3FKLA

P38 kinase crystal structure in complex with ro9552
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
349
structure length
344
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLAEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mapping Binding Pocket Volume: Potential Applications towards Ligand Design and Selectivity
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 112
structure length 344
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fklA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fklA01
2HAKA 4AP7A 3VUHA 3S2PA 4ZTQA 3AGLA 1VYWA 3WZUA 3OBJA 5KMLA 1KUTA 4DT8A 4KKHA 2YFXA 3QX2A 3UJGA 4BICA 3UG1A 2UZWE 4RSSA 3HP2A 2GFSA 3L1SA 5EDQA 2PVNA 2R3QA 2R7IA 1ZYSA 3QQGA 4PF4A 3HA8A 2F9GA 4L8MA 4CT1A 3QXPA 4EOPA 4BDEA 5IQBA 1BX6A 2HXLA 4C62A 3V3VA 3C4EA 5GJFA 3NUPA 1WAKA 3EQDA 1PXPA 1YXVA 3IECA 3NS9A 4MBLA 5CAOA 1YWNA 4DG3E 2RFNA 3MTLA 4E20A 4N57A 5EYDA 4QQCA 1JOWB 3ID6C 3R28A 4E8AA 4M14A 4NFMA 4NH1A 4DLJA 4DF3A 4XV2A 3QRUA 1R3CA 4EOQA 2XIZA 2QG7A 3BYMA 2GHLA 1F3MC 3MN3A 4FX3A 4OTHA 4QP2A 4WKQA 4HCTA 4HGEA 5AUTA 4BF2A 4XP0A 3PSBA 3PUPA 2Y8OA 4TRLA 2YLEA 4BCQA 4EKKA 2PULA 3ZEPA 2ONLC 2R4BA 2QOLA 4BVUA 4IWQA 5JK3A 2VTIA 2C6TA 3NUXA 3IOKA 3CKWA 3ODZX 1ZOEA 4EONA 1JQHA 2HZNA 4AF3A 2ZB0A 5M56A 4O82A 5JQ8A 3A60A 3LIJA 5CAVA 4GKHA 2OF2A 4DITA 2H8HA 3ANRA 5CU3A 1OUKA 4F0FA 4ZSAA 2B53A 3ALOA 3E8EA 5BQ0A 2X2MA 2VWVA 2O64A 4BDCA 4YZDA 1PXIA 4M8TA 4A9YA 4BI1A 1QPEA 2H6DA 2H34A 4ACGA 4DEIA 5M06A 1VYZA 3DAKA 3IKAA 3RALA 3U4UA 4I20A 1L3RE 4CD0A 3OBGA 3UO5A 4AAAA 3BPRA 2CGUA 4FSTA 2JDSA 2ETMA 4BDBA 3H9OA 4IB1A 4ZY6A 5A54A 4KIKB 1Q62A 3QD0A 3R7IA 3COHA 2V62A 4FSYA 3SVVA 4EOOA 5E4HA 5AEPA 4L52A 4ZSEA 4FTJA 3BLRA 2C5OA 3BV3A 1MQBA 5HTBA 1NVQA 1CDKA 4BCGA 3BZ3A 3I7CA 2WTKB 4JJRA 4FTMA 4O0SA 4I92A 4QPSA 2JKQA 2UW4A 4HYUA 1ND4A 4IEBA 3QQFA 5L8JA 5FD2A 4L3JA 4G6LA 3A7HA 4FG7A 4QQ5A 4R77A 4FKGA 5EQYA 3AD6A 4I41A 5CU2A 3NEWA 3PRFA 4L6QA 4D0WA 2WXVA 4N4SA 5L6WL 4Z16A 2UVZA 4J97A 3VN9A 2JGZA 1RW8A 4C4HA 4DH3A 5BX0A 5AWMA 5BMMA 3OXTA 3RP9A 4O0YA 3CGFA 3CC6A 3TV6A 2W1FA 2DYLA 4M67A 3T8OA 4RIXA 3W8LA 1WZYA 3RPRA 5JRQA 4LOPA 4RWIA 4ZY5A 3EQBA 2HK5A 2W1IA 2XCHA 4AGUA 3DBFA 1R39A 2VTRA 1OI9A 5JH6A 4JT3A 4GT5A 4ZP5A 2Y4IC 3ZUUA 4C57A 3LMIA 5DRBA 1WBVA 2Y7JA 4LMNA 2ITPA 4OT6A 5D41A 5HORA 2ITUA 4E6CA 4LOOA 4O96A 5HTIA 3FL4A 3P79A 4QTAA 1AQ1A 4U41A 5KHWA 1T45A 4HYSA 4CRSA 3A4PA 3NYOA 4L3LA 5FDXA 4OT5A 3QF9A 3TWJA 3KN5A 4LL5A 3FJQE 2C68A 2XNGA 3VW8A 3CTQA 2W5AA 3G9NA 4YJVA 2VZ6A 3DKGA 3OCTA 1PJKA 1SVGA 3AXWA 4D4VA 3QBNA 2GTMA 3UVQA 3EN4A 4LM5A 3I1AA 2GNFA 5KMMA 2OG8A 3PIYA 2G2FA 1I44A 5GJGA 3W18A 3O8PA 5EM6A 4AT4A 3P08A 4WRGA 4I5CA 3K3IA 2VWIA 5FXQA 5DT4A 4UMUA 4CEGA 2YCSA 4JDHA 2XIYA 2WTIA 3V5QA 3ORPA 4GYIA 3NGAA 4FTOA 4EKLA 3N4TA 4R7IA 5L2IA 3QCQA 3TZ8A 3EWHA 4NW6A 2BTSA 2IVUA 3VBQA 4B99A 3KXXA 3EQHA 5LCJA 4MXYA 1ZZ2A 3LXKA 3FLSA 4ITHA 3ZRMA 4FTKA 3ACKA 3U51A 4P5ZA 4LYNA 3IW5A 4J53A 2P2HA 1JLUE 2IVVA 2FSTX 2C6OA 2J90A 2JIVA 4FKWA 5CY3A 2B55A 1SVHA 4FIHA 4QNYA 4ZTLA 5GJDA 4MBJA 3TKHA 3VO3A 4B0GA 4EBWA 4IFGA 4OUCA 1U59A 4XMOA 4RIOA 3ZONA 4O7WA 5HCZA 1UNLA 3KFAA 3AQVA 4EEVA 5CYIA 3QAME 3PP1A 1NW1A 2F4JA 2HENA 2UZEA 3FXWA 3NYNA 2WMSA 5D7VA 3SX9A 4QMWA 5AUYA 3KL8A 4O27B 3R7OA 1J7IA 4FL1A 2UVYA 4QYFA 5EYMA 5JFVA 2PMOX 2ERZE 4AA4A 4CT2A 4H58A 3K54A 3H0ZA 3OT8A 3D15A 3R9RA 4IJ9A 4IZAA 2WMRA 2OJIA 2Y4PA 2OWBA 4QPMA 3BLHA 3BKBA 3FMDA 5LARA 3BLQA 2C30A 4J96A 4U79A 2X2LA 3Q6UA 1NY3A 5I9VA 5K5NA 5D7AA 3SG9A 2BAKA 4DTBA 4X3FB 1STCE 1OIYA 3F88A 2YIYA 3OCSA 5B2LA 5KBQA 3F2RA 1OB3A 4KA3A 5KBRA 2G9XA 1DI9A 3CTJA 2LGCA 5FXSA 4OTQA 2R5TA 2JIUA 4RIYA 3T9IA 3RCDA 4IVDA 4JI9A 3QQUA 2GNJA 2YHVA 2OBJA 4BRXA 4U81A 5E8YA 3BEAA 3UIXA 4I21A 3G90X 3BX5A 5B2KA 4JRVA 2VTOA 3OTVA 4FKTA 4YPDA 5E9EA 5HGIA 4BCOA 2V5QA 4FGBA 2BZJA 4C2WA 5JRSA 5M08A 4N6ZA 1SMHA 2JKOA 4FTCA 3IW4A 2F57A 1UKIA 3F5XA 2R3PA 4XBUA 3MVHA 1OPLA 2V22A 4RQKA 3EFJA 3SAYA 2E2BA 5DR6A 3DJ7A 4TT7A 4EHEA 3BWJA 4FKPA 3HMOA 1SNUA 4PL4A 3KY2A 2CKOA 4KKGA 4RJ5A 4IDTA 4M12A 2PSQA 2WMVA 3WE4A 3OEZA 1Q99A 1XO2B 4AE6A 1PMUA 3T3UA 4BDKA 5LMKC 3QD2B 4BCNA 3ZRLA 3KVWA 3MDYA 5HQ0A 2OH4A 4ONAA 5ETAA 3A8WA 5ITAA 4WG3A 4CFUA 3CBLA 2X7OA 4GYGA 1UKHA 3IW7A 4L43A 5H8BA 3VS2A 3LW0A 1Y91A 2VAGA 3OVVA 2C1BA 3QUDA 1J7UA 2YN8A 2A27A 3ZOSA 4AT3A 5M09A 2GFCA 3R1SA 1J91A 5E8UA 4TWOA 2VGOA 4HVHA 1JNKA 1PXOA 4FV5A 1KOBA 3E93A 1XH7A 4R3RA 3DBEA 5DEYA 2QO9A 2FH9A 3IG7A 3QQLA 2KTYA 3DT1A 1JAMA 4BWKA 4FODA 3PJCA 5JN2A 1IASA 1J3HA 4YC8A 2JITA 4O6EA 2ZYBA 3QYZA 4R3PA 2BILB 4CVAA 2W1GA 3ENHA 4RLLA 3R04A 2CHLA 4UWBA 4X2NA 4AZSA 4D4RA 4FKRA 3EKNA 4X7QA 4W8DA 1WCCA 4N70A 1KWPA 5ANGA 3D94A 3TNHA 3E8CA 2E9NA 4TZRA 3WF9A 5DNRA 1OITA 4WG5A 3V5JA 4ZIMA 2UZLA 1Q61A 3HZTA 2OO8X 3N4VA 2Z7SA 4E6DA 3QTQA 2UZBA 3I0QA 3PWYA 4FF8A 4IC7A 2BROA 5HLWA 3TJDA 2JDVA 2GPHA 2WMUA 1YHVA 3CJFA 3GCPA 3GU4A 1A06A 3MFUA 4FTQA 1YDTE 1F5QA 3I0OA 3BHHA 1LP4A 3K5VA 3PVWA 4JQEA 4X3FC 4TYHB 3IK3A 4JOAA 3HUBA 3OCBA 4YO6A 4BIDA 2HY0A 3QKMA 5DLSA 2VRXA 3R22A 1MRVA 3I7BA 