5GJGA

Crystal structure of human tak1/tab1 fusion protein in complex with ligand 4
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
307
structure length
289
Chain Sequence
GPLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAK1 kinase - TAB1 chimera fusion protein
publication title Development of a Method for Converting a TAK1 Type I Inhibitor into a Type II or c-Helix-Out Inhibitor by Structure-Based Drug Design (SBDD)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 289
sequence length 307
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5gjgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gjgA01
3OCSA 2ZV7A 2UVXA 2B54A 2VN9A 4NFMA 3AD4A 5DEWA 5FQDC 3U4UA 5CY3A 3MS9A 4BDFA 2XK3A 2XNPA 4A4OA 1QPJA 1M17A 1MQBA 2R7BA 5D7AA 4RIWB 4BR3A 4NCTA 1KE8A 5AAGA 3TWJA 3UMWA 3PLAE 2B52A 4CTBA 4BY9E 2VTOA 3KRRA 4BWPA 1WBTA 4Q5EA 3GXLA 5DN3A 2AUHA 5LVOA 3G6GA 1Q8TA 3C4XA 5LARA 3CD3A 3CR0A 3F3UA 5HVJA 2JGZA 2YM3A 4MAOA 2X0GA 3WYXA 1R3CA 3W2OA 4FTOA 4G3FA 4C3FA 3W2CA 5JH6A 2WTCA 4M7IA 3PSBA 1OKVA 2HXQA 3K5UA 5GIOE 1NT2A 4OT5A 1G8SA 2W05A 2YERA 4FV4A 3OT8A 3RK5A 5FEQA 5L3AA 2XS0A 1GNGA 3K3IA 3BRBA 3FL4A 4XP0A 3FSKA 4XV3A 3EFLA 2C3IB 3AG9A 4O0SA 2QOHA 4E7WA 4DBNA 4EUTA 4QQTA 4M14A 4OTDA 3IOKA 3LFDA 4DG0E 2Z7RA 1U59A 2VTMA 3CJGA 4QMLA 5TO8A 4FNXA 3PXQA 3FMDA 4DN5A 5BQ0A 5CI6A 2CGVA 3QKMA 5EI8A 4I92A 3ZS5A 5EKNA 4QP7A 1PMUA 3C4FA 3LCTA 4GU9A 1VEBA 4JQ8A 3VIDA 4FTCA 3U6IA 3HMIA 2C6DA 2VTAA 4NZWB 1PF8A 3MVLA 3LMHA 4PL4A 4M3QA 2JAVA 3CCNA 3EQGA 2PTKA 3WF6A 2UVZA 4W4WA 3W8LA 4OAUC 3EIDA 3IGOA 4Y5HA 4YJQA 4RIXA 2FSOX 4FK3A 4UBAA 4YO6A 4EQCA 3BGPA 1WAKA 4EK4A 2G15A 5HNIX 3U6JA 4XJ0A 3KEXA 2C6TA 1BKXA 3II5A 5BVNA 5I4NA 3PVWA 2NNWB 2PMLX 2XBAA 3EN6A 2XK8A 3W55A 5C4KA 4V01A 5T3QA 5KHWA 3PPZA 5IUGA 4ZTMA 2QKWB 1MRVA 5IA2A 4RZVA 4QP4A 3QTUA 3NMUF 1A9UA 2F2CB 5AX3A 2YITA 1YHVA 3FXWA 3R7YA 1CKPA 2F7ZE 4NTSA 3TG1A 4JOAA 4GT4A 3MY5A 3UOLA 3VUDA 1XHAA 4C58A 2NRYA 3A4OX 4D2WA 3I81A 3R8PA 5LVMA 4FUYA 1MP8A 4TWCA 3TJCA 3W18A 3PJ1A 4FNYA 4GV1A 2P2HA 4DG2E 4GK2A 5EW3A 2YISA 3MTFA 5A54A 2ONLC 1FOTA 4MWIA 4EQMA 5I9XA 3QZGA 4H36A 4XS2A 4GEOA 5CZIA 2Y6MA 4AOJA 3ATTA 4R3CA 2PVYA 3A7FA 1TQMA 2HYYA 2V55A 4V0GA 2BHEA 3HMMA 3UQFA 4FTIA 4HCVA 3Q4ZA 1UNGA 5AUTA 2R0IA 3AXWA 3QQHA 1KSWA 2CCIA 1ZY4A 5AUXA 5HNGA 3DOGA 4LV8A 3WI6A 3MFUA 2HXLA 4EHEA 2IN6A 3GT8A 3LOKA 2X7OA 4IAIA 4D9TA 2IVVA 2RIOA 3FE3A 3K5VA 4IZ7A 4QO9A 3HL7A 3MGYA 4AZTA 5IA4A 4FF8A 4UZDA 1J7LA 1SNXA 3ORLA 3QTSA 4IDVA 5EFQA 4BKYA 3CGOA 2E9VA 3FC2A 4M8TA 3F3ZA 2XNEA 3KXXA 1MQ4A 2ITUA 4S33A 3VBVA 1ZYSA 4OTIA 4UWCA 3OXTA 5HCZA 4NKSA 4O0RA 2XIKA 1YI4A 5HU9A 2R3FA 3GU4A 1Y8GA 3ORKA 2XYUA 3A7IA 1UNHA 1OITA 3DBFA 4LRMA 3C0IA 5AWMA 3KULB 4DAWA 3GI3A 2Y4PA 4FR4A 4LI5A 4D2RA 4UX9A 2QU6A 3PG1A 3ZDUA 3FLSA 4CQGA 3DZOA 4R77A 3UZPA 1VR2A 1PYXA 2XJ0A 3I60A 3IDCA 4PDPA 2HWPA 5CXHA 4ZXTA 1OBDA 2YCRA 3ZOSA 5IQEA 4Z3VA 3R2BA 1KOAA 3BBWA 3OWKA 3RCDA 5L8KA 3NNUA 4U3ZA 5IQAA 3RPSA 5IEVA 4ZJJA 4JDKA 3H0ZA 3KXZA 4C7TA 4QTBA 4KBCA 4DEBA 4I94A 3ZSHA 2W5HA 5BYLA 2WTKB 2YCFA 3BLHA 3O17A 2W9FB 3PVGA 1GY3A 4W4XA 4W8EA 3ZTXA 3CQWA 3Q3BA 1O9UA 3ORTA 5HEZA 1U54A 4IAKA 2VGPA 5HICA 5L4QA 3NNWA 3NX8A 3QC4A 5AR8A 4N4SA 3HECA 4O22A 5FBOA 4NT4A 3LIJA 2QO9A 4J8NA 3RP9A 5HX6A 3ORZA 1XH7A 4R5YA 4EOMA 4UMPA 1H1QA 2OXDA 2YIRA 4H3QA 4L6QA 5D9HA 4F7NA 4P7EA 5GJDA 5T68A 1XQZA 2Z60A 1H26A 2VO0A 2C4GA 5BUEA 5IISA 2IG7A 2V5QA 1AQ1A 4XG6A 4F7SA 2XRUA 2J6MA 4RZWA 2UW6A 3WE8A 4FSNA 3R0TA 3IDPA 2BILB 3HV7A 2BKKA 1SYKA 2B7AA 2P0CA 3EQHA 3IECA 4PL5A 4U80A 4Y73A 5CSHA 2OH0E 4ALUA 4EOSA 5K0XA 3I7BA 4DITA 2PZPA 4LL5A 4M0ZA 3QTWA 4JNWA 3UNKA 2RF9A 3R8ZA 5FLFA 4O2ZA 2VTPA 4U7ZA 3CQEA 3EFJA 3QHRA 2BZJA 2C1AA 1OPKA 3QXOA 4BICA 5M4CA 5A14A 2HIWA 4FKGA 2CKPA 5DA3A 4EK8A 3R2YA 4I5PA 3BELA 2J2IB 2VTJA 3HLLA 4MEDA 4WSYA 4EOIA 4AT4A 2BDJA 5DBXA 5EHOA 4PPAA 4CZTA 3C4EA 4IBMA 4OUCA 3PFQA 4IVCA 4NM3A 5F9EA 4IX5A 4MCVA 4EJNA 4GG7A 3MB7A 3V6RA 1WZYA 3HV3A 4XOYA 3ROYA 3PXKA 4NH1A 3QZIA 4QTEA 3BV2A 5HZNA 3EQCA 4ONAA 2I0EA 2CN5A 1B6CB 1H4LA 4F1OA 1H01A 3DK6A 4EBWA 5CF8A 4XEYA 2O0UA 4D0XA 1YWNA 4N70A 4O0WA 4PDSA 3SA0A 2PULA 1FBNA 4PWNA 4FVQA 4F65A 3FI2A 2O3PA 2VO3A 3NDMA 5DGZA 4I5HA 4XUFA 2J5FA 3QFVA 4ITJA 4APPA 2NRUA 2WZJA 4F9AA 2DWBA 4BDEA 3O96A 3TUDA 2ZMDA 3AC3A 3CKWA 4IW0A 4L52A 1U5QA 1XBBA 4RMZA 4E73A 1OBGA 4X3FC 2X39A 4JDHA 2OH4A 3QTIA 1YXVA 3IK3A 2UZBA 4FSMA 2YZAA 3AT2A 3D9VA 3ZZEA 3LHJA 4MVFA 2JKMA 4LL0A 5EQEA 4HNIA 4NU1A 1Q62A 2BIYA 2G9XA 4HVGA 2W4KA 4IVBA 4X6RA 4EH8A 4UWBA 3ZUUA 4M69A 4E6QA 2GDOA 3E3BX 3Q4UA 1NW1A 3DBCA 5K4IA 3ZU7A 2GS2A 3UO4A 3ET7A 2JAMA 5JFXA 2EXMA 2VTLA 3V5LA 3RJCA 4I0SA 4HVIA 4HW7A 3ENMA 2YDIA 3AMBA 3I6WA 5C8MA 4JS8A 3SAYA 2GPHA 4YUQA 4GU6A 4ZTHA 1YI3A 4MX9A 4ZTSA 5I5ZA 3DBEA 5E7RA 4AE9A 4FSYA 5ACBC 3ZRMA 5CEMA 4AGUA 5KZIA 2UZDA 2OSCA 5AR7A 3EQPA 4BTJA 4GFOA 3MPMA 3NUPA 3LXPA 4AFJA 3WZEA 3L1SA 3Q60A 4HOKA 4FV1A 3QTXA 2WTJA 4PRJA 4ZSLA 3H30A 4I21A 5I9UA 3GENA 4HYHA 4AA4A 4O7TA 2Q0NA 3SHEA 1IR3A 4KKGA 3ZMMA 4BDGA 5L2TA 2J4ZA 4DEDA 1YDTE 4I4EA 5HGIA 4NSTA 