5GJGA

Crystal structure of human tak1/tab1 fusion protein in complex with ligand 4
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
307
structure length
289
Chain Sequence
GPLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords TAK1 kinase - TAB1 chimera fusion protein
publication title Development of a Method for Converting a TAK1 Type I Inhibitor into a Type II or c-Helix-Out Inhibitor by Structure-Based Drug Design (SBDD)
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 289
sequence length 307
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5gjgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gjgA01
3T3UA 4O0WA 5ICPA 4FR4A 3QLFA 4J52A 5JMSA 1BX6A 1SVEA 4IAZA 1Q62A 1JKKA 3LOKA 1YQJA 5FXRA 3HAVA 3F2RA 3O50A 3PG3A 4FMQA 4RVKA 4BZDA 4JI9A 3U9CA 2BPMA 2WTIA 5J95A 4MF1A 5B2MA 5HX8A 3TDWA 4O6LA 3FLQA 3BHHA 5CZHA 4BCGA 1W8CA 4O21A 4EUUA 3SXFA 1OKVA 3LFNA 2CMWA 3MVLA 2QURA 3KFAA 3MPTA 4X3FC 3SQQA 4RFMA 3RM7A 1BI7A 3S2PA 2ZV9A 4FV7A 4USDA 4YJOA 3UMWA 3ZRLA 3DV3A 2GFCA 2UZLA 3W32A 4E4XA 2YZLA 1R3CA 2J50A 3KK8A 1R78A 3OVVA 4IDTA 5FLFA 3U4WA 4BC6A 5DT0A 4E4NA 4DH7A 1APME 2R3NA 3PP1A 4FL3A 4L53A 4F6UA 5DI1A 2YWVA 2ZV7A 3AD4A 2IZRA 4A06A 3LFAA 3QQGA 4P7EA 3MGYA 4MK0A 3PXRA 3PSBA 4FSZA 4AT4A 5LCKA 4BBMA 2V62A 2J0JA 4IXPA 2YA9A 2ZM3A 3NNVA 3FPQA 2WEVA 3Q96A 2UW6A 5DVRA 1IR3A 3VF9A 4CG9A 3LLAA 3UQFA 5H3QA 3ZC5A 4XH6A 3P7BA 4NM0A 4MBIA 5AV2A 4GKIA 2OICA 4RX9A 4D5HA 2WQNA 3F69A 3NDMA 1IA8A 2ZDTA 1H01A 4RJ8A 4KUJA 5DRDA 2HXQA 1Q8UA 4IDVA 4NFNA 3CY3A 4NIFB 3IGGA 5F20A 3GOKA 4U3ZA 4R7BA 3SGCA 5E8SA 2BDWA 1OL5A 3K2LA 4DEIA 4L44A 4K2RA 3C50A 4EOSA 5C03A 4YU2A 2BFYA 4JNWA 3VO3A 5IQGA 2ITPA 4GV1A 3TKHA 4BDJA 4AW5A 3LHJA 4M84A 3TZMA 4FV8A 3OY3A 4JIAA 1S9JA 3CGOA 3C0HA 4R77A 1GZKA 4FX3A 3R02A 2BKZA 3ZFYA 4YHJA 1KUTA 5HG8A 1ZOEA 3KRXA 3IO7A 3PVBA 1B38A 4TT7A 2F7XE 4M69A 3G0FA 3L1SA 4C4EA 3KCFA 3P08A 4O7LA 2J6MA 5J9LA 4CFVA 2B0QA 3NUAA 3O2MA 4U97A 2DQ7X 3KRJA 3QQHA 1P4OA 2JD5A 4CYJA 3ERKA 4W4YA 1PRYA 1URCA 3BWJA 1NW1A 4WT6A 1QPEA 2R3GA 3DZOA 4Q5EA 5KHXA 1X8BA 4FI1A 2BTRA 5FWKK 5H8EA 2ITXA 1J7LA 3FWQA 1XHAA 3MPMA 3TL8A 1VR2A 3LM0A 3EN6A 4FTIA 3ULZA 4OTHA 1YOJA 4NEUA 5E9EA 2X8IA 3Q32A 2ZOQA 4CZTA 5M4FA 4IWPA 5TKDA 3FZ1A 1FMKA 5HO6A 5EI2A 3T8OA 3PJ3A 4NJDA 3UOLA 3BRBA 3IGOA 4Q9ZA 4GG5A 3L9LA 3BCEA 2PE1A 2GNLA 3P4KA 2FGIA 3CP9A 3O71A 4IQ6A 4IFGA 3ZLXA 2C0TA 4DFYA 3LJ2A 5AADA 1WVYA 2PULA 5HBJA 1CTPE 3A7FA 3QD3A 3G9NA 2GMXA 2CGXA 2YN8A 5LOHA 2PMOX 3NZ0A 5HO7A 2E9VA 2W17A 4RG0A 5HE0A 5M08A 1FPUA 4ANQA 3KRRA 4LM5A 4L8MA 2CSNA 5LMAA 4JIKA 4OBQA 3U6JA 4I0SA 4CCUA 4XBUA 2YCQA 2GCDA 1KOBA 5ANDA 3EH9A 4AZSA 4QRCA 3F3VA 4TYGA 1ZRZA 1R1WA 5E90A 3GU5A 4DFLA 2YAKA 2W05A 2EXCX 1LR4A 2QOBA 1CKPA 2R64A 2XNGA 3QYWA 4IX6A 4OTIA 4DGMA 4MH7A 5BMSA 4PP9A 5DOSA 5L6OA 2XNEA 3LE6A 5TE0A 4DC2A 4AUAA 4YMJA 5CF4A 1WBVA 4ANNA 4D55A 2W1EA 2XRWA 2OXXA 1P14A 3EL7A 3EL8A 1E1XA 3OG7A 4NM3A 3JYAA 3R8PA 1RE8A 3QD4A 2F2UA 4IZAA 4MNEA 1QCFA 3EYHA 4FYOA 4U42A 4UMTA 5C9CA 2C69A 1UU3A 1A9UA 5FM3A 5LVMA 3LQ3A 4V05A 2YHVA 3FXZA 2HZNA 2QU6A 4FTQA 5EHLA 4M15A 3R9DA 4U41A 4ASXA 4MAOA 4EK5A 3FZRA 1Q61A 2BHHA 4FV6A 1MQBA 4P4CA 5FXSA 3THBA 4FSRA 2BUJA 3WBLA 3ET7A 4AF3A 3T9TA 3E7OA 5LVLA 3UE4A 3JVSA 5CU6A 3AC1A 4BCHA 4CTBA 1H1WA 4PQNA 5CEIA 2IG7A 4ZS0A 5AV3A 1IEPA 3NS9A 1YI4A 5K0KA 3TIZA 1E1VA 4G17A 4NTTA 4R1YA 4UZDA 2C3LA 4W9XA 3BYOA 5FP5A 4APCA 4CRLA 2R7BA 5HNIX 2HIWA 3QUDA 4QYFA 4W4VA 5KUPA 1ZYSA 2I40A 4IAKA 4J96A 2UW5A 5EFQA 4A4XA 4GL9A 4DYMA 4NH1A 3VRYA 3VJNA 5JZJA 4G5JA 1STCE 2OWBA 4YC3A 4JG7A 3R01A 4FZ6A 4N0SA 2BFXA 4QMPA 4E6DA 4CQGA 3D0EA 2VWXA 2PZPA 3VIDA 2YIXA 3VS2A 2GQRA 2V55A 3AT4A 3I0OA 4RWIA 2PZIA 3L8XA 2BRMA 4AS0A 1JPAA 3ITZA 4NL0A 2VTAA 1QPJA 5GJDA 3NMUF 2VUWA 2VWYA 4IAIA 1IG1A 5AUXA 3GGFA 3CPBA 4WG3A 4D2RA 2P55A 4M0ZA 2XBAA 3VUIA 4U44A 3UG2A 4AGWA 4ANBA 4D0WA 2YWPA 3DXNA 3LXLA 3GUBA 3RINA 4CT2A 4DE4A 2YLFA 3RTPA 4MNFA 5EKNA 4DH3A 3RWPA 5D7AA 4BVUA 4D58A 4D1ZA 2WMRA 4XYFA 4A9SA 2W0JA 2HY81 5CX9A 5TO8A 3BIZA 4F7LA 4F70A 5AA9A 2ETMA 4QPAA 2UW7A 4PL3A 4UY9A 2WKMA 3VS1A 4EK3A 4ENYA 2BIYA 2EU9A 4ASZA 4JR3A 3HMNA 5T68A 2UZNA 4NM7A 5K9IA 3V5QA 1WVXA 4H3BA 3ZC6A 2X81A 3L8VA 4HGLA 2R0IA 3DAKA 5IQCA 4WUAA 4F9AA 5IQFA 2VO0A 2W9ZB 3SG8A 2R7IA 3MV5A 5DHJA 3DB6A 4Q5HA 4JRVA 4DEHA 3RMFA 4Z16A 4ZY6A 4OR5A 3HMMA 5EOBA 2P0CA 3R22A 5CYIA 2OF4A 5IQIA 4I94A 2J0LA 4JT3A 4UWYA 5IQBA 4TL0A 4RVTA 3VBTA 5CU2A 2BZJA 2AC5A 2YEXA 4HYUA 3TNIA 2C4GA 5DRBA 3MBLA 2UZDA 4EBWA 3ZEWA 3SX9A 5EI6A 4JAIA 2XP2A 3QTIA 4G6OA 3DXPA 1V0PA 1Z57A 4GSBA 2ITYA 5AR3A 5L2WA 2XYUA 1AD5A 4MQ2A 4LOQA 5CVHA 3W55A 5HU3A 4O96A 4BCKA 4EK6A 4OTWA 5ANEA 1B39A 4DHFA 4Z7HA 2QHMA 1H00A 2WQBA 2JAVA 2FA2A 2IW9A 4F64A 2QOQA 5BUIA 5JGBA 2R2PA 4TWPA 2O3PA 3ORXA 3N9XA 4FV0A 2ZB0A 4ZLOA 4ZZMA 3OF0A 2OGVA 3FSKA 5L3AA 3AC5A 4P2KA 4RC3A 4V0GA 3EN9A 4ZMFA 3GU6A 4YJRA 2EXMA 1Y91A 2YDJA 2VWBA 4F1MA 3GI3A 4A4LA 4CMUA 5DFPA 3CXWA 4BWKA 3DGKA 4U9AA 3P5KA 4IBMA 4AZWA 1YDTE 2XEYA 5L8JA 3SAYA 4EI4A 2OF2A 3HGKA 3QCXA 2DS1A 4UEUA 3JVRA 2WTKB 3GU4A 3UC4A 1DI9A 