2IJMA

Crystal structure of focal adhesion kinase domain with 2 molecules in the asymmetric unit complexed with adp and atp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
275
structure length
260
Chain Sequence
DYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein,transferase
molecule keywords Focal Adhesion Kinase 1
publication title Crystal Structure of Focal Adhesion Kinase Catalytic Domain Complexed with ATP and Novel 7H-Pyrrolo [2,3-d] pyrimidine Inhibitor Scaffolds
rcsb
source organism Homo sapiens
total genus 82
structure length 260
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ijmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ijmA01
5ANDA 4ZSJA 2HIWA 5HCZA 5GIOE 2PVHA 4NEUA 3DLSA 5AP0A 1TQIA 2ONLC 4FI1A 5HIBA 1L3RE 4E6AA 5J87A 4O6EA 3H9FA 4P5ZA 3ALNA 4NW5A 3DFCB 5HCYA 1U46A 2IZSA 4PQNA 2P2HA 4NZWB 3DNEA 2GS7A 5CXHA 2C6LA 1WVWA 4I3ZA 4DG3E 4A9RA 1A48A 2EXMA 3FY2A 3KXZA 3PPJA 3EQPA 4GEOA 4FV5A 4LQMA 4PDSA 4XBUA 5EW3A 3ZLSA 2QHNA 4I21A 4KS7A 4Z7HA 2YZAA 5AWMA 1YXXA 3PP0A 4AN9A 3IPHA 1PYEA 2R3FA 2WMXA 3POOA 4HYUA 4JBVA 4MAOA 5FP5A 5FXSA 4E6DA 4DT8A 5EHYA 3EQIA 4DGLC 4Q9ZA 5AV1A 3WI6A 2C5OA 3MTLA 1JKKA 4TYJA 4RLLA 5J9YA 1SYKA 4K9YA 4YBJA 5GJDA 4CFUA 5EYMA 4A9UA 4GK4A 3D5WA 1ZMVA 4ZSAA 4JBPA 4QMLA 4FKJA 3MFSA 1UA2A 4YJQA 5DOSA 5HX6A 1W83A 3GUBA 3VJOA 3UP2A 4KIPA 3V5PA 5GZ9A 4AA4A 4AZTA 3D5UA 1PXIA 5M4FA 3TV6A 4EH7A 3PUPA 1H08A 3F2NA 4BCIA 2F2CB 3HAMA 1V1KA 2JAMA 2UW0A 2BMCA 4R3RA 3IO7A 4N6YA 5EKNA 5CF4A 2UZVA 4E7WA 3NGAA 3R7UA 4V05A 4HVHA 2UV2A 2YN8A 4QYGA 4ZSEA 4G31A 3F3VA 2YWVA 3TKUA 4IC7A 4ZMEA 3DB8A 4YTFA 4FTMA 4TNBA 5EM6A 2PWLA 3FMMA 3ZC5A 5IG1A 1UKIA 4PL5A 5E1SA 5AUZA 4O7NA 3NUPA 1GIJA 4FK6A 3NNVA 3JXWA 4M68A 1W0XC 2W5HA 4D9TA 4U40A 3ZCLA 3TZ9A 4EJNA 2QR7A 2JDTA 2B4SB 2IJMA 4HPUE 3QZHA 1OZ1A 1ZWSA 3QZIA 3TWJA 3UG2A 2V0DA 3PPKA 4TYGA 2PL0A 3DK6A 4IB0A 3IW8A 1YDSE 5CASA 4FIHA 5JQ5A 3S3IA 4X2KA 4D1XA 2RGPA 4QOXA 3G15A 3KVXA 3QYWA 4FTKA 2SRCA 5EM5A 4KRCA 2LAVA 3RM7A 4ACHA 3GU6A 3IKAA 2W1EA 4GW8A 3ORKA 2G2IA 3O23A 4CFXA 3U87A 2RKUA 3VJNA 3PIZA 4KWPA 4I4EA 4LMNA 4YJRA 5LMKC 2WQNA 3UQFA 1VJYA 3FC2A 2CPKE 4O2PA 4FL3A 3K5UA 2XCKA 4UXQA 3TT0A 4AAAA 4DBNA 5CANA 3UNKA 4LGHA 4Z55A 2PVMA 4E4NA 5FEEA 3WF5A 5BYZA 3QD4A 4HGLA 4XYFA 4HJOA 2Y6MA 5AMNA 5FXQA 3VC4A 2Q83A 4EOOA 4JQEA 4R7BA 5I3RA 2WQEA 2QOFA 2PUPA 3RWQA 3II5A 2X6DA 1T45A 2R7IA 3R7OA 3LFFA 3ZONA 5I5ZA 2QOIA 1REKA 3LLAA 2BHEA 3GFWA 2XIYA 3GC9A 3Q2MA 2ITQA 3AT3A 5KZIA 5HD4A 1OBDA 3SW4A 4H39A 3E3BX 3JYAA 3LFSA 3LFCA 3DPKA 3FLYA 3QUPA 4IFCA 4L3JA 5BMMA 4C2VA 2UZWE 5I9XA 4H05A 4EOSA 1H1QA 1X8BA 3VQUA 4EJ7A 4X21A 3IDCA 2YAAA 4IADA 2JDRA 2O63A 4H3PA 3VULA 1B38A 1P14A 3VWAA 1PYXA 2E9OA 3DBFA 3R63A 4R5SA 4XX9A 5E8ZA 4CT1A 5HZNA 5IA0A 3R7IA 5KE0A 2OFUA 5E8XA 3UOJA 2W1HA 4WBBB 4CYIA 4IVDA 4I6FA 4F99A 2PVRA 3KN5A 4P4CA 2XK9A 5EYCA 2YISA 1ZY5A 1DM2A 2IVUA 2OBJA 2YERA 3A4OX 4L46A 3LOKA 4R7HA 1BI7A 3VF9A 4O81A 4BY9E 2PK9A 2WXVA 3KU2A 4UMPA 4K18A 3R1QA 4CEGA 5HO7A 1Q97A 2WOUA 2UVZA 3MFRA 3A8XA 3QL8A 4F7NA 5CNOA 2WD1A 5C4LA 5CI6A 4GYIA 4F6WA 3AOXA 2XK6A 4YO6A 2UW6A 5CF5A 5HTBA 2VX1A 1KWPA 3W8QA 1QPJA 4DLJA 1BL7A 3IGGA 4X2FA 2GS6A 4MBLA 4Z3VA 4JG7A 5J9ZA 4OR5A 4FZAB 3ATSA 1DI8A 3MGYA 1LPUA 1ZYCA 4QD6A 3VN9A 1U5RA 4FG8A 3QWKA 1Q8YA 2Z7RA 2ITVA 5AR8A 1V0OA 2YAKA 5AR4A 2X8EA 4O0RA 3RINA 2G15A 3GP0A 5FM2A 3QQLA 2GNJA 1UWJA 1DI9A 2WMWA 4FV9A 4MWIA 4XLVA 4Y5QA 2YZLA 4BDKA 4FSMA 4FTAA 4ANOA 3DDQA 4IXPA 4BDIA 5J7HA 2EUFB 3ZC6A 4NM5A 2ITYA 2VWVA 4GMYA 4GYGA 3OXZA 3PVUA 4RQKA 2C5YA 3OY1A 4G17A 4GVJA 4USDA 4WUNA 3W18A 5CAPA 5JT2A 2Y4PA 4FT9A 5AP6A 3RHXA 2RFSA 4ANNA 4DH5A 4IAAA 3DK7A 3HRFA 5EG3A 1OL1A 4PTGA 2HYYA 2WFYA 2ITTA 2PVFA 4ZEGA 4MWHA 1YWRA 2OJIA 3PE2A 5CSXA 2YABA 4WG4A 2GTNA 1ZLTA 4NH1A 3QGYA 4FA2A 4MNEA 4USFA 2QQ7A 2GHMA 1PY5A 2X6EA 1Q8TA 1OPKA 4PTCA 4G1WA 4H1JA 4PMMA 5C1QB 2OFVA 4FG9A 4PF4A 2IVTA 3MESA 4L68A 2RL5A 5M4CA 1FGKA 5C01A 2R3GA 5AR3A 5LMKA 2XP2A 4IFGA 4EZ5A 4OAUC 3E92A 3UOLA 1UNLA 3RJCA 4EONA 1WBOA 3TUCA 5AUWA 5JMSA 3NCZA 1JQHA 3ORXA 4FKOA 3MPMA 4G2FA 3QRJA 2ACXA 2WHBA 3D9VA 2AYPA 4GVAA 5IH6A 5J79A 4X3JA 3C5IA 2FSOX 4M14A 3BYOA 3AMBA 3GOPA 4XV9A 4Y83A 1CKIA 4RBLA 4EC8A 4IVCA 4CKJA 5A54A 3BE2A 4MBIA 4AN2A 3HZTA 3IG7A 4RVLA 2WTKC 5CS6A 4FTNA 4ITIA 2WMQA 2JKQA 3EIDA 4K1BA 4M7IA 4R3PA 1H00A 2X2KA 4IM2A 3NCGA 4ERWA 4YJNA 3PZHA 3R7EA 4I5PA 2HW6A 1Q8UA 3ZRKA 4L7SA 4LL0A 4IB1A 3VBQA 5LVNA 4BL1A 3ZBFA 3LCOA 5FQDC 4E5BA 3A60A 4F9CA 4Z7GA 1UV5A 3E8NA 2JKKA 3BYMA 3FBVA 4J98A 4C57A 3FY0A 1G3NA 5E91A 2QD9A 1LP4A 4M0YA 1ZZLA 3D5VA 3HA6A 4BFMA 3W2PA 3RPVA 2JDOA 3OP5A 3GCSA 4O7VA 5IH5A 2XUUA 4BF2A 2GQSA 3E62A 2CGVA 2CNUA 2YCSA 1PKDA 2F7EE 3DLZA 3PVWA 3G9NA 2HWPA 3T8OA 3SW7A 2ZV8A 3PJCA 2BUJA 4P90A 3UO5A 3OW3A 4I4FA 4EWQA 2R2PA 5DE2A 5L8KA 3SRVA 3CKWA 4FGBA 4RJ3A 2A2AA 2XJ0A 5HLNA 1UNHA 4JDJA 4UALA 1ZZ2A 3P0MA 3HGKA 4EUTA 2AUHA 5EOLA 1VZOA 3DK3A 1JKLA 4QNYA 4O7SA 4CG9A 3D94A 3VUGA 4CG8A 5AX9A 2HZNA 2G9XA 4KAOA 4WNOA 4R7IA 4DAWA 4ENYA 3DV3A 1FBNA 4NIFA 2O8YA 4Y95A 4PMPA 2JLDA 3FYKX 4LV8A 3BEGA 4TRLA 4NFMA 