2IJMA

Crystal structure of focal adhesion kinase domain with 2 molecules in the asymmetric unit complexed with adp and atp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
275
structure length
260
Chain Sequence
b'DYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal Adhesion Kinase 1
publication title Crystal Structure of Focal Adhesion Kinase Catalytic Domain Complexed with ATP and Novel 7H-Pyrrolo [2,3-d] pyrimidine Inhibitor Scaffolds
rcsb
source organism Homo sapiens
molecule tags Signaling protein,transferase
total genus 82
structure length 260
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ijmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ijmA01
3SVVA 1QPEA 1ZWSA 4J99A 4EWQA 2GNLA 4Q5EA 4U5JA 5JMSA 2OJIA 3SV0A 4TWPA 2W5BA 5FRIA 3IGGA 2J5EA 2R64A 3FLNC 5FM3A 4K18A 3LJ1A 3ZSGA 3G0FA 4O0SA 3NGAA 3KC3A 3CKXA 2GSFA 4FTMA 3NCGA 1ZXEA 4HGSA 5CAPA 2BZJA 3N4TA 4DE4A 5IQBA 1URCA 4GEOA 3Q5IA 4CLIA 2WIPA 5BUJA 3A7JA 3HP5A 3CBLA 4TKSA 5CYIA 4C38A 1W7HA 4V01A 4CKIA 4DLIA 2R3OA 5HNGA 1OKZA 3LFFA 3PWDA 5E8WA 4E4XA 3GFWA 3IDCA 3FLZA 5C8KA 3BLHA 2NRYA 5IQHA 3RK7A 5T6KA 3FXWA 2WD1A 3V5TA 4QTAA 3UYSA 3GCVA 3WZJA 2XBAA 1YRPA 3D2IA 2ITQA 1P4FA 3A61A 3EQIA 4FOBA 2I7QA 4MD8E 4ZS0A 4IVAA 3VIDA 3BLQA 5IA0A 3R7EA 5CAVA 3NVMB 4D4RA 1CTPE 3ORPA 4I6BA 3O96A 2QHNA 3QZIA 3GU6A 4GUBA 3ZBFA 4L53A 3ZMMA 4L8MA 2OBJA 4HVHA 5LOHA 3C50A 2ITYA 4EUTA 4GKIA 2R3HA 2KULA 3CGOA 5JFSA 1HOWA 3TI1A 4F9AA 4L6QA 2XRWA 4QP1A 2UZDA 2BFYA 3QXOA 4CYIA 4O91A 2OU7A 2VX0A 3COKA 4FTTA 3BHVA 5FTOA 2PULA 5H3QA 4FUXA 4NTSA 3BGQA 2VRXA 5IH4A 1A9UA 5AUYA 4B99A 4MX9A 4IWQA 4L01A 4M84A 4G6LA 5JGDA 2WEIA 5HO7A 4FSQA 5FGKA 3IOPA 4Q9ZA 5KMLA 3C9WA 4FNWA 2QVSE 5IQDA 5CS6A 2B55A 4KINA 4AA5A 2QONA 2VNWA 4C33A 1WVYA 5IA1A 3D94A 2C6KA 2QCSA 4YZBA 1UNHA 2C5OA 3HV6A 1OIUA 2BR1A 3KMWA 3BV2A 3OXTA 4O22A 4RQKA 2H8HA 3QD2B 4YZ9A 4DG2E 4ORKA 3EOCA 4I24A 4K6ZA 4CZTA 4R3PA 5FLFA 3OP5A 3QRJA 3FC2A 4WNPA 4BWKA 3OHTA 2VO0A 2WXVA 1MQ4A 3RAKA 2CJMA 3ZUVA 2HOGA 3GCPA 4RIYB 3GENA 2FO0A 4N57A 2YM4A 2BZIB 3MWUA 4TWCA 3V51A 3LFBA 1KE6A 2WTDA 4W9XA 4DEAA 5LVOA 3GEQA 4MF1A 3VJNA 3KRJA 4EZ3A 5AMNA 5ITAA 3FQSA 3HVCA 4I3ZA 5A4LA 3H30A 3ORZA 4QMOA 2FGIA 3HA6A 5HU3A 3TNHA 4C4FA 3E7VA 3FY2A 3B8QA 3DZOA 5I9WA 3ZRMA 2UUEA 4E6CA 2UVZA 5CXZA 2OICA 3ORTA 3QRIA 3BIZA 5TR6A 4YNOA 3W2OA 3UO5A 3M2WA 4G17A 4YJPA 1JWHA 4I5CA 3WF5A 4RIYA 3PIZA 2I0YA 5J87A 3ZM4A 3F5UA 2UVXA 3SLSA 4O81A 5EHYA 4IC7A 4G16A 3QQKA 4O7WA 5A14A 5IDNA 1W8CA 3KB7A 1KUTA 2WMRA 3FQHA 4YJRA 5DI1A 3BU3A 2QO7A 3RPRA 3WILA 3WE4A 2QOKA 3DBFA 3QD0A 2JDSA 5TOZA 3R1SA 4RSSA 4ENXA 4F08A 3VF8A 5IG1A 2HW7A 4FKRA 4BIDA 3KGAA 4QO9A 3SXRA 3V6SA 4CNHA 1IASA 2QG5A 5KO1A 4R5YA 5IA2A 4LQMA 3HMIA 5HCXA 4IBMA 3H9RA 3ID6C 3MV5A 2R4BA 4RVTA 2HY81 4ANMA 3IONA 4S2ZA 1LEZA 4RIWB 4U44A 2Y6MA 4XS2A 4AU8A 4IZ7A 3ROYA 2X0GA 1PXMA 1Q4LA 1WVXA 5BYZA 3DCVA 5AJQA 1OL7A 3S4QA 3TKUA 4D1XA 3CLYA 1J1BA 3OOMA 3DNDA 4DYMA 4O1PA 2GU8A 1GZKA 2R7IA 3Q5ZA 1U4DA 1YDTE 4FKVA 5HG7A 4BBFA 3FI4A 3LFSA 1ZYSA 2F7ZE 2YIQA 2VTQA 3D5VA 1O6LA 3UP2A 2XIXA 4ZSLA 1L8TA 2PUNA 2I0HA 3L9LA 4LL5A 3UQGA 5IQGA 4CZYB 4ZSJA 1JAMA 3FAAA 3CGFA 2IJMA 3I7BA 4QMVA 3UO6A 1O6KA 3ZTXA 5EDPA 2ITWA 4RIWA 4BFMA 4E7WA 4P5ZA 1S9JA 1ZRZA 5AV4A 5J7HA 4EOJA 2X8DA 1PXLA 2IO6A 3WZUA 4GMYA 4QP3A 4ERKA 2FB8A 3GC0A 4YO6A 3CR0A 4GIIA 4PNKA 2C30A 2QI8A 4JDJA 3FYKX 4MF0A 5JRQA 3FMLA 4DFBA 2OF4A 4MYGA 5DGZA 2B52A 4GFGA 4U81A 3W8LA 1Q3DA 4ASDA 4CXAA 3NEWA 1MUOA 3RZBA 3NIZA 1PXKA 5CSWA 3H0YA 2IPXA 5IDPA 3FSFA 4I5HA 3GT8A 3JUHA 1H0WA 4UWBA 2G9XA 3C1XA 4X2GA 2GS7A 5L8JA 1ZYCA 1CKPA 2JIUA 5KMIA 1I09A 2F49A 1V0PA 2BRNA 4E5WA 5CF4A 1Z5MA 2CDZA 4IEBA 4TYHB 4F9YA 3VULA 1YHSA 1PMVA 1A48A 2BRBA 1PMUA 4IJ9A 4JRNA 5EQEA 3R9NA 3D5XA 5JSMA 4R6VA 4YC3A 4WBBB 1K3AA 4Z55A 5KBQA 4FKGA 4EC8A 2J0LA 1P4OA 3UIXA 3A7GA 4BC6A 4CRSA 4IACA 4CRLA 3G5DA 1IG1A 4BBMA 4GVJA 5FP6A 2X81A 4YHTA 3EIDA 3FZRA 3GOKA 4UMQA 3ZC6A 2QR8A 5AV2A 3K3IA 3RHXA 2CN5A 4FT7A 4NIFB 4CLJA 5M56A 3R9HA 3HAVA 1CSNA 2XNEA 4XOYA 2JDOA 5E1EA 3BHYA 3TN8A 4BCQA 1M7QA 1I44A 4TYHA 4XP2A 3WE8A 4E4NA 3PZHA 4XBRA 1JPAA 3VS7A 1TVOA 2FSLX 2IWIA 3A8XA 5HKMA 4MNEA 2XIRA 1FOTA 2WB8A 3E8DA 3OZ6A 3FZPA 5CLPA 4GH2A 4PL5A 5E1SA 4EK8A 4JDIA 4IX5A 2PE1A 2H6DA 5HTBA 1OKVA 2QO2A 3OROA 1H1WA 2A27A 4O7ZA 4IADA 5EW8A 3S00A 2X8IA 3F3ZA 4I0SA 5H2UA 4WUNA 2YEXA 3LXPA 3ORIA 4NIFA 5F9EA 5AWMA 5I9XA 2PUIA 2C0IA 3V5LA 3NR9A 3S95A 4AT4A 4C61A 5DEWA 1PYXA 5FG8A 1OKWA 4O7NA 3D7TB 4DH5A 2RSVA 4IVDA 4J1RA 5FQDC 5J9YA 2GTMA 5HX8A 4HGLA 1YHVA 2IZRA 4YJTA 4CEGA 4MK0A 2YCRA 2Y8OA 2YN8A 4MXXA 4AGUA 4ACMA 2QURA 3Q4ZA 4FBXA 5AV1A 2F9GA 3RAHA 3SG9A 3GC8A 3AMAA 5HVJA 2QOOA 5FXSA 4CKJA 3R30A 4M8TA 4WNOA 4X2NA 4BCNA 1YXUA 3QKMA 2VTMA 3QA0A 3P78A 3VBVA 3DTCA 3KRRA 3DKCA 4EI4A 1JSTA 3QHRA 2A2AA 3ORLA 3PVBA 3UNJA 2HW6A 3EFJA 3W2CA 4QT1A 5CU3A 3TDWA 3NW7A 3ZBXA 4KBAA 4BYIA 3ZRKA 2WTWA 1RE8A 2XA4A 1H08A 3EMGA 1PMEA 3LVPA 3SW7A 5IQFA 4B8LA 4II5A 3QWJA 2CKQA 4IZYA 4IDVA 4F1MA 3UE4A 4CFNA 4AF3A 2X8EA 4OW8A 3Q9YA 4DEDA 3ZLXA 1DI9A 3HV4A 4QYFA 3JYAA 3MJ2A 3CE3A 