2IJMA

Crystal structure of focal adhesion kinase domain with 2 molecules in the asymmetric unit complexed with adp and atp
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
275
structure length
260
Chain Sequence
DYEIQRERIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKAQQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Focal Adhesion Kinase 1
publication title Crystal Structure of Focal Adhesion Kinase Catalytic Domain Complexed with ATP and Novel 7H-Pyrrolo [2,3-d] pyrimidine Inhibitor Scaffolds
rcsb
source organism Homo sapiens
molecule tags Signaling protein,transferase
total genus 82
structure length 260
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ijmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ijmA01
3OP5A 4BVUA 2BMCA 4RX7A 3R6XA 3ZHPC 3ZC5A 5I9ZA 4NZWB 2FGIA 1S9IA 1W7HA 1QPJA 2Z7QA 4JG7A 1PF8A 2JFMA 1Y8GA 2R5TA 3OMVA 1QPEA 3L8XA 3SAYA 4DEIA 2WO6A 2YWVA 1Y91A 4IAKA 3IOKA 4M7IA 1OPJA 2GSFA 4D5HA 4YLJA 3AT3A 3LM5A 4LRJA 2PUIA 2Y4IB 4IFCA 4KIPA 3QTRA 2C6DA 4Q5EA 2OIDA 4OTFA 5AMNA 4BGQA 3R7YA 5D9HA 2WD1A 4YR8A 5KHWA 5JFSA 4FC0A 3DXPA 1Q99A 4O84A 4WIHA 1V0OA 5ACBC 5EQYA 1UU9A 3Q04A 5E90A 3M2WA 1H0VA 1QCFA 3MJ1A 3PZHA 4FI1A 4QP9A 3R9DA 3L9PA 1H28A 3ORNA 3WARA 3VQHA 2FB8A 4QP2A 4FKPA 3Q3BA 2VD5A 1GY3A 1PMUA 2VTQA 3FBVA 2IZUA 3GFWA 3NYNA 3O8PA 1WVXA 3QXPA 3NS9A 4BDFA 3BCEA 3LFQA 4EZ3A 4ZZMA 2F49A 4LOQA 3EQIA 3PA4A 2W1EA 3A7GA 5AA9A 2YAKA 1JLUE 4ZJVA 4CTBA 1ND4A 2I7QA 3I7BA 5LVMA 2GFCA 4O0TA 3COMA 4JIKA 2WTWA 2HY81 4W4XA 4YZ9A 3PY0A 4BKYA 3R0TA 3G15A 2YM5A 4DEDA 1YXSA 2RIOA 4L67A 5GNKA 2CN8A 5JQ8A 3KEXA 3Q96A 5IA3A 1JNKA 4GYIA 2QKRA 1ZLTA 5DNRA 4PTEA 3U54A 5BMSA 2X2MA 2WMBA 4IE9A 4FMQA 3DJ5A 3EKKA 4BICA 3P7BA 5M44A 2CMWA 2XNMA 4FKQA 4J8MA 4O91A 5KMJA 2ZB1A 3ZOSA 4G2FA 1P2AA 3G9NA 4PMPA 2WXVA 5FTGA 2JD5A 3ZH8A 5AAEA 5HLPA 4O1OA 5A4QA 4XNEA 4IVAA 4I1ZA 2PUUA 1PY5A 2W96B 5CTPA 5EW9A 2OZOA 2VAGA 5BUIA 4FUXA 5HE3A 5CSHA 1WBNA 2RFNA 3JR1A 5HX8A 2FSOX 2G2IA 3QTSA 2IN6A 2QOOA 2OJIA 3PA3A 3C0HA 4A4XA 4A7CA 3MPMA 1UV5A 1REJA 2YIYA 2IZTA 3JVRA 1XH8A 4FSNA 5FEEA 2W99B 4V05A 3U9NA 3RPYA 2W5HA 3DBFA 3SW4A 2P2IA 4BCKA 5JGBA 5I9VA 4QO9A 2IG7A 2R3GA 3PDTA 2R0UA 4IAIA 1DI9A 3VULA 1L3RE 5CVGA 4X2KA 2F7XE 3RK9A 4CV9A 3GQIA 4GUBA 4FTNA 2R3PA 2YLFA 4BHNA 3VUIA 2PE0A 4QT1A 3F7WA 4TW9A 4QMZA 3DZOA 2VTNA 4Y83A 3PIZA 4B8MA 5HCXA 1BL7A 5DWRA 4G3DA 4TYEA 2X1NA 1UVRA 2QONA 2XP2A 3UMXA 2PVKA 2B9JA 3W2CA 3IW7A 3NNVA 5D7VA 4WKQA 4F0GA 3SD0A 3R8PA 3AD6A 1AD5A 4QQ5A 3II5A 5FGKA 5EHYA 2XEYA 5IQBA 4CZTA 4C61A 3R71A 5EFQA 2BDJA 2PWLA 3QGYA 3IDBA 4X6RA 4YJNA 4ZZOA 5DT4A 4RT7A 4IVCA 4LRMA 4I6HA 2B52A 4U9AA 3BWFA 3RNYA 4N57A 2E9UA 3KK9A 5HD7A 1MRYA 4HZRA 2QU6A 4G6LA 3TNIA 3CQEA 4RJ5A 5ETFA 1I09A 4KKEA 5CAUA 2UZWE 5M08A 3KRJA 4NW6A 4TWNA 5J5TA 3SGCA 3PWDA 1XH5A 3BX5A 2J0IA 3C4FA 2UW8A 2R3FA 3QTWA 4UMTA 3RM7A 4YTFA 3RHXA 4BHZA 3QD0A 4U41A 1Y6BA 4IX5A 3HV3A 5FXQA 4BZDA 1O9UA 2YJSA 4JQ8A 3D15A 3TN8A 3VIDA 4D4YA 3V5WA 4YP8A 4ASEA 4H3QA 3QRKA 5ETAA 3UO5A 1EH4A 3HEGA 2ZMCA 3Q9WA 3ZM4A 3AC1A 3ITZA 4IJ9A 2C6IA 4FKWA 4X3FA 3MGYA 3D94A 3LCDA 3QAME 4KRDA 5DFPA 3ZDIA 4E4NA 5A4EA 3NW6A 3D4QA 5CVFA 4FKSA 3W33A 3C51A 4DEGA 4FKTA 4FV9A 3GU5A 1U46A 2ZAZA 3NDMA 3TZMA 3AXWA 4R5YA 4YZCA 1PXKA 4FNXA 4HGLA 3WF6A 1W98A 2VWYA 2XNPA 3KL8A 3MA3A 4R3PA 2V7OA 2YM4A 3PXZA 4J97A 5DLSA 4CFUA 2ETKA 1XH4A 2UZBA 4CFMA 2BPMA 5HTBA 5ITAA 4IX4A 4JNWA 1FMKA 4ZTLA 3AT4A 3RINA 3HMPA 3WBLA 4L6QA 3WF5A 4IDVA 3ZU7A 2A27A 4DEBA 5BYLA 3KULA 3QCYA 3QF9A 4LOOA 4R3RA 4ZSEA 5BVKA 5LMAA 3ZO2A 5H8BA 4D0WA 4AACA 3EYHA 2ZV7A 2WFYA 3VS3A 2Q83A 2Y6MA 3NEWA 3D14A 1WFCA 2EXEA 4IH8A 2C5VA 4FL1A 4O2ZA 2YIRA 4FSTA 5DEWA 5C9CA 4AN2A 3WILA 3OG7A 4TYHA 4R78A 1M14A 3GCSA 4AA5A 4UMUA 4PL3A 4QP3A 3QUEA 3UIMA 3C5UA 2YCSA 2KTYA 2UVXA 4QYEA 4XP2A 5DHJA 3VUMA 3OUNB 4M13A 3T9TA 4XV1A 4UY9A 4AZEA 4BCIA 3UZPA 3A2CA 2PZYA 2QODA 3UG2A 3K3IA 1Q61A 1UWJA 1FVRA 1Y8YA 4BN1A 4OW8A 5L6WL 3FLQA 3LJ0A 5HZNA 3SW7A 4WBOA 3ANQA 5I9UA 4E5AX 3PE1A 3EWHA 3DQWA 4EHZA 1PXLA 1RW8A 2X6DA 5CWZA 2OH4A 3GXLA 5E8WA 1YXXA 5GJGA 1TVOA 4ACCA 2ZM4A 4A9UA 2W1CA 5CLPA 5TR6A 3RAIA 4LUDA 3W55A 1FGKA 1VR2A 2VTHA 4BDEA 3DBCA 1GNGA 2V5QA 4PL5A 4PPAA 5ANEA 1HCLA 1KE5A 5AR5A 2B9IA 1YDRE 3EL8A 2XVDA 3CKXA 3OS3A 2BIKB 3P4KA 5B2MA 1FBNA 5EM8A 4PUZA 3SV0A 1ZXEA 4OLIA 5IEYA 2WTVA 1LP4A 3DDPA 4EHEA 3PXYA 5F95A 1CSNA 3QA0A 2X4FA 4G5PA 3K54A 5DPVA 3UO6A 1U5QA 3ZRLA 4BTMA 4DG3E 5JFWA 5LWMA 3LXKA 4YU2A 3CEKA 3F82A 4U44A 4LGHA 4QPAA 4WNMA 3NUSA 4BCOA 1J7LA 5FXSA 4GK2A 3QGWA 3EZVA 4YJTA 2XS0A 4PL4A 5CENA 3UVPA 5AX9A 2YITA 1GZOA 4C38A 3BI6A 2XCKA 5IA4A 3PJ1A 2BRGA 2XKFA 2G9XA 2YM7A 5ICPA 3U4UA 3LZBA 3POZA 3E87A 4HYHA 4CSVA 1M17A 3S2PA 4CZUA 2F2CB 4NTSA 2VTTA 3BHYA 4J99A 5EDQA 4CRLA 2VWBA 5K4IA 2UZNA 2Y7JA 2J4ZA 3PRIA 5ANJA 3NSZA 3QXOA 4PMSA 1KE7A 3OF0A 5L2TA 1ZOGA 2HAKA 2XM8A 1NT2A 1PMVA 4FKLA 4PTCA 2X8IA 3Q4CA 4GU6A 4YZBA 4C34A 2HELA 1YOLA 3EIDA 2AC3A 2VRXA 1SYKA 4FIHA 4TTHB 3U6IA 3UQCA 1YHVA 2FA2A 1JPAA 3E7OA 3K5VA 3NNUA 4RLKA 3GVUA 3REPA 4EL9A 2XNBA 4ZY5A 4CV8A 4QMOA 2W06A 2W5AA 2BKKA 3E8NA 