5GJGA

Crystal structure of human tak1/tab1 fusion protein in complex with ligand 4
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
307
structure length
289
Chain Sequence
b'GPLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPGRVEPYVDFAEFYRLWSVDHG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAK1 kinase - TAB1 chimera fusion protein
publication title Development of a Method for Converting a TAK1 Type I Inhibitor into a Type II or c-Helix-Out Inhibitor by Structure-Based Drug Design (SBDD)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 289
sequence length 307
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5gjgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gjgA01
4W8EA 3V5LA 4KWPA 3Q5IA 2HW6A 4L43A 3LCSA 3K5UA 3NYNA 2UZNA 4PUZA 3EL8A 4JQEA 5FLFA 4LYNA 4PL4A 3ZUTA 1S9IA 3UP7A 2WTVA 2QNJA 4LGHA 1W84A 4AQCA 2OSCA 4RX7A 5BX0A 3BX5A 3IONA 2QG7A 4TL0A 4FSUA 4FK6A 5HTBA 1G8SA 4BGGA 5FP6A 2BDFA 2QOCA 2VTAA 5ETCA 4XHKB 4IMYA 5C1QB 5EOBA 5JFXA 3CBLA 3MA3A 5HEZA 4IHPA 1A48A 4Q9SA 3VW6A 2W1ZA 4CKJA 4ALUA 3PE1A 5E8YA 5J7HA 2HCKA 3HV4A 5ACKA 4CFNA 4G1WA 1YI4A 1H1PA 5DN3A 1OL2A 2GS7A 4C61A 4RC2A 3ZTXA 4F08A 2ZM4A 4U3YA 3UIXA 4NTSA 3WE8A 4ORKA 2R3LA 3QTZA 5L6WL 2CPKE 3EFJA 5EI2A 4O38A 4E73A 3PXKA 4EHZA 3LMGA 5IQHA 4G6LA 3PWDA 4FV1A 1L3RE 3QUEA 4JDHA 5AM7A 5E8ZA 2CJMA 3Q9ZA 4L7FA 3V3VA 3QLGA 3POZA 4G3DA 2IVSA 1J7UA 4D0WA 4XNEA 3OEFX 2BRMA 4XOZA 2HK5A 4HW7A 3SOCA 3WBLA 2LAVA 4UV0A 3WZUA 4WG5A 4YUQA 3SKCA 4HNFA 2JBOA 4WNPA 4K33A 4BDIA 3R02A 4DGOA 3O23A 4QD6A 4XG4A 3FKOA 3ZLSA 1G8AA 2PVHA 2C4GA 3DCVA 2XK4A 4H1MA 2R2PA 3BLHA 4KUJA 5HE3A 4CMUA 3KK9A 1JBPE 4GFMA 4M68A 4E93A 3C4EA 3EYHA 4I94A 3ZUVA 1Q3WA 3O0GA 3R8UA 4GVJA 3O8TA 4MX9A 2OXDA 2Z60A 3AT4A 3MB7A 3EYGA 1AGWA 3E87A 3RJCA 3C4WA 4YJPA 4IBMA 3H9OA 1T45A 3MJ1A 4WNKA 4KSQA 1NVSA 2WTJA 4IX4A 5FWKK 4XRLA 5BMMA 4EH2A 4WNOA 5CEMA 3ATTA 4D2RA 4MWHA 4U79A 3DB6A 2P33A 3F61A 4XH6A 4CFUA 2C3JA 3KRLA 1VR2A 3EQBA 4IB1A 3AG9A 4LM5A 4R8QA 5DE2A 3FKLA 2C6OA 3ZEWA 4F09A 2GPHA 3AC2A 2CSNA 4F0GA 1YI6A 4PPAA 5EW9A 1W7HA 3FMDA 4WOVA 4RG0A 5EW3A 3DXPA 2J0KA 3IGGA 3OXIA 4XV9A 2E9NA 4JT3A 5I0BA 4YTFA 4PP9A 3RBWA 4FTAA 4J52A 4F9BA 4TYJA 1JKSA 5HCXA 2HIWA 3N4VA 4O2ZA 3OBGA 3FMKA 4G3EA 2XBAA 3Q4UA 5L4QA 4EKLA 4AOIA 1PMNA 3MWUA 3BPRA 2W9ZB 4FKVA 1LEZA 2DUVA 3NUSA 2FA2A 1GIHA 3WYXA 1YWVA 4KIKA 1UNLA 3FLYA 5ANGA 5TO8A 3E64A 5GIPE 2I0YA 2J90A 3CP9A 1M7NA 3LQ3A 3GCUA 4IM2A 3ANQA 4KAOA 4B0GA 1UA2A 4AFJA 3P86A 3H10A 3GU5A 3NW7A 4RX8A 2QO2A 4LRMA 3LAUA 1NXKA 4LOOA 4FNZA 3TDWA 2YJRA 4FSTA 4FV2A 3R9HA 4XBUA 5CNNA 4D4YA 4Y46A 1R1WA 2GU8A 4MAOA 3Q32A 3OCSA 1ERKA 2B9HA 3OOMA 4K8AA 2VO7A 4BDDA 3UODA 4AW5A 4ANSA 3Q04A 5FRIA 5HX8A 4Y73A 2CKQA 4KIPA 5IZFA 1DI8A 3BELA 2EUFB 5BVOA 2VX3A 3B8QA 4W8DA 4AT5A 4HGEA 5IA0A 3W10A 4OAVB 3QQGA 3UVRA 2GQRA 2OJ9A 1OL6A 2JIIA 4RJ4A 2BZHB 3V8SA 1K3AA 2Z7LA 4NIFB 4XG8A 4F0IA 5LXMA 1U54A 3RPOA 1IAJA 1Q99A 3KXNA 3QD0A 2BTSA 2XIZA 2QR7A 2UZTA 2R7IA 2R3HA 4ITJA 5CEQA 4ALWA 2ZV9A 4XX9A 2PZYA 3RK5A 5CX9A 4EWHA 3R7EA 2PVRA 3BGQA 4Z55A 3KL8A 4BGQA 5EHOA 4X7QA 4QMOA 3MVJA 4II5A 3PXQA 4XS2A 5K0XA 3ATSA 4RX5A 2YACA 4JXFA 4C2WA 1GNGA 5FBNC 4BTJA 4FKOA 2ZB0A 5KO1A 3PLAE 5M53A 1PHKA 3FV8A 3KXGA 3VRYA 1OUKA 5HVKA 3LFNA 4GT4A 5IF1A 2ITWA 5JGAA 3F5GA 4CEGA 5A4CA 3EZVA 4YR8A 2CGUA 3NWWA 5JSMA 4XP2A 3B2WA 4E4LA 1H24A 3FHRA 5EYKA 4A9RA 1UWHA 3PJ2A 3PA5A 3F3VA 3L9NA 3LPBA 3NVKI 2I0VA 3FLZA 2Y4IB 2A0CX 5LCJA 2OZOA 2UW4A 3PIYA 5LMBA 4CFXA 2W1EA 5CSVA 1FPUA 3GC0A 3NIEA 4N4SA 3I81A 4Z3VA 3NSZA 3TJDA 4RJ7A 4EH4A 3L9MA 3UQGA 4FKLA 4IX3A 5IUIA 3MS9A 4E5WA 3R8ZA 3P5KA 5M44A 3RGFA 5F94A 4I23A 4C62A 4FSZA 4X0MA 2BIYA 3CTJA 4CNHA 4IAAA 3OROA 1M2RA 2O0UA 1KV1A 4FT5A 3U87A 3WZKA 4CZUA 4DFYA 4QNAA 2WZJA 3COKA 3RZFA 3ZH8A 2ZMDA 3BHTA 4GL9A 5HBEA 1OI9A 5TE0A 2WTKC 3BHVA 5EYCA 2RFDA 2UW8A 3QKMA 4QMVA 3LXPA 5AEPA 4BDJA 2I1MA 4KA3A 1BI8A 3DAEA 2BROA 4MBIA 5DLSA 3WF5A 3R7VA 5J9ZA 4O83A 5AUXA 3I79A 2ITPA 3WF8A 3ZUUA 3KRRA 3PP0A 2HZIA 4EONA 4QMXA 5BUIA 4DEIA 5A54A 2YM3A 2I0EA 3SW4A 4UZHA 3MY0A 4FK3A 3MIAA 4BDHA 2BZJA 5HHWA 4ZSGA 5EM5A 3SGCA 4RBLA 4P90A 4EWQA 4Y83A 5I9ZA 3P23A 2QOLA 3QALE 3QQLA 4AGDA 4ZOGA 4TPTA 3V6RA 3IDBA 5HKMA 1FVTA 4DEDA 3BU5A 3RPVA 2JKOA 2FSTX 3EQGA 3L8XA 4RGJA 3OCTA 4D4SA 1FMOE 5CF6A 5CI7A 4YZBA 5IUGA 3QTUA 2X2KA 4DFLA 5FTQA 5GHVA 3ORPA 5HTCA 4PP7A 4IAZA 4BVUA 3LHJA 4UMRA 3O7LD 1ZAOA 1PJKA 3EN6A 2IW6A 4UXQA 2CMWA 4X2JA 4YLKA 4V0GB 4FTQA 5AV4A 3AMAA 5DNRA 5ETIA 3N9XA 3GVUA 4ASZA 5EH0A 5IG1A 4D55A 3IW7A 3ULZA 2YLFA 1UKIA 3ORMA 4Q2AA 1Q3DA 4F7SA 2DS1A 3MB6A 5GJFA 1W82A 4MXXA 1PY5A 4WNMA 4MBJA 2OJFE 5T68A 4ANLA 3ZRMA 2QI8A 4FNXA 4O84A 3LLTA 4WUNA 3R1YA 5I9UA 5IQIA 1DAYA 2BFXA 4M84A 2BALA 4PDPA 1UWJA 4EOKA 3O2MA 2P2HA 3GFEA 3Q53A 5B2LA 4OTQA 3C4FA 2Z2WA 5FQDC 4PTGA 4IFCA 2A2AA 3R63A 4UEUA 4PY1A 5CI6A 3FJQE 4U40A 3S2PA 5E8WA 2VO6A 4YMJA 4DEHA 3UVQA 3VUDA 3KVWA 3D14A 1UKHA 3A62A 3CR0A 4K11A 3LE6A 3WIKA 2G9XA 3F66A 3OCBA 4Y5QA 1WBPA 2ZMCA 5HVYA 5CXHA 4ZLZA 2Y4PA 2YLEA 3C4XA 5AP5A 4AE9A 2A1AB 3MVMA 3GOKA 2J0LA 3QTXA 