3FKLA

P38 kinase crystal structure in complex with ro9552
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
349
structure length
344
Chain Sequence
b'ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Mapping Binding Pocket Volume: Potential Applications towards Ligand Design and Selectivity
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 112
structure length 344
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fklA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fklA01
2HK5A 3T8OA 4QQ5A 5HKMA 1YI6A 3IECA 3R8MA 5EQEA 3PZEA 3DNDA 4UYNA 3TKUA 1S9JA 5AP0A 1AGWA 3G0EA 1Y6BA 2C6KA 2X8DA 3F5GA 2JDSA 5C8KA 4F0FA 3BV3A 3R01A 3OT8A 2OJ9A 1T45A 3WZEA 2BFXA 3TT0A 3BLHA 3VBXA 5AAGA 3VULA 3HZTA 4NSTA 4DHFA 4KIKB 3KULA 3R8UA 4DFZE 4M97A 3ETAA 1GIJA 3NUUA 4BBFA 5AUUA 3F3UA 3OXZA 3QQUA 1A48A 5J7HA 3W16A 4XG2A 3F5UA 5EDRA 3G9NA 5AP5A 3F3WA 2ZJWA 5CU6A 4DH8A 1ZOGA 3Q9XA 2G2HA 3MY1A 3PDTA 2UZOA 3NCZA 1CKPA 4MBIA 1YHVA 3Q53A 4EQUA 4ANMA 3G2FA 4QMPA 4BL1A 2F7EE 2AYPA 2A19B 2GS6A 5IDPA 1J7IA 2ITTA 4N6YA 4YZMA 2X6DA 4MX9A 4U42A 2PK9A 3FAAA 5LVNA 4FSZA 4EK3A 2BRMA 1JVPP 3HRCA 3LCSA 1R1WA 4FNWA 3LLTA 3RTPA 4KNBA 1YDSE 5IH5A 2W7XA 3QX4A 5FTOA 5EI2A 3R8LA 1JKKA 4EOPA 4C3RA 4H1JA 5B0XA 2XP2A 2CN8A 3LCOA 1EH4A 2CMWA 3D2KA 4FKSA 4CT1A 3WF9A 4BYIA 3RHXA 4M3QA 2NPQA 3GFWA 2JIIA 4QTBA 3ORNA 4YJPA 3QD2B 2XYNA 4WG5A 1W82A 2VTRA 1JOWB 2RL5A 3RINA 3UVRA 3WARA 1M2PA 3Q9ZA 3QAME 5A9UA 3KRWA 2XM8A 2C0OA 2UZLA 4C35A 3MVHA 2CCHA 3F5PA 2PZIA 3NUXA 4L52A 5KMJA 1OPKA 2VGOA 3CY2A 5F20A 3V6SA 4NYEA 1XBBA 5HHWA 4BCGA 4HPUE 5EG3A 1TQMA 1GZNA 3KMWA 3OW3A 3PY1A 2WU6A 3MBLA 5CEIA 4TYGA 4M0YA 4AX8A 1U5RA 1U59A 1XWSA 3RKBA 2UZTA 4RC4A 4RG0A 2YFXA 3QTSA 3ZUTA 2C3IB 2Q0BA 4FSNA 3SV0A 4QQTA 4RVTA 1IG1A 2BAQA 3NUYA 2A0CX 3W33A 4YJUA 4QT1A 3O7LB 4IVCA 5FXRA 5EQYA 4RWIA 4UX9A 4E20A 4XP3A 3O17A 5HICA 5IA3A 4E26A 1UU9A 5F4NA 4R78A 4AU8A 3I6WA 3ZO3A 4QTAA 2WXVA 4YJVA 1CDKA 3VQHA 3E7OA 4PMSA 4QMLA 3VO3A 3K2LA 2XK7A 3VBVA 4YHTA 5IQDA 2VX0A 2WD1A 4MBJA 5AR3A 3DT1A 3UNJA 1MRVA 2XYUA 5GHVA 2ITXA 4IAIA 4IMYA 3HKOA 4EHVA 1LEWA 4H3QA 4FTJA 4IC7A 4E8AA 3H3CA 1FVRA 3CTHA 4ANOA 5DRDA 4I5HA 3LM0A 4HNFA 4A9YA 3C9WA 1BI8A 1URWA 4O1PA 4X2FA 4EUUA 2C5NA 2OZAA 1YXTA 4X3FC 4MXAA 2VNYA 3OXIA 5DOSA 4MXOA 3PXZA 3DJ7A 3PJCA 2GNJA 3CXWA 5LVLA 5EM6A 3SLSA 3FLNC 3SRVB 3OEZA 2BHEA 2J2IB 3UMXA 3UOKA 3ZC5A 4ZSGA 2ITOA 3EQGA 3DTCA 4FTQA 1K9AA 3NYXA 4GK3A 2WMXA 2OG8A 5DLSA 3JXWA 4GV1A 5EHYA 5FXQA 3T9TA 4YPDA 4BCHA 1H1SA 3HMMA 1NT2A 3VF8A 3NYNA 5M55A 5CALA 4PDYA 1KE5A 5EFQA 5DPVA 5L6WL 2VWIA 5M06A 4RVKA 3G90X 3DPKA 4R7IA 3GCQA 3CQEA 4OBOA 3EN5A 4AAAA 2C6OA 4LV5A 2H8HA 3D2IA 4AT5A 3NGAA 2CDZA 3TV7A 4FT7A 2X7GA 3RAWA 4P2KA 4YC3A 4WIHA 1REJA 3BGZA 2J0JA 3THBA 4X3JA 4RMZA 1L3RE 1OKVA 3QTQA 4OTHA 5HLWA 3LFDA 2W99B 4NU1A 4ZTLA 4CMTA 3Q5ZA 4LV8A 4M67A 5T6KA 3RAKA 3FMNA 4IB0A 3EYHA 4WOVA 3MESA 2I0EA 2CGUA 3TZ7A 1YXSA 5IA2A 2R0UA 4S30A 4BDEA 2QOLA 3R30A 1VR2A 3UMWA 5KHXA 3R21A 4NM5A 5JFSA 5L6OA 4O7WA 4NW5A 4Y5HA 3U4UA 3OUKA 4I4EA 1U4DA 2J5EA 2ONLC 2WGJA 2V62A 2YLEA 4L3PA 5FRIA 2YITA 3KGAA 3ZO4A 2JIVA 2W17A 3HYHA 4RWLA 4CYJA 2BDFA 4WD5A 3SRVA 4D0XA 3ZRMA 5L2WA 3EJ1A 4IQ6A 4U44A 4N4SA 5HG7A 3RVGA 5AA9A 3KK9A 4BDHA 5A14A 4ACGA 3B2WA 4DTAA 4I94A 4ANQA 3GC9A 3VQUA 5BYZA 2C1BA 1U54B 2ZB1A 4D2SA 4MWIA 2YCQA 4WBOA 5DG5A 4NH1A 4BYJA 1H0VA 3P78A 4X7QA 3NCGA 2XK4A 5GJGA 2XIKA 4BBEA 2CLQA 1YOMA 5KMMA 2RFEA 3JY9A 4S2ZA 1BL7A 3QTRA 5AX3A 3OHTA 3ZUVA 2PL0A 4JR7A 4WA9A 3Q04A 2XBAA 4G2FA 5D41A 3AOXA 2C6LA 2OU7A 1VYWA 2E9OA 1JWHA 4BGQA 1UVRA 5KNJA 3UIUA 5HCZA 4WG3A 4FKRA 5E91A 4FSTA 5M07A 5IA1A 5ETAA 4RJ7A 1BX6A 5DI1A 3K5VA 1QPCA 1KE6A 2ERZE 3BHHA 2GQSA 3MIAA 4EOIA 3GBZA 2XM9A 3DKGA 5H8EA 4ERWA 4DG0E 3MS9A 2C1AA 4OT6A 4ZJJA 3LJ0A 4W9WA 4IBMA 3UDBA 4R1VA 5AEPA 2OK1A 1V0OA 2CCIA 2PSQA 4FX3A 3R73A 4UWCA 4FBXA 3JR1A 1U46A 3PFQA 3PXFA 5K0XA 1V0PA 5TOZA 3GCVA 2XKDA 3VUTA 2VWUA 2RG6A 2XCHA 4ZY5A 3G5DA 4FTNA 2BHHA 1OMWA 3FPMA 1ZYLA 5DGZA 5JGBA 4IADA 4D0WA 3LZBA 5HCXA 2YERA 4FG7A 4QYEA 5A4EA 4KBCA 2NP8A 3KCKA 1U54A 4QPSA 1FMOE 4PNIA 2GTMA 3F5XA 1WZYA 1PYEA 2FGIA 1YQJA 3E92A 5FUTA 4EONA 1Q8WA 5JMSA 4RVLA 4HVHA 2HZIA 1I09A 2CGWA 3F7WA 3KVXA 3TCPA 4JRNA 2WTIA 4F7SA 3ID6C 4J97A 5ANIA 4LM5A 3D5WA 3EL8A 4BDJA 4P4CA 5KUPA 4XOYA 3UG1A 4RZWA 4I20A 3U9CA 5I3RA 4IH8A 1LEZA 4WNKA 1DAWA 3GFEA 5CSPA 2Z8CA 3QKLA 4IM0A 2O63A 3R22A 2F4JA 3GQIA 3QBNA 2XBJA 5KMOA 1BL6A 4X2JA 4NZWB 3UIXA 2WEIA 5HNIX 2H34A 5IH6A 5LXMA 4O7YA 3R8ZA 1XH5A 3GB2A 3B2TA 4E5AX 2I6LA 3GOPA 3E3PA 3S00A 4CCUA 2JBPA 1B39A 4TWPA 3C1XA 3RK7A 3UBDA 3JY0A 3LXNA 3FQEA 2C47A 4LRJA 4PL5A 4PTEA 5L2TA 5D7AA 5AV3A 5I9YA 5HTIA 3FYJX 1J1CA 2XIXA 2PUUA 5HGIA 1J1BA 2R3KA 2V22A 3MFRA 1KV1A 3I7CA 3QYWA 4F7LA 1PMNA 2UW9A 4AT4A 1MQBA 4AGCA 3FI8A 3R1NA 2JD5A 3KKVA 4O81A 3ZCLA 4DEDA 3OD6X 5IEYA 2UZWE 5M56A 5D12A 2R7IA 2CNVA 4FKIA 2OH0E 5J9ZA 4XEYA 3LFFA 1IRKA 1NVRA 3E5AA 3W18A 3PLAE 1Z57A 1JPAA 3A8WA 3AC3A 5ACKA 4C4HA 3WE4A 4N70A 3NYVA 2PZYA 4AW0A 4JI9A 3QALE 1MRYA 4MXXA 2W1FA 2ZM4A 3KFAA 4CMOA 