2HXQA 3ZO2A 4MAOA 5JH6A 1OM1A 2WO6A 4D1XA 3ORMA 1M7NA 5AFVA 2WMVA 2OXYA 3V5PA 2PUIA 1PXMA 3LQ3A 4KRDA 4GK3A 3RPOA 5FEEA 4BGQA 5D41A 2VNWA 4IAFA 5AX3A 2PTKA 3KRWA 2RG6A 5GHVA 4EYMA 3CKWA 3NNUA 1KE7A 4O7SA 3PDTA 4WBOA 5AEPA 2VWWA 1YI4A 3LLAA 4BDHA 4IZ7A 4LM5A 3DQXA 3QKKA 4DH1A 1QPCA 1UV5A 3SG9A 2GU8A 3C13A 2JIVA 5L8JA 5E1SA 5E4HA 4U0IA 4E5WA 3P9JA 3LFQA 4G2FA 5AP1A 3QRUA 4FKTA 1K9AA 3MH0A 3NYVA 2V55A 4FV3A 1H27A 3ERKA 3SXSA 2BUJA 3DJ6A 2WTKB 4UV0A 5A6OA 3BYMA 4U42A 5DG5A 3BU5A 5DPVA 3UNJA 2VTRA 3FV8A 3PUPA 2XK6A 4ZTHA 4EH9A 4EOIA 4FYOA 2P55A 2UZEA 4OBPA 2W1ZA 4YJUA 4AE9A 4D5HA 3LFFA 4IADA 2PZYA 4FV5A 2F7EE 5DN3A 4A9UA 2BKZA 1OIQA 4XMOA 4IX5A 4TKSA 4YZ9A 1P2AA 2OI4X 4FV0A 4EK3A 2HW6A 1HCKA 3BQCA 1T46A 2X4FA 3A8XA 3QA0A 4F0FA 3CD8A 2C6DA 4IM0A 1Z57A 2WEVA 4FT3A 4JBVA 5CZHA 4CCBA 4EYJA 3GGFA 3UP7A 4F7LA 3VUDA 3O50A 3MN3A 4L3JA 2CSNA 2UW6A 3MY0A 4FTCA 2EXMA 2Z7QA 1OGUA 3SD0A 2WXVA 4G9CA 3SOAA 3PJ8A 4ZLZA 2XRWA 2R3HA 3QQHA 2QURA 2YM7A 3LCKA 3BV3A 4QMOA 3TZ9A 4FIFA 3OF0A 4CT2A 3L9NA 3QTSA 3BBTB 2VO3A 3K5VA 3RAKA 4G17A 2BDFA 5B2KA 1JKKA 4UZDA 5AV2A 4TRLA 3DPKA 4AW2A 3OVVA 3PZEA 4FIIA 2R3KA 1ZYDA 4M12A 3WF9A 4NM3A 3LM0A 4PWNA 3ZEWA 5AIRA 3LFEA 5B0XA 2C6EA 5TO8A 5L2SA 2QG7A 1YXTA 4XOZA 1GIJA 1WVYA 2DQ7X 3POZA 3CR0A 3MY1A 4ONAA 4X6QC 4EOQA 2YFXA 4Z55A 3ZZEA 5L6WL 3QXPA 1GIHA 1XH4A 3FY0A 4X2JA 4FNWA 4XYFA 4WKQA 4Y5QA 2P33A 2R7IA 5HE2A 3ZCLA 3N51A 3U6IA 3W2OA 2GTMA 2ITUA 3LW0A 3WZJA 4DH7A 4GIIA 1PRYA 1JKSA 3QRJA 4RQVA 3VQUA 3KVXA 4BDJA 4J8MA 5AP4A 3G5DA 4Q5HA 4EOOA 2HOGA 4CKJA 1GJOA 4PTGA 4GT3A 3R6XA 1ZZ2A 2HZNA 4K6ZA 4IWDA 3LJ2A 3RWQA 3UGCA 5CX9A 3FLNC 5EKNA 4FKWA 2XM9A 3MPAA 2IVTA 4I6HA 4GU6A 1Q3WA 3N4VA 1P4FA 5JRSA 3OWPA 1I44A 2EU9A 2QR8A 4HZRA
chains in the Genus database with same CATH superfamily