3NPCA 4GW8A 3RHKA 4OTGA 3WZUA 5KMOA 4FOCA 3C0GA 5IPJA 4IWQA 1YOJA 5HO7A 5IMEA 2R3PA 3R9HA 3ALOA 3RALA 2CNVA 1JAMA 3NYNA 3F2RA 3G0EA 4RIOA 3QX2A 4DFNA 4C4JA 4FZ6A 2XVDA 4ASZA 3RPOA 3HA8A 4ZY4A 5IQCA 4YJNA 4Y5QA 3F5UA 1R78A 3KK9A 3R9NA 2CKOA 1ZZLA 1RW8A 3HKOA 4YZBA 1SVHA 4JG6A 5AR5A 2PVFA 5B0XA 4AE6A 2C6IA 2ITNA 3ROCA 3UPZA 3EQIA 1OIYA 3LKMA 2XZSA 3EQRA 2QOOA 3GCQA 4EWQA 4O21A 1O6LA 4RWKA 4GFGA 4ZTLA 3NZ0A 1REKA 2WMBA 4GUBA 3ZYAA 3R1QA 2UZTA 2GNGA 3S00A 1JSTA 2R3OA 3BX5A 3FY2A 3QQUA 4CG9A 4QP3A 2XKEA 2YACA 4I4FA 4IZAA 4XX9A 5CF4A 3F2NA 5HIBA 4ID7A 2XJ1A 4FIFA 2JIVA 3CXWA 4RIYB 5FM2A 2W1FA 4XHKB 4XG9A 2GQSA 3LFSA 3VQUA 3NR9A 1L8TA 5M4FA 4R3PA 4J98A 4U44A 1K3AA 3NUYA 3SXRA 3ORMA 2PUNA 3VULA 3MWUA 2V0DA 3VW6A 4YZCA 2VTTA 1FQ1B 2G01A 2VWWA 3MYGA 3BBTB 5K9IA 3WBLA 3VUKA 4XV2A 3WF8A 2FVDA 4EEVA 2PZ5A 3I7CA 4KKEA 2HZ4A 1ZMUA 1FVVA 2X4ZA 4OTPA 4DLJA 5IMXA 4L01A 1HOWA 3P7BA 4G16A 4DINA 4IM2A 3LPBA 4YTHA 5AR3A 5TF9A 2ZAZA 2QQ7A 4PL3A 3ORNA 1BMKA 4OLIA 3RAWA 2R7IA 3C13A 1Q3DA 2YJSA 4G1WA 3WF7A 1P4OA 4YU2A 3HVCA 3AC8A 2WMXA 3I5NA 2YAAA 3P86A 5DI1A 2GNIA 4FZDB 2VRXA 3AC2A 3RAKA 3TNIA 4M97A 4AUAA 3DAEA 4D1ZA 3B8RA 4C59A 3OY3A 4DFLA 2J0LA 2X8DA 5IU2A 2F49A 4QPAA 5JEBA 4QOXA 3Q5IA 3V04A 1ZMVA 4K77A 1S9IA 4EH2A 5JFVA 5H2UA 1OI9A 4O7RA 1OGUA 4L45A 3F6XA 5JSMA 2XM9A 4Y85A 2HELA 2WHBA 3PZEA 3UVRA 2A19B 4O1PA 4PMSA 2GHMA 2XIRA 4YP8A 3VS5A 4EH9A 4J8MA 3RI1A 4YSJA 3GU6A 3FPQA 3UIMA 3WZJA 4BI1A 5CF6A 3QHWA 4L7SA 4TYHB 5AR2A 2UW0A 5H8BA 4PNKA 3D83A 3U54A 5IQHA 3C7QA 2AC5A 3PRIA 3A4PA 3OZ6A 3FMHA 3OHTA 4RQVA 4EH7A 5J5SA 5IQFA 3GUBA 4QP9A 3TNPC 2IJMA 3BYMA 3E92A 4MBLA 4QRCA 3QLFA 1CSNA 2WAJA 3LFFA 5DG5A 5DWRA 4RA5A 1P14A 2P4IA 4F7LA 2UW5A 2YM7A 1XH9A 3CEKA 1YXTA 3FZTA 1OM1A 2UVYA 3P7CA 3D5UA 2X6EA 4I0TA 5HTBA 4BDKA 3V01A 3I0OA 3GU8A 4BCPA 1Y6BA 3DKCA 4ORKA 2A0CX 5BNJA 2HENA 3N9XA 3MSSA 5FG8A 2GMXA 5FP6A 3VRZA 5FUTA 4MD7E 2SRCA 3FZRA 1ZRZA 4FTMA 5HU3A 2OICA 4FKLA 3FV8A 4M67A 3LVPA 2XNOA 2OXYA 2BMCA 4GVAA 5CNNA 2YCSA 1H1PA 4HVHA 3O71A 3O23A 1MRYA 2RL5A 3E87A 4E3CA 3SRVB 5FDPA 4BCGA 2PVRA 4DFZE 4HPUE 1FVTA 1GIJA 4GYIA 4QYHA 4RA4A 4F1MA 4CG8A 2C3KA 4TZRA 5HVYA 4X3JA 4MXAA 5BX0A 5CEPA 4FODA 4GUEA 4JX3A 4OTWA 2W0JA 5AJQA 2OF2A 4BDHA 5J9YA 5JGDA 3B8QA 4IC7A 4MBIA 4OAVB 4PPCA 4YJRA 3ZLXA 4DTBA 3V51A 4IANA 2O2UA 3OTVA 3ALNA 1BI7A 3UE4A 4QTAA 4GG5A 3O50A 4FEVA 1Q61A 4NIFB 3S4QA 4XV1A 3SV0A 2EUFB 4DEAA 5M55A 5HE1A 4CFUA 3DXQA 4I22A 2XK9A 4AP7A 2QODA 3UZTA 5M06A 2ZMCA 2CJMA 3ZO3A 1GZKA 4FKJA 4XP2A 2GCDA 2RFDA 4FI1A 4O0VA 4NTTA 5A4QA 2C0OA 3ZUVA 3NYOA 1CM8A 3Q4CA 4PP9A 3FQSA 4C36A 4WNMA 5F1ZA 1H0VA 1H0WA 3UNJA 3TN8A 4O7VA 4H05A 3D7TA 5HG8A 5FM3A 3KVXA 4MQ2A 3O8PA 4FTKA 3V8TA 5DOSA 3A62A 4DHFA 2XK7A 3PSCA 3WE4A 3ODYX 4FKQA 1TVOA 5TKDA 5L6OA 4O7NA 1BI8A 3D4QA 1A06A 1PMEA 3DQWA 2YM6A 1T45A 4P90A 3PE2A 4TTHB 3ULZA 1PRYA 3SG8A 1YDRE 3S3IA 1UA2A 4XLIA 4BDIA 3DKFA 4E4NA 1UV5A 2BRNA 3PPKA 3IW8A 5H9BA 4CT1A 4FKSA 4IB3A 5GHVA 4G9RA 4QP2A 5C8KA 3K2LA 2UZEA 5CSPA 3VRYA 2WEVA 5J95A 3VQHA 2WOUA 4BBEA 5A46A 3WOWA 4EOQA 4IQ6A 4Y8DA 1ZY5A 4F9CA 3PJ8A 4AZEA 1MUOA 1U5RA 1W0XC 3U51A 3F88A 4CV8A 4XG8A 4JBQA 3Q53A 2Y7JA 3HX4A 1PXKA 4YHJA 3ZZWA 5JN2A 3IW7A 1NVQA 1KV2A 4Y95A 3FLNC 1FPUA 5HD7A 5DIAA 4D5KA 4EC8A 3COMA 3IS5A 3V5TA 2CHLA 3OUKA 2KULA 4D2PA 4HGTA 3ZO4A 1O6KA 3IW6A 3OEZA 1H25A 5AV3A 5ANGA 4LMUA 4BDBA 3M2WA 3NUUA 5LCJA 3KMMA 2BRMA 4IWDA 1DS5A 4K11A 5TOZA 3JVRA 2H9VA 4IMYA 3QRIA 4K8AA 4WOVA 3VN9A 5IEYA 4WBBB 3IONA 3UDBA 2VWYA 3L9NA 4DEGA 5IH6A 3DPKA 3HV5A 4D1SA 3T3VA 3ZM4A 1V0OA 1OIRA 2B55A 4W9WA 2X2MA 3R1SA 2XK4A 3TV4A 4I3ZA 5BYYA 3MBLA 3VUHA 4HPTE 3RK7A 4U45A 4BBMA 4FUXA 2PHKA 2VTSA 3LMIA 2E2BA 3F69A 4BGQA 4JDJA 4O7SA 3FI3A 4EK5A 3P7AA 4S32A 1O6YA 5BVEA 4AF3A 4AOTA 3NYXA 4HYSA 3FBVA 3EQDA 4IB1A 4JAJA 4TWNA 4JG7A 3PIXA 1ZWSA 4PMPA 2OI4X 3PA4A 2YN8A 3UIUA 4FG9A 5ANDA 5CAUA 3ZHPC 3R04A 2A1AB 3MA6A 5EW9A 2ERZE 2OIQA 5G6VA 3UG1A 4E5BA 4BB4A 2WTVA 4E4MA 2OJ9A 3G51A 4RIXB 1IAHA 4R8QA 2WEIA 4QNYA 4MKCA 3BE2A 3OOGA 3QGYA 4FICA 3TKUA 2VWBA 1JKSA 2BFYA 1M2PA 4B0GA 2YWVA 4ZAUA 3HGKA 4JRNA 2WPAA 1YHWA 5HVKA 4UXLA 2X4FA 3QUDA 5DLSA 2GNFA 2EWAA 4BZDA 2Z7LA 2BVAA 2OF4A 4TL0A 1YDSE 1Z9XA 2VV9A 3GEQA 4N0SA 1WBOA 2W1DA 1IASA 5FTQA 3OW3A 4F9WA 5EYKA 2ZV2A 2G2IA 2IPXA 4FSQA 4FTNA 5CSVA 4N57A 5CQWA 1QMZA 4U42A 4YBKA 5HCXA 3WIGA 1Q97A 2X81A 5IF1A 4KD1A 3I5ZA 3U4WA 2HAKA 1ZYLA 2GNJA 3PJ2A 4L3LA 3FQHA 3KCFA 5CT7A 2Q0BA 1FVRA 4FSWA 4GL9A 2PMOX 2OZOA 4QMOA 3OC1A 5CU2A 2O63A 2C6KA 3UG2A 1HCLA 2UZLA 4ZSAA 3H9RA 5IKWA 4FV0A 3VBWA 3R71A 4GK4A 5LMAA 5HLPA 2JDSA 4Z7HA 4MNEB 4KABA 1TQPA 4WT6A 4EUUA 4Z9LA 2FA2A 1PJKA 2EB3A 3UOJA 2EVAA 4FKTA 4I5CA 3UOKA 3ANRA 3R01A 3ZFYA 4I6HA 3BQCA 3A61A 1TKIA 3UODA 4F70A 3RPYA 2IW9A 3MESA 4D4VA 4RG0A 4NUSA 4BCOA 3E5AA 3S95A 5D7VA 4KWPA 3BZ3A 3FMKA 4ZLZA 1XJDA 4X6QC 5JQ8A 3DB8A 5L2SA 3LQ3A 5M08A 1DI8A 1GIHA 4G2FA 3UPXA 3NSZA 2YJRA 1NA7A 3G2FA 4JR7A 4JT3A 4L8MA 5GIPE 5ACKA 4GIIA 5EH0A 4FTQA 2XNNA 3QD3A 2GHGA 5EKOA 3W33A 3NUNA 4NWMA 1UU7A 3AT4A 4IWOA 4CTCA 3VS2A 2NO3A 1XBAA 4ZSGA 4TNDA 3R9OA 