4NEUA 4D55A 4F1OA 5GNKA 1H27A 1ND4A 4O7ZA 2X4FA 1FINA 2CN5A 4MBLA 4XMOA 2GU8A 2YAAA 2HWPA 4IJPA 2B1PA 3OP5A 3VBWA 5KHWA 1YDRE 2Y9QA 4XG4A 1BYGA 2UZEA 3NVKI 5LMKC 3S1HA 4EOJA 2OGVA 4HCUA 2B4SB 4U3ZA 3ZMMA 3ZLYA 4BIDA 3IQ7A 3NMUF 3IOKA 4I5CA 4QPMA 1P14A 4QMZA 5CT7A 3O8TA 5I9XA 3A2CA 1PXKA 4X2GA 5FDXA 4D1XA 4DGOA 4RJ3A 1J7LA 4NTSA 2VTAA 3KA0A 2YIQA 3JPVA 4EOKA 2C68A 4KAOA 4E5BA 2HXLA 2I0HA 1E1VA 4MXCA 4DG2E 4DCAA 2FSOX 5FEEA 5A4LA 2R3OA 3H4JA 4FV1A 4EHEA 2OIDA 4C4EA 3W2CA 5CVGA 4AA0A 2ZVAA 3BYSA 3NDMA 5CTPA 1Q61A 1WMKA 5HBHA 2ITNA 5JFXA 2WTKB 4GU9A 4Z55A 1Q5KA 4PWNA 3V5LA 2YJSA 2ZM3A 3ZH8A 2YCFA 2QLQA 3DBEA 5CZIA 1Y8YA 1PXMA 4FT3A 4D4VA 2YZLA 1E1XA 2F49A 1LUFA 4RIXB 3RBWA 3E8CA 4CXAA 3LMIA 3SG9A 5DIAA 3C5UA 4FG8A 4QMVA 4BC6A 4NWMA 5IUGA 1G8AA 5CYIA 2W1IA 2HCKA 3CKXA 3AC1A 3G6GA 3KRJA 4F64A 4GT4A 1S9IA 1Q8ZA 4KBAA 4DEAA 3H0YA 2Z7QA 3RPRA 5HD4A 2IW9A 4RA4A 1H24A 4C8BA 3AMAA 4W8DA 4CFWA 4WG4A 4DEEA 5CF6A 3DAEA 3OZ6A 3QYZA 4FV2A 4IAYA 2ITVA 4AW5A 2PPQA 3MDYA 5E8WA 3LXPA 3MPMA 1ZYJA 5IISA 5JZJA 3ROYA 2WFYA 3FKNA 4JBQA 3BYOA 2PVLA 2ZOQA 2IVSA 3D0EA 3BE2A 3GGFA 1ZYCA 4AACA 4BKJA 1H8FA 2O8YA 3SKCA 4FIIA 1SVHA 1JKSA 4AFJA 2VO6A 2DQ7X 4EK6A 4F9BA 5L2QA 3DFAA 1H28A 2GFCA 4J8MA 3EQPA 4K6ZA 4OTWA 4FKLA 4D4RA 2W1GA 4IC8A 3PXQA 1YI4A 2P3GX 4LOPA 3O50A 4H05A 3RPVA 2YLFA 4CNHA 4XUFA 4K8AA 4YJOA 4J99A 5AUTA 5M44A 3IW5A 4C2VA 3D15A 5HG8A 2WMSA 3UGCA 2UW4A 2GMXA 2VTNA 4LQMA 4NCTA 4ZZMA 4CLJA 3H9RA 4EH8A 5C8NA 2VUWA 4L68A 5TKDA 1Y8GA 4BICA 3RI1A 5I4NA 3L9LA 4O0YA 5ANDA 1JSTA 4IWQA 4JBOA 3E64A 4ZZNA 4EWHA 1OITA 3Q4TA 4IVAA 5E8UA 3C0HA 1XO2B 3P08A 3DDPA 3V6RA 5IUIA 4EHGA 5T68A 5LOHA 4J95A 5IF1A 2UZBA 4MF1A 2QOHA 4WO5A 5KMIA 2XMYA 4FTTA 2R3RA 2OI4X 5A6OA 3TJCA 2BKZA 1OKWA 3SG8A 5TE0A 3R9DA 2Z7RA 3BRBA 4FKWA 4MD8E 3G9LX 4G3GA 3BELA 5I3OA 4FSWA 3O96A 4AN9A 4CRLA 5TR6A 4EHZA 1YXXA 3W2OA 3KN5A 2WMQA 3FMJA 2RFDA 4M69B 4N0SA 4TT7A 3KL8A 3TTJA 3DU8A 1W8CA 5HX6A 3H9OA 1MQ4A 4B0GA 3BEGA 4PDPA 4BKZA 5EKNA 4Q2AA 5AP6A 5LCJA 4KINA 4RBLA 2JLDA 4GT5A 1FQ1B 3ZO1A 3L8XA 4QMUA 3ZSIA 5DBXA 3RPSA 4H36A 3RWPA 4I1ZA 3W32A 2QR8A 4F7JA 4LRMA 3CP9A 3ZSGA 3QA8A 2QO2A 2B9FA 3E63A 2VTLA 1O6LA 3HEGA 3HV7A 3LOKA 3M1SA 4FKQA 4ACCA 3MN3A 5DEYA 4MVFA 4FVQA 4O7VA 2BIYA 3TZ9A 3WZKA 4CQGA 2FH9A 4QP1A 4RFYA 4F70A 5EH0A 5G1XA 2I0YA 4EH3A 1OL6A 2ETMA 5JQ8A 3K5UA 4K33A 4QO9A 3UZRA 4B8MA 3QD4A 3M42A 5J95A 5CZHA 1ZZLA 4QP7A 4I4FA 3VS4A 4AGWA 4AFEA 2PVYA 4EQMA 3MVMA 4IZYA 2QNJA 2W05A 4FTLA 2BRHA 2QG5A 3GC0A 3JS2A 4FTCA 2R7BA 3CPBA 4QMNA 3W55A 2OZOA 3VS2A 3ZFXA 4XG6A 2BPMA 4TN6A 1RW8A 3D7ZA 3E7VA 4G5PA 4JIKA 2IVVA 4MK0A 5GZ9A 4J71A 4M69A 5H2UA 1M52A 3PSCA 3C4ZA 4UB7A 4Y95A 5L2IA 1PJKA 5DH3A 4A9UA 5J5TA 1JNKA 2W5AA 3ET7A 4IW0A 4G6OA 4E6CA 4BI1A 3PP1A 2BTRA 2HZ0A 1ZLTA 4AZSA 2EU9A 3TL8A 4P7EA 3VJNA 4BTFA 2G01A 4QYFA 3VUMA 4EYJA 3MB6A 4FKJA 4O84A 4RJ4A 5A4QA 1R0PA 2ZV2A 3FLWA 2P4IA 1OPLA 1KOBA 1H4LA 3EQRA 3EFWA 3GU7A 3R1YA 4YU2A 2LAVA 3HV4A 2BZIB 3BI6A 3QRKA 4AZEA 1WBWA 4NKAA 2KULA 3UZPA 2R9SA 3FWQA 3H9FA 4LOOA 2PVNA 4H39A 4CG9A 2WTJA 3NS9A 3I81A 5AV0A 3UPXA 3IDPA 4NT4A 4AE9A 5FEDA 2UW6A 3Q2MA 2ZDUA 3E87A 3Q9YA 3VUGA 4EK5A 3V5PA 2BRNA 3HDMA 2X8EA 3Q3BA 3VNTA 4RC3A 2C3KA 4BWKA 4D2TA 4YZBA 3VS7A 2IG7A 4UBAA 4KD1A 2X7OA 4YJNA 4ZTNA 1KUTA 1RE8A 1Q4LA 4O7SA 1JKLA 3OG7A 4WSYA 2XNNA 4EH5A 3EIDA 3DQXA 4MNFA 4IFGA 5IEXA 4C4JA 5IUHA 4A4LA 4F09A 4BDCA 1VYZA 2WTWA 4Q5HA 5FP5A 3RZFA 3MVLA 2VWVA 3D5UA 3AGMA 2REIA 4FYOA 4HCVA 3BHUA 4IZAA 5B2LA 2XNMA 4TPTA 4XV2A 3VBTA 3EN4A 3COKA 1H1WA 2PVHA 2AUHA 3FSKA 4TWNA 5KKRC 1WFCA 3AC5A 2WQBA 3ZEPA 5KCVA 4FUYA 4QQCA 3ALNA 5AAEA 3MGYA 3OCBA 4IZ7A 3QTXA 4MH7A 4UMPA 2P2IA 5H9BA 4OW8A 2XF0A 4BCKA 2HENA 4RQKA 4ZJIA 4IX3A 4JG7A 4K2RA 2PMOX 3BEAA 4G16A 2UZUE 3C50A 4Y73A 5F9EA 2QOBA 1SZMA 3R8PA 3TG1A 4BHZA 4HVSA 4ZTSA 3DAJA 2DWBA 2GNLA 1GIHA 2UZDA 5TT7A 3SX9A 3ZRKA 2ZV7A 4L6QA 2R3GA 5HVYA 3T3UA 4EK8A 4RT7A 2W4JA 2H96A 3DJ5A 1O6YA 3BX5A 2BILB 4W4YA 3TNWA 2JIUA 5AP7A 3ZU7A 3VS6A 4A9RA 4BDKA 5J1WA 3AG9A 2HZNA 3HA6A 4BDAA 1JAMA 2YCSA 3PPZA 2WELA 4M66A 2IZTA 1OI9A 2BZKB 2R2PA 1WVYA 3RALA 3ZLWA 4CZUA 4GIHA 4FV5A 4U6RA 1E9HA 2P2HA 3R0TA 4G3FA 4F9CA 4GYIA 4YHJA 5CLPA 1JLUE 4ANBA 2I1MA 1NVSA 4ZTHA 4IB5A 2J0KA 2G2IA 3Q96A 4JT3A 5C03A 4BTKA 3BLQA 5HG5A 3LQ5A 2E9VA 4R3RA 3LMGA 2X0GA 3V8SA 1Q8UA 3BHYA 1DI9A 4FTAA 3NYOA 3RJCA 4DINA 4Y85A 4R1YA 3F66A 1R3CA 4PF4A 5BVKA 3VW6A 4AW2A 5JEBA 3VRYA 2UW8A 3PIXA 5DR9A 5KZIA 3RNIA 4DFUA 4ITJA 4LGGA 4PTGA 4R3CA 3DDQA 3NAXA 5CENA 2X4ZA 4YTHA 1FGIA 4Y72A 2CGVA 2VTMA 1OVEA 3GQLA 1PMVA 2W0JA 4X3FA 4WNMA 3PA3A 3S4QA 3U4WA 4DTKA 2B54A 2ZMDA 5M4IA 3DLZA 4KSQA 4UALA 1MRUA 3W8LA 3JYAA 4IJ9A 2C6DA 1ZMVA 4FV3A 4EOSA 1YOLA 4YZ9A 2BROA 2J4ZA 4BCQA 4W9XA 3ORMA 4BIBA 1LPUA 2A27A 5AP2A 3DZOA 5CS6A 5AA8A 2BIKB 4UZDA 4G17A 1MP8A 5DT0A 3UOLA 1BI7A 3NRMA 4IZ5A 5J79A 2HOGA 3L9NA 4O21A 3MY5A 1IASA 3TWJA 2HXQA 4O7RA 4PV0A 4BHNA 4QP4A 3DTWA 4IDVA 2OZAB 4GG5A 3WI6A 3RK9A 4K9YA 3HVCA 3PSBA 4JRVA 4GEOA 3DCVA 3N4VA 3QD3A 4FK6A 3DB8A 4B9DA 3C5IA 4DGNA 4JDJA 3RPOA 4C3FA 3KXMA 4XG7A 