2IZRA 3DY7A 4FIIA 2O8YA 2VWVA 2XK9A 2ZDUA 4FIHA 4GV1A 4LV5A 4WHZA 4XLIA 3IDPA 3P0MA 5CF5A 4EC9A 5EQYA 2Z7QA 4FSYA 4QQ5A 2W1FA 2WQBA 2J2IB 3RI1A 3D5VA 4FGBA 4FIJA 4FV8A 4IE9A 5DRBA 1BI7A 3MFUA 3OP5A 1STCE 4Z9LA 4Z16A 3ZLYA 1XH4A 4YC3A 3QLFA 4OTPA 2ITOA 4YLLA 4CD0A 3WF9A 2ZV7A 2BAQA 2KTYA 4K77A 4D5HA 1SVHA 4F9YA 2CNQA 2RG5A 3Q60A 4ZMFA 3HNGA 2Y8OA 4N6ZA 2XB7A 4I6FA 4C4HA 3NLBA 4IZ7A 2IO6A 4GT5A 5CU3A 5HG8A 5H8BA 2B1PA 3R6XA 3VUKA 3HUBA 3GB2A 3SXFA 4EBWA 5KBRA 4J99A 3L8VA 3OW4A 4CG9A 3AD4A 3LFEA 2HXQA 5IPJA 3C9WA 5I9VA 4L3LA 5AP3A 5JKGA 2PHKA 3F69A 1H0VA 4XOYA 5GZ9A 2GDOA 3LLAA 4M14A 5AUVA 3IG7A 1CKIA 4UB7A 2Z7RA 3O8PA 3QQJA 3MESA 5AR5A 2XIYA 2R64A 4FNYA 5EI6A 4R6VA 5M09A 3OUNB 4YHFA 3FMJA 5I3OA 2PYWA 4C3RA 4W4XA 2VGPA 3R9RA 1OL7A 4CFMA 2OGVA 5C03A 4QPSA 2XNEA 3C5UA 3E7OA 4P7EA 3ZDUA 4JIAA 1YDSE 1H27A 3R22A 4OT6A 2PMOX 4MTAA 4FI1A 4YBJA 5D7AA 5KKRB 2PZPA 3RMFA 3Q3BA 4IZAA 4YJRA 4CSVA 1RE8A 2VUWA 3IKAA 4RZVA 1LP4A 3M1SA 4O2PA 3PSCA 1IRKA 1PYEA 4MBLA 2UZEA 4PL5A 3G9NA 3QTWA 4I4EA 3UNZA 4AGWA 3D15A 4D9UA 4BCQA 4DH7A 5CASA 4NJDA 5A4TA 2HELA 3QCXA 3QBNA 2JAMA 3ZC6A 3ORXA 4RJ8A 5CNOA 4XEYA 2HWPA 5AJQA 4BY9E 2Z8CA 5HCYA 3LFAA 5CQWA 2XIRA 2YCFA 3ZBXA 3C0IA 3DNDA 3FXXA 1V0OA 2XUUA 2HOGA 3R9OA 2OLCA 3WIGA 3IO7A 3HVCA 5CVGA 3P9JA 2BTRA 4KIQA 3CY3A 1OGUA 3W8LA 5IEYA 2FSOX 1TQPA 4R7IA 5CEOA 4C02A 3S00A 3U54A 5CSWA 2XYNA 3V5JA 2G2IA 1BX6A 1K9AA 2QOIA 2YIYA 5DWRA 2JEDA 5FM2A 4UYAA 3JY0A 1YWNA 2C5YA 3CGFA 2ERKA 5KBQA 4NM7A 5AV1A 5AWMA 1UU9A 2OF4A 3R9NA 4IW0A 2W1CA 2J50A 2BIKB 2F2UA 3VS3A 4U8ZA 3W2SA 3GU6A 3GCSA 5IQDA 3VUHA 3NPCA 4YJVA 2UVXA 3EN9A 3FLSA 4YJTA 3RZBA 2G15A 2WQMA 4FKWA 3ZO3A 3TG1A 5BUJA 3R1QA 1IAHA 2VX0A 2VTMA 5I4NA 5AR8A 1J1CA 1OKYA 3FDNA 4IJ9A 3NX8A 4BYIA 2WTIA 1Q41A 2XIKA 4H58A 3I5ZA 3TEIA 4CMOA 4DHFA 5HTIA 1XH6A 3TTIA 2GTNA 4C0TA 3EN5A 5JRSA 4DLJA 3MVHA 3DZOA 3KB7A 1ZMUA 3P7BA 4BBEA 3SQQA 5IQCA 3BKBA 1BMKA 1YQJA 2QVSE 2PE2A 4IWPA 4OT5A 3FE3A 4IC8A 5IUHA 4HCTA 4UWBA 1FGKA 3O96A 5DT3A 3QGWA 5L6PA 3E92A 3PSBA 4OBQA 1Y6AA 4YC6A 2HYYA 3MPAA 3UIBA 4CV8A 3GT8A 4EUUA 5F4NA 3LCKA 4YZDA 2X6EA 4J8MA 2QO7A 2X7FA 5HLNA 3CXWA 2YCSA 5JT2A 1YHSA 3E88A 3EFLA 4GUBA 2OIBA 4PQNA 4QRCA 2I6LA 3CPBA 1H25A 3PUPA 4K6ZA 4ZZNA 5CS6A 5FUTA 5KMKA 2R3IA 4I6HA 4QMNA 3G5DA 4FTLA 4RPVA 4UWCA 3FI2A 3DTCA 3PA4A 3HMPA 5GIOE 1J91A 3LJ2A 4FV0A 1YOLA 3LJ1A 4X6RA 4MVFA 5AP7A 4S31A 1IR3A 1UU7A 5AA8A 2WU6A 5I9XA 4KBAA 3EN7A 5CALA 4YP8A 2GHMA 3ORTA 3O71A 5EKNA 1XH5A 4FKRA 4HGSA 3S1HA 3EKNA 2IVVA 3LCOA 2OJJA 2OO8X 2WXVA 3BQCA 5HO8A 1B6CB 5IA5A 3BYVA 4EQCA 4BKZA 5CZHA 1H0WA 4DF3A 2CGXA 3V5QA 2X39A 3PXYA 3FY0A 5K3YA 3S95A 4BI1A 1XQZA 1DM2A 4I92A 3ET7A 3OWKA 4E8AA 2XYUA 5KMLA 4U42A 1OVEA 2E9UA 5IDNA 4NK9A 2WOTA 4FKGA 5LJJA 4DFBA 5IISA 1BLXA 2CN8A 4MXAA 3I7CA 4RT7A 3EWHA 4WSQA 3ID6C 4EHGA 2JGZA 2YM8A 4M15A 4D28A 5J79A 1I09A 3A7FA 2C47A 4FT7A 4AGUA 4AZVA 5ITAA 1OL1A 4LOQA 4QMQA 2BRNA 2B52A 2PVNA 3BZ3A 4TWCA 1R3CA 2C0TA 4O81A 3DDPA 4PTEA 5AUUA 3RKBA 4TYIA 5HNGA 3RWPA 4C36A 3GU8A 5A4LA 3W55A 2B9FA 4D58A 4J97A 3P7AA 4GSBA 4NEUA 3HV7A 2W7XA 4S34A 5KZIA 4EHEA 1E1XA 3TUCA 4B8MA 3R8LA 4V04A 3V5TA 3VVHA 4DBNA 3CKXA 2C6IA 3FXWA 3BBWA 4JR7A 1KE5A 3LMIA 5EHYA 2VTPA 1NW1A 4OTGA 3UZTA 3F82A 2V0DA 4C57A 4EORA 2QONA 3QTRA 4XV2A 4C4GA 5HOAA 3W8QA 2NRYA 2VTNA 4ZZMA 5F20A 3KQ7A 3PY1A 5JH6A 3OXTA 5HZNA 5DOSA 3KKVA 4USDA 3AQVA 3FL5A 2ZOQA 4Y85A 1WFCA 4L6QA 4BCPA 4EQUA 4C59A 3FPQA 4YZMA 3QQKA 2OJIA 2UZBA 4ITHA 3UOKA 4J7BA 4H1JA 4ZTHA 3W1FA 4DYMA 3BGPA 1O6YA 2X7GA 4QMMA 3Q9XA 3ZOSA 4HCVA 4PPBA 4O0XA 5JZJA 2OG8A 5L2SA 4YZ9A 4O91A 3ENHA 4I6QA 3HV3A 2R7BA 3Q96A 3QZIA 3ZXTA 2PPQA 3DXQA 1Q8ZA 3KC3A 4RFMA 5J87A 3R1SA 1ND4A 1OKWA 4O86A 2IWIA 5CSPA 3V5WA 3EQCA 4GKIA 4ZJIA 3LMHA 3TKHA 3FZPA 3WZDA 2ZV8A 2YCQA 3PRFA 3PPKA 3Q4CA 4MCVA 2P55A 4FG7A 4JVGA 4TNBA 2X9EA 5EDQA 1G5SA 1NVQA 1REJA 1Q97A 4WBOA 4AS0A 4DG3E 4NM3A 5HBJA 3QRUA 2RF9A 4IB0A 3V51A 1DS5A 2ZYBA 3BHHA 4ZLOA 2V55A 4FUXA 3I1AA 3OW3A 5ANOA 4IJPA 2Q0NA 2X8EA 1EH4A 3DK3A 5A3XA 5IA1A 3AMBA 4RQKA 1ZMWA 5LVLA 2JDSA 2ITZA 3FAAA 3UNKA 2IZSA 3NMUF 1H01A 2UZDA 4BCMA 5CAUA 2VX1A 3M11A 3KCKA 4BL1A 4EH3A 3PLSA 3MIYA 4C3FA 2WMVA 2C0IA 3AXWA 4F63A 5AR2A 4QYHA 1WZYA 3OHTA 4FZ7A 4JBOA 3VQHA 1Y57A 4BZNA 5HNIX 3OCGA 1JVPP 3CTHA 3TNQB 4GK4A 4LFIA 5FXQA 4A9TA 5M55A 3ZS5A 3BCEA 2JIVA 2QKRA 5ANJA 5BUEA 5AV2A 2CGWA 3COIA 4TYHB 5IKWA 3KMWA 3HV5A 4IVDA 4JX3A 4PPCA 5E1SA 4IWQA 4LV8A 1SMHA 5BYZA 3PZHA 5CANA 4AZTA 2A4LA 4IZYA 5BPYA 4L9IA 4D1SA 2PUIA 3SRVB 2W4OA 4N6YA 3E8DA 4O1PA 3VBVA 4C33A 2WQOA 4G3GA 1JLUE 2IZTA 2C1AA 4AZWA 1KOAA 3HX4A 3SAYA 5DT0A 2OZAB 3DV3A 4GH2A 1CKPA 4JR3A 4RA5A 3SHEA 2X81A 5M57A 1U46A 2VTRA 3UIMA 3VRZA 4YURA 5L6OA 4B99A 5AP2A 1Z9XA 3HP2A 1BL7A 2GMXA 2YERA 3BV2A 4TZRA 4EOMA 4EH7A 2BKZA 3JUHA 2R3MA 4HYSA 3NEWA 1MRVA 3LFFA 1OM1A 2WMXA 1Q5KA 1TQIA 3KF4A 4YZNA 4CFFA 4IB3A 2QCSA 3GC9A 4LMNA 5DA3A 2XH5A 5JEBA 2W0JA 4LUDA 3QQFA 4DLIA 4ZXTA 2PSQA 1VZOA 4D2VA 1JSVA 4QQTA 2HZNA 5ANDA 3DJ7A 5HG7A 5HGIA 3RAIA 4O7TA 1WVYA 5FDPA 2HAKA 3PXFA 1HCKA 3PP1A 5L8LA 3SW7A 2R0IA 5CT7A 4OAUC 2YM4A 