1LPUA 1B6CB 5E92A 3FEGA 3REPA 1XBBA 2PYWA 1OBDA 2BIKB 2OZAB 5M4FA 3TIYA 2XM8A 4I0SA 4C58A 3OTUA 4UY9A 2PVMA 3EB0A 3TKUA 1MRYA 1CM8A 1RE8A 4G9RA 3EQIA 2CJMA 3AD4A 2X4FA 4G34A 4X3FA 5IMXA 2YM3A 2O65A 3O51A 2XKEA 4PTGA 5TO8A 4O7VA 3ZLSA 4DBXA 2YIQA 3DQXA 1FINA 1JKTA 4O0RA 4EOSA 3P7CA 4M0ZA 4AW1A 2CGVA 3OOMA 1JKSA 2GQGA 4IAIA 3TZ7A 4NTTA 4I5HA 5JQ5A 3PJ1A 2C4GA 4ACDA 2XYNA 1XH5A 3C1XA 4GV1A 2X1NA 3C9WA 2XKDA 4HYHA 4U5JA 5JKGA 3L9NA 3ORKA 3H10A 4MHAA 3KXNA 5LVNA 4DFBA 2UUEA 3G5DA 5HO8A 1ZY5A 4QTBA 5J5SA 2VO3A 3L9LA 4LQMA 3MH2A 3JY0A 4E5AX 4I6HA 3FI4A 4R1YA 1DAYA 3L8SA 5KMOA 3BQRA 4LGGA 3FYJX 2PUIA 4Z7GA 3GQLA 5HE1A 5FQDC 5AV0A 5EDPA 4EH5A 4LV8A 4YJSA 2BKKA 2UW3A 1OECA 4H3BA 2RGPA 1LR4A 4BDHA 4FT0A 4OBOA 2HZIA 3O2MA 4XOZA 3UIBA 3BRBA 3FSKA 2QLQA 4L7FA 4NKSA 5DT0A 1ZWSA 2GQSA 1OL6A 2E9VA 2GTNA 3OWJA 2FA2A 4RVKA 3U54A 1YXXA 2RFDA 5AP0A 5ANOA 4XH6A 4ZTHA 4MQ2A 3HA6A 3UO4A 1GIHA 2F7EE 3V5WA 3FBVA 2C0OA 3ZCLA 2EWAA 1P2AA 3GU7A 3K3JA 4FV7A 4FV0A 3ET7A 4A07A 3C50A 3SA0A 3CPBA 2CLQA 1O9UA 2IJMA 3POOA 4IH8A 1CKPA 3SRVA 4HGLA 4KS7A 2IZSA 1OIRA 4CLIA 3DBDA 3DBCA 4BDJA 5IQGA 4XUFA 4J8NA 3ZLWA 2BIYA 4IM0A 4XG3A 2ITNA 3LXNA 4KINA 3RK9A 1PMNA 1OZ1A 2YJSA 5AUUA 1ZYDA 2VO6A 4QMYA 3IW6A 4FBXA 2NPQA 1B38A 3DAJA 3DFAA 2BR1A 2VWWA 3LVPA 4FG8A 4OTFA 5K3YA 3R9OA 4O7YA 3VBTA 4CLJA 3KULA 3O7LD 3UC4A 4BTMA 1O6YA 2I0YA 4K18A 3TUCA 5IUIA 2GCDA 1FQ1B 4JQ8A 3KREA 2QKRA 5CT0A 3QQKA 2RKUA 5J5TA 2GQRA 1PKDA 4U44A 2AYPA 4K2RA 4BL1A 2I7QA 4MVFA 1XH9A 2HYYA 4BBMA 4WOVA 4K0YA 4U40A 5IF1A 3PLAE 3W2RA 4FC0A 3D2IA 4QP4A 1BMKA 2BHHA 3Q04A 4ZJJA 4RX5A 2BRHA 4ALWA 3F7ZA 4XG6A 3ORMA 4G6OA 2ZM1A 3WARA 4NUSA 5CXHA 2ZDUA 4ENYA 5CAPA 3KF4A 4UMQA 4V0GA 2XVDA 3P0MA 2QCSA 3MWUA 3IONA 4JDIA 3ZO2A 4EH7A 4ANOA 5AUZA 4ANMA 1ZYJA 3NNVA 3FV8A 2UZVA 3ZZEA 2NNWB 2FYSA 3WYYA 4D2TA 2X6DA 3A2CA 4NM0A 2W06A 2C3LA 5EQEA 4FZDB 3QXOA 4DGLC 5K4IA 1H1WA 3LFBA 1Q8UA 5E1SA 4QQTA 2B7AA 3NZ0A 3WF6A 2XJ0A 3AC3A 5HVJA 3QHRA 4P90A 4GUBA 4XJ0A 5CAUA 2R3GA 3V8TA 2HIWA 1K3AA 2JFLA 1KE8A 3ULIA 4DE4A 5CNNA 4AS0A 3ZRKA 4EI4A 2CSNA 4C4GA 3VQUA 1FGKA 4U0IA 4RA5A 4D55A 3W2SA 2ZV2A 2BZIB 4IIRA 3P7BA 3LXLA 2P55A 3KRWA 4WSYA 5KCVA 4TYGA 4D9TA 2W5BA 4BGGA 1E9HA 1TQMA 5FBNC 4A9UA 2XKCA 3Q3BA 5LVMA 3DA6A 3R21A 4TNDA 3IGOA 3UYSA 3QA0A 5GIOE 4I24A 3WZJA 2EUFB 3QQJA 2XBAA 3ORXA 3F3VA 4L53A 4YZNA 1UWJA 5KKRC 3UVRA 3N4UA 4IX6A 3R63A 2OJ9A 3TKIA 4XLVA 1J1BA 3U6JA 3OWPA 3VUKA 2WQBA 3PXKA 4FMQA 5IUGA 1JWHA 4I0TA 3U6IA 4QMLA 1AD5A 4EOJA 1H8FA 3A62A 4JBOA 3TZ9A 2Y4IB 3UP2A 3MVMA 1H0WA 4ITJA 3QQHA 4EC8A 3PVBA 4GW8A 4UN0C 5IEYA 5HICA 3BHYA 4UXQA 5JZNA 3R71A 2VWXA 4QMOA 3MIAA 4BDDA 4K33A 3H9RA 1H25A 4IHPA 4OGRA 4RPVA 4JX3A 2J4ZA 4EK3A 3BGZA 5CNOA 3OMVA 5IZFA 3S4QA 5M07A 4NU1A 4AFEA 2AUHA 3HRCA 4AZVA 3F3WA 3W10A 3Q52A 4UMRA 4Q9SA 4LI5A 3KRXA 4NJ3A 4EQCA 5AP7A 2ZVAA 2P3GX 2FSLX 1YXSA 4IFCA 3CY2A 2OH0E 4I6BA 2OFUA 4DYMA 5C4KA 4CNHA 1GOLA 1ZAOA 3P5KA 2FO0A 3FKNA 5EI2A 4F99A 3V6RA 5KUPA 5IQDA 2CPKE 5FLFA 5CLPA 5T3QA 4OTDA 1IAHA 3E8NA 3VRYA 3FZ1A 4BB4A 3EL7A 4WA9A 4R8QA 4H05A 5L4QA 5IQAA 2QHNA 4C38A 4F7NA 3QTSA 2P4IA 4FR4A 4H1JA 2BDFA 2J9MA 4IB0A 1QPJA 2XK8A 4FIJA 4E3CA 4IC8A 3RHXA 1HCKA 4CMTA 4F4PA 3D5XA 2QOBA 4EWQA 5H2UA 5EKNA 3RAIA 3JVSA 4YR8A 3P9JA 4KIKA 3PA5A 5L8LA 3E88A 3OWLA 4KBAA 1KV1A 4OLIA 4EHVA 1YWRA 5EQPA 5AFVA 5B0XA 1U5RA 4B8MA 1KE7A 4GL9A 2ITTA 2WNTA 4GIHA 3SW4A 4D2VA 2X8DA 2C6KA 4BBEA 1FGIA 4A9RA 4C0TA 3R0TA 4CXAA 5M4UA 1Q8WA 4ALUA 1X8BA 3WYXA 1H1SA 2WOTA 3VC4A 3S0OA 3NCZA 4Q5HA 1ZZLA 3V8WA 4DLIA 3R01A 4FSNA 4RFMA 5HG7A 4AZWA 2DQ7X 1OM1A 5HNIX 1PY5A 2W05A 3CEKA 4RX9A 2XMYA 4E26A 3B2WA 5I3OA 4I22A 5EOLA 2XNMA 2NP8A 4QMTA 3UVPA 2XK4A 1E1XA 2PK9A 4YHFA 4C4FA 4BDAA 3JS2A 5DH3A 1R1WA 2B9FA 4FTUA 4CFWA 4CZTA 3GGFA 1ZOHA 4XOYA 2Y6OA 3F61A 5LCKA 5AJQA 3QX4A 3AC5A 4YZCA 5F1ZA 3Q5ZA 1WBTA 2IZUA 4G17A 2F2CB 1M52A 3BGPA 1JPAA 3R02A 2C3IB 5HE0A 3QTIA 4ASXA 5AX3A 5EW3A 4W4WA 1OKYA 4TYHA 3MY1A 2WQMA 4DH1A 3RINA 2AC3A 3HRFA 3RZFA 3C4FA 1OIUA 4F9WA 2I1MA 3EZVA 5IDPA 5KO1A 3JUHA 5M55A 5L6PA 1PYEA 4CFVA 3EQPA 4NCTA 4EK4A 4EYMA 2GHGA 4Z9LA 3LFAA 1BL6A 5KHXA 1J7LA 3HAVA 2PVFA 3BGQA 5ETFA 4EH8A 5AA8A 3IDPA 4BHZA 3GU5A 3Q5IA 4FSRA 3DK7A 2C6EA 2W9FB 3OUNB 4G9CA 4LOQA 3TTJA 4D2SA 1UNHA 3CD3A 4JQ7A 3UOKA 1SZMA 2YZLA 3HX4A 4KD1A 4J7BA 5D9HA 2WZJA 1FVTA 4EJNA 5CS6A 3KQ7A 2QLUA 5EG3A 2C5VA 4UB7A 3BHTA 5C9CA 3C4XA 2C5YA 3EQCA 3FWQA 4MXOA 4QTDA 5EI8A 1PW2A 5AP3A 3UYTA 2YA9A 1OGUA 3BHUA 3F66A 5JGBA 3NNXA 3PPZA 3U4WA 3D5VA 4R3CA 4MNFA 4AT5A 2PUPA 3OOGA 4ZMEA 4TL0A 4FNYA 4TW9A 4BR3A 4FOBA 2Z02A 2JLDA 3LFNA 4U3YA 1Q8YA 4G6NA 5DOSA 4D58A 1G8SA 4EH9A 3FMLA 1G8AA 1W82A 4L44A 3SXRA 4FA2A 5ETCA 3TT0A 3ANQA 4X2FA 5AV4A 2XNPA 3M11A 4Q5EA 5IEVA 3D14A 5J9LA 1Y6BA 3QWJA 1OBGA 4Q9ZA 4O84A 3L8PA 1FBNA 2WMTA 5DE2A 5HBJA 5CSHA 1SYKA 3CGOA 4RIWA 5F94A 2UVXA 2C3JA 2ITYA 3GOKA 4MWHA 2B52A 4I93A 2GHMA 4E5WA 2VTHA 4IAFA 5AP2A 4BZNA 3F2NA 4C02A 1LEZA 4FKQA 4DFYA 5FXRA 3E62A 2IW9A 4E4MA 3R9NA 2WEVA 1G5SA 1TQPA 3LFSA 2CKQA 2WIPA 2A4LA 2R3IA 4FEXA 3DLZA 4IM3A 4RX7A 2YIWA 4ZSLA 3OF0A 