2OJFE 3A61A 4FGRA 2QOOA 4PNKA 2QHNA 3OY1A 3HV6A 2GS7A 5C4KA 1HOWA 3P7AA 4J53A 2YDJA 4RLKA 5L8LA 1WVWA 4H58A 2QLUA 2X2MA 2VD5A 4YUQA 1DM2A 1SMHA 2W06A 3DQWA 3O0GA 3Q60A 4G3DA 4J1RA 5AV4A 5IQEA 3HP5A 3F3TA 3WF5A 4EOMA 4C4FA 4X2NA 4NJDA 4QOXA 3WZDA 1STCE 2IVUA 2JDTA 2XUUA 3R9NA 4NTTA 4O91A 5HOAA 4FR4A 5M57A 2NO3A 4TYEA 4FSYA 2O5KA 4D1SA 4ZS0A 2QKRA 2JEDA 4FZ7A 3VHEA 5D7VA 4C58A 3E8EA 4L46A 2GNFA 5EW9A 5BVDA 3FXWA 3L1SA 2C4GA 3V8TA 4Z3VA 2XRWA 3FBVA 4RX5A 3G0FA 1PXPA 5EK7A 1G5SA 3B8QA 4MWHA 1ZOHA 4I23A 3R2BA 3UC4A 3COHA 3QUEA 4D4YA 5KZ0A 5KE0A 4ZAUA 3E8DA 3VN9A 3GC7A 4PPCA 3QQKA 3II5A 1FGKA 4ZZOA 3QGWA 5GZ8A 2W1DA 4I6HA 2B7AA 3BU5A 3L8SA 3C4CA 3FZTA 4RIOA 2OXDA 4EOQA 1YWRA 2QR7A 5FBOA 3DBCA 3VW8A 3CD8A 1WVXA 3R6XA 3BKBA 3MFUA 3G51A 2WMTA 3ZEWA 4L53A 4KS8A 2GHMA 3R7YA 4NK9A 3VAPA 4FV8A 1BMKA 4PMMA 4CRSA 4CYIA 4CFVA 3QUPA 3CSVA 1OL1A 5C26A 3F88A 3EWHA 3DV3A 2JITA 3ZYAA 3ODYX 4H1MA 5BUIA 3LFCA 4TXCA 4FC0A 4IB3A 3UIBA 2NRUA 5LVPA 2B52A 4C33A 3HRFA 3DNEA 2VWXA 5H8BA 4A9TA 3V5WA 2OJIA 4FMQA 3TJDA 4KUJA 2ITYA 4QMWA 5KX8A 3G33A 3NIZA 2X39A 4PDSA 2QQ7A 3QZGA 3SXRA 1LR4A 4F0IA 5HE0A 2XIRA 2FVDA 4JBPA 2WZJA 4PRJA 3PWYA 5EYKA 3LAUA 2C5OA 3GEQA 5DR2A 2VWZA 2Z02A 4XV3A 3QHWA 4FT9A 2A1AB 5AIRA 4PUZA 2QC6A 2B9HA 3HMPA 2YM3A 3VS5A 4ANSA 5L3AA 3IG7A 2J90A 2HAKA 5K5XA 3TACA 3BQCA 1CTPE 2RFNA 4UYAA 3BGQA 3WF8A 4X0MA 1AD5A 4OTPA 1W84A 2ERKA 4L7SA 3GOKA 4EK4A 4IVDA 4JQ7A 4GJ3A 4H3PA 3F2NA 1ZXEA 4JAJA 4DEGA 4GYGA 4L44A 5DYJA 2RGPA 4IWOA 2GS2A 5KO1A 5J9YA 3KVWA 4ZS4A 3MH2A 5BPYA 3DKCA 2XNBA 5H3QA 3TTIA 2UZNA 1URCA 2YM6A 4BTMA 3OWKA 1PMUA 2OIBA 4MF0A 5AR2A 5IQFA 2EB2A 3I7BA 2P33A 4GFGA 4KABA 3QHRA 4E6AA 5ETCA 2VTJA 3F2AA 3GC8A 4UWYA 4F0GA 4JR3A 1OIYA 3AC2A 4GSBA 5CAVA 4LMNA 1PKDA 2VTTA 5DE2A 3V3VA 3NAYA 4RLLA 3FLQA 3MY0A 5IZFA 4NM3A 3WF7A 4YJTA 3CS9A 3CGFA 4PPAA 3FMDA 3ZLSA 2HW7A 5HBJA 2XNGA 4FYNA 1NA7A 1GZKA 3RGFA 5AR8A 4TTHB 4ASXA 5CAUA 3SVVA 1UV5A 3RWQA 3V01A 5AFVA 5HD7A 3QWKA 1ZOEA 2YIWA 4IFCA 4FEXA 4CV8A 4RFMA 4M8TA 3QL8A 3R2YA 2XEYA 4XCUA 1IR3A 2YJRA 3PY3A 2XB7A 2ZYBA 4E6DA 1ZYDA 3QCXA 3EYGA 5CI7A 3EB0A 4F65A 4CVAA 3FHIA 2C0TA 1T46A 5AV2A 4JX7A 2UVZA 4I6QA 2ITQA 1PHKA 2YM8A 3FL4A 4FGBA 4KKEA 2JDOA 4Z9LA 3W2QA 3BU6A 4FKOA 2CKEA 1YWVA 3F7ZA 4CFUA 4BB4A 2AC5A 1ZYSA 2YWPA 5IQHA 3CIKA 2Z60A 4CTCA 4EI4A 4RZVA 2GNIA 4O7LA 4ARKA 4AGDA 4FV6A 4PL4A 5LMKA 2W4KA 3ERKA 4ID7A 4QNAA 3A99A 4DITA 5LVMA 3SC1A 1OL5A 4P90A 4CGAA 3PG1A 3U54A 4B4LA 2XH5A 2OSCA 3WYXA 4DGGA 5JKGA 4AOJA 3PUPA 3DKFA 4O0RA 5F1ZA 2J7TA 3A62A 1QPJA 3WIKA 4F6UA 2QU6A 3FKOA 3E3BX 4JS8A 1DAYA 4FOCA 1FOTA 2WTVA 2WAJA 2XZSA 3MV5A 2WMUA 1FVVA 1Q99A 2JDRA 3GU4A 5DT4A 3MWUA 3TIYA 4FSUA 4ZMEA 2WQMA 5ETFA 2IWIA 4RWKA 2UUEA 5C8MA 4X6RA 5CF4A 5J87A 4C7TA 3VBYA 5FP6A 1ZARA 2Y4IB 1Q8TA 2IVTA 2GCDA 2E9NA 1Z5MA 4RX9A 1ZWSA 4D1ZA 1FMKA 3ZONA 5IEVA 1FVTA 4OAVB 1SNUA 1H1RA 4FL3A 3QRTA 2R3HA 3I4BA 1XKKA 1RJBA 3ZBXA 4ZTMA 4CKIA 4BCMA 4Y46A 3U6IA 3ORXA 1GNGA 2BDJA 1MUOA 3EHAA 1OIUA 3NLBA 3NX8A 3QTUA 4TYHB 2QO7A 5EM8A 3UIMA 4DGMA 3SA0A 5CXHA 4Z7GA 3A7FA 3FUPA 5C1QB 4N57A 3DZQA 5A3XA 4CSVA 3RAIA 3ANRA 2JC6A 4AQCA 2ACXA 3SOAA 3A7GA 3MSSA 4W4XA 3EQCA 3E8NA 4O1OA 3FMLA 4ZSLA 3FI4A 5C9CA 4DEHA 3U6JA 3HV3A 4F6SA 1BLXA 4FNYA 1Q3WA 5LARA 5E8XA 5DWRA 1YDTE 5K0KA 3QXOA 3RCDA 4KWPA 1F5QA 2Z2WA 4EYMA 2BVAA 4HGEA 4ZLYA 4JVGA 2HELA 5EKOA 3F61A 3GT8A 3ZXZA 5EYMA 3KF4A 5FTQA 3NR9A 2JAMA 2G1TA 2JFMA 3EKKA 3S3IA 1UU8A 3FXXA 3KN6A 3V5QA 3ZBFA 4FE2A 4AZWA 2DYLA 4HZRA 4EL9A 4QP8A 4FIFA 4O6EA 5HLPA 4EEVA 5CU0A 3TUCA 3ORZA 4GVAA 2JKQA 3FLSA 3C4EA 5LVOA 2I7QA 3HL7A 5IH4A 3HRBA 4XJ0A 5KMLA 4D28A 3HV5A 4HYIA 5GINE 3SD0A 4OLIA 2Q83A 4FK3A 3TN8A 3SHEA 4B6LA 4WUNA 4TYJA 4I5MA 5ICPA 4JDHA 3VIDA 4O7TA 4ZOGA 4MTAA 3W10A 4L45A 1KOAA 2J0LA 1UWHA 2E2BA 4D58A 3H0ZA 4DBXA 1XBCA 3M2WA 4YTFA 3GUBA 5AX9A 3SXSA 4GU6A 4D5KA 2QOIA 3QTWA 4O0TA 4ALVA 4O0WA 3QZFA 5HU9A 3FLYA 2YIXA 4TYHA 4FL2A 5J7BA 5HVKA 2EXEA 5DA3A 3N4UA 2R3NA 3F6XA 3KMUA 3VUIA 3ZFMA 2XJ2A 3EKNA 4C62A 4O0VA 4L01A 4OBQA 3QD0A 1TKIA 4W4VA 4O38A 4MD7E 4WNOA 2BRGA 4O6LA 5D9HA 4R6VA 1UA2A 5HCYA 3EQFA 1L8TA 1ATPE 5M4UA 3P23A 4KRDA 5DRBA 2C69A 3QQGA 4UXQA 5AUWA 1I44A 4WUAA 4J52A 1U5QA 3QKKA 4OUCA 4H3BA 4PL3A 2OLCA 4EBWA 3IONA 2C3LA 3MFSA 3LE6A 3EL7A 1HCKA 2PVJA 1OL2A 3LFNA 3I79A 3NIEA 3ZDUA 4LL5A 3C13A 4JBVA 1CMKE 3FE3A 4LG4A 2NRYA 4YJRA 5EYDA 4ENYA 5L4QA 1KSWA 3A4OX 4FZDB 5G6VA 3DLSA 4MD9E 3RHKA 3W2SA 3PIZA 3BU3A 2VTQA 3MVJA 1XH7A 2BAKA 3HMOA 3PP0A 1H1PA 3QRIA 4RC2A 5FG8A 2RG5A 3T9IA 1GIIA 4FTKA 3FMKA 3PY0A 5HE2A 4D2VA 3I5NA 1UNLA 4HOKA 3U8WA 4IAKA 2R3MA 4IM3A 4R8QA 5ANKA 5BYLA 5M09A 4EZ7A 4QMYA 4FEUA 3U87A 3PA4A 5HO6A 2O3PA 4WBBB 1K2PA 1PXIA 5JN2A 2ZM1A 4J7BA 3DK7A 4UY9A 4AUAA 3K54A 3UZTA 3QXPA 4F9AA 4EH2A 5JGAA 3EQBA 4DYMA 3BHVA 2VAGA 4DG3E 1OBDA 3R7VA 2WQOA 3HMNA 3HMIA 4F63A 1Q3DA 2C6MA 2OWBA 3NPCA 4M12A 3EN7A 4OBPA 5E8TA 3OBJA 2EUFB 4YTCA 5IDNA 3EH9A 3D94A 4ZP5A 2R64A 4UV0A 3AGLA 2A2AA 2I40A 2JFLA 5CXZA 3LW0A 4F7NA 4FG9A 5DN3A 5D1JA 4QYYA 4FF8A 4G9RA 2ETRA 4QMXA 5JRQA 1IA9A 1YHSA 5IG1A 4ZXTA 