5CU2A 3E93A 2QCSA 4JJRA 4QMYA 4EH5A 3RMFA 2ITQA 2BDFA 5CZHA 4C4IA 2XA4A 3EHAA 4ZZNA 4G3EA 2J6MA 4BY9E 4O1PA 3OT8A 4AZWA 4UB7A 3O71A 4PNKA 4EQUA 5J1VA 4G9CA 4FYOA 5DRBA 2H9VA 4UZDA 3VUKA 3LFFA 3UZRA 1SVHA 4BDJA 5KMKA 2PVNA 3L1SA 4EOMA 1B39A 5AV1A 1PXNA 3V51A 2I0HA 2VNYA 4CFWA 4GK3A 3TKUA 3EQPA 3IDPA 4A9TA 5HO6A 4XOZA 5CQUA 4FKIA 3BE9A 2B4SB 3MJ2A 3AC2A 3DKCA 4KS7A 4O2PA 3A7FA 3R22A 4U3YA 2R3HA 4MK0A 3CTJA 1NVRA 4YZDA 3BQRA 3EKNA 4DT8A 2EWAA 1OIQA 4HNFA 4PY1A 4EC9A 3LOKA 4FTLA 3V5LA 3R2BA 5DR6A 4PV0A 2E9VA 4G31A 2C1AA 3P1AA 4AS0A 1PW2A 1Q8ZA 4X6QC 1M2PA 3SQQA 4FV3A 1WBVA 3ZZWA 3SOCA 4QMXA 5CF8A 4B99A 3F5XA 3VO3A 1H4LA 3ENMA 3FLZA 4MXAA 4CYJA 3SXRA 3O8TA 4BCHA 4CEGA 2BROA 2I6LA 1JOWB 2QKWB 4IAYA 1BUHA 3QZFA 2X9EA 4G3GA 3KQ7A 1JSUA 3HV4A 2XIXA 4OAVB 4O27B 3Q9ZA 4S33A 4YJUA 1LR4A 4RIXA 3T8OA 1Q8YA 3SKCA 5BVOA 1Q97A 3RPRA 3R01A 4E4MA 4GH2A 2J90A 3W2PA 3OW3A 3RVGA 5DT0A 3B8RA 3VBWA 3ZRKA 4DF3A 4DHFA 3E63A 3AOXA 1RDQE 3ORKA 4XG9A 5I9XA 4U43A 4C35A 1FQ1B 4WSYA 5KBQA 5BMMA 1LEWA 2PZRA 1GJOA 4C4GA 3L9NA 3FPQA 3CD3A 2W4KA 3UVRA 4ZSJA 1XBBA 2E9NA 4ANQA 3DY7A 5FM3A 4E4LA 5BX0A 1XBCA 4UN0C 1G3NA 4GFGA 5EW8A 3ZFYA 4J7BA 2ZM3A 3C4CA 3F5GA 3NX8A 3V5TA 5CAQA 4AP7A 1YOJA 2G15A 5AADA 2GQSA 2BDWA 4AX8A 5HBEA 4RIOA 5HU9A 1H8FA 5BNJA 3RGFA 3CPBA 2DQ7X 1GZNA 2GDOA 5BYZA 1W83A 5C01A 5JK3A 3CQWA 3OT3A 4EUUA 4LGGA 2IW9A 4P5QA 4AZSA 5I5ZA 2Q0BA 3R1YA 5HG9A 5LCKA 4AW1A 4H39A 3CXWA 3MA6A 4EZ7A 2UW9A 4OAUC 4YZMA 5I4NA 3C4ZA 5AUYA 3WYXA 3RPVA 2VTLA 3VS7A 4DINA 2VU3A 2X7FA 3QZGA 2CCHA 3D7TA 4KB8A 5DEYA 3ATTA 3HLLA 2OKRA 3AC5A 4FG8A 3QLGA 3PLSA 3PVUA 5KHXA 4ERKA 3PSBA 3LFAA 5M4UA 4I4EA 1CKPA 2C0OA 3R83A 4J71A 1ZZLA 5AP3A 1WBTA 3DK7A 2UUEA 2R3IA 3S3IA 3HAVA 4Y5HA 1UNLA 3IW4A 3DJ6A 1M7NA 1R0EA 1JSTA 3E88A 5IQFA 3MY5A 4MNFA 4RX5A 4BDDA 4TNDA 2JAMA 2VGPA 3AD5A 3V8SA 3MESA 4KNBA 3DCVA 3CLYA 3UG1A 3U6JA 2GPHA 2UZOA 4HVHA 3HECA 5A6OA 3BU6A 5ANDA 1BMKA 5DT3A 2GNJA 5HI2A 2OF4A 2BZJA 3O17A 3BYSA 4LL0A 3FLWA 3Q60A 4YJVA 3QTQA 3FC1X 4FSUA 1JKLA 3AGLA 3BE2A 4PP9A 1B6CB 4UEUA 3QU0A 5CI7A 4TWPA 5D10A 1L8TA 5J5SA 3KGAA 4UWCA 3RCDA 4X3FB 1OGUA 2YHVA 3LCKA 4ZTHA 3MS9A 3AC8A 2A4LA 4NSTA 2ITTA 4BIEA 1PMEA 4KS8A 3OROA 1BI8A 1O6KA 5C8MA 2PL0A 4F0IA 3CS9A 1MRUA 3TTJA 5C4KA 3FSKA 3PE2A 5E8UA 3OTUA 4UX9A 3G33A 1PRYA 5IA2A 3PP1A 1OIUA 4ZAUA 5HNBA 3GNIB 2BRBA 1XQZA 5IPJA 4OGRA 2QI8A 3QCSA 5EHLA 1JVPP 2PZIA 4TZRA 1Q8TA 4BWKA 5EK7A 2CGXA 5GIOE 2CSNA 3LAUA 1YRPA 4IADA 4S32A 4JOAA 2HXQA 4YBKA 2YJRA 4ARKA 1H1QA 5I0BA 4MD8E 3DS6A 3KULB 5D1JA 4FG7A 5FDPA 3SA0A 5F9EA 2B9FA 3GQLA 5BVEA 4R1YA 4EQMA 4DFUA 4RVKA 2JKKA 3FLYA 3QUDA 2WQMA 3R73A 4NM3A 4D4SA 2ETRA 2XK9A 2WTIA 4U79A 3H3CA 3KA0A 2A2AA 3H0YA 2OJFE 4ANNA 1OZ1A 3HYHA 1KOAA 2XH5A 5H8EA 5DOSA 1ZMUA 2PVJA 3P23A 3WI6A 5K3YA 3I0OA 3TEIA 5KMNA 5M06A 3W32A 5BPYA 1REKA 3S4QA 1W82A 1Q3DA 3U4WA 3UZTA 3PXQA 3UDBA 3R1SA 5IEVA 2C3IB 4C59A 3ZUVA 4BI1A 3EL7A 4CLJA 1GOLA 3P7AA 1H1WA 5HD4A 2WQBA 3F7ZA 4D9TA 3ENHA 1GZ8A 2YEXA 1QMZA 3BQCA 4R8QA 4LGDA 5KKRC 5GZ9A 5BUEA 2BHHA 1WBWA 4FOCA 4DCAA 4C37A 4OT5A 3IS5A 4E93A 4H3PA 4I0RA 4HPUE 3TG1A 4MHAA 2BTSA 4CQGA 4DGLC 5JGDA 1FGIA 3ZLYA 4I0TA 2J0JA 4LFIA 4BCNA 3QQFA 5DH3A 3VAPA 5IMXA 5LVNA 4EK5A 5LMBA 4BRXA 1IG1A 2J50A 5TF9A 4JL9A 4CKRA 4ASDA 4ZS0A 2OBJA 4CFVA 3FZ1A 3OBJA 2EXCX 4IAFA 4V0GB 4YTHA 5AM7A 3FYKX 4CT1A 2VTAA 4JQ7A 4TYIA 5IZFA 4TL0A 4GT5A 4EI4A 2WQOA 2KULA 2RG6A 2I0YA 5DR9A 4L53A 2X8DA 4LMUA 4N6YA 5DMZA 3TNWA 2C3LA 2E2BA 1H00A 4IX3A 4F9CA 1YXVA 4PQNA 4L8MA 4XG3A 2IZSA 2YM8A 4O86A 2JKQA 3QQJA 3SLSA 3C4EA 3COIA 4FIFA 4ZEGA 3WF9A 2C1BA 5IUIA 4YGAA 5CEKA 3HNGA 3RI1A 4BDCA 5HX6A 3V5PA 4XRJA 5L6PA 4MCVA 3LFSA 4ITIA 2WMAA 3AD4A 4QTDA 5I9YA 2A1AB 3RK5A 2A0CX 3ROYA 4A07A 2YZAA 4AZVA 2PUNA 3LXPA 5HIEA 4AW5A 4KKHA 3VUGA 3N51A 4WUNA 4RZVA 3LLTA 3MY1A 4I5CA 4UMQA 2XNEA 2QOLA 2REIA 3AC4A 4Z3VA 4B9DA 3F5UA 4QQCA 4XV9A 2C47A 1OITA 5HVJA 5AUWA 2BVAA 1U59A 3ZO3A 2BR1A 4EBWA 2OFVA 1PXJA 3G51A 4W8EA 3ORLA 3U8WA 3EH9A 1OPKA 2A19B 3Q6WA 3GEQA 2PPQA 2PU8A 2F7EE 3NIEA 3RK7A 2J0MB 5J1WA 4F1TA 3GFEA 3G0FA 1DS5A 2VTOA 5E1EA 3T3UA 2XK6A 3CSVA 1VEBA 3ZLXA 5CF4A 3A8XA 3PZEA 2JIIA 4A9SA 3O7LD 2YM6A 5CU3A 4ZTRA 4EONA 3BU3A 5IEXA 1PKGA 4CMUA 3R9RA 4AT3A 4L3JA 4YO4A 4FGRA 4PPCA 3GGFA 4CVAA 4EK3A 5GZ8A 5AAFA 3BGZA 5FP6A 3A7JA 3UQFA 4HVIA 2ZVAA 2BAQA 3NUXA 3FC2A 2G1TA 3OFMA 2EXMA 3QD2B 4EH3A 4EH6A 1WCCA 4KWPA 3S95A 3E8CA 4RWKA 4XRLA 5BVDA 4H1MA 3H9FA 3IW8A 2XKEA 3OOGA 2CCIA 4BCGA 4XX9A 2W9ZB 2Z2WA 5LQFA 3NNWA 2WMVA 4H58A 3ORMA 2QG7A 4GUEA 3L8VA 4HCUA 4U3ZA 3RZBA 1PHKA 3RAWA 5JH6A 2JDRA 4DEHA 4DH1A 2CHLA 1PXIA 2WMSA 4KIQA 1YWNA 3SXFA 3D0EA 4ZTNA 4HPTE 4WRSA 3CJFA 2BRMA 3R9OA 4H1JA 4M14A 3R9NA 4PWNA 2R3JA 4K33A 4NW5A 4C8BA 3TT0A 1MQBA 2IVUA 3C7QA 4DA5A 3KN6A 3KFAA 3VUTA 2R3LA 2OXYA 4ZOGA 1YDTE 3FI8A 5AFVA 5LARA 3TIYA 3DGKA 4FF8A 3GC9A 4RIXB 4WRGA 5IA1A 5EH0A 3IK3A 1F0QA 4CXAA 2QR7A 1NY3A 2DYLA 1BKXA 1YXTA 1SZMA 2PVFA 5AWMA 2H34A 2Y6OA 3E62A 4W9WA 1WBPA 3QZHA 4RA5A 4U81A 4W4YA 5D11A 3R7IA 3U6HA 3FSFA 4PDOA 3OWKA 2ZMDA 3MVJA 5M09A 5HCZA 2CNVA 5DN3A 3NW7A 3DOGA 4C7TA 4BCPA 5HBJA 