2VD5A 3NNXA 4IWOA 4GK4A 4XG7A 2NRYA 3DPKA 2HY0A 5ITAA 4FIIA 2GNIA 3VC4A 4LGGA 3FQSA 4C8BA 4L9IA 3GU8A 2R3FA 2H96A 4GU6A 3DFAA 3G6HA 4QP4A 3FEGA 3NUUA 4ZIMA 2PUIA 3BE2A 3Q4ZA 3OROA 3QZHA 4BCQA 4O86A 4EJ7A 3FQEA 4C0TA 3CQEA 2PVJA 3ZM4A 4JR7A 3I7CA 3PIXA 4YTFA 3WZDA 3NUSA 4BCMA 5I9XA 3BGPA 4WD5A 5LWMA 4GFGA 5K5XA 3CIKA 3GT8A 4RIWB 3MH3A 4FOBA 4L6QA 2XKCA 3F61A 3QFVA 3VUMA 3BEGA 3QRTA 4FT7A 4XG8A 2ITUA 2WO6A 4XRJA 2XNBA 2CLQA 4FSNA 4GIIA 4O0VA 1GIJA 4Z55A 2XK6A 2X39A 3OBJA 4V0GB 4QP1A 3QX4A 4IMYA 5JRQA 4TWOA 3ORZA 1Q8WA 4ZSJA 1R0PA 3E92A 2I0VA 5CAOA 4O7VA 2X7GA 4GYIA 3F3WA 4LMNA 3EFJA 5HBEA 5HIDA 3RK5A 4FKPA 2WHBA 4BDDA 4DA5A 1WBNA 5AUYA 4CV8A 4PMMA 5IUGA 3G5DA 5BMMA 3FMNA 4K1BA 2X9FA 5KO1A 1JBPE 3B8QA 4KSPA 4AT3A 5KMKA 4AW2A 3DBCA 5BUJA 4FF8A 2QKWB 3V5PA 4EC8A 3HZTA 4EH9A 5IKWA 4JOAA 1U54A 3MN3A 4XV2A 3Q60A 3GENA 3T3VA 4AP7A 5IA4A 3ALOA 5DIAA 3HDMA 4CNHA 3S1HA 4G3GA 5L8LA 2A27A 3CD3A 2H34A 2VNWA 4RJ3A 5A9UA 3UYTA 5I0BA 4BCJA 4C2WA 4KRCA 3H9FA 2VWWA 4L45A 5EH0A 2PY3A 1PHKA 1OKWA 3RM6A 3RNYA 5DEYA 3UNZA 4ZEGA 1Q8ZA 2G2HA 4GJ2A 1YXTA 5AUUA 5L2IA 4EOIA 4F63A 3HP2A 3MIAA 5IMEA 4ZTNA 4AOJA 5JGAA 4OTGA 3WARA 4PTEA 2BRNA 4I23A 4IWQA 4IH8A 5JFSA 3GQLA 3NCZA 1XH6A 3GFEA 5ETFA 2XIZA 4ZTMA 3CKXA 3TV4A 4L52A 4OTDA 3FLNC 2X6DA 2GTMA 4RC2A 2QU5A 3C51A 3U4UA 3A7HA 4BDGA 5AV1A 4ZTLA 4NSTA 2ONLA 3R21A 2GTNA 2IO6A 4JDKA 4LUEA 4D28A 3P86A 4AW1A 3KF7A 4JJRA 3R9RA 5EG3A 3PXZA 4ALWA 1U54B 3QTUA 4NCTA 1PMVA 4XG6A 4LFIA 4RZVA 3UIXA 5I9ZA 3ODZX 3GCSA 4TYJA 4B9DA 4UB7A 4BICA 4ACCA 4F9BA 3PLAE 2JLDA 1GAGA 4FZDB 2W06A 4AFEA 2FVDA 1OUKA 2C6IA 2UZUE 1Y6BA 3NYXA 3DLZA 5BPYA 4FGRA 3HRBA 3IW7A 4MCVA 3VS4A 3I6WA 1R39A 4DAWA 5H8BA 3R9HA 4BN1A 4I5CA 3OXIA 3D94A 4LMUA 4YPSA 5EHOA 5AUWA 2QC6A 5AP0A 3A60A 3TDVA 1Q41A 3LFQA 3EQDA 3CLYA 4G3FA 3A7IA 2ITVA 1F0QA 3AT2A 4DITA 2ETRA 3KEXA 3BLQA 4DFNA 2PVFA 4KWPA 2NRUA 4FICA 2O5KA 3VJOA 3MW1A 4C4IA 2GFSA 4JXFA 4PNIA 1U59A 2I0EA 5J79A 3DK6A 3PY3A 2JDTA 5JSMA 1ZMWA 2O8YA 3Q53A 3D2KA 3Q4TA 3NYOA 4LL5A 4AX8A 1J1CA 1DI8A 2JBPA 2VRXA 3FXXA 3CQWA 4X6QC 2IVSA 3O7LD 3SRVA 3TG1A 5D11A 3P1AA 3ZONA 2YCSA 3OY1A 4U6RA 3WOWA 4E5WA 3BLHA 1SYKA 5C26A 4FNWA 3FLSA 4G6NA 1M17A 2VX0A 4FSYA 2G1TA 2J0KA 2OIBA 1L8TA 3BU3A 4H1MA 3G90X 2NNWB 4BKJA 2VGOA 4EQUA 3OW3A 5DGZA 3AOXA 4HVHA 5M56A 2W9FB 2PMIA 2BZHB 2FYSA 4UV0A 4ALVA 2F4JA 1V0BA 2W1GA 4DG2E 4RC4A 5JH6A 5I9VA 3FKNA 2BVAA 2C3JA 1ND4A 3E7VA 3QA0A 4CSVA 1ZMVA 1JWHA 4IVBA 4GVAA 1FVRA 3WF8A 2OIQA 4ZSEA 3DT1A 4M97A 4QMSA 4M13A 2WB8A 2BILB 5TR6A 4UXLA 4BCFA 4NUSA 3I79A 4H3QA 4EOOA 5J7HA 1JSTA 2XNNA 4G3DA 3MIYA 3R8VA 3W8QA 2O64A 1ZYJA 2H6DA 3DK7A 1YXSA 3GCQA 4ZJVA 4F08A 3IK3A 3QC9A 2XB7A 3KL8A 4PL4A 1TQPA 4KB8A 1CDKA 2W7XA 3SOAA 4X2KA 4QYYA 3ZSIA 4YBJA 5E1SA 1YI6A 4FKVA 4FOCA 1H1SA 4FTOA 2LGCA 2Q0BA 4G3CA 3Q5ZA 5HLPA 3PRIA 1H8FA 5FG8A 5IH4A 4RT7A 2PU8A 4MD9E 2B9IA 4RX7A 4XX9A 3SD0A 1WVWA 1GZNA 2ACXA 1GZ8A 2UW0A 2XUUA 4YNEA 5E92A 3KREA 1GY3A 2I6LA 4NJ3A 2WMXA 3OT8A 3FC1X 2XM8A 4S31A 4M3QA 1J3HA 1OL6A 5CEKA 4TYEA 4OUCA 1QL6A 5AX3A 3FZSA 1O9UA 5J1WA 5EYDA 4EH6A 4AT5A 3DJ5A 1KWPA 4C59A 4B6LA 3EMGA 2XVDA 4OTFA 3A7JA 3O96A 3LQ5A 4PUZA 2JGZA 3QKMA 4IIRA 3CBLA 4NM5A 4FKSA 4Y5QA 3R7IA 3QBNA 3KULB 3H0ZA 5IEXA 3H9RA 3BZ3A 2A4LA 5LMBA 2ERKA 3FI2A 3F82A 5IU2A 4RGJA 2GU8A 4M7IA 1GZOA 2E9OA 3ATTA 2WQEA 3R83A 2XCKA 3KU2A 4XMOA 4BKYA 4TYIA 1ATPE 1OECA 3ULIA 4BL1A 3LFDA 4I1ZA 2W96B 2BCJA 4G1WA 1SMHA 4EH8A 1HOWA 2VTHA 4AWIA 5HO8A 2PZ5A 5D9HA 1MRUA 2FUMA 4BRXA 4YPDA 3FI8A 2XNOA 3DTWA 3PDTA 4TKSA 3DOGA 3I81A 2G2IA 2ITZA 2QHNA 2Q0NA 2XKEA 4U5JA 3ZSGA 3AT3A 3C5UA 3BQRA 2X4FA 3MH0A 5BVOA 4IM0A 4BGHA 3V3VA 4IVDA 2FSLX 4QMNA 1A06A 3OWJA 3DJ7A 1OBGA 3EHAA 4AACA 3WZUA 3UMXA 4TYHB 5AAFA 3I0QA 2WMTA 2C6OA 4I6QA 5EYCA 4BCPA 4C3PA 2C5XA 1OVEA 1YOLA 2PVRA 2WTKC 3CD8A 3QQKA 4J71A 3U51A 3EYGA 3RCJA 4H1JA 4WG4A 1YW2A 2IVUA 5CWZA 5HKMA 4O0XA 4ENXA 3RZFA 2C5OA 3UPZA 3V51A 2F7ZE 1ZYDA 4Y46A 3O8PA 3R6XA 4WNMA 4EZ7A 3L9NA 3ZHPC 5EW8A 4BY9E 3QALE 3E62A 4ACHA 3CSVA 3RBWA 5C8MA 1ZAOA 3D4QA 3IPHA 5AR2A 1FGIA 5CT7A 3LKMA 5CQUA 2C0IA 2XK7A 3HRFA 4WNOA 3BLRA 4E93A 3QHRA 4CGAA 3V8TA 3KN6A 3C5IA 1BLXA 3PA5A 1Y57A 2WEIA 4JBVA 4BI0A 3TT0A 4ID7A 4YURA 2BAQA 4K8AA 4MTAA 4O91A 2VTNA 3ZMMA 5GZ8A 3TZ9A 1YHSA 2PUPA 3HLLA 3UO6A 4B99A 3CCNA 2VNYA 3G2FA 4FSUA 4F9YA 4FGBA 4I6FA 4ZTSA 3SVVA 4D4SA 2YABA 1Q3DA 3OC1A 2QOIA 4FTLA 4U8ZA 2A19B 4I5HA 4RJ6A 3VS5A 2WMQA 4EK8A 2VTIA 3F6XA 1H26A 4C3RA 3TNWA 5F4NA 4EQMA 3OXZA 3OW4A 4S34A 5AP4A 4J8MA 4DCAA 2VX1A 3HA6A 2X9EA 3P23A 4NKSA 2VO3A 4PY1A 4F6WA 2ZB1A 2XH5A 2J9MA 5DA3A 3Q4UA 5HHWA 4O7RA 1KE8A 4AN2A 2QOHA 1H28A 1HCLA 4J8NA 2JKMA 4Q2AA 3NNUA 4C58A 3R9OA 3PFQA 5JQ8A 3VVHA 5HEZA 3SG9A 4R3RA 5EK7A 1ZYCA 4UWBA 5I9YA 5FD2A 3CTQA 5IMXA 2OJFE 2R3LA 3DQWA 2YDKA 1UKHA 2XJ0A 4FV5A 3RNIA 5CAUA 4D2VA 4HVGA 5BVNA 2O0UA 5CF6A 3EB0A 2JITA 3F3TA 4KAOA 1BL7A 3PLSA 1Q24A 5FBNC 3COMA 2GNHA 3W2SA 2QR7A 3EIDA 5IQDA 4FIJA 4WA9A 1JOWB 3BX5A 3AMAA 4ITHA 1FOTA 3BPRA 4FEVA 1LEZA 4YZDA 5FDXA 2C1BA 2UVXA 4ANOA 4E4MA 3U54A 3FMLA 4O84A 3EJ1A 4QMTA 2WOUA 5K5NA 