3VUKA 1AQ1A 4BDBA 4CFMA 4AT3A 3ENHA 2R3IA 5EW3A 3DKOA 3LCTA 3HA8A 3OTVA 4OTFA 4B7TA 3MA6A 3KC3A 4AN2A 2BDWA 4CTBA 3COIA 4CZTA 3MH3A 3MJ2A 3LHJA 1KE9A 2JKOA 3MB7A 4L42A 4FUXA 2EXMA 4YNEA 3WZJA 2YHVA 4YO6A 2C6EA 4KIQA 3NUSA 4OTGA 2B0QA 4PDOA 4IAAA 1W83A 1XBAA 1YWNA 3IGGA 3KU2A 3WOWA 3VS3A 5EM5A 3R9OA 4RWJA 4M0ZA 1XR1A 3OXTA 4AGUA 4RQVA 3MH1A 4NFMA 4ASDA 4EH7A 2C6TA 4L00A 2FUMA 4JX3A 4M15A 2VWWA 5M4CA 5AUYA 5J1VA 2QD9A 3QQFA 4FV4A 4IVBA 5TF9A 2CNQA 5E9EA 4IANA 5E7RA 1OIQA 4F9WA 5JGDA 3PXRA 4KBKA 3QLGA 3VWAA 3IW4A 3FMEA 5HX8A 3DXPA 3RNYA 4C0TA 3FYKX 5J9LA 2OH4A 5HESA 4F9YA 1PYXA 3D9VA 5D10A 3ULIA 3ULZA 2QHMA 3LFEA 3NW6A 3FC1X 3I60A 1B38A 5FM2A 5FTGA 2XA4A 4KSPA 4BTJA 4IACA 5L8KA 1ZAOA 1PXOA 1YI3A 5I9ZA 1H01A 3O23A 1Y6AA 3ORLA 5FXSA 4U81A 4HYUA 4LOQA 4YMJA 3ZHPC 4IIRA 4RJ8A 5BMSA 4F08A 4FV0A 4GS6A 2JDVA 4PP7A 3HUCA 4BCOA 4E3CA 5BVFA 2UV2A 1H25A 3OWPA 4P5QA 4BCPA 3W1FA 1UKIA 4DEIA 4S31A 2X7FA 2QODA 3K3JA 4XBUA 2UVYA 3PVBA 4FKTA 3S0OA 3TDVA 3UOHA 5K5NA 4PTCA 4YJQA 1OPJA 3DY7A 3CLYA 1YW2A 1WBNA 1SVGA 4WNPA 1KE8A 3F3VA 1YKRA 2XK8A 5JZNA 2JGZA 5CANA 2YISA 4CT2A 3ELJA 4MNEB 4APCA 2X2KA 2VO3A 3GENA 4FT5A 5HZNA 4IWDA 3ROCA 4C36A 3V04A 4EH4A 3RPYA 4OTIA 2R4BA 5HI2A 3PRFA 2P55A 4W8EA 3FZRA 3R7IA 4EC9A 4GUEA 4DAWA 1XQZA 4GK2A 3IW6A 4U8ZA 4BCFA 4RRVA 5EI8A 4XV1A 3BZ3A 3LJ2A 1GZ8A 2Z7SA 2R3LA 5AIKA 5AM7A 3UO6A 4Z7HA 4V0GB 3R28A 4EBVA 4JAIA 3HAVA 3P5KA 2CSNA 2ETKA 2WOUA 4CV9A 2VU3A 3CR0A 4FKPA 5CASA 2XIYA 3KXHA 4USFA 3AD5A 2Y6MA 4RGJA 4I22A 2QOQA 2UZVA 3PPKA 3AC4A 5DR6A 3PJ2A 3ZFYA 4M13A 4ZEGA 1IAJA 5DNRA 3U51A 2HY81 2YM4A 4BIEA 4R77A 2IZRA 3N9XA 5CAQA 2GFSA 5KMNA 5IQCA 5CQWA 4QP3A 2PTKA 4GW8A 1YVJA 4DC2A 2B9JA 2W4OA 5IQAA 1QPDA 3FKLA 4MNEA 3DBDA 3FV8A 5LQFA 3FDNA 3MTLA 3Q6UA 4NUSA 3KF7A 3HECA 2YWVA 4USDA 5HE1A 3ZDIA 3REPA 3U6HA 3VBQA 2H6DA 2OFUA 2H9VA 1G3NA 5EDQA 4HJOA 2WQNA 5AUVA 1R78A 3TDWA 5HLNA 2YABA 4YC6A 4YNOA 5DFPA 4BI2A 3O71A 5KMKA 2XK3A 2VWBA 2XIZA 3QC4A 4K1BA 4ZK5A 2V7OA 4G1WA 2X9EA 4AWIA 3DBFA 3IKAA 3ORTA 1R39A 4DCEA 4ZSEA 4QD6A 1PW2A 3F9NA 3IK3A 1OUYA 3VF9A 3BCEA 4V0GA 2GDOA 2W1HA 3BHTA 3CGOA 3LFQA 2UW7A 3PVGA 4WSQA 4XBRA 3MIYA 4PQNA 4G5JA 4XRLA 3WZUA 4CG8A 3OROA 3GVUA 1PXJA 2B55A 4FKGA 4GL9A 4AW1A 4FSRA 3MTFA 3NUAA 3FI2A 4CLIA 5HE3A 4X3FB 4Q5EA 5L8JA 4GCJA 1H0WA 4GJ2A 2R3FA 2CKOA 2GHLA 1JKTA 4QTDA 3FMHA 3AQVA 4ITIA 4X6QC 4Y8DA 4I21A 3UOJA 3ORIA 2VGPA 4FIEA 4RJ5A 3DS6A 2YAKA 4E7WA 4CKRA 3EN9A 1OL7A 2O65A 2Z7LA 5CT0A 4I0RA 4DN5A 1GZOA 3Q32A 1UKHA 4A4OA 2OBJA 3V5TA 4MQ1A 4MHAA 5A46A 1P4FA 3F3ZA 2OO8X 1H26A 3DXNA 4AS0A 3FMMA 2YN8A 3O2MA 4U0IA 4HGTA 4USEA 1OGUA 3HP2A 3PA5A 4ASEA 3KEXA 4HYSA 1W7HA 3H10A 3EZVA 5FM3A 2FSMX 5HNGA 4O82A 3AD4A 3O8UA 4L43A 4MEDA 4EJNA 4BKYA 2WIPA 4IX5A 4QMSA 3T3VA 4I6FA 3TI1A 3VUDA 5CWZA 3OCSA 1YRPA 3LCKA 3ZSHA 3QRUA 3UP7A 4DEBA 4EZ3A 4O2ZA 3FZSA 4G9CA 2J5FA 4GT3A 5IA5A 4AN3A 3UTOA 4YGAA 1QL6A 2HYYA 2XVDA 3CCNA 4EUTA 1XH8A 3LFSA 3DAKA 3R1SA 5LMBA 5HBEA 4EKKA 5HQ0A 3IGOA 1J91A 2QU5A 3OCTA 4UN0C 2XS0A 3AT2A 5DVRA 4WKQA 4LI5A 4D9UA 4DH1A 4D5HA 1M14A 3QCYA 3MYGA 4R5YA 5DEWA 4CKJA 2PVMA 4C3PA 1F3MC 1NY3A 4DH3A 2OJJA 1H08A 3D4QA 4MYGA 2V5QA 3I5ZA 4U80A 2RF9A 3U9NA 4B99A 1OKYA 3ORPA 3GCSA 3GU5A 2UW0A 4I92A 4AP7A 4HNIA 4QTEA 3QFVA 3TKIA 2PULA 4TRLA 4L9IA 4EWQA 2R3JA 4NM0A 4C61A 4XS2A 2YIRA 3EQIA 3ZLXA 2W5HA 3UNKA 2PMNX 3WF6A 5IMEA 4II5A 4KIPA 4TW9A 2JBOA 4ACDA 4D4SA 1H1QA 2IW6A 4UEUA 2FO0A 1CKJA 4DBNA 4AE6A 4KS7A 2W1ZA 3OCGA 4L3JA 4BDGA 4J96A 3BWJA 2XK9A 4BDIA 1JSUA 5BNJA 3D5XA 3UODA 4E1ZA 1OBGA 3I1AA 3MPAA 2VO0A 5A4CA 4DFYA 1P5EA 5HIDA 4PMTA 4ZY4A 3KREA 3LXKA 2WHBA 3QCSA 5AR7A 5AM6A 3UG2A 3PTGA 4IXPA 2ZV9A 4YLLA 1IEPA 4K11A 3VJOA 3EQDA 4ONAA 5E8VA 5IMXA 2RKUA 4XV9A 5C01A 2C3JA 3CQUA 3EN6A 3NEWA 3QRJA 4QP2A 1RQQA 4G6LA 4UMQA 4K77A 5L2SA 4I3ZA 3R9RA 4IEBA 3UYSA 1PRYA 3MJ1A 3LLAA 2GQGA 2ONLA 3ZOSA 4EOOA 4TKSA 2R3QA 4A4XA 4KIKA 2VWYA 3DK6A 1A9UA 3PVUA 2BZJA 3R7GA 1F0QA 3VUHA 2C5XA 3NNUA 2XNEA 1BUHA 3QTIA 5FEQA 5BX0A 4OT5A 4NL0A 2O0UA 3IDBA 4FL1A 3IW7A 4FTOA 3GP0A 5EHOA 5EM7A 4BFMA 3TNPC 5BVOA 3OF0A 3ZS5A 1UWJA 2FB8A 3C0IA 3CPCA 4JG6A 5EDPA 3NW7A 3S2PA 2DS1A 1UU7A 3IOPA 3R7UA 2X9FA 4MXZA 3VS0A 1GOLA 3RM6A 3RMFA 3DGKA 4QYGA 1VEBA 4YSJA 3C0GA 2PUPA 3BE9A 4BN1A 3KRLA 3TUDA 3LXLA 1Q97A 3R04A 4JIAA 1TVOA 2C5VA 4U45A 3KXZA 2BFYA 5CY3A 4XYFA 1H00A 1JQHA 2BRBA 2O2UA 4ORKA 1V0BA 4RA5A 2YZAA 3UNZA 4XG9A 3L9PA 4ANNA 4B8LA 1PF8A 3O51A 4FSQA 4AZVA 4E4MA 3POOA 3F69A 3HUBA 5GZAA 1SM2A 2F2CB 2XJ0A 4L67A 3V5JA 3UQFA 3KB7A 4LYNA 1OM1A 3ZXTA 4I41A 5HTCA 2FYSA 3OUNB 3TNHA 3ZZWA 4GUBA 3BBWA 4LRKA 2KTYA 2QCSA 4FZAB 4OTQA 4ACMA 4IX4A 3FXZA 4OR5A 3VRZA 3FZOA 3L8PA 4DF3A 4PP9A 4FI1A 4FTRA 1M2RA 2V55A 3AXWA 3UQGA 1KWPA 3CD3A 4TL0A 5M4FA 3RK5A 5LCKA 4FNXA 4LMUA 4QP6A 5K9IA 4C2WA 4QNYA 5KBRA 3GU8A 4EC8A 3FHRA 1X8BA 4ALWA 1KV2A 4BVUA 5CNOA 5AJQA 5JFVA 3OFMA 2ITZA 2WPAA 4LGHA 2PUIA 1YXVA 2FSLX 3OY3A 4PX6A 3ANQA 4Z16A 3UQCA 3MH0A 4LUEA 3SW7A 4CD0A 2B53A 2EB3A 2X6EA 4I93A 4YZNA 2BTSA 3E62A 2PE0A 5CSVA 4KRCA 2YDKA 4QMTA 4CMUA 3R8VA 2ITPA 4JJRA 2J0MB 