1QPCA 4M68A 5CEKA 4RWKA 3EN5A 3MFTA 3U9NA 4ZLOA 3TN8A 2YM6A 3MPAA 2ETKA 2XNOA 3HMNA 4G3CA 5BVEA 4F6UA 1UU3A 1ZARA 4JG7A 3FDNA 3FZPA 5HVKA 4V0GB 1K9AA 4E73A 2XIRA 3VF9A 5C01A 2HWPA 4RC2A 4D4YA 1NVSA 3W2PA 2J0JA 2VUWA 4NIFA 5FWKK 3VRZA 3MY0A 4FV4A 1WBNA 3PYYA 4YBJA 5A9UA 3A99A 4WSQA 4AA0A 3ZFXA 2GMXA 4DEBA 3BBWA 4FEWA 2IPXA 4DEHA 3IDCA 2PVYA 3KXHA 5A4LA 3W1FA 4GFOA 3DJ5A 2WO6A 1OMWA 2WMQA 2HW6A 4XP2A 2CN5A 2OZAA 3VUIA 2BRGA 4PQNA 3GCVA 5E1EA 4B4LA 3Q96A 2HELA 3LCDA 4IADA 3UDBA 5AR7A 3TNQB 2W1HA 1ZMVA 4FUXA 4D2RA 2Z60A 5AUXA 3KULB 1QCFA 4DH8A 3LM0A 3DU8A 4O6LA 4HNFA 5FP6A 3N9XA 3ZO3A 4LL0A 3LFEA 4YZMA 1VZOA 3LAUA 2VTLA 3SG8A 2EB2A 1W98A 3VF8A 5AA9A 4WHZA 3TZMA 3D83A 3ETAA 4H3PA 1M17A 1UV5A 3LHJA 4FTNA 5CI7A 4PNKA 1NVRA 1HOWA 1EH4A 3Q60A 4B9DA 5HKMA 5A6OA 3FAAA 4ZK5A 3H9FA 3QD4A 4XX9A 4EOKA 3RAHA 3NAXA 3QCSA 5ETIA 3RK7A 4YJTA 4FL2A 2RSVA 3BE9A 3Q9XA 2JKKA 3KVXA 3QUPA 4IWOA 5EW8A 5HOAA 3AMAA 3ZTXA 4GVJA 3FLQA 2HWOA 2QHMA 3PVGA 4K77A 4XRLA 4EH3A 2VN9A 4F9BA 2KULA 3PWDA 3CJGA 5HHWA 4UMPA 2C69A 2ZMCA 3I6WA 2OI4X 2VO0A 4FKVA 4KBCA 4EZ5A 4LUEA 3EOCA 3GB2A 1URCA 4A9TA 1WVYA 5LWMA 3PSDA 3V01A 5HG8A 3FI3A 4JIKA 2W4KA 4BYIA 4DINA 2PL0A 5DI1A 3NDMA 4GEOA 4OTIA 4V05A 3UIMA 3UOLA 2YM4A 3ROCA 3TG1A 3ZBFA 3TNPC 4PMMA 2XK7A 2CCHA 2R3FA 4D1SA 5IA1A 2GS7A 3LQ5A 5KX8A 2QKWB 2W1ZA 4ZMFA 1OUYA 5EK7A 4TYIA 2C47A 3FLWA 3MB7A 4TYEA 4FK6A 4ITIA 2VWUA 5BNJA 1YWVA 2YIXA 3MH0A 4I1ZA 1Q3WA 3CTHA 3MJ1A 4FSQA 4GG7A 4FZ7A 4KIOA 4MNEA 2X39A 5K0KA 3B8RA 3F3TA 5AR4A 3ZFYA 5KKRB 1B39A 1SVEA 4PMSA 5FM3A 1OL1A 5DYJA 2YJRA 3MH1A 3QTRA 3H30A 4EOIA 2XKFA 5CI6A 3NSZA 2O3PA 3S00A 5EI6A 2Z8CA 2WGJA 3O0GA 4MNEB 4X0MA 4CZUA 1H4LA 2R0UA 5GZ9A 2F7ZE 3MW1A 4ZLYA 3WIGA 4NZWB 1YXUA 4A4LA 2O2UA 2B9HA 4ORKA 4BZDA 4GFMA 2PVHA 3HEGA 3R8VA 3ORIA 3DKFA 2C5XA 1TKIA 3KXMA 2RIOA 1Q41A 3QTUA 2P0CA 3A61A 4QNAA 4D2WA 4LRMA 2X8IA 1PYXA 2UW5A 1TVOA 3CKXA 3PE1A 5EDRA 4ZZOA 3LM5A 3QLGA 4MBIA 4E1ZA 4TWNA 2JBOA 5BUJA 3WILA 3ERKA 3R8MA 3W2OA 4JBQA 4O91A 4IWPA 3HMPA 3PVUA 1PXNA 1R0EA 2J0KA 4PTCA 4QMVA 4UZDA 5G1XA 3ZHPC 2OLCA 2O5KA 3JXWA 4FI1A 5CSVA 5CSXA 4O7TA 3DXQA 2GNLA 4ASZA 3NYVA 2VX1A 2XUUA 3WF5A 5HG9A 2VWBA 4KRCA 3HUCA 4YTFA 1UVRA 4I6FA 3FXXA 3KRRA 4XLIA 4U42A 4FSUA 3LCTA 3D4QA 3RAWA 2PZ5A 5K4JA 4ZOGA 5D11A 5KZIA 5A4EA 1Q97A 1WBPA 4O22A 4YJUA 4F09A 4AA5A 1OKZA 3EQFA 2XBJA 2OU7A 5CU4A 1DI8A 5JFSA 1P4OA 2BALA 3S3IA 2OSCA 2BAJA 2QOQA 4YJOA 2J5EA 3QZHA 4GK4A 2IVTA 5FEDA 2R3KA 3MIYA 4HZRA 4JNWA 4JS8A 4W8EA 1PKGA 2X7GA 2J2IB 4FV2A 4GJ2A 2YWPA 4HJOA 3DQWA 4DGGA 4IZ7A 5M53A 1IG1A 3UBDA 4EH2A 4FIIA 3VS5A 5C03A 2WU7A 2ZV9A 4FV1A 4Q2AA 4FICA 5CZHA 3AMYA 3NWWA 3U8WA 5CZIA 3ZYAA 4AU8A 5CVGA 3VHEA 4FIGA 4W4YA 4IZ5A 3KMWA 3EFKA 3DAEA 1ATPE 2W1DA 4FTIA 4E4XA 3C51A 3R1YA 4PUZA 4GK2A 4DCEA 4C2VA 4O7NA 4BFMA 3O50A 2BMCA 1W83A 3OP5A 2QOCA 2Y0AA 3RPYA 4ZAUA 2J0IA 4MKCA 5LOHA 4GSBA 2PZYA 4V01A 3GFWA 2WTWA 4YTIA 1V0BA 4L3PA 4IVAA 3R7UA 3KGAA 4DC2A 3C13A 2J0LA 3MA3A 3NUYA 3OW3A 4KAOA 2GSFA 2YISA 2J0MB 4O21A 4GCJA 3GOPA 3OXZA 1JKKA 5JFWA 4ANQA 5HD4A 2H9VA 5IUHA 3QFVA 3MTFA 3BYOA 5AR3A 2G01A 3FC2A 2FSOX 4GT4A 4U97A 4QMXA 4WIHA 2PUUA 3JPVA 5L8KA 3PIXA 4WNKA 5D1JA 5DVRA 3VW6A 5IU2A 1DS5A 3BBTB 4CFXA 4FV9A 4FG9A 2IVSA 4ZY4A 2YZAA 3FMNA 3PPJA 5I4NA 3UPZA 4ZSJA 2DUVA 4HYIA 4BKZA 3WE8A 5L2WA 4IAYA 4S2ZA 3O7LB 4MD8E 4BY9E 4YP8A 4O7LA 3W8QA 4D4SA 4FZFB 3ALNA 5FGKA 2CKEA 3GCQA 3V5TA 4HVIA 4FOCA 4YGAA 5D12A 3GP0A 4BCFA 2XM9A 4TTHB 4ACCA 2R3MA 3AMBA 3HECA 3EL8A 1OIQA 3HVCA 3LJ1A 4MEDA 4RWLA 5I0BA 1YQJA 2JD5A 4YMJA 4D5HA 1CKJA 3B8QA 2WD1A 1YOMA 2X8EA 3ZM9A 2X9EA 2DS1A 4MTAA 5AUWA 4CG8A 1ZMUA 2VTPA 5GINE 3JY9A 3Q4ZA 3PE2A 1QMZA 2IZTA 2OXDA 3FMKA 4FNZA 4OTWA 4DEDA 3NCGA 2IG7A 4IANA 4ZZNA 3WZKA 1GY3A 4F9AA 5GZ8A 4IX3A 4MCVA 5LMKA 5EYKA 2VTQA 2YACA 3QL8A 4ASEA 1RJBA 3A7GA 3R7YA 5J1WA 3CPCA 4M0YA 3VHKA 4RIWB 3D7TB 3DS6A 4QMUA 5CVHA 4C4EA 4K11A 1H08A 2WELA 4M97A 4JDKA 3MA6A 3R1QA 4FVRA 2PZRA 3KMMA 3HRBA 1BKXA 5DR2A 3ZO4A 4W4XA 3KK8A 4O0WA 4BI0A 2JBPA 5HU3A 1HCLA 5L2SA 3GU8A 3ZO1A 3FLYA 4K8AA 3HNGA 3ITZA 4Z7HA 4X3JA 3DJ6A 5HX6A 4APCA 1ZXEA 4KRDA 5AUVA 2WTJA 4FL3A 2IN6A 5AR5A 4BTKA 2BPMA 3Q2JA 3QTXA 1PRYA 5IQHA 2YITA 4D1ZA 4UWCA 3NRMA 4RJ7A 1O6LA 3R7GA 3DDQA 2XNEA 3DXNA 5I9YA 3BELA 3S1HA 4GU9A 4RFZA 2VTJA 4WNPA 2YABA 2R7BA 5EHLA 4FKSA 4DA5A 5IH4A 4PDOA 3F69A 2X7FA 3RKBA 5L2TA 4IVBA 3D0EA 4BHNA 3E8DA 5DPVA 4JVGA 5A4CA 3E64A 2ACXA 3ZUTA 1BUHA 3LCOA 4CCUA 5J9ZA 4EQMA 3JVRA 4CCBA 5ACBC 1Z57A 2XK9A 5BVWA 2LAVA 5FDPA 4YLLA 4R1VA 4F63A 5HG5A 5L6OA 4QQJA 5E8ZA 3QWKA 4JG6A 3RPSA 2R3NA 2I40A 5BVDA 4FTAA 4C8BA 3MSSA 1O6KA 2WMAA 3HP5A 2JEDA 4OBPA 3LFFA 4RBLA 3VS7A 3OFMA 2PZIA 3ZDIA 4O7RA 3SLSA 4YJQA 4M84A 4S34A 3FY2A 3EN7A 4PDPA 2XF0A 3EFLA 4DFLA 5BYLA 2WTCA 4LFIA 3OUKA 2F7XE 4D1XA 4Y5HA 5AV3A 1W7HA 3M1SA 3M42A 3ORLA 2J6MA 2OK1A 4K9YA 2GNGA 2VTSA 4BCHA 3PA3A 4RLKA 4ZTRA 5BVNA 4XEYA 3UMXA 2ITWA 3GXLA 4AGWA 5BMSA 4CMOA 1KOAA 4BN1A 1M2PA 5CTPA 3OW4A 4WUAA 3EYGA 5H8GA 2Q0BA 4QT1A 3AC1A 3MY5A 3DPKA 4XG8A 4USEA 5IH6A 1JKLA 1XH4A 3P23A 4RC3A 4IBMA 3RM6A 4MAOA 