3D7ZA 4XBUA 2WMRA 4C33A 2OJFE 2W9ZB 3MN3A 4RC4A 4UYNA 3LFNA 3ZRLA 3BHTA 1KE9A 3CLYA 2R64A 3DT1A 4AW0A 4FVRA 4DTKA 5AMNA 1WMKA 2J0JA 3U87A 3JVSA 4BWKA 4PX6A 5CEIA 3QKKA 4BCKA 5EM5A 3HRFA 5CWZA 5HBEA 5DT4A 4FEQA 5EI6A 4YTIA 2IZRA 3F82A 4FVPA 2I0YA 4D58A 5J7HA 1QPCA 4OTRA 4TYJA 3DXPA 4WRGA 4FSUA 4RVMA 4ZZMA 3VBQA 1H24A 2OU7A 4FT3A 3W2PA 2UW4A 4DEHA 5IA3A 1JSVA 3FPMA 5AUZA 4EONA 4RVTA 4BCMA 3KVWA 4F6WA 2JEDA 4QMTA 5AP7A 3AT3A 5F95A 3U9CA 5HBJA 4D55A 2FB8A 2A4LA 2CGUA 4DH3A 5K3YA 5M57A 3D5XA 2Z02A 4ACCA 3TKHA 4XMOA 3NAXA 4C4IA 2QKRA 4WNKA 3E88A 2GS6A 4GMYA 3KXMA 3F9NA 5AM6A 4ZTQA 4O0TA 3BGQA 1GJOA 4RFZA 2PE2A 4EJ7A 4FSZA 2DUVA 2H34A 4J7BA 4TW9A 2W1EA 4I0RA 4AG8A 1QPDA 3FMMA 2XJ2A 1JNKA 1H28A 5C01A 5IEXA 3F3VA 4KS7A 1TQIA 4TXCA 5EI2A 4IJ9A 4NL0A 2G2HA 3QRKA 5IZFA 3FSFA 3KU2A 2WOTA 1P4FA 4PTEA 4RIWA 4AZVA 2VO7A 1KOBA 4WG5A 4NM0A 3TZ7A 3QQGA 5D12A 1FGIA 2JIIA 3C5IA 4JVGA 4IADA 5HHWA 4X21A 4YLLA 3RKBA 3AD5A 3TIYA 3ANQA 3R8MA 5LXMA 3R7OA 3CGFA 2WIPA 3LFBA 4FEUA 4XRLA 3T9IA 3E63A 3HV6A 5E91A 5F94A 2W4OA 2UZVA 4D2SA 3CQUA 3CE3A 3GC0A 4EKKA 4ANMA 3PXZA 3AQVA 3R6XA 2C3JA 3QUEA 3WIKA 4XYFA 4HYIA 4AAAA 1ZYJA 4DH8A 4ERWA 4YURA 1DAWA 2ZVAA 1YHSA 1H08A 2R5TA 3FHIA 4TT7A 3UOHA 5I9ZA 3LCOA 2ONLA 3JY0A 4IIRA 4DH7A 1J7IA 2XKFA 5CU4A 4F0IA 3BEAA 3KK8A 4JXFA 5DR2A 3DAKA 3GCPA 4MQ1A 2R3IA 3CBLA 4EH5A 3G33A 3AC5A 3TI1A 4YO4A 4NM5A 4E6DA 3D5VA 4RJ5A 4IE9A 3UQCA 5AP5A 3DDPA 5TR6A 4G6LA 1W82A 2V7OA 4TPTA 4RRVA 3UTOA 3W16A 4E5AX 4ASEA 5CVHA 5JRQA 4CMOA 4KSQA 2E9UA 4S2ZA 2PVLA 1WVYA 2ESMA 3N51A 3OWJA 4GCJA 1WVWA 4M69B 4B9DA 4W9XA 3RVGA 3SOAA 4ASDA 3G5DA 1E1XA 2OFVA 2ZM3A 5IA1A 5I0BA 3O0GA 5C26A 2VNWA 5DE2A 2F7EE 4L3JA 2C30A 4CYJA 1UKIA 5IA5A 4C34A 4DCEA 2JBPA 5E90A 3R21A 4ZOGA 4YJSA 4QMQA 3SVVA 1YOLA 4CZUA 5J87A 4C35A 1IA9A 2R4BA 2XYNA 1OVEA 5D1JA 4GFMA 3SQQA 5CU0A 1UKHA 3LXLA 1PXNA 3GU7A 4GS6A 2W99B 5FDXA 5CANA 3DB6A 3FLYA 4FG7A 3OT3A 3RCJA 2B1PA 5ETFA 3PXFA 4QMMA 4QMSA 1PXIA 2VTQA 4YJUA 4M84A 5ETIA 3SLSA 5I9WA 2QD9A 4HYUA 4JR3A 3A7JA 4E1ZA 1W84A 3Q2MA 4Z16A 4KRDA 4MBJA 4ALVA 2R3JA 1YI6A 3IW5A 3MW1A 1BX6A 5HI2A 3LW0A 4YC8A 3AMYA 2BZIB 4R6VA 4X2FA 4NKAA 3DNDA 3OXZA 4USEA 5IDPA 3NS9A 4EOOA 2QLQA 3HA6A 3KL8A 3QCYA 5I3RA 4DFXE 5J1VA 4PF4A 5BYZA 3NNXA 3F7ZA 4BCJA 3FZOA 1XH6A 2WTKC 4Q9SA 4CLIA 3JUHA 5CEQA 2WMSA 3NW7A 5E8SA 4G5JA 2BRGA 5LQFA 3UBDA 3CKXA 3ACKA 2WQMA 4BYIA 3C4WA 1J91A 4MXCA 5E8WA 2WMTA 4ITIA 2VTIA 2YFXA 5I9VA 3ZO2A 3LLAA 3E8NA 4FE2A 3EN4A 3ZFMA 4MF1A 2O65A 3EFWA 3Q4TA 4L46A 4B99A 5KUPA 1LPUA 2BUJA 3EYHA 2YIWA 1J1BA 2BCJA 2R3NA 2WFYA 3DJ6A 3POZA 3QD2B 3Q6UA 1JOWB 4O91A 3CS9A 3FMLA 1V1KA 2Y6OA 3QF9A 2ITVA 5JMSA 3GOKA 3PWDA 4J1RA 4AS0A 3BWJA 4FYNA 5KNJA 4XOZA 3R8UA 4ASXA 4AT3A 3FHRA 4G3EA 4F1TA 2CKEA 1OPJA 3C51A 1RE8A 4MNFA 1ZARA 2R9SA 2X9EA 4AGDA 2BALA 2ITQA 5FXRA 5AUWA 4IDTA 3TNQB 3F3WA 3ZONA 3L8SA 3R02A 4OTHA 1YW2A 2BRBA 4AW5A 3HDNA 5AAFA 2IW8A 1RJBA 2QO2A 2WO6A 4WG4A 5LWMA 3MB6A 3ZDIA 2OJJA 5JFSA 5LMKC 3TM0A 2PSQA 3IG7A 5CEOA 2WIHA 2BDWA 2XIXA 3DU8A 3MFRA 4H1MA 4LFIA 4UV0A 5D11A 4OT6A 3V8WA 1FMOE 3HMPA 3FMNA 5C27A 4E4XA 3R8LA 4R78A 3ZFXA 5EQYA 3SXFA 4IEBA 3P9JA 4YSMA 2I6LA 3ZC5A 2CKQA 3P08A 4E20A 4FV6A 4I6FA 2C5XA 3UNZA 5C8NA 1YRPA 4J95A 2IO6A 2IZTA 3L8XA 1I44A 4PQNA 4YNEA 3VWAA 3MH3A 4YTFA 3QQKA 5DRDA 5DR9A 5KMNA 2ZDUA 3DKGA 3REPA 4EK6A 5LWNA 5L6WL 3VO3A 5TT7A 4C2VA 2BR1A 2OXXA 5AAEA 4GT3A 4FG8A 4F6SA 4QYYA 3QRTA 3F3TA 5EM6A 4DFBA 4BKZA 3QBNA 4NJ3A 2C0IA 3R00A 4HVSA 4R3RA 3PJCA 4X3FA 2FSMX 3QZFA 1WBVA 5AV4A 3N4VA 4AQCA 4QTDA 2VNYA 3O7LD 2B0QA 5CAVA 2WTIA 3QAME 5HE2A 4FEXA 4FL1A 2X2KA 4AGWA 3S2PA 3C5UA 3DBDA 3QQJA 2Y9QA 5L6PA 4JL9A 3H3CA 2C6OA 2YM4A 1PY5A 3NLBA 2QOCA 1YXSA 1OKWA 3IGGA 2C68A 1W7HA 3KXNA 1NVSA 2C69A 3ITZA 4S31A 5K4JA 2RKUA 4FL3A 3O2MA 3PWYA 2E9OA 2YIXA 4FTUA 3OWLA 2AC3A 3PY1A 2YWPA 3R7GA 4RX8A 4GKHA 2C5VA 4RJ4A 4I41A 2Z2WA 3KGAA 3PJ3A 3BIZA 3EN9A 1J3HA 2F4JA 4WD5A 1CMKE 1S9JA 3FZPA 2YM5A 2WMWA 1E1VA 3DJ5A 4YZ9A 3K3JA 3MH0A 3RINA 4BF2A 5CSWA 5K5NA 4O6LA 2PPQA 2WQBA 3RAIA 4K1BA 3KXGA 4KIKA 5HG7A 1OL2A 1NXKA 5T6KA 3NCGA 3Q9ZA 5E8ZA 2GNHA 3UYSA 4G3GA 5AEPA 2OZAA 4A4LA 3R22A 2E9PA 2VO6A 2WMUA 4ZK5A 3M1SA 4HZSA 4CMUA 2HZNA 1PXMA 3E62A 2A2AA 2ZJWA 4QMZA 2WXVA 4YLJA 3EN7A 4FT0A 4WSQA 2ZB1A 2GTMA 4YJVA 4J52A 3MFSA 2UW9A 4C62A 4DGGA 3PVBA 5HO6A 2B4SB 4CFWA 4CRSA 3LLTA 2QU5A 5TE0A 3OMVA 3KN6A 2EU9A 2C6EA 3JR1A 2X8IA 1IA8A 3KA0A 5CYIA 5JQ5A 4OR5A 3SDJA 4DCAA 2WB8A 2XF0A 3LFQA 4LUDA 4HGEA 5GZAA 4J96A 3HV4A 2VUWA 3PIZA 2GHLA 5GINE 3TDWA 2JC6A 4FIIA 4CMTA 2WMQA 2GU8A 3PVUA 4IACA 4LQMA 5CT0A 5KMKA 4FGRA 3OEFX 3OS3A 5A3XA 4UALA 3QTRA 5AP0A 2VWVA 4L42A 2UZWE 1UWJA 4L67A 5EOBA 4YJPA 3N4TA 3NAYA 5AA9A 3CSVA 4LGHA 4QPMA 5AX9A 1VZOA 1DI9A 2FH9A 3OCGA 2FGIA 2W1HA 4V04A 5A9UA 3E8CA 4XV9A 1JKTA 3V8SA 3FMJA 2OKRA 4JQ7A 3QX4A 3KF4A 2WGJA 5HNBA 5B2KA 4F09A 3ZLWA 4D9UA 2XNBA 3P79A 3RBWA 5GNKA 1B38A 4BIDA 3V5QA 4BWXA 2VX0A 3DAJA 3RZFA 2BRHA 1LP4A 5DR6A 4ENXA 4MH7A 1Q8ZA 4MXZA 2QC6A 2XH5A 2ZV8A 2BAJA 4G3CA 4DGNA 5KKRB 5CENA 3ZUTA 3TUBA 5AV2A 3D2KA 3D7TB 2UW7A 3RAHA 3UO6A 