5GJGA

Crystal structure of human tak1/tab1 fusion protein in complex with ligand 4
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
307
structure length
289
Chain Sequence
GPLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of a Method for Converting a TAK1 Type I Inhibitor into a Type II or c-Helix-Out Inhibitor by Structure-Based Drug Design (SBDD)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords TAK1 kinase - TAB1 chimera fusion protein
total genus 83
structure length 289
sequence length 307
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5gjgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gjgA01
4BWXA 1LP4A 5HNBA 5H3QA 3PJ2A 1RJBA 3SVVA 3WZEA 4EH3A 4YLKA 3RGFA 2CGVA 1UU7A 1SVEA 3JUHA 3LQ8A 3A4OX 4EYJA 2JIIA 2BPMA 1AD5A 3I1AA 3K54A 1V0OA 5JK3A 4I94A 5FGKA 4CLJA 2XVDA 3AT2A 5E8TA 3IO7A 2HK5A 2IJMA 5HO8A 4L3LA 3HGKA 4DEEA 3EHAA 3TNWA 3MSSA 3CD3A 1Q97A 3GQLA 3NUNA 3EQBA 3KY2A 3NUAA 4ZSJA 2OJ9A 3EWHA 4NKAA 3CP9A 4AN3A 2C6TA 3CKXA 2HELA 3PJ8A 4I6HA 1ZZ2A 4D58A 4JBPA 2C6OA 2ERKA 2WTKB 3PA4A 4I24A 2QOBA 2REIA 4C2WA 3A7JA 4X2GA 1HCKA 2C30A 4YJQA 2RFSA 2ZDUA 3KF7A 3C0IA 5I3RA 4FV5A 3R83A 4FV3A 3LQ5A 4OBPA 3MGYA 5GHVA 3PRFA 3ODYX 1KE9A 2OFUA 4CKJA 3UG2A 3O2MA 2RG5A 4RX9A 1GIJA 4I5PA 4YZBA 3R28A 4PDOA 4RLLA 3OF0A 5GJGA 5L2QA 4I41A 3E92A 5ETFA 4FX3A 5HLWA 4XHKB 2PMOX 2C6DA 2IPXA 1KWPA 3QQKA 2P3GX 4UB7A 4ERWA 2E9PA 2GHLA 3ULIA 3L8VA 5C26A 3RAIA 4GJ2A 3CGFA 3GOKA 3E3PA 3G6GA 5AV3A 1YHSA 5HEZA 4HVGA 2Y4IC 1XBAA 4FL2A 3DNDA 4IX4A 2WQMA 1Q8ZA 3QBNA 3CY3A 3WI6A 2WZJA 4K11A 1AGWA 3DTCA 5CY3A 4O7NA 3CQEA 4RJ6A 4OGRA 1OL6A 1SNUA 2UW5A 3D5XA 3KRRA 3BGPA 4I0SA 4UWCA 3VIDA 4ARKA 3ZM9A 1OKZA 2OJFE 4QMQA 3HECA 3UBDA 4XH6A 4FTQA 1JSVA 5CQWA 2O2UA 2YCQA 2XNOA 4FV9A 2XRWA 4J98A 4EHEA 4IDTA 4HOKA 4F9CA 3QQLA 4QTCA 5EM6A 3ZZEA 3EN5A 5BVWA 1UNGA 3UMXA 3L9PA 3VS4A 2ZVAA 3KEXA 3MI9A 1YDTE 4M14A 2CHLA 2NRYA 4AW1A 5IZFA 4BDBA 2W1EA 3W1FA 4CFNA 1FPUA 4NK9A 4DEGA 3T3UA 4BZNA 3GNIB 5I9XA 2ETMA 2X81A 4WNMA 1YXUA 2BUJA 2H96A 3KK9A 4D2SA 5CAOA 4FF8A 5IA3A 3DFCB 3S4QA 2BALA 2WMVA 4YP8A 2P2IA 3RM6A 3FYJX 1VYWA 4O96A 3UC4A 2FSLX 4UXLA 5E8VA 3PY0A 1WZYA 3Q4ZA 3Q4CA 2DQ7X 4W8DA 3BU3A 4FIGA 1KV2A 3AC2A 1DI9A 5HD4A 3NMUF 3R30A 3ALNA 3F7ZA 5CU4A 4BKZA 2X7GA 1PY5A 4R7HA 3UOKA 5E90A 3NNUA 4OAVB 3A7FA 2NPQA 4FC0A 2JC6A 5J8IA 3S00A 3F3WA 2FSMX 4CCUA 4O21A 1BX6A 2XBAA 5IA4A 3PJCA 1WBNA 4QOXA 4IZAA 5I4NA 4BDGA 3UYTA 3EN9A 5HVKA 3QHRA 2VTHA 4RZVA 4UYAA 3BIZA 3VNTA 2RSVA 3G9LX 5L6WL 4C0TA 4LOOA 5GJDA 1YDRE 3ZRMA 4FKGA 4ALVA 4GMYA 4TN6A 4ANOA 2CGUA 4PWNA 