3V8TA 1OVEA 4XV1A 3ZXZA 3OMVA 3PG1A 3QX4A 3KXMA 3FUPA 2BKZA 2C0TA 5AP3A 5LARA 4EH2A 2O2UA 2CGWA 3LAUA 2OJGA 5EKOA 2AUHA 2UZWE 3W33A 3HX4A 3PXYA 3BWFA 2ZB1A 3AC2A 4O0TA 2F4JA 1IRKA 2B53A 5IKWA 3UTOA 3A8WA 5HBHA 2G2HA 2VTLA 5K0XA 3P4KA 2GNIA 4N0SA 3FPQA 3PJ3A 1JVPP 4YMJA 2XF0A 4UMTA 4G3FA 2W1GA 5BPYA 4DHFA 4EYJA 5GIPE 2BILB 4HYSA 5HVYA 4XG8A 5JH6A 2ACXA 5DBXA 4TL0A 1OPLA 5B2KA 4FTQA 3ZH8A 4C4JA 4QYHA 3VJOA 3WYYA 4UZHA 5BYLA 4AUAA 4ZTNA 4PDPA 3OY3A 4TPTA 4PPCA 5E8SA 3UG2A 4KA3A 2YLFA 2GDOA 4C58A 3DV3A 4K11A 5IEVA 3HDMA 4FIEA 4D1ZA 3U6HA 1NW1A 4N6ZA 4EKLA 1PYEA 2ETRA 3BCEA 3L1SA 4I23A 3PPZA 2ZVAA 4FSRA 4IE9A 2RG6A 2BRGA 3VS1A 1ZYLA 4F0GA 3F2RA 2RL5A 3U6JA 4UXLA 2YM7A 4WD5A 4ZIMA 3ZO3A 5LWNA 2C0OA 2J0MB 2Z2WA 3ORKA 4HNFA 4K2RA 4MBLA 4O6LA 4I20A 4XX9A 4Y95A 4EJNA 2HIWA 4NUSA 3K5VA 4LMNA 3OCSA 2P0CA 4FTIA 3KRLA 4FI1A 4YPDA 5D12A 2VTSA 5EYMA 3R02A 5EI6A 2BDFA 3PJCA 2VWYA 2ETKA 4JRVA 3D0EA 4QQJA 3SAYA 4E1ZA 2GFSA 3E63A 5HVKA 4F4PA 4TWNA 4MKCA 4HYUA 2VTTA 3RBWA 3R28A 3SXSA 4EYMA 5IUIA 4FSUA 3ZOSA 3IK3A 3QUPA 4DBNA 3EQGA 4GUEA 1V0BA 4ID7A 4RJ7A 1LPUA 4AT5A 3Q4TA 3CCNA 4AN3A 5LMKC 4FKWA 4BBEA 4USEA 2QG7A 4FUYA 2EUFB 2QKRA 2BCJA 3GBZA 2NNWB 4KRDA 4QPMA 4QMUA 2OH4A 2A4LA 2HZNA 5H8GA 2HY0A 3MH3A 3R73A 3CXWA 4FX3A 3HUCA 4L3LA 4L3PA 4FKPA 3CIKA 4FZAB 3QQGA 1WMKA 2DS1A 3OCTA 4G6NA 5CSVA 2WTJA 2C69A 3QCXA 2PPQA 3JY9A 4UMPA 5BUEA 1OBGA 5KNJA 3CC6A 3EH9A 4DEIA 4EOMA 1U54B 3KCFA 5BVFA 3MBLA 3R01A 4XEYA 4UWCA 3EN9A 1ND4A 4OTDA 4KS7A 3W2QA 1U5RA 3NAYA 3P23A 4EHVA 2BMCA 5M57A 1OIQA 4IZ5A 2R3GA 1OBDA 4P5QA 3NUXA 2CCIA 2W1DA 2Y4IB 2YACA 2F7EE 5G6VA 4BDBA 2WMSA 5B2MA 2ITPA 3LCOA 1YQJA 4EBVA 1WBTA 4H58A 5FXQA 2AC3A 5C4LA 2R3FA 4IW0A 3GCQA 3T3UA 5CAQA 4RC2A 4F7JA 4YC8A 3LFEA 3VS4A 4FMQA 1U54A 5HGIA 2VWUA 1GIJA 3A2CA 5D41A 4QMWA 4YURA 4M69B 4AZVA 3W55A 1QPCA 3PUPA 3OBJA 1WZYA 2W1CA 3AC4A 3JVRA 4IZAA 5LCKA 4CFWA 2QD9A 1W84A 3ZLSA 3GOPA 3HV3A 4G3EA 1UKHA 4C7TA 1GY3A 3LLTA 5BVKA 1TKIA 3FMMA 1KOAA 1YI4A 4JVGA 5HESA 4XOZA 4A4XA 1WBVA 4I4FA 4FC0A 1XKKA 2WMBA 4K0YA 4O0WA 4F64A 1Y6BA 2VTJA 3VUKA 3DDPA 5DHJA 3B2TA 4NWMA 4JG6A 5TO8A 3RPVA 4RFMA 5GJDA 1ZZ2A 4BHZA 5DEYA 4D2PA 5M51A 3QQJA 2VZ6A 2XZSA 3GU8A 3MFSA 1P14A 2OI4X 3NUUA 3HMPA 4J52A 3G33A 4RVLA 5KE0A 4AW1A 1NY3A 5AUUA 5LMKA 3TUBA 3LPBA 2CLXA 3A4OX 3O23A 4M69A 4Q2AA 2X9EA 3VS5A 5HCZA 4DGOA 3PVWA 1QMZA 4H36A 4DFZE 5KZIA 4RA5A 1BL7A 3JPVA 3LJ2A 4W4VA 1BLXA 4N70A 4UN0C 2OFUA 2PZYA 3WARA 3KXNA 2Y0AA 1OMWA 4UV0A 4J8NA 4YP8A 4IAFA 3UNZA 2FUMA 5BVEA 3U6IA 2ITOA 4X2KA 4DG0E 1OI9A 5FD2A 1ZMUA 4RZVA 3KK8A 1E1XA 4GT3A 3MESA 2FSMX 5CU2A 3BYOA 3ZYAA 3NYOA 4BCPA 4FG9A 4D55A 4S31A 1Y91A 5DN3A 4BDJA 4ASEA 2WO6A 2JD5A 3QF9A 2P2HA 3F2AA 3O8UA 1X8BA 5AP5A 3WBLA 5DWRA 3R22A 5DE2A 5LVNA 2PZRA 3GNIB 1A06A 5ANEA 5B2LA 3O17A 5E4HA 1VYZA 4MQ2A 4JDKA 4A9YA 1TQMA 4FIIA 4U97A 1KE7A 2BIKB 3VNTA 2WEVA 2NP8A 3I5ZA 3DZQA 4MWIA 3FKLA 1W83A 4TXCA 4GVAA 3VHKA 4H3BA 5HTIA 4U79A 5CSHA 1CDKA 3BI6A 2EVAA 3KULB 2XNGA 4BDGA 5C1QB 2ZB0A 4E93A 4O84A 4HVIA 2IVVA 2QC6A 2YM5A 3BHHA 2ZMCA 3TWJA 4EOSA 2Z7SA 4BIBA 4EOOA 1XO2B 3AT4A 5J9LA 1R78A 5HI2A 5I9YA 3V5JA 1CMKE 5HE3A 2OH0E 1YVJA 2XP2A 4JBPA 1FMKA 3TDVA 5JZNA 2BHHA 4PUZA 2B9JA 4I22A 5IU2A 5AM6A 4JQ8A 3OS3A 3NS9A 5A4QA 3FMKA 3KEXA 4O0XA 4FNZA 3RK9A 4CCUA 4M66A 4F1OA 4RFZA 4XG9A 4BTFA 4UXQA 3MPTA 3W18A 4NSTA 3COHA 3LLAA 5C4KA 3OWKA 5EHLA 2XKCA 4EBWA 3GQIA 4I0RA 2E9OA 5E8XA 3RWQA 3KULA 4DITA 3ITZA 4OLIA 3UPZA 3BU6A 3A7IA 3EN4A 4QOXA 1V0OA 4BI2A 3OW3A 4BDKA 4FV3A 4D58A 4O86A 5GZ8A 2PSQA 2UZNA 3OTUA 5HLPA 5AP7A 4DFLA 4GRBA 3MPAA 4DCEA 2X1NA 3HKOA 5AR4A 3KU2A 4HOKA 3ZFXA 5GZAA 4GL9A 2PYWA 3NCZA 3OFMA 1G3NA 5DR6A 1XBAA 5LXMA 4EL9A 5CVGA 4XBUA 4X6RA 3AQVA 3ZXTA 4BDFA 4DGMA 3TUDA 4O82A 3R7GA 4FL3A 3OEFX 4IB3A 3TACA 5M55A 4TT7A 2GS6A 3P7AA 4HVDA 2WTKB 2PTKA 2GQRA 4J96A 4L67A 4ZZNA 3MA6A 4I5MA 5DT0A 2O5KA 2R0UA 4I21A 4W8DA 3ULIA 2VN9A 4J97A 3KMUA 4FIGA 3KREA 2ZV7A 2F57A 4LGHA 3CQUA 4LUDA 4Y85A 1T46A 3THBA 4BDAA 2UW4A 3MPMA 3RCDA 4PQNA 4FV0A 4JXFA 5F20A 4FV9A 4B0GA 1ZYJA 5EI8A 5CY3A 3LXKA 2XM9A 1UU7A 4BYJA 3UPXA 5LVPA 4HZRA 3PIYA 1ATPE 4U45A 4QMZA 4A06A 3CPCA 5I5ZA 3EZRA 4FT5A 4XG3A 3TUCA 2Z7RA 4AGWA 4XMOA 1Y8GA 2BAQA 2VO7A 2VV9A 3P7CA 5KHXA 1KOBA 3FZSA 3FHIA 2HELA 4X3JA 4D9TA 1WBOA 3IW7A 2VTRA 2CSNA 4BCMA 3V5QA 4E73A 5CEKA 3HV5A 3R9DA 5L6OA 4YLLA 5AM7A 2PHKA 1XH5A 3AC8A 3BLRA 3NYXA 3EFKA 4Y46A 4CMUA 5I9UA 3HMNA 4UMUA 5L6PA 4GS6A 3EN5A 4FTAA 1Q3WA 4RLKA 4QMMA 4AGDA 5I9ZA 3F6XA 2J0IA 3NUAA 1JLUE 3DKOA 3KRWA 2PVLA 3V8SA 4IWOA 4RWIA 1PY5A 4XRJA 5HEZA 4DGGA 1K2PA 2YDIA 4RVMA 4OBOA 1M17A 1O9UA 4FKQA 3JR1A 3CD8A 2HZ4A 2J50A 4O0YA 1Q8TA 5BYYA 5CT0A 4LMUA 4M0YA 2XJ0A 1IA9A 1B38A 4O21A 2W4OA 3MI9A 3QD3A 1UKIA 3FE3A 4PDOA 5BVOA 2CKEA 4KD1A 2PL0A 4YZNA 4I4EA 3FMJA 4QP8A 3QTRA 3COIA 4ALVA 4Y73A 4D4VA 1B39A 3MFRA 3TM0A 2BZHB 1URWA 4KIPA 4FZ6A 3LQ8A 4BCGA 2BPMA 2XK4A 3L9PA 3ZDIA 4HCUA 4D2WA 2ETMA 2YCSA 3EZVA 1YXTA 3C51A 4JI9A 4MEDA 5GHVA 2I6LA 2JIVA 1HCLA 1ZMVA 4E3CA 2HAKA 4CV9A 5CANA 4ZY5A 4M97A 2CNVA 2I1MA 2XH5A 2WMUA 1OL6A 4G2FA 3UODA 4QP9A 4USFA 5CU6A 