3RCJA 4DLJA 3P7BA 3IO7A 3PSDA 1Q62A 4NW6A 4L8MA 3AMYA 4O22A 5K4IA 2XKFA 5CF5A 1SNXA 5ANOA 3SXFA 2W9FB 3OVVA 3OS3A 4RVMA 5FWKK 3BWFA 1WAKA 2PY3A 4HPTE 1ZRZA 4U40A 5H8GA 4IDTA 4C4GA 4EORA 2WTDA 4V01A 3VC4A 3A7JA 1CSNA 3DFCB 3QLFA 4AZFA 2QI8A 3Q2JA 2X81A 3G6HA 5E8SA 4BR3A 4Q9SA 2QOKA 1OKZA 2ITWA 3ITZA 2PVFA 3BIZA 5AMNA 5E8YA 2UW5A 4EQCA 3B8RA 4I5PA 4NFNA 3ATSA 3MA3A 1P4OA 3RM7A 5K3YA 4TWOA 1WCCA 2YDIA 5CX9A 3CTJA 2WIHA 3DB6A 2QG7A 4YHFA 1SVEA 2IO6A 2WMRA 2ZV8A 3C4FA 5AP4A 3UYTA 3Q52A 5LJJA 3NVMB 1NVQA 2C5YA 3NZ0A 3LFBA 4FV9A 4JL9A 2CGXA 3LIJA 5AWMA 3FQHA 4UXLA 2EVAA 4RIWB 2C6IA 3OOMA 3BBTB 3I0QA 3Q4UA 4RIYB 3U55A 3Q5IA 4ZSAA 4F99A 1WBVA 3PWDA 2WMBA 4IX6A 2OXYA 3F2RA 3PIYA 3NUNA 5EQPA 5IQIA 2Y4PA 5IKWA 3N4TA 4C59A 2Q0NA 2BAJA 3P4KA 4OAUC 2ZMCA 2G15A 5BQ0A 2W96B 4C57A 2OF4A 3QQLA 4HVIA 2PWLA 3OMVA 4OTRA 4IM2A 3OWLA 2QONA 4O27B 4X2KA 4XG3A 3PYYA 5M53A 1GY3A 5AR5A 3WE8A 5JK3A 3SW4A 2J6MA 3CQWA 5AP3A 4QYHA 4E5WA 3POZA 2HWOA 2WMAA 3OOGA 3PRIA 4RPVA 5E90A 3TV4A 2VN9A 4D2PA 3TV6A 3PZHA 4R7BA 4YC8A 4KKHA 2RFSA 5JFWA 5CEPA 4JOAA 2C30A 2J50A 4JNWA 4HW7A 3D14A 4AA4A 4FICA 1ZY4A 2VTOA 2IN6A 3IW8A 3QKMA 5HO8A 3SOCA 2OW3A 5EW8A 3SQQA 1G8SA 2YCRA 4CFXA 1ZMWA 2W1EA 4HVGA 4CQEA 1TQIA 5FDPA 2X2LA 2W1CA 1B6CB 1M17A 4CZYB 5F94A 3UVPA 2IZUA 3P9JA 4IHPA 3COMA 5M51A 2WOTA 4FVPA 1YOJA 5C27A 3FLZA 3FZPA 4GK4A 3V51A 3JUHA 3WBLA 4RIWA 4J8NA 4FEVA 4ZLZA 2R5TA 2PVKA 4O96A 4RIYA 2LGCA 2WU7A 3P86A 4TY1A 3ZC6A 4ERKA 1P2AA 1YHWA 5CU4A 1M7QA 3TNIA 4YLKA 4G34A 4V04A 5HIBA 4BDDA 5M08A 5AV1A 5CEMA 4AG8A 5JQ5A 1QCFA 3OTUA 4G3CA 4IWPA 5HG9A 3UE4A 3SDJA 1XJDA 4FKVA 1OZ1A 3MW1A 5HNBA 1WBTA 4PPBA 4JQEA 2QO9A 3WIGA 4ZLOA 1J7UA 2P0CA 3EFKA 3ZO2A 5IA4A 4YO4A 2VZ6A 1M2QA 4KB8A 4RX8A 3R9HA 5JH6A 4U7ZA 1VJYA 3DBQA 3OBGA 4XNEA 5AAFA 4PMPA 2RSVA 4YSMA 1IA8A 3QQJA 3NNXA 3FI3A 2YIYA 1PXLA 4XX9A 4ITHA 5ETIA 5BVEA 3HAMA 3IS5A 4IE9A 5CU2A 5C4LA 3EQHA 4D2WA 2EWAA 1W98A 3QU0A 4YZCA 4YBKA 3BPRA 4FKUA 4GMYA 5DHJA 5CVHA 4E4NA 4LFIA 3PG3A 4YPSA 4K18A 1J3HA 5CEOA 3R83A 1SYKA 3W2RA 4BWXA 4EOLA 5ANJA 4AOTA 2EXCX 4G31A 3GNIB 1OIRA 2E9UA 4RX7A 4ACHA 5I5ZA 1V1KA 3QZIA 5EI6A 3A60A 4YR8A 3TZMA 2OXXA 2GQRA 3Q4CA 2VTPA 1DS5A 1Q41A 3VVHA 5BUJA 3UC3A 4BY9E 5CQUA 4ZMFA 2XCKA 3ZUUA 3TEIA 4ASZA 2ESMA 3AMBA 1Q24A 3EMGA 4MCVA 4U3YA 1Z9XA 2UW3A 4HYHA 3QZHA 3R7EA 3PJ1A 3PXYA 3TKHA 2YEXA 3ATTA 2VTIA 2CKPA 2BR1A 3EOCA 4GKHA 3DJ6A 5J8IA 3CE3A 5TO8A 4UMRA 5CI6A 5CAOA 2IJMA 3Q9WA 4FVRA 3M11A 4YP8A 1GJOA 2HW6A 4HVDA 2GNGA 3FSFA 3L8VA 2CNUA 3MPTA 3HDNA 2ZAZA 1HCLA 4TNDA 4BCNA 4R3PA 3DXQA 5HORA 4UMTA 3O8PA 4JLCA 3R02A 5T3QA 4EH9A 4DFXE 3HGKA 2Y0AA 3CJGA 4FOBA 4V05A 4BDFA 5LWNA 3E93A 3CJFA 3OWJA 2PZ5A 3R00A 4U97A 4FTUA 4L3LA 1UNGA 4JDIA 4JG8A 5ITAA 4JQ8A 1FBNA 2WMWA 4Y5QA 3A7IA 4FEWA 4M68A 4FTIA 3KQ7A 3SAYA 3UO4A 2CPKE 4DT8A 4XRJA 2XK6A 3PJ8A 4FIJA 4FZ6A 4A07A 3JVRA 1PY5A 3LKMA 3BYMA 2J51A 3LFAA 5E8ZA 4BBMA 4FSMA 3LVPA 3G15A 4GFOA 4FIHA 4GRBA 4BZOA 5JSMA 1NXKA 1WBPA 4TZRA 2V7AA 5IA0A 3UO5A 4NKSA 1OB3A 4AF3A 5I9WA 2PMLX 5J5SA 3RAHA 3MFTA 4HZSA 3NSZA 1REKA 4APPA 4LL0A 4I0TA 4DE4A 3ORKA 4AXAA 4O86A 2XRUA 4A7CA 3KY2A 2YACA 4PY1A 3C51A 3CEKA 3D7TB 1JBPE 3P7CA 2BALA 4UWBA 4U43A 2X8IA 4CCBA 1WBOA 5CVFA 4RSSA 3TXOA 3FL5A 4U79A 5I9UA 1BKXA 3LMHA 3A7HA 4I24A 1XH4A 2GNHA 4ALUA 2IZSA 2R0IA 1XHAA 1Y91A 4UZHA 3UP2A 2W9ZB 3FY2A 4D2RA 3CKWA 3KXNA 4GH2A 4S34A 2JKMA 3N51A 4XOZA 2OFVA 2PVRA 4QTCA 1ERKA 5AUZA 5CEQA 5CSWA 2HY0A 1R0EA 4FNZA 3ENMA 4FODA 5CSHA 2G2FA 2SRCA 3RP9A 4BZDA 4C34A 4KKGA 4DH7A 5AADA 1QMZA 4IAFA 3KXGA 2HZ4A 3L9MA 3E88A 3QC9A 3TZ8A 3K3IA 3TUBA 2PE1A 4AA5A 4U9AA 3BYVA 4O0SA 2PUNA 5BUEA 4F1TA 3P1AA 4WHZA 5CEKA 3LQ8A 5KKRB 4MAOA 3P79A 4G3EA 4XP0A 5JRSA 4BZNA 2BCJA 3PXKA 3VHKA 5BVNA 3QUDA 1UU3A 2YM7A 2Y7JA 3AT4A 4TYIA 4O0XA 2VO7A 2Y4IC 5A4TA 4E6QA 4EZ5A 3Q6WA 4MXYA 4RIXA 3QX2A 4BCJA 4QMQA 4WRGA 5HO7A 2J0IA 4BF2A 3TNQB 2UVXA 3NUPA 3QTZA 5GJFA 3EZRA 4ZY6A 2YA9A 2PMIA 4BCIA 3HLLA 3D7TA 4QQJA 4RFZA 3AC8A 5F95A 3ZM4A 1GAGA 3TM0A 3BV2A 3KMMA 3P0MA 4BGHA 3PVWA 1CKIA 4NIFB 2VX1A 2PYWA 3LQ3A 1IAHA 3CBLA 4YURA 3UPZA 3QQHA 1ZZ2A 4Y83A 3GU6A 4J98A 4X21A 3UVQA 5GIOE 4IB1A 5BVWA 3A4PA 5BMMA 4KIOA 3CTQA 3QA0A 2JKKA 5AUXA 5IQBA 2V0DA 1TQPA 1H07A 2F9GA 4A06A 2F2UA 3KRRA 4O0UA 3R1QA 3LJ1A 3DK3A 4TWCA 4W4WA 5HVJA 4ZIMA 2CKQA 2BUJA 4DTBA 4O2PA 3NW5A 2F57A 2WB8A 4C38A 4DFNA 4GVJA 5E1SA 4Q9ZA 4MQ2A 2F7XE 2QVSE 4XP2A 4S33A 2ZB0A 4GG7A 4FV7A 3ZRLA 5B2MA 5CAPA 3BQRA 4P5ZA 3PE2A 4K0YA 5FLFA 2WTCA 4ZTRA 2W5BA 4M14A 4YJSA 4C37A 2AC3A 4A9SA 2F7ZE 4E4LA 1DI8A 2WO6A 4FTMA 2DUVA 4AZTA 3EFJA 5EOLA 2OF2A 4DFBA 3WYYA 3CC6A 2VRXA 4FA2A 5CU3A 2BKKA 5A6NA 1O6KA 2CHLA 1M7NA 3OEFX 4YTIA 4E4XA 5HU3A 2PU8A 4JXFA 3D5VA 4FIGA 4RJ6A 2HIWA 4NIFA 1OECA 2VTSA 3ACJA 3IPHA 3KXXA 5L6PA 1K3AA 4OTDA 2WTKC 3FQSA 4QRCA 5DMZA 5D11A 2FSTX 3TIZA 5JT2A 3FZ1A 1W0XC 2WKMA 4LUDA 1LP4A 4GKIA 2VTHA 4QPAA 2QOCA 4BWPA 4E93A 4NCTC 3ODZX 5E1EA 2B9IA 5LWMA 3GCUA 2BZHB 4U5JA 4U41A 3GI3A 1Q8YA 1PXNA 4F1MA 3R7OA 5CF8A 1QPEA 3PPJA 1ZMUA 3D83A 2QOFA 3KRXA 4FEQA 4M84A 4QMMA 4ZSJA 2CLXA 3FY0A 