3Q4CA 4AT4A 4G3GA 4D2VA 2EB2A 3ORNA 4BCNA 3M11A 3UG1A 2ZJWA 2R3IA 5K5XA 2C30A 2VWIA 4DN5A 4I20A 4MBJA 1EH4A 2B0QA 1REJA 4G9CA 3L9NA 5DH3A 3PXZA 5HG8A 4BCOA 3KRWA 3ZUVA 2QOCA 4C4IA 1H26A 1G8AA 2E9PA 2WGJA 3I6UA 4B9DA 3MYGA 4EOLA 1JVPP 3OVVA 3F69A 2ETMA 3WIKA 2UW8A 3D7TB 2JIIA 4M12A 4EEVA 3UZRA 3GC7A 4JR3A 1OUYA 3IOKA 4NKSA 2CN8A 3IOPA 3EN7A 3F3ZA 4C61A 3ZU7A 2XRUA 5JSMA 1S9IA 3W16A 3NW5A 4L3PA 4J71A 4GUEA 4Y5HA 5C9CA 3RCDA 3R9NA 3UQGA 4KNBA 4DINA 1Y8YA 4O22A 3JVSA 5I4NA 4RVMA 3EHAA 2X4ZA 4MF1A 3Q53A 4QYHA 4RIYB 4AXAA 4LM5A 5EFQA 3ENHA 4YJSA 4RIXA 3Q3BA 2PZYA 2VWZA 3FQHA 4QP9A 2O3PA 3UDBA 3VBTA 4RVTA 3QTXA 3BE9A 4YTIA 1E1XA 2X9FA 4J8MA 3FLZA 3UIXA 1SVGA 1M2RA 5DT3A 1LEWA 5CXZA 4B8LA 2ZM4A 2Z7SA 3D2KA 4JAIA 3PSBA 3PA4A 5CYIA 5CF8A 2GFCA 4JBOA 1PXJA 1SNUA 2PVLA 4A4XA 3N4UA 4XG6A 4QMWA 2B9JA 3ZXTA 5CAOA 3DAEA 2WTCA 4QQJA 4I0TA 1XH6A 4RQVA 3TKIA 2BILB 1W82A 1XKKA 3DZOA 3LQ8A 4QTDA 3WZDA 3QRIA 2BR1A 4U43A 5AM6A 3UJGA 2JD5A 4AFJA 2XK7A 1UNGA 3BLRA 4JIKA 3DJ7A 4N0SA 3FC1X 4CLIA 2GNFA 3VUDA 5AV4A 2WTDA 2X7OA 1FPUA 3DTCA 2JGZA 3EYHA 3TZ7A 3EN4A 2UZDA 5J5TA 4KSPA 4U45A 3DBEA 4KKGA 3WF7A 4APCA 4UB7A 4WA9A 5AA8A 4U79A 5LARA 2P0CA 5KHXA 2VTSA 5GHVA 2Y9QA 3V5QA 2YM3A 4BGHA 3Q9YA 1YI6A 2IVVA 4PY1A 1LEZA 4I22A 5FTOA 2PUUA 3PLAE 3FPMA 2WMRA 1V0PA 1KSWA 3R21A 3CTJA 5F4NA 4I5CA 4KBCA 3KF7A 4KB8A 4ANLA 4QMXA 2WMAA 2YLEA 5I3OA 4W9WA 3BCEA 3FQSA 3ORIA 5EHOA 4HVIA 5HE1A 4HZSA 3W2RA 3TEIA 3LMGA 3GCQA 3W2QA 1VYWA 1XH9A 4G3CA 4C3RA 4D0XA 4IAKA 3Q04A 2E9NA 1B6CB 4EOIA 3COIA 4ZS4A 5J1VA 5AIKA 3WE4A 3F3TA 4FTQA 3HMNA 4CFFA 4JI9A 3LCKA 4RLKA 4ZLOA 5LWNA 4LGDA 2IZUA 3OTVA 5CVFA 3F5GA 3MW1A 1FVVA 4U6RA 2HY0A 3REPA 2ZB0A 4NYEA 4FTOA 2R3HA 4LRKA 5IZFA 5HG9A 1CTPE 4FTLA 3ITZA 2PZPA 2QI8A 4XOZA 2CKOA 3OBJA 4YZDA 4DF3A 3CP9A 3ZYAA 2OWBA 4JDKA 2XNOA 2W1IA 2R3NA 3QKKA 4FEWA 3BBWA 1NVSA 5AV3A 4CSVA 2FO0A 5C8NA 3AXWA 5BVEA 4RC4A 5EI6A 1J3HA 2V7OA 5HCXA 1DAWA 4AE6A 5AUYA 4RIOA 4D58A 4QMPA 3R9RA 2EXEA 3PXYA 3WZEA 4F63A 3MY0A 3VUTA 5M4IA 3BRBA 4PL4A 4PL3A 3ZDIA 3ZEWA 5HU9A 4EHGA 2XIRA 4C02A 4ASXA 1BX6A 4X2GA 5HI2A 2XBAA 1OITA 4C35A 3DQXA 3LVPA 4CMUA 2B9HA 1ZYJA 3P78A 4XP3A 3MPAA 3I60A 5DBXA 4FV3A 2XB7A 3OFMA 4I0RA 4CMTA 3EL8A 1SVHA 2Y7JA 3I7CA 4L6QA 4I6QA 5T68A 5BVFA 2UZNA 4G6OA 4IM0A 5BVNA 5G1XA 5LCJA 2C6MA 3UZTA 2PHKA 5H8BA 4FUXA 2XEZA 4LI5A 5AAFA 5LOHA 2GSFA 4DTBA 2OW3A 3PDTA 2E9VA 2R3PA 4O7ZA 4BZOA 3G6HA 3Q32A 2RG6A 4XG3A 3U8WA 2PUIA 4R78A 4V01A 3TNQB 3HL7A 2RG5A 4KRDA 3NPCA 1R0PA 4R6VA 4FKSA 3GGFA 3UC3A 1QPEA 3V8TA 4YC3A 3NSZA 1STCE 3AC8A 4JIAA 4QPAA 4OT6A 4E4MA 3BU5A 5CEOA 5D10A 4U5JA 3U55A 2W9ZB 3DAKA 4R8QA 4E3CA 2OO8X 3EQRA 1U4DA 2QOLA 4YHJA 4C36A 4QO9A 3CIKA 4TYEA 3CR0A 4L8MA 5ETCA 1MQBA 3UMWA 3VS3A 4CNHA 1YOMA 3JY0A 5H8EA 4PV0A 5HORA 1Q5KA 3PA5A 2X39A 1Q24A 4O7LA 1QMZA 3COMA 3CPBA 3MPTA 1IAJA 2BRNA 2FSLX 2JBPA 4EH4A 5AUUA 3CTHA 3HRBA 3NIZA 5DI1A 5LMAA 4I24A 5EHLA 4HYSA 5I0BA 2CHLA 4M15A 4EYJA 4FKRA 4F9WA 5FEDA 1WBVA 5IUGA 1ZOEA 4YMJA 4NK9A 3EQCA 1OIYA 2VGOA 3HDNA 4MNFA 2V5QA 4QP2A 3LW0A 4RZVA 3QTQA 4AN3A 5AADA 1W7HA 5KBQA 4BTJA 2CNQA 1JWHA 5EOBA 2OIBA 3Q96A 5EDRA 5FG8A 4IC8A 2OU7A 3NYOA 3UVRA 2BHHA 2WEVA 1H0VA 3D4QA 1S9JA 5FBOA 4S30A 2XCHA 3ZH8A 3DKOA 2YM4A 1PXLA 3GT8A 2C6IA 4KINA 5IQEA 5IDPA 3F61A 3E5AA 2CGXA 3NVMB 4BTKA 4XV3A 3I5NA 3KXGA 2QO2A 1XWSA 3VRYA 3I79A 2ZMCA 5CNNA 3AD4A 2R5TA 3MS9A 2BCJA 3MA3A 4GL9A 4FL2A 5FWKK 2IW8A 3RI1A 5A6OA 3FV8A 4XOYA 3KF4A 1JKSA 4XNEA 5AUVA 3FXZA 4HVGA 3NUXA 4HCVA 4JRNA 2DQ7X 2WMVA 2F49A 2XK4A 2XYUA 4D4SA 4FIEA 1ZOHA 3RPOA 4EK5A 4F6SA 4BI0A 3JVRA 2OG8A 2ZV2A 3RBWA 5CZIA 4ZAUA 4PPAA 4R77A 5JEBA 3CCNA 4KIKB 3GQLA 3KKVA 3TTJA 4XG7A 4FOBA 3IDPA 4F7JA 2PY3A 4S34A 4G3EA 3C1XA 3ZFXA 3SOAA 2BAQA 2YACA 4D55A 2JKMA 3V5WA 4QYYA 4WO5A 4Y8DA 3AC3A 2CKPA 4DG0E 4FTTA 4FYNA 3GU8A 4MXXA 4AFEA 4YLLA 5H9BA 4B0GA 3DXNA 4RX7A 2XM8A 4O7RA 1OIQA 3FHIA 5HLWA 4E4LA 5DPVA 4MEDA 4FIFA 1DAYA 4TYHA 2VU3A 5JKGA 5BX0A 2ZDTA 2YEXA 2WOTA 4EK6A 2GNIA 1MRUA 1OL6A 1ZY4A 3AGMA 3PYYA 4IJPA 1IR3A 3WARA 2X81A 5M08A 4LOPA 4QMMA 4AE9A 4UBAA 5LVLA 2RFNA 4BCPA 5HIDA 2V62A 3NYVA 4U80A 4F1OA 4LOOA 3QKLA 5CX9A 4XP2A 4GFGA 4C37A 4FV0A 3HRCA 2FH9A 2YCFA 4YJPA 5KKRC 5ANEA 3F2RA 4L45A 2VTRA 4CQGA 2HAKA 4O27B 5AAEA 3A4PA 1J1BA 1Q41A 4G6LA 5EYKA 1MRYA 4RIWB 4NCTA 3EQBA 1CSNA 2IW6A 4D2TA 2JDVA 1PMEA 4W9XA 3UGCA 4A4OA 3UNJA 1ERKA 4A9YA 3KXHA 4LG4A 3MB7A 5IDNA 3LXLA 2WIHA 2ZOQA 2X4FA 3LFBA 3H9OA 4V04A 3NYXA 3K54A 4O21A 2I0VA 4RJ5A 3GC0A 2JITA 3SKCA 3V6RA 2GNHA 5CEKA 4PDPA 5L3AA 1OL5A 2Y0AA 3OCSA 3QU0A 4U0IA 4U41A 4ZTHA 2XNPA 2NRUA 3MSSA 4IX5A 4C59A 2X7FA 3UVQA 1Q3DA 1YDRE 1PXPA 3KRRA 1YRPA 1ZAOA 4FKUA 5H8GA 4D5HA 4DEHA 4EH8A 5BPYA 5M53A 3R04A 4QYEA 4XP0A 5CVHA 5JZJA 1YXTA 4IVBA 3TI1A 5E8VA 3QTSA 1ZMUA 2C5NA 1RDQE 3FSKA 4G3DA 4K8AA 1GAGA 2IN6A 4JR7A 4DEEA 4RX8A 5CU4A 2F7ZE 4FIGA 2CCIA 5I9UA 1B39A 1H8FA 5ANKA 5CU0A 3OY3A 3CSVA 4KABA 2J5FA 3LFNA 4BIBA 2EWAA 3WZJA 1R78A 1IRKA 4JQ7A 1XBAA 4TWPA 5ANGA 3R8UA 4XS2A 4CRSA 3MI9A 4NFNA 3QZGA 3BGQA 1U54B 3K3JA 2VTMA 4X3FC 3C7QA 4TWCA 5F20A 4ANMA 3WF8A 3I0OA 1ZXEA 