5IZFA 1O6YA 3C4FA 3MN3A 4GJ2A 1YHWA 4FT9A 4LM5A 4JIKA 1SMHA 4FKJA 3ATTA 4FR4A 3DPKA 2OSCA 1WAKA 3UZPA 5BMMA 3ATSA 1XHAA 4YTIA 3IOKA 2WTKC 3ZU7A 3PA5A 3AT3A 2WQOA 4DCAA 4AFEA 2P4IA 4O0VA 5GNKA 4DTBA 5EYCA 3SC1A 4EHGA 2OKRA 3SG8A 4YR8A 3RP9A 5K9IA 3DY7A 3KA0A 3DDQA 3JVSA 4IM2A 4JX7A 4BDCA 3T3VA 4LUEA 2R3NA 3EQDA 3DXNA 4KRCA 2V62A 4LFIA 4F09A 2W7XA 4DINA 5M06A 5JKGA 3U4WA 2W1FA 2BROA 3EQRA 3VVHA 4BCOA 3ZFYA 2QOLA 5CALA 5EM7A 3QRKA 5J5SA 5H9BA 1SYKA 1ERKA 3IDPA 3C4EA 4I1ZA 3IPHA 3FXZA 5L8KA 4A07A 3QUEA 4RJ6A 4ZXTA 2X9FA 4AACA 4EWHA 4IWPA 3CSVA 3EL8A 3PXZA 3OWJA 3PXFA 3G2FA 3I5NA 3QYZA 1F3MC 1UWJA 3EFLA 3HP2A 3QCSA 1E9HA 4ZTQA 4PV0A 3CTHA 2RG5A 4I0TA 4C35A 1YXXA 2WMVA 3FKOA 5KCVA 3CS9A 1NVSA 3AC5A 2XK8A 5E8ZA 3AD5A 4UEUA 2GHGA 2Z8CA 3U54A 1H28A 4TNBA 4RIXB 4F9CA 2Z02A 2AC5A 5HBJA 2IG7A 3V3VA 2OIBA 2XCKA 3T8OA 3IW6A 3R8PA 3TNQB 1GZOA 2FH9A 1XBCA 1JKSA 3GUBA 4NK9A 4HW7A 5EG3A 2OXYA 1QL6A 2OJ9A 1Q62A 3MS9A 1MRVA 2UZOA 2VTNA 4DH8A 3F7WA 2YABA 4ANSA 4KAOA 2DUVA 4YJUA 5K0KA 2C5YA 2XNBA 3FXXA 3ALOA 3JXWA 4MD9E 2X6EA 3U9NA 2XJ1A 4C4HA 5E8TA 3SW4A 3LKMA 1SNUA 5DR9A 5AUVA 4OAUC 5IQCA 4FVRA 4IAZA 3F2NA 4HVGA 1GJOA 3C4CA 4R1VA 3RALA 5B0XA 4NTTA 4XRLA 4U6RA 1GIHA 3FC1X 3UC3A 4YLKA 1GIIA 2NPQA 4P2KA 4DFXE 4R3CA 4RIXA 1OB3A 4F9WA 4OR5A 2AYPA 5M4CA 4J71A 3B2WA 4J53A 4YBJA 4BL1A 1BUHA 3FMEA 4U7ZA 5JZJA 2JDVA 4YJOA 3BV3A 3QC4A 4O96A 4GU6A 3WF9A 2FVDA 3IDBA 3E3BX 4E6DA 3G6GA 5AUTA 3BZ3A 4RWJA 2OXDA 5AUXA 5L4QA 4FV8A 4FYOA 2C5VA 4C0TA 4WNMA 2WAJA 3ALNA 3R7UA 2WTVA 3OWLA 4Y83A 3POZA 3SQQA 5K4JA 2XS0A 2YIWA 1M7NA 3AGLA 3FLYA 4KWPA 3DT1A 3BE2A 2Y9QA 5DRBA 3VW8A 3I60A 4BTMA 1R0PA 3NPCA 4FNXA 1W0XC 4EJ7A 2VGPA 4EK3A 4BN1A 4YU2A 2JGZA 3PJ2A 2OGVA 4DGLC 2B4SB 1U59A 1JNKA 2O64A 2CKPA 1MP8A 1XBBA 4O83A 4BZOA 4JBQA 2XB7A 3VBTA 4EZ5A 1Q8YA 3NNVA 4MAOA 5AP1A 2VO3A 4QNYA 4FYNA 3S3IA 4W4WA 5DT4A 4WO5A 4EH9A 4GT5A 1YI3A 4BGHA 4MNFA 4FSYA 4K33A 2VWVA 1PRYA 4NCTA 2X7OA 4FV4A 4CGAA 1KV1A 3NVKI 3E88A 1GZNA 2XK3A 2VWBA 1Y6AA 5HNIX 1M2PA 4HYIA 1BI8A 4FTNA 4TYGA 3R63A 4MCVA 2R3PA 4GK4A 4OTFA 5EQPA 2G2FA 4OT6A 2VTPA 2YERA 1XR1A 4K9YA 3O8PA 2C6LA 1OECA 3H10A 1DAYA 2PUPA 4MNEB 5IH6A 4JBVA 3BHUA 3V8WA 4S34A 3L8PA 2CMWA 3DJ6A 5FDXA 4LG4A 3DBQA 3LXNA 5FEEA 4QYEA 4YBKA 2IZUA 3G0EA 3AT2A 3QRTA 4ZTRA 4E4MA 4F63A 5A3XA 4IB1A 4UWYA 3ZM9A 3QKLA 4X7QA 3O71A 1YW2A 3F66A 4FF8A 5C01A 2C3KA 2GQSA 2C6OA 2XBJA 3SHEA 1RDQE 4IVBA 4ZK5A 3QGYA 3O2MA 3TZ7A 5DT3A 3DB6A 2UW6A 3HEGA 5IQIA 3HDNA 5EYKA 4AP7A 2ZV9A 3PRFA 4QMPA 3K2LA 4KBKA 4WHZA 3FBVA 3WI6A 1WBWA 5HG5A 1REJA 4PMMA 3SD0A 4DH1A 3LCKA 2W0JA 4CZUA 3H9FA 3QQHA 2R5TA 4EONA 5HG9A 1UWHA 2UZTA 3PRIA 3QUDA 3EKNA 4R8QA 5AIRA 2WMXA 5AV3A 4QD6A 4PPBA 2R3JA 4GU9A 5M4FA 3ORMA 5HD7A 1PXPA 4FV1A 2IVTA 1SVEA 4DLJA 3AXWA 3SA0A 1SZMA 1JSUA 4RG0A 2PWLA 3A99A 3PG3A 5AR5A 4B6LA 4LRMA 2VTHA 3G9NA 1UNGA 1YWNA 2YFXA 4QTBA 2REIA 4NT4A 3VAPA 2ITNA 4XG2A 3OOGA 5ANJA 5E8VA 3VUHA 3BX5A 4QMYA 4NCTC 4QQ5A 3UP7A 3O7LD 2ITXA 2W06A 1XH7A 2I40A 3NYVA 4WBOA 3ZEPA 4C4EA 1RJBA 4C37A 4QP2A 3IW8A 3F61A 2HYYA 5GZ9A 3W8QA 3UMXA 3P86A 3PZEA 4ZTMA 2W4KA 4QRCA 4FZFB 5ACBC 2W99B 5KKRC 5ICPA 4KUJA 2W17A 4ANLA 3DAEA 4G9CA 4AW5A 4BKYA 3TTJA 4XP0A 3ROCA 2XK6A 2O63A 4DTKA 4YO4A 2UW3A 4BKZA 1OL1A 4HGEA 4G3CA 1PHKA 2WQNA 2Q0BA 2B1PA 1R1WA 4BHNA 5FTGA 2QODA 4ZZOA 3QQUA 2ZAZA 2JFLA 3F3UA 3LE6A 4UALA 3F69A 3HAMA 4IFGA 5D10A 4G34A 3TJDA 2EB2A 4BB4A 4G3DA 5IUGA 3F3VA 3QL8A 4G3GA 4GKHA 3OG7A 4R77A 4XHKB 3VUDA 5JFWA 1KSWA 3FL5A 4RQVA 4CMOA 5LQFA 3ELJA 3L8SA 4FKOA 3C4WA 4ARKA 3GU5A 4L45A 2YLEA 1PKDA 4G9RA 4NM0A 2SRCA 3V04A 3R2BA 2EB3A 4ZSEA 2CKOA 2W1HA 3GXLA 3ODZX 3ULZA 4IJPA 1OGUA 2PVRA 4RBLA 2OJJA 4FODA 3ZFMA 5IEYA 4QYGA 3AMBA 2W05A 3Q04A 2WTIA 2XRUA 2C1AA 4QTCA 1ZY4A 3ZZEA 4NFMA 4ZLZA 4M3QA 3NNXA 2PK9A 5AAEA 1QPJA 4E6QA 4I6FA 4D28A 2HZIA 3UOJA 1F5QA 4KIQA 5LMBA 3DNEA 3CQWA 2QHMA 1W98A 1FVVA 2UW7A 3HZTA 3N9XA 4G6OA 4M15A 4RRVA 4IDTA 5CVFA 5J5TA 5I9VA 1GZ8A 3OCGA 5IEXA 5LVMA 3BE9A 3DA6A 3SXFA 4E8AA 4BWPA 4AW2A 2P55A 4YGAA 2C6TA 5ETFA 4P90A 3UIMA 2CHLA 4J95A 1M2QA 2JAVA 3UNKA 4O7TA 3O0GA 5F95A 4AE6A 3ACJA 3OT8A 5EM8A 4AOTA 1YDRE 2HWOA 4EH7A 3A7FA 3MB6A 4ZSAA 3EKKA 3LIJA 3W10A 5BQ0A 5DR2A 4JX3A 2RKUA 2PZ5A 3D14A 4JR3A 4OT5A 2J5FA 5L2TA 3QZFA 4RLLA 5LJJA 5E9EA 3QLGA 4L7SA 1SNXA 2B54A 4U8ZA 5HIEA 1JKLA 3O51A 5GJFA 1Q8ZA 3NAXA 4FT3A 4FTKA 5CF5A 5M09A 2PVHA 4W8EA 1CKJA 4M12A 2Q83A 5EH0A 3LQ5A 4FK3A 4IXPA 4AZTA 5J8IA 2ESMA 3KXGA 3R1NA 4I6QA 4AN9A 4YLJA 4KS8A 3DJ7A 5DFPA 3FSKA 1FINA 2QU6A 2JKMA 4ZJJA 5A6OA 3Q2JA 3IQ7A 4FEQA 1OIYA 4WOVA 2BUJA 2YZLA 4S30A 3ZSIA 3N4VA 1DM2A 1UNLA 4L68A 4D4YA 3DK3A 2GNJA 3WF8A 3MH0A 3ZS5A 3V6RA 5DNRA 2A0CX 2PU8A 3CY3A 2OFVA 4DEBA 5IPJA 3VHEA 4BGGA 4HJOA 1H07A 1H0VA 4JNWA 3QC9A 3Q96A 3EQCA 3GC7A 3DAKA 4F99A 5CSXA 4DBXA 4YPSA 3E87A 2J0JA 4BZDA 1OKYA 4GG7A 4XV2A 3EQHA 4IANA 5EYDA 4GFOA 1Q5KA 5L2IA 4UB7A 3ZCLA 2B9HA 5EM6A 5JFVA 1AGWA 3KVXA 3O8TA 3D4QA 3QTQA 4JIAA 4NFNA 3HYHA 1Q97A 3G9LX 4YZMA 3OY1A 5BVNA 2X4FA 4N6YA 3C0HA 1ZARA 4F70A 4CG9A 3IS5A 3QTUA 2VD5A 4L46A 2PVMA 3HMMA 1B6CB 5AUZA 3FI3A 4O38A 4ITIA 