2OH0E 2QD9A 3I6UA 1DS5A 3NPCA 1T45A 2UZBA 3FY2A 3FBVA 2YDIA 2F7EE 1AQ1A 2E9NA 4JQEA 5KMNA 2UW9A 3E8DA 2YIRA 4HGSA 3F2NA 4FZFB 3ORTA 1CSNA 2RFNA 4IB0A 4MHAA 3F5PA 3H4JA 4FV2A 3PP0A 4ACGA 2XMYA 3LXPA 3QF9A 1H08A 4E1ZA 5BYYA 3BE9A 4BBEA 2CNVA 3R8LA 3G0EA 1WAKA 4QP8A 3UVPA 2UUEA 3ZO3A 4R7IA 2W5BA 2X8DA 4G5PA 4NK9A 5DMZA 3ZLWA 5J5TA 2R3HA 3DNEA 2PYWA 4OAUC 1J91A 4IX3A 4CRSA 5J9YA 3FSFA 1PJKA 3HKOA 4O2PA 1OKZA 1XH8A 4EBVA 4QMZA 3MJ1A 3CR0A 2J2IB 4FTAA 4DH8A 5KMJA 4RA5A 3K5VA 2OLCA 4DT8A 3I5ZA 4KS8A 4BDIA 3OXTA 3JPVA 4JS8A 4CFNA 4CCBA 4QPSA 3VHEA 3FE3A 4RIYA 4BYIA 2PMNX 3DBEA 4C57A 3GBZA 4JDHA 3E8CA 3PA4A 3PRFA 3RPSA 4D4RA 2ONLC 3MFSA 4G9RA 5IG1A 3Q2JA 3R2BA 4J53A 1K2PA 3QGYA 3HECA 2YIQA 2YJRA 4OTQA 4IW0A 4TY1A 5J8IA 5D41A 3QU0A 4XEYA 5JEBA 4I5MA 3GCUA 2JAMA 3UTOA 1OUYA 3NAXA 4FKLA 2QOKA 2QODA 4RMZA 3A99A 3Q52A 4ANLA 4JX3A 1UA2A 2OFUA 4Y73A 3UODA 3V6SA 5IF1A 2WPAA 4KIKA 1KE5A 4M69B 1DAYA 3DDQA 3EN4A 3DY7A 3F9NA 4Y95A 2ETKA 3IKAA 4U80A 4XOZA 1ZOGA 5KCVA 3MYGA 4TN6A 3NSZA 1M14A 3WE4A 1UU9A 2VWIA 2JDVA 4M12A 4AOTA 4FV4A 3R8ZA 4BKZA 4WBOA 3TN8A 3ELJA 2VWZA 2EVAA 3QZGA 5DT4A 3O51A 3E93A 3WF7A 3LCSA 5EOLA 3LIJA 3ZTXA 5I4NA 3A4OX 5CASA 3I1AA 1M2QA 3E8EA 4JDJA 1QPDA 3OCTA 4RIYB 4FG8A 4Z7GA 2WFYA 3TV6A 4XOYA 4ZZNA 2J90A 5DR6A 4ZAUA 5AP2A 3C0GA 4BI2A 2HZ0A 5L2SA 3W18A 2XCHA 2HZ4A 4TZRA 4WOVA 5LVPA 2QR8A 1H1RA 3EN7A 3MJ2A 3IW6A 3R7VA 1F3MC 4W9WA 3SXRA 3QXPA 3E3PA 4XRLA 3TXOA 2CCIA 2J7TA 4MXCA 1Q4LA 3UP7A 3NW6A 5LQFA 2JKOA 1PF8A 1WFCA 2XK3A 3F66A 5M07A 4YTHA 3C0IA 3ZO4A 4CMOA 4CQEA 1Q5KA 3PSCA 1PYXA 1XR1A 3DNDA 4O0UA 4HCUA 1YOMA 4XV3A 3MVMA 4GFOA 2B53A 3HUCA 4NWMA 4ZTHA 4R5YA 5IUHA 3DJ6A 3N4VA 3UOKA 4AGUA 4U0IA 4KINA 3PVUA 4M8TA 1V1KA 4HGEA 5A4CA 2GQSA 5AFVA 1J1BA 2R5TA 2UZVA 5H9BA 4DEEA 4E73A 5I3RA 4FEQA 2XNPA 3TNQB 5J5SA 4C35A 2A1AB 2CDZA 3CJGA 4PMSA 5CVGA 2RFEA 4YHTA 3NRMA 3MTFA 4MNEB 3KRWA 5ANGA 5EQYA 1UKIA 2JEDA 2CKEA 3R0TA 2ZVAA 4BB4A 2B9JA 5FQDC 2AUHA 5AUVA 3RAWA 2V7OA 4DINA 3POOA 4E6CA 1PXKA 3L8SA 5L4QA 4CFUA 1PXLA 3PWYA 4FVQA 4OTPA 3RP9A 5LMKA 4KKEA 3V5LA 2FB8A 5G6VA 3DKFA 1FGKA 4CD0A 4DGOA 5J7BA 4JAJA 1HCKA 5AMNA 3COHA 5DN3A 1OMWA 5HVYA 3ZLSA 4HVDA 4DG0E 4IVAA 5FEQA 4HPTE 2UZOA 4NFMA 4MD8E 4TWNA 2OBJA 3D83A 3MY0A 4UALA 3LM5A 4FKQA 5L6WL 3BWFA 4ERKA 5BYLA 3OUKA 2IPXA 4D2PA 4KSQA 3UOJA 2QOOA 3D2IA 4YC8A 2XZSA 5EM6A 4FUYA 3LW0A 3SW4A 1UNHA 4HPUE 2W1CA 5HU9A 4YSJA 2CCHA 4DN5A 3LFSA 5CXZA 3S00A 4GW8A 3NEWA 3ALNA 1YI3A 2XIKA 1BMKA 3MA3A 2B1PA 3PG1A 5B0XA 4CV9A 2XBJA 2JDRA 1CM8A 2ZDUA 4J95A 3KXMA 4H05A 4HZRA 3WF5A 5CEPA 2W5AA 3HV6A 4EH4A 5LJJA 1YHVA 3TKIA 2IZSA 3FV8A 1VJYA 4C61A 2JFLA 4W4XA 5KZ0A 4I4EA 2C30A 1OIUA 2WQOA 3EN5A 2R3KA 3VF8A 4UMPA 4EH3A 4I93A 4A9UA 5E8WA 1H1PA 2W1FA 5HVKA 3NIZA 5EM8A 3VAPA 4A9YA 4KA3A 4JLCA 3IQ7A 3QWJA 2C5VA 1M52A 4RJ5A 4X3JA 4E8AA 3OEZA 4OBOA 4RA4A 5KMMA 4NYEA 1KV1A 3LPBA 5F94A 3QD2B 2HWOA 4GMYA 3DZQA 4AE9A 4C36A 2C6KA 3ACKA 3W1FA 1PXMA 3FQHA 3QRIA 3UBDA 2UZWE 3QQLA 4YO6A 3RPOA 3ZBFA 2JKKA 3D5XA 1RW8A 1Y8GA 2HK5A 4X2FA 4BIBA 1K9AA 4BDAA 3D7TA 3MB6A 3F3UA 3FL5A 4FKUA 3CY2A 3G33A 3NR9A 1P4FA 1YXXA 4EWQA 4IJPA 4NKAA 1Q99A 4L68A 1L3RE 4DCEA 4JG8A 5JFXA 5J87A 3ZSHA 3O23A 3HMIA 4BHZA 1SNXA 4B8MA 3VS0A 4D5KA 4ZLZA 2XYNA 4UXQA 3PA3A 4HGTA 4MXYA 3AC4A 3BBWA 1H0VA 3GXLA 4XG3A 2P33A 2P3GX 1B6CB 5HG9A 4K6ZA 1OIQA 3VW6A 4FTCA 3PTGA 5KMOA 4V04A 1REJA 2RF9A 5DNRA 2FH9A 3C4XA 4QMOA 5FTQA 4BDBA 4N57A 3BHUA 2IJMA 2B55A 2XK9A 3C9WA 1UU7A 2EUFB 4N6ZA 3LCDA 3VHKA 5HLWA 3U6IA 3QQUA 3CQUA 4MYGA 4R6VA 3P79A 3VN9A 2B54A 3TTJA 5C27A 3D5UA 1VYWA 3KC3A 3PZEA 4MBJA 4FV3A 1KE7A 3QTXA 2G9XA 4FTUA 2CKPA 4ZZOA 4CXAA 4RJ4A 4EOKA 1PXNA 3QTQA 3ZUTA 3C4ZA 3JS2A 3KXNA 3BHVA 4RVMA 2ZV2A 3C4EA 4KNBA 4BGGA 5AEPA 5E1EA 5H2UA 3OWPA 3UP2A 3E64A 5KX8A 3QKLA 3JUHA 3UPXA 1O6KA 5HQ0A 5I9WA 3QA8A 5CEOA 5AAGA 3CTJA 3EWHA 4MWHA 3MY1A 5EKOA 2JC6A 2CKOA 1UNGA 4FK6A 3FMKA 4WHZA 2VTOA 3OTVA 4XS2A 4IB5A 2JFMA 3N4UA 2R4BA 3DAEA 3W2CA 4BWPA 3TUCA 2QOCA 5GIOE 3F7ZA 1Y6AA 4BZOA 2WU6A 4YBKA 3EQIA 4ZK5A 5BVEA 4N4SA 1MUOA 3RK9A 1URWA 3KXHA 5F1ZA 3PXKA 4GK2A 2ZM4A 1GIHA 2B52A 2YJSA 5LARA 4CFFA 4U81A 4IC8A 4CZYB 1PW2A 4WKQA 1JSVA 4C4GA 3FLZA 5HE1A 3OP5A 3UYSA 3W2RA 3AGMA 2WTCA 2Z7SA 3VS6A 4JL9A 2XKFA 4JVGA 5ACBC 3H30A 4F1TA 1XWSA 3FY0A 1SNUA 4M0YA 4RX5A 4QMXA 4JX7A 3O0GA 4J97A 5IEVA 3E87A 3FI4A 3WF6A 1MP8A 4FYNA 4HW7A 2XA4A 5HTBA 2P2IA 3ROYA 3QQFA 2NO3A 3S3IA 1J7UA 3BELA 2SRCA 2IW6A 4KBKA 1OBDA 4G3EA 4GKHA 1OI9A 2HW7A 3ODYX 3MVHA 4UMRA 5F9EA 1JKLA 2FSTX 4FKGA 3FKLA 2HCKA 1G5SA 2GHMA 1OGUA 3EQBA 3DDPA 3NWWA 2X7FA 3QTWA 1NVQA 2OG8A 4HOKA 3DQXA 4QMUA 5CSVA 3PVWA 5FTGA 3DS6A 3LFEA 5CXHA 3BQCA 3Q3BA 3OOGA 4TNBA 1H4LA 5EYMA 3ZRKA 5E91A 4D0XA 4H39A 5FEDA 2X2MA 3FHIA 3HRCA 4L7SA 4PF4A 3ANRA 4TWCA 3FYKX 1OPLA 1OIYA 3IW4A 3KQ7A 4EQCA 1XH5A 4XNEA 3TWJA 4CMTA 1KSWA 3MA6A 3LCTA 3HV5A 5IISA 4MVFA 5HCXA 3QL8A 4FTRA 4A7CA 4AA5A 4Q9SA 5DPVA 4HVSA 2BZIB 1YRPA 3RWQA 3NUNA 1QMZA 4R5SA 4AZFA 3R7YA 3KCKA 5BVKA 4DGNA 3GCPA 4CZUA 5JN2A 2GHLA 3REPA 3MY5A 5M57A 3AC2A 4RQKA 4ACDA 3TZ7A 3ZRMA 3EZVA 4OT6A 2VN9A 