4EWHA 2WQNA 3P7CA 4X2FA 3CPCA 3EQRA 3FXZA 4FT0A 4DHFA 2G9XA 4UMUA 4C3PA 5CSHA 2XARA 3SLSA 4S32A 5HG5A 3ZOSA 5CTPA 3OXTA 2X7GA 4E26A 4S2ZA 5A46A 5HO8A 4D2WA 5AA9A 1SYKA 2RFDA 5E8WA 4BIDA 3AT2A 4B9DA 3GOPA 3Q6WA 4UMTA 4QTAA 4XV2A 4TYHA 2OF4A 3QD3A 4D4VA 3HV7A 3ETAA 2FB8A 1MRVA 4DEDA 4A07A 4DG3E 5IEVA 2B0QA 4BJJB 5HG7A 5M53A 3Q4UA 3D5UA 3R2BA 4ZTQA 3NIZA 1PMNA 1S9JA 2J0KA 2FUMA 5E8UA 2XK4A 4BZNA 3JY9A 3G6HA 1PXJA 1JWHA 3NUUA 3KCKA 2XZSA 1FVVA 5AP5A 4WT6A 4E4XA 4BICA 2XP2A 5DT3A 3TTIA 2XEZA 2QI8A 2R9SA 1R3CA 3M2WA 3R63A 5G1XA 5J7HA 3G33A 4KAOA 1XH9A 2GQRA 3DBFA 4O6EA 3HP2A 2REIA 4FICA 3U9CA 4QP9A 4CZUA 1XQZA 2B54A 3NLBA 4I23A 4I5CA 3DGKA 1OKVA 2ZJWA 2VN9A 4FTOA 1Q8YA 4ASEA 5LWMA 2UZDA 5K4JA 3UDSA 5EOLA 3F5GA 4IVCA 4MYGA 4AZVA 3O23A 3LMGA 3NAYA 5JT2A 3C4CA 5D7AA 3QC4A 3EN7A 3EN5A 3QCQA 4F7SA 4EQUA 3BYSA 5CF8A 2OFUA 3IGOA 4EOSA 2CN8A 2R2PA 5CSWA 3NNWA 2XH5A 2IZUA 4I5PA 2B9JA 3QU0A 1Y8GA 1XJDA 2XYNA 2P2IA 2X0GA 2NPQA 4FOCA 4MD7E 4E20A 2RL5A 4LGHA 3NUXA 4HGLA 4FG8A 4L7SA 4P4CA 4O0WA 2ZFYA 5HD4A 1IG1A 3PYYA 4C7TA 3EMGA 4DGNA 3UODA 3VF8A 2C30A 3COMA 4TNDA 2X1NA 3R00A 3DK7A 5AP0A 5I5ZA 3C51A 4LYNA 4OT6A 3UYSA 3MVHA 3FMJA 5E8TA 4HPUE 5DR6A 3NZ0A 4MBLA 5EHOA 3ATTA 4M3QA 5K3YA 2G15A 3ZRKA 4ITIA 2I0HA 1BLXA 4PV0A 3VS5A 4BN1A 4E4NA 1MUOA 2C4GA 3ENHA 3PY3A 2C5XA 4WNPA 3MVLA 4LUEA 1MRYA 4EOMA 3FZOA 2ERZE 3K5UA 3ODYX 3ZFYA 3Q6UA 5BVEA 4LRMA 5FEDA 4BBEA 2EWAA 4BCNA 5L8LA 3TUDA 2QLQA 4KABA 5AUVA 1HCLA 3ZRLA 3TACA 1W82A 4BDKA 4IAKA 2CDZA 2JKOA 1IEPA 4S31A 4C2WA 3BEGA 1YXVA 3FI8A 3QX2A 4JS8A 4K11A 2OJJA 5H8BA 4OAVB 3EH9A 4D58A 4HGEA 4QMYA 4QMSA 4AQKA 3PWDA 3TUCA 3DFCB 4Z16A 5EDPA 3BELA 2PVKA 2WQBA 4L01A 1OZ1A 1Y6AA 1W84A 4O4FA 1OMWA 4U79A 4L3PA 3F6XA 2WQOA 1OBGA 4DEAA 2JIIA 5AR8A 1L3RE 5HE0A 4O0XA 4RIYB 4BGGA 3O51A 4G6NA 2PZIA 2GS6A 1GAGA 5H2UA 3R9DA 4UY9A 3VS3A 3EWHA 3H3CA 5J79A 3VHKA 2WB8A 3NW6A 2DWBA 4IDTA 3QFVA 1T45A 3EL8A 4MNEB 2X0OA 2XYUA 4B8LA 3ZSIA 5JFXA 5GIOE 1QPEA 1VEBA 3L1SA 4ZLOA 3R71A 4IB5A 4KS7A 3OS3A 4J97A 4E4MA 4EEVA 5CT0A 4UWYA 