5J9ZA 4GFMA 4KSQA 4E5WA 4WNKA 4LQMA 4OTWA 2XB7A 3DU8A 4K8AA 2WPAA 4RLLA 2BFYA 5EM6A 5HLWA 4XH6A 3RBWA 4O0RA 4U7ZA 4N0SA 5AP6A 2WMQA 4DITA 1MP8A 4F1OA 4AZFA 3HV6A 4RBLA 3LFNA 2AYPA 4RVMA 4XOYA 3DK6A 3FZPA 2ZOQA 2UZLA 2JDTA 3DBEA 3HDNA 2JKOA 4CZYB 4DFNA 4KKGA 4QQTA 3BBTB 3KY2A 5M07A 3ZEPA 3POOA 4DH7A 3RP9A 4ZP5A 1KV2A 1KV1A 3GUBA 4QTBA 1R78A 4I92A 4DG2E 2OZAB 4GEOA 5JZNA 2UV2A 2FO0A 4MBJA 3ORXA 2PVRA 1ZARA 1OL1A 3CKWA 3LCOA 4S31A 2C3JA 2ACXA 2PVMA 3VJOA 4AA0A 2HZNA 4J98A 3MDYA 2WOUA 3MTLA 4OBQA 4EOPA 5FTOA 4UMPA 3D7TB 3FZSA 4JBPA 5HO7A 3COHA 1GAGA 2F2UA 1UU8A 2X2LA 2W05A 2V0DA 3FAAA 4FTAA 2W0JA 3R8UA 2CKOA 2W1HA 4TKSA 5CZIA 3EB0A 4NFMA 4KIKA 3R63A 5KMOA 3KCFA 3FV8A 4QMWA 1NW1A 3UIXA 1H25A 2XNOA 5IUGA 3QYZA 4F63A 2RKUA 4LRKA 2QOFA 3P5KA 2C4GA 3F2AA 3KRXA 4IJPA 4E8AA 1H1PA 2IVSA 2XEZA 2JIVA 2ZJWA 3R2YA 4J95A 1YQJA 1S9JA 2XIRA 2UVZA 5CXHA 2B9HA 5FRIA 4L46A 2EB2A 3KCKA 4Y46A 4DGMA 2YDJA 3A62A 1IR3A 4FV4A 2J0LA 3IW5A 4IB5A 3U9CA 5L2IA 4O7RA 4FEQA 3HMOA 1W0XC 3VNTA 5J7BA 3BLQA 5AUXA 5CXZA 3VHEA 3DJ7A 5CASA 4QQJA 1GIIA 5E9EA 4V01A 4F9AA 4IC7A 1PXMA 4E6QA 3MV5A 2OG8A 4IZYA 4RC3A 4EH7A 5F20A 4O7TA 4F1MA 1B38A 3DNEA 3OWLA 1R1WA 2GNIA 3FXXA 3UJGA 3TZ8A 4IIRA 4DEAA 5CF5A 3NVKI 2OICA 4GMYA 3NAYA 4FL2A 4FV6A 4FKRA 3ZZEA 2NP8A 1OIYA 4FIIA 5HVKA 4AAAA 2NNWB 3ZM9A 3CC6A 3KREA 1MRVA 5EM7A 3NUUA 4D4RA 4M15A 5CT7A 4IWOA 3PP0A 4G3FA 2FUMA 4OUCA 5HVYA 1JSVA 4BDKA 3NMUF 1UKHA 3Q6UA 2OJJA 4GKHA 2RGPA 5A14A 3LMHA 4PF4A 3Q2MA 3KXMA 4G3CA 4D4VA 4R7BA 3IG7A 4L43A 5FBNC 1KOBA 3E8EA 4GSBA 4IANA 1UU7A 2ITNA 3HP2A 5CQWA 5DA3A 5T6KA 1ZOHA 4IWPA 3DFCB 1WVYA 1QL6A 2OH0E 3DXNA 2C0TA 3FL5A 3LHJA 5D12A 5H3QA 2OXXA 1J7UA 4MVFA 4JG6A 4JVGA 4EORA 3ACJA 3F69A 2XK7A 4AGWA 2QO2A 4MXZA 4K0YA 4DFXE 4AXAA 2CPKE 3FHRA 2PMIA 4RVTA 5BVWA 4D1ZA 4DFLA 2BILB 4EYJA 1KE9A 3CIKA 4FZDB 5AA8A 4FTUA 3VS6A 2CJMA 4QMNA 5FEDA 1O6LA 1WBSA 3QRIA 4PDSA 3SHEA 2R3RA 2F7ZE 2LGCA 4AZTA 4CQEA 3C0GA 4NTTA 5E8YA 4M12A 3MH0A 3FE3A 4TT7A 4YZNA 4EOIA 3MBLA 3FLSA 1P14A 5CX9A 5HTIA 3PLAE 3JY0A 5IMEA 2XF0A 4YC8A 2VWXA 1TQIA 3KXHA 4IVBA 3NVMB 1ZYCA 1OKZA 5K0XA 4Z16A 3L8SA 3LPBA 5L8JA 3UO4A 3DNDA 4II5A 4QTEA 2PK9A 3LQ5A 3ZLWA 5KKRB 4EH9A 5AX3A 3ROCA 3ZCLA 3V6RA 3O2MA 1ZYJA 3FQSA 2UZVA 3C4WA 4GL9A 2XZSA 5LVLA 2YN8A 3ODYX 3N4VA 4ZTSA 4TN6A 5G6VA 4IC8A 4BTKA 5EYMA 5HU3A 3S1HA 2IWIA 4LYNA 4O7YA 3ZSGA 3EOCA 3VUHA 3ORPA 4WSQA 5K9IA 4DGOA 2C5XA 2ETMA 3EN6A 4GFOA 3TUCA 2ITOA 2V55A 3TM0A 4X0MA 5GINE 1U5RA 5HG5A 4YLLA 3HDMA 3CCNA 3F3VA 4OTRA 4EOLA 1BI7A 1JQHA 4J96A 5EKNA 2X7GA 2WEVA 1V0PA 3OUKA 4MTAA 4L7SA 2ZV9A 5EHOA 4BGGA 1Q8UA 4JRNA 1NVSA 2H6DA 3ZRMA 4F65A 3AG9A 4E6AA 4CMTA 3EFWA 4I93A 2PVLA 3RM6A 4I6QA 5B7VA 2X8EA 4DG0E 4ZTMA 2YZLA 3WE4A 2QR8A 3CR0A 3MFUA 4L3LA 4I6FA 2XIZA 4NWMA 1IAHA 4DE4A 3VJNA 5AJQA 2PULA 4JBVA 1VZOA 4ZK5A 3FEGA 3QYWA 3R28A 4GS6A 4FIJA 3FMKA 4QMUA 4A06A 5DIAA 5GIPE 4ALUA 4FT7A 2QLQA 4Y5QA 4UMRA 2GCDA 4K1BA 3R8MA 4C3PA 1XHAA 2VO3A 4QP7A 4Y72A 3RWPA 4DLIA 3WZKA 1APME 2YABA 2GTNA 3OXTA 4R7IA 3H10A 3UYSA 4O81A 2FH9A 5KO1A 2WTKC 4RJ4A 4C57A 3FKLA 3NUYA 3UGCA 1P4FA 4D2PA 3BYMA 2GU8A 1LUFA 3QC9A 3OD6X 5L8LA 3GC8A 4E1ZA 3EFLA 3BHUA 2QURA 2YISA 1UNGA 5T68A 4GT3A 3DTCA 3BLHA 4ZMEA 2GQGA 5IQHA 1JKTA 1NXKA 5AV3A 5LCJA 2R0IA 3MVHA 2IVTA 3EFKA 4ANBA 4FT3A 5AP0A 5AV4A 2HK5A 4OTDA 2VTPA 3B8QA 2ERKA 2C6EA 3FZTA 3EQCA 4J53A 2R3QA 1YXUA 4IAAA 3BV3A 4QP1A 4HGSA 2GFSA 3EN7A 1SNUA 5AR4A 1UA2A 2JITA 4FUYA 4CCUA 1M52A 2BAJA 3NLBA 3OZ6A 4FSRA 3DA6A 1PXOA 4C02A 4M69A 3KRWA 5C8NA 3TNQB 1XBAA 5IF1A 3QKMA 4FTIA 4ZS4A 3DKGA 5L2QA 4FIEA 2QO9A 4JQEA 2CKQA 4AGUA 3A99A 3KXNA 2HY0A 4IX6A 2XJ1A 3EQGA 4IZAA 1FVVA 1BLXA 2P55A 3M1SA 5KZIA 2W1IA 2W1DA 3DBDA 3LCTA 4O7ZA 3OCTA 5K5NA 4DBXA 4BR3A 4F0FA 2WIHA 5JEBA 2YCQA 2QOBA 4IXPA 2CLQA 3GOKA 3C9WA 4I20A 3R1NA 4IM0A 3K5UA 4YC3A 3K3JA 3QKLA 2RFEA 4PP7A 2WNTA 3ZBFA 1CKIA 5L2WA 1RE8A 4OR5A 4X2JA 1J3HA 4FZ7A 2JDSA 4D1SA 5IDNA 2QC6A 4BIDA 3BYOA 3R8ZA 1T45A 3D5VA 4EQCA 2I0EA 2RFDA 4G1WA 3IGGA 5AR7A 1OBDA 4O7WA 1KWPA 3FI3A 4MXOA 4JX7A 3MH1A 3P9JA 5IDPA 4EOJA 2HW6A 3DBQA 3GBZA 4ZY4A 2VX3A 5KE0A 3PPZA 1ZYDA 4L01A 4FV1A 4QPSA 4BB4A 1E9HA 5AP5A 4MWIA 3HUCA 2RG5A 3KXXA 3DKOA 4GYGA 3FQHA 4RGJA 4BGHA 3DQXA 2XNGA 2VX0A 4AU8A 4QYYA 2Y4IC 4EUTA 2VWWA 1OM1A 2CGWA 2PMNX 4FSWA 4W4VA 4EZ5A 3RTPA 3IKAA 1OKVA 2I0VA 4BZOA 4L7FA 2ONLC 5AUVA 1YOMA 2BTRA 2GNGA 3D2IA 4B7TA 3WF7A 4I5HA 2R3NA 4TRLA 4OTGA 3ELJA 3ETAA 2XKCA 4JXFA 3L9LA 4HVGA 4XP3A 2XRWA 4O6LA 4NJDA 4OTPA 5ETIA 5IH4A 4FTTA 3S00A 5A9UA 2XRUA 3D7ZA 1OIRA 4BIBA 5JGAA 5KBRA 4AF3A 5GJDA 5HG8A 5EYDA 4RMZA 5TT7A 4ZJJA 4E6DA 3A7IA 3WYYA 5AR3A 4YHTA 2XCHA 3NUPA 3HX4A 3ZXZA 4DH5A 2G2FA 3FHIA 3GU4A 3DB6A 3TWJA 1OUYA 2ZV2A 3GU7A 2X9FA 3NUNA 4WHZA 2I40A 4FEXA 2VWVA 2JIUA 4Y95A 4IWDA 3RPSA 1TQPA 3VC4A 1V1KA 4KIKB 4EH2A 4AN3A 4YNOA 4NIFA 4X7QA 4A9YA 4LV8A 1DI8A 3UPXA 5L3AA 4R77A 3UIUA 2EU9A 4L45A 2V62A 4FOBA 4IWQA 4TXCA 1OMWA 2WQNA 3ALNA 3FYJX 3GCUA 2O65A 4L68A 4XHKB 4YHFA 4F7LA 2GQRA 5A46A 3BYVA 3GP0A 4UZHA 1OB3A 5ETCA 5E91A 1IASA 4C36A 3LFCA 4E20A 1R0PA 1J91A 1LEZA 3NAXA 3TZ9A 4RPVA 3M42A 2QU5A 