4A4OA 4AOIA 4L00A 4MWIA 4IDVA 4J95A 4U9AA 1A9UA 4U8ZA 3GVUA 4YZBA 2AC5A 3G6HA 4BC6A 2CCIA 2RF9A 2CNVA 2R3LA 1BLXA 3AC4A 4O0TA 3SD0A 4QP8A 4NEUA 1IEPA 2HXQA 4U3ZA 4KUJA 2UZTA 5J7HA 1RQQA 4YBKA 2QQ7A 3QCXA 4JXFA 4NW5A 1IR3A 4LG4A 4ZJVA 4BCPA 3I6UA 3GC7A 3TL8A 4J98A 4MXAA 1OL2A 3K2LA 5B2MA 2R3RA 3EZRA 3EHAA 3F7WA 3MGYA 2BRMA 2WKMA 3CS9A 3QZFA 3A8XA 2XZSA 3R30A 4RJ4A 4AW0A 2BKZA 4ID7A 2Q83A 3KCFA 4Y95A 3IO7A 4QYEA 2ZV7A 4PWNA 3S95A 4LGDA 4KIPA 4XG4A 3QALE 5EFQA 3ULZA 5M51A 4MQ1A 1RDQE 5AM6A 4M69B 1U5QA 2QOKA 2R64A 3RJCA 3FMHA 2I0EA 3CCNA 2O0UA 4I3ZA 3DCVA 1JSTA 2VTNA 3LJ0A 3R8LA 2QOIA 5C4LA 4AQCA 5FTOA 1UNGA 3HGKA 1M7QA 1OVEA 2QODA 4AXAA 2GS2A 3LFCA 1PF8A 2QO7A 2XCKA 4YJRA 3VIDA 2R2PA 3AD5A 3MH3A 4IM2A 5FEQA 2QONA 5GNKA 1J1CA 4QYGA 4LV5A 4AN9A 3F3UA 2QD9A 4IE9A 2NO3A 2QC6A 3KRJA 4USDA 4RZWA 5HBHA 1H26A 3IS5A 3BCEA 4JRNA 3Q32A 3LMGA 4OTPA 3QKLA 4FEUA 5BYZA 3RCJA 2WMBA 4P2KA 4RVLA 3RI1A 3ZLXA 3W55A 3VS3A 1XHAA 2VWZA 1GIIA 3EMGA 2WMXA 4MH7A 4QO9A 5LMAA 2OXYA 3VVHA 4CTCA 5HCYA 3E3PA 2PZPA 5LXMA 1ZMWA 1GZKA 2BHEA 1SM2A 2CGXA 3AC8A 4QP7A 1JVPP 2ONLA 2ZAZA 4BTJA 4WNOA 3CXWA 4AW5A 3BYUA 4LRKA 3EJ1A 4J99A 4MXZA 4KWPA 3KC3A 1WBOA 4F6WA 5K0XA 3FZRA 1XH8A 5JGAA 3EN9A 3OROA 4KSQA 3PFQA 2JAVA 4YHTA 4WRSA 5ANIA 4K6ZA 3F5GA 1MRUA 3SRVB 3WOWA 4IAKA 5EOBA 3K5UA 4F6SA 4EC9A 3F6XA 4BWPA 5HIDA 3I5NA 2I0VA 4PNIA 5E8WA 1PXMA 5LWNA 2PMIA 1PMVA 4XP3A 5DT3A 5BPYA 3LLAA 3UPXA 2OKRA 4XRJA 4WBOA 4RJ8A 3PPKA 4UV0A 1YHWA 3OCGA 4NYEA 3DOGA 3E7OA 3PY1A 3OT3A 1FOTA 4NTSA 3FQSA 5DG5A 4YC6A 1BI7A 1PXLA 4YURA 4H39A 4E5BA 3BU3A 4DCAA 2HZ4A 3LLTA 2W17A 1GNGA 1GZNA 4BCIA 2OGVA 3SQQA 3VS0A 5IPJA 4AW2A 4BKYA 3QUEA 5G6VA 4M13A 4MX9A 4AX8A 4O0VA 1APME 1GZOA 4BTFA 2XS0A 3C5UA 4X2JA 4CMUA 5CALA 3HAMA 3EQGA 2E9PA 4QP6A 1DM2A 4IW0A 1ZYLA 1TQIA 1FVRA 3P4KA 5DIAA 2JIIA 2YAAA 2OJFE 4KB8A 3UC3A 1H0VA 1S9JA 3PXQA 4ZEGA 2UZOA 3R8PA 4CFNA 4DGOA 4KS8A 2YM7A 3LE6A 5J8IA 3QGWA 3TCPA 1H27A 4LUDA 2BZHB 3VBXA 5T68A 4QMSA 5M44A 4O2PA 2C6IA 5FM2A 3PXFA 3Q2MA 4TKSA 2UW6A 2RG5A 4BDFA 3FYKX 3EN6A 2GDOA 1GAGA 3KXZA 3HKOA 4QP3A 3TUBA 5CEMA 3PJ3A 5HTCA 3TXOA 5K9IA 2WTKC 3IGGA 3DZOA 3HL7A 4X6QC 4D0XA 3QD3A 5AAGA 5KMNA 3A7IA 4L67A 1KE5A 2G2HA 5EW9A 4IJPA 3IOPA 4APPA 3UODA 4Y8DA 4BI2A 2JDOA 4KBKA 4C59A 4F7JA 5CEOA 1PMEA 3G6GA 3DGKA 5H8EA 4QP9A 1XH6A 2YCRA 4EUTA 4ZS4A 2ITZA 2YCFA 1YI6A 1ZRZA 2JFMA 3GCUA 4FZAB 4HGSA 3ZH8A 5CSPA 5HEZA 4PX6A 5HIEA 4R78A 4QP1A 2VWYA 5TT7A 1OPJA 3VQHA 1UWHA 3E3BX 3L9MA 2RG6A 3C0HA 3GFEA 4IAAA 3KXGA 4IQ6A 4S32A 4DTAA 3V5LA 2REIA 3FY0A 2QU5A 2B9IA 3MYGA 5KE0A 2OW3A 5AAFA 1QPDA 3OS3A 3RHKA 5L3AA 3NMUF 5K5XA 3WIKA 4PP7A 5IQIA 2VNWA 3V5PA 4M7IA 3C4CA 4L7SA 4NCTC 4NT4A 1M7NA 1Q3DA 3GC8A 4QPAA 5AAEA 3PZHA 3SKCA 4IZYA 5HCXA 4Y73A 4YU2A 3VWAA 5DWRA 4BGHA 4DG0E 1P14A 4P4CA 4FT9A 3PTGA 5M4IA 4EHZA 3F3ZA 5HE2A 5IQEA 2JDTA 4Y83A 4D28A 4O7ZA 4F70A 2EVAA 3PSCA 3PP0A 1P5EA 3T9TA 1IAJA 3ZUVA 3QYWA 2QOFA 3TUDA 2PY3A 4FV8A 2QURA 4G31A 5LVOA 2EU9A 3D7TA 3F82A 4XG7A 5A3XA 4DEGA 2PU8A 1YI3A 3EH9A 4XV3A 3PG1A 1AGWA 2HCKA 4G16A 2VTMA 2GNIA 5ACKA 3VUTA 5IA3A 4AZTA 4O83A 3KK9A 4ZLZA 2H96A 4OAVB 3TTIA 5BUEA 5DMZA 1IA9A 2P33A 4O7SA 2XP2A 3ELJA 3FC1X 4Y5QA 3UNKA 3LQ8A 2A2AA 3LFQA 4F7SA 4S30A 4H1MA 4HNIA 4DGNA 4IVCA 4QMPA 4O1OA 5IG1A 5CASA 4QMMA 5LVPA 5C8KA 3CD8A 4Z3VA 4YJNA 3QA8A 3C4ZA 3ENMA 1T46A 4IB5A 4EBVA 2OICA 3UZPA 3FQEA 1WVWA 3O96A 1JSUA 2V7OA 3POZA 2BFYA 2W7XA 4Y85A 5FEEA 2VGPA 1VR2A 2JAMA 3SOAA 4ANLA 5BVOA 5KNJA 4FEQA 1OKWA 3MVJA 2VTTA 3AOXA 3D9VA 3R9DA 4BDGA 3DXPA 4GG5A 4EHGA 2JKMA 5AP4A 3LXPA 2IZRA 1FVVA 4C7TA 3RAKA 3VBYA 5IMEA 3ACJA 2UW8A 3CIKA 3GBZA 4X2GA 3VBVA 4ACMA 1ZOGA 4BGQA 1Q8TA 4D5KA 3EYHA 4CFFA 2IWIA 4LGHA 4ZSGA 2XJ1A 4O2ZA 4DN5A 1U54B 2BRBA 5CAQA 4J71A 3W16A 3BU5A 5EM7A 2ITOA 4C3FA 5A6NA 4Z55A 5CXZA 2VV9A 3PRIA 4RC4A 5TR6A 4ENXA 4OAUC 2RL5A 4E4NA 4YZ9A 2PE2A 3CQWA 5HZNA 3GEQA 2IW8A 1PHKA 2FVDA 3H4JA 4O38A 4C4IA 5TF9A 3GCSA 4G1WA 3Q6WA 5JMSA 5CEQA 5CEPA 3FI2A 1YKRA 3BWFA 4J8MA 4G2FA 3PIZA 4FIFA 3LKMA 4DG2E 3QC4A 2UW9A 2UW0A 5ICPA 3PXYA 3VUDA 3FKOA 4MXCA 4HGTA 5LMBA 4RX8A 4FTTA 3SV0A 3CR0A 2BCJA 1Y6AA 3QGYA 3SW7A 1W84A 4O0UA 5BVFA 4UALA 4TNBA 5KMJA 2PMLX 3U6HA 5FP5A 3BV2A 4W4VA 1BI8A 2YDJA 4RVMA 3ZSIA 2WQNA 3RK5A 3R7VA 2CNUA 4FEVA 3UOHA 4JIAA 4I23A 5JSMA 3C5IA 5CU6A 4XS2A 4I5MA 2YEXA 1Q5KA 2B4SB 2QI8A 2UZUE 3BYSA 4L42A 4QYHA 4FVPA 4EL9A 3O8UA 2PE1A 3L9PA 2O8YA 4MF0A 3D7ZA 4NWMA 5F4NA 5H3QA 4C3RA 3QLFA 4TWPA 5TE0A 3NVKI 4RFYA 2ZM4A 5DEWA 5IDNA 1NA7A 3MPMA 4D2PA 4HOKA 2J51A 4HCUA 5FBOA 3DK3A 3DDPA 4M69A 1QL6A 1I09A 3Q9WA 4RMZA 2EXCX 4F1OA 1YVJA 4WD5A 3NNUA 4L68A 4WG4A 3I79A 4HVDA 3FHRA 4E6QA 4EZ7A 3PXRA 1H28A 4C36A 5JT2A 4DFXE 4EK8A 2BZKB 2PE0A 4XV9A 5ANJA 3GC9A 1XQZA 4L01A 4ZTMA 2FB8A 4ZJIA 4U45A 2XB7A 3V6SA 2BVAA 3SHEA 3ZMMA 3EQRA 1YRPA 2OIDA 3G33A 3IPHA 4PV0A 1LUFA 3SDJA 2VX3A 5EHOA 4MD9E 4RRVA 3QC9A 4HW7A 5CF8A 4NSTA 3NUSA 4OTGA 5HLPA 3UMWA 3VBWA 1V0OA 2NRUA 4AGCA 4C34A 4I5PA 2I0HA 4DEEA 2VNYA 5ANEA 3JYAA 4E93A 4F9YA 3ORZA 4C35A 3U9CA 3KMUA 2A0CX 2HZ0A 1Z5MA 4YLKA 1FPUA 2UW7A 