3QALE 5EQEA 3ODZX 3EQFA 4DH3A 4BCGA 4D2RA 1WVYA 4FNWA 3U6HA 4JJRA 4ZZOA 2P33A 5KX8A 5AP3A 4FT3A 5IH4A 4ACMA 2BDJA 4ZP5A 4AACA 4BVUA 4F4PA 5KO1A 3BHTA 3E8EA 3KMWA 3H4JA 5GZAA 2WTWA 4DTAA 3BQCA 4L44A 4CV9A 4M84A 4ALVA 3NEWA 1Y6BA 3IW6A 4BGGA 4QPSA 4DTKA 3IW7A 2WMTA 3QHRA 5HKMA 3W1FA 3LJ2A 4QTCA 1KOAA 4ZTLA 3GQIA 3TUDA 5DLSA 2WU6A 4FT5A 2JEDA 4U7ZA 4UMTA 4HVDA 4O0UA 3OF0A 3LXKA 2A4LA 4IJ9A 3TUBA 4NM3A 3ZLWA 3ROCA 3CLYA 1MQ4A 4FGRA 1JKTA 3NNWA 1H1WA 4A07A 3G51A 5L4QA 5BYLA 2QCSA 3R00A 1JSVA 2Q0NA 3WYYA 3VBWA 2NNWB 3R73A 2O0UA 5I9VA 5CSVA 2ITPA 3UE4A 5GIPE 3VS1A 1KE5A 2YCRA 5IA4A 3B8QA 4AS0A 3FUPA 5ITAA 2Z2WA 4GIHA 1Y91A 4EH6A 3HMPA 5CEPA 1NT2A 4BGQA 5EQYA 2C3IB 2P2IA 4NM7A 2I0YA 3QA0A 3O8TA 1T46A 2YJRA 4YLKA 5DR9A 4MKCA 2YDKA 2PE0A 3PZEA 5M4UA 2B53A 4CKIA 4JX3A 2UVXA 5GZ8A 5AX3A 4TXCA 1PXNA 4IX6A 2OLCA 1GZ8A 3UMXA 3ZS5A 3HV6A 3NUYA 3ANQA 3FZ1A 2PZ5A 3SQQA 3LCTA 5TOZA 3SXFA 3FAAA 4C38A 4IM3A 2J2IB 3NR9A 3QXPA 3PA3A 4W8DA 1W98A 1OIRA 4FKIA 5LQFA 4FV2A 3TZ8A 3QBNA 2VTIA 2UZOA 3A7GA 4DA5A 3HA8A 3V5LA 4U97A 1G8SA 2QODA 4PX6A 4QMNA 5E4HA 3W55A 2ESMA 5LWMA 4LL5A 4D2WA 3TDWA 3I7BA 3H9RA 3IW4A 3BV2A 1R0EA 3G0EA 2C6OA 1NXKA 3DU8A 4HPTE 1WBSA 3RK7A 3ZFMA 4RFYA 1NW1A 4IEBA 3MN3A 1K2PA 1P2AA 1U5QA 2XRWA 2YM6A 3FZRA 3VBVA 4YUQA 2I7QA 3ZLXA 2OIDA 1YOJA 5IA5A 5L6PA 3Q6WA 3RZFA 1YOLA 3T3UA 3N4TA 4J97A 1GOLA 1ND4A 4EBVA 2W9FB 5LMBA 3LCSA 3P23A 3VW6A 5DT4A 3BU3A 3FE3A 4IW0A 3L1SA 2BZJA 3PRFA 2A27A 3PJ3A 3DAJA 3Q60A 3RAIA 1H1RA 3RCJA 3IECA 1H01A 1XH7A 2C3LA 2JBOA 5IEYA 4TKSA 3F88A 5HD7A 5LJJA 2WTJA 2ZM1A 3AC2A 3VHEA 3U6IA 4R5YA 3S1HA 1FQ1B 3QQJA 3GVUA 4ANQA 3ERKA 2WKMA 4C4GA 3O7LD 3WZUA 1M17A 2PVYA 3RKBA 4U9AA 3TTIA 4JG8A 3R9OA 2I6LA 3G0FA 5TT7A 4EKLA 4IAFA 1YDTE 4OTHA 5TF9A 3QQUA 2XIZA 4WRSA 3LE6A 4DBXA 5CQUA 3OUKA 4CKRA 3VUKA 2GHLA 5KNJA 2BZKB 3R1NA 2R3OA 4F0FA 3VIDA 3HUCA 3U6JA 5FDPA 3COHA 1F0QA 4ITJA 2W4KA 4Y85A 4FSRA 3S0OA 4G16A 4PTEA 3SGCA 3DBCA 4FSTA 3R1SA 2GMXA 3PSCA 3QAME 4TNDA 3GBZA 4L01A 4BDEA 1JSUA 5CU6A 2UZLA 1YXSA 4NCTC 3FI3A 2O64A 4R3CA 3R7VA 4PWNA 2W4OA 5A14A 2X8DA 2QOOA 4TPTA 4YJVA 1RW8A 2BIYA 5F95A 2J51A 4B6LA 3L8PA 3VS6A 4L53A 3V3VA 3E8DA 4IWDA 2NO3A 4ORKA 3O71A 4M3QA 2ETRA 4FF8A 3UBDA 4BCJA 4WT6A 4EBWA 2VRXA 4XG4A 3LM0A 3LXNA 4ZJVA 5DR2A 3UPZA 1V0BA 4UZDA 1CKPA 5AR5A 3GC8A 2VTTA 5L8JA 4BCFA 2YM7A 4BICA 3AMYA 4RGJA 2VX3A 5FTQA 3OD6X 4YTHA 2XM9A 2W1FA 3QGWA 4ZTSA 2CGUA 3OS3A 2FB8A 2QOKA 3D7TA 3OBGA 4CZTA 3F6XA 3QHWA 4RJ6A 1M52A 1OKWA 3MIAA 4R1YA 4PDOA 5JRQA 2ZV7A 2CSNA 3KCFA 1OM1A 4F1MA 3DTWA 4IX4A 4C4HA 3Q6UA 2J5EA 3AGLA 4XCUA 4FICA 4IAIA 3O50A 5B0XA 5AFVA 4RIYA 4WD5A 1YI3A 2C1BA 4QP6A 3T3VA 4ANBA 4DH8A 4F0GA 2VO6A 4L3LA 1UU7A 5IUIA 3R9DA 4D4YA 4F7LA 5K9IA 2R3RA 4BDFA 3TDVA 2JIUA 3Q2JA 1I44A 3FXWA 5JFXA 3O51A 2DYLA 4BBEA 3SLSA 3TG1A 4AA0A 4F7SA 4XJ0A 3EWHA 1R1WA 5JQ8A 4B7TA 2ZM3A 1O6LA 3LFDA 1Q99A 3OEZA 4L7FA 4M69A 5HVJA 2BAKA 4YGAA 4AZVA 5HQ0A 4OTFA 3RPRA 4G5JA 4QMSA 4P2KA 5I9YA 3V8WA 4ZK5A 3C50A 2QG7A 2PMOX 1HCKA 1UKHA 4N70A 1FINA 3HP5A 3BV3A 5IQFA 4IQ6A 4OTDA 3VUHA 1OKYA 2IO6A 4YPDA 3NNXA 3NRMA 3ORMA 4QQTA 3ZSHA 3HX4A 1XJDA 2R3LA 3RHKA 3B8RA 1Z57A 3MY5A 5DHJA 4EH9A 3JR1A 2HELA 2WQMA 1Y57A 4K33A 2EB3A 2YLFA 5AP5A 5EKOA 5H3QA 4O7WA 5EM8A 3VUMA 3R8LA 3BGPA 3PIYA 2VTQA 2W05A 3MJ1A 4RJ7A 4UWYA 3WF6A 5AEPA 3E87A 5AV0A 4KSQA 1KV1A 4O0WA 3UIUA 4QYFA 3D0EA 1WFCA 3R01A 1J7IA 4GV1A 1BYGA 4BCQA 3BYUA 4L9IA 2ITWA 4FV1A 5DFPA 4QP7A 4LOQA 5CSHA 2WU7A 3QC4A 4CFVA 3G5DA 5D1JA 4CZUA 4GT4A 4TW9A 5CEQA 2QG5A 4NTSA 5KMNA 2BAJA 4RC3A 3ET7A 3NDMA 3FZTA 1JNKA 3CKXA 1XBCA 2J4ZA 4IHPA 1P5EA 4AZFA 2NP8A 2GCDA 3FSFA 3TXOA 5HVKA 5M09A 3NVKI 2UZEA 4KBAA 3NW6A 3FZSA 4DEAA 5HU3A 4FV8A 5DWRA 3H10A 1MP8A 5C27A 2IG7A 4EC9A 4ZJIA 3HAVA 2W06A 4BTMA 2B7AA 1PXMA 2W1ZA 5JFVA 4EI4A 5HGIA 3PJ2A 2IZTA 3U4UA 1O6KA 2XNEA 3GXLA 4Z9LA 4FE2A 2BRGA 4UEUA 2QU6A 4WNKA 4UMUA 3RAWA 1PJKA 1GY3A 4CCBA 4H58A 3O8PA 3CXWA 4M0ZA 3E7VA 2CKEA 4FTRA 4HNIA 4OW8A 5A4QA 3M1SA 3FLSA 3AMAA 1ZOGA 1XHAA 2BTSA 2WTIA 4QP8A 4E5WA 2B9FA 3QF9A 4EK4A 1R3CA 3KXMA 4OT5A 4ERKA 5FTGA 5JRSA 2BZIB 4QTEA 4QP3A 3RAHA 3TCPA 3V51A 1IEPA 3U54A 1WMKA 2J7TA 3QCSA 3QTRA 4JRVA 3F3UA 3MH0A 5L6OA 2I0HA 2ITZA 5M57A 2WZJA 1J7UA 2P3GX 4FV6A 4H1MA 5ETFA 5HIEA 3OMVA 4YHFA 2Y4IB 2VWUA 4MF0A 2NRYA 5J8IA 3ZLYA 4IACA 4TN6A 2YFXA 2RFDA 4AOJA 3WYXA 1OL7A 4BHZA 2E9UA 2QO7A 4XBRA 2YCQA 2V7AA 4A9SA 4C3PA 4FZDB 4M66A 4AZWA 3DB6A 2PMLX 1UU9A 3PVGA 3QFVA 4JNWA 2XVDA 3W10A 4C2WA 3ALOA 5TE0A 4FYOA 1K9AA 1HOWA 4S32A 2OJJA 2REIA 3PXKA 4FSZA 2UZTA 2EU9A 4UV0A 1JBPE 3UPXA 3ZO4A 4EQCA 5KMKA 3N4VA 4DGOA 4E8AA 4XRLA 5HX8A 3QRKA 4GIIA 4CZYB 4Y73A 4AUAA 4F9YA 4N57A 5GJFA 4C33A 3Q9ZA 4WKQA 2PE2A 3NUUA 4I94A 4W4YA 3TACA 4X7QA 4AGWA 1YVJA 3FKOA 3KK8A 4DEDA 3KULA 3L9LA 2GNLA 3UYSA 2YHVA 3PLSA 2BFXA 4EK3A 3EZVA 2C69A 3KB7A 2OH0E 4WHZA 3TNHA 3C0GA 4I1ZA 5HBHA 1PMVA 4L43A 3BHYA 4GSBA 4DYMA 3PG1A 5D41A 4OTPA 4B4LA 1NA7A 4CV8A 5L2TA 1BMKA 2PMNX 3FI2A 3GB2A 3QD0A 5HE0A 2PPQA 3MVLA 4IANA 5JZNA 4GJ3A 3DZQA 3AC1A 3Q4ZA 4X2JA 3RMFA 3JPVA 1TVOA 3OXIA 3I4BA 2C68A 3UOKA 2VD5A 4ALUA 4CFWA 