2W1GA 5BQ0A 3JVSA 3VBYA 1NA7A 4HCVA 1A48A 3WE8A 2B1PA 4JG8A 4KSPA 3ZUTA 4CKIA 2CKPA 4QPMA 2HIWA 1AQ1A 3CY2A 4QMMA 2R9SA 3TZ7A 4ENYA 1W84A 4K9YA 4DFZE 3JUHA 4ANMA 4DFBA 3UOJA 4XP0A 2ESMA 3PJ2A 2WMXA 2BZKB 4QMLA 3PVWA 3E92A 4O6EA 4GU9A 5CY3A 5CANA 4TWOA 1ZYLA 4ENXA 2QD9A 5EYCA 4WO5A 4UWYA 3AC3A 4I5PA 5I3OA 3DPKA 4TYJA 3R21A 2WELA 4KBCA 4ACHA 4D2SA 4F99A 3E64A 2YACA 5EOLA 5JT2A 3P78A 4CNHA 4AOJA 3UNZA 3HRFA 2OIQA 3AQVA 4RFYA 4E4XA 5IKWA 2F57A 4RG0A 1OI9A 2B7AA 4O21A 3HZTA 3FKNA 5AUZA 3UYTA 4HGEA 4AGDA 4MH7A 3DDQA 4LI5A 4LOPA 4DLJA 5L6OA 2PVHA 3TKIA 3F3WA 3ZDUA 3R04A 2QOQA 4YC6A 3LFBA 4O0YA 3QFVA 3P7CA 4WNOA 3QUPA 4FTQA 5E1SA 2R2PA 2YAAA 3L9MA 3Q5ZA 3I1AA 4FVPA 4UV0A 3FXZA 2C5YA 4RA4A 3G6HA 3LJ2A 4D0XA 3QRUA 4KD1A 3R7EA 3TNPC 2VN9A 4OTHA 3ZSHA 3U51A 5BVFA 4R1VA 3DAEA 5L2SA 3MIYA 4IVDA 3MFSA 4E3CA 4XYFA 4UXLA 3BHTA 4EWHA 4FICA 3Q4TA 2VWIA 3HA6A 4L52A 3PRFA 3CJGA 2WEIA 5E92A 5DGZA 5CALA 1TKIA 2ITPA 5A4CA 3AT2A 4ASXA 3QCQA 4CG9A 4LL5A 3V04A 1J7IA 2CDZA 5KMLA 4C4EA 4IEBA 4NM0A 4X2GA 4YO6A 4RFZA 3NZ0A 5EG3A 1Y57A 4ZJIA 4FE2A 4BFMA 3Q32A 4TYHB 4QMSA 5ANKA 4XLVA 3RWQA 1RJBA 2F9GA 1WMKA 3Q53A 5FD2A 1NVQA 2B55A 2UZEA 4G16A 5GJFA 4JAJA 4S30A 3UOLA 4D2WA 2IPXA 4F09A 2OJ9A 3W8LA 4XUFA 3QC4A 4TNBA 3SG9A 3I4BA 3CPCA 4GK4A 4ZSGA 3DV3A 3CP9A 3I5ZA 2DWBA 3GOPA 3LJ1A 4Y8DA 4ZSAA 3QTIA 4ONAA 1XH6A 3F2RA 2Y8OA 1XH7A 4NK9A 4IB0A 3A8WA 4D1XA 2W7XA 1OBGA 4HOKA 4U42A 5GZAA 4DC2A 2UW0A 4PPBA 4F6WA 2JEDA 1OL7A 1PJKA 1ZAOA 3JY9A 2W4JA 3GB2A 4HVDA 4EOOA 1PKDA 4JI9A 3Q5IA 4Z7GA 4QNYA 3P0MA 4XV2A 4JS8A 2CKEA 2PHKA 2UW4A 4YSJA 5HLNA 4HYSA 5GHVA 2OXDA 2PMOX 5M57A 5IQIA 1ZRZA 3U55A 3DLZA 2YFXA 5EI2A 4WBBB 4F6UA 5KMMA 4MNEA 3SG8A 3FMMA 5DI1A 5EDPA 1URCA 2XUUA 3AGMA 3UC4A 3S0OA 4F7SA 4RJ7A 4ANSA 4CG8A 4FT0A 2ITVA 1K9AA 3H4JA 2E9OA 4AG8A 1VYWA 3HV5A 4FSMA 4I23A 4JBOA 4EHVA 1T46A 2ZB0A 1A9UA 2WGJA 1AGWA 5HHWA 1Z9XA 5HE2A 5HE1A 5C03A 1KSWA 3QKKA 4X2FA 4QYFA 4XBRA 3W8QA 5JZJA 4JDKA 1Q62A 3W2OA 2C5NA 5HG7A 5A4LA 1QPCA 2EB3A 4A9RA 2P0CA 3RJCA 2WMUA 3H30A 3QTUA 4NCTC 4AFJA 2GNLA 3C1XA 3FPMA 4DBNA 2O2UA 5HICA 3ZXTA 4JBQA 1CTPE 5EOBA 3KB7A 3SRVA 5JN2A 4ZMFA 2OI4X 5DVRA 5KCVA 4BDAA 1R3CA 3G6GA 3MN3A 1YKRA 3FMLA 4BCJA 4GG5A 4D2VA 2J0KA 4D5KA 4E5BA 3R30A 2CLXA 5HCYA 3HL7A 4IFGA 4BDBA 4USFA 1UWHA 3ZFXA 2J5EA 3UOHA 3KKVA 4HGTA 2HZ0A 3B2WA 3AMBA 2FSMX 3HUBA 4F7JA 3LLAA 1WAKA 2B53A 4M8TA 4DGGA 4G6NA 2VUWA 3LQ3A 2XYUA 3QWKA 1ZYSA 1YWVA 5HIDA 3TTIA 4LM5A 5DRDA 2WIPA 4AT4A 2W5BA 2FSLX 3COKA 2YDKA 4LMNA 5BYYA 2BFXA 3W2SA 5HBHA 3HMIA 4GVJA 3JXWA 3TL8A 3MIAA 1YHSA 3PXKA 4C0TA 4DGNA 4O96A 5KZ0A 5EYKA 3V5QA 4FTKA 4WG4A 1HCKA 2W4OA 1VJYA 3FZRA 5LMKA 4FODA 3GC7A 3QZIA 4O82A 2XBAA 5IISA 1WVWA 1ATPE 3KVXA 2ITUA 3P86A 3LQ8A 4RJ3A 1JAMA 3NYVA 3LIJA 3FDNA 2QHNA 2QNJA 3ZMMA 4YJSA 3KXZA 3I60A 2GNFA 3LVPA 4FNYA 4UYAA 4FNWA 2X4ZA 3FXWA 4GJ2A 4BC6A 4JDIA 1DAWA 2ZDUA 4P4CA 4C3RA 3VS4A 3I5NA 5CAOA 4Q9ZA 5J8IA 2YIXA 3EN9A 3IOPA 4F9BA 3R7OA 3W1FA 4W9XA 4N4SA 4CMOA 4JX3A 2BRNA 4FSZA 4Z9LA 3CTHA 1ZZ2A 3BWJA 3E5AA 3RNIA 5L8KA 4DTAA 4FVRA 4JR7A 2C6OA 3BPRA 4M84A 4UWBA 3LKMA 3IPHA 5EQEA 4GVAA 3PIYA 4AE6A 2BRHA 4BBMA 4NM5A 1W8CA 4RC2A 4C62A 4Z55A 1FMOE 3F5PA 4EYMA 1OL2A 4ITHA 5CF6A 4BYIA 3R7VA 1K2PA 3GU6A 4FK6A 4KRCA 4MXYA 4RSSA 5AP4A 3V5JA 4EC8A 2WMTA 4ZXTA 3VHKA 5J79A 3O8UA 4AUAA 2HZ4A 3JPVA 4MF1A 5JMSA 4IW0A 4O0XA 3PPKA 3UVQA 4J8NA 4D2TA 3IECA 2HWOA 5CEIA 4F64A 4BBFA 1IA8A 1Q8WA 4FL3A 4RC4A 3VBXA 2GS2A 2RSVA 3KN5A 2XJ0A 5J9LA 5EKOA 4CT2A 4NKSA 2BZHB 2XJ2A 3E7VA 4FK3A 4KBKA 4YTCA 2XK8A 1U54A 3H9OA 4FTCA 3BRBA 3ACKA 5CNOA 2XMYA 3ZO1A 3DXQA 4YMJA 4H3BA 3NYOA 3TUBA 1OECA 2JGZA 2OFUA 4RIWA 2Q0NA 2C6MA 4IQ6A 5TKDA 3PY1A 5BUJA 5CAPA 3RALA 4PX6A 4EH4A 2GHGA 2H96A 3MVMA 5TE0A 3TJDA 3TI1A 4AWIA 3BU5A 5CAVA 4FTRA 2XBJA 5K5XA 4JT3A 5CEOA 4DN5A 2AUHA 2VWZA 1Z5MA 2Z7SA 4LG4A 2X0GA 5H8GA 3ULZA 4U8ZA 4FEUA 2C0IA 2CNQA 1DM2A 3PA5A 3PY3A 3Q4ZA 3BLRA 4R3CA 4X21A 5HQ0A 4NL0A 3ULIA 4JAIA 4ORKA 3QQHA 4USDA 5I9WA 5IA0A 1A06A 3EYGA 3BYUA 1UU3A 1ZMVA 3OW4A 1H26A 3H9RA 3FMEA 2R3MA 3FKOA 3F3TA 5M4FA 4NIFB 3FUPA 4FIGA 5CSWA 4EEVA 3NRMA 5CSVA 4P7EA 4K11A 4XBUA 3F2NA 4EJ7A 2AC5A 3GCPA 4EKKA 3FY2A 3HRBA 4AW2A 4C58A 4DTKA 3P79A 3VF8A 2VV9A 4DEEA 3VN9A 3V3VA 5AR8A 4BCFA 5FEQA 4XCUA 2QOCA 4KA3A 2HYYA 2JDVA 2YIWA 4F70A 2G2HA 2QHMA 2XYNA 3ODZX 5K4JA 5I3RA 3UNKA 4P90A 1ZY5A 3C50A 4I6BA 3QL8A 5FG8A 4KBAA 5TOZA 3Q9XA 4A4OA 1U4DA 4O0SA 4CFFA 3GCQA 2Z8CA 4BF2A 4C4JA 3DAKA 4DYMA 4NUSA 3PXRA 3OC1A 4CFXA 2OIBA 5A54A 5CEQA 3P08A 3DT1A 4FNZA 3QLFA 4NJ3A 2GS7A 4WA9A 3EJ1A 3LXNA 3BHVA 4EK4A 5J7HA 2W9FB 2WMRA 5EM5A 5CEPA 5M56A 4HW7A 3UTOA 3R8LA 1GIJA 1PMNA 4NEUA 3VBTA 4BTFA 1YWRA 4D28A 5JQ5A 4YSMA 5ACKA 2WZJA 4F08A 3MVLA 4IM2A 4RIYA 3FQEA 5CVHA 4FT9A 5FP5A 4BCQA 1M7QA 4BI0A 4PMTA 3WOWA 4EJNA 2GMXA 3QRJA 2VGOA 4PNIA 5FM2A 2QG5A 4BDIA 1VYZA 5A3XA 3ZO4A 2P2HA 4ZLOA 5J9YA 2QVSE 4FKOA 2BZIB 3QCXA 3QTXA 3VRZA 4QRCA 3UC3A 5IUHA 1YI6A 2YERA 4YJPA 4ACGA 5BVNA 3ANRA 5FUTA 2HWPA 4FTJA 4QP6A 4UXQA 2PVYA 4RQVA 3O50A 4EKLA 1IEPA 3C13A 3WIKA 5EI6A 4I5MA 5LMKC 2WTJA 5AP1A 2PE2A 3A4OX 4OBPA 3KVWA 1RQQA 3BGPA 