5HVJA 4C4IA 3OZ6A 4WNOA 2PMOX 3TZMA 3WE4A 4AGWA 4D9UA 5DT0A 3LIJA 1KE8A 4YNEA 3FQSA 2B9IA 4D0XA 4ZJJA 3ORPA 4O7RA 4DLJA 3PFYA 4AP7A 2OW3A 5C4KA 3QCSA 1G5SA 3E93A 2QNJA 4LGGA 3SKCA 3ZS5A 5E8YA 5A4EA 5I9YA 2XJ1A 5FRIA 4RJ3A 2CLQA 3FMNA 4I4FA 3TKUA 4F9CA 4JAIA 5LVPA 2HZ4A 3P7AA 3KA0A 1DAYA 2ERKA 4HGSA 5A6NA 3QTXA 4RX8A 4IAAA 3IS5A 1Q5KA 2CHLA 1W0XC 2JDRA 3HZTA 4KIKB 2Q83A 4DCEA 5BVOA 4BCIA 1YWNA 3H9RA 1VLRA 2OH4A 4MK0A 3RGFA 3KRJA 3UQCA 4JG6A 1SMHA 2F9GA 3KULA 3MI9A 3OWLA 4O7NA 4RLLA 3LVPA 3U6HA 3LZBA 5HZNA 2GHLA 4FKGA 4O0RA 4F6WA 1JBPE 1URCA 2I40A 4KKGA 2YAAA 3Q9YA 3QRIA 4W9WA 4FSMA 3UIUA 4D4RA 3ZM9A 4RWIA 2GFSA 2W1HA 3ZFMA 3P5JC 2FGIA 3HMOA 2NP8A 3C5IA 4L00A 3BZ3A 4A9YA 3A62A 1BKXA 1KV1A 4BFMA 1NY3A 4YUQA 4GKHA 3EHAA 4GEOA 4NTTA 3H9FA 3TN8A 2WMWA 3F5XA 4DEEA 4EH8A 3ENMA 2UVZA 1OIUA 1V0BA 2W5HA 4YHTA 4X3FC 3V6SA 2WFYA 5DGZA 4A4OA 3PP1A 4S34A 1KWPA 3HRBA 3PXRA 1FMKA 3DZOA 5HIDA 4U43A 2ZDUA 3NSZA 4GCJA 5TT7A 3PXQA 2FSOX 4H3BA 4UYAA 2Z7LA 4HOKA 2R3IA 3VNTA 3VUGA 2B55A 1Q8WA 3OHTA 4X3FA 2W06A 3ZLYA 1H08A 5C8NA 3N4TA 1SVGA 2F2UA 2XNPA 3IDPA 3Q04A 1PMVA 3R04A 3R1QA 3D94A 5DBXA 5KKRB 4BKYA 3PE2A 2RGPA 3LXNA 3FPQA 3BYVA 4ZAUA 4EWQA 4BB4A 5J1VA 3K54A 3ZFXA 2AEGA 3W2PA 3I0QA 4RFYA 5BYYA 2W1DA 3CQUA 3SVVA 3TV7A 3Q4TA 4OBOA 3EQHA 2PMIA 4IVAA 5KBRA 1LR4A 4M14A 5ANEA 3GCSA 3MBLA 3BHUA 5LMAA 1GZNA 5I3OA 4PMSA 1RJBA 2BZHB 5AA8A 3AT4A 2WGJA 1KE5A 3OEZA 3AMYA 4K33A 4LRJA 3W2CA 1UVRA 1R1WA 4FV4A 2WTKC 1O6LA 4AW5A 3LLTA 4CZYB 3RHKA 4IH8A 3FJQE 1XBAA 3FLYA 4I94A 4QMVA 3QWKA 2BZIB 2YIWA 2O0UA 2R3JA 3GU5A 5T68A 3U8WA 4QP2A 3NWWA 4PDSA 5DFPA 4H1JA 3GOKA 1W8CA 2QHNA 2DS1A 3OG7A 3OXZA 3PA3A 4PUZA 4YHJA 5HO6A 2Y6MA 5A14A 4HCVA 3R7OA 4FTRA 3F5UA 4EOLA 3AOXA 4CFFA 3FZRA 3TMOA 1VYZA 3KXMA 4OTPA 4RC2A 4QQJA 4C62A 1J7UA 2ZV9A 1MQBA 2YABA 4K8AA 2P3GX 4BC6A 1W83A 4BCMA 3LXLA 4MBIA 3VN9A 4YTHA 5IG1A 4OTDA 4BTKA 4DTAA 3RK5A 5JMSA 3IW6A 3QALE 