5F9EA 4JOAA 4YNEA 4L42A 3H3CA 4BYIA 5J9LA 3WE8A 5GJGA 4PNKA 2OIQA 2HZ4A 4K0YA 4X2NA 4F9AA 2ZMDA 4HGEA 4F70A 5CEMA 3HEGA 5TR6A 2OZAB 3GU5A 2VUWA 2RIOA 4MXOA 4UY9A 3S4QA 4DGNA 5JK3A 3K5VA 3R83A 4IBMA 4FOCA 4L67A 2PUNA 3MH3A 3AC5A 4FKGA 3SAYA 5D12A 3C4EA 3DJ6A 4BDGA 4DEIA 2CKQA 1H25A 5IA2A 3UZPA 3KK9A 5E8YA 3RAKA 4AGUA 3CD8A 3CQEA 4EQMA 3NUNA 2ITNA 4CXAA 2BVAA 4FEXA 3D2IA 2FUMA 1OKVA 4IDVA 3VAPA 3SRVB 5CTPA 3W2OA 5T3QA 3VVHA 4RA4A 2J0LA 4BRXA 4MQ1A 5IQCA 3QLFA 4W4XA 2GTMA 4YR8A 4M13A 3DFAA 2VWXA 2QOBA 3EFJA 4YJUA 4PP9A 4LRMA 3RPYA 1P4FA 3ENMA 3HV4A 3F9NA 5FXRA 2Z7QA 2F57A 5E90A 5A4TA 3K2LA 5L6WL 3EKKA 4M8TA 4IZ7A 5HBEA 5EM7A 2XKEA 3F5XA 3EFKA 4NWMA 3HP2A 3FLQA 4PUZA 3ZOSA 2XYNA 2X7GA 2YITA 3OXTA 5A6NA 4V0GB 3PVBA 3ACKA 3F66A 1ZYDA 3IK3A 4FZ6A 4QP4A 4AW5A 4E1ZA 1WVXA 5LVMA 3UO4A 2EXCX 3G90X 4EYMA 3UOHA 3BPRA 5M07A 1SZMA 4CD0A 4NJDA 4E26A 2W5BA 1PF8A 3AT2A 3BLHA 3TNPC 1SNXA 3U4WA 1YHVA 1KE7A 3ZTXA 5DA3A 1XO2B 4CVAA 1OIUA 2R64A 4AGCA 4IMYA 2JFLA 3F7ZA 3QQGA 4EH3A 3BEAA 4KIKA 1JOWB 5J5SA 2KULA 3DKCA 2AC3A 4QPMA 3W8LA 2OXYA 2VNYA 5HE2A 4ZTMA 3LZBA 2XNGA 3R30A 3NZ0A 4ZMFA 4DLIA 4FX3A 3ULZA 4X3FA 3O8UA 4IH8A 1IAHA 1RQQA 4FV7A 3EN6A 3LIJA 3T9TA 4BCMA 1ZRZA 4TY1A 4BDDA 5JH6A 3RPSA 1PXKA 4YZMA 3E3PA 2C1AA 2OI4X 3FHRA 3V6SA 4HGTA 3EMGA 3EJ1A 4JBQA 2VTOA 4BKYA 4HW7A 2YIXA 5AR7A 2AC5A 3E63A 4JDIA 1BUHA 5CSWA 2VAGA 4QMTA 1MUOA 4FR4A 3OCBA 3DBDA 2HXLA 2W4JA 2GU8A 4FVPA 3ZMMA 4FC0A 4OAVB 3LFQA 3HV5A 4BN1A 2PU8A 4O84A 3L9MA 4GS6A 1HCLA 5HG7A 4BC6A 4DGMA 4I92A 4J7BA 5HICA 1O6YA 4FSUA 4X0MA 3A7FA 2GS2A 4U8ZA 5K3YA 3PG3A 4EORA 2QC6A 3O0GA 3U51A 1OMWA 4RIWA 4J95A 4QMYA 1KE8A 2PMIA 5CWZA 4LMUA 3CE3A 2WO6A 5CT0A 1J91A 3KMUA 3VF8A 3JUHA 3LKMA 3EB0A 3LLTA 3P7BA 3W2SA 3BHHA 4Y72A 5FGKA 4EH2A 3UIBA 1FMOE 3V5TA 2GQGA 4WG3A 2C47A 4I93A 1OB3A 1XQZA 3ZHPC 3EFLA 4G34A 3RNYA 2B54A 4IAZA 3S2PA 5M55A 4DITA 3PWYA 4XV2A 2QKRA 1M7QA 3E88A 5FDXA 3RALA 2Y6OA 2JIVA 4OTQA 1XH4A 4NT4A 3P9JA 2I1MA 3UYTA 2Z7LA 2ITOA 1IG1A 1H24A 1YXVA 1FOTA 3C4WA 4PNIA 1J1CA 1JPAA 1Y8GA 2GNGA 3KMMA 5CEIA 3TV4A 2W96B 4BHNA 4FEQA 2C5VA 3QUEA 4IIRA 3RTPA 3C4CA 5F1ZA 2XNNA 4MXZA 4OLIA 1BI8A 3AD6A 3CBLA 4GFMA 1VR2A 4AF3A 4PMTA 5EW8A 5KMLA 3FPQA 3C13A 3COKA 3C4XA 1CDKA 2YIQA 4UWCA 4AQCA 4UYNA 3E7OA 5EDQA 2VGPA 4GKHA 1IASA 1Q8ZA 3UP7A 4KD1A 4J52A 1J7LA 3KXNA 1YHSA 2UW5A 4U3ZA 3BYVA 3GCPA 4ZSLA 4DG2E 5AP1A 3FL5A 2UW7A 4RWLA 2G2FA 2WIPA 1M14A 4O2ZA 2R9SA 4O0SA 4MVFA 4BI2A 3KEXA 3EQHA 3M42A 4IAYA 3E8CA 5DT0A 4ZSGA 3TIZA 4GK3A 4FEUA 4D9UA 3NS9A 5J7BA 4AWIA 1RE8A 3NW7A 3QQHA 4I41A 1RJBA 2W5AA 5KHWA 4Q9SA 5EK7A 4FTJA 2J0IA 4O0VA 5AP4A 2E2BA 5LVPA 2B9IA 3NX8A 3NWWA 3P4KA 3ZZWA 3BELA 4PRJA 2XJ2A 2BDFA 4WG5A 4O7YA 5LVOA 4HCUA 2HZIA 3W2CA 5ANOA 1Q4LA 2XMYA 3QTUA 4J53A 2WELA 5D7AA 5HBJA 4ID7A 4ASDA 4TL0A 5JN2A 4O6LA 4TT7A 4O96A 3SOCA 3IS5A 4FK3A 4CGAA 3KQ7A 5FD2A 2C6DA 4UXLA 4CCUA 1SM2A 3BX5A 3CJGA 4YZCA 3SHEA 4USEA 5JFSA 4FBXA 2J0KA 3G33A 4IX3A 3N51A 4XRJA 2QOQA 2C0TA 2QOHA 3TNWA 5HEZA 5HOAA 5A4CA 2A1AB 4H3BA 4FKVA 2DS1A 2FGIA 4M67A 2YIRA 5T6KA 3R8PA 3RGFA 3G9LX 3TV7A 4CFMA 4KIOA 4RRVA 3HUBA 3ORZA 2QONA 2R0IA 3DGKA 4ITHA 3BI6A 3FQEA 4IE9A 5L2SA 3MVMA 2PVKA 3PWDA 3JS2A 4FVQA 5IMEA 3C9WA 3OCTA 4FNXA 5HVYA 5IISA 2X2LA 4JQ8A 2RSVA 4GRBA 4RMZA 4YU2A 2XF0A 3AQVA 3OWKA 3IONA 3K3IA 2C6TA 3PY1A 4FSNA 2JDSA 4P5QA 5E8TA 3C0IA 3FKLA 3RK5A 4O83A 3KA0A 4YZNA 3JY9A 4HOKA 4NSTA 3OROA 4QQCA 1TQMA 4QNAA 4RWKA 3CC6A 4UYAA 2J0MB 3FMHA 4QMUA 5E92A 5C03A 3SV0A 4DFNA 2J0JA 1OPJA 2YA9A 5IUHA 2G1TA 5EI2A 3V01A 1WBTA 1G5SA 2HWOA 4OGRA 1AGWA 4FNZA 5HO8A 3SG9A 1YWNA 3ULIA 5CF6A 3C51A 4RFMA 4RJ4A 4ZZNA 3GI3A 1YHWA 2CLQA 3GEQA 4YJOA 1DS5A 3EQGA 5GINE 2WB8A 3SC1A 4F65A 4I6HA 1NY3A 4EUUA 1H4LA 3NIEA 4F64A 3PSDA 5IQBA 4K6ZA 4NM0A 3TJCA 2H96A 2HCKA 3ORLA 4O91A 2VNWA 5IKWA 4GU6A 5A46A 3ZO1A 4O82A 2C5XA 1NVRA 2PTKA 3ORTA 3A99A 4A7CA 4G5PA 3ZEPA 2H6DA 3W33A 2ZVAA 3QTZA 4LV5A 4GG7A 3Q52A 3F7WA 5CI7A 4L00A 2ITXA 2W99B 3NAYA 4YC8A 3VS2A 5IQGA 3BQRA 2IVSA 2VO0A 4ENXA 1KUTA 3BZ3A 4EQUA 1W8CA 1NVQA 4UX9A 1KE9A 2XJ1A 3H30A 3MB6A 1FMKA 4D1ZA 2XIXA 4OBQA 4QQ5A 3DCVA 4WUAA 4BWXA 3KCKA 4EOKA 3ORPA 2XNMA 3V8SA 4YTCA 5AV2A 4CT2A 4OBPA 2YIYA 3DXQA 3CJFA 2YDJA 3KREA 3FI4A 4D2SA 2XS0A 4PPBA 5IEXA 2VX0A 5CENA 4ALWA 4QTBA 4KUJA 5BUJA 3Q9WA 3BBTB 3GFEA 3OWPA 4TZRA 5CT7A 4DCEA 3VHKA 5EH0A 2VWWA 3ODYX 4E6CA 4L52A 2PVNA 4I23A 5DVRA 2HZ0A 5BUIA 4TWNA 2C0IA 4XMOA 5IMXA 2YM8A 1Q61A 4BCHA 3ID6C 4H36A 2OJFE 4JDHA 2I40A 2H8HA 2UW9A 2Z8CA 3DA6A 4ONAA 5BMSA 3MIYA 5HESA 3UODA 2OKRA 3ACJA 3BYSA 2W1DA 4FVRA 3BWJA 4MTAA 3U9NA 2ERZE 2V55A 3AC4A 3C5UA 5CVGA 3VBXA 5A4LA 5C8MA 4BBMA 2X8IA 4UN0C 2IWIA 2YIWA 3MA6A 4J96A 4J1RA 2HY81 3VS5A 3THBA 4CQEA 2FYSA 4UZHA 3A7JA 4G6NA 4NL0A 3FMLA 3LJ1A 4JX7A 1SMHA 3C0HA 3D14A 3VS4A 5ICPA 3A7IA 1M7NA 4GU9A 2F4JA 4AU8A 3RK9A 3A8WA 4LFIA 4QMQA 4QTAA 4JT3A 4DC2A 2OK1A 2DWBA 4WNPA 4LYNA 4MYGA 5J95A 2QURA 4FIIA 4HYIA 2RFEA 2X9EA 3B2WA 4TYHB 4ZY5A 1E9HA 4BDAA 2UW3A 1H27A 4FT7A 5DYJA 4ANSA 3VUIA 3FJQE 3ZSGA 2HK5A 3MFUA 4A9TA 5AA9A 2RF9A 3FLWA 3MH1A 3ZUUA 4EOJA 5BVWA 3GU7A 5IQDA 