3CKWA

Crystal structure of sterile 20-like kinase 3 (mst3, stk24)
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
279
structure length
255
Chain Sequence
PEELFTKLEKIGEVFKGIDNRTQKVVAIKIIDLEEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase 24
publication title Crystal structure of sterile 20-like kinase 3 (MST3, STK24).
rcsb
source organism Homo sapiens
total genus 81
structure length 255
sequence length 279
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2008-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ckwA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ckwA01
2ITOA 2P33A 3R01A 4UMRA 2XCHA 4L45A 2QOIA 4KIPA 3IPHA 2C68A 4IHPA 4NIFB 2HCKA 1SVGA 4PPAA 3R21A 3W2QA 4DCAA 1O9UA 4Z9LA 4MKCA 4CZUA 5IQGA 3VUGA 2PE2A 1Z57A 1YOMA 2ITZA 2CLXA 2NP8A 4DGNA 3SG8A 3F7ZA 4OT6A 2GHMA 4QTAA 3LCDA 4BKJA 1B38A 1OL7A 1OKYA 4YZCA 3C4CA 2BAJA 4G34A 4QT1A 3PE1A 3COKA 3DK6A 2VX1A 3PXRA 2WMXA 3Q9XA 4HPUE 4FNZA 3NUYA 4A4XA 2UVYA 4GV1A 3ZMMA 1URWA 1WVYA 4IJ9A 1Q8TA 3I5ZA 4X2FA 4BZNA 4JR3A 3VS1A 4M12A 3IDCA 4IJPA 4E6QA 1P4OA 3HUBA 5CY3A 3QRIA 4DEGA 1PYEA 3C13A 1UNHA 1YWRA 5IDNA 3QX2A 4ANMA 1MRYA 2F49A 3GCPA 3R8MA 2VRXA 3EQHA 4PDPA 4IIRA 5L6OA 5C27A 4FF8A 1KOAA 3ZLYA 4X2GA 4QTDA 5B2KA 4AP7A 2V7AA 4CRLA 3JS2A 4U79A 3CGFA 5HBHA 2VTPA 4ZAUA 4F63A 4LRMA 5HNGA 2VTJA 3PVUA 3QZGA 4G17A 3RGFA 4TRLA 4H58A 5A46A 3FQSA 1ZOHA 4KRDA 1Z9XA 4GT4A 1ZZ2A 1TQIA 2XNNA 2AYPA 2R64A 2W96B 4K0YA 4F1MA 2QNJA 5D7VA 5EYCA 5BVNA 4XMOA 4IH8A 2R3JA 3CTJA 4I5PA 1Q61A 3GU4A 4AUAA 3DJ5A 3E88A 4ZLYA 3W32A 4I6BA 5IQHA 3FLZA 2YEXA 5BYYA 2IW6A 3UP7A 1JLUE 1Q3WA 1W83A 2NRUA 3TDVA 4FIGA 4G6LA 1L8TA 3GGFA 2JEDA 1PKGA 2EU9A 5IEVA 1XH7A 2X8DA 4FV9A 4P5ZA 3EKNA 3H10A 4EYJA 4CQGA 3A7HA 4FTKA 3V8SA 2BZJA 3GP0A 3PYYA 5GIPE 1KOBA 4OTRA 1LUFA 2VWVA 2WHBA 3MPAA 5L6WL 2WD1A 3HP5A 4YJUA 5T6KA 4O82A 1SNUA 4MD9E 3S95A 3FEGA 2B0QA 3FSKA 2GPHA 4PY1A 2DS1A 5AP3A 4B9DA 2J7TA 3RPRA 5DHJA 4GKIA 2YACA 5K0XA 4O7TA 4EH5A 4EK8A 4NM5A 2HZNA 4HPTE 5EM8A 1Q8ZA 3EN7A 4EKLA 3P86A 4JDJA 4U41A 3QQKA 3VBTA 4FTQA 3DK3A 2GTNA 2XCKA 4XV3A 3ENHA 4YPDA 3TI1A 4FT7A 4PDSA 4X2JA 3GEQA 4BCJA 4P90A 3CD8A 1GOLA 4NW6A 3DU8A 3EQGA 5E8XA 5CAQA 4G6NA 2C5YA 3OT8A 3RK9A 5HORA 1ZXEA 5E8VA 4G16A 4H3BA 4IFCA 4IX3A 5CQWA 3ZDIA 4CCUA 2XKDA 3NGAA 2QODA 3KY2A 3U6IA 4FYOA 2R7BA 3MSSA 4QTCA 5DR6A 3UOLA 2X6EA 4BBEA 5BX0A 4IAYA 4WBBB 4JDIA 4ACHA 3P78A 4ASEA 3PY0A 4D4YA 4WRSA 3QRUA 4C59A 3QQGA 3FZTA 3QTXA 4L42A 5I9YA 2W5BA 3UNKA 4D9UA 5ACKA 3FMKA 4HJOA 3N4TA 2UZNA 2GNIA 3SGCA 2OZAB 4BTJA 4K9YA 3MN3A 3QTWA 5IA4A 3I1AA 2CN8A 2ESMA 5F94A 2RL5A 4FSUA 4J96A 3R8PA 4ZMFA 4W9XA 5KCVA 3P1AA 4IAIA 2DYLA 3MWUA 3G6GA 5E1EA 1DAYA 1YXUA 2BROA 3H0YA 4Z7GA 3E8EA 2WMWA 1CKPA 3AMYA 2IW9A 5A6NA 2I0YA 5K0KA 5CVFA 2XVDA 1G3NA 4QRCA 5EQPA 4XOYA 2PMIA 3ZOSA 2PPQA 1OECA 1O6KA 2QG5A 3B8QA 4F7SA 2YM6A 4TW9A 3W2RA 4D5HA 2WQOA 4DFXE 4GW8A 4O96A 4NH1A 3QRKA 3VIDA 4LOOA 3UGCA 4I4FA 3ATSA 3AMBA 3HRCA 3ORPA 2QG7A 3PTGA 3MIAA 4J8MA 4HCUA 4ZTLA 3TZ8A 2ITNA 3TIYA 1SVEA 2CKEA 3V5JA 4F0FA 1NW1A 4M84A 4L43A 3GENA 3R8UA 1UU7A 3M2WA 3W18A 4ALWA 5JRQA 2IZSA 5KZIA 4XG7A 4TKSA 5ETCA 2YZAA 1R39A 4K33A 3R9RA 4AZSA 4OTIA 2WQNA 4XP0A 1PMUA 4L7SA 3UQGA 4ZLOA 5CQUA 2W5HA 1YI4A 2V0DA 4U81A 2G2IA 4QNAA 4UMUA 4DITA 5BUEA 4D2PA 5CF5A 4RC4A 2HENA 5AP2A 3BYOA 4BIBA 3RPYA 3G9NA 4YU2A 5CYIA 3PLAE 1Y8YA 4UMQA 4XV2A 4RQVA 2OXDA 5AP4A 3OEFX 3KFAA 5E8YA 4A9YA 1BX6A 3EMGA 1NXKA 3F6XA 3MTLA 5J9LA 4ZMEA 1U59A 5M44A 2VTRA 3QGWA 5HTIA 4JIAA 4DEIA 5KE0A 2W17A 4QP1A 2IVSA 2JKOA 4PL4A 3UQFA 2O5KA 4H36A 2PUUA 4IWQA 1FOTA 4YZMA 5C4LA 3ODYX 4E4MA 5KMMA 5AX9A 4XNEA 4YJTA 2R3GA 3FMMA 4O91A 5IQIA 4IW0A 3NW5A 3FY2A 2GTMA 2W1ZA 4BCHA 3QCXA 4F6WA 3DLSA 5CU4A 1IAHA 2JBOA 4P7EA 4F1TA 3F2NA 3F5XA 2VTMA 3GB2A 2C5VA 2UVZA 1XHAA 4KB8A 3GU6A 3MVLA 4YJOA 4H3QA 4PUZA 5A9UA 4MXAA 4I6FA 3CS9A 5AV2A 5BMSA 5H3QA 4GT3A 3P7AA 3KXNA 4Y5QA 5IDPA 2QKWB 5HBJA 2ZB0A 1YDSE 2XK9A 3KRRA 3OT3A 5GZ9A 4UBAA 3V04A 4X6RA 1K3AA 4WOVA 5FP6A 4DH5A 3A4OX 5JGAA 3NR9A 3FZPA 4JRVA 5DVRA 3T9TA 3BX5A 1URCA 1J1CA 1H28A 1BL6A 4YTIA 1WFCA 4BCQA 4IQ6A 4FKOA 4N4SA 1APME 4BL1A 1WMKA 3FMHA 2OF4A 3ZFXA 3F69A 4AU8A 3RPOA 2BFXA 1YXVA 4ZTQA 2C0TA 5BYLA 4XRLA 2GFCA 3UO4A 5EW9A 5J1WA 3H9RA 2OXYA 3DBCA 4L6QA 1DM2A 4MNFA 2GS6A 2WXVA 3AC3A 4ZZOA 1OGUA 1ZY4A 2Z7RA 3BU5A 4RX8A 4UWYA 1U54A 3EFKA 3VF9A 4RFMA 5H8EA 2J4ZA 5IMEA 2J5EA 4FE2A 3MH1A 4GS6A 3CTQA 1H07A 4C3FA 4F9BA 5HO7A 2UW3A 5DMZA 5E1SA 4ANLA 4BGQA 3OCBA 3DS6A 3PY3A 4KWPA 4CG9A 4FTJA 4ZTSA 4FIHA 5HG9A 5EM6A 4O0WA 3WZUA 3OWKA 4D2WA 3P08A 4JDHA 1VZOA 2GS7A 3BIZA 2A27A 4I1ZA 4EH7A 1YXXA 3EFJA 3TCPA 3V5PA 1UWHA 4YHTA 3KXGA 3ORXA 2C6OA 5T3QA 4OTQA 4GYGA 4EC9A 2Z7QA 5AIRA 5JFWA 4WT6A 3FI3A 5CWZA 3HKOA 3W2SA 5LQFA 1SMHA 4BCMA 4RC2A 5AM6A 4BGHA 4S32A 5C26A 3ZBXA 3UOJA 3PA4A 5LVOA 2WELA 5A6OA 4D5KA 2VTQA 3LOKA 4RIYA 3D5XA 5JGDA 1UKHA 2B9HA 4FTLA 3ZLWA 3CIKA 2YCRA 4ACMA 2W4OA 4ALUA 4BTFA 4BDJA 3ZUVA 3F2AA 3FKNA 5CSHA 3NUAA 2AC3A 3NPCA 3OUNB 3G9LX 4IC8A 3WYXA 2WQMA 1Y8GA 5E8UA 2VWUA 4QOXA 3KA0A 5KKRC 2RFEA 4KIQA 