4FKTA 5M08A 3B8RA 3ZLWA 1Q99A 4R7IA 2RIOA 1UV5A 4MXCA 1H4LA 3MTFA 5KMOA 3R9RA 5FBNC 2OZAB 5HBEA 4O7SA 4ZS4A 4AZEA 2CCHA 4PTGA 3QWKA 5CT7A 1CKIA 4U9AA 3MFTA 2ZM4A 3C4ZA 5BUIA 2O3PA 3CD3A 1J91A 1GNGA 2PVFA 1J3HA 4OBPA 4H39A 4D4SA 2X39A 3P1AA 4YJQA 3LFQA 5HIDA 3RWPA 1YWRA 4CFVA 4IB0A 5AIKA 3U51A 2YJSA 4BCFA 4DN5A 4FK6A 5A9UA 3NW5A 2YDKA 1ZY5A 4QMTA 4QYYA 4TZRA 3LFDA 2LAVA 1U46A 2WQBA 4AOIA 4FKLA 4QTDA 4AT3A 4ALWA 4YC6A 3C5UA 3DKGA 3BHTA 3MIAA 4ALUA 2OZAA 3T9TA 4YUQA 3H0ZA 3ERKA 2PE2A 3OD6X 3MY5A 3BWJA 4EQMA 1DS5A 1QCFA 4CT1A 1H1PA 1VYWA 4XLIA 3ACKA 3Q6UA 2QOIA 4YSJA 5CAOA 4FZ7A 2BZKB 3BQCA 3PJ1A 3PLAE 1UU8A 1WVWA 2XNMA 3LW0A 3FV8A 5HIBA 2GNGA 5HNBA 4D9UA 3SGCA 3HL7A 2UV2A 4ASZA 4YNEA 2X2KA 3I4BA 5IA5A 3UDBA 2YA9A 3EN7A 3QA8A 3WYXA 4F0FA 3LFCA 1G8AA 1YDSE 3E64A 1H00A 1KWPA 4GSBA 3ZHPC 5TF9A 4ZEGA 3BYMA 2GPHA 3DKFA 3ODYX 4DTAA 4PP7A 4UY9A 3K5UA 4FEXA 1WBNA 3I79A 4XUFA 4LI5A 3RNIA 5AP6A 1OL2A 4X3FA 5LVLA 3WF6A 4C3PA 3E8NA 4TWOA 4BTKA 2FSOX 4U42A 4HPUE 1P2AA 5F4NA 3FKNA 2GHLA 2XK9A 3I81A 3LM5A 4ZY6A 2DQ7X 3RZFA 4XH6A 5CEIA 1Q61A 3QU0A 4NW5A 3UBDA 3VUIA 3TNIA 3AC1A 4AOJA 2HK5A 5AR3A 3TZ8A 5JFXA 1BI7A 4L3JA 3BYVA 4NM3A 3Q4UA 3BELA 3NUSA 2FYSA 1FQ1B 4MXOA 4R5SA 3V5PA 2X2MA 5EDRA 2ZV8A 4D5HA 1VZOA 5I3RA 4PF4A 5FEDA 3U9CA 4IX6A 4YZCA 2JFMA 2CLQA 3LOKA 3PPKA 4RFYA 3OW4A 4A9SA 1OITA 5CEPA 3GB2A 3PXQA 3G90X 1Z57A 4QMQA 4RIOA 3SKCA 4ZJIA 3TEIA 2W1ZA 3LFNA 4JJRA 4UMRA 3R8UA 5HLNA 2XKDA 1J1CA 2Y6OA 3R83A 5CEMA 5IF1A 3FZ1A 2WU7A 3IECA 2V22A 4DC2A 4O0RA 2VU3A 2W9ZB 3ETAA 4RVKA 3UC4A 2JC6A 4EOPA 3CTJA 1KE5A 4E26A 3KXHA 2PUUA 5H8EA 4CQGA 4FICA 1OPJA 3TV6A 2B9FA 4DFNA 3NZ0A 4A9RA 4D2SA 1KV2A 3PSDA 3VW6A 4RT7A 4OBQA 4PTEA 1Q24A 2ITVA 2EWAA 4FA2A 2O0UA 2DWBA 3RAWA 3MY1A 1PXJA 4XG6A 3FL4A 5H8BA 1OUYA 3C0GA 4WKQA 3MH1A 3I1AA 2YM8A 4I5PA 4IAIA 3QALE 2JEDA 1TQPA 4FSMA 1APME 1XH4A 2A19B 3KN5A 3OUNB 4FTLA 4DFYA 4DEHA 4TYEA 1H27A 2UZUE 3UQFA 3GGFA 4PX6A 3GVUA 5DRDA 2F7XE 4CVAA 2GNHA 4G1WA 4D2RA 4LOPA 2HXQA 3CY2A 5DIAA 5CF8A 4E5BA 2UW0A 1XQZA 3TT0A 1P5EA 2BIYA 2VNYA 4X3FC 3TJCA 4IB5A 4C2WA 5HORA 5AFVA 5CQWA 2E9UA 3KF7A 5HTCA 2PY3A 5AP2A 4APCA 2R9SA 3H4JA 4D0XA 4Z3VA 2YCFA 3UOKA 4JAJA 5D1JA 5L2QA 3WZEA 2VX3A 4RJ3A 4KSPA 4C4GA 5M4UA 4ONAA 4CSVA 4QPAA 3VBYA 3GP0A 3RI1A 5HG8A 1Q41A 3L8VA 5HOAA 1VEBA 3FPMA 5CI6A 4JS8A 4QMSA 2C3LA 2Z7QA 5TKDA 4NKAA 1REKA 1WBPA 3DQWA 1H26A 2JBOA 1XWSA 2HCKA 5IQEA 2H9VA 4IFCA 3F9NA 2VWXA 5D7AA 3ZZWA 4R3RA 4AFJA 4IMYA 3LQ3A 1H25A 2WQMA 3R0TA 2O65A 4MBJA 4BVUA 4E4LA 5DA3A 4IX3A 3A4PA 2JKKA 4LGDA 5CI7A 5EI2A 3VBWA 4BY9E 1UVRA 4FVQA 4BGQA 3PSBA 4E20A 5K4IA 2ZV2A 4GYIA 5AR7A 4A4OA 4FV6A 4DEEA 3VN9A 2C6MA 4A7CA 2HENA 4ZTSA 5JN2A 4M68A 2Z60A 3MVJA 2OIQA 3CEKA 3EN6A 2ERKA 3PPJA 4BCHA 5JQ5A 3LFAA 4IHPA 2YAKA 4MTAA 4DG3E 4FKIA 5AAGA 5KZ0A 3P08A 4W4XA 4AZFA 5C8NA 4M13A 4HGTA 2IW6A 4O6EA 2YAAA 2GTNA 4U3ZA 5M07A 3LMGA 5T3QA 3DXPA 4RWLA 1RW8A 4QP4A 3HRBA 1IEPA 3MA3A 3ENHA 3HRFA 3VS0A 3AMYA 2PMOX 4FKSA 3TTIA 5JGAA 5AA9A 4H1MA 5L2WA 4EK5A 3TNWA 3AD4A 4AX8A 3DLSA 3QQFA 2WHBA 1Q8UA 4ANQA 3AGMA 4UZDA 4WRGA 4EKKA 5LCJA 5C9CA 4H05A 1ZLTA 3MTLA 4KABA 4O7VA 3BGPA 3I0OA 4RZWA 4X21A 3ZRLA 4BI1A 3L8XA 3NUYA 3UIBA 3BRBA 3P79A 4RJ5A 5IH5A 3W1FA 3F5GA 4QP6A 4GIHA 3FMDA 4FGBA 1XH9A 4PP9A 1VR2A 4DEGA 5JT2A 3R6XA 2ZDUA 1J7LA 2R3MA 3Q6WA 4RX7A 2OLCA 1M52A 3UVPA 5FXRA 4WSQA 1IA8A 2R3QA 5E8YA 2UW5A 2G2IA 1LR4A 4ANNA 5A54A 5EQYA 4QPSA 4BR3A 3FY0A 3BYUA 2RGPA 5EDQA 3RKBA 3FYJX 2C68A 2Z7LA 2HXLA 3PSCA 3CJFA 3ORNA 3R71A 4P7EA 3TNPC 3EYGA 3R9OA 4CD0A 5BNJA 5HD4A 1ZAOA 1NA7A 4Y72A 1R3CA 3I0QA 3TV4A 3DBCA 3IW5A 3PY1A 2OF2A 1H24A 3MW1A 3NWWA 4WG5A 5BVWA 5AEPA 2VO6A 2UVYA 4IC8A 2C6IA 2F2UA 3P9JA 4IM3A 4MWHA 4WT6A 4K1BA 2V5QA 3REPA 2WNTA 2BRMA 3AC3A 3ZO4A 4BRXA 3F3TA 5AR8A 5CAUA 3R8LA 3NX8A 3W32A 3E5AA 2H96A 1S9IA 4TYJA 3TL8A 3FMHA 1JKKA 3EWHA 5HO8A 3G15A 4UYAA 4OTQA 4FVPA 4EUUA 4F0IA 4U0IA 4FZDB 5HU9A 2I0EA 3Q9WA 1G8SA 1IAJA 4H3PA 5CNOA 4GV1A 4B4LA 3D83A 3RVGA 2WMTA 5AADA 1RQQA 4ACDA 2DYLA 5FWKK 5AAFA 3M1SA 2QOQA 4FEWA 4LOQA 3VUTA 3PA3A 3BEGA 2QR7A 4YJNA 2JDRA 4HPTE 2QQ7A 4UBAA 3DBEA 2C1BA 3BBWA 3EB0A 4ZLOA 1LUFA 1NXKA 3HLLA 3I7CA 3NDMA 2ITTA 3ZO2A 3RHKA 2VTOA 4H1JA 3Q3BA 3KVWA 3PTGA 5C27A 2IVUA 3WIKA 2IVSA 4IIRA 2YJRA 2P33A 4OGRA 3KRXA 1OL5A 1QPDA 5HHWA 1IR3A 3QTIA 2NRUA 3RM7A 4C02A 2C3JA 4QMNA 4KNBA 3FZTA 2P3GX 3E62A 4OTGA 4C3FA 2C3IB 4S32A 4XCUA 5J7BA 5ANGA 5BX0A 3NMUF 2HZ0A 5J79A 2FA2A 3W2RA 2PMLX 4YTCA 1PXOA 2WELA 5CASA 3DQXA 3NRMA 1HCKA 3UO4A 3WOWA 2GMXA 3DJ5A 5E92A 3G51A 2RF9A 3HA8A 3C13A 2W5HA 2XEZA 2YM6A 3PXRA 4JL9A 3MGYA 3SX9A 2I0VA 3MVMA 2XNOA 3GQLA 3OEZA 3Q9XA 1JKTA 4ITJA 4PMSA 5EW3A 4IAAA 5I3OA 3DU8A 4EC9A 1K9AA 4O7YA 5IA3A 2GCDA 3V01A 5L8LA 3RINA 1R39A 5FBOA 4X0MA 4FSWA 1MQBA 2WFYA 3HGKA 4LV5A 1NVRA 3LM0A 3OC1A 1L3RE 3QD4A 2XMYA 3UGCA 3OTVA 2ZM3A 1YI6A 5CEQA 4BCKA 4CMTA 5IMEA 4D5KA 2BKKA 4FT0A 4MVFA 5A6NA 1F0QA 2EXMA 4LL0A 4FL2A 4O2PA 4EORA 5KMKA 5HE0A 2J4ZA 4FTJA 4D2TA 2C6EA 4OTIA 1YKRA 3D7ZA 1OUKA 5IISA 3E93A 4FTCA 3VRZA 3Q9ZA 4L00A 5CVHA 4EH4A 3MJ1A 4ZP5A 3OWPA 4BWXA 3D5WA 4GYGA 3W16A 