2VWUA 2OW3A 3SGCA 4XG4A 3BEGA 3TCPA 4EH3A 3KMUA 1PXLA 1PXPA 3UJGA 2GQGA 4AZFA 3DNEA 4RBLA 4R7HA 3F66A 5E8XA 4FBXA 2C0TA 3WARA 3UZRA 3GB2A 3JYAA 2UV2A 4H3PA 3Q9XA 2R3HA 4RWIA 3R83A 3ORXA 4S34A 4ZEGA 2VGOA 3DLSA 3MPAA 5BVFA 2JFMA 4ZMFA 4X0MA 4MXXA 1URWA 3DZQA 1GZNA 4O6EA 4WNPA 4DTAA 3ZM9A 4IFGA 2ZM4A 5CLPA 1M2QA 1LUFA 4RJ3A 4U43A 3TJDA 1ZOEA 4D5HA 3GCSA 5ETAA 5A4TA 5EG3A 4D4SA 2QCSA 3I1AA 2W1GA 3AGLA 1Q24A 4AW2A 3BKBA 2IVTA 3UP2A 3OW4A 4D2VA 1YKRA 3VBTA 4C02A 4C37A 3KF7A 4IVDA 5M56A 3D0EA 2VX3A 5EM7A 5J8IA 3F5GA 2AYPA 2F2UA 3NUAA 4WHZA 4C4EA 4BDAA 4P5QA 3TXOA 5M09A 4X2JA 4I6BA 5DMZA 1KV1A 4O1OA 2Y4IB 1U46A 4BTFA 4FGBA 5JZJA 4KBKA 4FT7A 1G3NA 4ZTNA 2QG7A 1H27A 2X7FA 4DFUA 1Q41A 5AP2A 3EL7A 3HUCA 5E8VA 4CVAA 4O27B 5IA0A 3KCKA 3DCVA 3HZTA 5KKRC 4ZMEA 2IZUA 3F2AA 3RPRA 3BGZA 4C4FA 4YMJA 4U3YA 4X2KA 4DG3E 1B39A 3UC3A 1ZYCA 5JGBA 1W98A 5CAPA 3TACA 4CFXA 2YEXA 4LMNA 4UMRA 2V7AA 5J7BA 2P2IA 4K33A 2W1IA 3RTPA 3PE1A 4WBOA 4FTRA 4FZFB 3ORPA 4BIEA 3W1FA 2BFXA 4IM0A 4ANQA 4ZTRA 2YIYA 3SKCA 3NWWA 4ARKA 5JZNA 5HORA 3QYWA 2G2FA 3QCSA 2CGWA 3HEGA 4UZHA 2HZIA 4IFCA 4Q9ZA 3L9PA 3T9TA 4EHZA 4AXAA 4WUNA 4S30A 2C5YA 4TWOA 2CLQA 5IH5A 3BLRA 4ZIMA 1EH4A 1H07A 1ZLTA 2JD5A 4PY1A 3D2IA 5AADA 4QQCA 5AUUA 5K5XA 4GKIA 5IQIA 4RX9A 5CSXA 1YXXA 5G1XA 3AC1A 2CSNA 4QP8A 4BC6A 4R1YA 3RM7A 4QMVA 3GC8A 4U41A 3W2RA 5IQGA 4CNHA 3JPVA 2Y8OA 3QYZA 1I09A 3QLGA 3GCVA 4FZAB 4IAYA 4CYIA 2E9NA 2RFNA 3DLZA 2XEZA 4IZ5A 1NY3A 2GQRA 1JKKA 4CLJA 3UYTA 4O84A 4KB8A 3FY0A 4JLCA 2RSVA 2XM8A 1REJA 3ZLYA 2UW8A 5LVLA 4EOJA 4UMUA 2C3LA 2W5BA 3VUTA 2PU8A 3D5WA 3WF5A 3N4UA 3EZRA 4TYHA 3MA3A 4FKUA 4HCUA 5EHYA 2Z7SA 3NW5A 4ZY6A 3TTJA 3FLZA 2Z8CA 4GRBA 4X2GA 1Y91A 4IH8A 2LGCA 4GT5A 4F9YA 5HCYA 2BIKB 1XH4A 4CCUA 1XR1A 4O7YA 4QQ5A 3HAVA 4FIHA 2YZLA 2I7QA 2CDZA 1PXOA 4FSTA 1YWVA 2UZOA 5HE3A 3PP0A 2ETRA 4Z7GA 4RC2A 3HRBA 2WU6A 3I0QA 3I6UA 3ORIA 3QWJA 4OW8A 3Q9WA 4ITHA 5DT3A 5EDQA 5HIEA 2ITPA 2PMNX 5CAQA 3R9DA 5CS6A 2PMIA 4YJOA 5EK7A 1M7NA 3ZXZA 3KKVA 4FT9A 4E8AA 4UWYA 2HWOA 4CGAA 3OUNB 2JDTA 4BVUA 1APME 3OP5A 1OL1A 4KIOA 1LEWA 2BKZA 2IVSA 2W17A 4N6ZA 4C0TA 4FKWA 4I93A 3M42A 4UYAA 1W83A 3BV3A 4KINA 2RFSA 4G6OA 4F08A 2PL0A 2QURA 3BYVA 2RFEA 2W96B 2PVKA 4WUAA 4G6NA 3WZDA 4ZSJA 3SRVA 5A4CA 2QOLA 5M07A 4QYFA 3VS4A 5CI7A 4G3DA 3C1XA 4QQJA 4U0IA 4PPBA 1OKZA 3ULIA 3G15A 3U55A 1BYGA 3DQXA 3OBGA 4FMQA 4II5A 4PMMA 3BHUA 4IJPA 4YBJA 4EH6A 2PWLA 4KBAA 5J5TA 4KA3A 5CALA 3LFCA 3MH2A 5KZ0A 3THBA 4C4HA 4DEEA 1MRUA 3QA8A 4ZZOA 4K9YA 3PY3A 1JLUE 3CPBA 3NIEA 2ETMA 3RWQA 1Y6AA 1E9HA 4KKHA 2CCHA 1UU8A 3KY2A 3NGAA 2J9MA 3NNVA 4FX3A 2IVUA 3CY2A 4BI0A 4L43A 3LCSA 3LJ2A 4MYGA 1OZ1A 1W8CA 1K2PA 2PK9A 3RNIA 2BAKA 3P5KA 4XG3A 4EYJA 3ELJA 3KRJA 5KBRA 1WBPA 2I40A 3LMGA 3LZBA 4NK9A 4CFFA 3HAMA 1ERKA 2GFSA 2YDKA 3Q32A 4K6ZA 5AR4A 1CKIA 2W4JA 4CKRA 5HX8A 5HBHA 3D14A 3LCKA 3MJ2A 4O82A 2OJIA 3VF9A 3E3PA 4RWLA 4U79A 4BDJA 4JQEA 1GZOA 3FDNA 3QD0A 4DH1A 5IG1A 2H8HA 3FXZA 4F9BA 3PPJA 4X2NA 4NCTC 4O96A 1SM2A 4DEIA 1OL5A 3GC7A 2WMAA 3L9MA 2QOQA 4G34A 4NEUA 4BKJA 4FT5A 3QA0A 3E64A 2J51A 3DKOA 1BLXA 1XKKA 3C4CA 2XIZA 1DAYA 4TYGA 4EZ5A 3H9OA 5KHXA 4ZS0A 3MI9A 5DH3A 5ANKA 2JFLA 5M4IA 3H9FA 1V0PA 4WKQA 3QQFA 3OFMA 3FLWA 3G0FA 3QWKA 4EOKA 2WQEA 1XO2B 1QL6A 4DLIA 3NIZA 4M15A 3F61A 3W32A 3UC4A 3ZSIA 4Y46A 5FWKK 1PMNA 2DYLA 2HCKA 3PIYA 5E1EA 3RK9A 2QHNA 3JY9A 4V0GB 3TV6A 4AT5A 2J0MB 2PUUA 3ZEPA 4IX6A 4F0GA 4C8BA 2W1CA 5FTGA 2B9HA 5D41A 2X1NA 3OOMA 4FIGA 4LV5A 4U8ZA 3GOPA 5L8LA 5M4UA 5ANJA 3LCDA 3VVHA 4ACMA 3EFKA 4RFYA 3FEGA 3RHXA 4EBVA 3GNIB 3F5PA 4JRVA 4C61A 2HY81 2QR8A 5EYDA 3KMWA 1RQQA 3OTUA 5H8EA 4FNWA 4G17A 1YVJA 5IUIA 3M11A 3LAUA 3PUPA 1URCA 3A8XA 3VS0A 1STCE 3CY3A 4RSSA 4MF0A 2JITA 5CU3A 4M66A 3EOCA 3TTIA 1Q5KA 3VBXA 3MVJA 4BL1A 3OCBA 3QRJA 3OD6X 4O7WA 2PVHA 4U5JA 4TNBA 5A4EA 4F64A 4I24A 3OY1A 4YJTA 4BCIA 4EZ3A 2BHHA 2OJGA 3E7VA 2HOGA 3H4JA 5KMLA 2CGXA 5BPYA 5EM8A 3TNHA 4XBRA 4AZWA 4BCQA 1FGKA 3VAPA 3G6HA 3GFWA 2R3RA 2XEYA 3E8DA 4EOLA 2WD1A 4G31A 4JI9A 3C50A 5CNOA 2W5AA 2XIYA 3EYGA 5FXQA 4FZ7A 5FBNC 3P0MA 4LYNA 3FI4A 4FEWA 3QCQA 3BU5A 4FV3A 4BDDA 1U54B 3P4KA 3PA5A 2JDVA 4H58A 5J9LA 2OLCA 3KREA 4LGGA 3DGKA 3EN5A 2XUUA 5AP3A 2V22A 5H3QA 2Y0AA 5I9YA 4HCTA 1GIIA 4QT1A 3CIKA 4ANBA 5EW8A 1XWSA 4GJ3A 3B2TA 4B8MA 2OIBA 2XNMA 3U6HA 4APCA 2B53A 4OTQA 4YC3A 2GTNA 3R73A 1BL6A 1PHKA 4AX8A 4EH4A 4U97A 4MD8E 5BMMA 2CNUA 1NVRA 5BVWA 2VWIA 5AV0A 3ZBFA 5DT0A 5BMSA 2IW6A 3VNTA 1ZYDA 3IQ7A 3DXNA 4D28A 5HD4A 3Q2JA 4UMQA 4KIQA 1UWHA 5ANEA 4ZLYA 3K54A 4ZY5A 3CTQA 4ENYA 3SXSA 4DC2A 2J50A 3R8VA 1ZMWA 5KCVA 4RT7A 4YZMA 4P2KA 4BBFA 2R3MA 4ZLOA 3PDTA 3FYKX 4A9RA 4U81A 4NM7A 4TN6A 3PY0A 4MK0A 2XKCA 3QALE 3O8UA 3LXNA 4YPSA 4EYMA 3MIAA 5EHLA 3VS1A 4FOBA 5HLWA 3R7VA 4CFVA 4RLKA 3HYHA 3C4ZA 3VC4A 3CP9A 4O0YA 3BHVA 4KAOA 3V6SA 4DGOA 4O81A 5F20A 3TKIA 4ANLA 4ANOA 1A48A 3FJQE 1KWPA 2C6MA 4RJ8A 3PRFA 5HESA 3SW7A 3UIXA 4MNEA 5HTIA 4ZJIA 4L68A 3V3VA 1XBCA 2YDJA 3O8TA 4IVAA 3BLQA 2REIA 2C5OA 1WVXA 3DV3A 4BZNA 2F57A 3VHKA 4J71A 5AA8A 2B9IA 3COHA 4NJDA 2WELA 3LXKA 2HW7A 2XBJA 4L3PA 4E6CA 