4HCTA 4HGLA 2IPXA 4M7IA 4CFFA 4O83A 1CM8A 2VV9A 3DOGA 4I0SA 5BYYA 2PHKA 2WNTA 5IQGA 2BMCA 4QP9A 4EJ7A 5ANEA 5AP1A 5EHLA 2RIOA 4D9TA 3NWWA 3DA6A 4LGDA 4BI0A 4KA3A 3C7QA 2O64A 3LCDA 2YM5A 4MKCA 5FBNC 4ZTQA 1XH6A 4AOIA 4WRSA 5CNNA 3W8QA 3GXLA 3F82A 3S95A 4XHKB 4XLIA 4R5SA 4F6WA 5GJDA 1NW1A 4GFMA 4BGGA 4DLIA 4O7NA 4YBJA 4FZFB 2Y8OA 4N6ZA 3A8XA 3H30A 2OIQA 4G6NA 5I0BA 1OUKA 2PZPA 3ACKA 5ANGA 2IW8A 1A06A 4C4IA 5K4JA 3W2PA 4BRXA 1VZOA 3QWJA 4DFLA 3R71A 2C0IA 2ZDTA 4YZDA 1APME 4YLJA 5A54A 3AD6A 4GIIA 3GCPA 4E73A 5DT3A 3FC2A 5HIEA 5FQDC 4I6BA 4L7FA 3BGPA 5GIPE 1O9UA 2J9MA 3Q4ZA 4ZJVA 3FPQA 2WEVA 3SGCA 2XNPA 3BYUA 5IU2A 3NNWA 3PLSA 4DGLC 4OGRA 4S32A 2XNOA 4XH6A 3HX4A 2E9PA 1Y57A 1FPUA 2XKCA 2VX3A 2GPHA 4IAZA 4HGSA 3RZBA 3AT3A 2GHGA 4F4PA 2I0VA 2OJGA 3OT3A 2FA2A 5CSXA 3FJQE 4EH6A 3WILA 4ANLA 5I9VA 1ZY5A 4UMUA 2G9XA 3ALOA 3I6UA 5B7VA 1RDQE 2VNWA 2OKRA 3I0OA 3KULB 2QURA 5AR4A 2WQEA 3C4WA 2WMVA 4QMOA 5HTBA 5B2KA 3NNVA 4WT6A 3EFLA 5ACBC 4ENXA 1WBSA 5KBQA 3BLRA 2CJMA 2PE2A 3C4XA 3QF9A 5LMAA 4DA5A 2GTNA 3R63A 3HNGA 3JVSA 4DT9A 3V8WA 2XEZA 3LPBA 5E4HA 3ZZEA 3PE1A 1PMEA 3LM5A 2ITUA 4R7HA 3ZM9A 3OC1A 3VS1A 3KK8A 4NM7A 2JAVA 1JSVA 4EKLA 3FEGA 2Y6OA 2PZRA 2QKWB 3KCFA 5EOBA 3ZTXA 2XJ1A 3IDCA 4TNBA 1PKGA 3MI9A 4FT0A 4JDKA 5FGKA 3QGYA 4DH5A 5IPJA 3PJ3A 1KE7A 4XLVA 3O7LD 2NNWB 3QCQA 2R3PA 5FD2A 1YXUA 4XG8A 5EYCA 5HEZA 3UJGA 4CEGA 1XH9A 2A4LA 3CY3A 4NJ3A 4CFNA 5E92A 2OICA 2GSFA 1UNHA 3OW4A 4C02A 2XKEA 2X1NA
chains in the Genus database with same CATH superfamily
2HK5A 3T8OA 4QQ5A 5HKMA 1YI6A 3IECA 3R8MA 5EQEA 3PZEA 3DNDA 4UYNA 3TKUA 1S9JA 5AP0A 1AGWA 3G0EA 1Y6BA 2C6KA 2X8DA 3F5GA 2JDSA 5C8KA 4F0FA 3BV3A 3R01A 3OT8A 2OJ9A 1T45A 3WZEA 2BFXA 3TT0A 3BLHA 3VBXA 5AAGA 3VULA 3HZTA 3KIOC 4NSTA 4DHFA 4KIKB 3KULA 3R8UA 4DFZE 4M97A 3ETAA 1GIJA 3NUUA 4BBFA 5AUUA 3F3UA 3OXZA 3QQUA 1A48A 5J7HA 3W16A 4XG2A 3F5UA 5EDRA 3G9NA 5AP5A 3F3WA 2ZJWA 5CU6A 4DH8A 1ZOGA 3Q9XA 2G2HA 3MY1A 3PDTA 2UZOA 3NCZA 1CKPA 4MBIA 1YHVA 3Q53A 4EQUA 4ANMA 3G2FA 4QMPA 4BL1A 2F7EE 2AYPA 2A19B 2GS6A 5IDPA 1J7IA 2ITTA 4N6YA 4YZMA 2X6DA 4MX9A 4U42A 2PK9A 3FAAA 5LVNA 4FSZA 4EK3A 2BRMA 1JVPP 3HRCA 3LCSA 1R1WA 4FNWA 3LLTA 3RTPA 4KNBA 1YDSE 5IH5A 2W7XA 3QX4A 5FTOA 5EI2A 3R8LA 1JKKA 4EOPA 4C3RA 4H1JA 5B0XA 2XP2A 2CN8A 3LCOA 1EH4A 2CMWA 3D2KA 4FKSA 4CT1A 3WF9A 4BYIA 3RHXA 4AXCA 4M3QA 2NPQA 3GFWA 2JIIA 4QTBA 3ORNA 4YJPA 3QD2B 2XYNA 4WG5A 1W82A 2VTRA 1JOWB 2RL5A 3RINA 3UVRA 3WARA 1M2PA 3Q9ZA 3QAME 5A9UA 3KRWA 2XM8A 2C0OA 2UZLA 4C35A 3MVHA 2CCHA 3F5PA 2PZIA 3NUXA 4L52A 5KMJA 1OPKA 2VGOA 3CY2A 5F20A 3V6SA 4NYEA 1XBBA 5HHWA 4BCGA 4HPUE 5EG3A 1TQMA 1GZNA 3KMWA 3OW3A 3PY1A 2WU6A 3MBLA 5CEIA 4TYGA 4M0YA 4AX8A 1U5RA 4O4CA 1U59A 1XWSA 3RKBA 2UZTA 4RC4A 4RG0A 3ML1A 2YFXA 3QTSA 3ZUTA 2C3IB 2Q0BA 4FSNA 3SV0A 4QQTA 3UDTA 4RVTA 1IG1A 2BAQA 3NUYA 2A0CX 3W33A 4YJUA 4QT1A 3O7LB 4IVCA 5FXRA 5EQYA 4RWIA 4UX9A 4E20A 4XP3A 3O17A 5HICA 5IA3A 4E26A 1UU9A 5F4NA 4R78A 4AU8A 3I6WA 3ZO3A 4QTAA 2WXVA 4YJVA 1CDKA 3VQHA 3E7OA 4PMSA 4QMLA 3VO3A 3K2LA 2XK7A 3VBVA 4YHTA 5IQDA 2VX0A 2WD1A 4MBJA 5AR3A 3DT1A 3UNJA 1MRVA 2XYUA 5GHVA 2ITXA 4IAIA 4IMYA 3HKOA 4EHVA 1LEWA 4H3QA 4FTJA 4IC7A 4E8AA 3H3CA 1FVRA 3CTHA 4ANOA 5DRDA 4I5HA 3LM0A 4HNFA 4A9YA 3C9WA 1BI8A 1URWA 4O1PA 4X2FA 4EUUA 2C5NA 2OZAA 1YXTA 4X3FC 4MXAA 2VNYA 3OXIA 5DOSA 4MXOA 3PXZA 3DJ7A 3PJCA 2GNJA 3CXWA 5LVLA 5EM6A 3SLSA 3FLNC 3SRVB 3OEZA 2BHEA 2J2IB 3UMXA 3UOKA 3ZC5A 4ZSGA 2ITOA 3EQGA 3DTCA 4FTQA 1K9AA 3NYXA 4GK3A 2WMXA 2OG8A 5DLSA 3JXWA 4GV1A 5EHYA 5FXQA 3T9TA 4MUQA 4YPDA 3W0OA 4BCHA 1H1SA 3HMMA 1NT2A 3VF8A 3NYNA 5M55A 5CALA 4PDYA 1KE5A 5EFQA 5DPVA 5L6WL 2VWIA 5M06A 4RVKA 3G90X 3DPKA 4R7IA 3GCQA 3CQEA 4OBOA 3EN5A 4DHJA 4AAAA 2C6OA 4LV5A 2H8HA 4O4DA 3D2IA 4AT5A 3NGAA 2CDZA 3TV7A 4FT7A 3W0NA 2X7GA 3RAWA 4P2KA 4YC3A 4WIHA 1REJA 3BGZA 2J0JA 3THBA 4X3JA 4RMZA 1L3RE 1OKVA 3QTQA 4OTHA 5HLWA 3LFDA 2W99B 4NU1A 4ZTLA 4CMTA 3Q5ZA 4LV8A 4M67A 5T6KA 3RAKA 3FMNA 4IB0A 3EYHA 4WOVA 3MESA 2I0EA 2CGUA 3TZ7A 1YXSA 5IA2A 2R0UA 4S30A 4BDEA 2QOLA 3R30A 1VR2A 3UMWA 5KHXA 3R21A 4NM5A 5JFSA 5L6OA 3W0PA 4O7WA 4NW5A 4Y5HA 3U4UA 2XALA 3OUKA 4I4EA 1U4DA 2J5EA 2ONLC 2WGJA 2V62A 2YLEA 4L3PA 5FRIA 2YITA 3KGAA 3ZO4A 2JIVA 2W17A 3HYHA 4RWLA 4CYJA 2BDFA 4WD5A 3SRVA 4D0XA 3ZRMA 5L2WA 3EJ1A 4IQ6A 4U44A 4N4SA 5HG7A 3RVGA 5AA9A 3KK9A 4BDHA 5A14A 4ACGA 3B2WA 4DTAA 4I94A 4ANQA 3GC9A 3VQUA 5BYZA 2C1BA 1U54B 2ZB1A 4D2SA 4MWIA 2YCQA 4WBOA 5DG5A 4NH1A 4BYJA 1H0VA 3P78A 4X7QA 3NCGA 2XK4A 5GJGA 2XIKA 4BBEA 2CLQA 1YOMA 5KMMA 2RFEA 3JY9A 4S2ZA 1BL7A 3QTRA 5AX3A 3OHTA 3ZUVA 2PL0A 4JR7A 4WA9A 3Q04A 2XBAA 4G2FA 5D41A 3AOXA 2C6LA 2OU7A 1VYWA 2E9OA 1JWHA 4BGQA 1UVRA 5KNJA 3UIUA 5HCZA 4WG3A 4FKRA 5E91A 4FSTA 5M07A 5IA1A 5ETAA 4RJ7A 1BX6A 5DI1A 3K5VA 1QPCA 1KE6A 2ERZE 3BHHA 2GQSA 3MIAA 4EOIA 3GBZA 2XM9A 3DKGA 5H8EA 4ERWA 4DG0E 3MS9A 2C1AA 4OT6A 4ZJJA 3LJ0A 4W9WA 4IBMA 3UDBA 4R1VA 5AEPA 2OK1A 1V0OA 2CCIA 2PSQA 4FX3A 3R73A 4UWCA 4FBXA 3JR1A 1U46A 3PFQA 3PXFA 5K0XA 1V0PA 5TOZA 3GCVA 2XKDA 3VUTA 2VWUA 2RG6A 2XCHA 4ZY5A 3G5DA 4FTNA 