3PG1A 3AC1A 4C4FA 3MI9A 4AA5A 3VBWA 5CEIA 3FC2A 5M4IA 5JFVA 5J1WA 3QTIA 2C6KA 2QO9A 2HXLA 1FMKA 3I5NA 3GENA 2V7AA 3I6WA 3QZHA 3R7GA 4FSNA 4L01A 1Q8YA 3RNYA 4HVIA 2YZLA 3AC3A 5B2KA 3ZU7A 5B2MA 3I0QA 4YSJA 1PXJA 1XO2B 4K9YA 3GUBA 5FXRA 1LEWA 2JKQA 3FL4A 4J95A 2W96B 3JY9A 3GGFA 5DRDA 3R7UA 4FZAB 2C69A 4TN6A 2B53A 4J53A 5ACBC 5T3QA 3DKFA 4FKIA 3ENMA 1KUTA 2ITUA 2XEYA 2GTMA 2RFSA 4EH6A 2C6MA 3BLQA 4L44A 2JDVA 3UO4A 2GNLA 3RTPA 4E6QA 3ZEPA 2J9MA 1Y91A 3DQWA 3IK3A 3W16A 2FUMA 3BYMA 2PVFA 2VV9A 3O7LB 3V01A 3T8OA 4RIWA 4BWXA 3OWJA 2QLQA 1OMWA 2QOKA 2XP2A 4M69A 4MHAA 1BL6A 3A4OX 3FLQA 5ETAA 3ZHPC 2GQSA 4DEAA 1J3HA 4EK8A 4FV3A 4CYIA 1HCLA 4Y8DA 3KN5A 3JS2A 3PFQA 2G01A 3QCQA 5HG5A 2XNOA 4H05A 2W17A 3D5UA 4YO6A 3R21A 4I22A 3KRWA 3CIKA 3R71A 4WT6A 3ZRLA 3LKMA 3MGYA 3D7TB 3OT3A 3QCYA 3VUTA 5H2UA 4FV5A 1LR4A 4QYEA 2PMLX 5JQ5A 3QGYA 2VZ6A 4YBKA 3CQUA 4GEOA 4FR4A 5AX9A 3SG9A 2ITQA 3MFRA 3PVUA 4OTRA 1KE6A 4FSQA 1W98A 1QMZA 4CT1A 5CT0A 5CF4A 4HPUE 4L45A 3GQLA 2YISA 4R3RA 4YTHA 2XNGA 4YU2A 4RC4A 5DR6A 3ERKA 3V8TA 3EOCA 3K54A 4CTBA 3QD4A 4PMMA 1PXPA 1ZOEA 3FLNC 5HLPA 1NY3A 2OBJA 4BCIA 3DJ5A 4QMSA 2PULA 1WVWA 4U9AA 3NR9A 2PK9A 3DU8A 3FZOA 3ZCLA 1GZKA 3KMMA 4TTHB 4ZY4A 3ZM4A 1QL6A 2Z7SA 4QNYA 5A4EA 3DAJA 1SNUA 3FXZA 3PXZA 3N4TA 3A2CA 3UC4A 5D1JA 1OIYA 4O7LA 1QPJA 3QFVA 4HVGA 3Q2MA 2JDTA 3PVGA 1GIIA 2ETMA 2JKKA 2VTLA 4H3QA 4QP7A 4DBXA 2GNJA 3NYOA 4LQMA 5KHWA 2ITVA 3UOLA 2QQ7A 3E3BX 4NKAA 4RVMA 4X3FA 4FE2A 4ZLYA 4J71A 4QTAA 1F0QA 3W2PA 4RIXB 4F9CA 3ORZA 4I20A 1TVOA 2IZUA 2QOFA 3QYZA 5BYLA 3I6UA 3ALNA 5CSHA 3D2IA 4O0UA 2W1GA 1WBWA 4A9UA 4E6CA 3TUBA 4F6SA 4C2VA 3VUMA 4FTRA 4KRCA 1Q4LA 2ZAZA 2GS6A 4GT3A 3UG2A 4RWLA 1PYXA 4FTMA 4NFNA 3BWJA 2B9IA 3ZM9A 4IVCA 3PIXA 2QC6A 2WEVA 3HLLA 2W06A 2WFYA 4A9SA 3G9LX 2XIXA 4MWIA 4BB4A 4D9TA 1KE7A 4LG4A 4FTIA 4D5KA 4O7WA 5H3QA 1RJBA 5M06A 3KEXA 3OTVA 4PL3A 4AN3A 4CVAA 5L8KA 4BKJA 3H0ZA 3HRBA 3I0OA 4MF1A 2PUPA 4HGLA 4RVLA 3HGKA 4L52A 1FVVA 3OVVA 3C50A 4F99A 4EZ3A 4ENYA 4QTEA 3SV0A 5D11A 4FZFB 4FYNA 2UZVA 3QRKA 4EK3A 4O96A 3OBJA 3LVPA 4KNBA 3NIZA 3U6HA 3VUGA 1OIUA 3PZEA 3TJCA 4QYGA 1Y6BA 3HAMA 4O7ZA 3AMYA 2NP8A 4ZEGA 4C58A 4IIRA 3SA0A 3TNPC 4O82A 4RIOA 3LXNA 1WMKA 3AC4A 5DVRA 3VF9A 1JNKA 3LM5A 4EKKA 4CYJA 3VBYA 2VRXA 2G1TA 3QQUA 5DEWA 5IA2A 1ZY4A 3NYVA 4LUEA 3UG1A 4F70A 2WIHA 2Y6OA 1WBNA 4FNWA 3GCQA 4NL0A 2IPXA 4EEVA 4FEVA 4WRGA 5EM8A 5FDXA 3F88A 4JNWA 3K3JA 2F7EE 1ZOHA 4ASDA 4O0SA 2CNVA 3G0FA 3KU2A 4QYYA 5AR7A 4DH8A 3TDVA 1VYWA 3MW1A 3BE9A 4DFXE 3EH9A 4FTKA 3LFDA 4C38A 3RM6A 4NSTA 3OFMA 4HYHA 4DG0E 2BVAA 4CQEA 5CU2A 4QMYA 3M2WA 5HD7A 1XBBA 1TKIA 2OK1A 3VBQA 4OLIA 1SVEA 2J0JA 4P5ZA 2X4ZA 2YM6A 3E93A 4ANOA 5JQ8A 5J9LA 2VWIA 3EQFA 4FV9A 1FBNA 3IGOA 3KULB 2HZ4A 4ACCA 1ZZ2A 4DFUA 4YNOA 1VJYA 2OFVA 4JG8A 4D2WA 4C8BA 5CQUA 4FTUA 3E8EA 3KCFA 4RWIA 1CM8A 2JBPA 2R0UA 3SC1A 4CQGA 5JGDA 5C8KA 2A27A 3ODZX 4G34A 3UDBA 5HBHA 3KXXA 4F6UA 4WRSA 3F5XA 5HU9A 3C4CA 3ACJA 2R3KA 3QRTA 3FLWA 4E4MA 2PY3A 4G9RA 5J95A 4IAKA 4DCEA 5GJGA 4IWOA 1J7LA 5IQBA 1XBCA 2EB3A 5BVDA 3H3CA 3GP0A 5G6VA 2PTKA 3Q9YA 3DAKA 4FTNA 1XKKA 3PVBA 4OTWA 3UBDA 1FVRA 1LPUA 3P4KA 3HA6A 3E7VA 4NWMA 2C5VA 3GC8A 3MN3A 4FBXA 4UALA 3HP5A 5FEDA 4UMPA 2FSMX 4EOOA 3QX2A 3NS9A 4FF8A 3PSDA 3W2OA 4MKCA 2UV2A 1MRYA 4AW2A 3RVGA 5AADA 3UE4A 1PXOA 5BYYA 3VBTA 4EOPA 4OGRA 5HG9A 2C68A 4PNIA 5HIBA 3D5XA 4LRKA 1SM2A 3DS6A 2WEIA 3NRMA 2YIXA 2IW9A 1PMEA 3DBEA 4UBAA 1JAMA 2OWBA 2BR1A 4BZOA 4IM0A 5IEXA 4FEWA 4X3FC 4BDBA 2VTOA 5HIDA 5FM3A 4BBMA 2BDJA 4YTCA 5HE1A 4BHNA 4KKEA 4UN0C 2AC5A 2XKFA 5CU0A 2W5BA 5JFSA 4FTTA 3RAWA 4C4JA 3BU6A 5KNJA 4HPTE 2PUUA 2VO0A 3TACA 4I3ZA 3TZ9A 5EHLA 5FD2A 2WELA 2PVLA 1B39A 4B6LA 2W1IA 1JSUA 3D0EA 4MD9E 4MYGA 2X0GA 4AXAA 4MH7A 4ZAUA 5DMZA 4OTDA 5J5SA 3R8PA 3QC9A 3EQPA 4KS8A 4GFOA 4XP0A 4A4LA 4DEGA 5C4KA 5D12A 3K2LA 4ZZOA 1ZYSA 4DTAA 3EN4A 4K2RA 5IU2A 3BYSA 4V05A 4FIGA 4Q9ZA 5A9UA 4GVAA 2F2CB 2BDWA 4ZTMA 5E7RA 3Q5ZA 4DN5A 4E20A 3DTWA 4EOLA 4DC2A 3ZZEA 4CFWA 3LFCA 4RFZA 3GOPA 1M2PA 2OI4X 3A8XA 3M42A 4K0YA 3TV7A 4EC8A 1ZYLA 3BIZA 3SD0A 3CS9A 5HICA 4HGTA 4PRJA 1F5QA 3UZPA 3FMNA 4FEUA 3RNIA 1GY3A 1R0PA 4IH8A 4NIFA 2O3PA 2XK7A 4HVHA 2W1HA 3OF0A 4AG8A 2W05A 2GNIA 2IG7A 1OL5A 1SNXA 2F57A 2YAAA 1S9JA 1H1WA 3OZ6A 4R5SA 3VAPA 3VHKA 3HMMA 1YW2A 4ZTSA 5HO6A 3TZMA 3UIUA 5KUPA 4QTBA 1U59A 2HY81 3LJ0A 3REPA 1YRPA 4XG2A 2C6DA 3RP9A 4LMUA 3F9NA 2R3RA 4ZMEA 5B7VA 2YABA 4YZCA 3ZMMA 3PJ3A 4LRJA 5BVFA 5J9YA 1ZWSA 3QHWA 1ZYJA 5LMKC 3HKOA 4TWOA 5J5TA 3CSVA 3SOAA 2R9SA 3ZXZA 4AX8A 4E3CA 2GNHA 5F95A 4DA5A 1H8FA 1TQMA 4KSPA 3HMOA 5AP6A 4CXAA 4S32A 5JZNA 2BPMA 3OC1A 3JVRA 4O0RA 4XMOA 5AR4A 5L2TA 4RSSA 5FEEA 5IH6A 4EK4A 1M17A 4QPAA 4MQ2A 4QP9A 5E1EA 3JVSA 4XCUA 2CNUA 1CKJA 4XG7A 4YJNA 3OY1A 3F5PA 4C35A 2V62A 4KIOA 2QOBA 3DZQA 4ACDA 3DBQA 3HDNA 3C1XA 3T9IA 2R3OA 2ITXA 2WMTA 4FT3A 4G5PA 5KCVA 1PF8A 1JKLA 4ZSAA 3CD3A 4E5BA 5K5XA 5T6KA 3UPZA 2J0IA 4E26A 4FG9A 3E8NA 5ANKA 3WF6A 4D0XA 1UNGA 3GU4A 3GC7A 2VWZA 4C34A 4BCGA 3OT8A 3L1SA 3K3IA 4PNKA 1BUHA 1YVJA 4PTCA 2WNTA 3DQXA 3V8WA 3RHXA 1GAGA 4RVKA 4D4RA 4MD7E 3R2YA 3PYYA 