1YRPA 1WMKA 2R3PA 3CY2A 3LJ0A 5E8ZA 3RWQA 5AUTA 3ZZWA 4BCPA 3PZEA 2FYSA 4QQ5A 4GU9A 4XX9A 3QD3A 4E4NA 1XQZA 5FEQA 5JRSA 4FTAA 4ZSGA 5I9UA 5HTCA 5D41A 4ASZA 2F49A 3ZO3A 2PZPA 4LYNA 4F0FA 3QLFA 2UW4A 3QU0A 4O86A 4XCUA 1Y8YA 2DS1A 4FKSA 2EXCX 3OS3A 4A07A 3VO3A 5CF5A 3GCVA 4L3JA 2QQ7A 3CEKA 5CSXA 3I7BA 5HIDA 3VUKA 4AZEA 3QFVA 3OCGA 2V7AA 5T68A 3S0OA 3E5AA 3AOXA 3KMUA 3TNHA 3U8WA 4NJ3A 4ANLA 5F20A 5AX9A 2I0VA 2PZ5A 4ANNA 1K3AA 1KE8A 2CDZA 4EK8A 5HZNA 5L8KA 2VTJA 2YIYA 3KRWA 3UC3A 3R9HA 4EH5A 3MIAA 4D9UA 3R1SA 5ANOA 5E4HA 2B54A 3IW5A 2CN5A 4NWMA 1H28A 4GT3A 4DGGA 1BLXA 1OL5A 4QP9A 2WNTA 4GU6A 4F65A 3QTSA 5FM3A 3TTIA 2PSQA 3PE2A 3NVKI 5HNGA 4EBVA 3TKHA 4IM2A 4WO5A 4C4GA 4FUYA 3MY5A 2X2MA 4RIWB 4RVKA 2WTDA 4B99A 2UW3A 3B8RA 3FC2A 1OB3A 3HA8A 5L2SA 3D5WA 1OUKA 2RG6A 5DHJA 2XCHA 2JGZA 2QODA 4JBQA 5CEIA 2BIKB 4F7NA 4Y46A 5A4QA 2RFDA 3N51A 2I1MA 2QHMA 5IH6A 3TIYA 2FSOX 4U8ZA 1J91A 1OKWA 2R3QA 5IQFA 1MP8A 4I92A 4TW9A 2I6LA 5F4NA 4M8TA 4FZ7A 3BE9A 3VRYA 4W4VA 4V0GB 3SRVB 2PMNX 1XO2B 4S33A 4DEDA 4QMPA 1T45A 5JGBA 4XV3A 1V0BA 2A27A 3HRFA 4BHZA 4IWOA 4YJUA 4G5PA 5JT2A 3ENHA 2YEXA 4BGHA 3FBVA 4QTDA 2VTNA 5CF8A 2C5NA 1LPUA 1XHAA 3FKOA 4IJ9A 4O22A 4KNBA 3TKIA 4D4VA 5A14A 4HNFA 4M67A 1O6YA 2J5EA 3V8SA 1VYZA 1J7IA 1PHKA 2CMWA 5LVPA 1PXIA 3CS9A 3VUMA 3VS1A 4BCOA 4DC2A 3DFAA 2PE0A 4ZP5A 1YI3A 2ZV2A 4PDPA 4KRCA 2BDWA 3BGZA 1XR1A 2WAJA 4RGJA 2ITQA 3WF7A 2GNJA 2RFNA 4C57A 5K4JA 4XG6A 4W4WA 5EYKA 4XOYA 2WTKC 5HCXA 4I3ZA 2W5HA 3C4EA 4ZTNA 3HDMA 3ZFMA 3ORZA 5TO8A 1YW2A 1AQ1A 1YXXA 3F6XA 2CNVA 3MVHA 4XLVA 3NYOA 3V5PA 3QD0A 3MVLA 3GENA 3FZSA 1CKPA 3RNIA 3OTVA 5EI6A 4I4FA 4ID7A 5CT0A 5IMXA 1GZKA 3QGWA 4L01A 3UG1A 4DG3E 5B2LA 4D2TA 1U4DA 3CKWA 4FV0A 3NNVA 4OTDA 2IW6A 5IISA 3CQWA 3MV5A 2IZTA 4FTRA 2YZAA 3RK5A 4ACHA 3S1HA 1ERKA 3EKKA 2XIZA 3U6IA 1XH9A 5JZNA 2GSFA 3PLSA 2PVMA 2PVNA 4G31A 4GG7A 4KABA 3TUDA 4KSPA 4O81A 1M52A 2J50A 3FXWA 1VZOA 5JMSA 5IDPA 3LMHA 5BMMA 2PZYA 4B0GA 3GU6A 4P7EA 4NJDA 2Z7LA 3QUDA 1M7QA 4YHFA 4FSYA 4DG0E 5KBRA 3IKAA 4JX7A 3WOWA 2V22A 4XV9A 3FI3A 4AT4A 4E20A 1DS5A 1B6CB 4C7TA 3QCYA 4NKSA 3FQSA 3COKA 2ITTA 1H08A 3BWFA 4AW0A 4HGTA 2YERA 4AA5A 4USDA 4AE6A 4C3PA 3IOKA 5IQHA 5DEYA 2P33A 5M56A 2PYWA 4FT5A 2ZOQA 3DDPA 2C6KA 4XNEA 5IH5A 3LFQA 3L8SA 3UP7A 3HV7A 4ACCA 3IW7A 3QXOA 4WA9A 3MH0A 4YC3A 3UDBA 4DITA 4ZZOA 5LJJA 4X3FA 3UZTA 5CX9A 3W33A 3VS0A 2ETKA 3ZXZA 4BTMA 2CGXA 3DAEA 2F2UA 1ZYSA 3IW4A 4QMOA 4BDIA 1OBDA 2F7ZE 3FY2A 1ZMUA 4BCGA 5CVFA 1A06A 2FA2A 3PYYA 5K5XA 1CDKA 3NAYA 4IHPA 5AX3A 4G1WA 4HGLA 3HDNA 4BIDA 3EYGA 4OTHA 3UNZA 1KOAA 2BFYA 