3HMIA 3UO6A 3NUNA 5J9YA 2PVJA 4FGRA 4IB3A 2VX0A 5DN3A 3W32A 5J95A 4FNXA 2ITVA 4YSMA 3HV3A 2W96B 3FSFA 3O8TA 1VJYA 2YIRA 3FLZA 3GI3A 3NPCA 3R2YA 4RVTA 2X81A 5CQWA 3AT4A 3GU6A 4AFJA 4F9CA 1U46A 4PMTA 2IW6A 2XIXA 4Y46A 3R8UA 3R8ZA 3P7AA 5B7VA 3UQFA 5HNBA 4BCJA 3DNDA 3FZSA 2VO7A 4D9UA 2CGWA 5I5ZA 4R6VA 1Y57A 3FMEA 2WHBA 5FUTA 2R3OA 1UU8A 3FKLA 2WIHA 4M3QA 4HPTE 1BYGA 5CF6A 3CLYA 5DR9A 4BWXA 4UZHA 5CU0A 3ZSGA 1MP8A 3RGFA 3PY3A 4UX9A 3FMMA 1YDRE 3QRIA 4FKIA 4P7EA 2WQOA 4GH2A 4KABA 5GHVA 3TV7A 5L2QA 3VAPA 5H9BA 2C1AA 2WTDA 3NW7A 4IXPA 3TNIA 3SC1A 3UNJA 5C8NA 3QZIA 1V1KA 5I3RA 1K2PA 2V55A 5ANDA 4PL5A 1YOJA 2XJ2A 3BU6A 4FE2A 1UU9A 1V0PA 4FVQA 5E8SA 3D5UA 4IX5A 5EH0A 4U7ZA 4RA4A 1H1RA 4R7HA 4E6AA 2X0GA 3NW6A 4C4JA 2XRWA 4YUQA 4DFUA 2WMWA 4IAZA 2W99B 4OTRA 2QO2A 4QOXA 4A9SA 4C3PA 3HMMA 3FMJA 3ROYA 5IQFA 2RFEA 3ODYX 4DTKA 1ZY4A 3ZM4A 1YHSA 4BBFA 2W5HA 4HVSA 5IA0A 1YDSE 2ZV8A 3HV5A 3BEGA 3KN6A 5TOZA 3CQUA 5AMNA 3GC0A 3QKKA 4NIFB 2A1AB 3UG2A 3NR9A 1XWSA 3O23A 4R7BA 4TN6A 1Y8YA 2W4OA 4RG0A 2PTKA 4AACA 1E1VA 1URWA 5AR8A 3R6XA 3BIZA 1IA8A 2R3JA 4PPAA 4DT9A 3A7FA 4AG8A 1Q8ZA 4FUYA 2C0TA 5HX8A 3L8XA 2PUNA 1YXTA 4YC3A 4F0IA 1F0QA 2R9SA 3NLBA 5I9UA 4ANBA 2Z7RA 2OIBA 3OY1A 4ERKA 2WOUA 1NXKA 4HCVA 1M2QA 4UWYA 3LMHA 2OIQA 2OZOA 1CMKE 2RFSA 1CSNA 3ZLYA 3UZRA 5E7RA 2QU6A 3MB6A 2E9UA 3DY7A 2BUJA 1PXJA 3NUAA 3WBLA 1YI4A 2YM8A 4W9WA 2F2UA 3LJ2A 4AWIA 1JBPE 4L46A 4DH7A 4DH5A 3OG7A 2JC6A 4F08A 3I60A 4DAWA 4YNOA 4MD7E 4ANSA 4TWCA 4BYJA 2B54A 1WFCA 3SXFA 3RM7A 2X4ZA 4TXCA 2UV2A 2ESMA 4JAJA 4EH4A 1MUOA 5JGDA 5E8TA 1A48A 3E63A 4TPTA 4JR7A 4ZTNA 4B7TA 2B0QA 2XYUA 2QVSE 2NRYA 3E5AA 4XCUA 4Y72A 3U87A 2BFXA 4QMNA 5A14A 4USFA 4EZ3A 1XBCA 3FZTA 4F7LA 3DV3A 4PL3A 3A7JA 3KRLA 3WF8A 5HI2A 4ZZMA 4ACHA 4OW8A 2I6LA 2WB8A 3F5PA 2YM5A 4IMYA 4MF1A 4BKJA 4C33A 3PZEA 2PPQA 3I4BA 4FZ6A 4NKAA 4YHJA 1GIJA 2BRNA 3G0FA 4O0XA 4II5A 2A19B 4TYJA 4WNMA 2F49A 3R9HA 4XBRA 2WU6A 5CF5A 2ETRA 2OFVA 5J1VA 5CX9A 4FT7A 5BYYA 3ZFMA 3C7QA 5DA3A 4GK3A 4H36A 4YNEA 4UYNA 2XRUA 4KIQA 5E90A 1KE9A 4EWHA 4G3GA 1H01A 4UYAA 3GT8A 4GU6A 4UMTA 5E8VA 4ASDA 4UBAA 2XH5A 3EIDA 4A4XA 2YWVA 5FTGA 4FSZA 4BDIA 4S33A 2QOOA 4I0RA 4F1TA 3KA0A 4FKUA 3VS6A 4YJPA 2B1PA 4XG9A 4EOLA 3P86A 3D5WA 4WO5A 4NM5A 1XJDA 5LJJA 5F20A 1Y8GA 3W2CA 4LRJA 4PY1A 3THBA 3FI8A 1DAWA 4RIXB 3OXIA 1ZYCA 3CE3A 1YW2A 2B9JA 3F2AA 3U55A 2XK6A 4LMUA 5AP1A 2XA4A 3RNYA 3LOKA 3QTWA 2PVRA 5LQFA 1H00A 4N0SA 4NK9A 3QZGA 4RJ3A 4FTRA 2CDZA 5AX9A 3DNEA 3DTCA 2C0IA 2YLFA 4RZVA 4GS6A 3T3VA 5CENA 3NAYA 3ZC5A 3TM0A 2FGIA 3FPMA 3Q9YA 4G3EA 3UE4A 5DHJA 4PMPA 4BIEA 5AR2A 4QYYA 3OEFX 5I9ZA 4CFMA 4MK0A 5AV2A 3E7VA 5JEBA 4O86A 4JG8A 2WFYA 2W1EA 4I4EA 4KSPA 3VULA 3IQ7A 5KZ0A 5A46A 2ZM3A 1WMKA 3PA4A 5FG8A 3V8SA 4WBBB 1UU7A 4EQUA 4I6QA 5HO6A 1H07A 5HE3A 3RZBA 4JDJA 3SOCA 3VJOA 4ALVA 5J7BA 3KEXA 5DGZA 4FIEA 3FE3A 4FTLA 4EOMA 1Q4LA 3VUGA 4FKJA 4BCMA 4DEAA 3AC2A 3BE2A 3BYVA 3DB6A 2O63A 4J1RA 4JL9A 5AP6A 4F65A 3VS4A 3E92A 1ERKA 1MQ4A 1WBSA 2GNHA 4FKLA 3QU0A 5IH5A 4GFGA 4XNEA 4PPCA 2YERA 3HV4A 3NIZA 1VEBA 2IO6A 2ERKA 1CTPE 4AN2A 4IACA 3Q9ZA 5J79A 1OPKA 4R5SA 3HDMA 2C6MA 3ZXZA 4ERWA 4S31A 4L9IA 5GZAA 3MV5A 2OJJA 4ANNA 1GJOA 4NL0A 3RVGA 4RGJA 1P4FA 1ZLTA 3TEIA 1SNXA 3DLSA 2QR7A 4AZEA 4B8LA 4C61A 4CKRA 3LCSA 4UXLA 2SRCA 4QD6A 4QRCA 3KU2A 1KSWA 3LFDA 4V04A 5CEIA 4H3QA 1YOLA 1W0XC 3PG3A 2BTRA 3C4WA 2CN8A 3OC1A 3RBWA 4GVAA 3HYHA 3DFCB 3NUUA 3COMA 3FPQA 3TACA 4PDSA 5C1QB 3ATTA 3PJ2A 5AIRA 3UP7A 5A4TA 3DKOA 4OR5A 4JAIA 2ZB1A 5E91A 2C5NA 3DBQA 3IW8A 3R00A 5M4CA 2J50A 4G3FA 3UNZA 5JFXA 3OHTA 5EHYA 2V7AA 2C6DA 4U80A 4GUEA 4G3DA 3WI6A 2X6EA 4K1BA 4NFNA 3EFWA 5CT7A 4CYIA 3B2TA 4DFZE 4WT6A 3NVMB 4CYJA 1REJA 3ZSHA 3ZU7A 4X21A 1H1QA 1OL7A 5CF4A 2GU8A 4AN3A 1FMOE 3G0EA 4JR3A 4CKJA 5HO7A 1WVXA 3FHIA 4ARKA 2WPAA 3PLSA 4QMZA 4B6LA 4HPUE 4ZTSA 2CKPA 2R0IA 5CSWA 3KKVA 3W2QA 2J7TA 3CP9A 3OWKA 3COIA 2EXMA 3W33A 4BCKA 5T6KA 5AM7A 1NT2A 3LCKA 3R7EA 3UGCA 5I9XA 3ZEWA 2VU3A 2VTAA 1JSVA 5AP5A 4KKEA 3DB8A 3P1AA 1IRKA 1REKA 3BQCA 2CMWA 5DFPA 4XG2A 5HU9A 1S9IA 3L8VA 4BZOA 4L45A 4EJ7A 4GT3A 2OF4A 3FZOA 4F0GA 1M14A 2ZMDA 3RNIA 2EXEA 2PMNX 2W1CA 4CSVA 4X2KA 3G2FA 3OY3A 4RT7A 4EK5A 4DHFA 3CSVA 2OXXA 1H24A 2Z7QA 4CRLA 4DGMA 5ANKA 4JBPA 3VS1A 4G5JA 2ZJWA 2J5FA 4U6RA 4YPSA 4U43A 4CV9A 3COKA 5D10A 4JBVA 3Q4UA 3V51A 4YLJA 2E9OA 2YAKA 4C37A 4DBNA 5EM5A 5EKOA 4NJDA 4EUUA 5A4QA 1UA2A 5GIPE 2Y6MA 5AADA 2WAJA 4GIIA 4YTCA 4O1PA 4MYGA 3O17A 2QNJA 2XNBA 4FSMA 4FK3A 5J87A 3ZBXA 2PHKA 4EYJA 5C26A 4JX7A 4YSJA 1GZ8A 5FTQA 3QTZA 3R2BA 2FSMX 3F9NA 2QOHA 3ORNA 5LVLA 2XIKA 4HZSA 2W0JA 1FMKA 3RWPA 5KMIA 4O81A 1R78A 3D2KA 3N51A 5CVFA 1Q24A 1R0PA 5HNGA 3WZEA 2UZNA 1U54A 2PWLA 1KV2A 3KCKA 4FV3A 3KF7A 5DRDA 3RPOA 3TNWA 4QTEA 3GNIB 3MI9A 3MS9A 3NNWA 5E8XA 4G5PA 2G2IA 3G15A 3MPTA 3KB7A 4EK6A 4FKOA 2X9FA 2XK3A 3II5A 4YTHA 4MXXA 2ZOQA 3RWQA 3HDNA 3TJCA 2UZDA 5DBXA 5IA5A 4CTBA 2XNNA 2PVLA 3LQ3A 3MBLA 3ORTA 4I94A 3DTWA 5CQUA 2ITXA 3QRKA 2Y9QA 3PXZA 4IWDA 3UZTA 1XKKA 2Z7LA 5TKDA 3TDWA 4FYOA 5HD7A 1OKVA 4AOJA 3AT2A 2Q0NA 3BI6A 4CV8A 3FXZA 2G15A 