2BHHA 1OMWA 3FPMA 1ZYLA 5DGZA 5JGBA 4IADA 4D0WA 3LZBA 5HCXA 2YERA 4FG7A 4QYEA 5A4EA 4KBCA 2NP8A 3KCKA 1U54A 4QPSA 1FMOE 4PNIA 2GTMA 3F5XA 1WZYA 1PYEA 2FGIA 1YQJA 3E92A 5FUTA 4EONA 1Q8WA 5JMSA 4RVLA 4HVHA 2HZIA 1I09A 2CGWA 3F7WA 3KVXA 3TCPA 4JRNA 2WTIA 4F7SA 3ID6C 4J97A 5ANIA 4LM5A 3D5WA 3EL8A 4BDJA 4P4CA 5KUPA 4XOYA 3UG1A 4RZWA 4I20A 3U9CA 5I3RA 4IH8A 1LEZA 4WNKA 1DAWA 3GFEA 5CSPA 2Z8CA 3UDSA 3QKLA 4IM0A 2O63A 3R22A 2F4JA 3GQIA 3QBNA 2XBJA 5KMOA 1BL6A 4X2JA 4NZWB 3UIXA 2WEIA 5HNIX 2H34A 5IH6A 5LXMA 4O7YA 3R8ZA 1XH5A 3GB2A 3B2TA 4E5AX 2I6LA 3GOPA 3E3PA 3S00A 4CCUA 2JBPA 1B39A 4TWPA 3C1XA 3RK7A 3UBDA 3JY0A 3LXNA 3FQEA 2C47A 4LRJA 4PL5A 4PTEA 5L2TA 5D7AA 5AV3A 4O4BB 5I9YA 5HTIA 3FYJX 1J1CA 2XIXA 2PUUA 5HGIA 1J1BA 2R3KA 2V22A 3MFRA 1KV1A 3I7CA 3QYWA 4F7LA 1PMNA 2UW9A 4AT4A 1MQBA 4AGCA 3FI8A 3R1NA 2JD5A 3KKVA 4O81A 3ZCLA 4DEDA 3OD6X 5IEYA 2UZWE 5M56A 5D12A 2R7IA 2CNVA 4FKIA 2OH0E 5J9ZA 4XEYA 3LFFA 1IRKA 1NVRA 3E5AA 3W18A 3PLAE 1Z57A 1JPAA 3A8WA 3AC3A 5ACKA 4C4HA 3WE4A 4N70A 3NYVA 2PZYA 4AW0A 4JI9A 3QALE 1MRYA 4MXXA 2W1FA 2ZM4A 3KFAA 4CMOA 4NEUA 4D55A 4F1OA 5GNKA 1H27A 1ND4A 4O7ZA 2X4FA 1FINA 2CN5A 4MBLA 4XMOA 2GU8A 4DHIB 2YAAA 2HWPA 4IJPA 2B1PA 3OP5A 3VBWA 5KHWA 1YDRE 2Y9QA 4XG4A 1BYGA 2UZEA 3NVKI 5LMKC 3S1HA 4EOJA 2OGVA 4HCUA 2B4SB 4U3ZA 3ZMMA 3ZLYA 4BIDA 3IQ7A 3NMUF 3IOKA 4I5CA 4QPMA 1P14A 4QMZA 5CT7A 3O8TA 5I9XA 3A2CA 1PXKA 4X2GA 5FDXA 4D1XA 4DGOA 4RJ3A 1J7LA 4NTSA 2VTAA 3KA0A 2YIQA 3JPVA 4EOKA 2C68A 4KAOA 4E5BA 2HXLA 2I0HA 1E1VA 4MXCA 4DG2E 4DCAA 2FSOX 5FEEA 5A4LA 2R3OA 3H4JA 4FV1A 4EHEA 2OIDA 4C4EA 3W2CA 5CVGA 4AA0A 2ZVAA 3BYSA 3NDMA 1G8JA 2NYAA 5CTPA 1Q61A 1WMKA 5HBHA 2ITNA 5JFXA 2WTKB 4GU9A 4Z55A 1Q5KA 4PWNA 3V5LA 3W0SA 2YJSA 2ZM3A 3ZH8A 2YCFA 2QLQA 3DBEA 5CZIA 1Y8YA 1PXMA 4FT3A 4D4VA 2YZLA 1E1XA 2F49A 1LUFA 4RIXB 3RBWA 3E8CA 4CXAA 3LMIA 3SG9A 5DIAA 3C5UA 4FG8A 4QMVA 4BC6A 4NWMA 5IUGA 1G8AA 5CYIA 2W1IA 2HCKA 3CKXA 3AC1A 3G6GA 3KRJA 4F64A 4GT4A 1S9IA 1Q8ZA 4KBAA 4DEAA 3H0YA 2A98A 2Z7QA 3RPRA 5HD4A 2IW9A 4RA4A 1H24A 4C8BA 3AMAA 4W8DA 4CFWA 4WG4A 4DEEA 5CF6A 3DAEA 3OZ6A 3QYZA 4FV2A 4IAYA 2ITVA 4AW5A 2PPQA 3MDYA 5E8WA 3LXPA 3MPMA 1ZYJA 5IISA 5JZJA 3ROYA 2WFYA 3FKNA 4JBQA 3BYOA 4QDEA 2PVLA 2ZOQA 2IVSA 3D0EA 3BE2A 3GGFA 1ZYCA 4AACA 4BKJA 1H8FA 2O8YA 3SKCA 4FIIA 1SVHA 1JKSA 4AFJA 2VO6A 2DQ7X 4EK6A 4F9BA 5L2QA 3DFAA 1H28A 2GFCA 4J8MA 3EQPA 4K6ZA 4OTWA 4FKLA 4D4RA 2W1GA 4IC8A 3PXQA 1YI4A 2P3GX 4LOPA 3O50A 4H05A 3RPVA 2YLFA 4CNHA 4XUFA 4K8AA 4YJOA 4J99A 5AUTA 5M44A 3IW5A 4C2VA 3D15A 5HG8A 2WMSA 3UGCA 2UW4A 2GMXA 2VTNA 4LQMA 4NCTA 4ZZMA 4CLJA 3H9RA 4EH8A 5C8NA 2VUWA 4L68A 5TKDA 1Y8GA 4BICA 3RI1A 5I4NA 3L9LA 4O0YA 2XAOA 5ANDA 1JSTA 4IWQA 4JBOA 3E64A 4ZZNA 4EWHA 1OITA 3Q4TA 4IVAA 5E8UA 3C0HA 1XO2B 3P08A 3DDPA 3V6RA 5IUIA 4EHGA 5T68A 5LOHA 4J95A 5IF1A 2UZBA 4MF1A 2QOHA 4WO5A 5KMIA 2XMYA 4FTTA 2R3RA 2OI4X 5A6OA 3TJCA 2BKZA 1OKWA 3SG8A 5TE0A 3R9DA 2Z7RA 3BRBA 4FKWA 4MD8E 3G9LX 4G3GA 3BELA 5I3OA 4FSWA 3O96A 4AN9A 4CRLA 5TR6A 4EHZA 1YXXA 3W2OA 3KN5A 2WMQA 3FMJA 2RFDA 4M69B 4N0SA 4TT7A 3KL8A 3TYKA 3TTJA 3DU8A 1W8CA 5HX6A 3H9OA 1MQ4A 4B0GA 3BEGA 4PDPA 4BKZA 5EKNA 4Q2AA 5AP6A 5LCJA 4KINA 4RBLA 2JLDA 4GT5A 1FQ1B 3ZO1A 3L8XA 4QMUA 3ZSIA 5DBXA 3RPSA 4H36A 3RWPA 4I1ZA 3W32A 2QR8A 4F7JA 4LRMA 3CP9A 3ZSGA 3QA8A 2QO2A 2B9FA 3E63A 2VTLA 1O6LA 3HEGA 3HV7A 3LOKA 3M1SA 4FKQA 1TFFA 4ACCA 3MN3A 5DEYA 4MVFA 4FVQA 4O7VA 2BIYA 3TZ9A 3WZKA 4CQGA 2FH9A 4QP1A 4RFYA 4F70A 5EH0A 5G1XA 2I0YA 4EH3A 1OL6A 2ETMA 5JQ8A 3K5UA 4K33A 4QO9A 3UZRA 4B8MA 3QD4A 3M42A 5J95A 5CZHA 1ZZLA 4QP7A 4I4FA 3VS4A 4AGWA 4AFEA 2PVYA 4EQMA 3MVMA 4IZYA 2QNJA 2W05A 4FTLA 2BRHA 2QG5A 3GC0A 3JS2A 4FTCA 2R7BA 3CPBA 4QMNA 3W55A 2OZOA 3VS2A 3ZFXA 4XG6A 2BPMA 4TN6A 1RW8A 3D7ZA 3E7VA 4G5PA 4JIKA 2IVVA 4MK0A 5GZ9A 4J71A 4M69A 5H2UA 1M52A 3PSCA 3C4ZA 4UB7A 4Y95A 5L2IA 1PJKA 5DH3A 4A9UA 5J5TA 1JNKA 2W5AA 3ET7A 4IW0A 4G6OA 4E6CA 4BI1A 3PP1A 2BTRA 2HZ0A 4LDTA 1ZLTA 4AZSA 2EU9A 3TL8A 4P7EA 3VJNA 4BTFA 2G01A 4QYFA 3VUMA 4EYJA 3MB6A 4FKJA 4O84A 4RJ4A 5A4QA 1R0PA 2ZV2A 3FLWA 2P4IA 1OPLA 1KOBA 1H4LA 3EQRA 3EFWA 3GU7A 3R1YA 4YU2A 2LAVA 3HV4A 2BZIB 3BI6A 3QRKA 4AZEA 1WBWA 4NKAA 2KULA 3UZPA 3VONA 2R9SA 3FWQA 3H9FA 4LOOA 2PVNA 4H39A 4CG9A 2WTJA 3NS9A 3I81A 5AV0A 3UPXA 3IDPA 4NT4A 4AE9A 5FEDA 2UW6A 3Q2MA 2ZDUA 3E87A 3Q9YA 3VUGA 4EK5A 3V5PA 2BRNA 3HDMA 2X8EA 3Q3BA 3VNTA 4RC3A 2C3KA 4BWKA 4D2TA 4YZBA 3VS7A 2IG7A 4UBAA 4KD1A 2X7OA 4YJNA 4ZTNA 1KUTA 1RE8A 1Q4LA 4O7SA 1JKLA 3OG7A 4WSYA 2XNNA 4EH5A 3EIDA 3DQXA 4MNFA 4IFGA 5IEXA 4C4JA 5IUHA 4A4LA 4F09A 4BDCA 1VYZA 2WTWA 4Q5HA 5FP5A 3RZFA 3MVLA 2VWVA 3D5UA 3AGMA 2REIA 4FYOA 4HCVA 4AXFA 3BHUA 4IZAA 5B2LA 2XNMA 4TPTA 4XV2A 3VBTA 3EN4A 3COKA 1H1WA 2PVHA 2AUHA 3FSKA 4TWNA 5KKRC 3W0QA 1WFCA 3AC5A 2WQBA 3ZEPA 5KCVA 4FUYA 4QQCA 3ALNA 5AAEA 3MGYA 3OCBA 4IZ7A 3QTXA 4MH7A 4UMPA 2P2IA 5H9BA 4OW8A 2XF0A 4BCKA 2HENA 4RQKA 4ZJIA 4IX3A 4JG7A 4K2RA 2PMOX 3BEAA 4G16A 2UZUE 3C50A 4Y73A 5F9EA 2QOBA 1SZMA 3R8PA 3TG1A 4BHZA 4HVSA 4ZTSA 3DAJA 2DWBA 2GNLA 1GIHA 2UZDA 5TT7A 3SX9A 3ZRKA 2ZV7A 