4F0FA 4F6UA 5LJJA 4J97A 5AM7A 2RG5A 2VWXA 2HY0A 4ACDA 5KMJA 3QD4A 2OO8X 4EK3A 3ZH8A 1OIUA 5LOHA 3QKLA 4W4VA 4B4LA 2VTRA 4TRLA 3LFAA 5KO1A 5L2QA 4BDCA 4NW5A 5AIRA 3RM6A 4FTLA 2J5EA 1KE5A 3W10A 4QMWA 1OUYA 3DK3A 3EKKA 4CKJA 3EZVA 1GOLA 4CFNA 4JJRA 5HQ0A 5J1WA 2CMWA 3QXPA 5EOLA 3EWHA 3TNWA 4R7BA 3DTCA 1P5EA 2YCQA 3EQBA 4O86A 4XH6A 4DE4A 3EQFA 3QC9A 5IH4A 2GSFA 2UW3A 3OCTA 4FIJA 4UY9A 2QHMA 3IPHA 3LM5A 2VAGA 4A9YA 3QU0A 1ND4A 4FC0A 3G9LX 3COIA 1IEPA 4K2RA 2OWBA 4XNEA 4C3RA 4PTGA 5FEDA 3SG9A 3FXXA 3ODZX 4BYJA 3EL8A 3VS3A 2A27A 3BPRA 3PLSA 3MIYA 3Q9YA 3V5PA 1R0PA 3PP1A 4QP1A 3VUIA 4D2TA 3UVPA 1JBPE 2EXCX 3L8PA 4BGHA 5A4LA 5CAOA 1OL7A 4M12A 1OIQA 3CTHA 3VW8A 5E4HA 4PDOA 4R5SA 1KE7A 1WBNA 4AZSA 2XCKA 4D1XA 3NCZA 4A9UA 1YXUA 3AMAA 1SNUA 4UMTA 3LJ0A 2XCHA 5M51A 3W8QA 2QOKA 3FQEA 3DFCB 1JVPP 2PE1A 4RJ7A 4X3FB 3A7GA 1PW2A 1ZXEA 4L44A 4XG2A 4O0XA 5AIKA 4A9SA 2KTYA 2ZB0A 1UNLA 3LE6A 5CVGA 3P78A 4UB7A 2BPMA 4F63A 5BVOA 5BUJA 5HKMA 3FYJX 2GS7A 5EYMA 2ITXA 2VU3A 4WO5A 3SC1A 2OFUA 3VUGA 3WYYA 5B2MA 2PY3A 4F99A 4Q5HA 3FKOA 1JQHA 2ZM1A 4WIHA 4BGGA 1ZAOA 5AP4A 4DA5A 5GJGA 4LRKA 2PVNA 5HTCA 4A4XA 4UN0C 3DBQA 4TWPA 4USDA 3UO5A 1JPAA 4JBVA 4MWHA 4E5WA 4JBPA 4BIBA 2PUIA 4PV0A 2X9FA 4A06A 1CKJA 2OK1A 4IB0A 5AP1A 5K0KA 5IDNA 1WBSA 4KIPA 4PP7A 3FKNA 2R3KA 4QMPA 2C1BA 2PZYA 4DH5A 4DYMA 5EDRA 4EI4A 2WKMA 1UVRA 2R2PA 3HDMA 4CCBA 5C4LA 3R1NA 4BCHA 4KIKB 5GJFA 5BVDA 3QL8A 5DPVA 3KULA 4YLKA 2JDOA 4Z55A 2OZAB 5FXSA 4BFMA 1JKLA 4XRJA 2Z7QA 4I20A 5I3OA 4IB5A 4U9AA 1P2AA 4TYIA 4YHTA 3R7EA 2PYWA 1JWHA 2UUEA 2GNLA 4K0YA 4CFMA 1Q8UA 3KRXA 1ZOGA 5ANOA 3BU3A 2YABA 4RVLA 3R7IA 4EHVA 3AD6A 3GCUA 4O38A 5FTOA 1GZ8A 3VBYA 1Q4LA 5DEYA 3R7UA 2ITYA 3UP7A 4LG4A 3NVKI 4FV7A 4AACA 2P3GX 2FYSA 2PVJA 4R7IA 2H6DA 1G5SA 2RG6A 2P55A 3AOXA 1Y57A 3OXIA 2QG5A 5CTPA 4BN1A 3E8EA 1DM2A 4IAAA 5L8JA 5FGKA 3U9NA 4ALWA 4K18A 3VS6A 3JXWA 5A6NA 1J7UA 1CDKA 4ZP5A 4ZZNA 1WFCA 3BI6A 3NEWA 3Q5ZA 3F5XA 2BDFA 3Q6WA 3TUCA 2NP8A 4GK3A 3O7LB 4CD0A 3L8VA 1H00A 2JLDA 3TZ9A 2X2LA 5JFWA 2J90A 4FKVA 4ACGA 4M68A 3HP2A 2RGPA 2X6DA 3KB7A 4QMNA 4EQUA 2JKOA 4QYGA 3COKA 3DTWA 2WMVA 4OTFA 3W2QA 3NVMB 2ZOQA 4GIHA 4XCUA 3FAAA 1VYWA 2I0HA 2W06A 3R63A 4F7JA 5LMBA 2O8YA 3OBJA 1M7QA 3FUPA 3D94A 1M52A 2VTHA 5IQBA 1IRKA 1M14A 4TY1A 4OBOA 1ZZ2A 4IX4A 2HZ0A 4RGJA 4AFEA 5H8GA 5HOAA 4PUZA 3HMOA 5CX9A 1OPLA 2IZSA 5LMKA 2OG8A 4C57A 4KRCA 2CNQA 3NRMA 1AD5A 4M0YA 2NPQA 4JDIA 2QOBA 4AW1A 4YNOA 4JAIA 3BE9A 4XLVA 1SVEA 4JG8A 4IX3A 5KMIA 2YA9A 3MV5A 5E8UA 5AV1A 4JX7A 4QD6A 4WG3A 5CXZA 4RLLA 2R3QA 1IAJA 4PMTA 1OL6A 3ZBXA 2W7XA 3LFEA 3GQIA 2XMYA 3IDBA 2UZNA 3TL8A 4CQEA 1F5QA 1IG1A 3FKLA 1SZMA 3PYYA 4FKRA 2YAKA 3GFEA 2UZUE 4JIKA 3WF9A 3RWPA 4LGDA 2WTDA 5EDPA 3TEIA 3RNYA 3KC3A 3BHHA 3KXHA 4NFNA 5JRSA 2J0KA 4QMYA 4ZJVA 2VTNA 3RGFA 4B7TA 3EMGA 4R1VA 4EKLA 4BTMA 3A99A 3AGMA 4L7FA 4AA5A 4QMXA 4HNFA 5E8TA 5AUYA 4YTCA 4Q2AA 3NUSA 5AFVA 4C2WA 3ZXTA 4CT2A 3TDVA 4DGMA 1R39A 4H1JA 2ITZA 4MHAA 5E8YA 4ANNA 4QMUA 4L53A 4OGRA 2PZIA 2OIDA 1L3RE 2HK5A 1Y8YA 3PSDA 5HE0A 3RMFA 4IM3A 5CF5A 3B2WA 3L9LA 2DS1A 2XP2A 5HLNA 4ACHA 4UXQA 3DK7A 4CXAA 3ZO1A 2VD5A 3MJ1A 1QPEA 3D15A 3G90X 5AUVA 3BYSA 2XRWA 4QP6A 3MPTA 4OBPA 3V5JA 4N6YA 3WILA 3FWQA 4AN3A 4MXOA 3QCXA 5M44A 3GVUA 2EB2A 4RWJA 3CTJA 1BL7A 3POOA 5B7VA 3A60A 3FZ1A 4QYEA 5DVRA 2H96A 1XH8A 3CC6A 1WBWA 2F9GA 3HRCA 2WQOA 3V5WA 1M2RA 1Q8WA 3OG7A 3CJFA 2CLXA 1JSUA 3EH9A 3Q52A 3W2SA 4KUJA 2BROA 3VUMA 4IZYA 4PTCA 4NYEA 3R1YA 3ATSA 3QRUA 4LOOA 4CRLA 1R0EA 3WZKA 2FO0A 3LJ1A 1OB3A 3MTLA 4AWIA 5L2IA 4FV8A 3PZHA 4GSBA 2C5NA 5LCKA 2X7GA 3GGFA 3DA6A 2QVSE 3E7OA 3IKAA 3LM0A 3P1AA 2JKQA 3ZSGA 4WA9A 3S1HA 5FD2A 2J0IA 2WQNA 3VF8A 3I4BA 3UVQA 4HZRA 5CZHA 4A9TA 3O51A 2QONA 3QTQA 5M53A 4D4RA 4H39A 1VYZA 4MTAA 2CN8A 2ETKA 5GZ9A 4G5PA 4BHNA 4YR8A 5KX8A 4W4YA 1KUTA 5CU6A 5FEEA 2WTWA 3IW4A 1VJYA 4BHZA 5E1SA 4ERKA 4G9CA 3MFTA 1CTPE 4HGLA 4KS8A 4ZSEA 4MD9E 5DNRA 2VX1A 4USFA 5E92A 3UIBA 4O2PA 4AN2A 2GFCA 4FV5A 4JBOA 2QLUA 5CASA 4LM5A 4D4YA 3MVMA 3TZ8A 1KE6A 2QR7A 3GC9A 4UEUA 3HUBA 4Y72A 3NW6A 1LR4A 5J9ZA 2R3LA 3C0HA 3HMNA 3SOCA 2HW6A 3NUXA 3QTZA 2F7XE 4LUEA 5ITAA 2JBOA 4YC6A 1OECA 3ZEWA 3OVVA 2CPKE 2WNTA 3ACJA 3Q96A 5JGAA 4YZNA 5LVPA 1FINA 2BZHB 4IAFA 4RIYA 4U40A 4FTAA 2YHVA 2I0VA 2XK6A 4WRSA 4BZOA 5J79A 2YLEA 3ERKA 4YGAA 4YPDA 1UU3A 4CEGA 3UMXA 1T46A 4NW6A 5CVFA 2JIUA 4E4LA 3BWFA 1SMHA 1F0QA 3QQLA 1OMWA 1YWRA 5EQPA 2FSTX 4BCFA 3Q04A 2B9FA 4P4CA 3OWPA 3H0YA 3KQ7A 4HGSA 5A6OA 2P33A 2QI8A 4I23A 3PTGA 4CV9A 1V0BA 4GJ2A 5ANIA 3KRWA 1X8BA 3CD8A 5KE0A 1RDQE 3VJOA 3QGWA 4FK6A 4DFYA 1YOMA 4ZS4A 2R0UA 5DHJA 4C3PA 3PG3A 4E26A 3MVHA 4IWPA 5C1QB 2LAVA 3EHAA 2FUMA 2PZRA 3T3UA 4BCNA 4L9IA 4E93A 4EZ7A 2BZKB 3T8OA 2O5KA 3UGCA 2QNJA 2YLFA 5LVNA 5BUIA 4QNAA 4XP3A 4IC8A 4HJOA 2ACXA 4DT8A 2EXEA 3FZSA 3R30A 4CKIA 2V62A 5IQDA 5JT2A 1U4DA 2ZYBA 2Q83A 4V05A 4DF3A 4O83A 3EB0A 4QTCA 2R3GA 3GQLA 2Y4IC 3DS6A 1Q99A 3TZMA 4B8LA 4FV9A 1PYEA 3SW4A 3H10A 2VZ6A 5GZ8A 4PDYA 2OBJA 3ZCLA 1ZOHA 3PXRA 5FP5A 1Q8YA 4L00A 2BAQA 2XB7A 4KSPA 4BRXA 4EOPA 1J1CA 3DY7A 3ZLSA 4AN9A 4CZYB 1LEZA 