1JBPE 3R04A 4TL0A 2WPAA 4FKUA 4XP3A 1O6LA 5ETIA 2HXQA 4A4LA 2PUNA 3O23A 4ZLYA 1Z5MA 4AA4A 1DAYA 1DM2A 1Q4LA 1ZAOA 1M2RA 1H0VA 2B9JA 4PTCA 3ZRLA 5K5NA 4S2ZA 5EK7A 1RW8A 4LRKA 3ROCA 2DWBA 4FKVA 4TNBA 1ZXEA 3R2BA 4HGSA 3VF8A 4DTKA 5K0KA 4QP8A 3QHWA 5J87A 2O0UA 3R73A 2WTJA 4CV8A 3QYWA 4MK0A 3W16A 4R6VA 4L7SA 5EH0A 3HL7A 3OCSA 4UMRA 1OECA 1H25A 3FI2A 4FVRA 3C9WA 4G16A 3TJDA 1LR4A 4DG2E 5KNJA 4HZSA 5AAGA 3FI8A 4AOJA 5M55A 2ZM4A 3PY3A 4IC8A 4WBOA 3KC3A 4AZFA 4FV6A 4G5JA 3I60A 4PTGA 5DR2A 3MWUA 3DBQA 5FTQA 1H24A 3RINA 3WBLA 4XS2A 3S95A 1H0WA 4XG7A 4BHNA 4ZJVA 4BBMA 5A6NA 3FMHA 5AA9A 2JD5A 3FUPA 3PP1A 5GZ9A 3H0YA 1URWA 3UNJA 5DR6A 4CFUA 4ZLOA 5L2IA 4G34A 1U5RA 1KE7A 4XG9A 5M4IA 1H01A 2OK1A 3QTUA 2Y9QA 5DI1A 3GVUA 2BKKA 3MY1A 3LFBA 3WF8A 3HAVA 2B1PA 3H4JA 4JQ8A 4GIHA 3V5JA 2XJ2A 3QKMA 4CMOA 2I40A 5IMEA 2IZSA 3PY1A 4JX3A 3ZUUA 1GZ8A 3MW1A 3DU8A 4IB1A 3OUNB 4YGAA 4GT4A 4O0WA 3RHKA 4BIBA 1PJKA 4F64A 4DT8A 3POZA 2C0OA 4F0GA 4MBLA 2HXLA 2A1AB 3BHYA 3MVMA 4W8EA 4A9TA 4DINA 4FUXA 3EZVA 5DT4A 3W2PA 5BYYA 4HW7A 3FLWA 3A60A 3VBVA 5M53A 5E8WA 1KE5A 4F4PA 2B52A 5EDQA 1P5EA 3NIEA 4AS0A 2ACXA 4QQJA 5IEXA 2XK4A 4E8AA 2WKMA 1DI8A 4I1ZA 4IWDA 4DA5A 3HP2A 3KN6A 3BLRA 4II5A 2VV9A 3P23A 4BN1A 4ONAA 5LCJA 2VTRA 2G2FA 1XKKA 1PYXA 3V04A 4BCFA 3RBWA 3U55A 4FT7A 5FLFA 2XEYA 4BCQA 3SV0A 4V01A 3AC5A 4ZZMA 1CKIA 5FRIA 3VHKA 4MBJA 2BAQA 5BNJA 4MD8E 1JKLA 3FY0A 3JXWA 3BHUA 4D4SA 2XM8A 5A4LA 1PXOA 3R9RA 3AQVA 2Q0BA 2GU8A 4GCJA 3Q52A 4FTIA 4ZSEA 5LQFA 2CNUA 2HZIA 1BL7A 4E7WA 4RWIA 1JKKA 3HMNA 5J95A 3WILA 2BRGA 2WXVA 2YISA 4YBKA 5JQ5A 4IADA 1UWHA 4C4FA 4ZTRA 3WE4A 4FA2A 3QQFA 4I5CA 3OD6X 4NM3A 3NNXA 4FG9A 4QNYA 4LG4A 2B9FA 4YTIA 5AR5A 3UPXA 5ACKA 2ITVA 4G3CA 1JOWB 3TNQB 5A4CA 1G5SA 3VUTA 4DGMA 3UIXA 2PVRA 1I09A 4LRMA 1JLUE 2IVTA 4RIOA 4WUNA 1IAHA 3Q5IA 3E93A 4JBOA 3A62A 2C4GA 2F57A 2OH0E 2KULA 4DEBA 3VQUA 3BYOA 4WT6A 4DFNA 2Y6MA 2CCIA 3SXFA 4YJTA 2F9GA 1J3HA 2E9NA 3RZFA 4Z7HA 3AC8A 2B9HA 3NYNA 5H2UA 1TQMA 4MXXA 4BICA 4K6ZA 3E7VA 3KVXA 3AC1A 4CSVA 4YURA 4KBKA 4AFJA 3BGQA 5M08A 4BDEA 3MPAA 4RIXB 2PZIA 3KULA 1ZMWA 4GVAA 4RJ5A 5K3YA 2YIRA 4JDHA 4OUCA 4R5YA 5DVRA 3LLTA 4FSTA 5GZ8A 3WIGA 3DXQA 4YSMA 3KL8A 3WYXA 2XNEA 4B8MA 1P4FA 3H3CA 3IOPA 3KGAA 3DPKA 3W2CA 3WIKA 5C1QB 1FQ1B 3DKOA 5BUIA 5BPYA 3CTQA 4C3RA 3NAXA 4XRJA 4WHZA 5HORA 4FR4A 1APME 3CD8A 2Z8CA 4B8LA 5CALA 4HVDA 2ONLC 4O7ZA 1WVWA 2ITYA 3BPRA 3BRBA 3CE3A 4FIJA 3C4XA 1QL6A 4MQ1A 4X2JA 3WF6A 4ACMA 2JKKA 3D2KA 3GC7A 3R01A 3LOKA 4M13A 4AUAA 3BKBA 4R3CA 3UQCA 5ANDA 4F1MA 4JBVA 5ANGA 3DKGA 2QLUA 2WU7A 3HMPA 5F1ZA 5H8GA 3AD4A 