2BRHA 3H0YA 5B7VA 3R0TA 5E8UA 2W1CA 3PPZA 4F08A 3PE1A 4U42A 4DFUA 4B8MA 3P86A 3FI8A 4GCJA 4XV1A 1H28A 4P7EA 3ZRLA 3PTGA 5CU3A 2GPHA 3WIGA 4C0TA 3BKBA 1KV2A 3HMMA 3R22A 1PHKA 5JFWA 1OKZA 4KBKA 4YSMA 3QTIA 5CALA 4GH2A 3FZPA 3F2AA 1XH5A 3V04A 2HENA 2QO9A 2IZRA 3OT8A 3UVPA 2QLUA 3CY3A 3HVCA 3W32A 2P55A 4BCKA 3R7YA 2QNJA 3O2MA 4XUFA 3WBLA 3TM0A 2QR8A 2QKWB 3T9IA 3ZO2A 5CLPA 3MTFA 4E4XA 2W1GA 4YBKA 3DQWA 2XK3A 4K11A 3WOWA 5JGDA 1APME 1KOBA 1MRVA 4DH7A 4B99A 3HKOA 3G6GA 3MFTA 3P1AA 5GNKA 4O0XA 4ZOGA 4TTHB 1FVRA 3PY0A 5L2IA 4M97A 1OECA 2X1NA 3QCYA 4FKQA 1IA9A 3CS9A 4FSYA 2B1PA 2ZAZA 5FEQA 2XBJA 4MQ2A 3NUAA 1H0WA 1Z5MA 3KRXA 4DH1A 4F1TA 4F0IA 3E93A 2OJ9A 4I0SA 5CSPA 4DT9A 4MXAA 3OWJA 2DUVA 3OW4A 3QRTA 4CFNA 5DN3A 5IA1A 4W8EA 2G01A 5JGAA 1OVEA 4XG9A 3ZDUA 5KZ0A 1UU8A 3VS0A 2I0EA 2C3JA 3Q4TA 4DFLA 3S00A 2OZOA 3MH2A 4BDHA 3IGOA 3C4ZA 4OTRA 2XH5A 1UU3A 2VO7A 4DEBA 1LUFA 2UZUE 2R3JA 2QU5A 2W17A 4EH5A 4G3FA 4FEVA 1Y6AA 3ZBXA 4AOTA 4U3YA 2UUEA 4IZYA 2OH4A 5AJQA 5B2KA 3POZA 2LGCA 1SVEA 1URWA 3BU6A 2BALA 2BZHB 5KBRA 5C4KA 2WTKB 2ITUA 2XKDA 5B2MA 4C4FA 3LCDA 2CCHA 4ARKA 3IW5A 1F3MC 4JS8A 5D7VA 4FODA 5FBNC 3LMHA 4FKLA 4GT3A 4DE4A 3MWUA 3QLGA 4AT3A 3QTWA 4MH7A 5EYDA 4C34A 3NLBA 5DRDA 1GZOA 4S2ZA 4YPSA 2NPQA 4BIEA 1QPCA 4RFZA 3KN6A 4GG5A 4AA5A 2Z02A 1GIIA 5F94A 3R2BA 3VS7A 3QC9A 1PRYA 1ZARA 1Q62A 3Q4UA 5HLPA 4CRLA 2C6EA 2R0UA 4MCVA 4WRGA 4ZXTA 3ZXZA 3AD5A 5G6VA 4WBOA 3CGOA 2OSCA 1E1VA 5FP6A 3FMKA 3C4FA 4N4SA 3KXXA 4IZ5A 5ANIA 5HE3A 2PZRA 4BDCA 3LMIA 2WQBA 4GJ2A 4GT5A 4LRJA 2OF4A 1BL6A 4WOVA 1Q3WA 2VTHA 3N9XA 2WNTA 4II5A 1F5QA 5DMZA 5HTCA 3TKHA 3QX4A 1K3AA 3GU4A 4MXCA 4BDBA 4LUEA 4YLJA 5LXMA 1OL2A 3HMOA 2WTVA 5IF1A 4HYHA 3L8SA 5H2UA 2VWYA 4ZY4A 4Q5EA 3VBYA 3WILA 4BI1A 2BKZA 4IWPA 2PSQA 2C4GA 5CAQA 4KIQA 3ANRA 3DKGA 4ZZMA 4CTCA 4QMVA 4CMOA 1VEBA 4J8NA 5I9WA 4RT7A 5E7RA 3QQKA 3TIYA 4RPVA 1YI4A 2BRBA 4EZ7A 2PYWA 2W0JA 2Y8OA 3DOGA 3ZM9A 5EQPA 1WBPA 3EN5A 3PFQA 3DY7A 4LUDA 2XIKA 5TO8A 3OZ6A 3QD3A 1A9UA 3D83A 3R71A 4MHAA 4AZEA 4RG0A 2QVSE 4BKZA 5DGZA 1GJOA 2OF2A 3ELJA 5CZHA 2YJSA 5AAGA 2O2UA 2JAVA 4MD7E 3CD3A 3SDJA 2J50A 3MVHA 3CY2A 3BHVA 3I1AA 5DEYA 5ACBC 3SX9A 3EFWA 3EN9A 1O9UA 1JSTA 3HDMA 5CAUA 4ZTNA 1M2QA 2BRMA 1BLXA 3I6WA 4AGDA 5K4JA 4RWJA 2XK8A 5L2WA 4ASEA 3ZO3A 3ZSIA 4AP7A 4JL9A 4EHVA 4RC2A 2OZAA 3LXPA 4W4VA 4YO4A 3FYJX 3L8VA 4ZTQA 2UW4A 1PKGA 5IQHA 2O5KA 4JLCA 2R7BA 3NMUF 2HW7A 3O17A 3Q5IA 3D15A 3VO3A 4EKKA 2WAJA 3OWLA 5LCKA 3ZRMA 5BNJA 4AW2A 2A19B 4FZ7A 4RZWA 3FDNA 2EVAA 3PY3A 3LJ0A 4OUCA 4YC6A 5J1WA 3KRJA 3DT1A 4IWQA 3DBQA 2BFYA 5DG5A 2GDOA 2WPAA 4I6BA 2B55A 4AG8A 2VWBA 2J6MA 2BPMA 3LQ3A 1WBNA 5AM7A 4ACDA 4QMZA 3DXPA 4HGSA 5EDPA 4GKIA 3Q5ZA 2YWPA 5KMOA 3I81A 3PXFA 4BWKA 4FTIA 4MD8E 3L8XA 5DNRA 3TL8A 2G2HA 3ZUTA 3UO6A 3PJ8A 3R8VA 4N6ZA 4EWHA 4XLIA 4BZDA 2Q0BA 1UWHA 1PW2A 3R8ZA 4D0WA 4XG8A 4V0GA 4RX5A 5KMJA 1GZNA 4IVAA 5CAVA 2J90A 1OBGA 4O0YA 4KA3A 3DNDA 1OPLA 2CN5A 3MDYA 4C58A 1CKJA 4GUBA 4XG2A 2WMSA 2JKOA 5JGBA 3FLNC 2X0GA 3WZKA 4MNEB 4X6RA 4S31A 3OCGA 2VTAA 4FUYA 5C26A 5DEWA 3MBLA 4I5MA 5A3XA 5TKDA 4DFXE 3ZFYA 4O1PA 4OTIA 3RZBA 5ANJA 4BWPA 4FTUA 5BQ0A 4ZS0A 3QCXA 3HECA 4BKJA 4D4VA 4FV4A 5EI8A 4Q2AA 2JFMA 3LQ5A 3OEFX 4J99A 3GENA 3LAUA 4E93A 3KL8A 3KC3A 4YZBA 4JG6A 4YJTA 4APPA 4U44A 1CM8A 3NUSA 3UTOA 3OOGA 4FT0A 3BHUA 4BR3A 2PVJA 1ATPE 4NTTA 5BVDA 1KE6A 3KVWA 5K0KA 3ROYA 3Q9XA 4IZAA 3HLLA 5ETIA 3E64A 2HOGA 5KUPA 1TQPA 3KY2A 4WSQA 4M69B 3TZMA 5M56A 1YKRA 2BKKA 2QLQA 5L2QA 2CNVA 4DFZE 1Z9XA 2OXXA 2XA4A 2IPXA 3EYGA 3P08A 4C8BA 3EOCA 3LPBA 4DCAA 4NW6A 4EK8A 4F6UA 4DFYA 3R2YA 1XR1A 4RA5A 4FKTA 1XH8A 5B2LA 1GNGA 4C4JA 4UMQA 2R3MA 3ETAA 4FL1A 4D4RA 3MV5A 4QMOA 5ETAA 4D5KA 3SD0A 5BUEA 3QCQA 3FZOA 3RNIA 5BVKA 1URCA 1GIHA 3GNIB 3F5UA 3FMNA 3P79A 5HHWA 4CLJA 4RVKA 5IU2A 1WAKA 5D11A 2PULA 3PP1A 4EHEA 3R28A 3EH9A 2XKFA 1OUKA 4MXYA 2C6KA 2Y4IC 3F5PA 4ZIMA 2J9MA 5AUTA 1P4OA 4ACGA 3A2CA 4I5HA 4HZRA 1R39A 3PIXA 5AR2A 4HCTA 4BZNA 4CYJA 2XKCA 5KMMA 4BYJA 2VTLA 4MX9A 2R3KA 3QX2A 4NKAA 3QA8A 3QYZA 3KFAA 3NAXA 5FRIA 2ZYBA 5AP2A 3RP9A 2YDIA 4AX8A 4YHTA 3QUDA 4CTBA 5C8KA 3TN8A 3MVJA 1TKIA 1FGIA 4EL9A 5D9HA 3D5XA 4H3QA 3ZZEA 1WCCA 2H34A 2F9GA 3HNGA 4FIJA 3DS6A 4ZJJA 2GQRA 1BKXA 2BROA 4A06A 3KGAA 1OGUA 3QWJA 4NIFB 3HMIA 4Y46A 4RX9A 5DRBA 4BBFA 2OJGA 3A61A 4FKPA 4BIDA 1ZMWA 4JAJA 3TJDA 4EHZA 2WMUA 3HV7A 4FKWA 4YP8A 2ONLA 2QHMA 4D2PA 3QD2B 5M51A 4O86A 4DHFA 3FKNA 2ZB1A 1QL6A 2P4IA 4FSWA 3OG7A 1QCFA 2PZIA 1YQJA 2ZDUA 4IDTA 3EZRA 3UIMA 1YWVA 1OI9A 4D28A 4HNFA 5K4IA 2F2UA 3RM6A 3UC4A 3WF9A 3AT4A 4D1SA 2O65A 2WQOA 3NNUA 3R8MA 2Z60A 4YNOA 5DIAA 2FSMX 5HNBA 4AOIA 5IPJA 3FL4A 3DJ5A 3RWPA 3VQHA 4ACCA 1JLUE 2VN9A 3OT3A 4O1OA 4PDYA 4WNMA 2PE1A 4U81A 3VNTA 2GHGA 4FG7A 3CEKA 4MK0A 4AW0A 2R4BA 4RIXB 4WSYA 3H0ZA 1FVTA 2XEYA 5HG5A 4ASZA 3GCUA 4NUSA 4XH6A 2W7XA 3OOMA 3F3WA 3OTUA 5M06A 1PXOA 4FZFB 4NU1A 4X6QC 5BYYA 4KKEA 4C62A 4E20A 4AW1A 4G9RA 2IW9A 3DDPA 2WMBA 2FSTX 1A06A 5K5NA 4FMQA 1AD5A 3ATTA 3F82A 4ZTRA 3HV3A 4PPCA 2CLXA 1WBWA 3G2FA 2ETKA 3GOKA 3QRUA 4OTWA 5IA3A 5CU2A 3EL7A 3V5JA 1L8TA 4FTCA 1U59A 3A7HA 1AQ1A 