4I5HA 1MP8A 1CKJA 3DTCA 4MXYA 4ENXA 3MIAA 1PMEA 2XF0A 3BLQA 2CJMA 4NCTA 4LV5A 4O2ZA 5E8ZA 2NO3A 3JYAA 4FT7A 5FM3A 2W17A 4RC3A 3HYHA 3TIYA 4EBWA 1G8AA 2JFMA 4CT1A 3KRLA 2GNFA 3O8PA 3H30A 2Z02A 3UDZA 4KB8A 3NGAA 1UU9A 4G5PA 4B0GA 4FK6A 4QYFA 4EC9A 3NMUF 3V51A 2WHBA 4UN0C 5AMNA 5AM7A 3EYGA 3P08A 4KSPA 1ZMWA 1UU7A 2VWBA 4H3PA 5L2QA 4ZZOA 3HRCA 4E5AX 1JSVA 3GCUA 3WZEA 2F2CB 3GB2A 2QG5A 2X8EA 3UZRA 3U6JA 4OTFA 1J91A 3ODZX 4FNZA 2GFCA 3HV6A 4ASXA 5JSMA 3NVKI 3IW8A 2BHEA 4D55A 1OBDA 1U46A 3VF9A 2PUPA 4YC3A 4C4FA 1FOTA 2O64A 1BL7A 4F0GA 2DUVA 3G2FA 3MFRA 4RPVA 5BVDA 3UNKA 4XH6A 1BX6A 3RZFA 4H05A 4R6VA 2ITXA 3ZO3A 4APCA 4CV8A 5CF6A 2WIHA 5KMKA 3UZTA 4O4DA 3UG1A 2ETMA 3E62A 2HZ0A 4ALVA 1W7HA 2HIWA 3TIZA 4DT8A 4AXFA 3PE1A 5E7RA 4AW0A 2VRXA 4TTHB 3MH2A 1IR3A 2GNLA 1YHVA 4NKAA 3VJNA 3R21A 2BCJA 4ITHA 2C3JA 3D7ZA 4TWPA 3MFUA 5CAPA 1Y8YA 2HXLA 5IDPA 4OLIA 2YDJA 3C0IA 4MXZA 5B2LA 5CSVA 2VGPA 3MJ1A 5ANJA 3V5JA 3SG8A 3UVRA 1FVRA 4AGUA 2PVNA 4YNOA 4AS0A 4F7NA 2C0TA 3ZUTA 4JLCA 3QUDA 5BX0A 5IMXA 3F88A 3I81A 4FL1A 4ANSA 3REPA 3PLAE 5EDRA 3PXFA 5HX6A 4HYSA 2X2LA 2PVLA 3EQDA 3FLQA 5A4LA 5EQEA 4L8MA 3PSCA 5EM6A 5LCKA 4YTCA 4FF8A 4HCTA 4C61A 4RQKA 4F99A 5M07A 4CLIA 2E9VA 3GC7A 4X2GA 4I20A 4CTCA 2WMAA 1DS5A 3DNEA 5EI8A 4DEBA 1WFCA 4A4XA 3QYWA 2JBOA 4NM5A 3FKNA 3WZKA 1U4DA 1ZWSA 3CP9A 5A4QA 2BALA 4C57A 3UDBA 3BLHA 4WSYA 4C35A 4CYJA 1ZYCA 2VWVA 2ZVAA 1CTPE 3L8XA 3R1NA 4IJPA 3OY3A 4LI5A 4NWMA 4YO6A 5IA3A 3HA6A 4Q9ZA 4AX8A 2VWZA 5JQ5A 5K4IA 4JX3A 3TDWA 1M14A 4BYIA 4ERKA 4GJ2A 1E1VA 2C0IA 3GP0A 4QMZA 4U80A 2C6TA 2ZM1A 3FDNA 4UB7A 3PA4A 4WSQA 4HVSA 4OTHA 4J1RA 4O21A 4X0MA 3PUFC 4RIWA 4NJDA 3ZXTA 1PW2A 3O7LB 2PSQA 1ZOHA 4NW5A 3MB7A 3VUMA 1PYEA 1TQIA 5GINE 2E9OA 2ITQA 3R0TA 3CPBA 4XG8A 3SW7A 4RA5A 5DIAA 4PNIA 5CSXA 2OH0E 3PRFA 3FMDA 4ANNA 3CTHA 3P0MA 3QTIA 5F94A 1JQHA 3GEQA 3LFBA 2WOUA 2LAVA 4DHIB 2F49A 3CIKA 3NW7A 4O96A 4WA9A 3IW7A 3VBWA 