1PMVA 2XK7A 3SA0A 3ZC6A 4D5HA 3GU7A 4AGDA 2BAJA 3PA3A 1W7HA 3PIZA 2YM8A 2UZDA 4M84A 4CT2A 4OTFA 2XK8A 4R7IA 2PE2A 5CANA 4WNOA 3PWDA 2VWYA 2WO6A 2ZV7A 2H34A 4ZXTA 2I0YA 5KMKA 2BFXA 3A4PA 1XWSA 3VBYA 4EQMA 5BVOA 2QOLA 4PTEA 4DFZE 2W7XA 3Q9ZA 3R02A 3FMLA 2BHHA 3AXWA 3E7OA 3ETAA 5FQDC 1OL1A 5J7BA 3ORMA 2CLQA 2J9MA 4U9AA 4Z3VA 2BHEA 3SW4A 2CNQA 4OBOA 2I0EA 3FEGA 4FEUA 1YWVA 3V3VA 2BDJA 2XNMA 1WVXA 3QRIA 5CWZA 4EHGA 4BF2A 3FQHA 5FDPA 5HU9A 2X2LA 4O7LA 3EL7A 4KD1A 2P2HA 1QMZA 5FM2A 4DBXA 4FEVA 4UX9A 4EOJA 4FKLA 2A19B 3U4WA 4EC8A 4RWLA 4J99A 3HV6A 5DG5A 4RC2A 2CLXA 1A9UA 4RA5A 5DYJA 4CQEA 3QC4A 4MAOA 2VAGA 3OEFX 3RPYA 3TACA 3DJ5A 4GW8A 3ZSGA 3AGMA 4YC6A 5TE0A 4LQMA 3RNYA 2UW9A 4HGEA 3Q4TA 2VX1A 3QAME 2PY3A 1E9HA 3A99A 2FO0A 3QTZA 4CFXA 2WMWA 4FKWA 2QKWB 2R7BA 4LRJA 3WZKA 2QOHA 2W1FA 5B2MA 5CVHA 4WNPA 3MH3A 2ITWA 2PMIA 4BI1A 4EK5A 3D15A 2WEIA 1ZARA 3F69A 3QRUA 3OC1A 4FKJA 2BIYA 1YDSE 3O8TA 4Y73A 2YJSA 3GOPA 5AA8A 3HA6A 2YIQA 2R3NA 2V0DA 3DBDA 3NEWA 4GFGA 4HPUE 5EFQA 4TRLA 4DEIA 5ANJA 4QMUA 3FJQE 4F6UA 4I5MA 3TM0A 2XNGA 4EEVA 4Y8DA 3Q96A 4DEHA 3EFWA 4C2VA 3MJ2A 4IFGA 5TT7A 2OBJA 3R8VA 4I0TA 3VS6A 4MF1A 4S32A 4U0IA 3CC6A 4GK2A 5AUWA 1Q62A 1E1XA 2ZMCA 4Q2AA 4EONA 2XUUA 3UVPA 3FV8A 3HMMA 4O82A 5I0BA 4R8QA 4Z16A 2XEZA 4Y95A 3D94A 3SAYA 4QMLA 2FVDA 3FSFA 4AOTA 4HZRA 5K4IA 3QD4A 5CU6A 3NIZA 4U40A 5LVOA 3Q60A 5EYCA 4O7TA 3DA6A 5IG1A 2AC5A 3VJNA 3FQEA 3JS2A 4OTPA 4CYJA 4X3FB 4LGDA 3EFKA 5CEOA 4MD9E 2QD9A 5L6OA 1R3CA 1P2AA 3W8QA 2BRBA 2C69A 2XK3A 4F7LA 2BDFA 4K9YA 4RC3A 5A4EA 5EQEA 1JSUA 3PXYA 4QMNA 2W9FB 2EVAA 3DOGA 3OG7A 4G6LA 3C4CA 2BR1A 4A9SA 2BTRA 4E5WA 3DLSA 4G6OA 3THBA 3VHEA 3R63A 4OLIA 5HCZA 5HICA 4GUEA 4DH1A 3HP5A 4D1SA 5AM6A 4I93A 4H3QA 4BY9E 4U79A 3PPJA 5LOHA 4JQ7A 2FSTX 5E8SA 5FXRA 4NM5A 2XYUA 4RQKA 4NW5A 4D28A 5EKNA 1XH4A 3L9MA 3NSZA 3TNIA 3F7WA 4EOQA 5KHXA 4QMZA 2C3IB 2XKEA 4BDDA 3IECA 3T9TA 3LFSA 2WTVA 3KQ7A 2YACA 4FTTA 4EZ5A 3UGCA 3K3IA 3PUPA 3LCDA 4EI4A 2I0HA 3KXGA 2X9EA 1PYEA 2HY0A 2UW6A 3MFUA 5JZJA 1MRVA 5HIBA 2PUUA 2X7FA 4HNIA 2ETRA 2HW7A 2RKUA 4FSQA 3UJGA 4E6CA 5CZIA 4TZRA 3L8PA 4WSYA 3ACKA 5HBHA 5HTIA 4ZK5A 2XKDA 4L9IA 4A7CA 2AC3A 5HVJA 3O8PA 4G6NA 2XJ0A 3A2CA 3D7TA 3R0TA 3QC9A 4R1YA 3RK9A 3ZLXA 4AGWA 3DGKA 5ACBC 2W96B 3UVRA 3TZ9A 2GTMA 2GQGA 4E5AX 2JDRA 4XP0A 2W9ZB 1PMNA 1K9AA 5I9ZA 2AYPA 4IWQA 4O7WA 5F95A 3FMNA 3OXZA 2VO0A 4YTFA 3W8LA 5AV1A 2C3LA 4CNHA 3WZJA 4MNFA 3LLAA 5HNIX 3ZLYA 3QWJA 5M4UA 1KSWA 2XH5A 5E92A 2OJJA 3N4VA 3ZO4A 4PPAA 5HESA 2WIPA 5EW3A 1JPAA 4IJPA 1Y57A 3ORIA 5FXSA 3QL8A 4C58A 1NY3A 2XJ1A 3VBQA 4J71A 