3KULB 4FNYA 4S33A 5BVOA 2GFSA 3FWQA 3A62A 4RSSA 2KTYA 3LHJA 3TNIA 3PXRA 4Q5HA 3EQDA 3VW8A 4DEGA 3BIZA 2XNBA 4XHKB 4NJ3A 2WEIA 3LM5A 3IQ7A 4E73A 2HXQA 4AT5A 4E6QA 5IQAA 2BDWA 3FXXA 3NYNA 4IB3A 5FUTA 5DR6A 1W84A 4A4LA 1CMKE 2CGWA 2JC6A 5AP7A 3SVVA 3OUNB 3P5KA 3SG8A 3CGFA 3BLQA 4QRCA 4Z16A 2FVDA 3I0QA 4XEYA 5CY3A 3U9CA 3M2WA 3BGZA 4TWOA 5E8SA 4O38A 2CDZA 4R1VA 4BTFA 5FM3A 4IWOA 3R1YA 1XBBA 5EW9A 2VV9A 3UQCA 1WZYA 4YZ9A 3KRLA 4KS8A 4E5AX 4PMSA 1VYZA 3VRZA 4EOPA 2OXDA 1H1SA 3OHTA 1IA8A 4FSQA 5CQWA 5HO6A 3RVGA 5KMIA 4DFBA 3PJ1A 3I5ZA 3O96A 4O7TA 3CPCA 3QKMA 5KCVA 3CTQA 1ZYSA 3FMEA 1YW2A 3CQUA 3CQWA 2C0OA 1U54A 2CMWA 2R3QA 4RJ8A 3BWFA 5IQIA 4BDJA 3D7ZA 4W4WA 3EKNA 4LGGA 4OBOA 1UVRA 3SA0A 3OC1A 5KKRB 2X2MA 4IB5A 4C7TA 4YURA 1PMUA 3R7GA 4C3FA 4EOQA 2F7XE 3PXQA 1QPDA 2A0CX 1H07A 5AIRA 2ERKA 2FA2A 3AG9A 3HYHA 5FLFA 3R6XA 2BTRA 2BIKB 4ZY6A 3R02A 4BB4A 4O0TA 2XZSA 4ZLZA 3IDBA 4C4EA 4EZ3A 5HNIX 1GZKA 5IEVA 3MJ2A 5AUXA 1ZYLA 2V22A 4GFOA 3S95A 5M44A 4QT1A 4QP1A 3LFEA 3B2TA 4PP7A 3DKFA 4ZLYA 4HVSA 4MD9E 5K0XA 2OGVA 3P7AA 3GCVA 4K2RA 2VTNA 4UMRA 4UWBA 5L8LA 4OTGA 3LFAA 1Q8WA 3SXRA 4F9BA 3QZFA 3QXOA 2UVYA 3MY1A 3QQFA 4GK2A 4JXFA 5I9ZA 3O7LB 1H1PA 2VTPA 3L9PA 2OICA 4KKHA 2CJMA 4WIHA 5E8WA 5A4EA 2YM5A 2B52A 3FMJA 4TYIA 1I09A 2C3KA 4AZSA 5A9UA 3ZM4A 4JVGA 2UZBA 4X3FB 5ACKA 3PRIA 5HTIA 1JAMA 3P7CA 4RWIA 5E9EA 3FEGA 4EOMA 4DGGA 5HNGA 4YSJA 5E1EA 3R9HA 3FMDA 2VZ6A 3UNZA 4K77A 2H9VA 1LR4A 2VTJA 4F09A 2ZV9A 2VO3A 3SXSA 1M2PA 1PMNA 1YXUA
chains in the Genus database with same CATH superfamily
5ANDA 4ZSJA 2HIWA 5HCZA 5GIOE 2PVHA 4NEUA 3DLSA 5AP0A 1TQIA 2ONLC 4FI1A 5HIBA 1L3RE 4E6AA 5J87A 4O6EA 3H9FA 4P5ZA 3ALNA 4NW5A 3DFCB 5HCYA 1U46A 2IZSA 4PQNA 2P2HA 4NZWB 3DNEA 2GS7A 5CXHA 2C6LA 1WVWA 4I3ZA 4DG3E 4A9RA 1A48A 2EXMA 3FY2A 3KXZA 3PPJA 3EQPA 4GEOA 4FV5A 4LQMA 4PDSA 4XBUA 5EW3A 3ZLSA 2QHNA 4I21A 4KS7A 4Z7HA 2YZAA 5AWMA 1YXXA 3PP0A 4AN9A 3IPHA 1PYEA 2R3FA 2WMXA 3POOA 4HYUA 4JBVA 4MAOA 5FP5A 5FXSA 4E6DA 4DT8A 5EHYA 3EQIA 4DGLC 4Q9ZA 5AV1A 3WI6A 2C5OA 3MTLA 1JKKA 4TYJA 4RLLA 5J9YA 1SYKA 4K9YA 4YBJA 5GJDA 4CFUA 5EYMA 4A9UA 4GK4A 3D5WA 1ZMVA 4ZSAA 4JBPA 4QMLA 4FKJA 3MFSA 1UA2A 4YJQA 5DOSA 5HX6A 1W83A 3GUBA 3VJOA 3UP2A 4KIPA 3V5PA 5GZ9A 4AA4A 4AZTA 3D5UA 1PXIA 5M4FA 3TV6A 4EH7A 3PUPA 1H08A 3F2NA 4BCIA 2F2CB 3HAMA 1V1KA 2JAMA 2UW0A 2BMCA 4R3RA 3IO7A 4N6YA 5EKNA 5CF4A 2UZVA 4E7WA 3NGAA 3R7UA 4V05A 4HVHA 2UV2A 2YN8A 4QYGA 4ZSEA 4G31A 3F3VA 2YWVA 3TKUA 4IC7A 4ZMEA 3DB8A 4JMQA 4YTFA 4FTMA 4TNBA 5EM6A 2PWLA 3FMMA 3ZC5A 5IG1A 1UKIA 4PL5A 4QDEA 5E1SA 5AUZA 4O7NA 3NUPA 1GIJA 3VONA 4FK6A 3NNVA 3JXWA 4M68A 1W0XC 2W5HA 4D9TA 4U40A 3ZCLA 3TZ9A 4EJNA 2QR7A 2JDTA 2B4SB 2IJMA 4HPUE 3QZHA 1OZ1A 1ZWSA 3QZIA 3TWJA 3UG2A 2V0DA 3PPKA 4TYGA 2PL0A 3DK6A 4IB0A 3IW8A 1YDSE 5CASA 4FIHA 5JQ5A 3S3IA 4X2KA 4D1XA 2RGPA 4QOXA 3G15A 3KVXA 3QYWA 4FTKA 2SRCA 5EM5A 4KRCA 2LAVA 3RM7A 4ACHA 3GU6A 3IKAA 2W1EA 4GW8A 3ORKA 2G2IA 3O23A 4CFXA 3U87A 2RKUA 3VJNA 3PIZA 4KWPA 4I4EA 4LMNA 4YJRA 5LMKC 2WQNA 3UQFA 1VJYA 3FC2A 2CPKE 4O2PA 4FL3A 3K5UA 2XCKA 4UXQA 3TT0A 4AAAA 4DBNA 5CANA 3UNKA 4LGHA 4Z55A 2PVMA 4E4NA 5FEEA 3WF5A 5BYZA 3QD4A 4HGLA 4XYFA 4HJOA 2Y6MA 5AMNA 5FXQA 3VC4A 2Q83A 4EOOA 4JQEA 4R7BA 5I3RA 2WQEA 2QOFA 2PUPA 3RWQA 1TZDA 3II5A 2X6DA 1T45A 2R7IA 3R7OA 3LFFA 3ZONA 5I5ZA 2QOIA 1REKA 3LLAA 2BHEA 3GFWA 2XIYA 3GC9A 3Q2MA 2ITQA 3AT3A 5KZIA 5HD4A 1OBDA 3SW4A 4H39A 3E3BX 3JYAA 3LFSA 3LFCA 3DPKA 3FLYA 3QUPA 4IFCA 4L3JA 5BMMA 4C2VA 2UZWE 5I9XA 4H05A 4EOSA 1H1QA 1X8BA 3VQUA 4EJ7A 4X21A 3IDCA 2YAAA 4IADA 2JDRA 2O63A 4H3PA 3VULA 1B38A 1P14A 3VWAA 1PYXA 2E9OA 3DBFA 3R63A 4R5SA 4XX9A 5E8ZA 4CT1A 5HZNA 5IA0A 3R7IA 5KE0A 2OFUA 5E8XA 3UOJA 2W1HA 4WBBB 4CYIA 4IVDA 4I6FA 4F99A 2PVRA 3KN5A 4P4CA 2XK9A 5EYCA 2YISA 1ZY5A 1DM2A 2IVUA 2OBJA 2YERA 3A4OX 4L46A 3LOKA 4R7HA 1BI7A 3VF9A 4O81A 4BY9E 2PK9A 2WXVA 3KU2A 4UMPA 4K18A 3R1QA 4CEGA 5HO7A 1Q97A 2WOUA 2UVZA 3MFRA 3A8XA 3QL8A 4F7NA 5CNOA 2XANA 2WD1A 5C4LA 5CI6A 4GYIA 4F6WA 3AOXA 2XK6A 4YO6A 2UW6A 5CF5A 5HTBA 2VX1A 1KWPA 3W8QA 1QPJA 4DLJA 1BL7A 3IGGA 4X2FA 2GS6A 4MBLA 4Z3VA 4JG7A 5J9ZA 4OR5A 4FZAB 3ATSA 1DI8A 3MGYA 1LPUA 1ZYCA 4QD6A 3VN9A 1U5RA 4FG8A 3QWKA 1Q8YA 2Z7RA 2ITVA 5AR8A 1V0OA 2YAKA 5AR4A 2X8EA 4O0RA 3RINA 2G15A 3GP0A 5FM2A 3QQLA 2GNJA 1UWJA 1DI9A 2WMWA 4FV9A 4MWIA 4XLVA 4Y5QA 2YZLA 4BDKA 4FSMA 4FTAA 4ANOA 3DDQA 4IXPA 4BDIA 5J7HA 2EUFB 3ZC6A 4NM5A 2ITYA 2VWVA 4GMYA 4GYGA 3OXZA 3PVUA 4RQKA 2C5YA 3OY1A 4G17A 4GVJA 4USDA 4WUNA 3W18A 5CAPA 5JT2A 2Y4PA 4FT9A 5AP6A 3RHXA 2RFSA 4ANNA 4DH5A 4IAAA 3DK7A 3HRFA 5EG3A 1OL1A 4PTGA 2HYYA 2WFYA 2ITTA 2PVFA 4ZEGA 4MWHA 1YWRA 2OJIA 4O4CA 3PE2A 5CSXA 2YABA 4WG4A 2GTNA 1ZLTA 4NH1A 3QGYA 4FA2A 4MNEA 4USFA 2QQ7A 2GHMA 1PY5A 2X6EA 1Q8TA 4O4FA 1OPKA 4PTCA 4G1WA 4H1JA 4PMMA 5C1QB 2OFVA 4FG9A 4PF4A 2IVTA 3MESA 4L68A 2RL5A 5M4CA 1FGKA 5C01A 2R3GA 5AR3A 5LMKA 2XP2A 4IFGA 4EZ5A 4OAUC 3E92A 3UOLA 2AEGA 1UNLA 3RJCA 4EONA 1WBOA 3TUCA 5AUWA 5JMSA 3NCZA 1JQHA 3ORXA 4FKOA 3MPMA 4G2FA 3QRJA 2ACXA 2WHBA 3D9VA 2AYPA 4GVAA 5IH6A 5J79A 4X3JA 3C5IA 2FSOX 4M14A 3BYOA 3AMBA 