5E7RA 2F4JA 2GHLA 2FVDA 5AEPA 3OWJA 2VTSA 3NW5A 3V8WA 2Z02A 3OBGA 3GCVA 3PYYA 5EW3A 3KF7A 3WIGA 4FKUA 4M66A 3ZEWA 2Y0AA 4E7WA 2QOKA 3FI4A 3V8TA 5J87A 4DCEA 4QMQA 3EQHA 2J51A 4DH8A 5HORA 3GI3A 3W2QA 2J2IB 4FX3A 4FBXA 4DTBA 2W17A 3KMUA 4ZY6A 5J95A 3Q2JA 4FSQA 3WZJA 5IQEA 3ZFMA 5HESA 2OK1A 3F3ZA 3PSCA 4X3FC 4Y73A 2Y9QA 2DS1A 5IA5A 3F61A 4WUAA 3VVHA 4TYGA 4M0ZA 5M51A 4FKVA 3ZSIA 1WZYA 3LW0A 3B2TA 2QO7A 3ZYAA 3VS2A 3G0EA 4USEA 4JLCA 3BKBA 5E8XA 5EDRA 4U80A 4L9IA 2QOIA 4QP4A 1PXPA 1UNHA 3PXFA 3TNHA 4BI2A 2PZ5A 3SVVA 1M2RA 5FTQA 2IW8A 1P4OA 4FR4A 4S2ZA 4IB1A 4BCMA 4L00A 3UPZA 1H1SA 3MFTA 4BKZA 4Y85A 1J1BA 3GENA 4MQ2A 3UQGA 3NR9A 3QBNA 2OJGA 3NWWA 1YDSE 3GT8A 4NH1A 5IG1A 5E8ZA 3DTWA 1YW2A 5ANOA 5LJJA 4PTGA 4MBIA 5HOAA 3TIZA 4PDPA 3IGOA 4XG2A 1XKKA 2Y4PA 4RRVA 2PSQA 1OL6A 4MNEB 3BGQA 1JWHA 3R02A 2R7IA 3G9LX 3R7UA 2X2KA 3HAMA 3FMDA 2O63A 5FXRA 2QLUA 5AP7A 3KF4A 3PVGA 5CNNA 4FZ6A 4O22A 2XM9A 3PTGA 4YBJA 3FMHA 3ZTXA 4FKGA 4FYNA 2OW3A 3KK8A 3KU2A 2YM3A 3CD8A 3MB6A 4HYUA 4AT5A 2PUPA 3PG3A 5AP2A 3PFQA 3HVCA 4FG9A 3AMYA 3M11A 3R7GA 4O7SA 4DH3A 4X2NA 5H9BA 4CTCA 1JKKA 2HCKA 3OXZA 1OL5A 3F9NA 3JYAA 3EQRA 3WZDA 1Q41A 4YUQA 4OTQA 4AN9A 4XJ0A 4GIIA 5H2UA 1SVGA 4JRVA 2BCJA 4MWHA 5AV0A 4QNAA 3SRVB 3ID6C 4O38A 2XK3A 4ZIMA 4WG3A 3LMIA 5M55A 4U40A 5JFXA 2YA9A 3VS0A 5L4QA 3BELA 4PRJA 1BL6A 4PMMA 3T3VA 4AA4A 4QMTA 1H27A 4EOKA 4RFMA 1IRKA 3LFEA 4IB3A 4QYGA 3TJCA 5KX8A 4FVQA 3VUDA 3D5XA 3VW6A 4W4WA 4EK6A 3O0GA 5LWNA 4FZAB 2FYSA 2RL5A 2UVYA 3IW6A 4V0GA 3D2KA 3ZLSA 3NGAA 3MI9A 3FY0A 3QTZA 2VNWA 2ZV8A 3N4TA 5HIBA 2R7BA 4K18A 4R5SA 4PDYA 2WTDA 2WB8A 3RPOA 2SRCA 1J1CA 3OOMA 1YI4A 2VWUA 2Z7RA 5F4NA 3CY3A 4RWJA 2O0UA 1XJDA 2RFSA 3K2LA 3RAHA 4YNEA 4YURA 3NUAA 1Q24A 3W10A 1XR1A 1G8SA 4L3PA 4O0VA 4C2VA 4HVSA 4IACA 3A61A 3EQFA 4D55A 5M4CA 2UZTA 2XNNA 2EUFB 2GS6A 1YVJA 3QA8A 1PYEA 3R00A 4APCA 1URWA 1STCE 3TV7A 2IVVA 3OTVA 3TACA 5HEZA 3CGOA 2J9MA 2C6TA 2B0QA 1LPUA 1QPDA 4DT9A 4XG7A 3CE3A 3VF9A 4ANLA 3RAKA 1KE8A 3NCZA 4EWQA 5IH5A 1FOTA 4RQKA 3G5DA 3VRYA 4BDHA 3W16A 2WMWA 2XK4A 5AUUA 5HNIX 4IAZA 4M3QA 2O5KA 3TDWA 5C27A 3HMMA 4I3ZA 4ANOA 4CRSA 4IHPA 3R8VA 4I94A 1M2QA 1TQMA 2XKDA 2VX1A 3I7CA 4FKJA 5JKGA 4EOQA 4K2RA 3F6XA 5CEMA 4K77A 4I24A 1FVTA 3L8PA 3EQDA 3KRLA 4WT6A 5D7AA 3PWYA 3ATSA 2ERZE 3LE6A 5B0XA 4CD0A 5KNJA 5IQGA 3RKBA 4FSYA 3MH2A 4FGBA 4FEVA 3QWJA 4JR3A 3GU8A 2JLDA 4N6ZA 3LXLA 5D41A 4CFNA 4RX9A 4F7NA 2BUJA 2HOGA 4GW8A 2WTCA 1FPUA 5K0KA 3D83A 2WQEA 4MKCA 1ZY4A 2B54A 1OVEA 4RWIA 5C26A 3MTFA 2C69A 4K6ZA 4EOSA 4BKJA 4AOIA 2RF9A 3RZFA 4J52A 3KC3A 3TV4A 4I22A 2R3KA 3NNXA 5TO8A 2O64A 4Z7HA 3V01A 4F4PA 3ORTA 4MD9E 2VTIA 4HZSA 1ZOEA 3EMGA 3A7HA 4FV2A 4O7VA 2VO7A 2WU6A 4MAOA 4G9RA 2BKZA 4TWCA 1U54B 4EHGA 4U5JA 3ERKA 2X7OA 1K3AA 4RJ6A 4KABA 5FLFA 4G17A 2ITXA 3EZRA 4GG7A 4P2KA 4RIWB 4UBAA 4HYIA 4ERWA 2HZIA 4WOVA 3VBQA 1X8BA 2ONLA 4MQ1A 2HW7A 4IBMA 5DBXA 3JS2A 3W18A 1CKJA 3WF8A 3PVBA 5M53A 3FL4A 3CBLA 3LMGA 3MPAA 5HKMA 4HJOA 4N70A 2BIYA 4MYGA 4TY1A 4YJQA 2ITYA 4AGCA 4BL1A 2O8YA 2GHMA 3FMJA 2OSCA 3SX9A 4A4LA 2P3GX 5IQDA 3FLNC 4S34A 3MYGA 4ZLZA 5AIRA 1WBOA 5AUTA 3QQGA 4MEDA 3RCJA 3QQUA 2X81A 4M97A 5HO8A 5T3QA 3I6UA 4I21A 4YPDA 4AQCA 2C6KA 4Q5HA 2YLEA 4B0GA 3LM0A 3G90X 5IQAA 3F66A 2NO3A 3Q52A 2UW7A 2JDOA 2C68A 4BWXA 1FINA 1SMHA 1Z57A 2CN5A 4FT5A 3WZEA 3E3PA 4FV7A 3OVVA 4CLIA 3EQBA 3PUPA 3THBA 3D5UA 3MH3A 3QRTA 4QTAA 3F3UA 3ET7A 4QOXA 1Q3WA 3BEGA 3HA8A 3HKOA 3NYXA 4L42A 4XV3A 4WG5A 5FBOA 1JBPE 2QQ7A 3PSDA 3TXOA 4BWPA 4ASZA 2I1MA 4FZFB 2CGVA 2NPQA 5FQDC 2HENA 2W1ZA 4GRBA 4QD6A 2PE1A 5C1QB 1YI3A 3CQUA 1YHWA 3NCGA 3RHKA 3R1QA 1ERKA 3QHWA 4KUJA 4OT6A 4U0IA 5F94A 5CU0A 5LOHA 1H08A 3C5IA 4R6VA 4KIOA 5JFVA 4P5ZA 2H8HA 3MSSA 3BZ3A 3BHHA 4FV8A 1XH9A 1OPLA 2V7AA 5AAGA 2W1FA 4BDGA 2OZAA 3TV6A 3QALE 4NYEA 3VBVA 2GTMA 3O7LB 3OWPA 3MWUA 5EI8A 4U45A 2EVAA 3WZUA 2VO0A 3PIXA 5CS6A 4YJOA 4DAWA 4YJRA 3ZONA 2OF2A 3OEZA 4RIYB 4TPTA 4W8DA 3KRRA 1Q4LA 4WD5A 4BTJA 2G01A 4OBOA 4G34A 4C4HA 4EH8A 4DFYA 1IA9A 4CGAA 1F5QA 4XG8A 3DKFA 4F9WA 4MX9A 2NRUA 4XLIA 4IM3A 5E8TA 2JBOA 4I4FA 4O83A 5E4HA 3Q9YA 1G5SA 1CDKA 2C3KA 2O3PA 3DK3A 1CM8A 4MD7E 2BHEA 4XG4A 5C8KA 2Z60A 2UW5A 3NPCA 2XIKA 3OCGA 4H36A 4XG6A 4AFEA 2UW3A 3FI2A 4EK8A 3QQKA 3KMWA 3FMNA 4M0YA 4E6CA 3UBDA 4O0UA 5C4LA 3KXGA 4QP8A 2CNUA 3DZQA 1JKSA 4Q2AA 4V04A 3ZC6A 5AM6A 1IAJA 3MFRA 4X3JA 2R4BA 5KUPA 2IZRA 5CU4A 3UOKA 2VTJA 3FWQA 2YCRA 5DR2A 2R64A 4RVLA 2WOTA 2E9PA 3LCSA 4MXXA 3FJQE 5HE0A 5B2LA 4YPSA 4JDJA 1GZKA 3MB7A 3HRCA 3G2FA 3PJ8A 4D2RA 2NRYA 2VZ6A 2YIQA 3QD3A 2J7TA 4M68A 4QMVA 2VTRA 3DFAA 4RJ8A 5FDXA 3MY0A 2C30A 3HMNA 3OY3A 4O0WA 2IW6A 3UP2A 3N4UA 3OCBA 2UZUE 3MW1A 4G6OA 1KUTA 1O6YA 4GT4A 3DLSA 4UALA 1V0BA 4U97A 3OXIA 2FSTX 4ACDA 3OY1A 4NFNA 3ZBXA 4O7LA 4HCTA 4RZWA 2X39A 3I6WA 2WHBA 1I44A 1MUOA 4QTCA 3ZS5A 2C5OA 3I79A 3LFDA 3SC1A 3QHRA 2YDIA 2YWPA 4AOTA 3D9VA 4IZ5A 5AIKA 5CSXA 3QX2A 4NT4A 2PMLX 3C0IA 2P4IA 4QMPA 4D58A 4B6LA 4CCBA 3BBWA 2XIYA 3ORZA 3QQLA 4B8LA 3SXSA 4RWLA 3UP7A 5EQPA 3VWAA 4YHJA 1BYGA 3OEFX 2BALA 1MQ4A 2ZYBA 4ZSLA 3TKHA 1PYXA 3C4XA 2JKMA 5AR2A 2X6EA 4I41A 2DUVA 1HOWA 