4BICA 4W4YA 4M8TA 2R3JA 2UUEA 2Q0BA 3DBDA 5DR2A 4G6NA 2XCHA 3KVXA 2JDOA 3ANRA 2BCJA 2BRHA 2XKEA 2X2MA 4KKGA 4BCNA 2UW9A 2HW7A 4NYEA 4S2ZA 3QKKA 3QU0A 4YJUA 3R9DA 3AC5A 4QP8A 4M66A 5GNKA 3F7WA 3TV4A 4EOJA 2I7QA 4FVPA 1T46A 4GIHA 3G51A 4UZDA 4FKPA 2QURA 3SXRA 3VO3A 4AP7A 4MNFA 3TNHA 2GFCA 1WBVA 5LQFA 1H28A 2E2BA 4JG7A 4U97A 4Z7GA 3P78A 5C9CA 2OH4A 2O64A 4I5CA 4V01A 4RLLA 3CE3A 2ZM3A 1KWPA 3DGKA 3L8SA 3AC8A 3OS3A 2UZWE 2VWXA 4MXZA 5AR3A 4JI9A 1YI3A 4C4EA 3FMLA 4NT4A 1ZOGA 4X6QC 5EM6A 3MFTA 4M7IA 4AFEA 3NAXA 3KA0A 2H34A 3UVPA 4BCHA 4U44A 1MQ4A 4DEEA 3A99A 4KBKA 3RWQA 4OTIA 3MY5A 3TWJA 5GZAA 4E5AX 2YDIA 5C27A 1XH7A 4JDKA 4V0GA 5IH4A 4JQ8A 4U5JA 3FKNA 4Z7HA 3UP2A 3FSFA 1PXLA 2X8IA 3QHRA 4EK5A 3K5VA 3UZRA 4CCUA 3QQHA 4B7TA 3ZO4A 3A61A 1OITA 4M0YA 2PVYA 1V0BA 3NW5A 5H8EA 4UMUA 1OB3A 1PMUA 2R3FA 4ONAA 5HVJA 3UYSA 2CN5A 2YWVA 1YXSA 2VTJA 2XMYA 3BRBA 3BWFA 3V5PA 2VO3A 4OR5A 2XK8A 3FQSA 5DYJA 4D2TA 2ITNA 5EM7A 3L9PA 4FOBA 2BILB 2YZAA 3IW5A 4G3FA 4OTFA 4WIHA 4LL5A 1A9UA 1QPCA 1P14A 3CQWA 4UX9A 5EK7A 2W1DA 3Q6WA 3QKLA 3VS5A 4CFVA 1WCCA 2X1NA 3BE2A 3IPHA 4I1ZA 4RC3A 5HNBA 3ULIA 4BTKA 5IQGA 3QAME 4BGHA 3MPTA 3HUCA 4RA4A 2VTTA 3C7QA 1URCA 2QLUA 2YDKA 3DLSA 3LXKA 3MH2A 3OXZA 3QUDA 5FP5A 3VNTA 4DE4A 4GU6A 4M3QA 1VYZA 3RPSA 4G5JA 2WOUA 3UYTA 3ITZA 4BF2A 4CMTA 2H8HA 3BYUA 4BI2A 2WU7A 3VS4A 4BTFA 4A06A 3ZFMA 3PPJA 3FI8A 4MF0A 3JPVA 5DHJA 2Y4IC 4XJ0A 4X2GA 5B0XA 4EBVA 4P2KA 1IASA 2BRBA 2PWLA 3OUKA 5D41A 5D7VA 2G2FA 4ZTQA 3ORLA 4O22A 3RINA 3Q6UA 3DLZA 3QWKA 4MXOA 4I41A 5DG5A 1NT2A 4NUSA 3QTQA 4ZY6A 3PXRA 4AT4A 3W2RA 5CAPA 4A9YA 3EQDA 5HU3A 5K4IA 3U6IA 2WIPA 5CAOA 4BCKA 1PXMA 5AP0A 3LFSA 4TKSA 4EZ7A 2C30A 3RPRA 3G6HA 4HVSA 3V04A 3TUDA 1REKA 4O7VA 1NVRA 1PMVA 4FT0A 1MQBA 2QKWB 4KABA 5CVFA 3RCDA 1YWRA 4DEBA 2RGPA 2HY0A 3ZYAA 1M14A 3R73A 1GJOA 4CLIA 5KMMA 3U51A 3FEGA 2WTKB 4ZTRA 2XEZA 2Z02A 3TZ7A 4NW6A 5AMNA 5M56A 1GIJA 3TTJA 1BKXA 4PMPA 4QP3A 2ONLC 2WB8A 5EFQA 4LOPA 3PY3A 1ZRZA 3DKCA 3F3WA 4MXCA 3IW8A 1DI9A 1AQ1A 4UMQA 5A6NA 2FSLX 2YHVA 4E4XA 2B54A 3NUXA 4KS7A 1G3NA 3AD5A 2GCDA 2PZ5A 4FUYA 4AUAA 3UO5A 3QA8A 4YJOA 3NAYA 3LCDA 4YPDA 2UZUE 2CCIA 4KIKB 5CXZA 2ZDTA 5DH3A 4QO9A 2JITA 4ASEA 1E9HA 2RG6A 4FKJA 1L8TA 4GW8A 5LVOA 3TT0A 4IM3A 5AUTA 5CVHA 2XA4A 3PVWA 3HL7A 3FI3A 4GYGA 3VJNA 3JR1A 4JX7A 1SYKA 4O6EA 4F1OA 2XVDA 2ETKA 3VBXA 4YJQA 1OPKA 2YM5A 4Y5HA 3MV5A 1JWHA 4ANQA 2Y7JA 5D10A 3OD6X 2FVDA 2X4FA 4GFGA 5JGBA 3CJGA 3KRJA 4EL9A 4W4WA 4F9AA 4PF4A 3TXOA 5EI8A 3QCSA 3L9LA 3RAKA 4IC7A 2I40A 4IACA 3LQ5A 3F2RA 4U41A 2VWUA 3R30A 3FMHA 3SXSA 4DTKA 4QMLA 2O2UA 5FG8A 4ERWA 1Q24A 2IVUA 5CZIA 5CEKA 2BAJA 2X6DA 4FEQA 1VEBA 2GHGA 2QR8A 3R2BA 4TT7A 4IDVA 3SLSA 3S0OA 1J7IA 1U54B 3COMA 2VWYA 2PMNX 2WMUA 3A7GA 4MNEB 4L00A 5ANIA 3MH0A 2FB8A 2ZB1A 3NUYA 3F2AA 4E4NA 5KMJA 3NNVA 3UMXA 2XNPA 3LW0A 4XUFA 3TCPA 4F4PA 1P2AA 4WD5A 3HECA 3KXHA 5H9BA 2XNBA 3UGCA 3BHUA 3LM0A 4A4XA 4USFA 2PVJA 4D4VA 2W5AA 4L67A 4M0ZA 5JN2A 2SRCA 1XR1A 5D9HA 3C51A 3FSKA 4FSRA 5IA3A 3G33A 5HX6A 3R7OA 3DK7A 5E8XA 4HZRA 4TW9A 3OY3A 1J1BA 5FTOA 1KE9A 2BHEA 3EFWA 1URWA 2EB2A 3HYHA 4IB5A 4OBOA 4YSMA 3EJ1A 3EKKA 2BAKA 4XYFA 4FV4A 3QWJA 2OU7A 3E62A 3QZGA 3UJGA 5EYDA 3HDMA 4DT9A 4CT2A 3U55A 4R7BA 3A60A 4LI5A 4F1MA 2YA9A 4G6OA 4C4IA 4BHZA 4U6RA 4ZJVA 3ZLWA 3VUIA 3PRIA 1YXTA 2ESMA 4EZ5A 5KX8A 3ZSHA 5CU4A 3DT1A 3DOGA 4ZTNA 2Y9QA 2R3PA 5K0KA 5LARA 4DH3A 3EQIA 4A7CA 2C6LA 1Y8GA 1H08A 3C0HA 4FTCA 3EL7A 2XM9A 2WMAA 4ERKA 3FBVA 5IH5A 2IN6A 2H96A 2P3GX 1OPLA 3FZ1A 4O0TA 2J5EA 1QPDA 3DKOA 2ITTA 2OJGA 5J1VA 3WI6A 1IA8A 3GU7A 4DGMA 4FL1A 4EI4A 5JFWA 3POOA 3CPCA 3FPMA 2IW8A 3FYJX 4ZY5A 3S3IA 3KGAA 4NZWB 4CCBA 4BCJA 4KRDA 3TIZA 3QUPA 5F1ZA 5CF8A 3FI4A 4DAWA 2B0QA 4ARKA 1ATPE 3JYAA 3UQCA 5BVWA 3VHEA 4QTDA 3MYGA 3F7ZA 4E6AA 1A06A 4O7YA 3E5AA 4I24A 3KXMA 4F65A 2VGOA 5JK3A 2GSFA 4EQMA 2EXCX 2XK6A 1E1VA 2XJ2A 1OKVA 2P4IA 1OUYA 3KREA 2UW3A 3PIZA 2CCHA 3LZBA 1P5EA 4ZSJA 4O1OA 4JG6A 2H6DA 2WKMA 2JC6A 4CKIA 5H8GA 3DNEA 3L8PA 2NO3A 3CEKA 5BVEA 1Q61A 3BQRA 5EOLA 4FL2A 2W5HA 4WA9A 4HYUA 4E7WA 1NA7A 3KXZA 3VC4A 3VS0A 3DPKA 1YXXA 1MP8A 4KKHA 2JDRA 2RSVA 3VF8A 4IZ5A 4R77A 1YHVA 4FZDB 3TM0A 4QMPA 5KKRC 4HJOA 5LVMA 3FWQA 4FL3A 4GMYA 4ITIA 2LGCA 3ZDIA 4JBVA 1IA9A 4Y95A 2XNMA 5F9EA 2YAKA 4LGGA 1GOLA 1Y8YA 2WTWA 3KN6A 2YFXA 3FZSA 4JS8A 3DB8A 1CMKE 4JBQA 4NM0A 3UMWA 4TRLA 1O6LA 2B9JA 2NPQA 4HVDA 5HD4A 1ZY5A 4ANMA 2QU6A 4I6BA 5AX3A 2YWPA 2OIDA 4JAIA 5HESA 4ALVA 3RALA 3VWAA 3TL8A 5KZ0A 4W4VA 2C3KA 5KMOA 1YDRE 2WPAA 2YN8A 2R4BA 4CGAA 4BDFA 4L42A 4DINA 2VNWA 4I0RA 4I4FA 4WKQA 4D2SA 4IVAA 3ORKA 3FZRA 1XWSA 1W0XC 3BI6A 3MFSA 4J1RA 4TYEA 5M07A 3KMUA 4QT1A 3NDMA 2QOQA 3GQIA 4G2FA 4JDJA 4AZSA 4AF3A 4GJ2A 4AZEA 4GG5A 5BNJA 3LFQA 3CQEA 4FA2A 2EVAA 3ZSGA 5A46A 5M4CA 4D2PA 3O51A 2QODA 2DQ7X 4DTBA 3GEQA 3VN9A 4C37A 2ITYA 2AYPA 2WQNA 3TN8A 2PVKA 4FKQA 4WUAA 5I9WA 1YOMA 3G2FA 3NUNA 3ROCA 3U9CA 1P4OA 3II5A 3NCZA 3UPXA 4QYFA 1KOBA 1V0PA 4F0FA 2XF0A 4RLKA 3IECA 3R1NA 4FIFA 2X7OA 3WZEA 2C6TA 5FGKA 3U9NA 4AACA 4ANBA 4F64A 4X2FA 4EJNA 3RCJA 3EMGA 4G3CA 4B9DA 2WHBA 3H30A 4JBPA 5E92A 4BYJA 