4PL5A 3KREA 3LFDA 1Q24A 4IDVA 2XK9A 3PVWA 4FODA 3OBJA 4FSZA 2A2AA 3QGYA 4H36A 3FL4A 2BRNA 5CVGA 3UIUA 3LW0A 2A4LA 3FHRA 3QXPA 3BYSA 5A9UA 3DBFA 1H1QA 3GC0A 4FKRA 4RC4A 4KKEA 2C6EA 4PP7A 4YU2A 3FMJA 4ENYA 3LHJA 1YXSA 2OW3A 4RWKA 4ZEGA 3Q6WA 4MWHA 4Q5EA 3PVGA 5AV0A 3C4ZA 5CU3A 1XH8A 2GHMA 2QURA 2X0GA 2WB8A 5C8MA 4D0XA 4OTQA 1XH5A 5FDXA 2UZUE 2ZM1A 4LFIA 2WOUA 4RVTA 2CKQA 3DZOA 3A7GA 5CI6A 4F7JA 4IC7A 4ITHA 4K0YA 3NLBA 5CT7A 3LM0A 3CSVA 4QRCA 5J5SA 4HYHA 5J1WA 3IS5A 2H9VA 3DAKA 4YR8A 3PJ3A 1PKDA 2O5KA 3IGOA 3LCOA 4GEOA 5ITAA 4I0RA 2O8YA 3UO6A 4ZSAA 4C38A 4FKQA 2JLDA 4GG5A 5AADA 4CFMA 5F9EA 3W10A 3COHA 4J96A 4V04A 4PX6A 4RIYB 2XCKA 5FP6A 2H6DA 2OZAB 4EOKA 5DFPA 3D83A 3ZH8A 4RPVA 1OL2A 4D9TA 3KRJA 1ZOGA 5JN2A 2FB8A 1RQQA 2C6MA 4UV0A 3JVSA 5HGIA 5M06A 4RX7A 4EZ7A 5AFVA 2QC6A 4KBAA 3RPSA 1F5QA 4EOSA 1A48A 3RP9A 3FKNA 4NW6A 4DTBA 2B53A 3LFNA 5HCYA 4JOAA 4P2KA 2YCFA 4KWPA 2PHKA 4J1RA 2J51A 5EYDA 1I44A 2IG7A 3KKVA 2XP2A 4GL9A 3U87A 1NVQA 2WMAA 3SKCA 4IACA 5CAQA 3RJCA 5LVNA 4TNDA 4BYIA 1TVOA 4ENXA 2RIOA 4KSQA 3BLHA 4CT1A 5DE2A 5DBXA 1GJOA 5HO7A 3IDPA 3DKFA 5D7VA 3QTIA 3L8XA 4AA0A 4U7ZA 1R0EA 4FTOA 2QG5A 3FL5A 3H9FA 4QMTA 3OW3A 3UIBA 3PE1A 5EHLA 3BQCA 4QYGA 2VWBA 3O51A 4IB0A 3CGOA 3U51A 3VF9A 4KBCA 1PMUA 2CJMA 4L67A 2UZOA 1NVSA 2PVFA 3G51A 3KRXA 1ZYCA 2BKZA 4O0SA 3R9OA 2IZRA 4RX5A 4C8BA 3JY9A 3MIYA 3K5VA 4AZSA 4BKYA 3VVHA 3EOCA 3C1XA 2JDVA 4C02A 3MFRA 3TZ7A 4JIAA 4RA4A 2QO7A 3I0OA 3NUSA 4FTNA 4GT5A 3VBWA 4U44A 1JNKA 1HCLA 4FNYA 3HYHA 4AT5A 1UU8A 2ERZE 4CKRA 3VS5A 3MPTA 2OIQA 3F5XA 2YM3A 3PSDA 5CZHA 3TDVA 4D55A 1GIIA 1UA2A 4PL4A 5LXMA 3BQRA 4RMZA 4PPCA 2R0IA 4QP2A 4ZTLA 4AZWA 4S34A 1V0PA 1MUOA 4CMTA 1G8SA 1JQHA 3CCNA 5GZAA 3QUPA 1J7LA 4XUFA 3COIA 2PK9A 3DBCA 4YNOA 2BZIB 3D4QA 4LMUA 3UQGA 3ZBXA 4AWIA 4FGBA 5IA2A 4TKSA 3VQHA 3VJOA 3OWLA 4AG8A 4FEXA 5CNOA 1TQIA 4IX3A 4N57A 5CASA 4QP4A 4L3PA 4XBUA 4BZOA 1IEPA 5IDNA 4WOVA 4FV4A 2VN9A 3F82A 3HUBA 5CSWA 5JFVA 2P4IA 2YWVA 2WIHA 3OY1A 5L2WA 1DAWA 3MYGA 4L44A 4BGGA 4CKIA 4ANQA 5IPJA 2GS2A 2XYNA 4F70A 2OJGA 5AUYA 4U6RA 5DNRA 4EZ3A 2B55A 4JI9A 4O7YA 5JEBA 1UU3A 2XB7A 5IA5A 4EOIA 3ZOSA 2X4FA 2WTIA 4RJ4A 4HCTA 3TJCA 4YLLA 5AEPA 1CTPE 3QD2B 1L8TA 4FVPA 3EKNA 3KXNA 4AW5A 3U4UA 1OGUA 4NFNA 4QTAA 3QZFA 3VC4A 3I81A 3ZSIA 3QX2A 4QP7A 4J52A 1H00A 3JPVA 4EHVA 3R7EA 3AG9A 1PMEA 3T9IA 4O91A 2W1HA 4BTKA 3BE2A 3U6JA 2VX3A 3FXXA 2G01A 4RFZA 3UZPA 3V6SA 4O2PA 4TWCA 2CN8A 4FSRA 3DJ7A 4XRLA 5DRBA 3S2PA 1U54A 1ZMVA 5HG5A 1PXMA 2A0CX 4EOLA 4FL1A 5AP3A 5IA0A 2VGPA 2OSCA 4NIFA 3LCKA 4U80A 3LFAA 5AP1A 1Y6AA 2R3FA 5AUVA 3TV6A 