2J5FA 2V22A 4QYHA 1OKYA 5CT0A 3CGFA 5DG5A 2VO6A 3PJCA 2PY3A 3UIBA 5JRSA 2LAVA 2CGUA 2C6LA 5G1XA 4CYIA 5DYJA 4MF0A 4GCJA 3PPJA 3PG1A 3Q4UA 4U6RA 3I81A 5LVOA 2UZDA 4XS2A 2OLCA 4IDTA 3R9HA 4F9YA 3VS1A 3CTQA 1KE6A 3FZOA 3NIZA 4ALVA 4B4LA 4BZNA 5CSPA 3EN4A 4BBEA 3I0QA 1XO2B 4O7NA 3OCSA 4LUEA 2WU7A 1H07A 5ANGA 3E3BX 1Y6AA 1SNXA 4OTIA 2WKMA 3BIZA 2JAVA 5E8VA 3TCPA 4YTIA 2ITZA 5A6NA 5B2KA 4EBVA 4HNIA 2WTKB 3IO7A 4ITJA 5CYIA 5JRQA 5LVPA 3O23A 2YCFA 4GJ3A 4KAOA 2HXLA 4M67A 3UMWA 1H24A 1GIHA 4NCTA 4GIHA 1CMKE 5KMIA 5IQCA 2OWBA 3HV7A 2Z7LA 4BYJA 4C2WA 5CU6A 3ALOA 4C4FA 1P5EA 2OU7A 5HTCA 3PJ3A 1SVEA 4FA2A 5DE2A 1Q5KA 3UODA 3V6SA 2PZPA 4H05A 2ZM1A 4IZ7A 4KINA 4L44A 3A4PA 5CI6A 4ALWA 1XWSA 4IMYA 5AV2A 5LXMA 4MXCA 1E1XA 1ZWSA 3VQUA 5JSMA 4FV0A 2P33A 5A4TA 4CKJA 4Q9SA 3U87A 4C3FA 4NM7A 3N9XA 3QD4A 4NKAA 3TUDA 3HGKA 4MBLA 4NU1A 1H01A 4APPA 2R3OA 4C33A 4D9UA 3H0ZA 2JC6A 1F3MC 3IDCA 2VTMA 5HNGA 1E1VA 4XMOA 5FWKK 3W2RA 1OUKA 4AE9A 3D5WA 4AW0A 3GC0A 4FTOA 4JIAA 4F6SA 2PYWA 3AMAA 3HP5A 2ZDTA 4M69B 2IO6A 4ZTQA 3T9IA 5IU2A 2BAKA 2ITWA 4GV1A 3BEAA 3DB8A 5ANIA 5E8SA 1R39A 4FV5A 2OO8X 3ZUUA 3EFJA 4WNPA 3A60A 4G5JA 2JBPA 3IONA 3SDJA 2IJMA 4J1RA 4GKIA 2OGVA 2GNHA 4UYNA 4LV5A 1UKIA 4E26A 3SOAA 2UW6A 4ACMA 1ZMWA 4I0SA 1OKWA 3IQ7A 4FTMA 5F1ZA 4JDHA 5HGIA 4E73A 4R7HA 1DAYA 1H1RA 3BV2A 2JFLA 3OHTA 3E8DA 1H0WA 3O51A 3VS5A 1SM2A 3EN5A 3O96A 3ORIA 4XEYA 3VW8A 3UE4A 5IH6A 1G8AA 3KMMA 3TDVA 4ZLYA 5M4IA 4ID7A 3DAJA 3F88A 4FEWA 3MPTA 3QX4A 2WAJA 4RX8A 2PTKA 3UNJA 4YLKA 2QOHA 1BX6A
chains in the Genus database with same CATH superfamily
3OP5A 4BVUA 2BMCA 4RX7A 3R6XA 3ZHPC 3ZC5A 5I9ZA 4NZWB 2FGIA 1S9IA 1W7HA 1QPJA 2Z7QA 4JG7A 1PF8A 2JFMA 1Y8GA 1W2FA 2R5TA 3OMVA 1QPEA 3L8XA 3SAYA 4DEIA 2WO6A 2YWVA 1Y91A 4IAKA 3IOKA 4M7IA 1OPJA 2GSFA 4D5HA 4YLJA 3AT3A 3LM5A 4LRJA 2PUIA 2Y4IB 4IFCA 4KIPA 3QTRA 2C6DA 4Q5EA 2OIDA 4OTFA 5AMNA 4BGQA 3R7YA 5D9HA 2WD1A 4YR8A 5KHWA 5JFSA 4FC0A 3DXPA 4MUQA 1Q99A 4O84A 4WIHA 1V0OA 5ACBC 5EQYA 1UU9A 3Q04A 5E90A 3M2WA 1H0VA 1QCFA 3MJ1A 3PZHA 4FI1A 4BJJB 4QP9A 3R9DA 3L9PA 1H28A 3ORNA 3WARA 3VQHA 2FB8A 4QP2A 4FKPA 3Q3BA 2VD5A 1GY3A 1PMUA 2VTQA 3FBVA 2IZUA 3GFWA 3NYNA 3O8PA 1WVXA 3QXPA 3NS9A 4BDFA 3BCEA 3LFQA 4EZ3A 4ZZMA 2F49A 4LOQA 3EQIA 3PA4A 3P5JC 2W1EA 3A7GA 5AA9A 2YAKA 1JLUE 4ZJVA 4CTBA 1ND4A 2I7QA 3I7BA 5LVMA 2GFCA 4O0TA 3COMA 4JIKA 2WTWA 2HY81 4W4XA 4YZ9A 3PY0A 4BKYA 3R0TA 3G15A 2YM5A 4DEDA 1YXSA 2RIOA 4L67A 5GNKA 2CN8A 5JQ8A 3KEXA 3Q96A 5IA3A 1JNKA 4GYIA 2QKRA 1ZLTA 5DNRA 4PTEA 3U54A 5BMSA 2X2MA 2WMBA 4IE9A 4FMQA 3DJ5A 3EKKA 4BICA 3P7BA 5M44A 2CMWA 2XNMA 4FKQA 4J8MA 4O91A 5KMJA 2ZB1A 3ZOSA 4G2FA 1P2AA 3G9NA 4PMPA 2WXVA 5FTGA 2JD5A 3ZH8A 5AAEA 5HLPA 4O1OA 5A4QA 4XNEA 4IVAA 4I1ZA 2PUUA 1PY5A 4I6LA 2W96B 5CTPA 5EW9A 2OZOA 2VAGA 5BUIA 4FUXA 5HE3A 5CSHA 1WBNA 2RFNA 3JR1A 5HX8A 2FSOX 2G2IA 3QTSA 2IN6A 2QOOA 2OJIA 3PA3A 3C0HA 4A4XA 4A7CA 3MPMA 1UV5A 1REJA 2YIYA 2IZTA 3JVRA 1XH8A 4FSNA 5FEEA 2W99B 4V05A 3U9NA 3RPYA 2W5HA 3DBFA 3SW4A 2P2IA 4BCKA 5JGBA 5I9VA 4QO9A 2IG7A 2R3GA 3PDTA 2R0UA 4IAIA 1DI9A 3VULA 1L3RE 5CVGA 4X2KA 2F7XE 3RK9A 4CV9A 3GQIA 3TYKA 4GUBA 4FTNA 2R3PA 2YLFA 4BHNA 3VUIA 2PE0A 4QT1A 3F7WA 4TW9A 4QMZA 3DZOA 2VTNA 4Y83A 3PIZA 4B8MA 5HCXA 1BL7A 5DWRA 4G3DA 4TYEA 2X1NA 1UVRA 2QONA 2XP2A 3UMXA 2PVKA 2B9JA 3W2CA 3IW7A 3NNVA 5D7VA 4WKQA 4F0GA 3SD0A 3R8PA 3AD6A 1AD5A 4QQ5A 3II5A 5FGKA 5EHYA 2XEYA 5IQBA 4CZTA 4C61A 3R71A 5EFQA 2BDJA 2PWLA 3QGYA 3IDBA 4X6RA 4YJNA 4ZZOA 5DT4A 4RT7A 4IVCA 4LRMA 4I6HA 2B52A 4U9AA 3BWFA 3RNYA 4N57A 2E9UA 3KK9A 5HD7A 1MRYA 2X0QA 4HZRA 2QU6A 4G6LA 3TNIA 3CQEA 4RJ5A 5ETFA 1I09A 4KKEA 5CAUA 2UZWE 5M08A 3KRJA 4NW6A 4TWNA 5J5TA 3SGCA 3PWDA 1XH5A 3BX5A 2J0IA 3C4FA 2UW8A 2R3FA 3QTWA 4UMTA 3RM7A 4YTFA 3RHXA 4BHZA 3QD0A 4U41A 1Y6BA 4IX5A 3HV3A 5FXQA 4BZDA 1O9UA 2YJSA 4JQ8A 3D15A 3TN8A 3VIDA 4D4YA 3V5WA 4YP8A 4ASEA 4H3QA 3QRKA 5ETAA 3UO5A 1EH4A 3HEGA 2ZMCA 3Q9WA 3ZM4A 3AC1A 3ITZA 4IJ9A 2C6IA 4FKWA 4X3FA 3MGYA 3D94A 3LCDA 3QAME 4KRDA 5DFPA 3ZDIA 4E4NA 5A4EA 3NW6A 3D4QA 5CVFA 4FKSA 3W33A 3C51A 4DEGA 4FKTA 4FV9A 3GU5A 1U46A 2ZAZA 3NDMA 3TZMA 3AXWA 4R5YA 4YZCA 1PXKA 4FNXA 4HGLA 3WF6A 1W98A 2VWYA 2XNPA 3KL8A 3MA3A 4R3PA 2V7OA 2YM4A 3PXZA 4J97A 5DLSA 4CFUA 2ETKA 1XH4A 2UZBA 4CFMA 2BPMA 5HTBA 5ITAA 4IX4A 4JNWA 1FMKA 4ZTLA 3AT4A 3RINA 3HMPA 3WBLA 4L6QA 2ZFYA 3WF5A 4IDVA 3ZU7A 2A27A 4DEBA 5BYLA 3KULA 3QCYA 3QF9A 4LOOA 4R3RA 4ZSEA 5BVKA 5LMAA 3ZO2A 5H8BA 4D0WA 1W2DA 4AACA 3EYHA 2X0PA 2ZV7A 2WFYA 3VS3A 2Q83A 2Y6MA 3NEWA 3D14A 1WFCA 2EXEA 4IH8A 2C5VA 4FL1A 4O2ZA 2YIRA 4FSTA 5DEWA 5C9CA 4AN2A 3WILA 3O5AA 3OG7A 4TYHA 4R78A 1M14A 3GCSA 4AA5A 4UMUA 4PL3A 4QP3A 3QUEA 3UIMA 3C5UA 2YCSA 2KTYA 2UVXA 4QYEA 4XP2A 5DHJA 3VUMA 3OUNB 4M13A 3T9TA 4XV1A 4UY9A 4AZEA 4BCIA 3UZPA 3A2CA 2PZYA 2QODA 4LV7A 3UG2A 4O4DA 3K3IA 1Q61A 1UWJA 1FVRA 1Y8YA 4BN1A 4OW8A 5L6WL 3FLQA 3LJ0A 5HZNA 3SW7A 4WBOA 3ANQA 5I9UA 4E5AX 3PE1A 3EWHA 3DQWA 4EHZA 1PXLA 1RW8A 2X6DA 5CWZA 2OH4A 3GXLA 5E8WA 4LDTA 1YXXA 5GJGA 1TVOA 4ACCA 2ZM4A 4A9UA 2W1CA 4JMQA 5CLPA 5TR6A 3RAIA 4LUDA 3W55A 1FGKA 1VR2A 2VTHA 4BDEA 3DBCA 1GNGA 