3AKKA 4DTBA 2VTHA 4C36A 5EK7A 1CM8A 4FKLA 2C6LA 2B7AA 2V22A 3EQBA 4BDBA 2W4KA 2O65A 2OJFE 3LCTA 3ORTA 3U4UA 5GJDA 4AN9A 5BNJA 2ACXA 5L8KA 1PF8A 4BBFA 4G3FA 2HW7A 1XWSA 3CGFA 4O0VA 5LMKC 2CNVA 3TNQB 2PMLX 4FL2A 4RWKA 4YJVA 1YXSA 3S1HA 2WMUA 2YWVA 3TT0A 5I4NA 2OF2A 3ZHPC 5I3RA 3FYKX 2HK5A 2B53A 3KULB 4IM2A 2VU3A 3DDQA 3WARA 4AFJA 5HGIA 2WMQA 5LMKA 3V5LA 3PPJA 3QTUA 4F08A 4L42A 4ANMA 5FBNC 1ZRZA 4EHGA 5AV4A 4LFIA 5L2WA 4DHJA 2PVMA 2WU6A 2ZV2A 3OOMA 4QDVA 3W0SA 3I5NA 4FNYA 5CT7A 3MVMA 5FDPA 3KXHA 2C5VA 2R3NA 5JQ8A 1XHAA 4KRCA 4EQCA 3DXQA 3HVCA 2R7BA 3U54A 1A9UA 3HLLA 5J5SA 3U4WA 2R4BA 3CCNA 4ANQA 1MQ4A 3A8WA 3ZUUA 3TTJA 1LEZA 3BE9A 5C1QB 3JPVA 3ALNA 4J7BA 2VTSA 3TNPC 3R28A 4LUDA 3UNZA 1O6KA 4CFWA 4ASDA 5DH3A 2W0JA 4FC0A 4NM7A 4BCHA 2JKKA 4ERWA 5HNIX 4BWXA 5FXQA 1K2PA 4MNEA 4WD5A 4CCUA 5E91A 4O7YA 2A4LA 3BV2A 4IEBA 3R7GA 2JBPA 2OK1A 3O17A 4D4YA 4QP6A 3AMAA 4DAWA 4XLIA 1OIRA 3BI6A 3D9VA 4CLJA 3R9RA 4X2NA 2R0UA 3CEKA 5C27A 1DAWA 4JT3A 2C1BA 3QCYA 4OW8A 3WE8A 4C0TA 3BQRA 3PZHA 4U44A 3UBDA 3MPTA 3PJ1A 3GXLA 2X8DA 4TT7A 2QD9A 4BDAA 4ZTSA 4NT4A 5IA0A 3FWQA 3OWKA 1DI8A 4NTSA 3R8UA 2ZAZA 3ZMMA 1TZDA 2H6DA 4R3RA 4LQMA 4CV9A 5J5TA 3VS2A 3Q60A 3ANRA 5CEQA 4C37A 4CMOA 3O71A 3VC4A 4QMWA 3HMPA 5DWRA 4KIKA 2I7QA 1H25A 4FG9A 2OIBA 2QQ7A 4XV1A 3OT3A 3UC3A 3FMEA 4K1BA 2IPXA 1P5EA 2W9ZB 3RCJA 2I0YA 4E6DA 5DT4A 2VTLA 2ZM3A 4FEVA 3MVJA 3QX4A 2I0VA 1M2QA 4ZMEA 3I6WA 2ESMA 1Y6BA 5FLFA 3COHA 5HCYA 3VBYA 2DYLA 2WELA 3F2RA 4YJNA 4L7FA 2BHHA 2C6OA 3FLWA 3FMHA 3RAHA 5BUJA 3ZLWA 3UO5A 3VAPA 5ANIA 4O0YA 4FNXA 2OIDA 2OJGA 5HCXA 2WTIA 4QQ5A 4BIBA 3DBEA 3CGOA 3ZSHA 4RBLA 5D7VA 4PY1A 1OGYA 4FTUA 3RM7A 2F4JA 4QMQA 3UOJA 2JAVA 3FZ1A 4AWIA 2PZRA 4FEUA 4BZOA 2WQEA 3NNVA 5JZNA 3PVWA 5DEYA 5FXSA 4D2RA 3L8PA 3ZUVA 4E6CA 5ETAA 4FKRA 2WEIA 4Y83A 3RP9A 1GZOA 3TXOA 4C4JA 3QCXA 3DQWA 2HWPA 2JAMA 2QCSA 3BGZA 5CU4A 2XKFA 4GS6A 5KKRC 3KIOC 2OBJA 2IN6A 3D15A 