4QQCA 4QMPA 3PDTA 4PDOA 4C8BA 4TWPA 3EB0A 1M52A 3ORNA 2JDTA 1OPLA 5A4QA 2YIWA 1VEBA 4LGHA 2R4BA 2GNLA 4WNOA 4X2NA 2UZBA 3ZO1A 4DEEA 5LWNA 2VTTA 4AS0A 4C02A 3OCGA 1RJBA 3RAKA 3TV7A 1MQBA 2BALA 3PY1A 2G2FA 1Q5KA 3D7TA 1Y6AA 3TNIA 2UZTA 1ATPE 5B0XA 1MRVA 5DIAA 4LV8A 3SD0A 1O6YA 4BDAA 4C38A 1JNKA 2BIKB 3LCKA 3CBLA 2C6MA 4QPSA 4U43A 2W1GA 3TXOA 4EBWA 4QPAA 2FGIA 2YM8A 3ZCLA 5KHXA 3IDBA 3I0OA 4L3PA 3QD2B 3IK3A 4IM0A 1M14A 1YHSA 1I09A 4BDGA 4FKRA 1REJA 2X8EA 4WG3A 1QL6A 4C2VA 4YPSA 4PF4A 3R8VA 3PRFA 3ZLSA 4RIWB 3VC4A 1ZMVA 5DGZA 4ERKA 2UW8A 3ODZX 3T9IA 2PE1A 2UW9A 4RMZA 3KCFA 4TNDA 4MBJA 2DUVA 2XK4A 3BBWA 3R1SA 4FSNA 3K3IA 2VO0A 2Y7JA 2OJ9A 1ZZLA 3MH0A 4IXPA 4FTOA 5DR2A 3AD6A 3R2BA 4JRNA 3W2CA 4RIOA 2CNUA 4U7ZA 3A60A 3L8XA 3VN9A 5IA5A 1FMOE 3OWPA 5HVJA 3QLFA 2GHLA 5FEEA 3OZ6A 5CAUA 1M7QA 3Q5ZA 4AQCA 5AWMA 1E1XA 3BELA 3CP9A 4I0SA 5DPVA 4P2KA 2YDIA 4PP7A 5IA2A 3QUPA 4IMYA 5J7BA 4I5HA 3CC6A 4OLIA 4DLJA 1X8BA 4RJ4A 3F61A 4UALA 2ITTA 4CXAA 4QQTA 3EQRA 4MWHA 1JBPE 2X9FA 1H25A 3CQEA 2RFDA 2WTDA 2B9JA 5M57A 3I6UA 4RG0A 3SHEA 4FL1A 4DH7A 3AT3A 4L3LA 4NUSA 2JDVA 4FSTA 4RJ8A 4XP3A 2UZOA 3VS5A 3WYYA 2XM8A 2VUWA 3O96A 2Q0BA 3O0GA 4JX3A 4RFZA 1CKJA 3EYHA 4CKIA 5FXQA 3PXYA 4UMPA 4DA5A 5JQ5A 1NVSA 3RK5A 4A4OA 4O7YA 2OU7A 3CSVA 4GMYA 3NUNA 1YDTE 1OZ1A 4EBVA 5I3RA 4GKHA 5DT3A 2A0CX 5I5ZA 4YLKA 4I5CA 1OKWA 5C8KA 5CANA 1O6LA 4PMMA 4CFVA 3TNHA 4E6CA 3FMJA 4OTDA 4WHZA 4GG7A 3QWKA 2Y0AA 5AP6A 3QZFA 2XIYA 4LOPA 5EKOA 2VTHA 3IW4A 4RZWA 5CU6A 2C6DA 2E9UA 4AW0A 4YP8A 5ITAA 4XBUA 1MQ4A 5J1VA 4B4LA 4FT0A 4FZFB 5J95A 5CS6A 4R5YA 2XA4A 4DYMA 1YOJA 3EFWA 1I44A 4Q5EA 2WIHA 1OL1A 4I3ZA 2XB7A 4WNPA 5TO8A 5EW3A 4AT4A 4F09A 1PXLA 3L9LA 4HYUA 4K18A 4TNBA 5BVDA 4X3FA 5H8BA 4D4SA 4P4CA 3E93A 3MFSA 2BRHA 1PKDA 3ZS5A 3B8RA 4DT8A 5F95A 2IVVA 3ZO4A 5I3OA 4E20A 5KKRB 4I5MA 2Z8CA 4AXAA 1ZMWA 3CKWA 2I6LA 5ANEA 4EI4A 4USFA 3EQFA 3R63A 3PIZA 2HZ0A 2PE0A 5K9IA 2J2IB 3PXQA 4KRCA 3AD4A 3UVRA 4C36A 5HO6A 1B39A 1Y6BA 5KO1A 3DGKA 3E87A 4QMZA 4FV1A 4ARKA 1ZY5A 4BKZA 2Z2WA 4F08A 3LFFA 2PZIA 4FG8A 2A2AA 3ZONA 3QQHA 3UBDA 2F9GA 3W1FA 3DZQA 3HA6A 5IH4A 4X2KA 5FEDA 3NNVA 4FSMA 3A7IA 4JG7A 3O2MA 2ITWA 4B8MA 4GK4A 3QHRA 4MEDA 2PL0A 5DT4A 4D0XA 5FRIA 2FVDA 1ZYLA 3JPVA 1PXMA 2ONLA 3DJ6A 5CVHA 3PJ2A 3T3VA 1LEWA 1K9AA 2OJJA 5KBRA 2XH5A 4GCJA 4FZ7A 4HVSA 3JVSA 5B2MA 4OAVB 2VO6A 2X2MA 4G2FA 4HW7A 5A14A 5A4CA 4WO5A 5IEYA 2GFSA 4IB1A 2E9PA 5TKDA 1R0PA 1JKSA 3S2PA 1Q3DA 4DFBA 3Q4UA 4L9IA 2Z60A 1MRUA 4GJ2A 4LRKA 4QNYA 3P79A 4HYHA 4JG6A 3VAPA 3OEZA 5LVNA 1Y57A 1E1VA 5BUIA 4MVFA 3VUIA 3P0MA 1IR3A 2FO0A 5F9EA 4HVIA 1QPDA 1LEZA 4FGBA 2JDOA 3SQQA 3PSBA 3KKVA 5GNKA 1CDKA 2X7OA 2W4KA 3QTZA 4EOOA 5BPYA 3ZEPA 3QD4A 4MBLA 1OKVA 2QLQA 2G15A 4FIIA 5AP7A 3PA3A 3FL4A 4NTTA 4BHNA 3OXTA 4NIFA 3F3UA 3A7JA 3FZ1A 5EM7A 2ZMCA 4TTHB 2HZIA 3R1QA 4O0VA 4QP3A 3Q04A 3FL5A 4YSMA 2J0IA 2QI8A 2HY0A 2X6DA 1UU3A 3D5UA 1XH9A 2UZWE 1YXTA 3UIUA 5CZHA 4D2RA 4DGOA 3E7VA 3MY1A 4FYNA 4TWCA 2VWBA 2JIVA 1OKZA 3VW6A 3LE6A 4QP4A 4BHZA 2JD5A 1W84A 3LVPA 3VJOA 3LIJA 5EYKA 4BCPA 4RT7A 3ZHPC 2LGCA 4DTKA 2Y4PA 3VRZA 4AW5A 1FGIA 5J5SA 1ZYCA 4KBCA 4ANQA 4PTCA 3EJ1A 2FSMX 4BDHA 4Q5HA 4M15A 3MW1A 3O50A 4FG9A 4XG3A 4FX3A 1QCFA 3N9XA 4YO6A 4V04A 2XJ1A 4O7VA 5EQEA 3L9MA 4FIFA 3Q32A 4TY1A 1BYGA 3ZFMA 3SW7A 1PYXA 4H05A 2QU6A 3HRBA 4AACA 3LMGA 3BV2A 3DKCA 3OBGA 2XYNA 4YJQA 4CMUA 1OUYA 5HLWA 3OMVA 2ZVAA 3ACKA 4L46A 3Q6UA 5KBQA 4RVLA 5LJJA 1M2RA 4FSRA 1ZOEA 2CDZA 3ZRKA 3W16A 2XK7A 3VULA 2ZJWA 2CGUA 4YNOA 3H4JA 4MCVA 5HLPA 3LCSA 4MTAA 3RNIA 4C34A 2QO2A 5AR3A 2VO3A 4I6QA 3IGOA 3QFVA 3FE3A 1J7UA 4BYJA 5CX9A 3BLQA 1UNGA 3NUSA 3JVRA 1HOWA 4HZSA 4ACCA 5D9HA 2YHVA 3HV6A 3VUHA 2P4IA 3WE4A 1XBCA 3DAJA 3Q3BA 4EOMA 4FEWA 2WKMA 1GY3A 3FLWA 3I7CA 4ENYA 5IA0A 4F99A 4IANA 4UV0A 2XJ2A 4FZ6A 2ZB1A 2YIYA 2OK1A 3KXZA 3R2YA 4BTKA 4UXQA 3IO7A 2C3KA 4O1OA 4ACGA 3F3TA 2C4GA 2OGVA 4N70A 5DEWA 4AOJA 4QYYA 5I0BA 3UQCA 5AUZA 3FI2A 4GFOA 1OBDA 4E7WA 4XLIA 2A1AB 4LV5A 5FDPA 4KIOA 1H27A 2YFXA 3MFUA 3ZXTA 3SOAA 4IAFA 3ZYAA 3EIDA 5M55A 4CV8A 5C9CA 2PVHA 2UW0A 3AC4A 3E8CA 4YZ9A 4FTIA 3MVHA 3TKUA 3ZO3A 3KF7A 1JVPP 3H3CA 4O27B 2OH0E 2C6IA 4YZNA 1UV5A 3QTSA 2PULA 2YAAA 2J5FA 4UYAA 3RAHA 2F57A 3GOPA 5FEQA 3PVWA 2P2HA 4GUEA 1S9IA 3D9VA 2C6LA 3HLLA 4MQ2A 4B6LA 1Q62A 4KUJA 5TT7A 4IX5A 5M06A 4KS8A 5I9ZA 3TL8A 3K54A 5DI1A 3TN8A 5L3AA 2WU6A 3HYHA 3BE2A 3NDMA 3OCSA 3SVVA 2VO7A 4FV8A 5KMKA 1FPUA 2QHMA 2A4LA 3H30A 4X0MA 3ATTA 3LMIA 4Y85A 5I9XA 2X2LA 2BKKA 3K5UA 4K6ZA 5TOZA 3V6RA 4K8AA 1H26A 5HEZA 4XG4A 4Z3VA 4Z55A 4AE6A 4EJNA 3ACJA 4FKLA 4IDTA 3F2RA 5JFVA 3AC2A 3BHYA 3EN6A 4F70A 5IH6A 1WCCA 3F3WA 3HDMA 3KGAA 3OROA 3QD0A 4QQJA 4BRXA 4R7BA 2OZAA 3FDNA 5FXRA 4GEOA 4S30A 5HLNA 3LJ0A 2ZM3A 2FSLX 4J7BA 5HD7A 3FAAA 3IS5A 4FSQA 2B9FA 5M07A 2EXEA 2XM9A 4FMQA 2F4JA 2ZM4A 3UNZA 4DGLC 3OP5A 3SXSA 4O81A 3IOKA 1H1RA 2XIZA 2ITYA 3EL8A 3DA6A 4EK3A 2YA9A 3NNXA 5HE0A 4F6SA 2YZLA 2BZHB 3R7VA 4I93A 1SZMA 2WO6A 2ZV7A 4U8ZA 1SNXA 4DH3A 5C8NA 3QLGA 2R3RA 1YRPA 1KSWA 3F7WA 4JI9A 4D2SA 2O64A 4RJ7A 3R04A 2RIOA 1JKLA 5EQYA 3R1YA 3KXHA 5EI6A 