2CN8A 2JIIA 1KE8A 1YXVA 1YOLA 4OUCA 4IAKA 3EQPA 3TKHA 4AA0A 1H1SA 1NT2A 4NZWB 4CFUA 2LGCA 4WG4A 3NSZA 4EHZA 2QU5A 4QQCA 4ANBA 5ANDA 1DAWA 2EXEA 1JOWB 4DT9A 4O1OA 3Q4CA 3D9VA 3Q60A 4XV3A 5KKRB 3G6HA 4YZDA 3GU4A 4HCVA 4BI0A 4PMTA 5CEOA 4WIHA 2ITZA 4HYHA 3KN6A 4PNIA 5CQUA 2V0DA 4QNAA 3UIUA 5K5XA 4LOOA 4D1SA 2X2LA 2GHMA 4NEUA 3DAJA 3F82A 4Y5HA 2C47A 2VWZA 1OM1A 2OXXA 3FZOA 3V5WA 3S0OA 3FEGA 3EQBA 3H3CA 3CJGA 1KE9A 4DT8A 4F7SA 5AP4A 3VS6A 1PKGA 4LGGA 1Q8WA 3CPBA 3KKVA 4TW9A 3PP0A 2XNPA 2X7GA 1GOLA 5D11A 2RFSA 2C4GA 3OBGA 4FTOA 4USDA 2EXCX 3RM6A 2VWWA 2XK7A 3C7QA 1YXSA 4MHAA 2E2BA 3TIYA 2WKMA 3ZC5A 2RFNA 3FDNA 4NU1A 4IWDA 4RPVA 2UW8A 5D9HA 4PTCA 5DH3A 5E8UA 3BU5A 4AWIA 2IZSA 4AG8A 4C2VA 4XLVA 4ZAUA 5DYJA 4I94A 4GK3A 2X4ZA 5HZNA 5IQAA 4HCTA 2R0IA 5HCYA 3GI3A 4YTHA 4FV2A 2BDJA 4WA9A 4IAYA 4F6WA 4IX4A 5M44A 5L6WL 1EH4A 4FG7A 4CT2A 3RNYA 3F5XA 5GJGA 4RGJA 4NYEA 2XIKA 2RFDA 3DOGA 3TKIA 4GJ3A 5FP5A 3WIGA 4QP7A 3KY2A 4TN6A 2ITUA 2W5AA 4AQCA 2H34A 3ET7A 2YWPA 3Q2MA 3R7IA 4RJ8A 4U43A 2YITA 5DLSA 4IQ6A 4XP3A 5FEQA 4KSQA 5HX6A 4L44A 3E92A 4FE2A 4ZLYA 3RK5A 1UA2A 4FOCA 3LCTA 2XJ2A 2R2PA 4FTUA 3C4XA 4GW8A 5F1ZA 3OUKA 3CQEA 3C0IA 3DTWA 2WTCA 4M67A 3MY0A 5A4TA 5M53A 4PMPA 3S1HA 3DBDA 4H3QA 4BICA 3KQ7A 2VTIA 4JT3A 2WGJA 3AOXA 1XH8A 4NW6A 4ACGA 4RX5A 4D0WA 4C8BA 4RA4A 4W4YA 2ERZE 3JS2A 4BDIA 4DGNA 4I93A 1IAHA 4FSZA 3UZRA 4P4CA 4OTHA 2QLQA 1PXNA 2V7OA 2YCQA 3DFCB 3NNUA 4C36A 3QX2A 4F7LA 3RJCA 4JLCA 3POOA 2QNJA 4J8MA 1G5SA 4FIHA 4YHFA 5HE2A 4V04A 4BDEA 4Z7HA 2BAJA 5J1WA 3LCDA 3QBNA 5CTPA 3TZMA 1J7IA 1Z9XA 3ORXA 4I41A 2YZAA 2IW9A 4YJSA 1H1RA 5AP0A 4Z16A 1UU9A 2C6DA 3I6WA 4RC3A 5B7VA 3KF4A 2OK1A 4LYNA 3VQHA 4PWNA 4EOIA 4ZTLA 2QOCA 5HICA 4EHEA 3TG1A 2B7AA 3TXOA 3W2SA 5KMNA 3E8CA 3UVQA 5GINE 4YJVA 2XEYA 3M42A 2PVYA 5ETAA 2V7AA 4PL4A 4E5AX 4MXZA 5C03A 4ASXA 3FLWA 4PRJA 5JQ8A 3QYWA 2J9MA 2G01A 2XCHA 3U4UA 4PDSA 2OO8X 1BKXA 2IZTA 1DI8A 2ZOQA 3IG7A 3NYNA 1R0EA 4FSTA 4TRLA 3SOCA 3VQUA 5HQ0A 4MH7A 1WBSA 3KK9A 1OZ1A 2QO9A 4DA5A 5IMXA 1FBNA 4R78A 3QRUA 1BYGA 4NM5A 4R7HA 2WOTA 4ZMEA 3D7TA 2OG8A 4X2JA 3QKKA 4ZZMA 2QLUA 2NO3A 4LRJA 3L9NA 4FSNA 3ANRA 4ZMFA 4S33A 3R1YA 3VS3A 2WU6A 3VUGA 2WZJA 4KBCA 4GCJA 4J7BA 4O27B 1ZOHA 2VUWA 2X6DA 3OXZA 3RTPA 4AS0A 2C5NA 3VBQA 5A4EA 1PJKA 4ACHA 4G5JA 3QXPA 2XIYA 5A46A 2W1IA 3QLFA 2ZJWA 4AXAA 3K3JA 4C4IA 3HMOA 4XG7A 2PMIA 5BMSA 4UX9A 5M4IA 4FIFA 4RJ4A 2J6MA 4L9IA 4Y5QA 5A4CA 4CQEA 4I6HA 4RX8A 4RC4A 4WG3A 4RMZA 1GAGA 3HECA 2JAMA 2XM8A 3R7YA 3CTQA 2YIRA 3JY0A 4U41A 2UZVA 3M11A 2W4JA 1SVGA 3CP9A 2WQEA 4ZTHA 3MYGA 4M7IA 2OIDA 3MVLA 4GG5A 4B9DA 4ZY4A 3KMMA 2CGUA 3FLQA 5JGBA 4EQUA 3QZGA 3R7VA 1W82A 3E3PA 4JAIA 5FTQA 2RFEA 3C5IA 4AN2A 2JKOA 4PY1A 4QMLA 4BDHA 4WRSA 3P0MA 3UQCA 4KIOA 4WSYA 4NJDA 4BZNA 3N4UA 4X2FA 3CKWA 3ZO1A 2Y7JA 4X6QC 1OIRA 3BPRA 3OCBA 4XV9A 4D2VA 3PWYA 5IA4A 4NKSA 5I4NA 2XUUA 2XKFA 3RPSA 4ANOA 2PZPA 4EOLA 4EK4A 1STCE 1H1QA 3EHAA 3RAIA 2XYUA 4R7BA 2V55A 2PVKA 4BIEA 3DLZA 3ZLYA 3R04A 4U80A 4AAAA 4B7TA 3UOHA 1ZOGA 4HVSA 4FV5A 2JBPA 2EU9A 4MQ1A 4JQEA 4RWKA 4EH5A 3R8VA 4YSMA 2BVAA 5CZHA 1U5QA 3ENMA 3UVRA 3FI8A 3DGKA 3E7OA 4CKRA 3PA4A 2YDJA 2O8YA 4ZOGA 5EHOA 5E90A 5I0BA 4ITHA 3UYTA 3HRCA 3FLSA 4AGCA 4CTBA 1YOJA 5D7VA 2JITA 4KKEA 3FHRA 4G31A 3VBXA 4ACCA 2YIXA 2GQGA 1ZZLA 3H9OA 5J95A 5ANKA 3F3WA 5TT7A 3EQFA 4IH8A 1JSVA 2PMNX 4A9UA 4BCIA 1FGKA 1ZYDA 3TZ9A 3PP1A 3ZUUA 3DXQA 3D2KA 5T68A 3QGWA 3QAME 4FGRA 4DF3A 1BMKA 4KB8A 4U40A 4FIJA 4F6SA 4MXAA 4BCJA 4F7NA 2YM3A 4F1TA 2YHVA 3R7OA 4O7LA 5JK3A 4AA4A 2QOBA 3QZHA 1H01A 4AE9A 3I6UA 2GNFA 4EOKA 4J98A 1MRUA 5BVDA 2CGVA 3QTWA 2R3RA 4Q9SA 4YTFA 2W9FB 4GK2A 2XYNA 4CCBA 3IGOA 4FNYA 1PXIA 3NUPA 4JR7A 3A7HA 3FQEA 3LZBA 4OAVB 2J2IB 1Y8YA 3EJ1A 3R21A 2KTYA 4AW0A 4CFFA 4G5PA 2OWBA 3PY0A 3U87A 4C62A 2E9NA 4JOAA 5E91A 4LV8A 3A60A 3FJQE 3PFQA 3RPYA 2F2CB 3UG1A 4C57A 4IM0A 3GFEA 2PZIA 3O7LB 3UJGA 3BKBA 3LHJA 4XYFA 5HLWA 5EW9A 3F5PA 5EOBA 4KKHA 5ACKA 2BAKA 3QTSA 2Y4PA 3PYYA 2B0QA 4DFUA 1JQHA 2BRHA 3NUNA 3LMHA 5CF6A 2G1TA 4CFMA 2G15A 3E8EA 4L43A 4X3FB 5AUWA 3GC9A 2UW9A 2P2IA 2PVJA 1FPUA 3Q53A 4XNEA 5CWZA 4U3YA 4Z9LA 4C3RA 4EH6A 4C59A 4FKUA 4ERWA 3KXZA 2WPAA 4IVCA 1TQIA 3BEAA 4FL1A 2QOFA 5AR2A 3MSSA 4EOQA 5K5NA 3WF7A 4BKJA 2XKEA 1FVRA 4YHJA 4QTEA 2GS2A 2WMWA 3DK6A 3VO3A 3HNGA 4MXYA 4ZSGA 3RCJA 4CFXA 2J0KA 4JG8A 3WZKA 4NJ3A 2BHEA 3RMFA 4TYIA 1WCCA 1BX6A 3EL7A 3KFAA 3LCSA 4NH1A 4JBOA 5HE1A 2YISA 5L3AA 1YWVA 4XJ0A 2WMAA 3NIEA 3IO7A 3MVHA 4CYJA 1CM8A 3R8ZA 2JKQA 4CG8A 2C5XA 2JLDA 2XNNA 1PF8A 4AZWA 4C34A 3P7BA 5CSPA 4PDYA 3T9IA 3QFVA 1JBPE 3O50A 3BBTB 3IW4A 4NM7A 3NLBA 3QQLA 2Q0NA 2ZDTA 4KIKB 2QOHA 3KCKA 4L42A 4DH3A 4EK6A 2VGOA 1NVQA 1Y57A 4I92A 4ZJVA 4K8AA 3N51A 1ZMWA 4E6AA 4GT4A 2CPKE 3EYHA 3VC4A 4W9WA 3UMWA 4UYNA 2IW8A 5KX8A 4M0ZA 4AZSA 2R7BA 5DG5A 2UZEA 5EM5A 5JRSA 2WMQA 3Q52A 2W1EA 1FMOE 2CNQA 4NL0A 3S2PA 3ZONA 3VS2A 5CENA 4EH8A 3L9MA 3TCPA 2ZMDA 4KKGA 3P5KA 2HWPA 3ANQA 3DFAA 3GCSA 4JG7A 3A62A 4OTPA 2UZLA 2VTAA 2ONLA 3VUMA 4HZSA 3D5UA 3MIYA 3HV7A 5E7RA 3RPOA 2VX1A 3DS6A 2XIZA 3MFUA 1AD5A 3MH2A 3VF9A 5IUHA 3AG9A 2IN6A 4O7RA 4F6UA 