3P9JA 2RIOA 4GT3A 5GHVA 1O6LA 4QP3A 1XBCA 2PVLA 3NYVA 5GNKA 4DEGA 4AU8A 3W16A 4L3PA 4F0FA 5IA0A 3EFWA 3OCBA 4X2JA 4GT4A 3V01A 3QRJA 4X2GA 4UX9A 1IAJA 2R3RA 3CE3A 4P5QA 1UNLA 3R8UA 1OITA 1FVVA 2CGUA 1T46A 2IWIA 4F7JA 5AV4A 3BKBA 4XBRA 5HG5A 2BMCA 3I60A 4K11A 5ETCA 4TTHB 4QTCA 1NY3A 1TQMA 2HENA 2X2KA 4E7WA 5E8TA 4PDOA 3K54A 4RFYA 4WIHA 4LV8A 1IA9A 3BBTB 4IZ5A 4YSMA 2WD1A 1BL6A 4UZHA 2PUUA 4FUXA 4D2TA 4BDCA 1IASA 1OPJA 3SW7A 4E4LA 3R8MA 4YLKA 2WMAA 2WU7A 5EYKA 4AQCA 5JZNA 2YIYA 3KXGA 2OKRA 4O27B 4RWLA 3KA0A 2X2LA 4LG4A 4O0SA 2E9UA 2B4SB 3MSSA 3VUHA 1BYGA 5ANIA 2GNJA 3LXNA 4QQCA 4PPBA 3DAJA 1M2RA 3EKNA 4QQ5A 2ITWA 4KBAA 3QCQA 5E8VA 2C47A 1H0WA 3U87A 3UIMA 3V5WA 4YJNA 3Q9ZA 3HDNA 3O8TA 3CPCA 3L9MA 4W4WA 2ZM1A 2OH4A 4FTMA 3BYMA 3IG7A 3RAIA 1Q97A 4FKOA 4ZP5A 4F65A 2VGPA 3LCKA 4UYNA 3GOPA 4XCUA 3VS7A 3NX8A 4DTKA 4YTCA 3KN5A 3EQGA 3A8XA 1P2AA 4FV1A 4O82A 3ZUVA 3KXXA 3CKWA 1LUFA 4U3YA 3UNJA 2CN8A 3M1SA 3QXOA 2XK4A 2PZYA 4HNFA 4DLJA 3UIBA 2ITTA 3C13A 4YJTA 3OEFX 4YLLA 1W84A 4O1OA 3WF9A 3KY2A 3ANQA 3MDYA 4A9RA 3PIYA 3ENHA 4KRDA 4DH5A 3FMHA 5CT0A 4PTCA 2OXDA 2UW3A 2VWUA 3ORMA 4FIFA 4RX8A 4XG4A 3OUNB 4GRBA 3PXYA 2CNUA 4HNIA 5JRSA 3SRVB 4R8QA 3FL4A 3IDPA 2BDJA 5E8UA 5IH6A 4QP9A 3WZEA 4WUNA 4EYJA 1XBBA 3MFUA 4RRVA 4AFJA 4C02A 2WTVA 5AAEA 2C68A 4FZAB 4WO5A 2X0GA 4L42A 4XHKB 3RHKA 4EORA 3KMWA 1M7NA 3DCVA 3D9VA 3LMGA 4QP2A 3UQCA 3H3CA 4FL1A 4HJOA 5C1QB 1PY5A 1YDRE 1WBOA 5HESA 3M2WA 3KRLA 4GVJA 4G34A 5AR7A 4AGDA 4BYJA 2RG6A 2UW4A 4FL2A 3ZEPA 4ZS4A 3LCOA 3UVRA 4E26A 4FE2A 4GJ3A 3FDNA 3MTLA 2XNMA 2VWVA 4IAAA 4X7QA 4DH1A 3POZA 3OD6X 5EM7A 4EH2A 4EZ5A 3F5GA 4F7NA 5LMKC 3OWKA 4NW5A 2PVKA 3TI1A 3GEQA 5HG7A 3OOMA 1VEBA 3WI6A 3R28A 3SXSA 4CT1A 1WMKA 5CAVA 4FIHA 4F4PA 2X4ZA 4XJ0A 4FG9A 4YUQA 2PE0A 1OL1A 3PE2A 2OSCA 4MF0A 4QTAA 4IAFA 4OGRA 3NLBA 3W2OA 1R0EA 2GS2A 2VV9A 3MFTA 5D10A 3UC3A 5CVFA 4XLIA 4CLIA 3BHYA 4BDKA 2YCRA 4LOOA 1JQHA 4NW6A 2PVYA 5FBOA 5HE3A 4FEWA 3TEIA 3ZS5A 2F2CB 4ITJA 3B2TA 3GNIB 1LEWA 5E7RA 5TT7A 5J1VA 3HA8A 4GEOA 1PXIA 5DR9A 4EH5A 4JBQA 4QQJA 5A3XA 4C34A 4FTKA 5FDPA 1JKTA 2EWAA 3D7ZA 4YZCA 2RG5A 5HZNA 2XS0A 1U4DA 1U46A 3QAME 3VBYA 5CAPA 4R3PA 3TACA 5HTCA 4J1RA 4IX4A 3K5UA 2WMSA 5JFVA 2X1NA 4ZTQA 3O8UA 5EI8A 3EQFA 4JRNA 4EKLA 4JDIA 2OJ9A 2OK1A 3H0YA 3MH1A 1SZMA 5JFWA 3G6GA 5CLPA 2Y4PA 4FKTA 4CKJA 4DLIA 1NXKA 5K4IA 4B8LA 3DB8A 5M4UA 5CU0A 4WRSA 3G51A 3QHWA 4FKRA 4S30A 1JKSA 4FKJA 2VTQA 3R71A 4AG8A 3FMJA 1ZYLA 1YKRA 4WSYA 3VULA 2CN5A 4RVLA 1J7IA 2G15A 3FMDA 2J5FA 2VTSA 3F2AA 4IE9A 4RJ7A 3UGCA 4BCOA 4C33A 4FSQA 4FEUA 1FBNA 4DTAA 2VTMA 1SM2A 4QYGA 2XJ2A 4ONAA 4O83A 3E63A 4IACA 5CI7A 3UG1A 4S2ZA 4EC9A 2C6EA 3PYYA 5CNNA 4DFZE 2YM8A 1DAWA 3HNGA 2YCFA 4LUDA 4YZMA 4AOIA 3SA0A 2I0HA 5D7VA 3VUGA 3OS3A 1W98A 2F57A 4X0MA 3G15A 1VYZA 3V8WA 2VZ6A 3R30A 4QOXA 4Y72A 4YJSA 1ZARA 4QD6A 2Y6MA 4QMQA 4Y83A 4O0RA 3ZOSA 4AZTA 4YP8A 4EWHA 1ZY4A 2Y8OA 4K18A 3PPJA 4QMLA 5HE2A 3VWAA 5CTPA 2G01A 2UV2A 4FVRA 3EQCA 4PTGA 5HGIA 3TJDA 4W8EA 5IUIA 3MI9A 3U9NA 3WYYA 5CANA 2BROA 2FSMX 4FTJA 3RPRA 3VQUA 4C38A 5BUEA 4ITIA 4ZMEA 2ITQA 2QO7A 3RGFA 3ZU7A 5I9UA 2YLEA 2OI4X 4AZVA 3AC3A 2RFSA 4CTCA 5FEEA 1TVOA 3GP0A 3Q5IA 3RHXA 3VUDA 2YAAA 5FM2A 1JVPP 2Y4IB 4NIFA 4PX6A 5HNGA 3R00A 4IAYA 3UIUA 3V6RA 4D1XA 4E5BA 1JAMA 5CU4A 4OT5A 3AMBA 2BZKB 2QOLA 2RSVA 4FSMA 2FO0A 2Z7LA 3D5VA 4ZSLA 3VBQA 3ZDUA 4EKKA 2KTYA 2Y7JA 3A61A 4AXAA 4CFXA 5IDPA 3LAUA 2B9HA 3R04A 5C8NA 4IX5A 4AAAA 3PJCA 5E8YA 3DK3A 3HMOA 5EW3A 1IAHA 5FGKA 4O7SA 5TOZA 5BQ0A 2V7AA 1ZXEA 2WMBA 3UZPA 5C4LA 2XM9A 2Z7QA 5EDQA 5F95A 5HNBA 3BV2A 3RVGA 3HV4A 3ZO2A 3TUBA 4BFMA 2WMVA 4IB1A 4DTBA 5M44A 3RAHA 1M2PA 2XJ1A 2XEZA 5EM5A 2IN6A 2GS6A 5KZIA 5EDRA 4I41A 4WNKA 3TTIA 1W0XC 3EQPA 4LRJA 2WELA 5DG5A 4JG6A 2EXEA 2CHLA 1YXVA 3R7OA 4AN9A 2RKUA 5CEMA 3LQ8A 2PE2A 3VUTA 3K3IA 2YZAA 1H1QA 3UO5A 5FUTA 3CJFA 2Y0AA 4M67A 1TKIA 3KXZA 3QCYA 1WBSA 4D2SA 5JQ5A 1H25A 2VTPA 4ALUA 4EOLA 3OCSA 1WCCA 3PZHA 3NW7A 1MRVA 3MWUA 3ZLYA 4MXXA 1BUHA 2QQ7A 4RWKA 2O63A 5DT3A 3WIGA 4K9YA 4PRJA 4TPTA 4HVIA 3IW5A 3KMMA 3AC8A 4QMVA 4YJPA 1QPCA 3ORIA 3ORNA 3NUYA 1YDSE 2WTWA 3KVXA 4O7NA 3VBVA 3ZYAA 2WTJA 4MX9A 2YM5A 3P7AA 2R3JA 4QQTA 3V5JA 2Z2WA 3FPMA 5AIKA 5KKRB 5A4EA 2VX3A 4M66A 3QD0A 1WBPA 4QYEA 5HIBA 2AC3A 4ASEA 2YIWA 4BTKA 3JY0A 2YISA 4I3ZA 5DE2A 4DEAA 4EONA 2PWLA 2PSQA 4DEDA 5M53A 4DBXA 4GU9A 1EH4A 1I44A 4IZYA 3RAKA 1LPUA 5D1JA 3BU6A 5ACKA 2YFXA 3I4BA 4BWXA 4O7YA 1SVGA 4W8DA 4R7HA 1H24A 5KBRA 2HAKA 4XUFA 4NCTC 3ZCLA 3U8WA 3U6HA 1S9IA 4O22A 5HX6A 3TNHA 2F49A 3HX4A 4O1PA 4H36A 4L3LA 2A0CX 3FZTA 4GUEA 5CSHA 5CENA 2HYYA 3E88A 4ZXTA 3FLWA 5M06A 2ZMDA 1REKA 3B2WA 5EW9A 4B4LA 5A4TA 3Q2MA 4O6EA 5KHWA 4EUTA 3UO4A 3UZRA 4K77A 5EHYA 4FEXA 4MD7E 5L8KA 5LVNA 4GYGA 1E9HA 3BHTA 4MBLA 2ZYBA 2ZJWA 3R7EA 4E6AA 2PPQA 4UBAA 2RL5A 5M4IA 3AG9A 3MFRA 1O6YA 1G8AA 4GS6A 1JSUA 5AM6A 5B7VA 4KIOA 3LFBA 5EQEA 2W5HA 2BIKB 3DBDA 4L00A 3TV7A 3UJGA 2OO8X 4MXOA 2XKDA 3R7GA 5A46A 5HBHA 4EHGA 4ZOGA 3QQJA 2JIIA 4NTSA 3D15A 5C8KA 3F88A 4PPAA 3ZXZA 4LGDA 2EB3A 1H27A 5HD4A 2UZTA 3A7GA 3ZZEA 5E8XA 2W1ZA 4AGCA 4I5PA 