3GOPA 4XV9A 4Y83A 1CKIA 4RBLA 4EC8A 4IVCA 4CKJA 5A54A 3BE2A 4MBIA 4AN2A 3HZTA 3IG7A 4RVLA 2WTKC 5CS6A 4FTNA 4ITIA 2WMQA 2JKQA 3EIDA 4K1BA 4M7IA 4R3PA 1H00A 2X2KA 4IM2A 3NCGA 4ERWA 4YJNA 3PZHA 3R7EA 4I5PA 2HW6A 1Q8UA 3ZRKA 4L7SA 4LL0A 4IB1A 3VBQA 5LVNA 4BL1A 3ZBFA 3LCOA 5FQDC 4E5BA 3A60A 4F9CA 4Z7GA 1UV5A 3E8NA 2JKKA 3BYMA 3FBVA 4J98A 4C57A 3FY0A 1G3NA 5E91A 2QD9A 1LP4A 4M0YA 1ZZLA 3D5VA 3HA6A 4BFMA 4DDIA 3W2PA 3RPVA 2JDOA 3OP5A 4AXCA 3GCSA 4O7VA 5IH5A 2XUUA 4BF2A 2GQSA 3E62A 2CGVA 2CNUA 2YCSA 1PKDA 2F7EE 3DLZA 3PVWA 3G9NA 2HWPA 3T8OA 3SW7A 2ZV8A 3PJCA 2BUJA 4P90A 3UO5A 3OW3A 4I4FA 4EWQA 2R2PA 5DE2A 5L8KA 3SRVA 3W0OA 3CKWA 4FGBA 4RJ3A 2A2AA 2XJ0A 5HLNA 1UNHA 4JDJA 4UALA 1ZZ2A 3P0MA 3HGKA 4EUTA 2AUHA 5EOLA 1VZOA 3DK3A 1JKLA 4QNYA 4O7SA 4CG9A 3D94A 3VUGA 4CG8A 5AX9A 2HZNA 2G9XA 4KAOA 4WNOA 4R7IA 4DAWA 4ENYA 3DV3A 1FBNA 4NIFA 2O8YA 4Y95A 4PMPA 2JLDA 3FYKX 4LV8A 3BEGA 4TRLA 4NFMA 3Q4CA 4AT4A 4G3GA 4D2VA 2EB2A 3ORNA 4BCNA 3M11A 3UG1A 2ZJWA 2R3IA 5K5XA 2C30A 2VWIA 4DN5A 4I20A 4MBJA 1EH4A 2B0QA 1REJA 4G9CA 3L9NA 5DH3A 3PXZA 5HG8A 4BCOA 3KRWA 3ZUVA 2QOCA 4C4IA 1H26A 1G8AA 2E9PA 2WGJA 3I6UA 4B9DA 3MYGA 4EOLA 1JVPP 3OVVA 3F69A 2ETMA 3WIKA 2UW8A 3D7TB 2JIIA 4M12A 4D0XA 4EEVA 3GC7A 4JR3A 1OUYA 3IOKA 4NKSA 2CN8A 3IOPA 3EN7A 3F3ZA 4C61A 3ZU7A 2XRUA 5JSMA 1S9IA 3W16A 3NW5A 4L3PA 4J71A 4GUEA 4Y5HA 5C9CA 3RCDA 3R9NA 3UQGA 4KNBA 4DINA 1Y8YA 4O22A 3JVSA 5I4NA 4RVMA 3EHAA 2X4ZA 4MF1A 3Q53A 4QYHA 4RIYB 4AXAA 4LM5A 5EFQA 3ENHA 4YJSA 4RIXA 3Q3BA 2PZYA 2VWZA 3FQHA 4QP9A 2O3PA 3UDBA 3VBTA 4RVTA 3QTXA 3BE9A 4YTIA 1E1XA 2X9FA 4J8MA 3FLZA 3UIXA 1SVGA 1M2RA 5DT3A 1LEWA 5CXZA 4B8LA 2ZM4A 2Z7SA 3D2KA 4JAIA 3PSBA 3PA4A 5CYIA 5CF8A 2GFCA 4JBOA 1PXJA 1SNUA 2PVLA 4A4XA 3N4UA 4XG6A 4QMWA 2B9JA 3ZXTA 5CAOA 3DAEA 2WTCA 4QQJA 4I0TA 1XH6A 4RQVA 3TKIA 2BILB 1W82A 1XKKA 3DZOA 3LQ8A 4QTDA 3WZDA 3QRIA 2BR1A 4U43A 5AM6A 3UJGA 2JD5A 4AFJA 2XK7A 1UNGA 3BLRA 4JIKA 3DJ7A 4N0SA 3FC1X 4CLIA 2GNFA 3VUDA 5AV4A 2WTDA 2X7OA 1FPUA 3DTCA 2JGZA 3EYHA 3TZ7A 3EN4A 2UZDA 5J5TA 4KSPA 4U45A 3DBEA 4KKGA 3WF7A 4APCA 4UB7A 4WA9A 5AA8A 4U79A 5LARA 2P0CA 5KHXA 2VTSA 5GHVA 2Y9QA 3V5QA 2YM3A 4BGHA 3Q9YA 1YI6A 2IVVA 4PY1A 1LEZA 4I22A 5FTOA 2PUUA 3PLAE 3FPMA 2WMRA 1V0PA 1KSWA 3R21A 3CTJA 5F4NA 4I5CA 4KBCA 3KF7A 4KB8A 4ANLA 4QMXA 2WMAA 2YLEA 5I3OA 4W9WA 3BCEA 3FQSA 3ORIA 5EHOA 4HVIA 5HE1A 4HZSA 3W2RA 2A98A 3LMGA 3GCQA 3TEIA 1VYWA 1XH9A 4G3CA 3W2QA 4C3RA 4IAKA 3Q04A 2E9NA 1B6CB 4EOIA 3COIA 1G8JA 4ZS4A 5J1VA 5AIKA 3WE4A 3F3TA 4FTQA 3HMNA 4CFFA 4JI9A 3LCKA 4RLKA 4ZLOA 5LWNA 4LGDA 2IZUA 3OTVA 5CVFA 3F5GA 3MW1A 1FVVA 4U6RA 2HY0A 3REPA 2ZB0A 4NYEA 4FTOA 2R3HA 4LRKA 5IZFA 5HG9A 1CTPE 4FTLA 3ITZA 2PZPA 2QI8A 4XOZA 2CKOA 3OBJA 4YZDA 4DF3A 3CP9A 3ZYAA 2OWBA 4JDKA 2XNOA 2W1IA 2R3NA 3QKKA 4FEWA 3BBWA 1NVSA 5AV3A 4CSVA 2FO0A 5C8NA 3AXWA 5BVEA 4RC4A 5EI6A 1J3HA 2V7OA 5HCXA 1DAWA 4AE6A 5AUYA 4RIOA 4D58A 4QMPA 3R9RA 2EXEA 3PXYA 3WZEA 4F63A 3MY0A 3VUTA 5M4IA 3BRBA 4PL4A 4PL3A 3ZDIA 3ZEWA 5HU9A 4EHGA 2XIRA 4C02A 4ASXA 1BX6A 4X2GA 4FJVA 5HI2A 2XBAA 1OITA 4C35A 3DQXA 3LVPA 4CMUA 2B9HA 1ZYJA 3P78A 4XP3A 3MPAA 3I60A 5DBXA 3UZRA 4FV3A 2XB7A 3OFMA 4I0RA 4CMTA 3EL8A 1SVHA 2Y7JA 3I7CA 4L6QA 4I6QA 5T68A 5BVFA 2UZNA 4G6OA 4IM0A 5BVNA 5G1XA 5LCJA 2C6MA 3UZTA 2PHKA 5H8BA 4FUXA 2XEZA 4LI5A 5AAFA 5LOHA 2GSFA 4DTBA 2OW3A 3PDTA 2E9VA 2R3PA 4O7ZA 4BZOA 3G6HA 3Q32A 2RG6A 4XG3A 3U8WA 2PUIA 4R78A 4V01A 3TNQB 3HL7A 2RG5A 4KRDA 3NPCA 1R0PA 4R6VA 4FKSA 3GGFA 3UC3A 1QPEA 3V8TA 4YC3A 3NSZA 1STCE 3AC8A 4JIAA 4QPAA 4OT6A 4E4MA 3BU5A 5CEOA 5D10A 4U5JA 3U55A 2W9ZB 3DAKA 4R8QA 4E3CA 2OO8X 3EQRA 1U4DA 2QOLA 4YHJA 4C36A 4QO9A 3CIKA 4TYEA 3CR0A 4L8MA 5ETCA 1MQBA 3UMWA 3VS3A 4CNHA 1YOMA 3JY0A 5H8EA 4PV0A 5HORA 1Q5KA 3PA5A 2X39A 1Q24A 4O7LA 1QMZA 3COMA 3CPBA 3MPTA 1IAJA 2BRNA 2FSLX 2JBPA 4EH4A 5AUUA 3CTHA 3HRBA 1W2FA 3NIZA 5DI1A 4I24A 5EHLA 5LMAA 4HYSA 5I0BA 2CHLA 4M15A 4EYJA 3TYKA 4FKRA 4F9WA 5FEDA 1WBVA 5IUGA 1ZOEA 4YMJA 4NK9A 3EQCA 1OIYA 2VGOA 3HDNA 4MNFA 2V5QA 4QP2A 3LW0A 4RZVA 3QTQA 4AN3A 5AADA 1W7HA 1ST0A 5KBQA 4BTJA 2CNQA 1JWHA 5EOBA 2OIBA 3Q96A 5EDRA 5FG8A 4IC8A 2OU7A 3NYOA 3UVRA 2BHHA 4BJJB 2WEVA 1H0VA 3D4QA 1S9JA 5FBOA 4S30A 2XCHA 3ZH8A 3DKOA 2YM4A 1PXLA 3GT8A 2C6IA 4KINA 5IQEA 5IDPA 3F61A 3E5AA 2CGXA 3NVMB 4BTKA 4XV3A 3I5NA 3KXGA 2QO2A 1XWSA 3VRYA 3I79A 2ZMCA 5CNNA 3AD4A 2R5TA 3MS9A 2BCJA 3MA3A 4GL9A 4FL2A 5FWKK 2IW8A 3RI1A 5A6OA 3FV8A 4XOYA 3KF4A 1JKSA 4XNEA 5AUVA 3FXZA 4HVGA 3NUXA 4HCVA 4JRNA 2DQ7X 2WMVA 2F49A 2XK4A 2XYUA 4D4SA 4FIEA 1ZOHA 3RPOA 4EK5A 4F6SA 4BI0A 3JVRA 2OG8A 2ZV2A 3RBWA 5CZIA 4ZAUA 4PPAA 4R77A 5JEBA 3CCNA 4KIKB 3GQLA 3KKVA 3TTJA 4XG7A 4FOBA 3IDPA 4F7JA 2PY3A 4S34A 4G3EA 3C1XA 3ZFXA 3SOAA 2BAQA 2YACA 4D55A 2JKMA 3V5WA 4QYYA 4WO5A 4Y8DA 3AC3A 2CKPA 4DG0E 4FTTA 4FYNA 3GU8A 4MXXA 4AFEA 4YLLA 5H9BA 4B0GA 3DXNA 4RX7A 2XM8A 4O7RA 1OIQA 3FHIA 5HLWA 4E4LA 5DPVA 4MEDA 4FIFA 1DAYA 4TYHA 2VU3A 5JKGA 5BX0A 2ZDTA 2YEXA 2WOTA 4EK6A 2GNIA 1MRUA 1OL6A 1ZY4A 3AGMA 3PYYA 4IJPA 1IR3A 3WARA 2X81A 5M08A 4LOPA 4QMMA 4AE9A 4UBAA 5LVLA 2RFNA 4BCPA 5HIDA 2V62A 3NYVA 4U80A 