5J7BA 1H1SA 3PJCA 3ZZWA 1ZARA 5ANEA 2VD5A 3R0TA 4GKHA 3OG7A 4S30A 3HMIA 3VJOA 4Q5HA 2GS2A 2XBJA 3OWPA 3VULA 4BWPA 1XHAA 5AFVA 2XJ0A 3MA6A 4JQ7A 4L68A 4XG3A 3UOHA 2GHLA 3HZTA 4C3PA 4DH5A 4QP2A 2WMWA 3R8MA 3A7JA 5JMSA 4O7RA 4WG4A 2ZV2A 2BZKB 4FVRA 4PMSA 4XRJA 3PPZA 3R00A 4NJ3A 3JXWA 4XV1A 1M52A 1I44A 4AN9A 3U6JA 3I60A 2XRUA 2YDJA 3P08A 2XCKA 4JL9A 3DDQA 2GQGA 4NCTA 4CKRA 3HAVA 4EH5A 5AUWA 4HNIA 4MNEA 4QTCA 4G31A 1LUFA 5L2WA 4OW8A 4EYMA 5AA9A 1WAKA 4GRBA 4QMWA 3BGZA 3DK6A 4N57A 1H07A 1Q8TA 3E63A 4O0VA 1FINA 3CD8A 5DR9A 2NNWB 3FQHA 3AD6A 3AGMA 2XM8A 5ETFA 4QOXA 2UW0A 1GZNA 1ZZLA 3CGOA 4B4LA 3DBFA 1PKGA 2KULA 4PDSA 2J5FA 4P4CA 4I93A 5CY3A 4XG9A 2EWAA 2B7AA 2QOOA 4BBFA 3FC1X 3QC4A 4TYHA 4DGGA 2GFSA 3CJFA 3TKIA 3CC6A 3PE2A 2VN9A 3D5WA 5TR6A 2O65A 4JDIA 5BVNA 2FGIA 5M51A 2EXMA 1OBGA 3SVVA 3MH3A 1OKZA 1X8BA 2OICA 3P1AA 3SRVA 1OECA 3VS7A 4ZJJA 3GXLA 5EW8A 2R3QA 2VTIA 4WG3A 3R7IA 4XG6A 1PRYA 1UVRA 4ZP5A 2OZAA 3A8WA 5J8IA 4K18A 5A4QA 4RWJA 4XLVA 3ORNA 3RHKA 3C0GA 3QXPA 5EG3A 2YITA 2F49A 5C8NA 1XJDA 1W83A 4R3PA 4IAYA 5LMKA 3FZTA 2OKRA 2BUJA 5EDPA 4AZFA 2ERZE 4ASXA 3SDJA 4F1TA 2DYLA 2WGJA 3D7ZA 4ZSEA 5HE0A 3ZO1A 3D94A 4ID7A 4DGNA 4BCOA 2P2IA 3QRIA 4M67A 4CRLA 5CEPA 4R1VA 5TOZA 4F7LA 5L3AA 2BFYA 2QHMA 2V5QA 4NKSA 1YDTE 4FMQA 4TWNA 2Y0AA 2YIQA 4BN1A 4EJ7A 4CTCA 2W99B 5C8MA 2WMQA 1WVXA 3VS1A 5IEVA 3G90X 3IDCA 3D83A 3T3VA 2VTHA 1F3MC 2PZRA 5C26A 1O6KA 4H3BA 1H4LA 4KINA 4GK3A 3NGAA 5K9IA 3QL8A 3QXOA 2E9VA 4WSYA 4DT8A 2WQEA 4J8NA 4RQVA 2WD1A 1O9UA 4RJ5A 5HI2A 2VU3A 2F4JA 1H26A 5DGZA 5LCKA 4PDYA 3A7HA 3IW4A 4APCA 4GCJA 2QU5A 4FSWA 4IFGA 5IQEA 4WO5A 2JFLA 4GS6A 2OXYA 3V6SA 3IQ7A 4FEXA 1U5QA 3RAHA 3ORIA 3WYYA 1XBAA 2ZJWA 4CZYB 3HRCA 4H36A 5CU6A 2F9GA 3W2CA 2PL0A 3NNWA 5AUZA 4DG2E 5KMIA 4MD8E 1PXNA 4YHJA 5KE0A 4ACGA 5GINE 4EYJA 2C6EA 3O8UA 1MUOA 3ACKA 4N0SA 4DCAA 2J0MB 3NUUA 3QZFA 5I9YA 3LCTA 1SVGA 1RQQA 1YKRA 3COHA 4PX6A 5BMSA 4YGAA 4ZS4A 3UC3A 2W9FB 2WAJA 1IEPA 2R3GA 3MBLA 4FTJA 5E8VA 4CLJA 5K5NA 5LMAA 4GG7A 4X2KA 3U4WA 4JOAA 4HOKA 1GZOA 4FSMA 2VTSA 4PDOA 3MDYA 2RKUA 4U7ZA 5GZ8A 1QCFA 3F2NA 1WBSA 3AT2A 4GIIA 4DGLC 5HO7A 2A19B 2X9FA 1H00A 4NH1A 4J96A 4QMUA 4YC8A 5EQEA 3G15A 3D7TA 5HQ0A 2WMBA 4NCTC 1R78A 3D2KA 4JIKA 1BYGA 2AC3A 3H4JA 3FHIA 1UV5A 5DT4A 3ZONA 2XS0A 3BBTB 2XKDA 3OTUA 2C5XA 2CDZA 2PE0A 4S33A 4AGCA 4BDAA 1WBTA 3PWYA 3HRFA 1AD5A 1UNHA 1FOTA 3B8RA 4J98A 3VW8A 3RM7A 4UMTA 4ZTLA 4DFNA 4YLJA 3W32A 1WBOA 3Q9WA 5HIEA 4E1ZA 2VWWA 2OF2A 1M2QA 5AAGA 2XRWA 5E8UA 4FT9A 2EXEA 3LFBA 3CLYA 4RWKA 2ETRA 4H39A 4ZK5A 5A6OA 2W4JA 3PJ1A 3RPYA 4O0WA 3SX9A 5AP4A 3ZC5A 3FQEA 3TV6A 3IOKA 3GCVA 3OMVA 5K4JA 2C5NA 3Q52A 1H1QA 2RFEA 4X3JA 4AAAA 1OPJA 1OIQA 4I5HA 5FBOA 4Q5EA 3MPMA 5GJDA 3AGLA 3F5UA 3H9FA 4P5QA 2W4KA 4BIEA 4TYGA 3GNIB 2XZSA 3CKWA 4DITA 4R78A 4RIXA 2BRGA 3ODYX 3HA8A 4BTMA 2XK3A 3FY2A 4U81A 5HE2A 4L8MA 3A4PA 1Q8UA 3QYWA 3PG3A 4JRNA 4ACMA 1Q8WA 3EQRA 2WMSA 4CV9A 4QMTA 2ACXA 3OWLA 2VAGA 4KD1A 4USEA 1PKDA 4IX6A 3WZJA 4YHTA 4IAFA 5AIRA 5HORA 5LWNA 4BDGA 4XV3A 4FVQA 4TXCA 5AV3A 4F6WA 3ZFYA 4BIDA 4YJSA 3FMMA 3T9TA 5CAQA 5BVKA 5EQPA 2BKKA 4CG8A 4AOTA 2I0HA 1CDKA 4F9WA 1JQHA 3F3TA 2VTQA 3HEGA 3NYXA 3ZLXA 1CTPE 4U45A 4GUEA 1ZXEA 3U8WA 2C3LA 4R3CA 5IQFA 4BCFA 3NVMB 2V7OA 4PWNA 1ZYDA 4QPMA 4R5YA 5CTPA 3NCGA 4EOSA 4D1XA 4KB8A 3QTSA 4U0IA 3MY1A 4XP3A 2E9OA 5DBXA 1RW8A 4QQCA 4DFZE 5CAVA 1ZYCA 4YPSA 3U4UA 4BWKA 2PZIA 4IQ6A 4WBBB 3ALOA 4JAJA 3W2QA 2X2LA 1PXKA 2CLXA 2OIQA 3UOJA 3RK9A 2R5TA 1U5RA 5IDPA 4ANNA 2RL5A 3PA3A 1R0EA 2WMRA 4LGDA 4MEDA 4BDKA 4EOQA 2IJMA 1DAWA 4AOJA 2ONLA 2O63A 4FOCA 3BEAA 4G16A 2Q83A 3FMEA 2UVYA 3KF7A 2EU9A 1FGIA 5CENA 4AE6A 3GI3A 2FH9A 4R7HA 4I5PA 5ICPA 3LOKA 4KBCA 2JAVA 3AT3A 4RMZA 2PMIA 2X8DA 4MK0A 4AW0A 3VS2A 5BQ0A 5E4HA 2VNYA 5KMNA 3HMNA 4L53A 3THBA 4GU9A 4O21A 5FXSA 4RRVA 4X21A 2J7TA 4RIYB 4MXYA 3CCNA 4RFYA 4QQJA 4DH1A 4FTOA 4FV7A 3KULA 5AUYA 4IWDA 2FO0A 4OUCA 5DPVA 5M4FA 5IQAA 1W8CA 3DXNA 3ELJA 3N51A 4IX5A 3VQUA 2ZVAA 4FKTA 3UTOA 4XBRA 4HZSA 5M08A 5E91A 3I4BA 4BDEA 2ZM1A 1JOWB 3MSSA 4GYIA 4C7TA 3OOGA 4F7JA 3IOPA 3EFKA 5CSXA 5I3RA 1MRUA 2C5OA 5LVNA 4K1BA 2RFNA 3GBZA 2QG5A 3QRJA 4BR3A 4FC0A 3BHYA 5DI1A 3KK8A 2CGVA 1GZ8A 3D4QA 3P7CA 1YOJA 3NZ0A 4A4OA 4E6DA 1XH8A 3EIDA 4FYOA 4BI0A 4PV0A 2BMCA 5EYMA 3WOWA 3UNJA 2UZLA 2J4ZA 2OFUA 1YXVA 4AA4A 3R04A 3PTGA 4FICA 4FKUA 2JD5A 2NRUA 4IXPA 2UW7A 2F7ZE 2XNNA 4TWPA 2G2HA 4UXLA 2CHLA 5LWMA 4FIEA 2J51A 3R83A 1K2PA 3ZSIA 1KV2A 2GNFA 2WTDA 2Y6MA 3FUPA 2AUHA 2XKCA 4O0YA 5E9EA 4UWYA 5AIKA 5LOHA 4GK2A 4U43A 2B55A 5EKOA 3TI1A 3DJ6A 4I0TA 2PUNA 3B2TA 4W9XA 1Q62A 4EK6A 3F3UA 5CYIA 2F7XE 3SG8A 4AW1A 4CZTA 2J6MA 5C4LA 4ZS0A 3CTQA 1PXIA 5IMEA 4EUTA 2UW5A 3FYKX 5AP1A 1KE8A 3E3PA 1ZMVA 4O27B 4B8LA 1OZ1A 4APPA 2JIUA 2V22A 3S4QA 4NM5A 1KSWA 2YIWA 4IVBA 4G17A 4EHVA 3QF9A 4TY1A 4R1YA 4HYIA 4RVTA 3IW6A 2JFMA 5DFPA 2VWBA 3EHAA 3W18A 4ACHA 3DFCB 4EH9A 5IMXA 2CKOA 3N4UA 4I5MA 4H3PA 5L8JA 3BLRA 4L3JA 3LIJA 5LVPA 4JLCA 1RDQE 5EDRA 3QD2B 4NU1A 2PE1A 4AN2A 3NNXA 2YJSA 3C4ZA 3OEZA 3WILA 5KHXA 3G0EA 4L46A 3BEGA 3H9RA 4O7SA 2WTCA 2YCRA 4NW5A 2HWOA 5E90A 