2I0YA 2BTSA 3BYUA 2PVNA 2WZJA 3KKVA 3AMYA 3KGAA 5ANKA 4IWDA 2PK9A 4IHPA 4Y85A 5JK3A 2HOGA 1PXJA 1G8SA 1KE6A 1CKIA 4A9TA 3GU7A 2C3IB 2ITNA 4CKIA 2R3OA 3LMIA 3S0OA 3DLSA 3C1XA 4QTDA 2QVSE 4G16A 4MXAA 4RBLA 4LL0A 3VQHA 3WZKA 3PSDA 4KIKB 4J7BA 1ZWSA 5B2LA 3VUKA 1Q8TA 3NAYA 3NNWA 4EL9A 3BI6A 4FT9A 1IRKA 3VBWA 3KF4A 4CEGA 3COIA 2CGWA 4S32A 3PUPA 5BVDA 4CG8A 1W82A 4IEBA 1ERKA 3V8SA 5HICA 3I5NA 5E4HA 5I5ZA 4N70A 2BKKA 4IANA 3CEKA 4DFXE 4EYMA 2YITA 2RGPA 4O7ZA 3Q6UA 1TQIA 2OU7A 4OAVB 3BYVA 4YLJA 1GNGA 5M4CA 1OKYA 1ZY5A 5LWNA 3R1NA 4FSWA 3R63A 4KD1A 3ID6C 5M09A 4I0RA 3NGAA 3GQIA 3JXWA 3UVQA 4TNDA 3M42A 3Q9XA 4IB3A 5IQAA 3IOPA 2JIUA 3EQHA 1CMKE 4Y5HA 2C3KA 1YHWA 1AGWA 4X6RA 2CKQA 2X8EA 2ESMA 2W4OA 4F1OA 5AA8A 4FTTA 4L3JA 5CQWA 3R73A 3N51A 3R2YA 4PWNA 3RI1A 4AE6A 3FXWA 4N6YA 2QOFA 4FTNA 4TRLA 3F7WA 4FA2A 1JLUE 2GNGA 3GVUA 3EOCA 3PIZA 3NYNA 5HCYA 3H9OA 3EFLA 5I3OA 4ACMA 4EZ3A 5CSPA 1RJBA 2W99B 5L2QA 2YM3A 3FUPA 5DBXA 2OXYA 1PKDA 1XJDA 2WTDA 3QCSA 4KBCA 4WNPA 1ZZLA 5BVFA 1RQQA 3ATSA 1JNKA 3Q04A 3NIEA 1PXPA 3L8PA 1BI8A 2OJGA 3W10A 5K3YA 3RPVA 4YJUA 5C01A 3W2QA 2C6LA 3QUEA 5IEYA 1XQZA 4IFCA 2G2FA 3QTRA 4E3CA 4EOMA 3A4PA 1OZ1A 4LQMA 5AP6A 5EDPA 2C6TA 2QKRA 4U7ZA 5GJFA 1UU8A 2OW3A 4JQ7A 5AWMA 4A07A 4YR8A 3L9PA 2CLXA 4BGQA 2RFDA 2VTTA 4HYHA 4K33A 1VZOA 4YC6A 3TNPC 3WIKA 4PNKA 1PMNA 4ZLYA 4ZY4A 2Z8CA 1OM1A 3DKGA 4DGGA 5DYJA 2R0UA 5FP6A 1PYEA 4IADA 2GS7A 4HCTA 2QNJA 1XH7A 4L46A 2OJJA 4G6LA 3PXQA 2JIVA 4KS7A 2YM7A 2GPHA 3GCVA 2E2BA 2BRGA 3ORLA 3OBGA 2B9FA 3ENMA 4GH2A 3QWKA 4S33A 3PE1A 2R9SA 3LZBA 5C4KA 5AR8A 4C4HA 3AQVA 1CKJA 1V0OA 4FIGA 1YXUA 4ASDA 3GC8A 4XP0A 5AIRA 2C5NA 2BR1A 5GZAA 4QYHA 4BCNA 3S95A 3RJCA 2HW6A 1YWRA 3S4QA 2QI8A 4I6BA 5JKGA 3COKA 4KKGA 2WOTA 4R3CA 4FVPA 3KK9A 3SV0A 4OBPA 2X6EA 3FJQE 1KV2A 2ZMCA 3IDCA 1ZOHA 3NVMB 4DG3E 5IZFA 3Q9YA 3BU5A 2IZUA 3ETAA 5CU3A 3V04A 4O7WA 3GC9A 3RKBA 2CJMA 3PJ2A 4PL5A 3ROCA 3HP5A 4RIWA 2QONA 4RWJA 3HVCA 5CAQA 4J98A 4PPCA 3RCDA 3Q9WA 3F3ZA 4ZJJA 4BDEA 2Z7RA 3OWLA 1Z5MA 5DH3A 3VRZA 3OHTA 3SOCA 5AJQA 4FZ7A 2Y4IC 2GSFA 2J5EA 4D9TA 2GDOA 4KKHA 5BYZA 2Y6OA 4CFWA 1XO2B 3LXKA 4I22A 5AV0A 3QLGA 5FRIA 4BTFA 3ZXTA 2EB2A 4UN0C 4DF3A 1M7QA 2IVVA 2HXLA 2X7OA 2O2UA 2O65A 3D5WA 4C7TA 4E20A 4GK3A 4F9CA 4UMUA 3QKKA 4X3FA 3FC2A 3D7TB 3QX2A 2C1AA 4PMTA 5K4JA 4DFUA 4RLLA 1PMUA 5CI6A 5GJGA 2YM4A 3FHRA 1F5QA 5A4QA 1RDQE 4KIQA 4BBFA 3R7UA 4QTEA 3MVJA 4MQ1A 4YZBA 5AUTA 4YZ9A 4EOQA 3FAAA 4BHNA 3TM0A 3LMHA 2R3IA 4FNYA 3OCGA 1KOAA 5JT2A 4GIHA 3QYZA 2VO7A 3R1QA 3O17A 4P90A 5LXMA 4FKIA 3FMMA 4FG7A 5DWRA 4APPA 3TZ8A 3SKCA 4GFMA 1GOLA 2W1DA 4X2NA 4NZWB 3HL7A 4ANMA 1OL2A 4RIXA 2JDSA 1W7HA 5CALA 2YERA 3PPKA 4BIDA 3W8LA 3CGFA 3DTCA 3MESA 4CKRA 4FC0A 2WAJA 4LV5A 5IA1A 3QRUA 5AP5A 4IJ9A 4RPVA 2ERZE 3SC1A 2HWPA 5CZIA 4I4FA 4E6QA 5HVJA 2V22A 3NVKI 3DBFA 1OPKA 2OJIA 3QZFA 5HD7A 3IOKA 1MQ4A 1WZYA 3HYHA 5DEWA 5CY3A 5AUZA 3ZDIA 4C4JA 3DXQA 4X3FB 3GC7A 5L2TA 5KMIA 4DFBA 2CNQA 3VBXA 3UDBA 1A48A 5H8GA 5KKRC 3OT3A 3OZ6A 4O2ZA 3ZFMA 3ZO1A 3MH2A 3DKOA 3BEAA 1YWNA 3T9IA 3TKUA 4Z9LA 3P7CA 2V0DA 3EQRA 4BZNA 3E5AA 4USEA 4BIEA 3WZJA 2WMUA 3LFCA 5BNJA 4AN3A 3GC0A 5LVOA 3AGLA 3MPAA 4QNAA 2C6MA 3DA6A 2AYPA 4XP2A 2GNFA 4GCJA 3UQGA 1OL7A 3IDBA 2R3PA 3DBQA 2H9VA 4XV1A 4R78A 3TIYA 4O81A 4RZWA 3H10A 4P5ZA 4XG9A 4RIXB 5CSXA 4EEVA 4NU1A 2E9PA 3II5A 5BX0A 2QLUA 3DKCA 3A62A 3C7QA 3C4WA 1WBTA 3ZM9A 5AM7A 4F99A 3ZFXA 3PJ1A 2BHEA 4MEDA 5CS6A 2XIXA 3UZTA 3V5TA 2IZTA 4II5A 4CLJA 1YWVA 3FKOA 5A14A 3LJ1A 3FI3A 1LP4A 3C4CA 1UWJA 1YVJA 4L67A 3TUDA 4LGHA 4BDFA 2PVMA 4I20A 3U55A 5L6PA 3BGQA 3LFFA 3KB7A 4F09A 4O38A 3A8WA 3NW5A 1FVTA 3G9LX 2A2AA 4PV0A 5J9ZA 2QG7A 2CPKE 3EFKA 4PMPA 4YZNA 5G1XA 5HI2A 4C4FA 1WBWA 2VTLA 3JY9A 4CFMA 2BAKA 3AD5A 3E3BX 4USFA 5IA5A 1MRYA 5AP7A 4YTIA 3PVGA 3F5UA 1PMEA 2QO2A 4FODA 5HORA 4UWCA 3NUXA 4XP3A 2VO6A 2WMWA 4DGLC 2Z02A 4YO4A 3RZBA 2VU3A 2HELA 5HTIA 4ZSAA 2W4JA 4LOPA 3OFMA 4G2FA 5AX9A 4EH7A 4DBNA 4J99A 2QG5A 5HLNA 4KIPA 3GFWA 4IVCA 2ZAZA 4WBBB 2ZV8A 3FYJX 5GINE 4ERWA 3VS3A 4IZ7A 1XH9A 1Z9XA 4PP7A 1FQ1B 4RSSA 4TXCA 5AP3A 3DU8A 4ZJIA 2VTJA 4QO9A 4QMMA 4CYIA 2PMLX 3WILA 4QP6A 4D4YA 3NUPA 2XRUA 2BRBA 2OIDA 2OZAA 4PDYA 4QP7A 3PY0A 5IPJA 4BR3A 1NVRA 4I0TA 2WNTA 4ZSGA 2PL0A 4QT1A 4WSQA 4XV9A 4YJQA 4V01A 4Z3VA 3LVPA 4HYIA 3VW8A 2F9GA 2C6DA 5KBQA 4WRGA 5ETIA 4AW0A 2KULA 2YACA 4UMQA 4XG2A 3UOHA 1NT2A 1Y8YA 3BGZA 4XLVA 4C2VA 1K3AA 2UZEA 4JBOA 3IS5A 2P4IA 4AA4A 4U43A 4QNYA 5T3QA 3SDJA 5M55A 2PUNA 4K0YA 5B2KA 2J51A 3QZIA 3P78A 4GUBA 4C3FA 4ARKA 1PXOA 4FT5A 4YGAA 2C0OA 5AP1A 4QTBA 2IW8A 2UW8A 5IDNA 2H8HA 2W1HA 2JBOA 4FBXA 4ZY5A 3RALA 5KNJA 4D1SA 2HZIA 5D12A 4I21A 4F0IA 2VTRA 3QTZA 2XIRA 3PJ8A 4AZEA 5A6OA 2Y9QA 2ITOA 3HUBA 3PPZA 5KE0A 3SLSA 5IA3A 3GB2A 3F5XA 3RPYA 1SVHA 2WGJA 3B8RA 4A4OA 4EHVA 4EHEA 3CC6A 5HIEA 2FSOX 2OZAB 1U5QA 3FLYA 3KULA 4HZSA 2NPQA 4BCIA 4QMYA 5M51A 4HYSA 4L43A 4MKCA 2OZOA 3PXFA 1I09A 1W83A 4O0YA 5E8ZA 2DWBA 1UV5A 4IC7A 4QMWA 2P2HA 3AXWA 3FZPA 4JBPA 4LRMA 4NT4A 4D4VA 3HMPA 4UYAA 1XKKA 3K3JA 3QGWA 4H58A 2WIPA 2GHGA 4I92A 4U40A 3IONA 2QLQA 4FKWA 5CEQA 