4F0GA 5E9EA 2OI4X 2V22A 2OIBA 4NT4A 3VW8A 4EOIA 1BKXA 3Q9WA 2H6DA 2WAJA 1FVTA 2VD5A 2FH9A 3CY3A 2B54A 1BMKA 5DA3A 2O8YA 2W1DA 1G8SA 4CCBA 5I4NA 3QQLA 4YJNA 1WBVA 2C47A 3DDQA 4PTGA 5D41A 5EK7A 3C0GA 3D7ZA 3FKOA 2YISA 2FYSA 3OTVA 3PUPA 4IVCA 4IZAA 4AFEA 3LFSA 4DFZE 3DBFA 3E3BX 2VTAA 3ZTXA 4C61A 3VO3A 3VBXA 4A9UA 2CJMA 3UPXA 3BI6A 4IX4A 2QVSE 4GK3A 4O7ZA 4PNIA 4D58A 5HGIA 4ZTHA 2C6TA 3B2TA 5AR8A 4KNBA 3BPRA 4MNEB 4A07A 2VX3A 4IEBA 4BC6A 1CTPE 4EK4A 5HKMA 3MY5A 1CSNA 3VS2A 5CASA 3ID6C 4CQEA 1PJKA 4DH1A 2R3QA 5HTBA 2O0UA 4H39A 4NCTC 2XF0A 3E92A 5GZ8A 3O17A 3O8TA 4L53A 4PMSA 3TG1A 4I21A 3HMMA 3U4WA 3NIZA 5CTPA 3RWPA 3NUUA 4MX9A 3BGZA 3KK9A 5JFXA 1Q99A 3SRVB 4EOPA 1BL7A 1KV1A 4FKTA 2G2HA 3GUBA 2I0HA 2ZYBA 3CKXA 4JVGA 3A61A 1JSTA 2GNHA 1YHWA 4XOZA 3HL7A 5B2LA 4FR4A 3SLSA 4D4VA 4UZHA 2OF2A 3QYWA 4ZXTA 5LCJA 1U5QA 2JKKA 4R3PA 2WTKC 3TV4A 2NPQA 3ZM4A 4D55A 5FTQA 5JMSA 3Q4TA 4QMWA 4DEDA 1K2PA 3Q4CA 1OPJA 2GQSA 2R3KA 3E5AA 4NJDA 4LFIA 3UIBA 3ZRMA 3LW0A 3QRTA 1XH4A 1YI6A 4FIEA 3NRMA 3QXOA 4XCUA 3VQHA 3L8SA 4M97A 2NNWB 4C2WA 2HW7A 4APPA 3TV6A 2BZKB 2J9MA 3KRXA 2BHEA 1XO2B 3KL8A 3MGYA 4HGSA 5FBNC 3AGLA 3EN4A 4C57A 4I20A 4U3YA 4FA2A 4G1WA 4FT3A 3UMXA 3HNGA 3UZTA 3GU7A 3Q4ZA 4C4JA 5AV1A 4IE9A 4ALVA 4O7NA 2JGZA 4QMLA 3V8WA 3ENMA 3ORTA 4O21A 4M69B 4O0SA 4OTHA 3QUEA 5KMOA 3ORLA 3Q5IA 2BPMA 3UZRA 3TKHA 3NAXA 4IDVA 4F9AA 2VAGA 5K5XA 3E62A 4O7SA 3I0QA 5ANIA 2PSQA 5KMIA 5EOLA 2BDJA 4EH3A 2WMUA 1H0VA 1HCKA 4ITJA 2JDSA 3R8LA 4R8QA 3GC9A 5F1ZA 4LOQA 2W99B 3E64A 3BEAA 3FPMA 4KKEA 4Y83A 5C8MA 4TWNA 2EB2A 2E9NA 3KULB 3ULIA 3RHKA 1W0XC 3HV4A 5BNJA 5GJGA 3OD6X 5DWRA 4ZSGA 4EQCA 4O22A 2J0JA 5JGBA 4ACDA 5KZ0A 3MYGA 5JT2A 5E8TA 1ZRZA 3ORKA 4JL9A 2IG7A 4KKHA 3O7LB 1L3RE 2BRGA 2WU7A 1B6CB 2HIWA 5CNOA 3ULZA 5AEPA 3C4XA 1QMZA 4E5BA 2W0JA 4UB7A 4RIXB 3OUKA 5EFQA 3VBWA 5LMBA 3FV8A 4FEQA 2YABA 3F5PA 3G51A 3QAME 4MH7A 4Q2AA 2F2CB 1JPAA 3PP0A 3GCSA 3OW3A 1GJOA 4IWPA 3WF5A 4LGGA 4IFGA 4QMSA 3HDNA 4FOCA 4I6HA 1U5RA 3QKKA 4FUYA 5CEIA 3VUTA 3TEIA 4AGUA 4CFFA 3T3UA 2KTYA 3I5NA 2IW8A 3COIA 5D7AA 3TZMA 5CF4A 3QA0A 2QKRA 5LVPA 1PXJA 4K77A 3WF9A 3FSFA 4H1MA 1OIUA 3U51A 2W06A 4WSYA 2YM7A 5HD4A 3A7GA 3LLTA 3AOXA 5HNBA 3RZFA 5CEMA 3ORIA 4ZTMA 4R6VA 1AQ1A 3K2LA 3NYOA 4RA4A 1H1PA 2PMOX 3FMNA 4XV1A 3ELJA 4QP8A 4RSSA 5JZNA 3FYJX 3S4QA 2GMXA 4S31A 2WMBA 1KE5A 3EN5A 5IISA 3P7BA 3SC1A 1PRYA 4CGAA 3LFBA 4XBRA 1H8FA 2PVNA 4FEXA 3QQUA 4LUEA 5T68A 1QPJA 5CSVA 4AW2A 4J71A 2PUIA 4C58A 3QALE 3KN5A 4UZDA 5EI2A 4JNWA 4D4RA 5M08A 3V5TA 2VWZA 3ROYA 2I7QA 3NVMB 2F7ZE 3FHIA 3G5DA 4ZS0A 3SOCA 5J7HA 4FEUA 2YM4A 4N6ZA 4V0GB 1JKKA 3Q9ZA 3ZZEA 3R7OA 3VWAA 4BWXA 4ZSAA 4LI5A 4M68A 2BRMA 1JAMA 2WNTA 4JBPA 4IB3A 2OJIA 2WPAA 4BF2A 3FLYA 4O6EA 3ERKA 3I79A 4G3DA 4C4HA 3QCQA 5DH3A 2H34A 2CGXA 4N0SA 3DY7A 2QURA 3M11A 4DEHA 2OG8A 4YBKA 2J51A 2UZDA 2ERZE 2X8IA 3AC1A 3W10A 3M42A 4D1SA 2BTRA 3PJ3A 4YZBA 5IH5A 1YXSA 1DI9A 3U8WA 4NZWB 3H9FA 4RIWA 4EWHA 2VNYA 4CZTA 3R83A 4JDKA 3GOKA 1BLXA 5FQDC 1NT2A 4G31A 3NUPA 4J52A 3ZSHA 4WNKA 4HCTA 2CKPA 3FYKX 3MFRA 4R1YA 3WZKA 1XKKA 5K5NA 3EKKA 3QU0A 4Q9ZA 4BCOA 2IVTA 4FTRA 2OW3A 2QOCA 3ZO2A 2O63A 1HCLA 4FI1A 4PQNA 2XEZA 3EWHA 3TTJA 1IA9A 2UVXA 4RWKA 3I60A 4HNIA 3UG2A 4G3FA 2XKCA 1KV2A 4V05A 3MH3A 3MPMA 2WMQA 5H9BA 2OO8X 2HZ4A 4M13A 3RP9A 3VNTA 4EZ3A 3OG7A 2HAKA 1PY5A 3N4UA 3PPZA 3Q2JA 4AOIA 1OL6A 3GQLA 4CLIA 4KSQA 2C3IB 2OLCA 2BCJA 4Q9SA 1GZ8A 4GIHA 4X3JA 1YW2A 1WBSA 2WEVA 3BV3A 2HY81 2VTLA 2R0UA 3CGOA 2WTIA 4K2RA 4BTMA 1ND4A 2ITXA 4CZYB 1KE9A 1P4FA 1V0PA 1VYWA 3EOCA 4FV4A 2QOOA 4HGTA 2YIRA 3QTRA 4H3PA 1PMVA 4BDEA 4BKYA 5GINE 4XJ0A 5HI2A 4MXCA 2CHLA 3R8ZA 2QU5A 5TR6A 1YDRE 2PVKA 2VU3A 4BYIA 4RWJA 4X7QA 5KNJA 4U3ZA 2Y6MA 2YN8A 3ROCA 2QONA 4ONAA 5CSWA 4EOJA 4OTPA 5BVKA 3WI6A 2UW5A 4DTBA 3DKGA 4FV6A 4MXZA 4APCA 2P0CA 3DDPA 4FKGA 4C3RA 1OBGA 3JUHA 3NAYA 1SVHA 2NO3A 2BMCA 2ITQA 2CGWA 4FTUA 4AZWA 5JK3A 4EQUA 5C4KA 3HP2A 3VF8A 4KS7A 2W5AA 4NU1A 3DB6A 3ETAA 3M1SA 2WOTA 2W1CA 1WBOA 4GSBA 3COHA 3UE4A 3KEXA 3UNJA 4RFYA 2UUEA 2GDOA 3L1SA 3OY1A 4JAIA 3C4ZA 3NX8A 2CPKE 3BYSA 3QQFA 4FIJA 3UPZA 4EJ7A 3POOA 4FKUA 1PHKA 3FWQA 4RZVA 4FTMA 5CT7A 4E26A 4R5SA 5BVOA 3G2FA 4NJ3A 3P23A 3UDBA 2AC5A 4AT5A 4D0WA 4XUFA 3O51A 4GL9A 4P5QA 3GI3A 4O6LA 3ZEWA 3U55A 5A54A 3R7GA 3KREA 4W4WA 5HHWA 3TJDA 1WZYA 3KCKA 3BEGA 4USDA 1GZOA 3R9DA 4D1XA 3VBQA 4A4LA 4E1ZA 3EHAA 3MDYA 4OTFA 3UODA 4IVAA 3O23A 1SYKA 2UW4A 4QMTA 3P9JA 3N4VA 2RG5A 4FGRA 1WVWA 4C35A 1KE6A 3EYGA 4Y8DA 3VS6A 2QO9A 3UO6A 5IZFA 3IONA 1ZARA 3Q60A 3QX4A 4WG4A 4MXYA 4GU6A 4E73A 4EEVA 3C9WA 2BVAA 5HIBA 4U42A 1XR1A 5M53A 3MESA 4BBFA 3C51A 4JXFA 4QP9A 3P5KA 5JEBA 4M3QA 3QTIA 4I41A 4IC7A 2XBAA 3DFCB 4CV9A 5CSPA 2ZV2A 4FKIA 1REKA 2HK5A 2PZPA 4FVQA 2XIXA 4E4LA 1U4DA 1EH4A 2YWPA 3PVBA 5FP5A 4R3CA 4YLJA 4F7NA 5IA3A 3V8TA 4AOTA 3KRLA 5ICPA 5IQFA 4FKPA 3ORZA 2XP2A 3OFMA 4YC6A 2QOLA 4IZ7A 4RQKA 4R7HA 1M7NA 4AA0A 2PVRA 3LFCA 4XH6A 3UIMA 4QMXA 3U6JA 4YTHA 2G9XA 4HGLA 2C5NA 3DBQA 2ACXA 5FM2A 2KULA 3ZLXA 4ANBA 2YLEA 4WUAA 3MTFA 5EHOA 5FXSA 2BFYA 4R7IA 4TYGA 3TJCA 4IADA 4PL3A 4ZY6A 