3FMNA 2YWVA 1SM2A 4KIKA 2ZM1A 2E9PA 2JDTA 2BFXA 2WOUA 4L7FA 5K3YA 1MRYA 5EK7A 5ANOA 5J1VA 4GFMA 5CXHA 1V1KA 3NNWA 5LWMA 3F88A 3U8WA 4F9BA 3PDTA 4EH3A 4L52A 3WZDA 3QTZA 3PE2A 3QCYA 2J90A 3LXLA 4R1YA 5DPVA 4APPA 5KHWA 2W96B 5TE0A 3R1QA 5FDPA 2Y4IC 5GIOE 4FEVA 4CV8A 3DK7A 4O2ZA 4QMXA 3PJ8A 3QTXA 4ENYA 3K54A 5C26A 4K77A 4F65A 5ANIA 1T45A 2BTRA 5EKNA 2CGXA 3PY3A 5CX9A 4Y8DA 4QQTA 3BGZA 5EFQA 5LMAA 5J9ZA 1PMNA 5L2SA 5CZIA 3U55A 4A9TA 5KMMA 4V05A 1AQ1A 3UOLA 5KBRA 3OVVA 4EEVA 3OXIA 4N4SA 5EOLA 5AV0A 3R00A 4TTHB 4FV7A 4M14A 1UU3A 5JEBA 5CNNA 2QKWB 4CTCA 3BYSA 4MD7E 4BDDA 2OW3A 4EQCA 3PVUA 1LEWA 2PVNA 2XVDA 1VJYA 4BF2A 1SVHA 2VAGA 5AA8A 3COMA 5DMZA 3KL8A 5CU4A 3SOAA 3R8MA 2BTSA 2YIYA 3QCQA 4Q5HA 3NW6A 4JQ7A 3VWAA 4XG4A 4PL3A 4EZ7A 2B9IA 3OT3A 5KUPA 5C8MA 3Q32A 4B8MA 4BTJA 1YOMA 5DVRA 1XJDA 5F94A 5ETIA 1WFCA 4FG8A 5AX3A 3ZDUA 3BQRA 3KXXA 3MB7A 4A4LA 3LMIA 2ZYBA 4FEUA 4O0UA 1OPKA 2PE0A 2BALA 2ONLC 2R3IA 1M14A 4V0GB 3FWQA 2FSTX 3UZTA 2OJFE 3II5A 3PE1A 3R2YA 1FVTA 3AD6A 5FM2A 5G1XA 4JDHA 1E1VA 5KMJA 3SRVB 2OZOA 3DB8A 4Z7GA 3PVGA 3ZEWA 3TIZA 3IKAA 4OTRA 4DAWA 2A1AB 5ETCA 2CNUA 1J7UA 4OTWA 5DOSA 3GU7A 3ZUTA 2R3LA 3TV7A 4WUAA 2UZBA 2R3KA 4WNKA 3VRYA 2J7TA 3GCUA 3QHWA 3MDYA 3OF0A 4HNIA 4DH7A 3W2PA 5CU0A 2E9VA 1ZOEA 2BDWA 3PXKA 3PLSA 5HO6A 2WIHA 3D15A 1M2RA 3FI2A 4RX9A 4V0GA 5AX9A 2X7FA 3SDJA 2J51A 5FUTA 4MBIA 1FGIA 1PW2A 4LRKA 4PPAA 4TY1A 3EFWA 1H8FA 2GFCA 3ZSHA 3PIXA 3SRVA 3RGFA 1LP4A 1BL6A 3F7ZA 1XH6A 3HUBA 4FTRA 4TNDA 3LJ0A 2VWIA
chains in the Genus database with same CATH superfamily
3SVVA 1QPEA 1ZWSA 4J99A 4EWQA 2GNLA 4Q5EA 4U5JA 5JMSA 2OJIA 3SV0A 4TWPA 2W5BA 5FRIA 3IGGA 2J5EA 2R64A 3FLNC 5FM3A 4K18A 3LJ1A 3ZSGA 3G0FA 4O0SA 3NGAA 3KC3A 3CKXA 2GSFA 4FTMA 3NCGA 1ZXEA 4HGSA 5CAPA 2BZJA 3N4TA 4DE4A 5IQBA 1URCA 4GEOA 3Q5IA 4CLIA 4FRFA 2WIPA 5BUJA 3A7JA 3HP5A 3CBLA 4TKSA 5CYIA 4C38A 1W7HA 4V01A 4CKIA 4DLIA 2R3OA 5HNGA 1OKZA 3LFFA 3PWDA 5E8WA 4E4XA 3GFWA 3IDCA 3FLZA 5C8KA 3BLHA 2NRYA 5IQHA 3RK7A 5T6KA 3FXWA 2WD1A 3V5TA 4QTAA 3UYSA 3GCVA 3WZJA 2XBAA 1YRPA 3D2IA 2ITQA 1P4FA 3A61A 3EQIA 4FOBA 2I7QA 4MD8E 4ZS0A 4IVAA 3VIDA 3BLQA 5IA0A 3R7EA 5CAVA 3NVMB 4D4RA 1CTPE 3ORPA 4I6BA 3O96A 2QHNA 3QZIA 3GU6A 4GUBA 3ZBFA 2ZFYA 4L53A 3ZMMA 4L8MA 2OBJA 4HVHA 5LOHA 3C50A 2ITYA 4EUTA 4GKIA 2R3HA 2KULA 3CGOA 5JFSA 1HOWA 3TI1A 4F9AA 4L6QA 2XRWA 4QP1A 2UZDA 2BFYA 3QXOA 4CYIA 4O91A 2OU7A 2VX0A 3COKA 4FTTA 3BHVA 5FTOA 2PULA 5H3QA 4FUXA 4NTSA 3BGQA 2VRXA 5IH4A 1A9UA 5AUYA 4B99A 4MX9A 4IWQA 4L01A 4M84A 4G6LA 5JGDA 2WEIA 5HO7A 4FSQA 5FGKA 3IOPA 4Q9ZA 5KMLA 3C9WA 4FNWA 2QVSE 5IQDA 5CS6A 2B55A 4KINA 4AA5A 2QONA 2VNWA 4C33A 1WVYA 5IA1A 3D94A 2C6KA 2QCSA 4YZBA 1UNHA 2C5OA 3HV6A 1OIUA 2BR1A 3KMWA 3BV2A 3OXTA 4O22A 4RQKA 2H8HA 3QD2B 4YZ9A 4DG2E 4ORKA 3EOCA 4I24A 4K6ZA 4CZTA 4R3PA 5FLFA 3OP5A 3QRJA 3FC2A 4WNPA 4BWKA 3OHTA 2VO0A 2WXVA 1MQ4A 3RAKA 3VONA 2CJMA 3ZUVA 2HOGA 3GCPA 4RIYB 3GENA 2FO0A 4N57A 2YM4A 2BZIB 3MWUA 4TWCA 3V51A 3LFBA 1KE6A 2WTDA 4W9XA 4DEAA 5LVOA 3GEQA 4MF1A 3VJNA 3KRJA 4EZ3A 5AMNA 5ITAA 3FQSA 3HVCA 4I3ZA 5A4LA 3H30A 3ORZA 4QMOA 2FGIA 3HA6A 5HU3A 3TNHA 4C4FA 3E7VA 3FY2A 3B8QA 3DZOA 5I9WA 3ZRMA 2UUEA 4E6CA 2UVZA 5CXZA 2OICA 3ORTA 3QRIA 3BIZA 5TR6A 4YNOA 3W2OA 3UO5A 3M2WA 4G17A 4YJPA 1JWHA 4I5CA 3WF5A 4RIYA 3PIZA 2I0YA 5J87A 3ZM4A 3F5UA 2UVXA 3SLSA 4O81A 5EHYA 4IC7A 4G16A 3QQKA 4O7WA 5A14A 5IDNA 1W8CA 3KB7A 1KUTA 2WMRA 3FQHA 4YJRA 5DI1A 3BU3A 2QO7A 3RPRA 4LV7A 3WILA 3WE4A 2QOKA 3DBFA 3QD0A 2JDSA 5TOZA 3R1SA 4RSSA 4ENXA 4F08A 3VF8A 5IG1A 2HW7A 4FKRA 4BIDA 3KGAA 4QO9A 3SXRA 3V6SA 4CNHA 1IASA 2QG5A 5KO1A 4R5YA 5IA2A 4LQMA 3HMIA 5HCXA 4IBMA 3H9RA 3ID6C 3MV5A 2R4BA 4RVTA 2HY81 4ANMA 3IONA 4S2ZA 1LEZA 4RIWB 4U44A 2Y6MA 4XS2A 4AU8A 4IZ7A 3ROYA 2X0GA 1PXMA 1Q4LA 1WVXA 5BYZA 3DCVA 5AJQA 1OL7A 3S4QA 3TKUA 4D1XA 3CLYA 1J1BA 3OOMA 3DNDA 4DYMA 4O1PA 2GU8A 1GZKA 2R7IA 3Q5ZA 1U4DA 1YDTE 4FKVA 5HG7A 4BBFA 3FI4A 3LFSA 1ZYSA 2F7ZE 2YIQA 2VTQA 3D5VA 1O6LA 3UP2A 2XIXA 4ZSLA 1L8TA 2PUNA 2I0HA 3L9LA 4LL5A 3UQGA 5IQGA 4CZYB 4ZSJA 1JAMA 3FAAA 3CGFA 2IJMA 3I7BA 4QMVA 3UO6A 1O6KA 3ZTXA 5EDPA 2ITWA 4RIWA 4BFMA 4E7WA 4P5ZA 1S9JA 1ZRZA 5AV4A 5J7HA 4EOJA 2X8DA 1PXLA 2IO6A 3WZUA 4GMYA 4QP3A 4ERKA 2FB8A 3GC0A 4YO6A 3CR0A 4GIIA 4PNKA 2C30A 2QI8A 4JDJA 3FYKX 4MF0A 5JRQA 3FMLA 4DFBA 2OF4A 4MYGA 5DGZA 2B52A 4GFGA 4U81A 3W8LA 1Q3DA 4ASDA 4CXAA 3NEWA 1MUOA 3RZBA 3NIZA 1PXKA 5CSWA 3H0YA 2IPXA 5IDPA 3FSFA 4I5HA 3GT8A 3JUHA 1H0WA 4UWBA 2G9XA 3C1XA 4X2GA 1ST4A 2GS7A 5L8JA 1ZYCA 1CKPA 2JIUA 5KMIA 1I09A 2F49A 1V0PA 2BRNA 4E5WA 5CF4A 1Z5MA 2CDZA 4IEBA 4TYHB 4F9YA 3VULA 1YHSA 1PMVA 1A48A 2BRBA 1PMUA 4IJ9A 4JRNA 5EQEA 3R9NA 3D5XA 5JSMA 4R6VA 4YC3A 4WBBB 1K3AA 4Z55A 5KBQA 4FKGA 4EC8A 3ML1A 2J0LA 1P4OA 3UIXA 3A7GA 4BC6A 4CRSA 4IACA 4CRLA 3G5DA 5BV3A 1IG1A 4BBMA 4GVJA 5FP6A 2X81A 4YHTA 3EIDA 3FZRA 3GOKA 4UMQA 3ZC6A 4QEBA 2QR8A 5AV2A 3K3IA 3RHXA 2CN5A 4FT7A 4NIFB 4CLJA 5M56A 3R9HA 3HAVA 1CSNA 2XNEA 4XOYA 2JDOA 4I6LA 5E1EA 3BHYA 3TN8A 4BCQA 1M7QA 1I44A 4TYHA 4XP2A 3WE8A 4E4NA 3PZHA 4XBRA 1JPAA 3VS7A 1TVOA 2FSLX 2IWIA 3A8XA 5HKMA 4MNEA 2XIRA 