2QOFA 3RPVA 3TT0A 3BYOA 4F4PA 2BTSA 4IAZA 2XNGA 4TYEA 4RPVA 2C47A 3BYUA 4Y83A 1PKGA 3TV7A 3GU5A 4B6LA 4D0WA 4LOPA 5L2WA 4O7ZA 3FL5A 4RC3A 5B2LA 2OGVA 1R1WA 4RFMA 2YM8A 2BTRA 1OUKA 1H1RA 4FV2A 4YZDA 4C38A 5FRIA 2QOIA 1K9AA 2QO7A 3MDYA 2DQ7X 4RQKA 4YHFA 2ERKA 2B9JA 2JDRA 3EJ1A 3UQGA 3PXYA 3KRLA 1FMKA 5C03A 2YIQA 1Z57A 3KFAA 2VWZA 3OROA 4QPSA 3TIZA 2ZDTA 3QZHA 3VJNA 4EL9A 5KBQA 3R9RA 1F3MC 3AC4A 4FIEA 5EYCA 3VS7A 2XKDA 4BI2A 3DJ7A 3DDQA 4GYGA 2I1MA 5E9EA 4BTKA 4HVDA 2ITTA 3LQ5A 4RJ6A 3IO7A 4C4GA 5C9CA 4IXPA 4A7CA 3PA3A 3NYVA 4LRJA 5IUHA 1AGWA 1HCKA 3GP0A 2PVMA 3KN5A 2O64A 4XG7A 4DT9A 1H1SA 3S0OA 3FLQA 4X7QA 1H8FA 3FC1X 4I1ZA 5HIDA 4AU8A 3BU6A 3VHEA 1QCFA 1BUHA 3C9WA 3A7HA 3A2CA 3P23A 4O0UA 4OBQA 2FSLX 4H3BA 5ICPA 4FKOA 3IOPA 4FYOA 4A07A 1ATPE 3ZC6A 4FKPA 5HG9A 4NIFA 1XH5A 4FKIA 4EORA 4FTJA 1PKDA 3LQ8A 3MY1A 4TKSA 5KMMA 4FNZA 4GVJA 5JK3A 5ETCA 3HNGA 3QUPA 4GH2A 4U6RA 3SD0A 2WU7A 3EKNA 1UU9A 4M13A 3GBZA 4J99A 5CEKA 4AGCA 3CPCA 2XA4A 3BCEA 4CSVA 4I5MA 2C6LA 3FI8A 2ITOA 4FA2A 5DFPA 4RX5A 1H1WA 2X8EA 5F4NA 4FL2A 5D10A 2PE0A 4IHPA 4AOIA 3HP5A 5DRBA 3OF0A 5AP6A 4ANSA 1PMVA 4DGLC 1G8AA 2PUPA 5JKGA 4DBXA 3DFAA 3ETAA 3BHYA 3F7WA 4JIAA 4W8DA 4P5ZA 2W1ZA 3G9NA 1Q3WA 5BVKA 1GAGA 2JKKA 3MH1A 4LOQA 3MY0A 4PNIA 3U8WA 3E93A 1PXJA 3ID6C 3JS2A 3RZBA 4RX7A 4AA0A 1Z5MA 2J7TA 3FMEA 4E6AA 4RVKA 2ZV9A 5HG5A 5DYJA 5HO8A 4J53A 3ZRKA 3BQRA 4EC9A 1SVGA 4MXYA 2ITWA 3R28A 2G1TA 4O7LA 4FSRA 3ENHA 4FTTA 2IWIA 4WNOA 3SX9A 1YQJA 4EHGA 4EWHA 4KNBA 5CQUA 1WCCA 1OKYA 3A8WA 3I79A 4I6QA
chains in the Genus database with same CATH superfamily
3OCSA 2ZV7A 2UVXA 2B54A 2VN9A 4NFMA 3AD4A 5DEWA 5FQDC 3U4UA 5CY3A 3MS9A 4BDFA 2XK3A 2XNPA 4A4OA 1QPJA 1M17A 1MQBA 2R7BA 5D7AA 4RIWB 4BR3A 4NCTA 1KE8A 5AAGA 3TWJA 3UMWA 3PLAE 2B52A 4CTBA 4BY9E 2VTOA 3KRRA 4BWPA 1WBTA 4Q5EA 3GXLA 5DN3A 2AUHA 5LVOA 3G6GA 1Q8TA 3C4XA 5LARA 3CD3A 3CR0A 3F3UA 5HVJA 2JGZA 2YM3A 4MAOA 2X0GA 3WYXA 1R3CA 3W2OA 4FTOA 4G3FA 4C3FA 3W2CA 5JH6A 2WTCA 4M7IA 3PSBA 3UDZA 1OKVA 2HXQA 3K5UA 5GIOE 1NT2A 4OT5A 1G8SA 2W05A 2YERA 4FV4A 3OT8A 3RK5A 5FEQA 5L3AA 2XS0A 1GNGA 3K3IA 3BRBA 3FL4A 4XP0A 3FSKA 4XV3A 3EFLA 2C3IB 3AG9A 4O0SA 2QOHA 4E7WA 4DBNA 4EUTA 4QQTA 4M14A 4OTDA 3IOKA 3LFDA 4DG0E 2Z7RA 1U59A 2VTMA 3CJGA 4QMLA 5TO8A 4FNXA 3PXQA 3FMDA 4DN5A 5BQ0A 5CI6A 2CGVA 3QKMA 5EI8A 4I92A 3ZS5A 5EKNA 4QP7A 1PMUA 3C4FA 3LCTA 4GU9A 1VEBA 4JQ8A 1XMMA 3VIDA 4FTCA 3U6IA 3HMIA 2C6DA 2VTAA 4NZWB 1PF8A 3MVLA 3LMHA 4PL4A 4M3QA 2JAVA 3CCNA 3EQGA 2PTKA 3WF6A 2UVZA 4W4WA 3W8LA 4OAUC 3EIDA 3IGOA 4Y5HA 4YJQA 4RIXA 2FSOX 4FK3A 4UBAA 4YO6A 4EQCA 3BGPA 1WAKA 4EK4A 2G15A 5HNIX 3U6JA 4XJ0A 3KEXA 2C6TA 1BKXA 3II5A 5BVNA 5I4NA 3PVWA 2NNWB 2PMLX 2XBAA 3EN6A 2XK8A 3W55A 5C4KA 4V01A 5T3QA 5KHWA 3PPZA 5IUGA 4ZTMA 2QKWB 1MRVA 5IA2A 4RZVA 4QP4A 3QTUA 3NMUF 1A9UA 2F2CB 5AX3A 2YITA 1YHVA 3FXWA 3R7YA 1CKPA 2F7ZE 4NTSA 3TG1A 4JOAA 4GT4A 3MY5A 3UOLA 3VUDA 1XHAA 4C58A 2NRYA 3A4OX 4D2WA 3I81A 3R8PA 5LVMA 4FUYA 1MP8A 4TWCA 3TJCA 3W18A 3PJ1A 4FNYA 4GV1A 2P2HA 4DG2E 4GK2A 5EW3A 2YISA 3MTFA 5A54A 2ONLC 1FOTA 4LDTA 4MWIA 4EQMA 5I9XA 3QZGA 4H36A 4XS2A 4GEOA 5CZIA 2Y6MA 4AOJA 3ATTA 4R3CA 2PVYA 3A7FA 1TQMA 2HYYA 2V55A 4V0GA 2BHEA 3HMMA 3UQFA 4FTIA 4HCVA 3Q4ZA 1UNGA 5AUTA 2R0IA 3AXWA 3QQHA 1KSWA 2CCIA 1ZY4A 5AUXA 5HNGA 3DOGA 4LV8A 3WI6A 3MFUA 2HXLA 4EHEA 2IN6A 3GT8A 3LOKA 2X7OA 4IAIA 4D9TA 2IVVA 2RIOA 3FE3A 3K5VA 4IZ7A 4QO9A 3HL7A 3MGYA 4AZTA 5IA4A 4FF8A 4UZDA 1J7LA 1SNXA 3ORLA 3QTSA 4IDVA 5EFQA 4BKYA 3CGOA 2E9VA 3FC2A 4M8TA 3F3ZA 2XNEA 3KXXA 1MQ4A 2ITUA 4S33A 3VBVA 1ZYSA 4OTIA 4UWCA 3OXTA 5HCZA 4NKSA 4O0RA 2XIKA 1YI4A 5HU9A 2R3FA 3GU4A 1Y8GA 3ORKA 2XYUA 3A7IA 1UNHA 1OITA 3DBFA 4LRMA 3C0IA 5AWMA 3KULB 4DAWA 3GI3A 2Y4PA 4FR4A 4LI5A 4D2RA 4UX9A 2QU6A 1ST0A 3PG1A 3ZDUA 3FLSA 4CQGA 3DZOA 4R77A 3UZPA 1VR2A 1PYXA 2XJ0A 3I60A 3IDCA 4PDPA 2HWPA 5CXHA 4ZXTA 1OBDA 2YCRA 3ZOSA 5IQEA 4Z3VA 3R2BA 1KOAA 3BBWA 3OWKA 3RCDA 5L8KA 3NNUA 4U3ZA 5IQAA 3RPSA 5IEVA 4ZJJA 4JDKA 3H0ZA 3KXZA 4C7TA 4QTBA 4KBCA 4DEBA 4I94A 3ZSHA 2W5HA 5BYLA 2WTKB 2YCFA 3BLHA 3O17A 2W9FB 3PVGA 1GY3A 4W4XA 4W8EA 3ZTXA 3CQWA 3Q3BA 1O9UA 3ORTA 5HEZA 1U54A 4IAKA 2VGPA 5HICA 5L4QA 3NNWA 3NX8A 3QC4A 5AR8A 4N4SA 3HECA 4O22A 5FBOA 4NT4A 3LIJA 2QO9A 4J8NA 3RP9A 5HX6A 3ORZA 1XH7A 4R5YA 4EOMA 4UMPA 1H1QA 2OXDA 2YIRA 4H3QA 4L6QA 5D9HA 4F7NA 4P7EA 5GJDA 5T68A 1XQZA 2Z60A 1H26A 2VO0A 2C4GA 5BUEA 5IISA 2IG7A 2V5QA 1AQ1A 4XG6A 4F7SA 2XRUA 2J6MA 4RZWA 2UW6A 3WE8A 4FSNA 3R0TA 3IDPA 2BILB 3HV7A 2BKKA 1SYKA 2B7AA 2P0CA 3EQHA 3IECA 4PL5A 4U80A 4Y73A 5CSHA 2OH0E 4ALUA 4EOSA 5K0XA 3I7BA 4DITA 2PZPA 4LL5A 4M0ZA 3QTWA 4JNWA 3UNKA 2RF9A 3R8ZA 5FLFA 4O2ZA 2VTPA 4U7ZA 3CQEA 3EFJA 3QHRA 2BZJA 2C1AA 1OPKA 3QXOA 1OGYA 4BICA 5M4CA 5A14A 2HIWA 4FKGA 2CKPA 5DA3A 4EK8A 3R2YA 4I5PA 3BELA 2J2IB 2VTJA 3HLLA 4MEDA 4WSYA 4EOIA 4AT4A 2BDJA 5DBXA 5EHOA 4PPAA 4CZTA 3C4EA 4IBMA 4OUCA 3PFQA 4IVCA 4NM3A 5F9EA 4IX5A 4MCVA 4EJNA 4GG7A 3MB7A 3V6RA 1WZYA 3HV3A 4XOYA 3ROYA 3PXKA 4NH1A 3QZIA 4QTEA 3BV2A 5HZNA 3EQCA 4ONAA 2I0EA 2CN5A 1B6CB 1H4LA 4F1OA 1H01A 3DK6A 4EBWA 5CF8A 