2F7XE 2OJGA 4MAOA 4HYSA 5L8JA 3V3VA 4U80A 4RGJA 5ANJA 2P3GX 3FUPA 5LARA 1G5SA 4EC8A 3CPBA 5ACBC 4M0YA 4L7FA 4I0TA 5I9UA 3LFNA 3HVCA 4U40A 4NWMA 2OIQA 4UEUA 1FQ1B 4BWPA 3AG9A 1GZKA 1ZYDA 5HVKA 4DBXA 3EZRA 3PPJA 4DBNA 2ITVA 5JQ8A 3KC3A 3OHTA 4AFJA 1H01A 3TIZA 4PRJA 4A7CA 2VV9A 3GQIA 5A4LA 5E8SA 4B8LA 4EWQA 3FMDA 4DG2E 1GZNA 3AC5A 3RINA 4K11A 4OW8A 1T45A 4RX9A 5J9YA 1FBNA 1IAJA 4NEUA 4RX5A 4DEAA 2BDFA 2WZJA 3GFWA 3PVGA 2WIPA 4GVJA 4KIKB 5BUJA 5C01A 2VTSA 4NYEA 2Q0NA 4DFLA 4EONA 2Z02A 2ZMDA 4PWNA 3LM0A 4FNWA 5L8KA 1CMKE 4YJSA 5ANOA 2QOKA 4BCIA 2E9VA 3TNWA 4J95A 4I94A 3FXWA 2RFSA 2LAVA 3RM6A 3TDWA 2C6KA 1NVQA 2G01A 5E8WA 5DBXA 3OW4A 4Y46A 3BLRA 5AR7A 4GH2A 4PP9A 3QZIA 3E8NA 3D83A 4MWIA 3R30A 3ZUTA 1FMKA 4EYMA 2OKRA 5AA9A 3RKBA 4MQ1A 4CFNA 4U0IA 1Q8UA 3GNIB 5CI6A 3D2KA 3DQWA 4O86A 1GIHA 2W4JA 4QYHA 5CU3A 5L2QA 4HOKA 3QTQA 4WRGA 5LCKA 4CLJA 3U4UA 4CKJA 3PRIA 4DTAA 4CMTA 2X39A 2Y9QA 3LAUA 4AT3A 3F88A 1W8CA 3CQUA 1H0WA 1NVRA 1ZYJA 3EQBA 3FPQA 3K5VA 3DLZA 4QTEA 4BN1A 3Q9YA 4YHJA 5CEOA 5HX6A 3HMNA 4ZJVA 5ETFA 3ZC5A 5CENA 4BDFA 2QOBA 2CNQA 3PP1A 4W4VA 4RJ3A 3DCVA 4FC0A 1J1BA 5AUYA 4RRVA 3VS0A 4L67A 2YERA 5D10A 4BICA 4O38A 3KVXA 4L3JA 4U6RA 3H9OA 4IZ5A 2PVLA 4LMNA 4O0TA 2PVJA 1V0BA 3QYZA 4AN2A 5DYJA 4YSJA 4OT5A 1V0OA 2JAVA 3LQ8A 3A8XA 3CD3A 3Q52A 4QP2A 5AP0A 3W33A 4C4IA 2XS0A 4E4NA 3H0ZA 4S33A 1PXPA 4FV5A 4ANSA 4OR5A 2XKFA 4BIDA 2CSNA 5LMKC 4O7WA 4IB0A 4X6QC 1KE8A 3GC7A 3FC2A 3QC9A 2R7IA 3QWJA 2YDKA 3QD3A 2VNWA 4KD1A 2EB3A 2XBJA 4M7IA 4W4YA 3TM0A 3W2OA 3I4BA 2CLQA 2VTOA 3NWWA 3ZC6A 3QHWA 1SM2A 2XNOA 5H8GA 4CTCA 4WG5A 1BI7A 2Y6OA 5AV4A 2EXMA 3KMMA 4QYFA 1J7IA 5D12A 3ZM9A 1E9HA 4U45A 3A8WA 5JSMA 4S34A 5DE2A 3RPSA 4ZSLA 1CM8A 1JQHA 4LRJA 5DRBA 3RAIA 4L44A 3R9OA 3ZRLA 4G6OA 5EG3A 5JRSA 4F65A 3EQPA 3BZ3A 4ERWA 5TF9A 4FV7A 3DB8A 2J0LA 5I9VA 3QC4A 4FV0A 5FGKA 4HGEA 4CYJA 2HWOA 4ZZMA 2J0KA 2E2BA 2P55A 4EOQA 4YMJA 2QOHA 2R3NA 2RKUA 2R2PA 2JBPA 4MXXA 4I4EA 3QA8A 1XH8A 3TTIA 2JFLA 1OIRA 5DRDA 5EH0A 5HU3A 4FICA 3CE3A 2GCDA 5EM5A 4QMQA 4XV9A 3DAEA 5IU2A 5CEQA 3DK7A 3R71A 2UZUE 2CKOA 4CEGA 5BYZA 2I0VA 4AF3A 4XYFA 3R9NA 4AZEA 1BI8A 2OH4A 2H9VA 4MBIA 2J6MA 3HX4A 3SV0A 3FLSA 3JR1A 4BGGA 1ZWSA 2RFNA 4BDBA 5AP1A 4FVPA 3NLBA 5DFPA 5HG7A 3A7FA 3BE9A 4DGGA 5KMLA 5LWMA 3LKMA 1Q8WA 4E5WA 5IF1A 2IZRA 4NKSA 3SDJA 3BHHA 4GUBA 3WIKA 1GNGA 1OIQA 5AUTA 2GNFA 1T46A 3R02A 5J87A 3TACA 3QL8A 4GU9A 4YO4A 5AAGA 4O84A 3VS3A 4TWOA 2H96A 3QTUA 5FD2A 4EHEA 3COMA 5AJQA 4DG3E 5CF8A 3F82A 3RI1A 3P7CA 4OBPA 3WZJA 4RLKA 4ASDA 4JS8A 5F20A 4YC8A 5EDRA 1OL2A 3JYAA 4BCKA 4LG4A 4QMVA 1S9JA 3CEKA 3FQHA 4A9SA 2WQEA 3NSZA 2R3MA 3QCSA 5E7RA 2PYWA 4FV2A 4KBKA 3PJCA 3NCZA 4Z7HA 5EDPA 3QUDA 3LMHA 5ANDA 3V6SA 3C5IA 4IACA 3U87A 4BVUA 2GSFA 1IA8A 2WB8A 2PZYA 3ALOA 5CAVA 3UO5A 3OWLA 5K4JA 4JR7A 5LVLA 3VUKA 4YNEA 5AAEA 2BIYA 4ZEGA 2QQ7A 3LJ1A 4F0IA 1BUHA 4I22A 4O7RA 4MNEA 2XK8A 3ALNA 2CMWA 3FXZA 4IVDA 4UY9A 3O8PA 2IVUA 4JOAA 4RVKA 5JZJA 1PXIA 3RHXA 2IPXA 3PZEA 3IW6A 4TYHB 4BFMA 4W4XA 4AW1A 2B55A 3KB7A 4B0GA 2W1HA 4OGRA 2FUMA 3RCDA 4FKQA 4TYEA 3CLYA 3S3IA 4D2TA 1J3HA 3FLNC 4ASXA 3G0FA 3E8DA 3NIEA 3LJ2A 3LXKA 5BQ0A 4QMYA 3TNQB 2O3PA 3HAMA 2ZOQA 2BR1A 4GRBA 5CF6A 3DXNA 4EK6A 3SRVA 3L8PA 3EZVA 1UU8A 4JIKA 4CFWA 2QHNA 4IX6A 3HUCA 3CXWA 3C7QA 1FGKA 4L68A 4AZFA 4BI1A 1FINA 2GS2A 3R28A 3LM5A 5FTOA 3BBTB 3NYVA 4MD8E 3ZU7A 4CFXA 1W7HA 4O1PA 4HVHA 4O83A 4R78A 1M2QA 1GIIA 1OMWA 3BQRA 2GU8A 3HV3A 4GG5A 2Y8OA 4C4FA 3LCTA 4MYGA 2BHHA 2J50A 3KMUA 3ORMA 4GK2A 4NSTA 2YIXA 4BDKA 2Y4IC 4FBXA 4DC2A 4EHGA 2HWPA 1A9UA 1F3MC 2Z7SA 3PJ1A 4RLLA 2BDWA 1FVRA 3ZUUA 4BIEA 4E6AA 4M0ZA 1QPEA 2XMYA 3Q53A 3GC0A 3HMIA 4GYIA 1OVEA 3FI8A 2VGPA 3PA5A 5EYMA 5EHYA 5HIEA 3FY0A 1Y91A 3OWJA 4E8AA 4LUDA 2RSVA 2JIUA 2X0GA 5A4EA 5IQEA 4DCEA 3NNUA 4IZYA 2VTIA 3BWJA 4FNXA 4M69A 1JSUA 4LGDA 4LQMA 5M51A 4AA4A 3R7YA 3OXIA 3KVWA 2WMRA 5KX8A 1JSVA 3LHJA 5FUTA 3E63A 1Z5MA 5LVMA 4BI2A 2JDRA 1YI3A 4W9WA 3REPA 4RBLA 1ZYSA 4ZLZA 2ZV8A 1JKTA 3D14A 4DF3A 4R3RA 5HVYA 4I0RA 2OICA 1H1SA 3PG1A 2I1MA 3ANQA 4NM3A 5CI7A 3LFQA 2EUFB 2XNGA 2XZSA 3KULA 3C0HA 4YC3A 5E92A 3ZH8A 4HVDA 4EUUA 4KABA 3WOWA 3AXWA 2QR7A 2CCHA 3IG7A 5E90A 4WSQA 3PWDA 2J90A 3HECA 3HGKA 2BKZA 2ITUA 4FNYA 4RVMA 4TYJA 3UOKA 4BCGA 4O2PA 3BHTA 5KHWA 1JWHA 3AT2A 2YCQA 3A2CA 4RIXA 4F9YA 1YHVA 3QZHA 3PIYA 4CT1A 2XJ0A 1H00A 4C3PA 3DBEA 4ANOA 4HVGA 4O0UA 4XEYA 5CLPA 5CEPA 2WTVA 3KF4A 4J8NA 4QYGA 4WKQA 3RNYA 3WZDA 3TUCA 2I40A 2FSOX 2REIA 4B99A 2ETMA 3AQVA 2HOGA 3SXRA 1WBPA 3PJ8A 5AA8A 4QTBA 3HAVA 4MF1A 1IASA 4YUQA 1XBAA 4EH8A 5AUWA 4TXCA 1UVRA 3I7BA 3RBWA 3DKFA 3JY0A 3FZSA 1FVVA 2PVMA 5L2IA 3O8UA 2GNJA 4RWIA 3PXKA 3Q2MA 1W98A 4CRSA 1R78A 5ANKA 2C30A 5CSXA 4DG0E 5FTGA 1P14A 3HMPA 4ZTNA 2IO6A 5ANGA 4F9CA 5IEXA 3L9NA 4YJPA 5HOAA 3D5WA 4JJRA 3BRBA 3WF6A 3MY0A 3BYMA 4FODA 3NNWA 3OS3A 3PXZA 5J79A 2IJMA 5ETAA 1UA2A 3KN6A 4RJ6A 5EI8A 5EYDA 3VUDA 2ZDUA 3DV3A 3KQ7A 4L52A 5HE3A 3BGQA 4NL0A 2A19B 1XH5A 3PG3A 2VX0A 2O2UA 2PU8A 5IUIA 3THBA 3R7UA 5M4CA 4EH4A 1A48A 1XQZA 5AX3A 5IUGA 1Q97A 2WTWA 3WARA 3EFLA 4V0GA 3LXPA 1PF8A 3G90X 2XNEA 