4F64A 2WQEA 3H0YA 1XR1A 4QTCA 4GRBA 1XBAA 5CANA 5FRIA 2C6LA 3A4OX 4AUAA 3MFSA 3OZ6A 3RMFA 2X2KA 3I5ZA 4CQEA 4UEUA 4WUNA 2WTVA 2PVKA 4TY1A 2FUMA 3ZC6A 4A7CA 3NYXA 3AT3A 3M2WA 5F9EA 3UTOA 3TDVA 4R5YA 5C27A 5IQCA 5IISA 3UQGA 3TI1A 4FT5A 3ZXTA 4NM3A 4M66A 4RQVA 4RIYB 2XEYA 3JR1A 4IX4A 3TV4A 3P78A 2CNQA 5CWZA 3GUBA 3FUPA 3R73A 5IEXA 4QMQA 4X6RA 1KE6A 3TIZA 3G51A 4J52A 5IA2A 5JZJA 3FLNC 3V04A 4ZXTA 3CY3A 2WEIA 4XYFA 3QRTA 3DK6A 3PDTA 4RJ6A 5HVYA 5HBEA 3GQIA 2XEZA 4I4FA 4CGAA 4XV1A 3MVLA 4FT3A 5HESA 3VJNA 4CG9A 4BIBA 3I81A 3MJ2A 5C8MA 4PTEA 1L8TA 5BVKA 4A06A 4AZFA 4F1MA 3DKCA 2QR8A 1U4DA 5I9WA 2C3KA 4W9XA 3UQCA 3IDBA 3Q4TA 3HLLA 4AGDA 3NIEA 4PDYA 3HV6A 2R3HA 3ZZWA 4AE9A 4AOTA 4GJ3A 3SGCA 1W8CA 2HY81 2JDRA 4ZS0A 4P5QA 5BUIA 3MESA 3DZQA 5IKWA 3H3CA 1PXKA 2W9ZB 3UOJA 4CQGA 3NX8A 2P2IA 3RTPA 3QRJA 4M15A 5AV1A 1M2RA 5HLNA 4XHKB 3GENA 3FL5A 1Z9XA 4YO4A 2CLXA 4GKIA 3QHWA 1BL7A 3QCYA 5F95A 4CZYB 4PRJA 2QG5A 3LPBA 2V0DA 3VUMA 3WF7A 3PY0A 4GMYA 3R83A 2OJGA 2W4JA 4CKIA 3ZDUA 5IA4A 3Q4CA 3SXSA 5M57A 4N6YA 2HOGA 4FV6A 1H1PA 2BAQA 2DWBA 2G1TA 3AG9A 3HV7A 4FYNA 4E7WA 4HVGA 3CQEA 5EYCA 3O71A 3AGMA 3F5UA 4JLCA 5HIBA 3C0GA 3C0IA 3ATSA 2EB3A 4NM7A 4PP9A 3FQHA 3ZS5A 3MFRA 2ZDTA 3LZBA 2GS6A 3BHVA 4OBQA 2YCQA 3NW5A 5AIKA 1G3NA 3PJ8A 3R1NA 3Q53A 2BDWA 5KMKA 1WBWA 2ITQA 2BDJA 4EORA 2VD5A 2HW7A 1CKIA 2YDKA 3OD6X 4KNBA 3E87A 3UIUA 4E4LA 1LEWA 3EKKA 4EH6A 3VNTA 3WZDA 4DFNA 4RWJA 1OL5A 4PPBA 3G9LX 4FNWA 2YDIA 3RPVA 5EM8A 2Z2WA 4FSWA
chains in the Genus database with same CATH superfamily
2HAKA 4AP7A 3VUHA 3S2PA 4ZTQA 3AGLA 1VYWA 3WZUA 3OBJA 5KMLA 1KUTA 4DT8A 4KKHA 2YFXA 3QX2A 3UJGA 4BICA 3UG1A 2UZWE 4RSSA 3HP2A 2GFSA 3L1SA 5EDQA 2PVNA 2R3QA 2R7IA 1ZYSA 3QQGA 4PF4A 3HA8A 2F9GA 4L8MA 4CT1A 3QXPA 4EOPA 4BDEA 5IQBA 1BX6A 2HXLA 4C62A 3V3VA 3C4EA 5GJFA 3NUPA 1WAKA 3EQDA 1PXPA 1YXVA 3IECA 3NS9A 4MBLA 3AKKA 5CAOA 1YWNA 4DG3E 2RFNA 3MTLA 4E20A 4N57A 5EYDA 4QQCA 1JOWB 3ID6C 3R28A 4E8AA 4M14A 4NFMA 3W0NA 4NH1A 4DLJA 4DF3A 4XV2A 3QRUA 1R3CA 4EOQA 2XIZA 2QG7A 3BYMA 2GHLA 1F3MC 3MN3A 4FX3A 4OTHA 4QP2A 4WKQA 4HCTA 4HGEA 5AUTA 4BF2A 4XP0A 3PSBA 3PUPA 2Y8OA 4TRLA 2YLEA 4BCQA 4EKKA 2PULA 3ZEPA 2ONLC 2R4BA 2QOLA 4BVUA 4IWQA 5JK3A 2VTIA 2C6TA 3NUXA 3IOKA 3CKWA 3ODZX 1ZOEA 4EONA 1JQHA 2HZNA 4AF3A 2ZB0A 5M56A 4O82A 5JQ8A 3A60A 3LIJA 5CAVA 4GKHA 2OF2A 4DITA 2H8HA 3ANRA 5CU3A 1OUKA 4F0FA 4ZSAA 2B53A 4DHJA 3ALOA 3E8EA 5BQ0A 2X2MA 2VWVA 2O64A 4BDCA 4YZDA 1PXIA 4M8TA 4A9YA 4BI1A 1QPEA 2H6DA 2H34A 4ACGA 4DEIA 5M06A 1VYZA 3DAKA 3IKAA 3RALA 3U4UA 4I20A 1L3RE 4CD0A 3OBGA 3UO5A 4AAAA 3BPRA 2CGUA 4FSTA 2JDSA 2ETMA 4BDBA 3H9OA 4IB1A 4ZY6A 5A54A 4KIKB 1Q62A 3QD0A 3R7IA 3COHA 2V62A 4FSYA 3SVVA 4EOOA 5E4HA 5AEPA 4L52A 4ZSEA 4FTJA 3BLRA 2C5OA 3BV3A 3O5AA 1MQBA 5HTBA 1NVQA 1CDKA 4BCGA 3BZ3A 3I7CA 2WTKB 4JJRA 4FTMA 4O0SA 4I92A 4QPSA 2JKQA 4MUQA 2UW4A 4HYUA 1ND4A 4IEBA 3QQFA 5L8JA 5FD2A 4L3JA 4G6LA 3A7HA 4FG7A 4QQ5A 4R77A 4FKGA 5EQYA 3AD6A 4I41A 5CU2A 3NEWA 3PRFA 4L6QA 4D0WA 2WXVA 4N4SA 5L6WL 4Z16A 2UVZA 4J97A 3VN9A 4BKJA 2JGZA 3W0PA 1RW8A 4C4HA 4DH3A 5BX0A 5AWMA 5BMMA 3OXTA 3RP9A 4O0YA 3CGFA 3CC6A 3TV6A 2W1FA 2DYLA 4M67A 3T8OA 4RIXA 3W8LA 1WZYA 3RPRA 5JRQA 4LOPA 4RWIA 4ZY5A 3EQBA 2HK5A 2W1IA 2XCHA 4AGUA 1OGYA 3DBFA 1R39A 2VTRA 1OI9A 5JH6A 4JT3A 4GT5A 4ZP5A 2Y4IC 3ZUUA 4C57A 3LMIA 5DRBA 1WBVA 2Y7JA 4LMNA 2ITPA 4OT6A 5D41A 5HORA 2ITUA 4E6CA 4LOOA 4O96A 5HTIA 3FL4A 3P79A 4QTAA 1AQ1A 4U41A 5KHWA 1T45A 4HYSA 4CRSA 3A4PA 3NYOA 4L3LA 5FDXA 4OT5A 3QF9A 3TWJA 3KN5A 4LL5A 3FJQE 2C68A 2XNGA 3VW8A 3CTQA 2W5AA 3G9NA 4YJVA 2VZ6A 3DKGA 3OCTA 1PJKA 1SVGA 3AXWA 4D4VA 3QBNA 2GTMA 3UVQA 3EN4A 4LM5A 3I1AA 2GNFA 5KMMA 2OG8A 3PIYA 2G2FA 1I44A 5GJGA 3W18A 3O8PA 5EM6A 4AT4A 3P08A 4WRGA 4I5CA 3K3IA 2VWIA 5FXQA 2IEWA 5DT4A 4UMUA 4CEGA 2YCSA 4JDHA 2XIYA 2WTIA 3V5QA 3ORPA 4GYIA 3NGAA 4FTOA 4EKLA 3N4TA 4R7IA 5L2IA 3QCQA 3TZ8A 3EWHA 4NW6A 2BTSA 2IVUA 3VBQA 4B99A 3KXXA 3EQHA 5LCJA 4MXYA 1ZZ2A 3LXKA 3FLSA 4ITHA 3ZRMA 4FTKA 3ACKA 3U51A 4P5ZA 3W0RA 4LYNA 3IW5A 4J53A 2P2HA 1JLUE 2IVVA 2FSTX 2C6OA 2J90A 2JIVA 4FKWA 5CY3A 2B55A 1SVHA 4FIHA 4QNYA 4ZTLA 5GJDA 4MBJA 3TKHA 3VO3A 4B0GA 4EBWA 4IFGA 4OUCA 1U59A 4XMOA 4RIOA 3ZONA 4O7WA 5HCZA 1UNLA 3KFAA 3AQVA 4EEVA 5CYIA 3QAME 3PP1A 1NW1A 2F4JA 2HENA 2UZEA 3FXWA 3NYNA 2WMSA 5D7VA 3SX9A 4DDGA 4QMWA 5AUYA 3KL8A 4O27B 3R7OA 1J7IA 4FL1A 2UVYA 4QYFA 5EYMA 5JFVA 2PMOX 2ERZE 4AA4A 4CT2A 4H58A 3K54A 3H0ZA 3OT8A 3D15A 3R9RA 4IJ9A 4IZAA 2WMRA 2OJIA 2Y4PA 2OWBA 4QPMA 3BLHA 3BKBA 3FMDA 5LARA 3BLQA 2C30A 4J96A 4U79A 2X2LA 3Q6UA 1NY3A 5I9VA 5K5NA 5D7AA 3SG9A 2BAKA 4DTBA 4X3FB 1STCE 1OIYA 3F88A 2YIYA 3OCSA 5B2LA 5KBQA 3F2RA 1OB3A 4KA3A 5KBRA 2G9XA 1DI9A 3CTJA 2LGCA 5FXSA 4OTQA 2R5TA 2JIUA 4RIYA 3T9IA 3RCDA 4IVDA 4JI9A 3QQUA 2GNJA 2YHVA 2OBJA 4BRXA 4U81A 5E8YA 3BEAA 3UIXA 4I21A 3G90X 3BX5A 5B2KA 4JRVA 2VTOA 3OTVA 4FKTA 4YPDA 5E9EA 5HGIA 4BCOA 2V5QA 4FGBA 2BZJA 4C2WA 5JRSA 5M08A 4N6ZA 1SMHA 2JKOA 4FTCA 3IW4A 2F57A 1UKIA 3F5XA 2R3PA 4XBUA 3MVHA 1OPLA 2V22A 4RQKA 3EFJA 3SAYA 2E2BA 5DR6A 3DJ7A 4TT7A 4EHEA 3BWJA 