4E7WA 4WIHA 4U41A 4U97A 4YZDA 2W99B 2CGVA 2YIXA 4HCUA 5CEMA 4EUUA 5IQIA 4MNFA 5G6VA 3HDNA 3OW3A 3ROYA 4RRVA 2JITA 4GVJA 2GDOA 4P2KA 4L6QA 5KMNA 2H96A 3LE6A 4UMQA 1JSTA 4GFOA 2C68A 4G6LA 4HVIA 5AP7A 4ZTMA 3CQEA 2HENA 3KRXA 4C58A 1ZYSA 1SVHA 5AV0A 3LPBA 3I4BA 3AGMA 4OUCA 3QQUA 4JXFA 1M2PA 3S00A 1UA2A 2YLEA 4ACCA 2OLCA 4O86A 4DFNA 2PVHA 4CRSA 2CKPA 4GT5A 4L53A 4PPCA 1ND4A 3QC9A 2G2HA 3ELJA 2GMXA 3ZBXA 4FIJA 1J3HA 2W5BA 1YOJA 4HZSA 2BFYA 3QHRA 4J71A 4O0SA 5CLPA 2YISA 4QPMA 4GFGA 4AT3A 4O1PA 4DE4A 2VV9A 3Q96A 4FTJA 3UJGA 4O81A 2VTQA 4Y46A 2YCQA 4G31A 5GJGA 3ET7A 2Z60A 3G0EA 4YC8A 1UWJA 2FH9A 2XKEA 5J8IA 2HWOA 4DF3A 2J5FA 2PU8A 1ZYLA 2JGZA 5HOAA 3MFTA 3PP0A 3V5WA 5ETCA 2CKQA 1PXKA 4XP3A 1J1CA 2HCKA 3UVQA 5HQ0A 3NUPA 4JRNA 2OJIA 3SDJA 5IEXA 5CU6A 3V5QA 5IZFA 4W4YA 5AR5A 3G9LX 4EH2A 4FZ7A 3OT8A 2HYYA 4O6LA 4FK3A 3S95A 4M66A 3KRRA 5C8MA 3QAME 4MD9E 5DEWA 2QR7A 4GK4A 3GC9A 4DBXA 4W4XA 1STCE 4I6FA 3RBWA 3UTOA 1IAJA 5CXHA 5JFSA 1LPUA 3LM5A 3TKIA 1VYWA 4PP9A 3FMKA 4BCKA 2JDOA 3V01A 3Q5ZA 4GT4A 3A7IA 3QTZA 2UZVA 4AA0A 4CFMA 3MESA 3KN5A 5IEYA 5ACKA 1PJKA 2I6LA 4L3LA 5FP5A 4ARKA 3QWJA 4NKSA 3R73A 3VUTA 4BDGA 4WBBB 4CQGA 3R83A 4XG7A 2B9HA 3AGLA 5HTIA 3LOKA 2ITNA 3PPZA 4MVFA 1NVRA 3JVRA 5AIKA 4QDEA 1FGKA 2QONA 3OD6X 3CJFA 4HW7A 5D9HA 2PZPA 3UIMA 3LJ0A 3EN4A 4FYNA 4NL0A 1WMKA 2EB3A 5AAFA 5LQFA 4TW9A 2O63A 3KFAA 3E88A 4XNEA 1YRPA 1PKGA 3H9OA 3GCQA 3HMNA 4GG7A 4DLIA 4KA3A 2XEYA 4I92A 2C47A 2YITA 4FV2A 2XIZA 2XNGA 3CBLA 3EIDA 1G8JA 5LCJA 4RIWB 1YW2A 4R7IA 4RVTA 4HVGA 4QTDA 4CYIA 2F57A 3DLSA 4CEGA 4DINA 3C4EA 1M52A 5GZ8A 1E9HA 2UZLA 4CG9A 2XNMA 4FKPA 3GC8A 3R9OA 4DH3A 3VO3A 3UG2A 5AJQA 1ZMVA 4ACGA 4FSWA 4E73A 5GZAA 1VJYA 3W0MA 1UU8A 4HGTA 2C5OA 3C7QA 5DLSA 3HP5A 4L9IA 3NUNA 4M84A 5IUIA 3O2MA 4ZY5A 4EH5A 5BMSA 5K9IA 5FGKA 4HVDA 5CVHA 4IZAA 4DGGA 3PSBA 5GNKA 3B8QA 4F6UA 5KE0A 4FTIA 4YO4A 3DDPA 1R39A 3TWJA 3C0GA 4MXXA 3KXGA 4IQ6A 3W0RA 