5EDQA 2PTKA 4NCTA 5KMNA 2C6EA 3O7LD 1XH6A 3QXPA 4QYEA 4UWBA 3FHRA 5D1JA 4FSWA 4FZDB 5AR2A 5TE0A 4OBQA 5CU2A 2PWLA 4HNFA 2C5OA 4WUNA 4QD6A 3FXXA 3WF8A 4IWOA 1TQMA 3EQIA 3IECA 3UG1A 3W55A 3AMAA 3DJ7A 2PUNA 1VR2A 2YCSA 1YQJA 3C4EA 4EK5A 4USEA 2W1FA 5HO8A 1F0QA 1V1KA 2YLFA 2XKEA 3OF0A 3R7EA 2B52A 3OBJA 1UWJA 4C4GA 3D94A 4TZRA 5DT0A 4FK6A 4KINA 4OUCA 2Y4IB 3BCEA 5CAPA 3VJNA 5B7VA 4RWLA 3C0IA 3MJ1A 4ZJJA 1PXNA 3BHVA 2OZOA 4I23A 5CAOA 5I9WA 3D2IA 3POZA 4NFMA 2EXCX 4FOBA 4FT5A 4GFMA 1YWNA 4OTGA 4YGAA 4ZSJA 4ZZNA 5K4IA 1GAGA 3TZ7A 3DBDA 4EQMA 1UKIA 2BZIB 1U46A 3FZRA 2JLDA 4AN3A 1OIYA 3BHUA 5JH6A 4HZRA 5M09A 5HCXA 2OSCA 4FG7A 1WBWA 2IWIA 3TT0A 4BY9E 2X7GA 3PLSA 3BU3A 5IKWA 4OTWA 5AUVA 3G6HA 1NY3A 2YWVA 3S1HA 4PTEA 5AP5A 3C5UA 5HU9A 3MA3A 1F5QA 2WMVA 1KE7A 3VRYA 4L01A 4M8TA 4B7TA 2RG6A 5L2TA 3CY2A 4RJ5A 3CQWA 3F5GA 3HEGA 5HCZA 4F7LA 5CALA 4JAJA 1M2PA 3MA6A 5DOSA 3E3PA 3RVGA 3RMFA 3SX9A 3R6XA 4WBOA 3OXZA 4L00A 3UZPA 3RJCA 3Q6WA 1CKIA 1R3CA 4IWDA 4CG8A 1P5EA 4LYNA 5HNIX 2JKQA 4YJRA 2HYYA 4ZJIA 3F66A 3TKIA 3FLQA 4C0TA 3GCUA 1QPCA 4W8DA 2V7OA 5AIKA 4ZSEA 2V55A 5G6VA 4CT2A 4EOSA 3V5LA 1G8AA 3VHKA 4CKRA 2UZVA 3DT1A 1YKRA 2CKQA 1UU9A 2C1BA 4EHZA 3LZBA 3ZBFA 2BRNA 3NYNA 1RQQA 2X81A 3B2WA 4PPCA 5DR9A 4F1OA 4YTFA 5M56A 4IAZA 4UYNA 4TYIA 3UYTA 4ANNA 4A9RA 4YJVA 5IUHA 2W9FB 2DWBA 3G33A 3IOPA 3RALA 4E4XA 3DXQA 2PZ5A 4IM2A 2C0IA 2C3LA 5HZNA 5G1XA 4HYIA 2BAQA 2B9IA 2C0OA 2ETKA 3R0TA 3MVMA 1ZOGA 5F4NA 1RE8A 5DN3A 3GFEA 4XX9A 1H1WA 1Q4LA 4U9AA 1OM1A 5FG8A 1Q24A 4JBVA 2GNGA 4DN5A 2CNVA 2WTKB 3UIXA 3DFAA 4BDDA 1LPUA 1DAWA 1VJYA 4ITIA 4JQ7A 4E6DA 5IQCA 4J99A 2X2KA 4F6UA 3S0OA 5FM3A 1H4LA 4RA5A 1KUTA 3PZHA 2JITA 2XRUA 4FK3A 3SW4A 1NA7A 3TWJA 3GXLA 5M4IA 3MH2A 3RCJA 3VS7A 4FSZA 4J1RA 5DG5A 3DPKA 4EUTA 3EH9A 3UJGA 3KK8A 4DAWA 4NW5A 3OTUA 2VWWA 2JFMA 3LFDA 3RM7A 4EZ5A 3KRWA 5IQDA 2OXXA 4FKSA 5CNNA 4H1JA 1IEPA 3CPCA 3PPKA 2ZAZA 2W9ZB 2PVYA 3EL7A 4QMOA 1WAKA 3I81A 5EHLA 5C03A 3GCVA 2OFUA 3U9CA 2XNPA 5KUPA 2WTCA 2JIIA 2XK6A 3FI4A 3R73A 3ZXZA 3ITZA 4AX8A 3KMWA 3LFEA 5CZIA 4ZOGA 5AR5A 5LOHA 1YWVA 4BCFA 4YTCA 1ERKA 4BZDA 3JY9A 5JFSA 2PY3A 4XRJA 5AM7A 3TUDA 3DXPA 4O2ZA 1J91A 2R3OA 3FMLA 3WBLA 4BZOA 2EVAA 3Q96A 2C5XA 2FA2A 2GHGA 2QO7A 3FC1X 4XG2A 5KMJA 3P4KA 4G5PA 4Y73A 3WF7A 4G3EA 2XIRA 4V01A 4AE9A 4D1ZA 4Y72A 5C1QB 5CVGA 4E5AX 5IQBA 3OOMA 5HIDA 2XIKA 2YJRA 5DLSA 3DAKA 3VVHA 4TL0A 3NVKI 3D5VA 4EZ7A 3U54A 3TZ9A 3W2PA 4ZTRA 2YM5A 3GC8A 3T8OA 4AG8A 1M17A 3A99A 1A06A 1LP4A 5BMMA 4FL2A 3PFQA 3BYVA 4JQ8A 3FZOA 2H8HA 1AGWA 3UOHA 3V51A 4HCVA 1R1WA 4M66A 1YOLA 2B7AA 4NTSA 1PMEA 4A06A 3II5A 4NK9A 3DNDA 4KAOA 2WTJA 2UZLA 5E4HA 4XG8A 2XK3A 3ANRA 4M14A 4DINA 3W8LA 1RDQE 4RVTA 4FTTA 4YURA 2GQGA 2AUHA 3QRJA 4PL5A 3GT8A 4EHVA 2Q83A 4JT3A 3MBLA 4O7LA 3OVVA 4Z16A 3MB7A 5HICA 3D0EA 3MI9A 3AD5A 2R3LA 3UC4A 4FKJA 2QCSA 5BVEA 4G3CA 2CGVA 4D28A 2YIQA 5EKNA 3HV7A 4XS2A 2ZDTA 1WBTA 2WOUA 2XEYA 4ITHA 3RWQA 4KIKA 4JQEA 1OL5A 2WEIA 3QQJA 4JBOA 4QMMA 5HE1A 3WE8A 1U54B 4EH6A 2JC6A 2ZM1A 2YDJA 4DE4A 3IDPA 4U97A 2VWXA 2PK9A 2VZ6A 1PXKA 3RPVA 4F64A 4QPMA 4WD5A 4BDCA 2DQ7X 1XJDA 4FTAA 3SG9A 4BDIA 4MK0A 5HE2A 2B4SB 4PNKA 2I0EA 3LXLA 1MUOA 5L6PA 4OBOA 5E91A 4DH8A 4XG9A 4KBAA 4BB4A 2FSTX 1MP8A 2QC6A 3RAWA 3MB6A 4Y95A 5K3YA 5J9ZA 1DS5A 4PPBA 2IZTA 4DFNA 2W05A 3UP2A 1XWSA 4W8EA 4ID7A 3F3ZA 3QKMA 4OAUC 5H2UA 4EOKA 4KSPA 2VGOA 1JOWB 3FJQE 4UX9A 4EH2A 3GVUA 3AC8A 2C1AA 2R3PA 4FTCA 2CN5A 2ERKA 4J98A 3DTWA 3NCGA 2X7FA 3G15A 3NEWA 4CYIA 2XNMA 3C4FA 3KXMA 4RIYB 4CSVA 4WNMA 5LXMA 5CEKA 4EOLA 2RGPA 5L4QA 4X3FC 2HELA 3VUMA 3SXFA 5AR4A 4DGMA 4YR8A 2BAKA 3DTCA 4FTNA 3LQ3A 4U5JA 5ETIA 4AN9A 4FVRA 4YHFA 2R0IA 3DKOA 1TQPA 3UYSA 4DFYA 2YM3A 3VHEA 4PMPA 4AWIA 3QGYA 5GIOE 2JAMA 3VBYA 1WVXA 4BI0A 2PVFA 2R3FA 4IM3A 4D9TA 5M4UA 4ZS4A 4S2ZA 4GJ3A 4FZAB 4RC3A 4UWCA 4UN0C 5BVFA 4GIIA 1OI9A 2UW7A 3CCNA 3QF9A 2W7XA 4IVBA 4O0XA 4U44A 2B1PA 3GU8A 3D7TB 3FKLA 3DOGA 4N57A 3U6HA 3CTHA 3L9PA 3G0EA 3PE2A 3E7OA 3R1NA 1DI8A 3ZZWA 2CCIA 3MS9A 5HG8A 5A4TA 2X9EA 4PDYA 3ZDUA 2PHKA 4YZDA 3WZEA 5HX8A 3HZTA 4FKWA 2F7EE 5JKGA 4AGWA 2BTSA 2ITPA 3A62A 2PMNX 4IAKA 4R77A 3IW5A 2PMLX 2VWYA 3DQXA 4FL3A 3RZBA 4E93A 4AZTA 2WFYA 4R1VA 2ONLC 4CFMA 3R22A 1ZMUA 3DZOA 3S00A 2GQRA 2OBJA 4FUXA 2BRBA 5AADA 4IAAA 5FBOA 1PXOA 3RK7A 5HQ0A 2XNBA 3HA8A 4FV3A 3NYXA 5IA1A 4N6YA 4YBJA 3FQEA 2OJFE 5FDXA 3N51A 4BWKA 3U9NA 3BKBA 3CR0A 3HRFA 3NUXA 2JKMA 4TPTA 1OB3A 3OOGA 4YLLA 4GVAA 4K1BA 3CJGA 4O0RA 3HV5A 4QP6A 4ASZA 4IB5A 5L8LA 3PSDA 3GBZA 2QOQA 2QOFA 5CXZA 4ZK5A 2XUUA 1R0EA 3QKLA 5CXHA 4X21A 4CD0A 3MV5A 1H1QA 4F9WA 2QD9A 2W1IA 2R9SA 4XG6A 5AV3A 5L2SA 3SA0A 2SRCA 1J7LA 3F5UA 4J53A 4EKKA 4BR3A 4RPVA 3RTPA 4NM7A 3LFAA 4QO9A 4PX6A 5JN2A 5M4FA 2EWAA 1P2AA 2IN6A 4NM0A 3QBNA 4MHAA 2ETRA 4J97A 2QR8A 2WMSA 3NZ0A 3ET7A 2W1EA 1ZLTA 1LR4A 4G9CA 4ZP5A 3VQUA 5IQAA 3O71A 4MF0A 3K3JA 4DHFA 1KWPA 1W82A 3OC1A 5E8ZA 4CTBA 3V01A 4C37A 2HXLA 4G3GA 4UXLA 2C69A 3DNEA 3MFTA 4F7JA 3D4QA 1WBNA 5CT0A 3OY3A 4G9RA 3FBVA 1PMNA 4JBQA 2P2IA 4AA5A 3BQCA 3C50A 2YCFA 4XLVA 5IPJA 3VBVA 3JXWA 3C1XA 5J8IA 4NFNA 5LMAA 