4BZDA 2REIA 4FGRA 4QP4A 3DFAA 3LQ8A 3O50A 4Y72A 2OW3A 1H1RA 2YM7A 4X2NA 3E8CA 4RZWA 4BFMA 5AV0A 5A14A 3Q2JA 3QX4A 3TIYA 5M4UA 3GFWA 2WO6A 5C01A 2UVZA 3BV3A 3R01A 3Q4ZA 1UU8A 1ZLTA 2C1BA 3DKGA 3WE4A 3AOXA 2PVMA 3VIDA 4FODA 3BU3A 3R28A 1Z57A 3QD3A 2BHHA 4N70A 3D9VA 1UU3A 1YHWA 4FKSA 4QP1A 4O6LA 1JPAA 3EQHA 3KFAA 5E8TA 5CLPA 2C0OA 2H9VA 4M12A 1QPEA 3G6GA 3ROYA 4A07A 3ZFXA 2E9PA 3WF7A 3QA0A 4UY9A 3ZBFA 2B4SB 4RIWB 1XH9A 2YIRA 4M69B 4EH8A 2DWBA 4O7NA 4AU8A 4LL0A 4NTTA 5HLWA 4RJ3A 5DEYA 2CLQA 2UZOA 3MJ2A 4ZSLA 4AA0A 5AAEA 4F7NA 1HOWA 4D1ZA 4OTHA 4MQ1A 3ETAA 3R8VA 2PU8A 1R39A 3VS6A 1JKTA 4I0SA 4UYNA 3F3ZA 3BYOA 3P79A 4BRXA 4YO4A 4G9CA 5AM6A 5G1XA 1U4DA 3NNUA 4FZ6A 3C13A 4M13A 2JLDA 3NUAA 4FX3A 1OIRA 3UO6A 4U80A 4YTIA 4JJRA 2R3NA 5TF9A 2O5KA 5FEQA 3KY2A 3TZ8A 3WARA 4IADA 2OXXA 3MTFA 4OBPA 1YXUA 2RIOA 3T3UA 3W33A 2FYSA 2YEXA 4HCUA 2QHNA 3O17A 4IDTA 4W9WA 5TKDA 5JRQA 3C5IA 3NUPA 5I5ZA 1Z5MA 3F6XA 4JRVA 2UW6A 4RJ6A 4ENXA 5L2IA 2C3IB 4RX9A 5FTGA 5TT7A 2P0CA 3PY0A 4QP6A 4QMZA 3MH1A 4BDCA 1APME 4FG8A 1PW2A 5CWZA 3EZRA 3PJ8A 2XJ1A 1V1KA 3UQFA 1FQ1B 4U3ZA 5HCZA 1OBDA 4ZIMA 2GNGA 3GCPA 5DIAA 3DBCA 4I21A 3Q4TA 2HZ0A 1B38A 4FV6A 1JKKA 5L2QA 4BC6A 4M97A 4L7SA 3MVLA 2JKMA 4PMTA 2QD9A 3DA6A 1IG1A 3RK7A 4AT3A 3NW6A 4AWIA 4IANA 5IA4A 3PDTA 1SZMA 4IEBA 3KRXA 3IS5A 3ZO2A 4X3FB 2BZIB 3HV6A 4NFMA 1CSNA 2CKEA 2OH0E 3A7IA 2CKPA 5E8SA 2HENA 2IVTA 3LXLA 4TNDA 2QOHA 3H0YA 4L3PA 3TNWA 5AAFA 4BIBA 4BKYA 4YNEA 3TNIA 4RIYA 3CY2A 4GJ3A 4EOIA 1M7QA 3I7BA 3MTLA 3R7YA 3TKUA 4CRSA 1JSTA 3ZRKA 1P4FA 3EB0A 4IAIA
chains in the Genus database with same CATH superfamily
4W8EA 3V5LA 4KWPA 3Q5IA 2HW6A 4L43A 3LCSA 3K5UA 3NYNA 2UZNA 4PUZA 3EL8A 4JQEA 5FLFA 4LYNA 4PL4A 3ZUTA 1S9IA 3UP7A 2WTVA 2QNJA 4LGHA 1W84A 4AQCA 2OSCA 4RX7A 5BX0A 3BX5A 3IONA 2QG7A 4TL0A 4FSUA 4FK6A 5HTBA 1G8SA 4BGGA 5FP6A 1TFFA 2BDFA 2QOCA 2VTAA 5ETCA 4XHKB 4IMYA 5C1QB 5EOBA 5JFXA 3CBLA 3MA3A 5HEZA 4IHPA 1A48A 4Q9SA 3VW6A 2W1ZA 4CKJA 4ALUA 3PE1A 5E8YA 5J7HA 2HCKA 3HV4A 5ACKA 4CFNA 4G1WA 1YI4A 1H1PA 5DN3A 1OL2A 2GS7A 4C61A 4RC2A 3ZTXA 4F08A 2ZM4A 4U3YA 3UIXA 4NTSA 3WE8A 4ORKA 2R3LA 3QTZA 5L6WL 2XALA 2CPKE 3EFJA 5EI2A 3NFFB 4O38A 4E73A 3PXKA 4EHZA 3LMGA 5IQHA 4G6LA 3PWDA 4FV1A 1L3RE 3QUEA 4JDHA 5AM7A 5E8ZA 2CJMA 3Q9ZA 4L7FA 3V3VA 3QLGA 3POZA 4G3DA 2IVSA 1J7UA 4D0WA 4XNEA 3OEFX 2BRMA 4XOZA 2HK5A 4HW7A 3SOCA 3WBLA 2LAVA 4UV0A 3WZUA 4WG5A 4YUQA 3SKCA 4HNFA 2JBOA 4WNPA 4K33A 4BDIA 3R02A 4DGOA 3O23A 4QD6A 2A98A 4XG4A 3FKOA 3ZLSA 1G8AA 2PVHA 2C4GA 3DCVA 2XK4A 4H1MA 2R2PA 3BLHA 4KUJA 5HE3A 4CMUA 3KK9A 1JBPE 4GFMA 4M68A 4E93A 3C4EA 3EYHA 4I94A 3ZUVA 1Q3WA 3O0GA 3R8UA 4GVJA 3O8TA 4MX9A 3W0RA 2OXDA 2Z60A 3AT4A 3MB7A 3EYGA 1AGWA 3E87A 3RJCA 3C4WA 4YJPA 4IBMA 3H9OA 1T45A 3MJ1A 4WNKA 4KSQA 1NVSA 2WTJA 4IX4A 5FWKK 4XRLA 5BMMA 4EH2A 4WNOA 5CEMA 3ATTA 4D2RA 4MWHA 4U79A 3DB6A 2P33A 3F61A 4XH6A 4CFUA 2C3JA 3KRLA 1VR2A 3EQBA 4IB1A 3AG9A 4LM5A 4R8QA 5DE2A 3FKLA 2C6OA 3W0QA 3ZEWA 4F09A 2GPHA 3AC2A 2CSNA 4F0GA 1YI6A 4PPAA 5EW9A 1W7HA 3FMDA 4WOVA 4RG0A 5EW3A 3DXPA 2J0KA 3IGGA 3OXIA 4XV9A 2E9NA 4JT3A 5I0BA 4YTFA 4PP9A 3RBWA 4FTAA 4J52A 4F9BA 4TYJA 1JKSA 5HCXA 2HIWA 3N4VA 4O2ZA 3W0NA 3OBGA 3FMKA 4G3EA 2XBAA 3Q4UA 5L4QA 4EKLA 4AOIA 1PMNA 3MWUA 3BPRA 2W9ZB 4FKVA 1LEZA 2DUVA 3NUSA 2FA2A 1GIHA 3WYXA 1YWVA 4KIKA 1UNLA 3FLYA 5ANGA 5TO8A 3E64A 5GIPE 2I0YA 2J90A 3CP9A 1M7NA 3LQ3A 3GCUA 4IM2A 3ANQA 4KAOA 4B0GA 1UA2A 4AFJA 3P86A 3H10A 3GU5A 3NW7A 4RX8A 2QO2A 4LRMA 3LAUA 1NXKA 4LOOA 4FNZA 3TDWA 2YJRA 4FSTA 4FV2A 3R9HA 4XBUA 5CNNA 4D4YA 4Y46A 1R1WA 2GU8A 4MAOA 3Q32A 3OCSA 1ERKA 2B9HA 3OOMA 4K8AA 2VO7A 4BDDA 3UODA 4AW5A 4ANSA 3Q04A 5FRIA 5HX8A 4Y73A 2CKQA 4KIPA 5IZFA 1DI8A 1W2DA 3BELA 2EUFB 5BVOA 2VX3A 3B8QA 4W8DA 4AT5A 4HGEA 5IA0A 3W10A 4OAVB 3QQGA 3UVRA 2GQRA 2OJ9A 1OL6A 2JIIA 1ST0A 4RJ4A 2BZHB 4DHIB 3V8SA 1K3AA 2Z7LA 4NIFB 4XG8A 4F0IA 5LXMA 1U54A 3RPOA 1IAJA 1Q99A 3KXNA 3QD0A 2BTSA 2XIZA 2QR7A 2UZTA 2R7IA 2R3HA 4DDIA 4ITJA 5CEQA 4ALWA 2ZV9A 4XX9A 2PZYA 3RK5A 5CX9A 4EWHA 3R7EA 2PVRA 3BGQA 4Z55A 3KL8A 4BGQA 5EHOA 4X7QA 4QMOA 3MVJA 4II5A 3PXQA 4XS2A 5K0XA 3ATSA 4RX5A 2YACA 4JXFA 4C2WA 1GNGA 5FBNC 4BTJA 4FKOA 2ZB0A 5KO1A 3PLAE 5M53A 1PHKA 3FV8A 3KXGA 3VRYA 1OUKA 5HVKA 3LFNA 4GT4A 5IF1A 2ITWA 5JGAA 3F5GA 4CEGA 5A4CA 3EZVA 4YR8A 2CGUA 3NWWA 5JSMA 4XP2A 3B2WA 4E4LA 1H24A 3FHRA 5EYKA 4A9RA 1UWHA 3PJ2A 3PA5A 3F3VA 3L9NA 3LPBA 3NVKI 2I0VA 3FLZA 2Y4IB 2A0CX 5LCJA 2OZOA 2UW4A 3PIYA 5LMBA 4CFXA 2W1EA 5CSVA 1FPUA 3GC0A 3NIEA 4N4SA 3I81A 4Z3VA 3NSZA 3TJDA 4RJ7A 4EH4A 3L9MA 3UQGA 4FKLA 4IX3A 5IUIA 3MS9A 4E5WA 3R8ZA 3P5KA 5M44A 4LV7A 3RGFA 5F94A 4I23A 4C62A 4FSZA 4X0MA 2BIYA 3CTJA 4CNHA 4IAAA 3OROA 1M2RA 2O0UA 1KV1A 4FT5A 3U87A 3WZKA 4CZUA 4DFYA 4QNAA 4DDGA 2WZJA 3COKA 3RZFA 3ZH8A 2ZMDA 3BHTA 4GL9A 5HBEA 1OI9A 5TE0A 2WTKC 3BHVA 5EYCA 2RFDA 2UW8A 3QKMA 4QMVA 3LXPA 5AEPA 4BDJA 2I1MA 4KA3A 1BI8A 3DAEA 2BROA 4MBIA 5DLSA 3WF5A 3R7VA 5J9ZA 4O83A 5AUXA 3I79A 2ITPA 3WF8A 3ZUUA 3KRRA 3PP0A 2HZIA 4EONA 4QMXA 5BUIA 4DEIA 5A54A 2YM3A 2I0EA 3SW4A 4UZHA 3MY0A 4FK3A 3MIAA 4BDHA 2BZJA 5HHWA 