2V5QA 4PL5A 4PPAA 5ANEA 1HCLA 1KE5A 5AR5A 2B9IA 1YDRE 3EL8A 2XVDA 3CKXA 3OS3A 2BIKB 3P4KA 5B2MA 1FBNA 5EM8A 4PUZA 3SV0A 1ZXEA 4OLIA 5IEYA 2WTVA 1LP4A 3DDPA 4EHEA 3PXYA 5F95A 1CSNA 3QA0A 2X4FA 4G5PA 3K54A 5DPVA 3UO6A 1U5QA 3ZRLA 4BTMA 4DG3E 5JFWA 5LWMA 3LXKA 4YU2A 4F78A 3CEKA 3F82A 4U44A 4LGHA 4QPAA 4WNMA 3NUSA 4BCOA 1J7LA 5FXSA 4GK2A 3QGWA 3EZVA 4YJTA 2XS0A 4PL4A 5CENA 3UVPA 5AX9A 2YITA 1GZOA 4C38A 3BI6A 2XCKA 5IA4A 3PJ1A 2BRGA 2XKFA 2G9XA 2YM7A 5ICPA 3U4UA 3LZBA 3POZA 3E87A 4HYHA 4CSVA 1M17A 3S2PA 4CZUA 2F2CB 4NTSA 2VTTA 3BHYA 4J99A 5EDQA 4CRLA 2VWBA 5K4IA 2UZNA 2Y7JA 2J4ZA 3PRIA 5ANJA 3NSZA 3QXOA 4PMSA 1KE7A 3OF0A 5L2TA 1ZOGA 2HAKA 2XM8A 1NT2A 1PMVA 4FKLA 4PTCA 2X8IA 3Q4CA 4GU6A 4YZBA 4C34A 2HELA 1YOLA 3EIDA 2AC3A 2VRXA 1SYKA 4FIHA 4TTHB 3U6IA 3UQCA 1YHVA 2FA2A 1JPAA 3E7OA 3K5VA 3NNUA 4RLKA 3GVUA 3REPA 4EL9A 2XNBA 4ZY5A 4CV8A 4QMOA 2W06A 2W5AA 2BKKA 3E8NA 5CU2A 3E93A 2QCSA 4JJRA 4QMYA 4EH5A 3RMFA 2ITQA 2BDFA 5CZHA 4C4IA 2XA4A 3EHAA 4ZZNA 4G3EA 2J6MA 4BY9E 4O1PA 3OT8A 4AZWA 4UB7A 3O71A 4PNKA 4EQUA 5J1VA 4G9CA 4FYOA 5DRBA 2H9VA 4UZDA 3VUKA 3LFFA 3UZRA 1SVHA 4BDJA 5KMKA 2PVNA 3L1SA 4EOMA 1B39A 5AV1A 1PXNA 3V51A 2I0HA 2VNYA 4CFWA 4GK3A 3TKUA 3EQPA 3IDPA 4A9TA 5HO6A 4XOZA 5CQUA 4FKIA 3BE9A 2B4SB 3MJ2A 3AC2A 3DKCA 4KS7A 4O2PA 3A7FA 3R22A 4U3YA 2R3HA 4MK0A 3CTJA 1NVRA 4YZDA 3BQRA 3EKNA 4DT8A 2EWAA 1OIQA 4HNFA 4PY1A 4EC9A 3LOKA 4FTLA 3V5LA 3R2BA 5DR6A 4PV0A 2E9VA 4G31A 2C1AA 3P1AA 4AS0A 1PW2A 1Q8ZA 4X6QC 1M2PA 3SQQA 4FV3A 1WBVA 3ZZWA 3SOCA 4QMXA 5CF8A 4B99A 3F5XA 3VO3A 1H4LA 3ENMA 3FLZA 4MXAA 4CYJA 3SXRA 3O8TA 4BCHA 4CEGA 2BROA 2I6LA 1JOWB 2QKWB 4IAYA 1BUHA 3QZFA 2X9EA 4G3GA 3KQ7A 1JSUA 3HV4A 2XIXA 4OAVB 4O27B 3Q9ZA 4S33A 4YJUA 1LR4A 4RIXA 3T8OA 1Q8YA 3SKCA 5BVOA 1Q97A 3RPRA 3R01A 4E4MA 4GH2A 2J90A 3W2PA 3OW3A 3RVGA 5DT0A 3B8RA 3VBWA 3ZRKA 4DF3A 4DHFA 3E63A 3AOXA 1RDQE 3ORKA 4XG9A 5I9XA 4U43A 4C35A 1FQ1B 4WSYA 5KBQA 5BMMA 1LEWA 2PZRA 1VLRA 1GJOA 4C4GA 3L9NA 3FPQA 3CD3A 2W4KA 3UVRA 4ZSJA 1XBBA 2E9NA 4ANQA 3DY7A 5FM3A 4E4LA 5BX0A 1XBCA 4UN0C 1G3NA 4GFGA 5EW8A 3ZFYA 4J7BA 2ZM3A 3C4CA 3F5GA 3NX8A 3V5TA 5CAQA 4AP7A 1YOJA 2G15A 5AADA 2GQSA 2BDWA 4AX8A 5HBEA 4RIOA 5HU9A 1H8FA 5BNJA 3RGFA 3CPBA 2DQ7X 1GZNA 2GDOA 5BYZA 1W83A 5C01A 5JK3A 3CQWA 3OT3A 4EUUA 4LGGA 2IW9A 4P5QA 4AZSA 5I5ZA 2Q0BA 3R1YA 5HG9A 5LCKA 4AW1A 4H39A 3CXWA 3MA6A 4O4BB 4EZ7A 2UW9A 4OAUC 4YZMA 5I4NA 3C4ZA 5AUYA 3WYXA 3RPVA 2VTLA 3VS7A 4DINA 2VU3A 2X7FA 3QZGA 2CCHA 3D7TA 4KB8A 5DEYA 3ATTA 3HLLA 2OKRA 3AC5A 4FG8A 2XANA 3QLGA 3PLSA 3PVUA 5KHXA 4ERKA 3PSBA 3LFAA 5M4UA 4I4EA 1TFFA 1CKPA 2C0OA 3R83A 4J71A 1ZZLA 5AP3A 1WBTA 3DK7A 2UUEA 2R3IA 3S3IA 3HAVA 4Y5HA 1UNLA 3IW4A 3DJ6A 1M7NA 1R0EA 1JSTA 3E88A 5IQFA 3MY5A 4MNFA 4RX5A 4BDDA 4TNDA 2JAMA 2VGPA 2X0OA 3AD5A 3V8SA 3MESA 4KNBA 3DCVA 3CLYA 3UG1A 3U6JA 2GPHA 2UZOA 4HVHA 3HECA 5A6OA 3BU6A 5ANDA 1BMKA 3W0RA 5DT3A 2GNJA 5HI2A 2OF4A 2BZJA 3O17A 4O4CA 3BYSA 4LL0A 3FLWA 3Q60A 4YJVA 3QTQA 3FC1X 4FSUA 1JKLA 3AGLA 3BE2A 4PP9A 1B6CB 4UEUA 3QU0A 5CI7A 4TWPA 5D10A 1L8TA 5J5SA 3KGAA 4UWCA 3RCDA 4X3FB 1OGUA 2YHVA 3LCKA 4ZTHA 3MS9A 3AC8A 2A4LA 4NSTA 2ITTA 4BIEA 1PMEA 4KS8A 3OROA 1BI8A 1O6KA 5C8MA 2PL0A 4F0IA 3CS9A 1MRUA 3TTJA 5C4KA 3FSKA 3PE2A 5E8UA 3OTUA 4UX9A 3G33A 1PRYA 5IA2A 3PP1A 1OIUA 4ZAUA 5HNBA 3GNIB 2BRBA 1XQZA 5IPJA 4OGRA 2QI8A 3QCSA 5EHLA 1JVPP 2PZIA 4TZRA 1Q8TA 4BWKA 5EK7A 2CGXA 5GIOE 2CSNA 3LAUA 1YRPA 4IADA 4S32A 4JOAA 2HXQA 4YBKA 2YJRA 4ARKA 1H1QA 5I0BA 4MD8E 3DS6A 3KULB 5D1JA 4FG7A 5FDPA 3SA0A 5F9EA 2B9FA 3GQLA 5BVEA 4R1YA 4EQMA 4DFUA 4RVKA 2JKKA 3FLYA 3QUDA 2WQMA 3R73A 4NM3A 4D4SA 2ETRA 2XK9A 2WTIA 4U79A 3H3CA 3KA0A 2A2AA 3H0YA 2OJFE 4ANNA 1OZ1A 3HYHA 1KOAA 2XH5A 5H8EA 5DOSA 1ZMUA 2PVJA 3P23A 3WI6A 5K3YA 3I0OA 3TEIA 5KMNA 5M06A 3W32A 5BPYA 1REKA 3S4QA 1W82A 1Q3DA 3U4WA 3UZTA 3PXQA 3UDBA 3R1SA 5IEVA 2C3IB 4C59A 3ZUVA 4BI1A 3EL7A 4CLJA 1GOLA 3P7AA 1H1WA 5HD4A 2WQBA 3F7ZA 4D9TA 3ENHA 1GZ8A 2YEXA 1QMZA 3BQCA 4R8QA 4LGDA 5KKRC 5GZ9A 1G8KA 5BUEA 2BHHA 1WBWA 4FOCA 4DCAA 4C37A 4OT5A 3IS5A 4E93A 4H3PA 4I0RA 4HPUE 3TG1A 4MHAA 2BTSA 4CQGA 4DGLC 5JGDA 1FGIA 3UDTA 3ZLYA 4I0TA 2J0JA 4LFIA 4BCNA 3QQFA 5DH3A 3VAPA 5IMXA 5LVNA 4EK5A 5LMBA 4BRXA 1IG1A 2J50A 5TF9A 4JL9A 4CKRA 4ASDA 4ZS0A 2OBJA 4CFVA 3FZ1A 3OBJA 2EXCX 4IAFA 4V0GB 4YTHA 5AM7A 3FYKX 4CT1A 2VTAA 4JQ7A 4TYIA 5IZFA 4TL0A 4GT5A 4EI4A 2WQOA 2KULA 2RG6A 4QDVA 2I0YA 5DR9A 4L53A 2X8DA 4LMUA 4N6YA 5DMZA 3TNWA 2C3LA 2E2BA 1H00A 4IX3A 4F9CA 1YXVA 4PQNA 4L8MA 4XG3A 3AKKA 2IZSA 2YM8A 4DHZA 4O86A 2JKQA 3QQJA 3SLSA 3C4EA 3COIA 4FIFA 4ZEGA 3WF9A 2C1BA 5IUIA 4YGAA 5CEKA 3HNGA 3RI1A 4BDCA 5HX6A 3V5PA 4XRJA 5L6PA 4MCVA 3LFSA 4ITIA 2WMAA 3AD4A 4QTDA 5I9YA 2A1AB 3RK5A 2A0CX 3ROYA 4A07A 2YZAA 4AZVA 2PUNA 3LXPA 5HIEA 4AW5A 4KKHA 3VUGA 3N51A 4WUNA 4RZVA 3AKLA 3LLTA 3MY1A 4I5CA 4UMQA 2XNEA 2QOLA 2REIA 3AC4A 4Z3VA 4B9DA 3F5UA 4QQCA 4XV9A 2C47A 1OITA 5HVJA 5AUWA 2BVAA 1U59A 3ZO3A 2BR1A 4EBWA 2OFVA 1PXJA 3G51A 4W8EA 3ORLA 3U8WA 3EH9A 1OPKA 2A19B 3Q6WA 3GEQA 2PPQA 2PU8A 2F7EE 3NIEA 3RK7A 2J0MB 5J1WA 4F1TA 3GFEA 3G0FA 1DS5A 2VTOA 5E1EA 3T3UA 2XK6A 