3R7IA 4CMOA 3KRJA 1OUKA 2C3JA 3KXXA 2WMTA 1IRKA 3HMOA 5DNRA 5AUXA 4A9TA 4QMUA 4E3CA 4GT5A 2OIDA 3EQDA 2UW6A 3NS9A 5FLFA 5HG5A 5CU0A 3UVQA 3MPTA 4LL5A 4I92A 3LPBA 1YVJA 1Q41A 5GJFA 4BCNA 2XYUA 4RX7A 2R5TA 4XHKB 1UNLA 3AGMA 5HESA 3QCYA 3WIGA 4WA9A 2F2UA 3GU5A 3PXFA 5IG1A 3WILA 3IKAA 2J0MB 4AGCA 3UMWA 3NW7A 3EN9A 2E9OA 3EQCA 4TYHA 3ZSIA 4BBMA 4TT7A 4D2VA 4X3FB 1H08A 2B53A 4C4EA 4C7TA 3TUBA 5AFVA 3W8QA 2V62A 4MXOA 4ORKA 4QMNA 2BUJA 2UZEA 3CJFA 5AUUA 4M67A 4AAAA 4C62A 1TVOA 5AAFA 4MD7E 2G1TA 1AD5A 2YITA 3PSCA 1PW2A 4TN6A 1TKIA 4ENXA 3UVPA 3FMEA 2ZV9A 1OPKA 4AZVA 3LLAA 3VS4A 2Z7LA 3NW6A 5LMKA 1ZAOA 4I24A 4IBMA 2WGJA 4KKGA 5EOBA 3V5WA 2XRWA 3PIXA 3SKCA 2WQBA 4UMTA 3R9HA 4JG8A 2R3HA 1XBBA 1Q8YA 2O65A 4CNHA 2OWBA 3IW7A 4JLCA 4CFUA 2YJSA 3TNPC 2VN9A 2UV2A 1OITA 5GJDA 4EORA 2R3IA 3I6WA 3OCTA 3LQ5A 5DEYA 3IW8A 5FWKK 4II5A 3ZFYA 4LMUA 4PV0A 5A3XA 4AGDA 2OFVA 4ZY4A 1STCE 2VTNA 4F4PA 4CVAA 3BU6A 5AMNA 3GCQA 4ZIMA 4XP2A 2QLUA 4O0YA 3AT4A 4EH9A 4QP7A 3ZSGA 2HXQA 3LXNA 3MJ2A 5GHVA 4WIHA 4FEVA 1H24A 3A4PA 3LCOA 3C4WA 4PMTA 5GZAA 4Y5HA 2V5QA 3BWFA 1GIJA 3UC3A 2VWIA 4NKAA 2X1NA 4FSYA 1RW8A 5HCYA 1IG1A 2RF9A 3MIYA 5D11A 4L8MA 4DT9A 4ZY5A 4DLIA 5BVWA 3PWYA 5EW8A 2FB8A 2HW6A 2YAKA 3D15A 3F3VA 4DEBA 4GFGA 4KA3A 3IQ7A 3BYUA 4C33A 3L8VA 2X4FA 3KU2A 4LL0A 2NRYA 3NMUF 2X4ZA 3UTOA 3V5QA 4QQ5A 2BILB 2IZUA 3F9NA 5L2WA 4EL9A 4DFUA 3R00A 4G5JA 5AV0A 5J5TA 3IGGA 5HBEA 5HTCA 4JX7A 2WMAA 3BGPA 3SAYA 5IMXA 4LM5A 4FT9A 2PUPA 4FKVA 1VYZA 3BLHA 2PZRA 3MVJA
chains in the Genus database with same CATH superfamily
2ITOA 2P33A 3R01A 4UMRA 2XCHA 4L45A 2QOIA 4KIPA 3IPHA 2C68A 4IHPA 4NIFB 2HCKA 1SVGA 4PPAA 3R21A 3W2QA 4DCAA 1O9UA 4Z9LA 4MKCA 4CZUA 5IQGA 3VUGA 2PE2A 1Z57A 1YOMA 2ITZA 2CLXA 2NP8A 4DGNA 3SG8A 3F7ZA 4OT6A 2GHMA 4QTAA 3LCDA 4BKJA 1B38A 1OL7A 1OKYA 4YZCA 3C4CA 2BAJA 4G34A 4QT1A 3PE1A 3COKA 3DK6A 2VX1A 3PXRA 2WMXA 3Q9XA 4HPUE 4FNZA 3NUYA 4A4XA 2UVYA 4GV1A 3ZMMA 1URWA 1WVYA 4IJ9A 1XMLA 1Q8TA 2AQXA 3I5ZA 4X2FA 4BZNA 4JR3A 3VS1A 4M12A 3IDCA 4IJPA 4E6QA 1P4OA 3HUBA 5CY3A 3QRIA 4DEGA 1PYEA 3C13A 1UNHA 1YWRA 5IDNA 3QX2A 4ANMA 1MRYA 2F49A 3GCPA 3R8MA 2VRXA 3EQHA 4PDPA 4IIRA 5L6OA 5C27A 4FF8A 1KOAA 3ZLYA 4X2GA 4QTDA 5B2KA 4AP7A 2V7AA 4CRLA 3JS2A 4U79A 3CGFA 5HBHA 2VTPA 4ZAUA 4F63A 4LRMA 5HNGA 5BV3A 2VTJA 3PVUA 3QZGA 4G17A 3RGFA 4TRLA 4H58A 5A46A 3FQSA 1VLRA 1ZOHA 4KRDA 1Z9XA 4GT4A 1ZZ2A 1TQIA 2XNNA 2AYPA 2R64A 2W96B 4K0YA 4F1MA 2QNJA 5D7VA 5EYCA 5BVNA 1ST4A 4XMOA 4IH8A 2R3JA 3CTJA 4I5PA 1Q61A 3GU4A 4AUAA 3DJ5A 3E88A 4ZLYA 3W32A 4I6BA 5IQHA 3FLZA 2YEXA 5BYYA 2IW6A 3UP7A 1JLUE 1Q3WA 1W83A 2NRUA 3TDVA 4FIGA 4G6LA 1L8TA 3GGFA 2JEDA 1PKGA 2EU9A 5IEVA 1XH7A 2X8DA 4FV9A 4P5ZA 3EKNA 3H10A 4EYJA 4FJVA 4CQGA 3ML1A 3A7HA 4FTKA 3V8SA 2BZJA 3GP0A 3PYYA 5GIPE 1KOBA 4OTRA 1LUFA 2VWVA 2WHBA 3MPAA 5L6WL 2WD1A 3HP5A 4YJUA 5T6KA 2NYAA 4O82A 1SNUA 4MD9E 3S95A 3FEGA 2B0QA 3FSKA 2GPHA 4PY1A 2DS1A 5AP3A 4B9DA 2J7TA 3RPRA 5DHJA 4GKIA 2YACA 5K0XA 4O7TA 4EH5A 4EK8A 4NM5A 2HZNA 4HPTE 5EM8A 1Q8ZA 3EN7A 4EKLA 3P86A 4LV7A 4JDJA 4U41A 3QQKA 3VBTA 2X0OA 4FTQA 3DK3A 2GTNA 2XCKA 4XV3A 3ENHA 4YPDA 3TI1A 4AAYA 4FT7A 4PDSA 4X2JA 3GEQA 4BCJA 4P90A 3CD8A 1GOLA 4NW6A 3DU8A 3EQGA 5E8XA 5CAQA 4G6NA 2C5YA 3OT8A 3RK9A 5HORA 1ZXEA 5E8VA 4G16A 4H3BA 4IFCA 4IX3A 5CQWA 3ZDIA 4CCUA 2XKDA 3NGAA 2QODA 3KY2A 3U6IA 4FYOA 2R7BA 3MSSA 4QTCA 5DR6A 3UOLA 2X6EA 4BBEA 3UDTA 5BX0A 4IAYA 4WBBB 4JDIA 4ACHA 3P78A 4ASEA 3PY0A 4D4YA 4WRSA 3QRUA 4C59A 3QQGA 3FZTA 3QTXA 4L42A 5I9YA 2W5BA 3UNKA 4D9UA 5ACKA 3FMKA 4HJOA 3N4TA 2UZNA 2GNIA 3SGCA 3W0MA 2OZAB 4BTJA 4K9YA 3MN3A 3QTWA 5IA4A 3I1AA 2CN8A 2ESMA 5F94A 2RL5A 4FSUA 4J96A 3R8PA 4ZMFA 4W9XA 5KCVA 3P1AA 4IAIA 2DYLA 3MWUA 3G6GA 5E1EA 1DAYA 1YXUA 2BROA 3H0YA 4Z7GA 3E8EA 2WMWA 1CKPA 3AMYA 2IW9A 5A6NA 2I0YA 5K0KA 5CVFA 2XVDA 1G3NA 4QRCA 5EQPA 4XOYA 2PMIA 3ZOSA 4DDGA 2PPQA 1OECA 1O6KA 2QG5A 2X0PA 3B8QA 4F7SA 2YM6A 4TW9A 3W2RA 4D5HA 2WQOA 4DFXE 4GW8A 4O96A 4NH1A 3QRKA 3VIDA 4LOOA 3UGCA 2IF8A 4I4FA 3ATSA 3AMBA 3HRCA 3ORPA 2QG7A 3PTGA 3MIAA 4J8MA 4HCUA 4ZTLA 3TZ8A 2ITNA 3TIYA 1SVEA 2CKEA 3V5JA 4F0FA 1NW1A 4M84A 4L43A 3GENA 3R8UA 1UU7A 3M2WA 3W18A 4ALWA 5JRQA 2IZSA 5KZIA 4XG7A 4TKSA 5ETCA 2YZAA 1R39A 4K33A 3R9RA 4AZSA 4OTIA 2WQNA 4XP0A 1PMUA 4L7SA 3UQGA 4ZLOA 5CQUA 2W5HA 1YI4A 2V0DA 4U81A 2G2IA 4QNAA 4UMUA 4DITA 5BUEA 4D2PA 5CF5A 4RC4A 2HENA 5AP2A 3BYOA 4BIBA 3RPYA 3G9NA 4YU2A 5CYIA 3PLAE 1Y8YA 4UMQA 4XV2A 4RQVA 2OXDA 5AP4A 3OEFX 3KFAA 5E8YA 4A9YA 1BX6A 3EMGA 1NXKA 3F6XA 3MTLA 5J9LA 4ZMEA 1U59A 5M44A 2VTRA 3QGWA 5HTIA 4AXFA 4JIAA 4DEIA 5KE0A 2W17A 4QP1A 2IVSA 2JKOA 4PL4A 3UQFA 2O5KA 4H36A 2PUUA 4IWQA 1FOTA 4YZMA 5C4LA 3ODYX 4E4MA 5KMMA 5AX9A 4XNEA 4YJTA 2R3GA 3FMMA 4O91A 5IQIA 4IW0A 3NW5A 3FY2A 2GTMA 2W1ZA 4BCHA 3QCXA 4F6WA 3DLSA 5CU4A 1IAHA 2JBOA 4P7EA 4F1TA 3F2NA 3F5XA 2VTMA 3GB2A 2C5VA 2UVZA 1XHAA 4KB8A 3GU6A 3MVLA 4YJOA 4H3QA 4PUZA 5A9UA 4MXAA 1TZDA 4I6FA 3CS9A 5AV2A 5BMSA 5H3QA 4GT3A 3P7AA 3KXNA 4Y5QA 5IDPA 2QKWB 5HBJA 2ZB0A 1YDSE 2XK9A 3KRRA 3OT3A 5GZ9A 4UBAA 3V04A 4X6RA 1K3AA 4WOVA 5FP6A 4DH5A 3A4OX 