4ZSGA 5EM5A 3SGCA 4RBLA 4P90A 4EWQA 4Y83A 5I9ZA 4O4DA 4AXFA 3P23A 2QOLA 3QALE 3QQLA 4AGDA 4ZOGA 4TPTA 3V6RA 3IDBA 5HKMA 1FVTA 4DEDA 3BU5A 3RPVA 2JKOA 2FSTX 3EQGA 3L8XA 4RGJA 3OCTA 4D4SA 1FMOE 5CF6A 5CI7A 4YZBA 5IUGA 3QTUA 2X2KA 4DFLA 5FTQA 5GHVA 3ORPA 5HTCA 4PP7A 4IAZA 4BVUA 3LHJA 4UMRA 3O7LD 1ZAOA 1PJKA 3EN6A 2IW6A 4UXQA 2CMWA 4X2JA 4YLKA 4V0GB 4FTQA 5AV4A 3AMAA 5DNRA 5ETIA 3N9XA 3GVUA 4ASZA 4BJJA 5EH0A 5IG1A 4D55A 3IW7A 3ULZA 2YLFA 1UKIA 3ORMA 4Q2AA 1Q3DA 4F7SA 2DS1A 3MB6A 5GJFA 1W82A 4MXXA 1PY5A 4WNMA 4MBJA 2OJFE 5T68A 4ANLA 3ZRMA 2QI8A 4FNXA 4O84A 3LLTA 4WUNA 3R1YA 5I9UA 5IQIA 1DAYA 2BFXA 4M84A 2BALA 4PDPA 1UWJA 4EOKA 3O2MA 2P2HA 3GFEA 3Q53A 5B2LA 4OTQA 3C4FA 2Z2WA 5FQDC 4PTGA 4IFCA 2A2AA 3R63A 4UEUA 4PY1A 5CI6A 3FJQE 4U40A 3S2PA 5E8WA 2VO6A 4YMJA 4DEHA 3UVQA 3VUDA 3KVWA 3D14A 1UKHA 3A62A 3CR0A 4K11A 3LE6A 3WIKA 2G9XA 3F66A 3OCBA 4Y5QA 1WBPA 2ZMCA 5HVYA 5CXHA 4ZLZA 2Y4PA 2YLEA 3C4XA 5AP5A 4AE9A 4F78A 2A1AB 3MVMA 3GOKA 2J0LA 3QTXA 2IZRA 3DY7A 4FIIA 2O8YA 2VWVA 2XK9A 2ZDUA 4FIHA 4GV1A 4LV5A 4WHZA 4XLIA 3IDPA 3P0MA 5CF5A 4EC9A 5EQYA 2Z7QA 4FSYA 4QQ5A 2W1FA 2WQBA 2J2IB 3RI1A 3D5VA 4FGBA 4FIJA 4FV8A 4IE9A 5DRBA 1BI7A 3MFUA 3OP5A 1STCE 4Z9LA 4Z16A 3ZLYA 1XH4A 4YC3A 3QLFA 4OTPA 2ITOA 4YLLA 4CD0A 3WF9A 2ZV7A 2BAQA 2KTYA 4K77A 4D5HA 1SVHA 4F9YA 2CNQA 2RG5A 3Q60A 4ZMFA 3HNGA 2Y8OA 4N6ZA 2XB7A 4I6FA 4C4HA 3NLBA 4IZ7A 2IO6A 4GT5A 5CU3A 5HG8A 5H8BA 2B1PA 3R6XA 3VUKA 3HUBA 3GB2A 3SXFA 4EBWA 5KBRA 4J99A 3L8VA 3OW4A 4CG9A 3AD4A 3LFEA 2HXQA 5IPJA 3C9WA 5I9VA 4L3LA 5AP3A 5JKGA 2PHKA 3F69A 1H0VA 4XOYA 5GZ9A 2GDOA 3LLAA 4M14A 5AUVA 3IG7A 1CKIA 4UB7A 2Z7RA 3O8PA 3QQJA 3MESA 5AR5A 2XIYA 2R64A 4FNYA 5EI6A 4R6VA 5M09A 3OUNB 4YHFA 3FMJA 5I3OA 2PYWA 4C3RA 4W4XA 2VGPA 3R9RA 1OL7A 4CFMA 2OGVA 5C03A 4QPSA 2XNEA 3C5UA 3E7OA 4P7EA 3ZDUA 4JIAA 1YDSE 1H27A 3R22A 4OT6A 2PMOX 4MTAA 4FI1A 4YBJA 5D7AA 5KKRB 2PZPA 3RMFA 3Q3BA 4IZAA 4YJRA 4CSVA 1RE8A 2VUWA 3IKAA 4RZVA 1LP4A 3M1SA 4O2PA 3PSCA 1IRKA 1PYEA 4MBLA 2UZEA 4PL5A 3G9NA 3QTWA 4I4EA 3UNZA 4AGWA 3D15A 4D9UA 4BCQA 4DH7A 5CASA 4NJDA 5A4TA 2HELA 3QCXA 3QBNA 2JAMA 3ZC6A 3ORXA 4RJ8A 5CNOA 4XEYA 2HWPA 5AJQA 4BY9E 2Z8CA 5HCYA 3LFAA 5CQWA 2XIRA 2YCFA 3ZBXA 3C0IA 3DNDA 3FXXA 1V0OA 2XUUA 2HOGA 3R9OA 2OLCA 3WIGA 3IO7A 3HVCA 5CVGA 3P9JA 2BTRA 4KIQA 3CY3A 1OGUA 3W8LA 5IEYA 2FSOX 1TQPA 4R7IA 5CEOA 4C02A 3S00A 3U54A 5CSWA 2XYNA 3V5JA 2G2IA 1BX6A 1K9AA 2QOIA 2YIYA 5DWRA 2JEDA 5FM2A 4UYAA 3JY0A 1YWNA 2C5YA 3CGFA 2ERKA 5KBQA 4NM7A 5AV1A 5AWMA 1UU9A 2OF4A 3R9NA 4IW0A 2W1CA 2J50A 2BIKB 2F2UA 3VS3A 4U8ZA 3W2SA 3GU6A 1XMLA 3GCSA 5IQDA 3VUHA 3NPCA 3BL9A 4YJVA 2UVXA 3EN9A 3FLSA 4YJTA 3RZBA 2G15A 2WQMA 4FKWA 3ZO3A 3TG1A 5BUJA 3R1QA 1IAHA 2VX0A 2VTMA 5I4NA 5AR8A 1J1CA 1OKYA 3FDNA 4IJ9A 3NX8A 4BYIA 2WTIA 1Q41A 2XIKA 4H58A 3I5ZA 3TEIA 4CMOA 4DHFA 5HTIA 1XH6A 3TTIA 4FJVA 2GTNA 4C0TA 3EN5A 5JRSA 4DLJA 3MVHA 3DZOA 3KB7A 1ZMUA 3P7BA 4BBEA 3SQQA 5IQCA 3BKBA 1BMKA 1YQJA 2QVSE 2PE2A 4IWPA 1G8JA 4OT5A 3FE3A 4IC8A 5IUHA 4HCTA 4UWBA 1FGKA 3O96A 5DT3A 3QGWA 5L6PA 3E92A 3PSBA 4OBQA 1Y6AA 4YC6A 2HYYA 3MPAA 3UIBA 3BL7A 4CV8A 3GT8A 4EUUA 5F4NA 3LCKA 4YZDA 2X6EA 4J8MA 2QO7A 2X7FA 5HLNA 3CXWA 2YCSA 5JT2A 1YHSA 3E88A 3EFLA 4GUBA 2OIBA 4PQNA 4QRCA 2I6LA 3CPBA 1H25A 3PUPA 4K6ZA 4ZZNA 5CS6A 5FUTA 5KMKA 2R3IA 4I6HA 4QMNA 3G5DA 4FTLA 4RPVA 4UWCA 3FI2A 3DTCA 3AKLA 3PA4A 3HMPA 5GIOE 1J91A 3LJ2A 4FV0A 1YOLA 3LJ1A 4X6RA 4MVFA 5AP7A 4S31A 1IR3A 1UU7A 5AA8A 2WU6A 5I9XA 4KBAA 3EN7A 5CALA 4YP8A 2GHMA 3ORTA 3O71A 5EKNA 1XH5A 4FKRA 4HGSA 3S1HA 3EKNA 2IVVA 3LCOA 2OJJA 2OO8X 2WXVA 3BQCA 5HO8A 1B6CB 3W0MA 5IA5A 3BYVA 4EQCA 4BKZA 5CZHA 1H0WA 4DF3A 2CGXA 3V5QA 2X39A 3PXYA 3FY0A 5K3YA 3S95A 4BI1A 1XQZA 1DM2A 4I92A 3ET7A 3OWKA 4E8AA 2XYUA 5KMLA 4U42A 1OVEA 2E9UA 5IDNA 4NK9A 2WOTA 4FKGA 5LJJA 4DFBA 5IISA 1BLXA 2CN8A 4MXAA 3I7CA 4RT7A 3EWHA 4WSQA 3ID6C 4EHGA 2JGZA 2YM8A 4M15A 4D28A 5J79A 1I09A 3A7FA 2C47A 4FT7A 4AGUA 4AZVA 5ITAA 1OL1A 4LOQA 4QMQA 2BRNA 2B52A 2PVNA 3BZ3A 4TWCA 1R3CA 2C0TA 4O81A 3DDPA 4PTEA 5AUUA 3RKBA 4TYIA 5HNGA 3RWPA 4C36A 3GU8A 5A4LA 3W55A 2B9FA 4D58A 4J97A 3P7AA 4GSBA 4NEUA 3HV7A 2W7XA 4S34A 5KZIA 4EHEA 1E1XA 3TUCA 4B8MA 3R8LA 4V04A 3V5TA 3VVHA 4DBNA 3CKXA 2C6IA 3FXWA 3BBWA 4JR7A 1KE5A 3LMIA 5EHYA 2VTPA 1NW1A 4OTGA 3UZTA 3F82A 2V0DA 4C57A 4EORA 2QONA 3QTRA 4XV2A 4C4GA 5HOAA 3W8QA 2NRYA 2VTNA 4ZZMA 5F20A 3KQ7A 3PY1A 5JH6A 3OXTA 5HZNA 5DOSA 3KKVA 4USDA 3AQVA 3FL5A 2ZOQA 4Y85A 1WFCA 4L6QA 4BCPA 4EQUA 4C59A 3FPQA 4YZMA 3QQKA 2OJIA 2UZBA 4ITHA 3UOKA 4J7BA 4H1JA 4ZTHA 3W1FA 4DYMA 3BGPA 1O6YA 2X7GA 4QMMA 3Q9XA 3ZOSA 4HCVA 4PPBA 3ML1A 4O0XA 5JZJA 2OG8A 5L2SA 4YZ9A 4O91A 3ENHA 4I6QA 3HV3A 2R7BA 3Q96A 3QZIA 3ZXTA 2PPQA 3DXQA 1Q8ZA 3KC3A 4RFMA 5J87A 3R1SA 1ND4A 1OKWA 4O86A 2IWIA 5CSPA 3V5WA 3EQCA 4GKIA 4ZJIA 3LMHA 3TKHA 3FZPA 3WZDA 2ZV8A 2YCQA 3PRFA 3PPKA 3Q4CA 4MCVA 2P55A 4FG7A 4JVGA 3KIOC 4TNBA 2X9EA 5EDQA 1G5SA 1NVQA 1REJA 1Q97A 4WBOA 4AS0A 4DG3E 4NM3A 5HBJA 3QRUA 2RF9A 4IB0A 3V51A 1DS5A 2ZYBA 3BHHA 4ZLOA 2V55A 4FUXA 3I1AA 3OW3A 2AEGA 5ANOA 4IJPA 2Q0NA 2X8EA 1EH4A 3DK3A 5A3XA 5IA1A 