2BTSA 3F66A 3EL7A 4O7VA 4ZMFA 1OL6A 4FSNA 1PHKA 2CCIA 4QYYA 4G3DA 4NW6A 4IB1A 1R0EA 1H4LA 3VONA 3E8DA 3GVUA 4O2PA 4BYJA 5HNGA 4KIOA 5CZIA 3DY7A 5DVRA 3WI6A 3VHEA 1W98A 5TKDA 5HU9A 1YWVA 3RK9A 4DCAA 1VZOA 4IWOA 3BWFA 3QQJA 2R3LA 3Q5IA 5EM7A 2XK3A 1SZMA 2XK7A 2VWXA 4I1ZA 4IFCA 5M09A 3TJDA 3D4QA 3D7TA 3UZPA 5EQYA 3PSDA 1XO2B 4IHPA 3VW8A 1Q99A 1OPKA 1WVXA 3DJ5A 3D14A 4WHZA 4J98A 4YLKA 2KULA 3CS9A 4UMRA 3BHTA 2AQXA 3D83A 3HMMA 5AP2A 1WAKA 3IW4A 2YLFA 1BL6A 5CWZA 3FL4A 3G90X 5CS6A 5D1JA 4A06A 3VULA 3GBZA 5I9XA 2VAGA 5EHYA 4FG7A 2IEWA 2PYWA 4OTIA 4JNWA 2XAMA 3H0YA 2QHMA 2IF8A 5IA4A 4XJ0A 3CY2A 4KSQA 3SOCA 3O7LD 3FSKA 4IFGA 3ZO4A 1H07A 2C6IA 3QTWA 4AZEA 3V8WA 1ZY4A 1QMZA 3QL8A 3BKBA 1OUYA 1YHSA 4UBAA 2JDVA 3MSSA 4PNKA 4UYNA 1CKIA 2XBAA 1ZMUA 4ZSGA 2ZM4A 3PG3A 3CKXA 4NIFA 3W8LA 5LVMA 2VTTA 3C9WA 4R7HA 2X9EA 4ZSJA 5LVLA 4M0YA 4LOOA 2ZB0A 4MF1A 4J52A 4DDGA 4Y95A 3G15A 3FE3A 4FKQA 3P5KA 4R1VA 4BCOA 4F70A 4E93A 3G51A 4U9AA 3FL5A 5HLPA 2PPQA 5FQDC 4JAJA 1H26A 4EKLA 1ERKA 4QT1A 3RTPA 4BKZA 2RF9A 3I5ZA 3ZXZA 5DHJA 4CSVA 5J9YA 2BIYA 3MGYA 4ZIMA 3FQEA 1DM2A 4D28A 2YIRA 2XA4A 3RM6A 5LWNA 2FA2A 3JS2A 5IH6A 3U87A 3DU8A 3ORIA 4RJ7A 3PWYA 3NRMA 3BYOA 2Z8CA 3RHXA 3TDVA 4QP1A 3ZYAA 1EH4A 2XIXA 5JGDA 1QL6A 2EXCX 3DBQA 3RALA 1YDSE 4IZ5A 4X7QA 3T9IA 3P78A 3UIBA 4CXAA 5FTGA 2UW3A 4DGOA 3NYOA 1Q8UA 4FTKA 3R9NA 3NPCA 4PF4A 3E7VA 5EW8A 3FZSA 4QMXA 5EW3A 3W16A 4V05A 5CU2A 5ITAA 1IAHA 4XRJA 4JBPA 4FZFB 3NYNA 4MD8E 4EBVA 3PA5A 4YBJA 5DE2A 2BIKB 1FPUA 1IA8A 4QNAA 2PK9A 2FVDA 5FTQA 5CNOA 5M4CA 2BTRA 3I79A 4KBAA 4D1SA 3ORZA 3LXKA 3W33A 2CPKE 2UZWE 3LJ1A 4HYHA 3HUBA 4O4CA 4F1MA 2XJ2A 2VD5A 2PWLA 1Q8ZA 3KMUA 3KN6A 3ZRMA 4ZK5A 4AZWA 4YLLA 5JFWA 4JX7A 4XV3A 2GNJA 5IQAA 4PDOA 1P4OA 2OJ9A 3DKGA 3DKCA 3NYXA 4CFUA 1SNXA 4BCGA 3LCOA 5M51A 3O8TA 1YXUA 4N57A 1W2DA 2GQGA 5KMIA 2XMYA 4IAYA 5F1ZA 4IC8A 4ZTNA 5KX8A 3M1SA 1PXPA 4XBUA 4BWPA 1WBNA 4QMMA 4YMJA 