1FOTA 2WB8A 3E8DA 3OZ6A 3FZPA 5CLPA 4GH2A 4PL5A 5E1SA 4EK8A 4JDIA 4IX5A 2PE1A 2H6DA 5HTBA 1OKVA 2QO2A 3OROA 1H1WA 2A27A 4O7ZA 4IADA 5EW8A 3S00A 2X8IA 3F3ZA 4I0SA 5H2UA 4WUNA 2YEXA 3LXPA 3ORIA 4NIFA 5F9EA 5AWMA 5I9XA 2PUIA 2C0IA 3V5LA 3NR9A 3S95A 4AT4A 4C61A 5DEWA 1PYXA 4DDGA 5FG8A 1OKWA 4O7NA 4JMQA 3D7TB 4DH5A 2RSVA 4IVDA 4J1RA 5FQDC 5J9YA 2GTMA 5HX8A 4HGLA 1YHVA 2IZRA 4YJTA 4CEGA 4MK0A 2YCRA 2Y8OA 2YN8A 4MXXA 4AGUA 4ACMA 2QURA 3Q4ZA 4FBXA 5AV1A 2F9GA 3RAHA 3SG9A 3GC8A 3AMAA 5HVJA 2QOOA 5FXSA 4CKJA 3R30A 4M8TA 4WNOA 4X2NA 4BCNA 1YXUA 3QKMA 2VTMA 3QA0A 3P78A 3VBVA 3DTCA 3KRRA 3DKCA 4EI4A 1JSTA 3QHRA 2A2AA 3ORLA 3PVBA 3UNJA 2HW6A 3EFJA 3W2CA 4QT1A 5CU3A 3TDWA 3NW7A 3ZBXA 4KBAA 4BYIA 3ZRKA 2WTWA 1RE8A 2XA4A 1H08A 3EMGA 1PMEA 3LVPA 3SW7A 5IQFA 4B8LA 4II5A 3QWJA 2CKQA 4IZYA 4IDVA 4F1MA 3UE4A 4CFNA 4AF3A 2X8EA 4OW8A 3Q9YA 4DEDA 3ZLXA 1DI9A 3HV4A 4QYFA 3JYAA 3MJ2A 3CE3A 3V8TA 1OVEA 4XV1A 3ZXZA 3OMVA 3PG1A 3QX4A 3KXMA 3FUPA 2BKZA 2C0TA 5AP3A 5LARA 4EH2A 2O2UA 2CGWA 3LAUA 2XAOA 2OJGA 5EKOA 2AUHA 2UZWE 3W33A 3HX4A 3PXYA 3BWFA 2ZB1A 3AC2A 4O0TA 2F4JA 1IRKA 2B53A 5IKWA 3UTOA 3A8WA 5HBHA 2G2HA 2VTLA 5K0XA 3P4KA 2GNIA 4N0SA 3FPQA 3PJ3A 1JVPP 4YMJA 2XF0A 4UMTA 4G3FA 2W1GA 5BPYA 4DHFA 4EYJA 5GIPE 2BILB 4HYSA 5HVYA 4XG8A 2XAMA 5JH6A 2ACXA 5DBXA 4TL0A 1OPLA 5B2KA 4FTQA 3ZH8A 4C4JA 4AXFA 4QYHA 3VJOA 3WYYA 4UZHA 5BYLA 4AUAA 4ZTNA 4PDPA 3OY3A 4TPTA 4PPCA 5E8SA 3UG2A 4KA3A 2YLFA 2GDOA 4C58A 3DV3A 4K11A 5IEVA 3HDMA 4FIEA 4D1ZA 3U6HA 1NW1A 4N6ZA 4EKLA 1PYEA 2ETRA 3BCEA 3L1SA 4I23A 3PPZA 2ZVAA 4FSRA 4IE9A 2RG6A 2BRGA 3VS1A 1ZYLA 4F0GA 3F2RA 2RL5A 3U6JA 4UXLA 2YM7A 4WD5A 4ZIMA 3ZO3A 5LWNA 2C0OA 2J0MB 2Z2WA 3ORKA 4HNFA 4K2RA 4MBLA 4O6LA 4I20A 4XX9A 4Y95A 4EJNA 2HIWA 4NUSA 3K5VA 4LMNA 3OCSA 2P0CA 4FTIA 3KRLA 4FI1A 4YPDA 5D12A 2VTSA 5EYMA 4DHJA 3R02A 5EI6A 2BDFA 3PJCA 2VWYA 2ETKA 4JRVA 3D0EA 4QQJA 3SAYA 4E1ZA 4O4FA 2GFSA 3E63A 5HVKA 4O4DA 4F4PA 4TWNA 4MKCA 4HYUA 2VTTA 3RBWA 3R28A 3SXSA 4EYMA 5IUIA 4FSUA 3ZOSA 3IK3A 3QUPA 4DBNA 3EQGA 4GUEA 1V0BA 4ID7A 4RJ7A 1LPUA 4AT5A 3Q4TA 3CCNA 4AN3A 5LMKC 4FKWA 4BBEA 4BJJB 4USEA 2QG7A 4FUYA 2EUFB 2QKRA 2BCJA 3GBZA 2NNWB 4KRDA 4QPMA 4QMUA 2OH4A 2A4LA 2HZNA 5H8GA 2HY0A 3MH3A 3R73A 3CXWA 4FX3A 3HUCA 4L3LA 4L3PA 4FKPA 3CIKA 4FZAB 3QQGA 1WMKA 2DS1A 3OCTA 4G6NA 5CSVA 2WTJA 2C69A 3QCXA 2PPQA 3JY9A 4UMPA 5BUEA 1OBGA 5KNJA 3CC6A 3EH9A 4DEIA 4EOMA 1U54B 3KCFA 5BVFA 3MBLA 3R01A 4XEYA 4UWCA 3EN9A 1ND4A 4OTDA 4KS7A 3W2QA 1U5RA 3NAYA 3P23A 4EHVA 2BMCA 5M57A 1OIQA 4IZ5A 2R3GA 3BL7A 1OBDA 4P5QA 3NUXA 2CCIA 2W1DA 2Y4IB 2YACA 2F7EE 5G6VA 4BDBA 2WMSA 5B2MA 2ITPA 3LCOA 1YQJA 4EBVA 1WBTA 3UDSA 4H58A 5FXQA 2AC3A 5C4LA 2R3FA 4IW0A 3GCQA 3T3UA 5CAQA 4RC2A 4F7JA 4YC8A 3LFEA 3VS4A 4FMQA 1U54A 5HGIA 2VWUA 1GIJA 3A2CA 5D41A 4QMWA 4YURA 4M69B 4AZVA 3W55A 1QPCA 3PUPA 3OBJA 1WZYA 2W1CA 3AC4A 3JVRA 4IZAA 5LCKA 4CFWA 2QD9A 1W84A 3ZLSA 3GOPA 3HV3A 4G3EA 1UKHA 4C7TA 1GY3A 3LLTA 5BVKA 1TKIA 3FMMA 1KOAA 1YI4A 4JVGA 5HESA 4XOZA 4A4XA 1WBVA 4I4FA 4FC0A 1XKKA 2WMBA 4K0YA 4O0WA 4F64A 1Y6BA 2VTJA 3VUKA 3DDPA 5DHJA 3B2TA 4NWMA 4JG6A 5TO8A 3RPVA 4RFMA 5GJDA 1ZZ2A 4BHZA 5DEYA 4D2PA 5M51A 3QQJA 2VZ6A 2XZSA 3GU8A 3MFSA 1P14A 2OI4X 3NUUA 3HMPA 4J52A 3G33A 4RVLA 5KE0A 4AW1A 1NY3A 5AUUA 5LMKA 3TUBA 3LPBA 2CLXA 3A4OX 3O23A 4M69A 4Q2AA 2X9EA 3VS5A 5HCZA 4DGOA 3PVWA 1QMZA 4H36A 4DFZE 5KZIA 4RA5A 1BL7A 3JPVA 3LJ2A 4W4VA 4DHZA 1BLXA 4N70A 4UN0C 2OFUA 2PZYA 3WARA 3KXNA 2Y0AA 1OMWA 4UV0A 1ST0A 4J8NA 4YP8A 4IAFA 3UNZA 2FUMA 5BVEA 3U6IA 2ITOA 4X2KA 4DG0E 1OI9A 5FD2A 1ZMUA 4RZVA 3KK8A 1E1XA 4GT3A 3MESA 2FSMX 5CU2A 2AQXA 3BYOA 3ZYAA 3NYOA 4QDVA 4BCPA 4FG9A 4D55A 4S31A 1Y91A 5DN3A 4BDJA 4ASEA 2WO6A 2JD5A 3QF9A 2P2HA 3F2AA 3O8UA 1X8BA 5AP5A 3WBLA 5DWRA 3R22A 5DE2A 5LVNA 2PZRA 3GNIB 1A06A 5ANEA 5B2LA 3O17A 5E4HA 1VYZA 4MQ2A 4JDKA 4A9YA 1TQMA 4FIIA 4U97A 1KE7A 2BIKB 3VNTA 2WEVA 2NP8A 3I5ZA 3DZQA 4MWIA 3FKLA 1W83A 4TXCA 4GVAA 3VHKA 4H3BA 5HTIA 4U79A 5CSHA 1CDKA 3BI6A 2EVAA 3KULB 2XNGA 4BDGA 5C1QB 2ZB0A 4E93A 4O84A 4HVIA 2IVVA 2QC6A 2YM5A 3BHHA 2ZMCA 3TWJA 4EOSA 2Z7SA 4BIBA 4EOOA 1XO2B 3AT4A 5J9LA 1R78A 5HI2A 5I9YA 3V5JA 1CMKE 5HE3A 2OH0E 1YVJA 2XP2A 1W2FA 4JBPA 1FMKA 3TDVA 5JZNA 2BHHA 4PUZA 2B9JA 4I22A 5IU2A 5AM6A 4JQ8A 3OS3A 3NS9A 5A4QA 3FMKA 3KEXA 4O0XA 4FNZA 3RK9A 4CCUA 4M66A 4F1OA 4RFZA 4XG9A 4BTFA 4UXQA 3MPTA 3W18A 4NSTA 3COHA 3LLAA 5C4KA 3OWKA 5EHLA 2XKCA 4EBWA 3GQIA 4I0RA 2E9OA 5E8XA 3RWQA 3KULA 4DITA 3ITZA 4OLIA 3UPZA 3BU6A 3A7IA 3EN4A 4QOXA 1V0OA 4BI2A 3OW3A 4BDKA 4FV3A 4D58A 4O86A 5GZ8A 2PSQA 2UZNA 3OTUA 5HLPA 5AP7A 4DFLA 4GRBA 3MPAA 4DCEA 2X1NA 3HKOA 5AR4A 3KU2A 4HOKA 3ZFXA 5GZAA 4GL9A 2PYWA 3NCZA 3OFMA 1G3NA 5DR6A 1XBAA 5LXMA 4EL9A 5CVGA 4XBUA 4X6RA 3AQVA 3ZXTA 4BDFA 4DGMA 3TUDA 4O82A 3R7GA 4LDTA 4FL3A 3OEFX 4IB3A 3TACA 5M55A 4TT7A 2GS6A 3P7AA 4HVDA 2WTKB 2PTKA 2GQRA 4J96A 4L67A 4ZZNA 3MA6A 4I5MA 5DT0A 2A98A 2O5KA 2R0UA 4I21A 4W8DA 3ULIA 2VN9A 4J97A 3KMUA 4FIGA 3KREA 2ZV7A 2F57A 4LGHA 3CQUA 4LUDA 4Y85A 1T46A 3THBA 4BDAA 2UW4A 3MPMA 3RCDA 4PQNA 4FV0A 4JXFA 5F20A 4FV9A 4B0GA 1ZYJA 5EI8A 5CY3A 3LXKA 