4IBMA 4L8MA 3FLYA 4P4CA 5EHOA 3KCFA 4ZJJA 3VW6A 4CFFA 4FGRA 4APPA 3ZRKA 5CAPA 3ATTA 2WMRA 5LMKA 4O0TA 4UYNA 3QKLA 5EOLA 3ATSA 3UE4A 4MYGA 3VUDA 3K5UA 4J97A 2CSNA 5LARA 2V7OA 2VU3A 4OTRA 1KE6A 5FEDA 3ALOA 3QRKA 1YOJA 3Q5ZA 4LOPA 4HPTE 1B38A 3G90X 5ETAA 5G1XA 3RI1A 2R3KA 1YQJA 4ZIMA 5KMLA 4Y85A 3FZOA 5HX6A 3NUYA 3OOGA 2X1NA 2H8HA 2JBPA 5K0XA 3GUBA 2IN6A 4F7SA 4XBRA 4DLIA 4NUSA 4D2VA 4HVHA 3QLGA 2EXEA 4DFYA 3PIYA 4CXAA 4Z7GA 1J1BA 4EK3A 4FZ6A 5CXHA 4NT4A 3GI3A 1W83A 3Q3BA 1FVRA 4FK3A 1ZY4A 2J90A 3FSKA 2ZM3A 4EOOA 4PP9A 4XYFA 4LMNA 4EUTA 4IXPA 1H8FA 2XBJA 3I5NA 4HYUA 3GFEA 3WARA 3P7CA 4ASXA 4FOBA 4FTKA 4KB8A 4BTFA 4DGNA 2C5OA 4FL3A 3IG7A 4WUAA 3DB6A 4G3DA 4M69A 5DN3A 3GP0A 4G9RA 4I6BA 3E8CA 2ZYBA 4PMTA 3UO5A 3QZGA 5FP5A 3IW8A 4I6FA 4TYHA 1H27A 5H9BA 5TF9A 3FZTA 3TZ8A 1Z57A 2FH9A 5DGZA 2O3PA 3PXRA 2HIWA 4NM7A 4BWPA 2B7AA 3EFLA 2VWUA 4NTSA 4RSSA 5B2KA 3NVMB 2G9XA 1ZWSA 4RG0A 4YPSA 5LVLA 3LXKA 4EK6A 5EDRA 3I6WA 3R9DA 3PLAE 2R3IA 5DLSA 2E2BA 4PPBA 4XV2A 4F63A 1VJYA 1OBGA 5FUTA 2W4JA 4FT9A 3PXFA 4MEDA 4ZTMA 2UZTA 2JDOA 4FI1A 3FAAA 2EU9A 4AT3A 2EWAA 4EC9A 2GMXA 4H39A 4C4HA 4YSJA 4KKGA 5C9CA 2J0LA 4ERKA 1PXJA 2JEDA 5J79A 2XS0A 3LE6A 4LL0A 4N6ZA 1OIRA 3BV2A 1OVEA 3JYAA 4RX8A 3EB0A 3IDBA 4BBEA 4QTEA 4ZSLA 4IAKA 4MWIA 5AAFA 3V5LA 2V55A 1JSTA 4I6QA 4U45A 4EJ7A 2XK6A 4IW0A 4F1TA 3NYVA 2W05A 4G17A 2JAVA 2WFYA 1BUHA 3DQXA 4O38A 4X6RA 3P4KA 1PXNA 4GIIA 3BHHA 3QTRA 3P7BA 5HE3A 5IQIA 3HMIA 3OT8A 1CMKE 3C50A 3TEIA 1NVRA 3ZXTA 3UMWA 3I0QA 4U43A 3VULA 1UWJA 3DCVA 1GZNA 5FTOA 4C36A 1W0XC 2OGVA 3MTLA 4MBIA 4E3CA 3KN5A 4O0XA 3BCEA 1U46A 4EH2A 2WELA 4FNWA 3I5ZA 3FPQA 4YTHA 2YLFA 3VW8A 1Q8TA 5AV4A 4HVIA 3HRCA 1ZYJA 4IVBA 4AX8A 3AC4A 3G0EA 4HYSA 3M2WA 5K9IA 4TWOA 3DNEA 3K2LA 2W0JA 3NCGA 3KK8A 2W06A 1OI9A 3QZIA 4I20A 4XJ0A 4Y5QA 3O0GA 5T3QA 4U81A 3ID6C 4XMOA 4R5SA 3SDJA 3SOAA 4EQCA 4E4XA 2EB2A 4BC6A 1XBBA 3DY7A 3MFSA 3KF4A 2W4OA 4LGHA 5LCKA 3AC3A 4DFXE 1PRYA 2F2CB 4F9YA 2X8EA 3E3BX 3N4TA 3TTJA 1Q3DA 4TPTA 5GIOE 3OUKA 3ORXA 4P5ZA 1OPLA 5E1EA 5I9VA 3FDNA 4GS6A 3KMWA 3SXSA 5IKWA 4YZ9A 2F4JA 4MF0A 4DEAA 5CU2A 1WAKA 4X6QC 4TYIA 2OZOA 4AQCA 3BYUA 4NEUA 5EQPA 1G8AA 3AD6A 3KXXA 2GTNA 2F7XE 4QMWA 4AACA 2JDSA 4JAIA 1QPJA 5JGAA 2GCDA 5DR9A 4L46A 2C1AA 5JRQA 5KMJA 2WHBA 4CZUA 2QHNA 5E8YA 5FBOA 5CYIA 4FOCA 4M69B 5HX8A 2YM7A 3P08A 3VS2A 4KIPA 2ITXA 3GCPA 4USEA 2YAKA 3ZBFA 3ZLSA 5TKDA 4OW8A 2OI4X 4AF3A 4FSNA 4LM5A 4O1OA 1R78A 3R8UA 3ZDIA 2Y4IB 3LAUA 5EDPA 1SVHA 4CFVA 4EH8A 5DOSA 2UVXA 3EIDA 4KKHA 3R2YA 3CTHA 4BDFA 3TCPA 4PQNA 3F66A 4GFOA 1OUYA 3QZHA 5EG3A 2F7EE 4EL9A 