3CSVA 1VEBA 3ZLXA 5CF4A 3A8XA 3PZEA 2JIIA 4A9SA 3O7LD 2YM6A 5CU3A 4ZTRA 4EONA 3BU3A 5IEXA 1PKGA 4CMUA 3R9RA 4AT3A 4L3JA 4YO4A 4FGRA 4PPCA 3GGFA 4CVAA 4EK3A 5GZ8A 5AAFA 3BGZA 3PUFC 5FP6A 3A7JA 3UQFA 4HVIA 2ZVAA 2BAQA 3NUXA 3FC2A 2G1TA 3OFMA 2EXMA 3QD2B 4EH3A 4EH6A 1WCCA 4KWPA 3S95A 3E8CA 4RWKA 4XRLA 5BVDA 4H1MA 3H9FA 3IW8A 2XKEA 3OOGA 2CCIA 4BCGA 4XX9A 2W9ZB 2Z2WA 5LQFA 3NNWA 2WMVA 4H58A 3ORMA 2QG7A 4GUEA 3L8VA 4HCUA 4U3ZA 3RZBA 1PHKA 3RAWA 5JH6A 2JDRA 4DEHA 4DH1A 2CHLA 1PXIA 2WMSA 4KIQA 1YWNA 3SXFA 3D0EA 4ZTNA 4HPTE 4WRSA 3W0NA 3CJFA 2BRMA 3R9OA 4H1JA 4M14A 3R9NA 4PWNA 2R3JA 4K33A 4NW5A 4C8BA 3TT0A 1MQBA 2IVUA 3C7QA 4DA5A 3KN6A 3KFAA 3VUTA 2R3LA 2OXYA 4ZOGA 1YDTE 3FI8A 5AFVA 5LARA 3TIYA 3DGKA 4FF8A 3GC9A 4RIXB 4WRGA 5IA1A 5EH0A 3IK3A 1F0QA 4CXAA 2QR7A 1NY3A 2DYLA 1BKXA 1YXTA 1SZMA 2PVFA 5AWMA 2H34A 2Y6OA 3E62A 4W9WA 1WBPA 3QZHA 4RA5A 4U81A 4W4YA 5D11A 3R7IA 3U6HA 3FSFA 4PDOA 3OWKA 2ZMDA 3MVJA 5M09A 5HCZA 2CNVA 5DN3A 3NW7A 3DOGA 4C7TA 4BCPA 5HBJA 5J9ZA 4GFMA 4KSQA 2XAMA 4E5WA 4WNKA 4LQMA 4OTWA 2XB7A 3DU8A 4K8AA 2WPAA 4RLLA 2BFYA 5EM6A 5HLWA 4XH6A 3RBWA 4O0RA 4U7ZA 4N0SA 5AP6A 2WMQA 4DITA 1MP8A 4F1OA 4AZFA 3HV6A 4RBLA 3LFNA 2AYPA 4RVMA 4XOYA 3DK6A 3FZPA 2ZOQA 2UZLA 2JDTA 3DBEA 3HDNA 2JKOA 4CZYB 4DFNA 4KKGA 4QQTA 3BBTB 3KY2A 5M07A 3ZEPA 3POOA 4DH7A 3RP9A 4ZP5A 1KV2A 1KV1A 3GUBA 4QTBA 1R78A 4I92A 4DG2E 2OZAB 4O4EA 4GEOA 5JZNA 2UV2A 2FO0A 4MBJA 3ORXA 2PVRA 1ZARA 1OL1A 3CKWA 3LCOA 4S31A 2C3JA 2ACXA 2PVMA 3VJOA 4AA0A 2HZNA 4J98A 3MDYA 2WOUA 3MTLA 4OBQA 4EOPA 5FTOA 4UMPA 3D7TB 3FZSA 4JBPA 5HO7A 3COHA 1GAGA 2F2UA 1UU8A 2X2LA 2W05A 2V0DA 3FAAA 4FTAA 2W0JA 3R8UA 2CKOA 2W1HA 4TKSA 5CZIA 3EB0A 4NFMA 4KIKA 3R63A 5KMOA 3KCFA 3FV8A 4QMWA 1NW1A 3UIXA 1H25A 2XNOA 5IUGA 3QYZA 4F63A 2RKUA 4LRKA 2QOFA 3P5KA 5BV3A 2C4GA 3F2AA 3KRXA 4IJPA 4E8AA 1H1PA 2IVSA 2XEZA 2JIVA 2ZJWA 3R2YA 4J95A 1YQJA 1S9JA 2AQXA 2XIRA 2UVZA 5CXHA 2B9HA 5FRIA 4L46A 2EB2A 3KCKA 4Y46A 4DGMA 2YDJA 3A62A 1IR3A 4FV4A 2J0LA 3IW5A 4IB5A 3U9CA 5L2IA 4O7RA 4FEQA 3HMOA 1W0XC 3VNTA 5J7BA 3BLQA 5AUXA 5CXZA 3VHEA 4AXFA 3DJ7A 5CASA 4QQJA 1GIIA 5E9EA 4V01A 4F9AA 4IC7A 1PXMA 4E6QA 3MV5A 2OG8A 4IZYA 4RC3A 4EH7A 5F20A 4O7TA 4F1MA 1B38A 3DNEA 3OWLA 1R1WA 2GNIA 3FXXA 3UJGA 3TZ8A 4IIRA 4DEAA 5CF5A 3NVKI 2OICA 4GMYA 3NAYA 4FL2A 4FV6A 3PFYA 4FKRA 3ZZEA 2NP8A 1OIYA 4FIIA 5HVKA 4AAAA 2NNWB 3ZM9A 3CC6A 3KREA 1MRVA 5EM7A 3NUUA 4D4RA 4M15A 5CT7A 4IWOA 3PP0A 4G3FA 2FUMA 4OUCA 5HVYA 1JSVA 4BDKA 3W0QA 1UKHA 3NMUF 3Q6UA 2OJJA 4GKHA 2RGPA 3BL9A 5A14A 3LMHA 4PF4A 3Q2MA 3KXMA 4G3CA 4D4VA 4R7BA 3IG7A 4L43A 5FBNC 1KOBA 3E8EA 4GSBA 4IANA 1UU7A 2ITNA 3HP2A 5CQWA 5DA3A 5T6KA 1ZOHA 4IWPA 3DFCB 1WVYA 1QL6A 2OH0E 3DXNA 2C0TA 3FL5A 3LHJA 5D12A 5H3QA 2OXXA 1J7UA 4MVFA 4JG6A 4JVGA 4EORA 3ACJA 3F69A 2XK7A 4AGWA 2QO2A 4MXZA 4K0YA 4DFXE 4AXAA 2CPKE 3FHRA 2PMIA 4RVTA 5BVWA 4D1ZA 4DFLA 2BILB 4EYJA 1KE9A 3CIKA 4FZDB 5AA8A 4FTUA 3VS6A 2CJMA 4QMNA 5FEDA 1O6LA 1WBSA 3QRIA 4PDSA 3SHEA 2R3RA 2F7ZE 2LGCA 4AZTA 4CQEA 3C0GA 4NTTA 5E8YA 4M12A 3MH0A 3FE3A 4TT7A 4YZNA 4EOIA 3MBLA 3FLSA 1P14A 5CX9A 5HTIA 3PLAE 3JY0A 5IMEA 2XF0A 4YC8A 2VWXA 1TQIA 3KXHA 4IVBA 3NVMB 1ZYCA 1OKZA 5K0XA 4Z16A 3L8SA 3LPBA 5L8JA 3UO4A 3DNDA 4II5A 4QTEA 2PK9A 3LQ5A 3ZLWA 5KKRB 4EH9A 5AX3A 3ROCA 3ZCLA 3V6RA 3O2MA 1ZYJA 3FQSA 2UZVA 3C4WA 4GL9A 2XZSA 5LVLA 2YN8A 3ODYX 3N4VA 4ZTSA 4TN6A 5G6VA 4IC8A 4BTKA 5EYMA 5HU3A 3S1HA 2IWIA 4LYNA 4O7YA 3ZSGA 3EOCA 3VUHA 3ORPA 4WSQA 5K9IA 4DGOA 2C5XA 2ETMA 3EN6A 4GFOA 3TUCA 2ITOA 2V55A 3TM0A 4X0MA 5GINE 1U5RA 5HG5A 4YLLA 3HDMA 3CCNA 3F3VA 4OTRA 4EOLA 1BI7A 1JQHA 4J96A 5EKNA 2X7GA 2WEVA 1V0PA 3OUKA 4MTAA 4L7SA 2ZV9A 5EHOA 4BGGA 1Q8UA 4JRNA 1NVSA 2H6DA 3ZRMA 4F65A 3AG9A 4E6AA 4CMTA 3EFWA 4I93A 2PVLA 3RM6A 4I6QA 5B7VA 2X8EA 4DG0E 4ZTMA 2YZLA 3WE4A 2QR8A 3CR0A 3MFUA 4L3LA 4I6FA 2XIZA 4NWMA 1IAHA 4DE4A 3VJNA 5AJQA 2PULA 4JBVA 1VZOA 4ZK5A 3FEGA 3QYWA 3R28A 4GS6A 4FIJA 3FMKA 4QMUA 4A06A 5DIAA 5GIPE 4ALUA 4FT7A 2QLQA 4Y5QA 4UMRA 2GCDA 4K1BA 3R8MA 4C3PA 1XHAA 2VO3A 4QP7A 4Y72A 3RWPA 4DLIA 3AKJA 3WZKA 1APME 2YABA 2GTNA 3OXTA 4R7IA 3H10A 3UYSA 4O81A 2FH9A 5KO1A 2WTKC 4RJ4A 4C57A 3FKLA 3NUYA 3UGCA 1P4FA 4D2PA 3BYMA 2GU8A 1LUFA 3QC9A 3OD6X 5L8LA 3GC8A 4E1ZA 3EFLA 3BHUA 2QURA 2YISA 1UNGA 5T68A 4GT3A 3DTCA 3BLHA 4ZMEA 2GQGA 5IQHA 1JKTA 1NXKA 5AV3A 5LCJA 2R0IA 3MVHA 2IVTA 3EFKA 4ANBA 4FT3A 5AP0A 5AV4A 2HK5A 4OTDA 2VTPA 3B8QA 2ERKA 2C6EA 3FZTA 3EQCA 4J53A 2R3QA 1YXUA 4IAAA 3BV3A 4QP1A 4HGSA 2GFSA 3EN7A 1SNUA 5AR4A 1UA2A 2JITA 4FUYA 4CCUA 1M52A 2BAJA 3NLBA 3OZ6A 4FSRA 3DA6A 1PXOA 4C02A 4M69A 3BL7A 3KRWA 5C8NA 3TNQB 1XBAA 5IF1A 3QKMA 4FTIA 4ZS4A 3DKGA 5L2QA 4FIEA 2QO9A 4JQEA 2CKQA 4AGUA 3A99A 3KXNA 2HY0A 4IX6A 2XJ1A 3EQGA 4IZAA 1FVVA 1BLXA 1ST0A 2P55A 3M1SA 5KZIA 2W1IA 4AXDA 2W1DA 3DBDA 3LCTA 4O7ZA 3OCTA 5K5NA 4QDEA 4DBXA 4BR3A 4F0FA 2WIHA 5JEBA 2YCQA 2QOBA 4IXPA 2CLQA 3GOKA 3C9WA 4I20A 3R1NA 4IM0A 3K5UA 4YC3A 3K3JA 3QKLA 2RFEA 4PP7A 2WNTA 3ZBFA 1CKIA 5L2WA 1RE8A 4OR5A 4DDGA 4X2JA 1J3HA 4FZ7A 2JDSA 4D1SA 5IDNA 2QC6A 4BIDA 3BYOA 3R8ZA 1T45A 3D5VA 4EQCA 2I0EA 2RFDA 4G1WA 3IGGA 5AR7A 1OBDA