3VONA 3AMBA 4RQKA 1ZMWA 5LVLA 2JDSA 2ITZA 3FAAA 3UNKA 2IZSA 3NMUF 1H01A 2UZDA 4BCMA 5CAUA 2VX1A 3M11A 3KCKA 4BL1A 4EH3A 3PLSA 3MIYA 4C3FA 2WMVA 2C0IA 3AXWA 4F63A 5AR2A 4QYHA 1WZYA 3OHTA 4FZ7A 4JBOA 3BLAA 3VQHA 1Y57A 4BZNA 5HNIX 3OCGA 1JVPP 3CTHA 3TNQB 4GK4A 4LFIA 5FXQA 4A9TA 5M55A 3ZS5A 3BCEA 2JIVA 2QKRA 5ANJA 5BUEA 5AV2A 2CGWA 3COIA 4TYHB 5IKWA 3KMWA 3HV5A 4IVDA 4JX3A 4PPCA 5E1SA 4IWQA 4LV8A 1SMHA 5BYZA 3PZHA 5CANA 4AZTA 2A4LA 4IZYA 5BPYA 4L9IA 4D1SA 2PUIA 3SRVB 2W4OA 4N6YA 3E8DA 4O1PA 3VBVA 4C33A 2WQOA 4G3GA 1JLUE 2IZTA 2C1AA 4AZWA 1KOAA 3HX4A 3SAYA 5DT0A 2OZAB 3DV3A 4GH2A 1CKPA 4JR3A 4RA5A 3SHEA 2X81A 5M57A 1U46A 2VTRA 3UIMA 1VLRA 3VRZA 4YURA 5L6OA 4B99A 5AP2A 1Z9XA 3HP2A 1BL7A 2GMXA 2YERA 3BV2A 4TZRA 4EOMA 4EH7A 2BKZA 3JUHA 2R3MA 4HYSA 3NEWA 1MRVA 3TMOA 3LFFA 1OM1A 2WMXA 1Q5KA 1TQIA 3KF4A 4YZNA 4CFFA 4IB3A 2QCSA 3GC9A 4LMNA 5DA3A 2XH5A 5JEBA 2W0JA 4LUDA 3QQFA 4DLIA 4ZXTA 2PSQA 1VZOA 4D2VA 1JSVA 4QQTA 2HZNA 5ANDA 3DJ7A 5HG7A 5HGIA 3RAIA 4O7TA 1WVYA 5FDPA 2HAKA 3PXFA 1HCKA 3PP1A 5L8LA 3SW7A 2R0IA 5CT7A 4OAUC 2YM4A 3PG1A 3AC1A 4C4FA 3MI9A 4AA5A 3VBWA 5CEIA 3FC2A 5M4IA 5JFVA 5J1WA 3QTIA 2C6KA 2QO9A 2HXLA 1FMKA 3I5NA 3GENA 2V7AA 3I6WA 3QZHA 3R7GA 4FSNA 4L01A 1Q8YA 3RNYA 4HVIA 2YZLA 3AC3A 5B2KA 3ZU7A 5B2MA 3I0QA 4YSJA 1PXJA 3AKKA 1XO2B 4K9YA 3GUBA 5FXRA 1LEWA 2JKQA 3FL4A 4J95A 2W96B 3JY9A 3GGFA 5DRDA 3R7UA 4FZAB 2C69A 4TN6A 2B53A 4J53A 5ACBC 5T3QA 3DKFA 4FKIA 3ENMA 1KUTA 2ITUA 2XEYA 2GTMA 2RFSA 4EH6A 2C6MA 3BLQA 4L44A 2JDVA 3UO4A 2GNLA 3RTPA 4E6QA 3ZEPA 2J9MA 1Y91A 3DQWA 3IK3A 3W16A 2FUMA 3BYMA 2PVFA 2VV9A 3O7LB 3V01A 3T8OA 4RIWA 4BWXA 3OWJA 2QLQA 1OMWA 2QOKA 2XP2A 4M69A 4MHAA 1BL6A 3A4OX 3FLQA 5ETAA 3ZHPC 2GQSA 4DEAA 1J3HA 4EK8A 4FV3A 4CYIA 1HCLA 4Y8DA 3KN5A 3TYKA 3JS2A 3PFQA 2G01A 3QCQA 5HG5A 2XNOA 4H05A 2W17A 3D5UA 4YO6A 3R21A 4I22A 3KRWA 3CIKA 3R71A 4WT6A 3ZRLA 3LKMA 4AXEA 3MGYA 3D7TB 3OT3A 3QCYA 3VUTA 5H2UA 4FV5A 1LR4A 4QYEA 2PMLX 5JQ5A 3QGYA 2VZ6A 4YBKA 3CQUA 4GEOA 4FR4A 5AX9A 3SG9A 2ITQA 3MFRA 3PVUA 4OTRA 1KE6A 4FSQA 1W98A 1QMZA 4CT1A 5CT0A 5CF4A 4HPUE 4L45A 3GQLA 2YISA 4R3RA 4YTHA 2XNGA 4YU2A 4RC4A 5DR6A 3ERKA 3V8TA 3EOCA 3K54A 4CTBA 3QD4A 4PMMA 1PXPA 1ZOEA 3FLNC 5HLPA 1NY3A 2OBJA 4BCIA 3DJ5A 4QMSA 2PULA 1WVWA 4U9AA 3NR9A 2PK9A 3DU8A 3FZOA 3ZCLA 1GZKA 3KMMA 4TTHB 4ZY4A 3ZM4A 1QL6A 2Z7SA 4QNYA 5A4EA 3DAJA 1SNUA 3FXZA 3PXZA 3N4TA 3A2CA 3UC4A 5D1JA 1OIYA 4JMQA 4O7LA 1QPJA 3QFVA 4HVGA 3Q2MA 2JDTA 3PVGA 1GIIA 2ETMA 2JKKA 2VTLA 4H3QA 4QP7A 4DBXA 2GNJA 3NYOA 4LQMA 5KHWA 2ITVA 3UOLA 2QQ7A 3E3BX 4NKAA 4RVMA 4X3FA 4FE2A 4ZLYA 4J71A 4QTAA 1F0QA 3W2PA 4RIXB 4F9CA 3ORZA 4I20A 1TVOA 2IZUA 2QOFA 3QYZA 5BYLA 3I6UA 3ALNA 5CSHA 3D2IA 4O0UA 2W1GA 1WBWA 4A9UA 4E6CA 3TUBA 4F6SA 4C2VA 3VUMA 4FTRA 4KRCA 1Q4LA 2ZAZA 2GS6A 4GT3A 3UG2A 4RWLA 1PYXA 4FTMA 4NFNA 3BWJA 2B9IA 3ZM9A 4IVCA 3PIXA 2QC6A 2WEVA 3HLLA 2W06A 2WFYA 4A9SA 3W0OA 3G9LX 2XIXA 4MWIA 4BB4A 4D9TA 1KE7A 4LG4A 4FTIA 4D5KA 4O7WA 5H3QA 1RJBA 5M06A 3KEXA 3OTVA 4PL3A 4AN3A 4CVAA 5L8KA 4BKJA 3H0ZA 3HRBA 3I0OA 4MF1A 2PUPA 4HGLA 4RVLA 3HGKA 4L52A 1FVVA 3OVVA 3C50A 4F99A 4EZ3A 4ENYA 4QTEA 3SV0A 5D11A 4FZFB 4FYNA 2UZVA 3QRKA 4EK3A 4O96A 3OBJA 3LVPA 3UDSA 4KNBA 3NIZA 3U6HA 3VUGA 1OIUA 3PZEA 3TJCA 4QYGA 1Y6BA 3HAMA 4O7ZA 3AMYA 2NP8A 4ZEGA 4C58A 4IIRA 3SA0A 3TNPC 4O82A 4RIOA 3LXNA 1WMKA 3AC4A 5DVRA 3VF9A 1JNKA 3LM5A 3PFYA 4EKKA 4CYJA 3VBYA 2VRXA 2G1TA 3QQUA 5DEWA 5IA2A 1ZY4A 3NYVA 4LUEA 3UG1A 4F70A 2WIHA 2Y6OA 1WBNA 4FNWA 3GCQA 4NL0A 2IPXA 4EEVA 4FEVA 4WRGA 5EM8A 5FDXA 3F88A 4JNWA 3K3JA 2F7EE 1ZOHA 4ASDA 4O0SA 2CNVA 3G0FA 3KU2A 4QYYA 5AR7A 4DH8A 3TDVA 1VYWA 3MW1A 3BE9A 4DFXE 3EH9A 4FTKA 3LFDA 4C38A 3RM6A 4NSTA 3OFMA 4HYHA 4DG0E 2BVAA 4CQEA 5CU2A 4QMYA 3M2WA 5HD7A 1XBBA 1TKIA 2OK1A 3VBQA 4OLIA 1SVEA 2J0JA 4P5ZA 2X4ZA 2YM6A 3E93A 4ANOA 5JQ8A 5J9LA 2VWIA 3EQFA 4FV9A 1FBNA 3IGOA 3KULB 4QEBA 2HZ4A 4ACCA 1ZZ2A 4DFUA 4YNOA 1VJYA 2OFVA 4JG8A 4D2WA 4C8BA 5CQUA 4FTUA 3E8EA 3KCFA 4RWIA 1CM8A 2JBPA 2R0UA 3SC1A 4CQGA 5JGDA 5C8KA 2A27A 3ODZX 4G34A 3UDBA 5HBHA 3KXXA 4F6UA 4WRSA 3F5XA 5HU9A 3C4CA 3ACJA 2R3KA 3QRTA 3FLWA 4E4MA 2PY3A 4G9RA 5J95A 4IAKA 4DCEA 5GJGA 4IWOA 1J7LA 5IQBA 1XBCA 2EB3A 5BVDA 3H3CA 3GP0A 5G6VA 2PTKA 3Q9YA 3DAKA 4FTNA 1XKKA 3PVBA 4OTWA 3UBDA 4MUQA 1FVRA 1LPUA 3P4KA 3HA6A 3E7VA 4NWMA 2C5VA 3GC8A 3MN3A 4FBXA 4UALA 3HP5A 5FEDA 4UMPA 2FSMX 4EOOA 3QX2A 3NS9A 4FF8A 3PSDA 3W2OA 4MKCA 2UV2A 1MRYA 4AW2A 3RVGA 5AADA 3UE4A 1PXOA 5BYYA 3VBTA 4EOPA 4OGRA 5HG9A 2C68A 4PNIA 5HIBA 3D5XA 4LRKA 1SM2A 3DS6A 2WEIA 3NRMA 2YIXA 2IW9A 1PMEA 3DBEA 4UBAA 1JAMA 2OWBA 2BR1A 4BZOA 4IM0A 5IEXA 4FEWA 4X3FC 4BDBA 2VTOA 5HIDA 5FM3A 4BBMA 2BDJA 4YTCA 5HE1A 4BHNA 4KKEA 4UN0C 2AC5A 2XKFA 5CU0A 2W5BA 5JFSA 4FTTA 3RAWA 4C4JA 3BU6A 5KNJA 4HPTE 2PUUA 2VO0A 3W0SA 3TACA 4I3ZA 3TZ9A 5EHLA 5FD2A 2WELA 2PVLA 1B39A 4B6LA 2W1IA 1JSUA 3D0EA 4MD9E 4MYGA 2X0GA 4AXAA 4MH7A 4ZAUA 5DMZA 4OTDA 5J5SA 3R8PA 3QC9A 3EQPA 4KS8A 4GFOA 4XP0A 4A4LA 4DEGA 5C4KA 5D12A 3K2LA 4ZZOA 1OGYA 1ZYSA 4DTAA 3EN4A 4K2RA 5IU2A 3BYSA 4V05A 4FIGA 4Q9ZA 5A9UA 5BV3A 4GVAA 2F2CB 2BDWA 4ZTMA