4F1OA 4LOOA 3QKLA 5CX9A 4XP2A 4GFGA 4C37A 4FV0A 3HRCA 2FH9A 2YCFA 4YJPA 5KKRC 5ANEA 3F2RA 4L45A 2VTRA 4CQGA 2HAKA 4O27B 5AAEA 3A4PA 1J1BA 4MUQA 1Q41A 4G6LA 5EYKA 1MRYA 4RIWB 4NCTA 3EQBA 1CSNA 2IW6A 4D2TA 2JDVA 1PMEA 4W9XA 3UGCA 4O4BB 4A4OA 3UNJA 1ERKA 4A9YA 3KXHA 4LG4A 3MB7A 5IDNA 3LXLA 2WIHA 2ZOQA 2X4FA 3LFBA 3H9OA 4V04A 3NYXA 3K54A 4O21A 2I0VA 4RJ5A 3GC0A 2JITA 3SKCA 3V6RA 2GNHA 5CEKA 4PDPA 5L3AA 1OL5A 2Y0AA 3OCSA 3QU0A 4U0IA 4U41A 4ZTHA 2XNPA 2NRUA 3MSSA 4IX5A 4C59A 2X7FA 3UVQA 1Q3DA 1YDRE 1PXPA 3KRRA 1YRPA 1ZAOA 4FKUA 5H8GA 4D5HA 4DEHA 4EH8A 5BPYA 5M53A 3R04A 4QYEA 4XP0A 5CVHA 5JZJA 1YXTA 4IVBA 3TI1A 5E8VA 3QTSA 1ZMUA 2C5NA 1RDQE 3FSKA 4G3DA 4K8AA 1GAGA 2IN6A 4JR7A 4DEEA 4RX8A 5CU4A 2F7ZE 4FIGA 2CCIA 5I9UA 2XAOA 1B39A 1H8FA 5ANKA 5CU0A 1OGYA 3OY3A 3CSVA 4KABA 2J5FA 3LFNA 4BIBA 2EWAA 3WZJA 1R78A 1IRKA 4JQ7A 1XBAA 4TWPA 5ANGA 3R8UA 4XS2A 4CRSA 3MI9A 4NFNA 3QZGA 3BGQA 1U54B 3K3JA 2VTMA 4X3FC 3C7QA 4TWCA 5F20A 4ANMA 3WF8A 3W0RA 3I0OA 1ZXEA 3QALE 5EQEA 3ODZX 3EQFA 4DH3A 4BCGA 4D2RA 1WVYA 4FNWA 3U6HA 4JJRA 4ZZOA 2P33A 5KX8A 5AP3A 4FT3A 5IH4A 4ACMA 2BDJA 4ZP5A 4AACA 4BVUA 4F4PA 5KO1A 3BHTA 3E8EA 3KMWA 3H4JA 5GZAA 2WTWA 4DTAA 3BQCA 4L44A 4CV9A 4M84A 4ALVA 3NEWA 4LV7A 1Y6BA 3IW6A 4BGGA 4QPSA 4DTKA 3IW7A 2WMTA 3QHRA 5HKMA 3W1FA 3LJ2A 4QTCA 1KOAA 4ZTLA 3GQIA 3TUDA 5DLSA 2WU6A 4FT5A 2JEDA 4U7ZA 4UMTA 4HVDA 4O0UA 3OF0A 3LXKA 2A4LA 4IJ9A 3TUBA 4NM3A 3ZLWA 3ROCA 3CLYA 1MQ4A 4FGRA 1JKTA 3NNWA 1H1WA 4A07A 3G51A 5L4QA 3UDTA 5BYLA 2QCSA 3R00A 1JSVA 2Q0NA 3WYYA 3VBWA 2NNWB 3R73A 2O0UA 5I9VA 4I6LA 5CSVA 2ITPA 3UE4A 5GIPE 3VS1A 1KE5A 2YCRA 5IA4A 3B8QA 4AS0A 3W0SA 3FUPA 5ITAA 2Z2WA 4GIHA 1Y91A 4EH6A 3HMPA 5CEPA 1NT2A 4BGQA 5EQYA 2C3IB 2P2IA 4NM7A 2I0YA 3QA0A 3O8TA 1T46A 2YJRA 4YLKA 5DR9A 4MKCA 2YDKA 2PE0A 3PZEA 5M4UA 2B53A 4CKIA 4JX3A 2UVXA 5GZ8A 5AX3A 4TXCA 1PXNA 4IX6A 2OLCA 1GZ8A 3UMXA 3ZS5A 3HV6A 3NUYA 3ANQA 3FZ1A 2PZ5A 3SQQA 3LCTA 5TOZA 3SXFA 3FAAA 4C38A 4IM3A 2J2IB 3NR9A 3QXPA 3PA3A 4W8DA 1W98A 1OIRA 4FKIA 5LQFA 4FV2A 3TZ8A 3QBNA 2VTIA 2UZOA 3A7GA 4DA5A 3HA8A 3V5LA 4U97A 1G8SA 2QODA 4PX6A 4QMNA 5E4HA 3W55A 2ESMA 5LWMA 4LL5A 4D2WA 3TDWA 3I7BA 3H9RA 3IW4A 3BV2A 1R0EA 3G0EA 2C6OA 1NXKA 3DU8A 4HPTE 1WBSA 3RK7A 3ZFMA 4RFYA 1NW1A 4IEBA 3MN3A 1K2PA 1P2AA 1U5QA 2XRWA 2YM6A 3FZRA 3VBVA 4YUQA 2I7QA 3ZLXA 2OIDA 1YOJA 5IA5A 5L6PA 3Q6WA 3RZFA 1YOLA 3T3UA 3N4TA 4J97A 1GOLA 3BL9A 1ND4A 4EBVA 2W9FB 5LMBA 3LCSA 3P23A 3VW6A 5DT4A 3BU3A 3FE3A 4IW0A 3L1SA 2BZJA 2IF8A 3PRFA 2A27A 3PJ3A 3DAJA 3Q60A 3RAIA 3W0PA 1H1RA 3RCJA 3IECA 1H01A 1XH7A 2C3LA 2JBOA 5IEYA 4TKSA 3F88A 5HD7A 5LJJA 2WTJA 2ZM1A 3AC2A 3VHEA 3U6IA 4R5YA 3S1HA 1FQ1B 3QQJA 3GVUA 4ANQA 3ERKA 2WKMA 4C4GA 3O7LD 3WZUA 1M17A 2PVYA 3RKBA 4U9AA 3TTIA 4JG8A 3R9OA 2I6LA 3G0FA 5TT7A 4EKLA 4IAFA 1YDTE 4OTHA 5TF9A 3QQUA 4O4EA 2XIZA 4WRSA 3LE6A 4DBXA 5CQUA 3OUKA 4CKRA 3VUKA 2GHLA 5KNJA 2BZKB 3R1NA 2R3OA 4F0FA 3VIDA 2XALA 3HUCA 3U6JA 5FDPA 3COHA 1F0QA 4ITJA 2W4KA 4Y85A 2X0PA 4FSRA 4G16A 4PTEA 3S0OA 3DBCA 4FSTA 3SGCA 3R1SA 2GMXA 3PSCA 3QAME 4TNDA 3GBZA 4L01A 4BDEA 1JSUA 5CU6A 2UZLA 1YXSA 4NCTC 3FI3A 2O64A 4R3CA 3R7VA 4PWNA 2W4OA 5A14A 2X8DA 2QOOA 4TPTA 4YJVA 1RW8A 2BIYA 5F95A 2J51A 4B6LA 3L8PA 3VS6A 4L53A 3V3VA 3E8DA 4IWDA 2NO3A 3BL7A 4ORKA 3O71A 4M3QA 2ETRA 4FF8A 4AXEA 3UBDA 4BCJA 4WT6A 4EBWA 2VRXA 4XG4A 3LM0A 3LXNA 4ZJVA 5DR2A 3UPZA 1V0BA 4UZDA 1CKPA 5AR5A 3GC8A 2VTTA 5L8JA 4BCFA 2YM7A 4BICA 3AMYA 4RGJA 3ML1A 2VX3A 5FTQA 3OD6X 4YTHA 2XM9A 2W1FA 3QGWA 4ZTSA 2CGUA 3OS3A 2FB8A 2QOKA 3D7TA 3OBGA 4CZTA 3F6XA 3QHWA 4RJ6A 1M52A 1OKWA 3MIAA 4R1YA 4PDOA 5JRQA 2ZV7A 2CSNA 3KCFA 1OM1A 4F1MA 3DTWA 4IX4A 4C4HA 3Q6UA 2J5EA 3AGLA 4XCUA 4FICA 4IAIA 3O50A 5B0XA 5AFVA 3W0QA 4RIYA 4WD5A 1YI3A 2C1BA 4QP6A 3T3VA 4ANBA 4DH8A 4F0GA 2VO6A 4L3LA 1UU7A 5IUIA 3R9DA 4D4YA 4F7LA 5K9IA 2R3RA 4BDFA 3PUFC 3TDVA 2JIUA 3Q2JA 1I44A 3FXWA 5JFXA 3O51A 2DYLA 4BBEA 3SLSA 3TG1A 4AA0A 4F7SA 4XJ0A 3EWHA 1R1WA 5JQ8A 4B7TA 2ZM3A 1O6LA 3LFDA 1Q99A 3OEZA 4L7FA 4M69A 5HVJA 2BAKA 4YGAA 4AZVA 5HQ0A 4OTFA 3RPRA 4G5JA 4QMSA 4P2KA 5I9YA 3V8WA 4ZK5A 3C50A 2QG7A 2PMOX 1HCKA 1UKHA 4N70A 1FINA 3HP5A 3BV3A 5IQFA 4IQ6A 4OTDA 3VUHA 1OKYA 2IO6A 4YPDA 3NNXA 3NRMA 3ORMA 4QQTA 3ZSHA 3HX4A 1XJDA 2R3LA 3RHKA 3B8RA 1Z57A 3MY5A 5DHJA 4EH9A 3JR1A 2HELA 2WQMA 1Y57A 4K33A 2EB3A 2YLFA 5AP5A 5EKOA 5H3QA 4O7WA 5EM8A 3VUMA 3R8LA 3BGPA 3PIYA 2VTQA 2W05A 3MJ1A 4RJ7A 4UWYA 3WF6A 5AEPA 3E87A 5AV0A 4KSQA 1KV1A 4O0WA 3UIUA 4QYFA 3D0EA 1WFCA 3R01A 1J7IA 4GV1A 2XAMA 1BYGA 4BCQA 3BYUA 4L9IA 2ITWA 4FV1A 5DFPA 4QP7A 4LOQA 5CSHA 2WU7A 3QC4A 4CFVA 3G5DA 5D1JA 4CZUA 4GT4A 1VLRA 4TW9A 5CEQA 2QG5A 4NTSA 5KMNA 2BAJA 4RC3A 3ET7A 3NDMA 3FZTA 1JNKA 3CKXA 1XBCA 2J4ZA 4IHPA 1P5EA 4AZFA 2NP8A 2GCDA 3FSFA 3TXOA 2AQXA 5HVKA 5M09A 3NVKI 2UZEA 4KBAA 3NW6A 3FZSA 4DEAA 5HU3A 4FV8A 5DWRA 3H10A 1MP8A 5C27A 2IG7A 4EC9A 4ZJIA 3HAVA 2W06A 4BTMA 2B7AA 1PXMA 2W1ZA 2X0QA 4EI4A 5JFVA 5HGIA 3PJ2A 2IZTA 3U4UA 1O6KA 2XNEA 3GXLA 4Z9LA 4FE2A 2BRGA 4UEUA 2QU6A 4WNKA 4UMUA 3RAWA 1PJKA 1GY3A 4CCBA 4H58A 3O8PA 3CXWA 4M0ZA 3E7VA 2CKEA 4FTRA 4HNIA 4OW8A 5A4QA