5JGAA 3NR9A 3FZPA 4JRVA 5DVRA 3T9TA 3BX5A 1URCA 1J1CA 1H28A 1BL6A 4YTIA 1WFCA 4BCQA 4IQ6A 4FKOA 4N4SA 1APME 4BL1A 1WMKA 3FMHA 2OF4A 3W0PA 3ZFXA 3F69A 4AU8A 3RPOA 2BFXA 1YXVA 4ZTQA 2C0TA 5BYLA 4XRLA 2GFCA 3UO4A 5EW9A 5J1WA 3H9RA 2OXYA 3DBCA 4L6QA 1DM2A 4MNFA 3W0SA 2GS6A 2WXVA 3AC3A 4ZZOA 1OGUA 1ZY4A 2Z7RA 3BU5A 4RX8A 4UWYA 1U54A 3EFKA 3VF9A 4RFMA 5H8EA 2J4ZA 5IMEA 2J5EA 4FE2A 3MH1A 4GS6A 3CTQA 1H07A 4C3FA 4F9BA 5HO7A 2UW3A 5DMZA 5E1SA 4ANLA 4BGQA 3OCBA 3DS6A 3PY3A 4KWPA 4CG9A 4FTJA 4ZTSA 4FIHA 5HG9A 5EM6A 4O0WA 3WZUA 3OWKA 4D2WA 3P08A 4JDHA 1VZOA 2GS7A 3BIZA 2A27A 4I1ZA 4EH7A 1YXXA 3EFJA 3TCPA 3V5PA 1UWHA 4YHTA 3KXGA 4AXCA 3ORXA 2XAMA 2C6OA 5T3QA 4OTQA 4GYGA 4EC9A 2Z7QA 5AIRA 5JFWA 4WT6A 3FI3A 5CWZA 3HKOA 3W2SA 5LQFA 1SMHA 4BCMA 4RC2A 5AM6A 4BGHA 4S32A 5C26A 3ZBXA 3UOJA 1W2CA 3PA4A 5LVOA 2WELA 5A6OA 1OGYA 4D5KA 2VTQA 3LOKA 4RIYA 3D5XA 5JGDA 1UKHA 2B9HA 4FTLA 3ZLWA 3CIKA 2YCRA 4ACMA 2W4OA 4ALUA 4BTFA 4BDJA 3ZUVA 3F2AA 3FKNA 5CSHA 3NUAA 2AC3A 3NPCA 3OUNB 3G9LX 4IC8A 3WYXA 2WQMA 1Y8GA 5E8UA 2VWUA 4QOXA 3KA0A 5KKRC 2RFEA 4KIQA 4QQCA 4QMPA 3PDTA 4PDOA 4C8BA 4TWPA 3EB0A 1M52A 3ORNA 2JDTA 1OPLA 5A4QA 2YIWA 1VEBA 4LGHA 2R4BA 2GNLA 4WNOA 4X2NA 2UZBA 3ZO1A 4DEEA 5LWNA 2VTTA 4AS0A 4C02A 3OCGA 1RJBA 3RAKA 3TV7A 1MQBA 2BALA 3PY1A 2G2FA 1Q5KA 3D7TA 1Y6AA 3TNIA 2UZTA 1ATPE 5B0XA 1MRVA 5DIAA 4LV8A 3SD0A 1O6YA 4BDAA 4C38A 1JNKA 2BIKB 3LCKA 3CBLA 2C6MA 4QPSA 4U43A 2W1GA 3TXOA 1G8KA 4EBWA 4QPAA 2FGIA 2YM8A 4FRFA 3ZCLA 5KHXA 3IDBA 3I0OA 4L3PA 3QD2B 3IK3A 4IM0A 1M14A 1YHSA 3AKLA 1I09A 4BDGA 4FKRA 1REJA 2X8EA 4WG3A 1QL6A 4C2VA 4YPSA 4PF4A 3R8VA 3PRFA 3ZLSA 4RIWB 3VC4A 1ZMVA 5DGZA 4ERKA 2UW8A 3ODZX 3T9IA 1TFFA 2PE1A 2UW9A 4RMZA 3KCFA 4TNDA 4MBJA 2DUVA 2XK4A 3BBWA 3R1SA 4FSNA 3K3IA 2VO0A 2Y7JA 2OJ9A 1ZZLA 3MH0A 4IXPA 4FTOA 5DR2A 3AD6A 3R2BA 4JRNA 3W2CA 4RIOA 2CNUA 4U7ZA 3A60A 3L8XA 3VN9A 5IA5A 1FMOE 3OWPA 5HVJA 3QLFA 2GHLA 5FEEA 3OZ6A 5CAUA 1M7QA 3Q5ZA 4AQCA 5AWMA 1E1XA 3BELA 3CP9A 4I0SA 5DPVA 4P2KA 2YDIA 4PP7A 5IA2A 3QUPA 4IMYA 4O4DA 5J7BA 4I5HA 3CC6A 4OLIA 4DLJA 1X8BA 4RJ4A 3F61A 4UALA 2ITTA 4CXAA 4QQTA 3EQRA 4MWHA 1JBPE 2X9FA 1H25A 3CQEA 2RFDA 2WTDA 2B9JA 5M57A 3I6UA 4RG0A 3SHEA 4FL1A 4DH7A 3AT3A 4L3LA 4NUSA 2JDVA 4FSTA 4RJ8A 4XP3A 2UZOA 3VS5A 3WYYA 2XM8A 2VUWA 3O96A 2Q0BA 3O0GA 4JX3A 4RFZA 1CKJA 3EYHA 4CKIA 2AEGA 5FXQA 3PXYA 4UMPA 4DA5A 5JQ5A 1NVSA 3RK5A 4A4OA 4O7YA 2OU7A 3CSVA 4GMYA 3NUNA 1YDTE 1OZ1A 4EBVA 5I3RA 4GKHA 5DT3A 2A0CX 5I5ZA 4YLKA 4O4CA 3UDSA 4I5CA 1OKWA 5C8KA 5CANA 1O6LA 4PMMA 4CFVA 3TNHA 4E6CA 3FMJA 4OTDA 4WHZA 4GG7A 3QWKA 2Y0AA 5AP6A 3QZFA 2XIYA 4LOPA 5EKOA 2VTHA 3IW4A 4RZWA 5CU6A 2C6DA 2E9UA 4AW0A 4YP8A 5ITAA 4XBUA 1MQ4A 5J1VA 4B4LA 4FT0A 4FZFB 5J95A 5CS6A 4R5YA 2XA4A 4DYMA 1YOJA 3EFWA 1I44A 4DDIA 4Q5EA 2WIHA 1OL1A 4I3ZA 2XB7A 4WNPA 5TO8A 5EW3A 4AT4A 4F09A 1PXLA 3L9LA 4HYUA 4K18A 4TNBA 5BVDA 4X3FA 5H8BA 4D4SA 4P4CA 3E93A 3MFSA 2BRHA 1PKDA 3ZS5A 3B8RA 4DT8A 5F95A 2IVVA 3ZO4A 5I3OA 4E20A 5KKRB 3PUFC 4I5MA 2Z8CA 4AXAA 1ZMWA 3CKWA 2I6LA 5ANEA 4EI4A 4USFA 3EQFA 3R63A 3PIZA 2HZ0A 2PE0A 5K9IA 2J2IB 3PXQA 4KRCA 3AD4A 3UVRA 4C36A 3KIOC 5HO6A 4QDVA 1B39A 1Y6BA 5KO1A 3DGKA 3E87A 4QMZA 4FV1A 4ARKA 1ZY5A 4BKZA 2Z2WA 4F08A 3LFFA 2PZIA 4FG8A 2A2AA 3ZONA 3QQHA 3UBDA 2F9GA 3W1FA 3DZQA 3HA6A 5IH4A 4X2KA 5FEDA 3NNVA 4FSMA 3A7IA 4JG7A 3O2MA 2ITWA 4B8MA 4GK4A 1W2FA 3QHRA 2PL0A 4MEDA 5DT4A 4D0XA 5FRIA 2FVDA 1ZYLA 3JPVA 1PXMA 2ONLA 3DJ6A 5CVHA 3PJ2A 3T3VA 1LEWA 1K9AA 3W0RA 2OJJA 5KBRA 2XH5A 4GCJA 4FZ7A 4HVSA 3JVSA 5B2MA 4OAVB 2VO6A 2X2MA 4G2FA 4HW7A 5A14A 5A4CA 4WO5A 5IEYA 2GFSA 4IB1A 2E9PA 5TKDA 1R0PA 1JKSA 3S2PA 1Q3DA 4DFBA 3Q4UA 4L9IA 2Z60A 1MRUA 4GJ2A 4LRKA 4QNYA 3P79A 4HYHA 4JG6A 3VAPA 3OEZA 5LVNA 1Y57A 1E1VA 5BUIA 4MVFA 3VUIA 3P0MA 1IR3A 2FO0A 5F9EA 4HVIA 1QPDA 1LEZA 4FGBA 2JDOA 3SQQA 3PSBA 3KKVA 5GNKA 1CDKA 2X7OA 2W4KA 3QTZA 4EOOA 5BPYA 3ZEPA 3QD4A 4MBLA 1OKVA 2QLQA 2G15A 4FIIA 5AP7A 3PA3A 3FL4A 4NTTA 4BHNA 3OXTA 4NIFA 3F3UA 3A7JA 3FZ1A 5EM7A 2ZMCA 4TTHB 2HZIA 3R1QA 4O0VA 4QP3A 3Q04A 3VONA 3FL5A 4YSMA 2J0IA 2QI8A 2HY0A 2X6DA 1UU3A 3D5UA 1XH9A 2UZWE 1YXTA 3UIUA 5CZHA 4D2RA 4DGOA 3E7VA 3MY1A 4FYNA 4TWCA 2VWBA 2JIVA 1OKZA 3VW6A 3LE6A 4QP4A 4BHZA 2JD5A 1W84A 3LVPA 3VJOA 4LDTA 3LIJA 5EYKA 4BCPA 4RT7A 3ZHPC 2LGCA 4DTKA 2Y4PA 3VRZA 4AW5A 1FGIA 5J5SA 1ZYCA 4KBCA 4ANQA 4PTCA 3EJ1A 2FSMX 4BDHA 4Q5HA 4M15A 3MW1A 3O50A 4FG9A 4XG3A 4FX3A 1QCFA 3N9XA 4YO6A 4V04A 2XJ1A 4O7VA 5EQEA 3L9MA 4FIFA 3Q32A 4TY1A 1BYGA 3ZFMA 3SW7A 1PYXA 4H05A 2QU6A 3HRBA 4AACA 3LMGA 3BV2A 3DKCA 3OBGA 2XYNA 4YJQA 4CMUA 1OUYA 4O4EA 5HLWA 3OMVA 2ZVAA 3ACKA 4L46A 3Q6UA 5KBQA 4RVLA 5LJJA 1M2RA 4FSRA 1ZOEA 2CDZA 3ZRKA 3W16A 2XK7A 3VULA 2ZJWA 2CGUA 4YNOA 3H4JA 4MCVA 5HLPA 3LCSA 4MTAA 3RNIA 4C34A 2QO2A 5AR3A 2VO3A 4I6QA 3IGOA 3QFVA 3FE3A 1J7UA 4O4BB 4BYJA 5CX9A 3BLQA 1UNGA 3NUSA 3JVRA 1HOWA 4HZSA 4ACCA 5D9HA 2YHVA 3HV6A 3VUHA 2P4IA 3WE4A 1XBCA 3DAJA 3Q3BA 4EOMA 4FEWA 2WKMA 1GY3A 3FLWA 3I7CA 4ENYA 5IA0A 4F99A 4IANA 4UV0A 2XJ2A 4FZ6A 2ZB1A 2YIYA 2OK1A 3KXZA 3R2YA 4BTKA 4UXQA 3IO7A 2C3KA 4O1OA 4ACGA 3F3TA 