4ANMA 3D5VA 2C6LA 4F1OA 1JKSA 4RIXA 4BI2A 4W4XA 5DRDA 1Q99A 3WF5A 3PG3A 4O2ZA 3OFMA 2GS7A 5FWKK 4ACDA 3E62A 4EQUA 1UVRA 2UW0A 1Q61A 3I6UA 3OP5A 4GSBA 4M68A 4R3PA 1OPKA 1OM1A 3R7UA 3FLNC 4MVFA 3REPA 4CRLA 3TKUA 1J7UA 4MHAA 3FXZA 3IPHA 4C61A 3RAWA 4X0MA 1UV5A 3BLQA 3MFTA 3HAMA 1S9IA 4GUBA 4D4YA 4XOZA 1H07A 3DQWA 3GC9A 3GCQA 4JRNA 5KKRC 2Z7RA 3DK7A 3OVVA 4NSTA 2PUIA 1W8CA 1YI4A 5M09A 1IRKA 5E7RA 4ZMFA 3QF9A 2YN8A 3ORNA 2HWPA 2PTKA 5F94A 3VBTA 4U41A 3B2WA 5H8EA 4A9UA 4N0SA 3FHIA 5EI8A 3R7OA 3EQHA 5CI7A 5D12A 4EORA 3SD0A 5EYMA 4R1VA 3E63A 1GIHA 4E6AA 4BCMA 3LFFA 4Q5HA 2WTWA 1REKA 2ZAZA 4RFYA 3RZBA 1XBCA 1FVTA 4USFA 4XEYA 2X8DA 4JXFA 2JKOA 3CLYA 3Q9XA 4MD7E 2ITZA 2HCKA 3Q4UA 4BL1A 2C5YA 3BYMA 3JR1A 2UZEA 5CF6A 4JG6A 2XNBA 1QPCA 3E64A 2Z60A 5EQYA 2AUHA 3IK3A 5AP5A 4A4XA 4X2FA 4YC8A 2R7IA 4RQVA 3EH9A 2OF4A 3PVUA 2PVYA 4IM0A 1SMHA 1YXTA 4CG9A 4FTLA 3M11A 2PU8A 4M15A 4C37A 1IAJA 4I23A 2Z2WA 3P5KA 5ANEA 5AUUA 5AAEA 3Q9WA 3FMEA 5HE0A 2GQRA 2SRCA 4O7SA 5C27A 2FUMA 2WMQA 4NH1A 1WBVA 5HO6A 1FGKA 1PXLA 3B8QA 4JJRA 3H9RA 5HHWA 5GJFA 2X9FA 4S30A 1TQPA 5AR2A 5C8NA 3MB7A 3UNKA 3AMBA 2C5XA 3BZ3A 1BMKA 2IVVA 3ORLA 3R8PA 4YBJA 5BX0A 4WKQA 4BR3A 3H9OA 3MA6A 3VWAA 4FKTA 4IAZA 4TWNA 3V51A 1UNLA 4Q9SA 4QMVA 4J53A 5E9EA 1FGIA 1YVJA 3EL8A 4Y5HA 5J1VA 2YDJA 4QT1A 2J4ZA 2VO6A 5TOZA 3E8EA 4YLJA 4O0UA 3DS6A 2JAMA 2UZLA 4HVSA 1K2PA 2YFXA 1PXKA 2JITA 3CTJA 5DPVA 5AJQA 4FVQA 5E1SA 3VBXA 5KUPA 4FK6A 3L9LA 3ACJA 3P9JA 4YJSA 4YJNA 5CLPA 3OZ6A 3ZHPC 3OW4A 3R1QA 4IB3A 4LL5A 3SGCA 3HUCA 3PXKA 2R3LA 3HEGA 1Q8UA 4JIKA 3R7YA 3UQFA 2UZWE 4XG4A 3C4WA 4QTBA 2BILB 4NM0A 5DEWA 5IQBA 4O27B 2GNLA 4BB4A 5BVFA 2ITUA 2O63A 2QOKA 3E8NA 5JSMA 4WG3A 4DH8A 3V8TA 4DFBA 3KFAA 5HLNA 2KTYA 1WBSA 4K77A 4TWPA 5FG8A 3OROA 4TTHB 2B0QA 3KB7A 3QQGA 4ZAUA 3LZBA 1RE8A 3GU4A 3R00A 3V01A 3NUXA 2VGOA 3Q2MA 5M51A 2R9SA 3R21A 1GNGA 4L68A 3RHXA 2X2KA 4OR5A 2PUPA 2W99B 3TNPC 4PY1A 3CJFA 3NW6A 3B2TA 3TL8A 4CLIA 3CR0A 3QCQA 4F9AA 1M14A 2YCSA 1W98A 4BWKA 3G0FA 1Y6BA 2ZDTA 3RCDA 4X2KA 1HOWA 5AP7A 5HTBA 1YOMA 2XIYA 3EN4A 4MTAA 3RCJA 3VUHA 2J0KA 3VUGA 3F88A 4FNZA 3EJ1A 3L9NA 5I9WA 4C62A 4DGLC 4V05A 3Q32A 3NR9A 3NGAA 3W2RA 2PULA 5CSHA 4ANBA 3IQ7A 3O71A 3SX9A 5EOBA 2VNYA 1WCCA 4E1ZA 5ICPA 3BELA 2IVUA 3E8DA 4TYEA 3CBLA 3H0ZA 3EQCA 1XH7A 2C1BA 5DA3A 3U9CA 5CEPA 3R7GA 2CKPA 1ZY5A 4DYMA 4L6QA 2NNWB 5J9ZA 3M42A 1P14A 1SZMA 3LXPA 5HOAA 2E9UA 4KIOA 4DAWA 4N6YA 5JFSA 4G3FA 4DCAA 4NYEA 3PPKA 1F0QA 2R3MA 4FTJA 1H26A 3DB8A 2OIBA 3IONA 3OHTA 2J2IB 4QYYA 2OO8X 4IX6A 1MRYA 3KMMA 5JQ8A 2J0MB 2VWZA 3O50A 4IB5A 4YZDA 3MS9A 5L6PA 