2XM9A 1UU7A 4BYJA 3UPXA 5LVPA 4HZRA 3PIYA 1ATPE 4U45A 4QMZA 4A06A 3CPCA 5I5ZA 3EZRA 4FT5A 4XG3A 3TUCA 2Z7RA 4AGWA 4XMOA 1Y8GA 2BAQA 2VO7A 2VV9A 3P7CA 5KHXA 1KOBA 3FZSA 3FHIA 2HELA 4X3JA 4D9TA 1WBOA 3IW7A 2VTRA 2CSNA 4BCMA 3V5QA 4E73A 5CEKA 3HV5A 3R9DA 5L6OA 4YLLA 5AM7A 2PHKA 1XH5A 3AC8A 3BLRA 3NYXA 3EFKA 4Y46A 4CMUA 5I9UA 3HMNA 4UMUA 5L6PA 4GS6A 3EN5A 4FTAA 1Q3WA 4RLKA 4QMMA 4AGDA 5I9ZA 3F6XA 2J0IA 3NUAA 1JLUE 3DKOA 3KRWA 2PVLA 3V8SA 4IWOA 4RWIA 1PY5A 4XRJA 5HEZA 4DGGA 1K2PA 2YDIA 4RVMA 4OBOA 1M17A 1O9UA 4FKQA 3JR1A 3CD8A 2HZ4A 2J50A 4O0YA 1Q8TA 5BYYA 5CT0A 4LMUA 4M0YA 2XJ0A 1IA9A 1B38A 4O21A 2W4OA 3MI9A 3QD3A 1UKIA 3FE3A 4PDOA 5BVOA 2CKEA 4KD1A 2PL0A 4YZNA 4I4EA 3FMJA 4QP8A 3QTRA 3COIA 4ALVA 4Y73A 4D4VA 1B39A 3MFRA 3TM0A 2BZHB 1URWA 4KIPA 4FZ6A 3LQ8A 4BCGA 2BPMA 1XMMA 4AQKA 2XK4A 3L9PA 3ZDIA 4HCUA 4D2WA 2ETMA 2YCSA 3EZVA 1YXTA 3C51A 4JI9A 4MEDA 5GHVA 2I6LA 2JIVA 1HCLA 1ZMVA 4E3CA 2HAKA 4CV9A 5CANA 3O5AA 4DHIB 4ZY5A 4M97A 2CNVA 2I1MA 2XH5A 2WMUA 1OL6A 4G2FA 3UODA 4QP9A 4USFA 5CU6A 5IZFA 1O6YA 3C4FA 3MN3A 4GJ2A 1YHWA 4FT9A 4LM5A 4JIKA 1SMHA 4FKJA 3ATTA 4FR4A 3DPKA 2OSCA 1WAKA 3UZPA 5BMMA 3ATSA 1XHAA 4YTIA 3IOKA 2WTKC 3ZU7A 3PA5A 3AT3A 2WQOA 4DCAA 4AFEA 2P4IA 4O0VA 5GNKA 4DTBA 5EYCA 3SC1A 4EHGA 2OKRA 3SG8A 4YR8A 3NFFB 3RP9A 5K9IA 3DY7A 3KA0A 3DDQA 3JVSA 4IM2A 4JX7A 4BDCA 3T3VA 4LUEA 2R3NA 3EQDA 3DXNA 4KRCA 2V62A 4LFIA 4F09A 2W7XA 4DINA 5M06A 5JKGA 3U4WA 2W1FA 2BROA 3EQRA 3VVHA 4BCOA 3ZFYA 2QOLA 5CALA 5EM7A 3QRKA 5J5SA 5H9BA 1SYKA 1ERKA 3IDPA 3C4EA 4I1ZA 3IPHA 3FXZA 5L8KA 4A07A 3QUEA 4RJ6A 4ZXTA 2X9FA 4AACA 4EWHA 4IWPA 3AKLA 3CSVA 3EL8A 3PXZA 3OWJA 3PXFA 3G2FA 3I5NA 3QYZA 1F3MC 1UWJA 3EFLA 3HP2A 3QCSA 1E9HA 4ZTQA 4PV0A 3CTHA 2RG5A 4I0TA 4C35A 1YXXA 2WMVA 3FKOA 5KCVA 3CS9A 1NVSA 3AC5A 2XK8A 5E8ZA 3AD5A 4UEUA 2GHGA 2Z8CA 3U54A 1H28A 4TNBA 4RIXB 4F9CA 2Z02A 2AC5A 5HBJA 2IG7A 3V3VA 2OIBA 2XCKA 3T8OA 3IW6A 3R8PA 3TNQB 1GZOA 2FH9A 1XBCA 1JKSA 3GUBA 4NK9A 4HW7A 5EG3A 2OXYA 1QL6A 2OJ9A 1Q62A 3MS9A 1MRVA 2UZOA 2VTNA 4DH8A 3F7WA 2YABA 4ANSA 4KAOA 2DUVA 4YJUA 5K0KA 2C5YA 2XNBA 3FXXA 3ALOA 3JXWA 4MD9E 2X6EA 3U9NA 2XJ1A 4C4HA 5E8TA 3SW4A 3LKMA 1SNUA 5DR9A 5AUVA 4OAUC 5IQCA 4FVRA 4IAZA 3F2NA 4HVGA 1GJOA 3C4CA 4R1VA 3RALA 5B0XA 4NTTA 4XRLA 4U6RA 1GIHA 3FC1X 3UC3A 4YLKA 1GIIA 2NPQA 4P2KA 4DFXE 4R3CA 4RIXA 1OB3A 4F9WA 4OR5A 2AYPA 5M4CA 4J71A 3B2WA 4J53A 4YBJA 4BL1A 1BUHA 3FMEA 4U7ZA 5JZJA 2JDVA 4YJOA 3BV3A 3QC4A 4O96A 4GU6A 3WF9A 2FVDA 3IDBA 3E3BX 4E6DA 3G6GA 5AUTA 3BZ3A 4RWJA 2OXDA 5AUXA 5L4QA 4FV8A 4FYOA 2C5VA 4C0TA 4WNMA 2WAJA 3ALNA 3R7UA 2WTVA 3OWLA 1VLRA 4Y83A 3POZA 3SQQA 5K4JA 2XS0A 2YIWA 1M7NA 3AGLA 3FLYA 4KWPA 3DT1A 3BE2A 2Y9QA 5DRBA 3VW8A 3I60A 4BTMA 1R0PA 3NPCA 4FNXA 1W0XC 4EJ7A 2VGPA 4EK3A 4BN1A 4YU2A 2JGZA 3PJ2A 2OGVA 4DGLC 2B4SB 1U59A 1JNKA 2O64A 2CKPA 1MP8A 1XBBA 4O83A 4BZOA 4JBQA 2XB7A 3VBTA 4EZ5A 1Q8YA 3NNVA 4MAOA 5AP1A 2VO3A 4QNYA 4FYNA 3S3IA 4W4WA 5DT4A 4WO5A 4EH9A 4GT5A 1YI3A 4BGHA 4MNFA 4FSYA 4K33A 2VWVA 1PRYA 4NCTA 2X7OA 4FV4A 4CGAA 1KV1A 3NVKI 4AXCA 3E88A 1GZNA 2XK3A 2VWBA 1Y6AA 5HNIX 1M2PA 4HYIA 1BI8A 4FTNA 4TYGA 3R63A 4MCVA 1W2CA 2R3PA 4GK4A 4OTFA 5EQPA 2G2FA 4OT6A 2VTPA 2YERA 1XR1A 4K9YA 3O8PA 2C6LA 1OECA 3TMOA 3H10A 1DAYA 2PUPA 4MNEB 5IH6A 4JBVA 3BHUA 3V8WA 4S34A 3L8PA 2CMWA 3DJ6A 5FDXA 4LG4A 3DBQA 3LXNA 5FEEA 4QYEA 3UDZA 4YBKA 2IZUA 3G0EA 3AT2A 3QRTA 4ZTRA 4E4MA 4F63A 5A3XA 4IB1A 4UWYA 3ZM9A 3QKLA 4X7QA 3O71A 1YW2A 3F66A 4FF8A 5C01A 2C3KA 2GQSA 2C6OA 2XBJA 3SHEA 1RDQE 4IVBA 4ZK5A 3QGYA 3O2MA 3TZ7A 5DT3A 3DB6A 2UW6A 3HEGA 5IQIA 3HDNA 5EYKA 4AP7A 2ZV9A 3PRFA 4QMPA 3K2LA 4KBKA 4WHZA 3FBVA 3WI6A 1WBWA 5HG5A 1REJA 4PMMA 3SD0A 4DH1A 3LCKA 2W0JA 4CZUA 3H9FA 3QQHA 2R5TA 4EONA 5HG9A 1UWHA 2UZTA 3PRIA 3QUDA 3EKNA 4R8QA 5AIRA 2WMXA 5AV3A 4QD6A 4PPBA 2R3JA 4GU9A 5M4FA 3ORMA 5HD7A 1PXPA 4FV1A 2IVTA 1SVEA 4DLJA 3AXWA 3SA0A 1SZMA 1JSUA 4RG0A 2PWLA 3A99A 3PG3A 5AR5A 4B6LA 4LRMA 2VTHA 3G9NA 1UNGA 1YWNA 2YFXA 4QTBA 2REIA 4NT4A 3VAPA 2ITNA 4XG2A 3OOGA 5ANJA 5E8VA 3VUHA 3BX5A 2X0QA 4QMYA 4NCTC 4QQ5A 3UP7A 3O7LD 2ITXA 2W06A 1XH7A 2I40A 3NYVA 4WBOA 3ZEPA 4C4EA 1RJBA 4C37A 4O4CA 4QP2A 3IW8A 3F61A 2HYYA 5GZ9A 3W8QA 3UMXA 3P86A 3PZEA 4ZTMA 2W4KA 4QRCA 4FZFB 5ACBC 2W99B 5KKRC 5ICPA 4KUJA 2W17A 4ANLA 3DAEA 4G9CA 4AW5A 4BKYA 3TTJA 4XP0A 3ROCA 2XK6A 2O63A 4DTKA 4YO4A 2UW3A 4BKZA 1OL1A 4HGEA 4G3CA 1PHKA 2WQNA 2Q0BA 2B1PA 1R1WA 3PUFC 4BHNA 5FTGA 2QODA 4ZZOA 3QQUA 2ZAZA 2JFLA 3F3UA 3LE6A 4UALA 3F69A 3HAMA 4IFGA 5D10A 4G34A 3TJDA 2EB2A 4BB4A 4G3DA 5IUGA 3F3VA 3QL8A 4G3GA 4GKHA 3OG7A 4QDEA 4XHKB 3VUDA 5JFWA 1KSWA 4R77A 3FL5A 4RQVA 4CMOA 5LQFA 3ELJA 3L8SA 4FKOA 4F78A 3C4WA 4ARKA 3GU5A 4L45A 2YLEA 1PKDA 4G9RA 4NM0A 2SRCA 3V04A 3R2BA 2EB3A 4ZSEA 2CKOA 2W1HA 3GXLA 3ODZX 3ULZA 4IJPA 1OGUA 2PVRA 4RBLA 2OJJA 4FODA 3ZFMA 5IEYA 4QYGA 3AMBA 2W05A 3Q04A 2WTIA 2XRUA 2C1AA 4QTCA 1ZY4A 3ZZEA 4NFMA 4ZLZA 4M3QA 3NNXA 2PK9A 5AAEA 1QPJA 4E6QA 4I6FA 4D28A 2HZIA 3UOJA 1F5QA 4KIQA 5LMBA 3DNEA 3CQWA 2QHMA 1W98A 1FVVA 2UW7A 3HZTA 3N9XA 4G6OA 4M15A 4RRVA 4IDTA 5CVFA 5J5TA 5I9VA 1GZ8A 3OCGA 5IEXA 5LVMA <