2C4GA 2OGVA 4N70A 5DEWA 4AOJA 4QYYA 5I0BA 3UQCA 5AUZA 3FI2A 4GFOA 1OBDA 4E7WA 4XLIA 2A1AB 4LV5A 5FDPA 4KIOA 1H27A 2YFXA 3MFUA 3ZXTA 3SOAA 4IAFA 3ZYAA 3EIDA 5M55A 4CV8A 5C9CA 3NFGB 2PVHA 2UW0A 3AC4A 3E8CA 4YZ9A 4FTIA 3MVHA 3TKUA 3ZO3A 3KF7A 1JVPP 3H3CA 4O27B 2OH0E 2C6IA 4YZNA 1UV5A 3QTSA 2PULA 2YAAA 2J5FA 4UYAA 3RAHA 2F57A 3GOPA 5FEQA 3PVWA 2P2HA 4GUEA 1S9IA 3D9VA 2C6LA 3HLLA 4MQ2A 4B6LA 1Q62A 4KUJA 5TT7A 4IX5A 3W0NA 5M06A 4KS8A 5I9ZA 3TL8A 3K54A 5DI1A 3TN8A 5L3AA 2WU6A 3HYHA 3BE2A 3NDMA 3OCSA 3SVVA 2VO7A 4FV8A 5KMKA 1FPUA 2QHMA 2A4LA 3H30A 4X0MA 3ATTA 3LMIA 4Y85A 5I9XA 2X2LA 2XALA 2BKKA 3K5UA 4K6ZA 5TOZA 3V6RA 4K8AA 1H26A 5HEZA 4XG4A 4Z3VA 4Z55A 4AE6A 4EJNA 3ACJA 4FKLA 4IDTA 3F2RA 5JFVA 3AC2A 3BHYA 3EN6A 4F70A 5IH6A 1WCCA 3F3WA 3HDMA 3KGAA 3OROA 3QD0A 4QQJA 4BRXA 4R7BA 2OZAA 3FDNA 5FXRA 4GEOA 4S30A 5HLNA 3LJ0A 2ZM3A 2FSLX 4J7BA 5HD7A 3FAAA 3IS5A 4FSQA 2B9FA 5M07A 2EXEA 2XM9A 4FMQA 2F4JA 2ZM4A 3UNZA 4DGLC 3OP5A 3SXSA 4O81A 3IOKA 1H1RA 2XIZA 2ITYA 3EL8A 3DA6A 4EK3A 2YA9A 3NNXA 5HE0A 4F6SA 2YZLA 2BZHB 3R7VA 4I93A 1SZMA 2WO6A 2ZV7A 4U8ZA 1SNXA 4DH3A 5C8NA 3QLGA 2R3RA 1YRPA 1KSWA 3F7WA 4JI9A 4D2SA 2O64A 4RJ7A 3R04A 2RIOA 1JKLA 5EQYA 3R1YA 3KXHA 5EI6A 4F0GA 5E9EA 2OI4X 2V22A 2OIBA 4NT4A 3VW8A 4EOIA 1BKXA 3Q9WA 2H6DA 2WAJA 1FVTA 2VD5A 2FH9A 3CY3A 2B54A 1BMKA 5DA3A 2O8YA 2W1DA 1G8SA 4CCBA 5I4NA 3QQLA 4YJNA 1WBVA 2C47A 3DDQA 4O4FA 4PTGA 5D41A 5EK7A 3C0GA 3D7ZA 3FKOA 2YISA 2FYSA 3OTVA 3PUPA 4IVCA 4IZAA 4AFEA 3LFSA 4DFZE 3DBFA 3E3BX 2VTAA 3ZTXA 4C61A 3VO3A 3VBXA 4A9UA 2CJMA 3UPXA 3BI6A 4IX4A 2QVSE 4GK3A 4O7ZA 4PNIA 4D58A 5HGIA 4ZTHA 2C6TA 3B2TA 5AR8A 4KNBA 3BPRA 4MNEB 4A07A 2VX3A 4IEBA 4BC6A 1CTPE 4EK4A 5HKMA 3MY5A 1CSNA 3VS2A 5CASA 3ID6C 4CQEA 1PJKA 4DH1A 2R3QA 5HTBA 2O0UA 4H39A 4NCTC 2XF0A 3E92A 5GZ8A 3O17A 3O8TA 4L53A 4PMSA 3TG1A 4I21A 3HMMA 3U4WA 3NIZA 5CTPA 3RWPA 3NUUA 4MX9A 3BGZA 3KK9A 5JFXA 1Q99A 3SRVB 4EOPA 1BL7A 1KV1A 4FKTA 2G2HA 3GUBA 2I0HA 2ZYBA 3CKXA 4JVGA 3A61A 1JSTA 2GNHA 1YHWA 4XOZA 3HL7A 5B2LA 4FR4A 3SLSA 4D4VA 4UZHA 2OF2A 3QYWA 4ZXTA 5LCJA 1U5QA 2JKKA 4R3PA 2WTKC 3TV4A 2NPQA 3ZM4A 4D55A 5FTQA 5JMSA 3Q4TA 4QMWA 4DEDA 1K2PA 3Q4CA 1OPJA 2GQSA 2R3KA 3E5AA 4NJDA 4LFIA 3UIBA 3ZRMA 3LW0A 3QRTA 1XH4A 1YI6A 4FIEA 3NRMA 3QXOA 4XCUA 3VQHA 3L8SA 4M97A 2NNWB 4C2WA 2HW7A 4APPA 3TV6A 2BZKB 2J9MA 3KRXA 2BHEA 1XO2B 3KL8A 3MGYA 4HGSA 5FBNC 3AGLA 3EN4A 4C57A 4I20A 4U3YA 4FA2A 4G1WA 4FT3A 3UMXA 3HNGA 3UZTA 3GU7A 3Q4ZA 4C4JA 5AV1A 4IE9A 4ALVA 4O7NA 2JGZA 4QMLA 3V8WA 3ENMA 3ORTA 4O21A 4M69B 4O0SA 4OTHA 3QUEA 5KMOA 3ORLA 3Q5IA 2BPMA 3UZRA 3BLAA 3TKHA 3NAXA 4IDVA 4F9AA 2VAGA 5K5XA 3E62A 4O7SA 3I0QA 5ANIA 2PSQA 5KMIA 5EOLA 2BDJA 4EH3A 2WMUA 4AXDA 1H0VA 1HCKA 4ITJA 2JDSA 3R8LA 4R8QA 3GC9A 5F1ZA 4LOQA 2W99B 3E64A 3BEAA 3FPMA 4KKEA 4Y83A 5C8MA 4TWNA 2EB2A 2E9NA 3KULB 3ULIA 3RHKA 1W0XC 3HV4A 5BNJA 5GJGA 3OD6X 5DWRA 4ZSGA 4EQCA 4O22A 2J0JA 5JGBA 4ACDA 5KZ0A 3MYGA 5JT2A 5E8TA 1ZRZA 3ORKA 4JL9A 2IG7A 4KKHA 3O7LB 1L3RE 2BRGA 2WU7A 1B6CB 2HIWA 5CNOA 3ULZA 5AEPA 3C4XA 1QMZA 4E5BA 2W0JA 3AKKA 4UB7A 4RIXB 3OUKA 5EFQA 3VBWA 5LMBA 3FV8A 4FEQA 2YABA 3F5PA 3G51A 3QAME 4MH7A 4Q2AA 2F2CB 1JPAA 3PP0A 3GCSA 3OW3A 1GJOA 4IWPA 3WF5A 3TYKA 4LGGA 4IFGA 4QMSA 3HDNA 4FOCA 4I6HA 1U5RA 3QKKA 4FUYA 5CEIA 3VUTA 3TEIA 4AGUA 4CFFA 3T3UA 2KTYA 3I5NA 2IW8A 3COIA 5D7AA 3TZMA 5CF4A 3QA0A 2QKRA 5LVPA 1PXJA 4K77A 3WF9A 3FSFA 4H1MA 1OIUA 3U51A 2W06A 4WSYA 2YM7A 5HD4A 3A7GA 3LLTA 3AOXA 5HNBA 3RZFA 5CEMA 3ORIA 4ZTMA 4R6VA 1AQ1A 3K2LA 3NYOA 4RA4A 1H1PA 2ZFYA 3W0OA 2PMOX 3FMNA 4XV1A 3ELJA 4QP8A 4RSSA 5JZNA 3FYJX 3S4QA 3PFYA 2GMXA 4S31A 2WMBA 1KE5A 3EN5A 5IISA 3P7BA 3SC1A 1PRYA 4CGAA 3LFBA 4XBRA 1G8JA 1H8FA 2PVNA 4FEXA 3QQUA 4LUEA 5T68A 1QPJA 5CSVA 4AW2A 4J71A 2PUIA 4C58A 3QALE 3KN5A 4UZDA 5EI2A 4JNWA 4D4RA 5M08A 3V5TA 2VWZA 3ROYA 2I7QA 3NVMB 2F7ZE 3FHIA 3G5DA 4ZS0A 3SOCA 5J7HA 4FEUA 2YM4A 4N6ZA 4V0GB 1JKKA 3Q9ZA 3ZZEA 3R7OA 3VWAA 4BWXA 4ZSAA 4LI5A 4M68A 2BRMA 1JAMA 2WNTA 4JBPA 4IB3A 2OJIA 2WPAA 4BF2A 3FLYA 4O6EA 3ERKA 3I79A 4G3DA 4C4HA 3QCQA 5DH3A 2H34A 2CGXA 4N0SA 3DY7A 2QURA 3M11A 4DEHA 2OG8A 4YBKA 2J51A 2UZDA 2ERZE 2X8IA 3AC1A 3W10A 3M42A 4D1SA 2BTRA 4I6LA 3PJ3A 4YZBA 5IH5A 1YXSA 1DI9A 3U8WA 4NZWB 3H9FA 4RIWA 4EWHA 2VNYA 4CZTA 3R83A 4JDKA 3GOKA 1BLXA 5FQDC 1NT2A 4G31A 3NUPA 4J52A 3ZSHA 4WNKA 4HCTA 2CKPA 3FYKX 3MFRA 4R1YA 3WZKA 1XKKA 5K5NA 3EKKA 3QU0A 4Q9ZA 4BCOA 2IVTA 4FTRA 2OW3A 2QOCA 3ZO2A 2O63A 1HCLA 4FI1A 4PQNA 2XEZA 3EWHA 3TTJA 4AXEA 1IA9A 2UVXA 4RWKA 3I60A 4HNIA 3UG2A 4G3FA 2XKCA 1KV2A 4V05A 3MH3A 3MPMA 2WMQA 5H9BA 2OO8X 2HZ4A 4M13A 3RP9A 3VNTA 4EZ3A 3OG7A 2HAKA 1PY5A 3N4UA 3PPZA 3Q2JA 4AOIA 1OL6A 3GQLA 4CLIA 4KSQA 2C3IB 2OLCA 2BCJA 4Q9SA 1GZ8A 4GIHA 4X3JA 1YW2A 1WBSA 2WEVA 3BV3A 2HY81 2VTLA 2R0UA 3CGOA 2WTIA 4K2RA 4BTMA 1ND4A 2ITXA 4CZYB 1KE9A 1P4FA 1V0PA 1VYWA 3EOCA 4FV4A 2QOOA 4HGTA 2YIRA 3QTRA 4H3PA 1PMVA 4BDEA 4BKYA 5GINE 4XJ0A 5HI2A 4MXCA 2CHLA 3R8ZA 2QU5A 5TR6A 1YDRE 2PVKA 2VU3A 4BYIA 4RWJA 4X7QA 5KNJA 4U3ZA 2Y6MA 2YN8A 3ROCA 2QONA 4ONAA 5CSWA 4EOJA 4OTPA 5BVKA 3WI6A 2UW5A 4DTBA