4XEYA 2O0UA 4D0XA 1YWNA 4N70A 4O0WA 4PDSA 3SA0A 2PULA 1FBNA 4PWNA 4FVQA 4F65A 3BL9A 3FI2A 2O3PA 2VO3A 3NDMA 5DGZA 4I5HA 4XUFA 2J5FA 3QFVA 4ITJA 4APPA 2NRUA 2WZJA 4F9AA 2DWBA 4BDEA 3O96A 3TUDA 2ZMDA 3AC3A 3CKWA 4IW0A 4L52A 1U5QA 1XBBA 4RMZA 4E73A 1OBGA 4X3FC 2X39A 4JDHA 2OH4A 3QTIA 4O4EA 1YXVA 3IK3A 2UZBA 4FSMA 2YZAA 3AT2A 3D9VA 3ZZEA 3LHJA 4MVFA 2JKMA 4LL0A 5EQEA 4HNIA 4NU1A 1Q62A 2BIYA 2G9XA 4HVGA 2W4KA 4IVBA 4X6RA 4EH8A 4UWBA 3ZUUA 4M69A 4E6QA 2GDOA 3E3BX 3Q4UA 1NW1A 3DBCA 5K4IA 3ZU7A 2GS2A 3UO4A 3ET7A 2JAMA 5JFXA 2EXMA 2VTLA 3V5LA 3RJCA 4I0SA 4HVIA 4HW7A 3ENMA 2YDIA 3AMBA 3I6WA 5C8MA 4JS8A 3SAYA 2GPHA 4YUQA 4GU6A 4ZTHA 1YI3A 4MX9A 4ZTSA 5I5ZA 3DBEA 5E7RA 4AE9A 4FSYA 5ACBC 3ZRMA 5CEMA 4AGUA 5KZIA 2UZDA 2OSCA 5AR7A 3EQPA 4BTJA 4GFOA 3MPMA 3NUPA 3LXPA 4AFJA 3WZEA 3L1SA 3Q60A 4HOKA 4FV1A 3QTXA 2WTJA 4PRJA 4ZSLA 3H30A 4I21A 5I9UA 3GENA 4HYHA 4AA4A 4O7TA 2Q0NA 3SHEA 1IR3A 4KKGA 3ZMMA 4BDGA 2XANA 5L2TA 2J4ZA 4DEDA 1YDTE 4I4EA 5HGIA 4NSTA 3NPCA 4DHZA 4GW8A 3RHKA 4OTGA 3WZUA 5KMOA 4FOCA 3C0GA 5IPJA 4IWQA 1YOJA 5HO7A 5IMEA 2R3PA 4O4FA 3R9HA 3ALOA 3RALA 2CNVA 1JAMA 3NYNA 3F2RA 3G0EA 4RIOA 3QX2A 4DFNA 4C4JA 4FZ6A 2XVDA 4ASZA 3RPOA 3HA8A 4ZY4A 5IQCA 4YJNA 4Y5QA 3F5UA 1R78A 3KK9A 3R9NA 2CKOA 2X0PA 1ZZLA 1RW8A 3HKOA 1SVHA 4JG6A 4YZBA 2PVFA 5AR5A 5B0XA 4AE6A 2C6IA 2ITNA 3ROCA 3UPZA 3EQIA 1OIYA 3LKMA 2XZSA 3EQRA 2QOOA 3GCQA 3O5AA 4EWQA 4O21A 1O6LA 4RWKA 4GFGA 4ZTLA 3NZ0A 1REKA 2WMBA 4GUBA 3ZYAA 3R1QA 2UZTA 2GNGA 4AAYA 3S00A 1JSTA 2R3OA 3BX5A 3FY2A 3QQUA 4CG9A 4QP3A 2XKEA 2YACA 4I4FA 4IZAA 4XX9A 5CF4A 3F2NA 5HIBA 4ID7A 2XJ1A 4FIFA 2JIVA 3CXWA 4RIYB 5FM2A 2W1FA 4XHKB 4XG9A 2GQSA 3LFSA 3VQUA 3NR9A 1L8TA 5M4FA 4R3PA 4J98A 4U44A 1K3AA 3NUYA 3SXRA 3ORMA 2PUNA 4DDIA 3VULA 3MWUA 2V0DA 3VW6A 4YZCA 2VTTA 1FQ1B 2G01A 2VWWA 3MYGA 3BBTB 5K9IA 3WBLA 3VUKA 4XV2A 3WF8A 2FVDA 4EEVA 2PZ5A 3I7CA 4KKEA 2HZ4A 1ZMUA 1FVVA 2X4ZA 4OTPA 4DLJA 5IMXA 4L01A 1HOWA 3P7BA 4G16A 4DINA 4IM2A 3LPBA 4YTHA 5AR3A 5TF9A 2ZAZA 2QQ7A 4PL3A 3ORNA 1BMKA 4OLIA 3RAWA 2R7IA 3C13A 1Q3DA 2YJSA 4G1WA 3WF7A 1P4OA 4YU2A 3HVCA 3AC8A 2WMXA 3I5NA 2YAAA 3P86A 5DI1A 2GNIA 4FZDB 2VRXA 3AC2A 3RAKA 3TNIA 4M97A 4AUAA 3DAEA 4D1ZA 2X0QA 3B8RA 4C59A 3OY3A 4DFLA 4I6LA 2J0LA 2X8DA 5IU2A 2F49A 4QPAA 5JEBA 4QOXA 3Q5IA 3V04A 1ZMVA 4K77A 1S9IA 4EH2A 5JFVA 5H2UA 1OI9A 4O7RA 1OGUA 4L45A 3F6XA 5JSMA 2XM9A 4Y85A 2HELA 2WHBA 3PZEA 3UVRA 4AXFA 2A19B 4O1PA 4PMSA 2GHMA 2XIRA 4YP8A 3VS5A 4EH9A 4J8MA 3RI1A 4YSJA 3GU6A 3FPQA 3UIMA 3WZJA 4BI1A 5CF6A 3QHWA 4L7SA 4TYHB 5AR2A 2UW0A 5H8BA 4PNKA 3D83A 3U54A 5IQHA 3C7QA 2AC5A 3PRIA 3A4PA 3OZ6A 3FMHA 3OHTA 4RQVA 4EH7A 5J5SA 5IQFA 3GUBA 4QP9A 3TNPC 2IJMA 3BYMA 3E92A 4MBLA 4QRCA 3QLFA 1CSNA 2WAJA 3LFFA 5DG5A 5DWRA 4RA5A 1P14A 2P4IA 4F7LA 2UW5A 2YM7A 1XH9A 3CEKA 1YXTA 3FZTA 1OM1A 3UDSA 2UVYA 3P7CA 3D5UA 2X6EA 4I0TA 5HTBA 4BDKA 3V01A 3I0OA 3GU8A 4BCPA 1Y6BA 3DKCA 4ORKA 2A0CX 5BNJA 2HENA 3N9XA 3MSSA 5FG8A 2GMXA 5FP6A 3VRZA 5FUTA 4MD7E 2SRCA 3FZRA 1ZRZA 4FTMA 5HU3A 2OICA 4FKLA 3FV8A 3UDTA 4M67A 3LVPA 2XNOA 2OXYA 2BMCA 4GVAA 5CNNA 2YCSA 1H1PA 4HVHA 3O71A 3O23A 1MRYA 2RL5A 3E87A 4E3CA 3SRVB 5FDPA 4BCGA 2PVRA 4DFZE 4HPUE 1FVTA 1GIJA 4GYIA 4QYHA 4RA4A 4F1MA 4CG8A 2C3KA 4TZRA 5HVYA 1ST4A 4X3JA 4MXAA 5BX0A 5CEPA 4FODA 4GUEA 4JX3A 4OTWA 2W0JA 5AJQA 2OF2A 4BDHA 5J9YA 5JGDA 3B8QA 4IC7A 4MBIA 4OAVB 4PPCA 4YJRA 3ZLXA 4DTBA 3V51A 4IANA 2O2UA 3OTVA 3ALNA 1BI7A 3UE4A 4QTAA 4BJJB 4GG5A 3O50A 4FEVA 1Q61A 4NIFB 3S4QA 4XV1A 3SV0A 2EUFB 4DEAA 5M55A 5HE1A 4CFUA 3DXQA 4I22A 2XK9A 4AP7A 2QODA 3UZTA 5M06A 2ZMCA 2CJMA 3ZO3A 1GZKA 4FKJA 4XP2A 2GCDA 2RFDA 4FI1A 4O0VA 4NTTA 5A4QA 2C0OA 3ZUVA 3NYOA 1CM8A 3Q4CA 4PP9A 3FQSA 4C36A 4WNMA 5F1ZA 1H0VA 1H0WA 3UNJA 3TN8A 4O7VA 4H05A 3D7TA 5HG8A 5FM3A 3KVXA 4MQ2A 3O8PA 4FTKA 3V8TA 5DOSA 3A62A 4DHFA 2XK7A 3PSCA 3WE4A 3ODYX 4FKQA 1TVOA 5TKDA 5L6OA 4O7NA 1BI8A 3D4QA 1A06A 1PMEA 3DQWA 2YM6A 1T45A 4P90A 3PE2A 4TTHB 3ULZA 1PRYA 3SG8A 1YDRE 3S3IA 1UA2A 4XLIA 4BDIA 2IF8A 3DKFA 4E4NA 1UV5A 2BRNA 3PPKA 2XALA 3IW8A 5H9BA 4CT1A 4FKSA 4IB3A 5GHVA 4G9RA 4QP2A 5C8KA 3K2LA 2UZEA 5CSPA 3VRYA 2AEGA 2WEVA 5J95A 3VQHA 2WOUA 4BBEA 5A46A 3WOWA 4EOQA 4IQ6A 4Y8DA 1ZY5A 4F9CA 3PJ8A 4AZEA 1MUOA 1U5RA 1W0XC 3U51A 3F88A 4CV8A 4AXEA 4XG8A 4JBQA 3Q53A 2Y7JA 3HX4A 1PXKA 4YHJA 3ZZWA 5JN2A 3IW7A 1NVQA 1KV2A 4Y95A 3FLNC 1FPUA 5HD7A 5DIAA 4D5KA 4EC8A 3COMA 3IS5A 3V5TA 2CHLA 3ML1A 3OUKA 2KULA 4D2PA 4HGTA 3ZO4A 1O6KA 3IW6A 3OEZA 1H25A 5AV3A 5ANGA 4LMUA 4BDBA 3M2WA 3NUUA 5LCJA 3KMMA 2BRMA 4IWDA 1DS5A 4K11A 5TOZA 3JVRA 2H9VA 4IMYA 3QRIA 4K8AA 4WOVA 3VN9A 5IEYA 4WBBB 3IONA 3UDBA 2VWYA 3L9NA 4DEGA 5IH6A 4AQKA 3DPKA 3HV5A 4D1SA 3T3VA 3ZM4A 1V0OA 1OIRA 2B55A 4W9WA 2X2MA 3R1SA 2XK4A 3TV4A 4I3ZA 5BYYA 3MBLA 3VUHA 4HPTE 3RK7A 4U45A 4BBMA 4FUXA 2PHKA 2VTSA 3LMIA 2E2BA 3F69A 4BGQA 4JDJA 4O7SA 3FI3A 4EK5A 3P7AA 4S32A 1O6YA 5BVEA 4AF3A 4AOTA 3NYXA 4HYSA 3FBVA 3EQDA 4IB1A 4JAJA 4TWNA 4JG7A 3PIXA 1ZWSA 4PMPA 2OI4X 3PA4A 2YN8A 3UIUA 4FG9A 5ANDA 5CAUA 3ZHPC 3R04A 2A1AB 3MA6A 5EW9A 2ERZE 2OIQA 5G6VA 3UG1A 4E5BA 4BB4A 2WTVA 4E4MA 2OJ9A 