4FKPA 3HMOA 1SNUA 4PL4A 3KY2A 2CKOA 4KKGA 4RJ5A 4IDTA 4M12A 2PSQA 2WMVA 3WE4A 3OEZA 3W0SA 1Q99A 1XO2B 4AE6A 1PMUA 3T3UA 4BDKA 5LMKC 3QD2B 4BCNA 3ZRLA 3KVWA 3MDYA 5HQ0A 2OH4A 4ONAA 5ETAA 3A8WA 5ITAA 4WG3A 4CFUA 3CBLA 2X7OA 4GYGA 1UKHA 3IW7A 4L43A 5H8BA 3VS2A 3LW0A 1Y91A 2VAGA 3OVVA 2C1BA 3QUDA 1J7UA 2YN8A 2A27A 3ZOSA 4AT3A 5M09A 2GFCA 3R1SA 1J91A 5E8UA 4TWOA 2VGOA 4HVHA 1JNKA 1PXOA 4FV5A 1KOBA 3E93A 1XH7A 4R3RA 3DBEA 5DEYA 2QO9A 2FH9A 3IG7A 3QQLA 2KTYA 3DT1A 1JAMA 4BWKA 4FODA 3PJCA 5JN2A 1IASA 1J3HA 4YC8A 2JITA 4O6EA 2ZYBA 3QYZA 4R3PA 2BILB 4CVAA 2W1GA 3ENHA 4RLLA 3R04A 2CHLA 4UWBA 4X2NA 4AZSA 4D4RA 4FKRA 3EKNA 4X7QA 4W8DA 1WCCA 4N70A 1KWPA 5ANGA 3D94A 3TNHA 3E8CA 2E9NA 4TZRA 3WF9A 5DNRA 3TMOA 1OITA 4WG5A 3V5JA 4ZIMA 2UZLA 1Q61A 3HZTA 2OO8X 3N4VA 2Z7SA 4E6DA 3QTQA 2UZBA 3I0QA 3PWYA 4FF8A 4IC7A 2BROA 5HLWA 3TJDA 2JDVA 2GPHA 2WMUA 1YHVA 3CJFA 3GCPA 3GU4A 1A06A 3MFUA 4FTQA 1YDTE 1F5QA 3I0OA 3BHHA 1LP4A 3K5VA 3PVWA 4JQEA 4X3FC 4TYHB 3IK3A 4JOAA 3HUBA 3OCBA 4YO6A 4BIDA 2HY0A 3QKMA 5DLSA 2VRXA 3R22A 1MRVA 3I7BA 1LPUA 1B6CB 5E92A 3FEGA 3REPA 1XBBA 2PYWA 1OBDA 2BIKB 2OZAB 5M4FA 3TIYA 2XM8A 4I0SA 4C58A 3OTUA 4UY9A 2PVMA 3EB0A 3TKUA 1MRYA 1CM8A 1RE8A 4G9RA 3EQIA 2CJMA 3AD4A 2X4FA 4G34A 4X3FA 5IMXA 2YM3A 2O65A 3O51A 2XKEA 4PTGA 5TO8A 4O7VA 3ZLSA 4DBXA 2YIQA 3DQXA 1FINA 1JKTA 4O0RA 4EOSA 3P7CA 4M0ZA 4AW1A 2CGVA 3OOMA 1JKSA 2GQGA 4IAIA 3TZ7A 4NTTA 4I5HA 5JQ5A 3PJ1A 2C4GA 4ACDA 2XYNA 1XH5A 3C1XA 4GV1A 2X1NA 3C9WA 2XKDA 4HYHA 4U5JA 5JKGA 3L9NA 3ORKA 3H10A 4MHAA 3KXNA 5LVNA 4DFBA 2UUEA 3G5DA 5HO8A 1ZY5A 4QTBA 5J5SA 2VO3A 3L9LA 4LQMA 3MH2A 3JY0A 4E5AX 4I6HA 3FI4A 4R1YA 1DAYA 3L8SA 5KMOA 3BQRA 4LGGA 3FYJX 2PUIA 4Z7GA 3GQLA 5HE1A 5FQDC 5AV0A 4I6LA 5EDPA 4EH5A 4LV8A 4YJSA 2BKKA 2UW3A 1OECA 4H3BA 2RGPA 1LR4A 4BDHA 4FT0A 4OBOA 2HZIA 3O2MA 4XOZA 3UIBA 3BRBA 3FSKA 2QLQA 4L7FA 4NKSA 5DT0A 1ZWSA 2GQSA 1OL6A 2E9VA 2GTNA 3OWJA 2FA2A 1TFFA 4RVKA 3U54A 1YXXA 2RFDA 5AP0A 5ANOA 4XH6A 4ZTHA 4MQ2A 3HA6A 3UO4A 1GIHA 2F7EE 3V5WA 3FBVA 2C0OA 3ZCLA 2EWAA 1P2AA 3GU7A 3K3JA 4FV7A 4FV0A 3ET7A 4A07A 3C50A 3SA0A 3CPBA 2CLQA 1O9UA 2IJMA 3POOA 4IH8A 1CKPA 3SRVA 4HGLA 4KS7A 3VONA 2IZSA 1OIRA 4CLIA 3DBDA 3DBCA 4BDJA 5IQGA 4XUFA 4J8NA 3ZLWA 2BIYA 4IM0A 4XG3A 2ITNA 3LXNA 4KINA 3RK9A 1PMNA 1OZ1A 2YJSA 5AUUA 1ZYDA 2VO6A 4QMYA 3IW6A 4FBXA 2NPQA 1B38A 3DAJA 3DFAA 2BR1A 2VWWA 3LVPA 4FG8A 4OTFA 5K3YA 3R9OA 4O7YA 4DHIB 3VBTA 4CLJA 3KULA 3O7LD 3UC4A 4BTMA 1O6YA 2I0YA 4K18A 3TUCA 5IUIA 2GCDA 1FQ1B 4JQ8A 3KREA 2QKRA 5CT0A 3QQKA 2RKUA 5J5TA 2GQRA 1PKDA 4U44A 2AYPA 4K2RA 4BL1A 2I7QA 4MVFA 1XH9A 2HYYA 4BBMA 4WOVA 4K0YA 4U40A 5IF1A 3PLAE 3W2RA 4FC0A 3D2IA 4QP4A 1W2FA 1BMKA 2BHHA 3Q04A 4ZJJA 4RX5A 2BRHA 4ALWA 3F7ZA 4XG6A 3ORMA 4G6OA 4O4FA 2ZM1A 3WARA 2AQXA 4NUSA 5CXHA 2ZDUA 4ENYA 5CAPA 3KF4A 4UMQA 4V0GA 2XVDA 3P0MA 2QCSA 3MWUA 3IONA 4JDIA 3ZO2A 4EH7A 4ANOA 5AUZA 4ANMA 2NYAA 1ZYJA 3NNVA 3FV8A 2UZVA 3ZZEA 2NNWB 2FYSA 3WYYA 4D2TA 2X6DA 3A2CA 4NM0A 2W06A 2C3LA 5EQEA 4FZDB 3QXOA 4DGLC 5K4IA 1H1WA 3LFBA 1Q8UA 5E1SA 4QQTA 2B7AA 3NZ0A 3WF6A 2XJ0A 3AC3A 5HVJA 3QHRA 4P90A 4GUBA 4XJ0A 5CAUA 2R3GA 3V8TA 2HIWA 1K3AA 2JFLA 1KE8A 3ULIA 4DE4A 5CNNA 4AS0A 3ZRKA 4EI4A 2CSNA 4C4GA 3VQUA 1FGKA 4U0IA 4RA5A 4D55A 3W2SA 2ZV2A 2BZIB 4IIRA 3P7BA 3LXLA 2P55A 3KRWA 4WSYA 5KCVA 4TYGA 4D9TA 2W5BA 4BGGA 1E9HA 1TQMA 5FBNC 4A9UA 2XKCA 3Q3BA 5LVMA 3DA6A 3R21A 4TNDA 3IGOA 3UYSA 3QA0A 5GIOE 4I24A 3WZJA 2EUFB 3QQJA 2XBAA 3ORXA 4O4BB 3F3VA 4L53A 4YZNA 1UWJA 5KKRC 3UVRA 3N4UA 4IX6A 3R63A 2OJ9A 3TKIA 4XLVA 1J1BA 3U6JA 3OWPA 3VUKA 2WQBA 3PXKA 4FMQA 5IUGA 1JWHA 4I0TA 3U6IA 4QMLA 1AD5A 4EOJA 3P5JC 4FRFA 1H8FA 3A62A 4JBOA 4F78A 3TZ9A 2Y4IB 3UP2A 3MVMA 1H0WA 4ITJA 3QQHA 4EC8A 3PVBA 4GW8A 3BL7A 4UN0C 5IEYA 5HICA 3BHYA 4UXQA 5JZNA 3R71A 2VWXA 4QMOA 3MIAA 4BDDA 4K33A 3H9RA 1H25A 4IHPA 4OGRA 4DDIA 4RPVA 4JX3A 2J4ZA 4EK3A 3BGZA 5CNOA 3OMVA 5IZFA 3S4QA 5M07A 4NU1A 4AFEA 2AUHA 3HRCA 4AZVA 3F3WA 3W10A 3Q52A 4UMRA 4Q9SA 4LI5A 3KRXA 4NJ3A 4EQCA 5AP7A 2ZVAA 2P3GX 2FSLX 1YXSA 4IFCA 3CY2A 2OH0E 4I6BA 2OFUA 4DYMA 5C4KA 4CNHA 1GOLA 1ZAOA 3P5KA 2FO0A 3FKNA 5EI2A 4F99A 3V6RA 5KUPA 5IQDA 2CPKE 5FLFA 5CLPA 5T3QA 4OTDA 1IAHA 3E8NA 3VRYA 3FZ1A 4BB4A 3EL7A 4WA9A 4R8QA 4H05A 5L4QA 5IQAA 2QHNA 4C38A 4F7NA 3QTSA 2P4IA 4FR4A 4H1JA 2BDFA 2J9MA 4IB0A 1QPJA 2XK8A 4FIJA 4E3CA 4IC8A 3RHXA 1HCKA 4CMTA 4F4PA 3D5XA 2QOBA 4EWQA 5H2UA 5EKNA 3RAIA 3JVSA 4YR8A 3P9JA 4KIKA 3PA5A 5L8LA 3E88A 3OWLA 4KBAA 1KV1A 4OLIA 4EHVA 1YWRA 5EQPA 5AFVA 5B0XA 1U5RA 4B8MA 1KE7A 4GL9A 2ITTA 2WNTA 4GIHA 3SW4A 4D2VA 2X8DA 2C6KA 4BBEA 1FGIA 4A9RA 4C0TA 3R0TA 4CXAA 5M4UA 4QEBA 1Q8WA 4ALUA 1X8BA 3WYXA 3W0MA 1H1SA 2WOTA 3VC4A 3S0OA 3NCZA 4Q5HA 1ZZLA 3V8WA 4DLIA 3R01A 4FSNA 4RFMA 5HG7A 4AZWA 2DQ7X 1OM1A 5HNIX 1PY5A 2W05A 3CEKA 4RX9A 2XMYA 4E26A 3B2WA 5I3OA 4I22A 5EOLA 2XNMA 2NP8A 4QMTA 3UVPA 2XK4A 1E1XA 2PK9A 4YHFA 4C4FA 3NFFB 4BDAA 3JS2A 4AXCA 5DH3A 1R1WA 2B9FA 4FTUA 4CFWA 4CZTA 3GGFA 1ZOHA 1XMLA 4XOYA 2Y6OA 3F61A 5LCKA 5AJQA 3QX4A 3AC5A 4YZCA 5F1ZA 3Q5ZA 1WBTA 2IZUA 4G17A 2F2CB 1M52A 3BGPA 1JPAA 