3IECA 5CF4A 3F61A 5J1WA 5D12A 5M4IA 4B6LA 4TYGA 3G6GA 5T6KA 4TY1A 4NFNA 3JXWA 4IBMA 2R3GA 2XUUA 4GW8A 4QYEA 4FT9A 3FSFA 4WO5A 4XG4A 5HE3A 4AG8A 3TNIA 4FOBA 5H9BA 2QU6A 4CD0A 3NIEA 1ZOEA 4ZSAA 2F7ZE 2RIOA 3H4JA 4IZYA 4R1YA 1PY5A 3R7IA 3BRBA 4WG4A 2XNEA 2FYSA 2J0IA 3KF4A 3P23A 4M8TA 5IA2A 4O82A 1NA7A 4YJPA 3R7EA 4AT5A 4U8ZA 5EYKA 3R1YA 3CJGA 4RMZA 1W2CA 3OROA 3UP2A 1VR2A 3TJCA 2WMTA 4GKIA 3ITZA 4DH8A 3OC1A 3UO4A 2XCHA 1UKHA 3BE2A 2J6MA 4BR3A 5DR2A 5EDQA 5AUYA 2QOOA 3L9PA 4ASZA 3UO6A 2X4ZA 4B4LA 2PUNA 1YDRE 3WIKA 4K9YA 4AW1A 4CKRA 1WBSA 4NSTA 4O4EA 3BU3A 4D9TA 2XNOA 3SV0A 3LMHA 3EJ1A 1AGWA 3BEAA 3MYGA 3LFCA 4QD6A 4V0GA 4FL3A 2JDTA 3KU2A 1A48A 1ATPE 1G3NA 5CQWA 4GYIA 3RNYA 2Y9QA 2Y4PA 5DOSA 3I7BA 3POOA 3HV3A 4EOKA 5HX8A 2FO0A 2YDIA 3OBGA 3ZC5A 4II5A 4NCTC 2W4OA 4UMPA 3R8LA 3PLSA 4EORA 4O7WA 4M97A 1OL5A 1A06A 2XJ0A 2W5AA 3I1AA 3KC3A 3R30A 3O0GA 4YZBA 4H36A 4W4WA 2XIYA 3OCSA 3ULIA 5L2IA 5IQEA 4EONA 4YZCA 5AADA 1YHWA 4RWLA 1OECA 5EI6A 2YHVA 3B2WA 5A4TA 3EKNA 4F65A 5I9WA 2QOHA 4FRFA 4RSSA 3HX4A 3ZU7A 5C4LA 3FAAA 4UALA 2WMXA 4RFZA 3SA0A 3TNHA 1PKDA 3BL7A 3GU6A 4IX4A 4FGBA 2HAKA 4EZ7A 4BDFA 3NUAA 4PTCA 4USFA 4QP3A 4JDJA 4PX6A 3DTWA 2GSFA 4QO9A 3IDBA 5IU2A 3QD4A 4FUYA 3GNIB 4MKCA 2PVFA 4DTKA 1IA9A 2FSLX 5EYCA 4CG8A 3IOPA 4TXCA 4JOAA 3PY1A 5HI2A 5K5XA 5CF5A 3RNIA 4DG2E 3OTUA 3BHYA 4JDHA 1M2RA 2WNTA 5CVGA 3NFFB 4ORKA 4GMYA 4FKSA 4TYIA 2J51A 5KUPA 3ORLA 4G34A 2JD5A 4LOPA 3FPMA 5HVYA 4IW0A 3WYXA 3KB7A 3G0FA 3NAXA 3Q4CA 1GOLA 4MWHA 1GZKA 4MTAA 5JFVA 4C33A 4LRKA 3ZDIA 4XG2A 4YP8A 4YGAA 3RI1A 5BVFA 2CNQA 3VBVA 4ACDA 2YDKA 1U5QA 3F3ZA 3GT8A 4MXCA 4FVQA 4AGDA 2BFXA 3PIYA 4QRCA 3QRKA 3MS9A 5BMMA 1UU3A 4BDIA 5KMLA 4R78A 4RFMA 4XS2A 2BZJA 2VO7A 3NCGA 4YC6A 5EYDA 4OAUC 2GNIA 3AC2A 4DFUA 1J1BA 1H1SA 5AV3A 3ZLSA 3LMIA 1Q4LA 3LFNA 2GTNA 2QOIA 3HRFA 4GL9A 1OL2A 4DFXE 2H34A 3KVWA 4PRJA 4JJRA 3VBQA 1KOAA 4ZP5A 3MH3A 5DMZA 4R3CA 4PPBA