3G51A 4RIXB 1IAHA 4R8QA 2WEIA 4QNYA 4MKCA 3BE2A 3OOGA 3QGYA 4FICA 3TKUA 2VWBA 1JKSA 2BFYA 1M2PA 4B0GA 2YWVA 4ZAUA 3HGKA 4JRNA 2WPAA 1YHWA 5HVKA 4UXLA 2X4FA 3QUDA 5DLSA 2GNFA 2EWAA 4BZDA 2Z7LA 2BVAA 2OF4A 4TL0A 1YDSE 1Z9XA 2VV9A 3GEQA 4N0SA 1WBOA 2W1DA 1IASA 5FTQA 3OW3A 4F9WA 5EYKA 2ZV2A 2G2IA 2IPXA 4FSQA 4FTNA 5CSVA 4N57A 5CQWA 1QMZA 4U42A 4YBKA 5HCXA 3WIGA 2XAMA 1Q97A 2X81A 5IF1A 4KD1A 3I5ZA 3U4WA 2HAKA 1ZYLA 2GNJA 3PJ2A 4L3LA 3FQHA 3KCFA 5CT7A 2Q0BA 1FVRA 4FSWA 4GL9A 2PMOX 2OZOA 4QMOA 3OC1A 5CU2A 2O63A 2C6KA 3UG2A 1HCLA 2UZLA 4ZSAA 1XMLA 3H9RA 5IKWA 4FV0A 3VBWA 3R71A 4GK4A 5LMAA 5HLPA 2JDSA 4Z7HA 4MNEB 4KABA 1TQPA 4WT6A 4EUUA 4Z9LA 2FA2A 1PJKA 2EB3A 3UOJA 2EVAA 4FKTA 4I5CA 3UOKA 3ANRA 3R01A 3ZFYA 4I6HA 3BQCA 3A61A 3AKJA 1TKIA 3UODA 4F70A 3RPYA 2IW9A 3MESA 4D4VA 4RG0A 4NUSA 4BCOA 3E5AA 3S95A 5D7VA 4KWPA 3BZ3A 3FMKA 4ZLZA 1XJDA 4X6QC 5JQ8A 3DB8A 5L2SA 3LQ3A 5M08A 1DI8A 1GIHA 4G2FA 3UPXA 3NSZA 3NFGB 2YJRA 1NA7A 3G2FA 4JR7A 4JT3A 4L8MA 5GIPE 5ACKA 4GIIA 5EH0A 4FTQA 2XNNA 3QD3A 2GHGA 5EKOA 3W33A 3NUNA 4NWMA 1UU7A 3AT4A 4IWOA 4CTCA 3VS2A 2NO3A 1XBAA 4ZSGA 4TNDA 3R9OA 3D7ZA 2IEWA 4XBUA 2WMRA 4C33A 2OJFE 2W9ZB 3MN3A 4RC4A 4UYNA 3LFNA 3ZRLA 3BHTA 1KE9A 3CLYA 2R64A 3DT1A 4AW0A 4FVRA 4DTKA 5AMNA 1WMKA 2J0JA 3U87A 3JVSA 4BWKA 4DDGA 4PX6A 5CEIA 3QKKA 4BCKA 5EM5A 3HRFA 5CWZA 5HBEA 5DT4A 4FEQA 5EI6A 4YTIA 2IZRA 3F82A 4FVPA 2I0YA 4D58A 5J7HA 1QPCA 4OTRA 4TYJA 3DXPA 4WRGA 4FSUA 4RVMA 4ZZMA 3VBQA 1H24A 2OU7A 4FT3A 3W2PA 2UW4A 4DEHA 5IA3A 1JSVA 3FPMA 5AUZA 4EONA 4RVTA 4BCMA 3KVWA 4F6WA 2JEDA 3W0QA 4QMTA 5AP7A 3AT3A 5F95A 3U9CA 5HBJA 4D55A 2FB8A 2A4LA 2CGUA 4DH3A 5K3YA 5M57A 4FJVA 3D5XA 2Z02A 4ACCA 3TKHA 4XMOA 3NAXA 4C4IA 2QKRA 4WNKA 3E88A 2GS6A 4GMYA 3KXMA 3F9NA 5AM6A 4ZTQA 4O0TA 3BGQA 1GJOA 4RFZA 3W0RA 2PE2A 4EJ7A 4FSZA 2DUVA 2H34A 4J7BA 4TW9A 2W1EA 4I0RA 4AG8A 1QPDA 3FMMA 2XJ2A 1JNKA 1H28A 5C01A 5IEXA 3F3VA 4KS7A 1TQIA 4TXCA 5EI2A 4IJ9A 4NL0A 2G2HA 3QRKA 5IZFA 3FSFA 3KU2A 2WOTA 1P4FA 4PTEA 4RIWA 4AZVA 2VO7A 1KOBA 4WG5A 4NM0A 3TZ7A 3QQGA 5D12A 1FGIA 2JIIA 3C5IA 4JVGA 4IADA 5HHWA 4X21A 4YLLA 3RKBA 3AD5A 3TIYA 3ANQA 3R8MA 5LXMA 3R7OA 3CGFA 2WIPA 3LFBA 4FEUA 4XRLA 3T9IA 3E63A 3HV6A 5E91A 5F94A 2W4OA 2UZVA 4D2SA 3CQUA 3CE3A 3GC0A 4EKKA 4ANMA 3PXZA 3AQVA 3R6XA 2C3JA 3QUEA 3WIKA 4XYFA 4HYIA 4AAAA 1ZYJA 4DH8A 4ERWA 4YURA 1DAWA 2ZVAA 1YHSA 1H08A 2R5TA 3FHIA 4TT7A 3UOHA 5I9ZA 3LCOA 2ONLA 3JY0A 4IIRA 4DH7A 1J7IA 2XKFA 5CU4A 4F0IA 3BEAA 3KK8A 4JXFA 5DR2A 3DAKA 3GCPA 4MQ1A 2R3IA 3CBLA 4EH5A 3G33A 3AC5A 3TI1A 4YO4A 4NM5A 4E6DA 3D5VA 4RJ5A 4IE9A 3UQCA 5AP5A 3DDPA 5TR6A 4G6LA 1W82A 2V7OA 4TPTA 4RRVA 3UTOA 3W16A 4E5AX 4ASEA 5CVHA 5JRQA 4CMOA 4KSQA 2E9UA 4S2ZA 2PVLA 1WVYA 2ESMA 3N51A 3OWJA 4GCJA 1WVWA 4M69B 4B9DA 4W9XA 3RVGA 3SOAA 4ASDA 3G5DA 1E1XA 2OFVA 2ZM3A 5IA1A 5I0BA 3O0GA 5C26A 2VNWA 5DE2A 2F7EE 3NFFB 4L3JA 2C30A 4CYJA 1UKIA 5IA5A 4C34A 4DCEA 2JBPA 5E90A 3R21A 4ZOGA 4YJSA 4QMQA 3SVVA 1YOLA 4CZUA 5J87A 4C35A 1IA9A 2R4BA 2XYNA 1OVEA 5D1JA 4GFMA 3SQQA 5CU0A 1UKHA 3LXLA 1PXNA 3GU7A 4GS6A 2W99B 5FDXA 5CANA 3DB6A 3FLYA 4FG7A 3OT3A 3RCJA 2B1PA 5ETFA 3PXFA 4QMMA 4QMSA 1PXIA 2VTQA 4YJUA 4AXCA 4M84A 5ETIA 3SLSA 5I9WA 2QD9A 4HYUA 4JR3A 3A7JA 4E1ZA 1W84A 3Q2MA 4Z16A 4KRDA 4MBJA 4ALVA 2R3JA 1YI6A 3IW5A 3MW1A 1BX6A 5HI2A 3LW0A 4YC8A 3AMYA 2BZIB 4R6VA 4X2FA 4NKAA 3DNDA 4FRFA 3OXZA 4USEA 5IDPA 3NS9A 4EOOA 2QLQA 3HA6A 3KL8A 3QCYA 5I3RA 4DFXE 5J1VA 4PF4A 5BYZA 3NNXA 3F7ZA 4BCJA 3FZOA 1XH6A 2WTKC 4Q9SA 4CLIA 3JUHA 5CEQA 2WMSA 3NW7A 5E8SA 4G5JA 2BRGA 5LQFA 3UBDA 3CKXA 3ACKA 2WQMA 4BYIA 3C4WA 1J91A 4MXCA 5E8WA 2WMTA 4ITIA 2VTIA 2YFXA 5I9VA 3ZO2A 3LLAA 3E8NA 4FE2A 3EN4A 3ZFMA 4MF1A 2O65A 3EFWA 3Q4TA 4L46A 4B99A 5KUPA 1LPUA 2BUJA 3EYHA 2YIWA 1J1BA 2BCJA 2R3NA 2WFYA 3DJ6A 3POZA 3QD2B 3Q6UA 1JOWB 4O91A 3CS9A 3FMLA 1V1KA 2Y6OA 3QF9A 2ITVA 5JMSA 3GOKA 3PWDA 4J1RA 4AS0A 3BWJA 4FYNA 5KNJA 4XOZA 3R8UA 4ASXA 4AT3A 3FHRA 4G3EA 4F1TA 2CKEA 1OPJA 3C51A 1RE8A 4MNFA 1ZARA 2R9SA 2X9EA 4AGDA 2BALA 2ITQA 5FXRA 5AUWA 4IDTA 3TNQB 3F3WA 3ZONA 3L8SA 3R02A 4OTHA 1YW2A 2BRBA 4AW5A 3HDNA 5AAFA 2IW8A 1RJBA 2QO2A 2WO6A 4WG4A 5LWMA 3MB6A 3ZDIA 2OJJA 5JFSA 5LMKC 3TM0A 2PSQA 3IG7A 5CEOA 2WIHA 2BDWA 1VLRA 2XIXA 3DU8A 3MFRA 4H1MA 4LFIA 4UV0A 5D11A 4OT6A 3V8WA 1FMOE 3HMPA 3FMNA 5C27A 4E4XA 3R8LA 4R78A 3ZFXA 5EQYA 3SXFA 4IEBA 3P9JA 4YSMA 2I6LA 3ZC5A 2CKQA 3P08A 4E20A 4FV6A 4I6FA 2C5XA 3UNZA 5C8NA 1YRPA 4J95A 2IO6A 2IZTA 3L8XA 1I44A 4PQNA 4YNEA 3VWAA 3MH3A 4YTFA 3QQKA 2XARA 5DRDA 5DR9A 5KMNA 2ZDUA 3DKGA 3REPA 4EK6A 5LWNA 5L6WL 3VO3A 5TT7A 4C2VA 2BR1A 2OXXA 5AAEA 4GT3A 4FG8A 4F6SA 4QYYA 3QRTA 3F3TA 5EM6A 4DFBA 4BKZA 3TYKA 3QBNA 4NJ3A 2C0IA 3R00A 4HVSA 4R3RA 3PJCA 4X3FA 2A98A 2FSMX 3QZFA 1WBVA 5AV4A 3N4VA 4AQCA 4QTDA 2VNYA 3O7LD 2B0QA 5CAVA 2WTIA 3QAME 2XAOA 5HE2A 4FEXA 4FL1A 2X2KA 4AGWA 3S2PA 3C5UA 3DBDA 3QQJA 2Y9QA 5L6PA 4JL9A 3H3CA 2C6OA 2YM4A 1PY5A 3NLBA 2QOCA 1YXSA 1OKWA 3IGGA 2C68A 1W7HA 3KXNA 1NVSA 2C69A 3ITZA 4S31A 5K4JA 3W0NA 2RKUA 4FL3A 3O2MA 3PWYA 2E9OA 2YIXA 4FTUA 3OWLA 2AC3A 3PY1A 2YWPA 3R7GA 4RX8A 4GKHA