4PDSA 4R1VA 5TF9A 3R1SA 3R1YA 5ANJA 4B0GA 1UVRA 2XF0A 3MS9A 2VAGA 3FZOA 3BYSA 1H07A 1NA7A 4JQ8A 4D2WA 1ZMUA 4L01A 1XBAA 3IW8A 2REIA 3ORKA 1NVSA 4OTRA 4YJVA 4CVAA 4EK4A 2DYLA 4F0GA 4ZTRA 3PWDA 2R3QA 3CTHA 2J4ZA 2UVZA 3QRKA 4M14A 4M68A 4LRKA 4O0TA 4EOJA 4FNZA 3W33A 4DT9A 3KMUA 5CF8A 4TYHA 4EHZA 3QTSA 2BAJA 4LYNA 4X21A 4L7FA 3E8NA 4TW9A 5FXQA 1PKGA 3ZZWA 2Q83A 2JKQA 4Y8DA 4HCVA 4EJNA 3QC4A 4BTMA 5GIPE 4C37A 4OLIA 4WG5A 1OIRA 1DM2A 5AR4A 2WIHA 5FTOA 3OMVA 3IECA 1ZLTA 4QPMA 4KABA 4FV9A 2PVHA 1GIIA 4GT5A 4MXZA 3A2CA 4BDHA 2XIYA 3HEGA 2YM6A 1BKXA 4FT3A 5DR2A 4RQVA 4BI1A 4FIEA 1UWHA 4GG7A 5HOAA 5LCJA 3JR1A 2J0IA 3EZRA 4FT0A 3N4TA 5IQHA 3AD6A 3PY1A 4LI5A 2Z60A 4F7SA 4DEBA 3FMEA 2WQMA 3WYXA 4D9UA 3ZBXA 1U5RA 2NP8A 2PTKA 3ORPA 3O7LB 4PDPA 4BTJA 5IA2A 2R3MA 3D14A 4MWIA 3KVWA 5JGDA 5BVWA 3LJ0A 4RLKA 4YHFA 4F9WA 3RK7A 3WE8A 4O7TA 4IM2A 3EKKA 2W1IA 3W2PA 2LAVA 4E5AX 2JDOA 2BDFA 3LLTA 3UNKA 2CGVA 2WXVA 3BV3A 4FNXA 2PHKA 5CNOA 5GZ9A 2I7QA 1Q3WA 4B7TA 5ETAA 4RFZA 3ACJA 2BRHA 4G9CA 4OW8A 5IH5A 1GJOA 4H3PA 2B7AA 1Q8YA 5AR5A 3NCGA 4IM3A 5CF5A 4U45A 5HCZA 1KE9A 3C4FA 4C62A 3P0MA 4RIOA 1XH4A 2OFVA 1G3NA 3TJCA 5A54A 3OTUA 2J0MB 3TCPA 1FMOE 4FK3A 4G31A 3CS9A 5CSWA 2XK8A 5A4LA 5KMLA 4I24A 4ORKA 4U79A 3M11A 5K0XA 3HAMA 4BF2A 3ZUUA 3Q4CA 4YNOA 3HV3A 1P5EA 3DFCB 3HV7A 3ZH8A 2IVTA 3Q6WA 3VNTA 3R9NA 4F6SA 3QUPA 5ANOA 1ZZ2A 4EOPA 3MB7A 2BALA 5T6KA 5EQPA 5DLSA 1FINA 5IQEA 2QCSA 2GQGA 2I1MA 5A6NA 2QO9A 2W4KA 2DUVA 4AA0A 4ANSA 2PZRA 3I7BA 3SHEA 2V5QA 1OB3A 2UVYA 4FSTA 4I6HA 2C5YA
chains in the Genus database with same CATH superfamily
3T3UA 4O0WA 5ICPA 4FR4A 3QLFA 4J52A 5JMSA 1BX6A 1SVEA 4IAZA 1Q62A 1JKKA 3LOKA 1YQJA 5FXRA 3HAVA 3F2RA 3O50A 3PG3A 4FMQA 4RVKA 4BZDA 4JI9A 3U9CA 2BPMA 2WTIA 5J95A 4MF1A 5B2MA 5HX8A 3TDWA 1OGYA 4O6LA 3FLQA 3BHHA 5CZHA 4BCGA 1W8CA 4O21A 4EUUA 3SXFA 1OKVA 3LFNA 2CMWA 3MVLA 2QURA 3KFAA 3MPTA 4X3FC 3SQQA 4RFMA 3RM7A 1BI7A 3S2PA 2ZV9A 4FV7A 4USDA 3BL7A 4YJOA 3UMWA 3ZRLA 3DV3A 2GFCA 2UZLA 3W32A 4E4XA 2YZLA 1R3CA 2J50A 3KK8A 1R78A 3OVVA 4IDTA 5FLFA 3U4WA 4BC6A 5DT0A 4E4NA 4DH7A 1APME 3W0PA 2R3NA 3PP1A 4FL3A 4L53A 4F6UA 5DI1A 2YWVA 2ZV7A 3AD4A 2IZRA 4A06A 3LFAA 3QQGA 4P7EA 3MGYA 4MK0A 3PXRA 3PSBA 4FSZA 4AT4A 5LCKA 4BBMA 4DDGA 2V62A 2J0JA 4IXPA 2YA9A 2ZM3A 3NNVA 3FPQA 2WEVA 3Q96A 2UW6A 5DVRA 1IR3A 3VF9A 4CG9A 3LLAA 3UQFA 5H3QA 3ZC5A 4XH6A 3P7BA 4NM0A 4MBIA 5AV2A 4GKIA 2OICA 4RX9A 4D5HA 2WQNA 3F69A 3NDMA 1IA8A 2ZDTA 1H01A 4RJ8A 4KUJA 5DRDA 2HXQA 1Q8UA 4IDVA 4NFNA 3CY3A 4NIFB 3IGGA 5F20A 3GOKA 4U3ZA 4R7BA 3SGCA 5E8SA 2BDWA 1OL5A 3K2LA 4DEIA 4L44A 4K2RA 3C50A 4EOSA 5C03A 4YU2A 2BFYA 4JNWA 3VO3A 5IQGA 2ITPA 4GV1A 3TKHA 4BDJA 4AW5A 3LHJA 4M84A 3TZMA 4FV8A 3OY3A 4JIAA 1S9JA 3CGOA 3C0HA 4R77A 1GZKA 4FX3A 3R02A 2BKZA 3ZFYA 4YHJA 1KUTA 5HG8A 1ZOEA 3KRXA 3IO7A 3PVBA 1B38A 4TT7A 2F7XE 4M69A 3G0FA 3L1SA 4C4EA 3KCFA 3P08A 4O7LA 2J6MA 5J9LA 4CFVA 2B0QA 3NUAA 3O2MA 4U97A 2DQ7X 3KRJA 3QQHA 4QEBA 1P4OA 2JD5A 4CYJA 3ERKA 4W4YA 1PRYA 1URCA 3BWJA 1NW1A 4WT6A 1QPEA 2R3GA 3DZOA 4Q5EA 5KHXA 1X8BA 4FI1A 2BTRA 5FWKK 5H8EA 2ITXA 1J7LA 3FWQA 1XHAA 3MPMA 3TL8A 1VR2A 3LM0A 3EN6A 4FTIA 3ULZA 4OTHA 1YOJA 4NEUA 5E9EA 2X8IA 3Q32A 2ZOQA 4CZTA 5M4FA 4IWPA 5TKDA 3FZ1A 1FMKA 5HO6A 5EI2A 3T8OA 3PJ3A 4NJDA 3UOLA 3BRBA 3IGOA 4Q9ZA 4GG5A 3L9LA 3BCEA 2PE1A 2GNLA 3P4KA 2FGIA 3CP9A 3O71A 4IQ6A 4IFGA 3ZLXA 2C0TA 4DFYA 3LJ2A 5AADA 1WVYA 2PULA 5HBJA 1CTPE 3A7FA 3QD3A 3G9NA 2AQXA 2CGXA 2GMXA 2YN8A 5LOHA 2PMOX 3NZ0A 5HO7A 2E9VA 2W17A 4RG0A 5HE0A 5M08A 1FPUA 4ANQA 3KRRA 4LM5A 4L8MA 2CSNA 5LMAA 4JIKA 4OBQA 3U6JA 4I0SA 4CCUA 4XBUA 2YCQA 2GCDA 1KOBA 5ANDA 3EH9A 4AZSA 4DDIA 4QRCA 3F3VA 4TYGA 1ZRZA 1R1WA 5E90A 3GU5A 4DFLA 2YAKA 2W05A 2EXCX 1LR4A 2QOBA 1CKPA 2R64A 2XNGA 3QYWA 4IX6A 4OTIA 4DGMA 4MH7A 5BMSA 4PP9A 5DOSA 5L6OA 2XNEA 3LE6A 5TE0A 4DC2A 4AUAA 4YMJA 5CF4A 1WBVA 4ANNA 4D55A 2W1EA 2XRWA 2OXXA 1P14A 3EL7A 3EL8A 4I6LA 1E1XA 3OG7A 4NM3A 3JYAA 3R8PA 1RE8A 3QD4A 2F2UA 4IZAA 4MNEA 1QCFA 3EYHA 4FYOA 4U42A 4UMTA 5C9CA 2C69A 1UU3A 1A9UA 5FM3A 5LVMA 3LQ3A 4V05A 2YHVA 3FXZA 2HZNA 2QU6A 4FTQA 5EHLA 4M15A 3R9DA 4U41A 4ASXA 4MAOA 4EK5A 3FZRA 1Q61A 2BHHA 4FV6A 1MQBA 4P4CA 5FXSA 3THBA 4FSRA 2BUJA 3WBLA 3ET7A 4AF3A 3T9TA 3E7OA 5LVLA 3UE4A 3JVSA 5CU6A 3AC1A 4BCHA 4CTBA 1H1WA 4PQNA 5CEIA 2IG7A 4ZS0A 5AV3A 1IEPA 3NS9A 1YI4A 5K0KA 3TIZA 4QDVA 1E1VA 4G17A 4NTTA 4R1YA 4UZDA 2C3LA 4W9XA 3BYOA 5FP5A 4APCA 4CRLA 2R7BA 5HNIX 2HIWA 3QUDA 4QYFA 4W4VA 5KUPA 1ZYSA 2I40A 4IAKA 4J96A 2UW5A 5EFQA 4A4XA 4GL9A 4DYMA 4NH1A 3VRYA 3VJNA 5JZJA 4G5JA 1STCE 2OWBA 4YC3A 4JG7A 3R01A 4FZ6A 4N0SA 2BFXA 4QMPA 4E6DA 4CQGA 3D0EA 2VWXA 2PZPA 3VIDA 2YIXA 3VS2A 2GQRA 2V55A 3AT4A 3I0OA 4RWIA 2PZIA 3L8XA 2BRMA 4AS0A 1JPAA 3ITZA 4NL0A 2VTAA 1QPJA 5GJDA 1ST0A 3NMUF 2VUWA 2VWYA 4IAIA 1IG1A 5AUXA 3GGFA 3CPBA 4WG3A 4D2RA 2P55A 4M0ZA 2XBAA 3VUIA 4U44A 3UG2A 4AGWA 4ANBA 4D0WA 2YWPA 3DXNA 3LXLA 3GUBA 3RINA 4CT2A 4DE4A 2YLFA 3RTPA 4MNFA 5EKNA 4DH3A 3RWPA 5D7AA 4BVUA 4D58A 4D1ZA 2WMRA 4XYFA 4A9SA 2W0JA 2HY81 5CX9A 5TO8A 3BIZA 4F7LA 4F70A 5AA9A 2ETMA 4QPAA 2UW7A 