4L6QA 2R3GA 5HVYA 3T3UA 4EK8A 4RT7A 2W4JA 2H96A 3DJ5A 1O6YA 3BX5A 2BILB 2IF8A 4W4YA 2JIUA 5AP7A 3ZU7A 3VS6A 4A9RA 4BDKA 5J1WA 3AG9A 2HZNA 3HA6A 4BDAA 1JAMA 2YCSA 3PPZA 2WELA 4M66A 2IZTA 1OI9A 2BZKB 2R2PA 1WVYA 3RALA 3ZLWA 4CZUA 4GIHA 4FV5A 4U6RA 1E9HA 2P2HA 3R0TA 4G3FA 4F9CA 4GYIA 4YHJA 5CLPA 1JLUE 4ANBA 2I1MA 1NVSA 4ZTHA 4IB5A 2J0KA 2G2IA 3Q96A 4JT3A 5C03A 4BTKA 3BLQA 5HG5A 3LQ5A 2E9VA 4R3RA 3LMGA 2X0GA 3V8SA 1Q8UA 3BHYA 1DI9A 4FTAA 3NYOA 3RJCA 4DINA 4Y85A 4R1YA 3F66A 1R3CA 4PF4A 5BVKA 3VW6A 4AW2A 5JEBA 3VRYA 2UW8A 3PIXA 5DR9A 5KZIA 3RNIA 4DFUA 4ITJA 4LGGA 4PTGA 4R3CA 3DDQA 3NAXA 5CENA 2X4ZA 4YTHA 1FGIA 4Y72A 2CGVA 2VTMA 1OVEA 3GQLA 1PMVA 2W0JA 4X3FA 4WNMA 3PA3A 3S4QA 3U4WA 4DTKA 2B54A 2ZMDA 5M4IA 3DLZA 4KSQA 4UALA 1MRUA 3W8LA 3JYAA 4IJ9A 2C6DA 1ZMVA 4FV3A 3TNWA 4EOSA 1YOLA 4YZ9A 2BROA 2J4ZA 4BCQA 4W9XA 3ORMA 4BIBA 1LPUA 2A27A 5AP2A 3DZOA 5CS6A 5AA8A 2BIKB 4UZDA 4G17A 1MP8A 5DT0A 3UOLA 1BI7A 3NRMA 4IZ5A 5J79A 2HOGA 3L9NA 4O21A 3MY5A 1IASA 3TWJA 2HXQA 4O7RA 4PV0A 4BHNA 4QP4A 3DTWA 4IDVA 2OZAB 4GG5A 3WI6A 3RK9A 4K9YA 3HVCA 3PSBA 4JRVA 4GEOA 3DCVA 3N4VA 3QD3A 4FK6A 3DB8A 4B9DA 3C5IA 4DGNA 4JDJA 3RPOA 4C3FA 3KXMA 4XG7A 2OJFE 3A61A 4FGRA 2QOOA 4PNKA 2QHNA 3OY1A 3HV6A 2GS7A 5C4KA 1HOWA 3P7AA 4J53A 2YDJA 4RLKA 5L8LA 1WVWA 4H58A 2QLUA 2X2MA 2VD5A 4YUQA 1DM2A 1SMHA 2W06A 3DQWA 3O0GA 3Q60A 4G3DA 4J1RA 5AV4A 5IQEA 3HP5A 3F3TA 3WF5A 4EOMA 4C4FA 4X2NA 4NJDA 4QOXA 2XARA 3WZDA 1STCE 2IVUA 2JDTA 2XUUA 3R9NA 4NTTA 4O91A 5HOAA 4FR4A 5M57A 2NO3A 4TYEA 4FSYA 2O5KA 4D1SA 4ZS0A 2QKRA 2JEDA 4FZ7A 3VHEA 5D7VA 4C58A 3E8EA 4L46A 2GNFA 5EW9A 5BVDA 3FXWA 3L1SA 2C4GA 3V8TA 4Z3VA 2XRWA 3FBVA 4RX5A 3G0FA 1PXPA 5EK7A 4F78A 1G5SA 3B8QA 4MWHA 1ZOHA 4I23A 3R2BA 3UC4A 3COHA 3QUEA 4D4YA 5KZ0A 5KE0A 4ZAUA 3E8DA 3VN9A 3GC7A 4PPCA 3QQKA 3II5A 1FGKA 4ZZOA 3QGWA 5GZ8A 2W1DA 4I6HA 2B7AA 3BU5A 3L8SA 3C4CA 3FZTA 4RIOA 2OXDA 4EOQA 1YWRA 2QR7A 5FBOA 3DBCA 3VW8A 3CD8A 1WVXA 3R6XA 3BKBA 3O5AA 3MFUA 3G51A 2WMTA 3ZEWA 4L53A 4KS8A 2GHMA 3R7YA 4NK9A 3VAPA 4FV8A 1BMKA 4PMMA 4CRSA 4CYIA 4CFVA 3QUPA 3CSVA 1OL1A 4LV7A 5C26A 3F88A 3EWHA 3DV3A 2JITA 3ZYAA 3ODYX 4H1MA 5BUIA 3LFCA 4TXCA 4FC0A 4IB3A 3UIBA 2NRUA 5LVPA 2B52A 4C33A 3HRFA 3DNEA 2VWXA 5H8BA 4A9TA 3V5WA 2OJIA 4FMQA 3TJDA 4KUJA 2ITYA 4QMWA 5KX8A 3G33A 3NIZA 2X39A 4PDSA 2QQ7A 3QZGA 3SXRA 1LR4A 4F0IA 5HE0A 2XIRA 2FVDA 4JBPA 2WZJA 4PRJA 3PWYA 4O4FA 3LAUA 2C5OA 3GEQA 5EYKA 5DR2A 2VWZA 2Z02A 4XV3A 3QHWA 4FT9A 2A1AB 5AIRA 4PUZA 2QC6A 2B9HA 3HMPA 2YM3A 3VS5A 4ANSA 5L3AA 3IG7A 2J90A 2HAKA 5K5XA 3TACA 3BQCA 4AXDA 1CTPE 2RFNA 4UYAA 3BGQA 3WF8A 4X0MA 1AD5A 4OTPA 1W84A 2ERKA 4L7SA 3GOKA 4EK4A 4IVDA 4JQ7A 4GJ3A 4H3PA 3F2NA 1ZXEA 4JAJA 4DEGA 4GYGA 4L44A 5DYJA 2RGPA 4IWOA 2GS2A 5KO1A 5J9YA 3KVWA 4ZS4A 3MH2A 5BPYA 3DKCA 2XNBA 5H3QA 3TTIA 2UZNA 1URCA 2YM6A 4BTMA 3OWKA 1PMUA 2OIBA 4MF0A 5AR2A 5IQFA 2EB2A 3I7BA 2P33A 4GFGA 4KABA 3QHRA 4E6AA 5ETCA 2VTJA 3F2AA 3GC8A 4UWYA 4F0GA 4JR3A 1OIYA 3AC2A 4GSBA 5CAVA 4LMNA 1PKDA 2VTTA 5DE2A 3V3VA 3NAYA 4RLLA 3FLQA 3MY0A 5IZFA 4NM3A 3WF7A 4YJTA 3CS9A 3CGFA 4PPAA 3FMDA 3ZLSA 2HW7A 5HBJA 2XNGA 4FYNA 1NA7A 1GZKA 3RGFA 5AR8A 4TTHB 4ASXA 5CAUA 3SVVA 1UV5A 3RWQA 3V01A 5AFVA 5HD7A 3QWKA 1ZOEA 2YIWA 4IFCA 4FEXA 4CV8A 4RFMA 4M8TA 3QL8A 3R2YA 3UDZA 2XEYA 4XCUA 1IR3A 2YJRA 3PY3A 2XB7A 2ZYBA 4E6DA 1ZYDA 3QCXA 3EYGA 5CI7A 3EB0A 4F65A 4CVAA 3FHIA 2C0TA 1T46A 5AV2A 4JX7A 2UVZA 4I6QA 2ITQA 1PHKA 2YM8A 3FL4A 4FGBA 4KKEA 2JDOA 4Z9LA 3W2QA 3BU6A 4FKOA 2CKEA 1YWVA 3F7ZA 4CFUA 4BB4A 2AC5A 1ZYSA 2YWPA 5IQHA 3CIKA 2Z60A 4CTCA 4EI4A 4RZVA 2GNIA 4O7LA 4ARKA 4AGDA 4FV6A 4PL4A 5LMKA 2W4KA 3ERKA 4ID7A 4QNAA 3A99A 4DITA 5LVMA 3SC1A 1OL5A 4P90A 4CGAA 3PG1A 3U54A 4B4LA 2XH5A 2OSCA 3WYXA 4DGGA 5JKGA 4AOJA 3PUPA 3DKFA 2IEWA 4O0RA 5F1ZA 2J7TA 3A62A 1QPJA 3WIKA 4F6UA 2QU6A 3FKOA 3E3BX 4JS8A 1DAYA 4FOCA 1FOTA 2WTVA 2WAJA 2XZSA 3MV5A 2WMUA 1FVVA 1Q99A 2JDRA 3GU4A 5DT4A 3MWUA 3TIYA 4FSUA 4ZMEA 2WQMA 5ETFA 2IWIA 4RWKA 2UUEA 5C8MA 4X6RA 5CF4A 5J87A 4C7TA 3VBYA 5FP6A 1ZARA 2Y4IB 3NFFB 1Q8TA 2IVTA 2GCDA 2E9NA 1Z5MA 4RX9A 1ZWSA 4D1ZA 1FMKA 3ZONA 5IEVA 1FVTA 4OAVB 1SNUA 1H1RA 4FL3A 3QRTA 2R3HA 3I4BA 1XKKA 1RJBA 3ZBXA 4ZTMA 4CKIA 4BCMA 4Y46A 3U6IA 3ORXA 1GNGA 1W2CA 1MUOA 2BDJA 1OIUA 3EHAA 3NLBA 3NX8A 3QTUA 2QO7A 4TYHB 3UIMA 4DGMA 3SA0A 5CXHA 4Z7GA 3A7FA 3FUPA 5C1QB 4N57A 3DZQA 5A3XA 4CSVA 3RAIA 3ANRA 2JC6A 4AQCA 2ACXA 3SOAA 3A7GA 3MSSA 4W4XA 3EQCA 3E8NA 4O1OA 3FMLA 4ZSLA 3FI4A 5C9CA 4DEHA 3U6JA 3HV3A 4F6SA 1BLXA 4FNYA 1Q3WA 5LARA 5E8XA 5DWRA 1YDTE 5K0KA 3QXOA 3RCDA 4KWPA 1F5QA 2Z2WA 4EYMA 2BVAA 4HGEA 4ZLYA 4JVGA 2HELA 5EKOA 3F61A 3GT8A 3ZXZA 5EYMA 3KF4A 5FTQA 3NR9A 4AQKA 2JAMA 2G1TA 2JFMA 3EKKA 3S3IA 1UU8A 3FXXA 3KN6A 3V5QA 3ZBFA 3AKKA 4FE2A 4AZWA 2DYLA 4HZRA 4EL9A 4QP8A 4FIFA 4O6EA 5HLPA 4EEVA 5CU0A 3TUCA 3ORZA 4GVAA 2JKQA 3FLSA 3C4EA 5LVOA 2I7QA 3HL7A 5IH4A 3HRBA 4XJ0A 5KMLA 4D28A 3HV5A 4HYIA 5GINE 3SD0A 4OLIA 2Q83A 4FK3A 3TN8A 3SHEA 4B6LA 4WUNA 4TYJA 4I5MA 5ICPA 4JDHA 3VIDA 4O7TA 4ZOGA 4MTAA 3W10A 4L45A 1KOAA 2J0LA 1UWHA 2E2BA 4D58A 3H0ZA 4DBXA