3R02A 2C3IB 5HE0A 3QTIA 4ASXA 5AX3A 5EW3A 4W4WA 1OKYA 4TYHA 3MY1A 2WQMA 4DH1A 3RINA 2AC3A 3HRFA 3RZFA 3BLAA 3C4FA 1OIUA 4F9WA 2I1MA 3EZVA 5IDPA 5KO1A 3JUHA 5M55A 5L6PA 1PYEA 4CFVA 3EQPA 4NCTA 4EK4A 4EYMA 2GHGA 4Z9LA 3LFAA 1BL6A 5KHXA 1J7LA 3HAVA 2PVFA 3BGQA 5ETFA 4EH8A 5AA8A 3IDPA 4BHZA 3GU5A 3Q5IA 4FSRA 3DK7A 2C6EA 2W9FB 3OUNB 4G9CA 4LOQA 3TTJA 4D2SA 1UNHA 3CD3A 4JQ7A 3UOKA 1SZMA 2YZLA 3HX4A 4KD1A 4J7BA 5D9HA 2WZJA 1FVTA 4EJNA 5CS6A 3KQ7A 2QLUA 5EG3A 2C5VA 4UB7A 3BHTA 5C9CA 3C4XA 2C5YA 3EQCA 3FWQA 4MXOA 4QTDA 5EI8A 1PW2A 5AP3A 3UYTA 2YA9A 1OGUA 3BHUA 3F66A 5JGBA 3NNXA 3PPZA 3U4WA 3D5VA 4R3CA 4MNFA 4AT5A 2PUPA 3OOGA 4ZMEA 4TL0A 4FNYA 4TW9A 4BR3A 4FOBA 2Z02A 2JLDA 3LFNA 4U3YA 1TZDA 1Q8YA 4G6NA 5DOSA 4D58A 1G8SA 4EH9A 3FMLA 1G8AA 1W82A 4L44A 3SXRA 4FA2A 5ETCA 3TT0A 3UDTA 3ANQA 4X2FA 5AV4A 2XNPA 3M11A 4Q5EA 5IEVA 3D14A 5J9LA 1Y6BA 3QWJA 1OBGA 4Q9ZA 4O84A 3L8PA 1FBNA 2WMTA 5DE2A 5HBJA 5CSHA 1SYKA 3CGOA 4RIWA 5F94A 2UVXA 2C3JA 2ITYA 3GOKA 4MWHA 2B52A 2XAOA 4I93A 2GHMA 4E5WA 2VTHA 4IAFA 5AP2A 4BZNA 3F2NA 4C02A 1LEZA 4FKQA 4DFYA 5FXRA 3E62A 2X0QA 2IW9A 4E4MA 3R9NA 2WEVA 1G5SA 1TQPA 3LFSA 2CKQA 2WIPA 2A4LA 2R3IA 4FEXA 3DLZA 4IM3A 4RX7A 2YIWA 4ZSLA 3OF0A 1QPCA 4M68A 5CEKA 4RWKA 3EN5A 3MFTA 3U9NA 4ZLOA 3TN8A 2YM6A 3MPAA 2ETKA 2XNOA 3HMNA 4G3CA 5BVEA 4F6UA 1UU3A 1ZARA 4JG7A 3FDNA 3FZPA 5HVKA 4V0GB 1ST0A 1K9AA 4E73A 2XIRA 3VF9A 5C01A 2HWPA 4RC2A 4D4YA 1NVSA 3W2PA 2J0JA 2VUWA 4NIFA 5FWKK 3VRZA 3MY0A 4FV4A 1WBNA 3PYYA 4YBJA 5A9UA 3A99A 4WSQA 4AA0A 3ZFXA 2GMXA 4DEBA 3BBWA 4FEWA 2IPXA 4DEHA 3IDCA 2PVYA 3KXHA 5A4LA 3W1FA 4GFOA 3DJ5A 2WO6A 1OMWA 2WMQA 2HW6A 4XP2A 2CN5A 2OZAA 3VUIA 2BRGA 4PQNA 3GCVA 5E1EA 4B4LA 3Q96A 2HELA 3LCDA 4IADA 3UDBA 5AR7A 3TNQB 2W1HA 1ZMVA 4FUXA 4D2RA 2Z60A 5AUXA 3KULB 1QCFA 4DH8A 3LM0A 3DU8A 4O6LA 4HNFA 5FP6A 3N9XA 3ZO3A 4LL0A 3LFEA 4YZMA 1VZOA 3LAUA 2VTLA 3SG8A 2EB2A 1W98A 3VF8A 2XAMA 5AA9A 4WHZA 3TZMA 3D83A 3ETAA 4H3PA 1M17A 1UV5A 3LHJA 4FTNA 5CI7A 4PNKA 1NVRA 1HOWA 1EH4A 3Q60A 4B9DA 5HKMA 5A6OA 3FAAA 4ZK5A 3H9FA 3QD4A 4XX9A 4EOKA 3RAHA 3NAXA 3QCSA 5ETIA 3RK7A 4YJTA 4FL2A 2RSVA 3BE9A 3Q9XA 2JKKA 3KVXA 3QUPA 4IWOA 5EW8A 5HOAA 3AMAA 3ZTXA 4GVJA 3FLQA 2HWOA 2QHMA 3PVGA 4K77A 4XRLA 4EH3A 2VN9A 4F9BA 4LDTA 2KULA 3PWDA 3CJGA 5HHWA 4UMPA 2C69A 2ZMCA 3I6WA 2OI4X 2VO0A 4FKVA 4KBCA 4EZ5A 4LUEA 3EOCA 3GB2A 1URCA 2ZFYA 4A9TA 1WVYA 5LWMA 3PSDA 3V01A 5HG8A 3FI3A 4JIKA 2W4KA 4BYIA 4DINA 2PL0A 5DI1A 3NDMA 4GEOA 4OTIA 4V05A 3UIMA 3UOLA 5BV3A 2YM4A 3ROCA 3TG1A 3ZBFA 3TNPC 4PMMA 2XK7A 2CCHA 2R3FA 4D1SA 5IA1A 2GS7A 3LQ5A 5KX8A 2QKWB 2W1ZA 4ZMFA 1OUYA 5EK7A 4TYIA 2C47A 3FLWA 3MB7A 4TYEA 4FK6A 4ITIA 2VWUA 5BNJA 1YWVA 2YIXA 3MH0A 4I1ZA 1Q3WA 3CTHA 3MJ1A 4FSQA 4GG7A 4FZ7A 4KIOA 4MNEA 2X39A 5K0KA 3B8RA 3F3TA 5AR4A 3ZFYA 5KKRB 1B39A 1SVEA 4PMSA 5FM3A 1OL1A 5DYJA 2YJRA 3MH1A 3QTRA 3H30A 4EOIA 2XKFA 5CI6A 3NSZA 2O3PA 3S00A 5EI6A 2Z8CA 2WGJA 3O0GA 4MNEB 4X0MA 4CZUA 1H4LA 2R0UA 5GZ9A 2F7ZE 3MW1A 4ZLYA 3WIGA 4NZWB 1YXUA 4A4LA 2O2UA 2B9HA 4ORKA 4BZDA 4GFMA 2PVHA 3HEGA 3R8VA 3ORIA 3DKFA 2C5XA 1TKIA 3KXMA 2RIOA 1Q41A 3QTUA 2P0CA 3A61A 4QNAA 4D2WA 4LRMA 2X8IA 1PYXA 2UW5A 1TVOA 3CKXA 3PE1A 5EDRA 4ZZOA 3LM5A 3QLGA 4MBIA 4E1ZA 4TWNA 2JBOA 5BUJA 3WILA 3ERKA 3BL9A 3R8MA 3W2OA 4JBQA 4O91A 4IWPA 3HMPA 3PVUA 1PXNA 1R0EA 2J0KA 4PTCA 4QMVA 4UZDA 5G1XA 3ZHPC 2OLCA 2O5KA 3JXWA 4FI1A 5CSVA 5CSXA 4O7TA 3DXQA 2GNLA 4ASZA 3NYVA 2VX1A 2XUUA 3WF5A 5HG9A 2VWBA 4AXEA 4KRCA 3HUCA 4YTFA 1UVRA 4I6FA 3FXXA 3KRRA 4XLIA 4U42A 4FSUA 3LCTA 3D4QA 3RAWA 2PZ5A 5K4JA 4ZOGA 5D11A 5KZIA 5A4EA 1Q97A 1WBPA 4O22A 4YJUA 4F09A 4AA5A 1OKZA 3EQFA 2XBJA 2OU7A 5CU4A 1DI8A 5JFSA 1P4OA 2BALA 3S3IA 2OSCA 2BAJA 2QOQA 4YJOA 2J5EA 3QZHA 4GK4A 2IVTA 5FEDA 2R3KA 3MIYA 4HZRA 4JNWA 4JS8A 4W8EA 1PKGA 2X7GA 2J2IB 4FV2A 4GJ2A 2YWPA 4HJOA 3DQWA 4DGGA 2A98A 4IZ7A 5M53A 1IG1A 3UBDA 4EH2A 4FIIA 3VS5A 5C03A 2WU7A 2ZV9A 4FV1A 4Q2AA 4FICA 5CZHA 3AMYA 3NWWA 3U8WA 5CZIA 3ZYAA 4AU8A 5CVGA 3VHEA 4FIGA 4W4YA 4IZ5A 3KMWA 3EFKA 3DAEA 1ATPE 2W1DA 4FTIA 4E4XA 3C51A 3R1YA 4PUZA 4GK2A 4DCEA 4C2VA 4O7NA 4BFMA 3O50A 2BMCA 1W83A 3OP5A 2QOCA 2Y0AA 3RPYA 4ZAUA 2J0IA 4MKCA 5LOHA 4GSBA 2PZYA 4V01A 3GFWA 2WTWA 4YTIA 1V0BA 4L3PA 4IVAA 3R7UA 3KGAA 4DC2A 3C13A 2J0LA 3MA3A 3NUYA 3OW3A 4KAOA 2GSFA 2YISA 2J0MB 4O21A 4GCJA 3GOPA 3OXZA 1JKKA 5JFWA 4ANQA 5HD4A 2H9VA 5IUHA 3QFVA 3MTFA 3BYOA 5AR3A 2G01A 3FC2A 2FSOX 4GT4A 4U97A 4QMXA 4WIHA 2PUUA 3JPVA 5L8KA 3PIXA 4WNKA 5D1JA 5DVRA 3VW6A 5IU2A 1DS5A 3BBTB 4CFXA 4FV9A 4FG9A 2IVSA 4ZY4A 2YZAA 3FMNA 3PPJA 5I4NA 3UPZA 4ZSJA 2DUVA 4HYIA 4BKZA 3WE8A 5L2WA 4IAYA 4S2ZA 3O7LB 4MD8E 4BY9E 4YP8A 4O7LA 3W8QA 4D4SA 4FZFB 3ALNA 5FGKA 2CKEA 3GCQA 3V5TA 4HVIA 4FOCA 4YGAA 5D12A 3GP0A 4BCFA 2XM9A 4TTHB 4ACCA 2R3MA 3AMBA 3HECA 3EL8A 1OIQA 3HVCA 3LJ1A 4MEDA 4RWLA 5I0BA 1YQJA 2JD5A 4YMJA 4D5HA 4BJJA 1CKJA 3B8QA 2WD1A 1YOMA 2X8EA 3ZM9A 2X9EA 2DS1A 4MTAA 5AUWA 4CG8A 1ZMUA 2VTPA 5GINE 3JY9A 3Q4ZA 3PE2A 1QMZA 2IZTA 2OXDA 3FMKA 4FNZA 4OTWA 4DEDA 3NCGA 2IG7A 4IANA 4ZZNA 3WZKA 1GY3A 4F9AA 5GZ8A 4IX3A 4MCVA 5LMKA 5EYKA 2VTQA