4PL3A 4UY9A 2WKMA 3VS1A 4EK3A 2X0QA 4ENYA 2BIYA 2EU9A 4ASZA 4JR3A 3HMNA 5T68A 2UZNA 4NM7A 5K9IA 3V5QA 1WVXA 4H3BA 3ZC6A 2X81A 3L8VA 4HGLA 2R0IA 3DAKA 5IQCA 4WUAA 4F9AA 5IQFA 2VO0A 2W9ZB 3SG8A 2R7IA 3MV5A 5DHJA 3DB6A 4Q5HA 4JRVA 4DEHA 3RMFA 4Z16A 4ZY6A 4OR5A 3HMMA 5EOBA 2P0CA 3R22A 5CYIA 4DHIB 2OF4A 5IQIA 4I94A 2J0LA 4JT3A 4UWYA 5IQBA 4TL0A 4RVTA 3VBTA 5CU2A 2BZJA 2AC5A 2YEXA 4HYUA 3TNIA 2C4GA 4F78A 5DRBA 3MBLA 2UZDA 4EBWA 3ZEWA 3SX9A 5EI6A 4JAIA 2XP2A 3QTIA 4G6OA 3DXPA 1V0PA 1Z57A 4GSBA 2ITYA 5AR3A 5L2WA 2XYUA 1AD5A 4MQ2A 4LOQA 5CVHA 3W55A 5HU3A 4O96A 4BCKA 4EK6A 4OTWA 5ANEA 1B39A 4DHFA 4Z7HA 2QHMA 1H00A 2WQBA 2JAVA 2FA2A 2IW9A 4F64A 2QOQA 5BUIA 5JGBA 2R2PA 4TWPA 2O3PA 3ORXA 3N9XA 4FV0A 2ZB0A 4ZLOA 4ZZMA 3OF0A 2OGVA 3FSKA 5L3AA 3AC5A 4P2KA 4RC3A 4V0GA 3EN9A 4ZMFA 3GU6A 4YJRA 2EXMA 1Y91A 2YDJA 2VWBA 4F1MA 3GI3A 4A4LA 4CMUA 5DFPA 3CXWA 4BWKA 3DGKA 4U9AA 3P5KA 4IBMA 4AZWA 1YDTE 2XEYA 5L8JA 3SAYA 4EI4A 2OF2A 3HGKA 3QCXA 2DS1A 4UEUA 3JVRA 2WTKB 3GU4A 3UC4A 1DI9A 2VD5A 3NNXA 4IWOA 4GK4A 4XG7A 2NRYA 3DPKA 2HY0A 5ITAA 4FIIA 2GNIA 3VC4A 4LGGA 3FQSA 4C8BA 4L9IA 3GU8A 2R3FA 2H96A 4GU6A 3DFAA 3G6HA 4QP4A 3FEGA 3NUUA 4ZIMA 2PUIA 3BE2A 3Q4ZA 3OROA 3QZHA 4BCQA 4O86A 4EJ7A 3FQEA 4C0TA 3CQEA 2PVJA 3ZM4A 4JR7A 3I7CA 3PIXA 4YTFA 3WZDA 3NUSA 4BCMA 5I9XA 3BGPA 4WD5A 5LWMA 4GFGA 5K5XA 3CIKA 3GT8A 4RIWB 3MH3A 4FOBA 4L6QA 2XKCA 3F61A 3QFVA 3VUMA 1XMMA 3BEGA 3QRTA 4FT7A 4XG8A 2ITUA 2WO6A 4XRJA 2XNBA 2CLQA 4FSNA 4GIIA 4O0VA 1GIJA 4Z55A 2XK6A 2X39A 3OBJA 4V0GB 4QP1A 3QX4A 4IMYA 5JRQA 4TWOA 3ORZA 1Q8WA 4ZSJA 1R0PA 3E92A 2I0VA 5CAOA 4O7VA 2X7GA 4GYIA 3F3WA 4LMNA 3EFJA 5HBEA 5HIDA 3RK5A 4FKPA 2WHBA 4BDDA 4DA5A 1WBNA 5AUYA 4CV8A 4PMMA 5IUGA 3G5DA 5BMMA 3FMNA 4K1BA 2X9FA 5KO1A 1JBPE 3B8QA 4KSPA 4AT3A 5KMKA 4AW2A 3DBCA 5BUJA 4FF8A 2QKWB 3V5PA 4EC8A 3HZTA 4EH9A 5IKWA 4JOAA 1U54A 3MN3A 4XV2A 3Q60A 3GENA 3T3VA 4AP7A 5IA4A 3ALOA 5DIAA 3HDMA 4CNHA 3S1HA 4LV7A 4G3GA 5L8LA 2A27A 3CD3A 2H34A 2VNWA 4RJ3A 5A9UA 3UYTA 5I0BA 4BCJA 4C2WA 4KRCA 3H9FA 2VWWA 4L45A 5EH0A 2PY3A 1PHKA 1OKWA 3RM6A 3RNYA 1ST4A 5DEYA 3UNZA 4ZEGA 1Q8ZA 2G2HA 4GJ2A 1YXTA 5AUUA 5L2IA 4EOIA 4F63A 3HP2A 3MIAA 5IMEA 4ZTNA 4AOJA 5JGAA 4OTGA 3WARA 4PTEA 2BRNA 4I23A 4IWQA 4IH8A 5JFSA 3GQLA 3NCZA 1XH6A 3GFEA 5ETFA 2XIZA 2X0PA 4ZTMA 3CKXA 3TV4A 4L52A 4OTDA 3FLNC 5BV3A 2X6DA 2GTMA 4RC2A 2QU5A 3C51A 3U4UA 3A7HA 4BDGA 5AV1A 4ZTLA 4NSTA 2ONLA 3R21A 2GTNA 2IO6A 4JDKA 4LUEA 4D28A 3P86A 4AW1A 3KF7A 4JJRA 3R9RA 5EG3A 3PXZA 4ALWA 1U54B 3QTUA 4NCTA 1PMVA 4XG6A 4LFIA 4RZVA 3UIXA 5I9ZA 3ODZX 3GCSA 4TYJA 4B9DA 4UB7A 4BICA 4ACCA 4F9BA 3PLAE 2JLDA 1GAGA 4FZDB 2W06A 4AFEA 2FVDA 1OUKA 2C6IA 2UZUE 1Y6BA 3NYXA 3DLZA 5BPYA 4FGRA 3HRBA 3IW7A 4MCVA 3VS4A 3I6WA 1R39A 4DAWA 5H8BA 3R9HA 4BN1A 4I5CA 3OXIA 3D94A 4LMUA 4YPSA 5EHOA 5AUWA 2QC6A 5AP0A 3A60A 3TDVA 1Q41A 3LFQA 3EQDA 3CLYA 4G3FA 3A7IA 2ITVA 1F0QA 3AT2A 4DITA 2ETRA 3KEXA 3BLQA 4DFNA 2PVFA 4KWPA 2NRUA 4FICA 2O5KA 3VJOA 3MW1A 4C4IA 2GFSA 4JXFA 4PNIA 1U59A 2I0EA 5J79A 3DK6A 3PY3A 2JDTA 5JSMA 1ZMWA 2O8YA 3Q53A 3D2KA 3Q4TA 3NYOA 4LL5A 4AX8A 1J1CA 1DI8A 4LDTA 2JBPA 2VRXA 3FXXA 3CQWA 4X6QC 2IVSA 3O7LD 3SRVA 3TG1A 5D11A 3P1AA 3ZONA 2YCSA 3OY1A 4U6RA 3WOWA 4E5WA 3BLHA 1SYKA 5C26A 4FNWA 3FLSA 4G6NA 1M17A 2VX0A 4FSYA 2G1TA 2J0KA 2OIBA 1L8TA 3BU3A 4H1MA 3G90X 2NNWB 4BKJA 2VGOA 4EQUA 3OW3A 5DGZA 3AOXA 4HVHA 5M56A 2W9FB 2PMIA 2BZHB 2FYSA 4UV0A 4ALVA 2F4JA 1V0BA 2W1GA 4DG2E 4RC4A 5JH6A 5I9VA 3FKNA 2BVAA 2C3JA 1ND4A 3E7VA 4O4EA 3QA0A 4CSVA 1ZMVA 1JWHA 4IVBA 4GVAA 1FVRA 3WF8A 2OIQA 4ZSEA 3DT1A 4M97A 4QMSA 4M13A 2WB8A 2BILB 5TR6A 4UXLA 4BCFA 4NUSA 3I79A 4H3QA 4EOOA 5J7HA 1JSTA 2XNNA 4G3DA 3MIYA 3R8VA 3W8QA 2O64A 1ZYJA 2H6DA 3DK7A 1YXSA 3GCQA 4ZJVA 4F08A 3IK3A 3QC9A 2XB7A 3KL8A 4PL4A 1TQPA 4KB8A 1CDKA 2W7XA 3SOAA 4X2KA 4QYYA 3ZSIA 4YBJA 5E1SA 1YI6A 4FKVA 4FOCA 1H1SA 4FTOA 2LGCA 2Q0BA 4G3CA 3Q5ZA 5HLPA 3PRIA 1H8FA 5FG8A 5IH4A 4RT7A 2PU8A 4MD9E 2B9IA 4RX7A 4XX9A 3SD0A 1WVWA 1GZNA 2ACXA 1GZ8A 2UW0A 2XUUA 4YNEA 5E92A 3KREA 1GY3A 2I6LA 4NJ3A 2WMXA 3OT8A 3FC1X 2XM8A 4S31A 4M3QA 1J3HA 1OL6A 5CEKA 4TYEA 4OUCA 1QL6A 5AX3A 3FZSA 1O9UA 3AKJA 5J1WA 5EYDA 4EH6A 4AT5A 3DJ5A 1KWPA 4C59A 4B6LA 3EMGA 2XVDA 4OTFA 3A7JA 3O96A 3LQ5A 4PUZA 2JGZA 3QKMA 4IIRA 3CBLA 4NM5A 4FKSA 4Y5QA 3R7IA 3QBNA 3KULB 3H0ZA 5IEXA 3H9RA 3BZ3A 2A4LA 5LMBA 2ERKA 3FI2A 3F82A 5IU2A 4RGJA 2GU8A 4M7IA 1GZOA 1TZDA 3W0OA 2E9OA 3ATTA 2WQEA 3R83A 2XCKA 3KU2A 4XMOA 4O4BB 4TYIA 1ATPE 1OECA 3ULIA 4BKYA 3LFDA 4BL1A 4I1ZA 3W0QA 2W96B 2BCJA 4G1WA 1SMHA 4EH8A 1HOWA 2VTHA 4AWIA 5HO8A 2PZ5A 5D9HA 1MRUA 2FUMA 4BRXA 4YPDA 3FI8A 2XNOA 3PFYA 3DTWA 3PDTA 4TKSA 3DOGA 3I81A 2G2IA 2ITZA 2QHNA 2Q0NA 2XKEA 4U5JA 3ZSGA 3AT3A 3C5UA 3BQRA 2X4FA 3MH0A 5BVOA 4IM0A 4BGHA 3V3VA 4IVDA 2FSLX 4QMNA 1A06A 3OWJA 3DJ7A 1OBGA 3EHAA 4AACA 3WZUA 2XAOA 3KIOC 3UMXA 4TYHB 5AAFA 3I0QA 2WMTA 2C6OA 4I6QA 5EYCA 4BCPA 4C3PA 2C5XA 1OVEA 1YOLA 2PVRA 2WTKC 3CD8A 3QQKA 4J71A 3U51A 3EYGA 3RCJA 4H1JA 4WG4A 1YW2A 2IVUA 5CWZA 5HKMA 4O0XA 4ENXA 3RZFA 2C5OA 3UPZA 3V51A 2F7ZE 1ZYDA 4Y46A 3O8PA 3R6XA 4WNMA 4EZ7A 3L9NA 3ZHPC 3TMOA 5EW8A 4BY9E 3QALE 3E62A 4ACHA 3CSVA 3RBWA 5C8MA 1ZAOA 3D4QA 3IPHA 5AR2A 1FGIA 5CT7A 3LKMA 5CQUA 2C0IA 2XK7A 3HRFA 4WNOA 3BLRA 4E93A 3QHRA 4O4DA 4CGAA 3V8TA 3KN6A 3C5IA 1BLXA 3PA5A 1Y57A 2WEIA 4JBVA 4BI0A 1W2FA 3TT0A 4ID7A 4YURA 2BAQA 4K8AA 4MTAA 4O91A 2VTNA 3ZMMA 5GZ8A 3TZ9A 1YHSA 2PUPA 3HLLA 3UO6A 4B99A 3CCNA 2VNYA 3G2FA 4FSUA 4F9YA 4FGBA 4I6FA 4ZTSA 4O4CA 3SVVA 4D4SA 2YABA 1Q3DA 3OC1A 2QOIA 4FTLA 4U8ZA 2A19B 4I5HA 4RJ6A 3VS5A 2WMQA 4EK8A 4BJJA 2VTIA 3F6XA 1H26A 4C3RA 3TNWA 5F4NA 4EQMA 3OXZA 3OW4A 4S34A 5AP4A 4J8MA 4DCAA 2VX1A 3HA6A 2X9EA 3P23A 4NKSA 2VO3A 4PY1A 4F6WA 2ZB1A 2XH5A 2J9MA 5DA3A 3Q4UA 5HHWA 4O7RA 1KE8A 4AN2A 2QOHA 1H28A 1HCLA 4J8NA 2JKMA 4Q2AA 3NNUA 4C58A 3R9OA 3PFQA 5JQ8A 3VVHA 5HEZA 3SG9A 4R3RA 5EK7A 1ZYCA 4UWBA 4AXCA 5I9YA 5FD2A 3CTQA 5IMXA 2OJFE 2R3LA 3DQWA 2YDKA 1VLRA 1UKHA 2XJ0A 4FV5A 3RNIA 5CAUA 4D2VA 4HVGA 3W0MA 5BVNA 2O0UA 5CF6A 3EB0A 2JITA 3F3TA 4KAOA 1BL7A 3PLSA 1Q24A 5FBNC 3COMA 2GNHA 3W2SA 2QR7A 3EIDA 5IQDA 4FIJA 4WA9A 1JOWB 3BX5A 1G8JA 3AMAA 4ITHA 1FOTA 3BPRA 4FEVA 1LEZA 4YZDA 5FDXA 2C1BA 2UVXA 4ANOA 4E4MA 3U54A 4AXEA 3FMLA 4O84A 3EJ1A 4QMTA 2WOUA 5K5NA 2OH0E 2QD9A 3I6UA 4AXFA 1DS5A 3NPCA 1T45A 2UZBA 3FY2A 3FBVA 2YDIA 2F7EE 1AQ1A 2E9NA 4JQEA 5KMNA 2UW9A 3E8DA 2YIRA 4HGSA 3F2NA 4FZFB 3ORTA 1CSNA 2RFNA 4IB0A 4MHAA 3F5PA 3H4JA 4FV2A 3PP0A 4ACGA 2XMYA 3LXPA 3QF9A 1H08A 4E1ZA 5BYYA 3BE9A 4BBEA 2CNVA 4DHZA 3R8LA 3G0EA 1WAKA 4QP8A 3UVPA 2UUEA 3ZO3A 4R7IA 2XARA 2W5BA 2X8DA 4G5PA 4NK9A 5DMZA 3ZLWA 5J5TA 2R3HA 3DNEA 2PYWA 4OAUC 1J91A 4IX3A 4CRSA 2XANA 5J9YA 3FSFA 1PJKA 3HKOA 4O2PA 1OKZA 1XH8A 4EBVA 4QMZA 3MJ1A 3CR0A 2J2IB 4FTAA 4DH8A 5KMJA 4RA5A 3K5VA 2OLCA 4DT8A 3I5ZA 4KS8A 4BDIA 3OXTA 3JPVA 4JS8A 4CFNA 4CCBA 4QPSA 3VHEA 3FE3A 4RIYA 4BYIA 2PMNX 3DBEA 4C57A 3GBZA 4JDHA 3E8CA 3PA4A 3PRFA 3RPSA 4D4RA 3BLAA 2ONLC 3MFSA 4G9RA 5IG1A 3Q2JA 3R2BA 4J53A 1K2PA 3QGYA 3HECA 2YIQA 2YJRA 4OTQA 4IW0A 4TY1A 5J8IA 5D41A 3QU0A 4XEYA 5JEBA 4I5MA 3GCUA 2JAMA 3UTOA 1OUYA 3NAXA 4FKLA 2QOKA 2QODA 4RMZA 3A99A 3Q52A 4ANLA 4JX3A 1UA2A 2OFUA 4Y73A 3UODA 3V6SA 5IF1A 2WPAA 4KIKA 1KE5A 4M69B 1DAYA 3DDQA 3EN4A 3DY7A 3F9NA 4Y95A 2ETKA 3IKAA 4U80A 4XOZA 1ZOGA 5KCVA 3MYGA 4TN6A 3NSZA 3BL9A 1M14A 3WE4A 1UU9A 2VWIA 2JDVA 4M12A 4AOTA 4FV4A 3R8ZA 4BKZA 4WBOA 3TN8A 3ELJA 2VWZA 2EVAA 3QZGA 5DT4A 3O51A 3E93A 3WF7A 3LCSA 5EOLA 3LIJA 3ZTXA 5I4NA 3A4OX 5CASA 3I1AA 1M2QA 3E8EA 4JDJA 1QPDA 3OCTA 4RIYB 4FG8A 4Z7GA 2WFYA 3TV6A 4XOYA 4ZZNA 2J90A 5DR6A 4ZAUA 5AP2A 3C0GA 4BI2A 2HZ0A 5L2SA 3W18A 2XCHA 2HZ4A 4TZRA 4WOVA 5LVPA 2QR8A 1H1RA 3EN7A 3MJ2A 3IW6A 3R7VA 1F3MC 4W9WA 3SXRA 3QXPA 2XAMA 3E3PA 4XRLA 3TXOA 2CCIA 2J7TA 4MXCA 1Q4LA 3UP7A 3NW6A 5LQFA 2JKOA 1PF8A 1WFCA 2XK3A 3F66A 5M07A 4YTHA 3C0IA 3ZO4A 4CMOA 4CQEA 1Q5KA 3PSCA 1PYXA 1XR1A 3DNDA 4O0UA 4HCUA 1YOMA 4XV3A 3MVMA 4GFOA 2B53A 3HUCA 4NWMA 4ZTHA 4R5YA 5IUHA 3DJ6A 3N4VA 3UOKA 4AGUA 4U0IA 4KINA 3PVUA 4M8TA 1V1KA 4HGEA 5A4CA 2GQSA 5AFVA 1J1BA 2R5TA 2UZVA 5H9BA 4DEEA 4E73A 5I3RA 4FEQA 2XNPA 3TNQB 5J5SA 4C35A 2A1AB 2CDZA 3CJGA 4PMSA 5CVGA 2RFEA 4YHTA 3NRMA 3MTFA 4MNEB 3KRWA 5ANGA 5EQYA 3W0RA 1UKIA 2JEDA 2CKEA 3R0TA 2ZVAA 4BB4A 2B9JA 5FQDC 2AUHA 5AUVA 3RAWA 2V7OA 4DINA 3POOA 4E6CA 1PXKA 3L8SA 5L4QA 4CFUA 1PXLA 3PWYA 4FVQA 4OTPA 3RP9A 5LMKA 4KKEA 3V5LA 2FB8A 5G6VA 3DKFA 1FGKA 4CD0A 4DGOA 5J7BA 4JAJA 1HCKA 5AMNA 3COHA 5DN3A 1OMWA 5HVYA 3ZLSA 4HVDA 4DG0E 4IVAA 5FEQA 4HPTE 2UZOA 4NFMA 4MD8E 4TWNA 2OBJA 3D83A 3MY0A 4UALA 3LM5A 4FKQA 5L6WL 3BWFA 4ERKA 5BYLA 3OUKA 2IPXA 4D2PA 4KSQA 3UOJA 2QOOA 3D2IA 4YC8A 2XZSA 5EM6A 4FUYA 3LW0A 3SW4A 1UNHA 4HPUE 2W1CA 5HU9A 4YSJA 2CCHA 4DN5A 4QDEA 3LFSA 5CXZA 3S00A 4GW8A 3NEWA 3ALNA 1YI3A 2XIKA 1BMKA 3MA3A 2B1PA 3PG1A 5B0XA 4CV9A 2XBJA 2JDRA 1CM8A 2ZDUA 4J95A 3KXMA 4H05A 4HZRA 3WF5A 5CEPA 2W5AA 3HV6A 4EH4A 5LJJA 1YHVA 3TKIA 2IZSA 3FV8A 1VJYA 4C61A 2JFLA 4W4XA 5KZ0A 4I4EA 2C30A 1OIUA 2WQOA 3EN5A 2R3KA 3VF8A 4UMPA 4EH3A 4I93A 4A9UA 5E8WA 1H1PA 2W1FA 5HVKA 3NIZA 5EM8A 3VAPA 4A9YA 4KA3A 4JLCA 3IQ7A 3QWJA 2C5VA 1M52A 4RJ5A 4X3JA 4E8AA 3OEZA 4OBOA 4RA4A 5KMMA 4NYEA 1KV1A 3LPBA 5F94A 3QD2B 2HWOA 4GMYA 3DZQA 4AE9A 4C36A 2C6KA 3ACKA 3W1FA 1PXMA 3FQHA 3QRIA 3UBDA 2UZWE 3QQLA 4YO6A 3RPOA 3ZBFA 2JKKA 3D5XA 1RW8A 1Y8GA 2HK5A 4X2FA 4BIBA 1K9AA 4BDAA 3D7TA 3MB6A 3F3UA 3FL5A 4FKUA 3CY2A 3G33A 3NR9A 1P4FA 1YXXA 4EWQA 4IJPA 4NKAA 1Q99A 4L68A 1L3RE 4DCEA 4JG8A 5JFXA 5J87A 3ZSHA 3O23A 3HMIA 4BHZA 1SNXA 4B8MA 3VS0A 4D5KA 4ZLZA 2XYNA 4UXQA 3PA3A 4HGTA 4MXYA 3AC4A 3BBWA 1H0VA 3GXLA 4XG3A 2P33A 2P3GX 1B6CB 5HG9A 4K6ZA 1OIQA 3VW6A 4FTCA 3PTGA 5KMOA 4V04A 1REJA 2RF9A 5DNRA 2FH9A 3C4XA 4QMOA 5FTQA 4BDBA 4N57A 3BHUA 2IJMA 2B55A 2XK9A 3C9WA 1UU7A 2EUFB 4N6ZA 3LCDA 3VHKA 5HLWA 3U6IA 3QQUA 3CQUA 4MYGA 4R6VA 3P79A 3VN9A 2B54A 3TTJA 5C27A 3D5UA 1VYWA 3KC3A 3PZEA 4MBJA 4FV3A 1KE7A 3QTXA 2G9XA 4FTUA 2CKPA 4ZZOA 4CXAA 4RJ4A 4EOKA 1PXNA 3QTQA 3ZUTA 3C4ZA 3JS2A 3KXNA 3BHVA 4RVMA 2ZV2A 3C4EA 4KNBA 4BGGA 5AEPA 5E1EA 5H2UA 3OWPA 3UP2A 3E64A 5KX8A 3QKLA 3JUHA 3UPXA 1O6KA 5HQ0A 5I9WA 3QA8A 5CEOA 5AAGA 3CTJA 3EWHA