1R1WA 4IQ6A 1OITA 1ATPE 4FIEA 4MXZA 3DXPA 3JVRA 4AU8A 1OPJA 3OWPA 3UIMA 4ZOGA 2PWLA 4NU1A 4FG8A 1CSNA 2LGCA 5C8KA 4FTMA 3TDWA 4CEGA 4HJOA 3W2SA 4YPDA 2R3JA 4WRGA 3WZUA 3ZUTA 3QUEA 4BDCA 3BHVA 4DBNA 1OIQA 4UALA 4CQGA 4Y72A 4KUJA 1FOTA 2GNHA 4RJ7A 2Q0NA 2GPHA 4CV9A 5TR6A 2PVKA 4IM3A 4BKJA 4OTWA 2Z7SA 4I4EA 4PL3A 4KAOA 4QYHA 3SW7A 3W2OA 4O7RA 4DE4A 2ZJWA 4QP1A 2HOGA 3OWKA 4D2PA 3Q04A 4O0RA 5EKOA 2G2IA 4N70A 4RBLA 3KU2A 3EMGA 4QMMA 4JS8A 1ZOEA 3NPCA 3W2QA 3W18A 2QG7A 4F9WA 2VTQA 2PVLA 1M2QA 3D5UA 2RL5A 1LEWA 1UNHA 3C51A 3BWJA 5A46A 2WMBA 5HG7A 4YUQA 1GAGA 3A8XA 3KXMA 4YJOA 2WQNA 3C13A 4FT3A 4U5JA 1H4LA 3EQPA 3T8OA 1Y8GA 2VD5A 2VWIA 1SM2A 3K3JA 4O1PA 3RAHA 5KZ0A 3P1AA 3A7HA 3R71A 1VR2A 4UMTA 1JKTA 1XJDA 5KBQA 3GCSA 5AR4A 3TT0A 4KS7A 4U3ZA 2OXXA 3NS9A 2C6IA 5HLPA 4AXAA 4FV2A 2ITPA 3ZCLA 1U5QA 4U42A 1OIYA 2DUVA 3NNWA 4CFWA 5CNNA 4KIKB 3HNGA 4FMQA 2VTTA 4UEUA 5CSVA 4FIHA 3Q6UA 3DKCA 4MXCA 3POOA 4G3GA 4MH7A 4RZWA 4S31A 2E9OA 4LV8A 4M0YA 3P0MA 3ITZA 3DT1A 5AIRA 2G15A 5JH6A 3SRVA 3ZDUA 4ZLZA 2WMUA 5IQGA 4FSMA 2P0CA 1WVYA 3ORKA 4V0GA 2VTOA 3SLSA 3C0HA 4FKPA 4APCA 5J7HA 3G33A 4BZDA 4IVAA 4QNAA 3UO4A 4CTBA 2WTCA 4QMYA 5IF1A 3W32A 4IMYA 1CKJA 5IUGA 3QA0A 4TY1A 4U3YA 4XP2A 4EYMA 3A7IA 3VS7A 3HV4A 1Q3WA 3BYVA 3DTWA 4DF3A 3BHTA 3MA3A 4EH9A 5LMKC 4HCVA 4QPSA 2C68A 3FLSA 5C01A 5KHWA 4E4MA 1YWNA 3FMMA 2XRUA 3BU5A 3FZPA 2B4SB 3QTXA 4BBFA 4BCNA 4KIKA 2G1TA 3ZYAA 2VZ6A 3F2RA 4F9BA 5CEKA 2PE1A 3Q53A 4PRJA 1H1RA 4DGOA 4UN0C 5C4KA 4D2RA 1BYGA 4OBQA 3HV3A 4JRVA 3ZM4A 5HVYA 3JY0A 5FD2A 5JFWA 1O9UA 4PNKA 3FLQA 3UOHA 3T3VA 4UXQA 4LUEA 4EJNA 2BZHB 4QP6A 5HU3A 5BYZA 4BDJA 2GFSA 4JVGA 5AIKA 4I5HA 3U54A 2WGJA 1NXKA 3AMYA 1WBTA 1E1VA 2R5TA 3DBEA 4YZMA 2O64A 1Q8YA 1W84A 4D4RA 3IDCA 3LMGA 4EKLA 1P4OA 4M97A 3UOJA 4MXYA 3LFCA 3TIZA 4A4OA 4F09A 2OIDA 5HBEA 4ZTSA 1GOLA 2QI8A 5A6OA 4GKHA 5KZIA 5IQAA 2WQEA 4BFMA 2EUFB 1SNXA 3N9XA 4PUZA 3LPBA 3NZ0A 3ZO2A 4E6DA 3QCXA 5DMZA 2PPQA 1U54B 4O83A 2JIVA 2WQBA 4GK3A 3RTPA 4Z55A 1R39A 4F6SA 3UPZA 1WFCA 4EH6A 1OL7A 2RFEA 4E93A 2QR8A 3BBTB 4C35A 3N4UA 3CPCA 3R9NA 4LI5A 4YZCA 2VWWA 3LJ2A 2PL0A 1YHWA 3I4BA 1YKRA 2C3JA 3PVBA 3ROYA 2JFMA 3QTQA 4ITJA 2Y8OA 3ZFXA 3D14A 3I7CA 2JFLA 2OFVA 2GNFA 4ASEA 2VTIA 4QMXA 5EHYA 4IZYA 3VUIA 4UZHA 2GS6A 5KMMA 3EN6A 5IEVA 1Z9XA 4UMQA 4BVUA 4Y83A 3G15A 3QQJA 3PG1A 4K1BA 5M07A 2GQSA 3LVPA 4FNXA 3QA8A 1H1PA 2XIRA 3RALA 3VAPA 3OBGA 5AR8A 2R3HA 2R3GA 5I5ZA 3MTFA 3TZMA 4TT7A 5BYLA 5IUIA 2QLQA 5EM8A 3ENMA 3GEQA 2IW9A 2VNWA 1URCA 2VO3A 4QD6A 2XNPA 1EH4A 1MQ4A 1BI7A 3DAJA 5D1JA 2ZMDA 4ZJIA 1L3RE 3R7IA 1ND4A 4FV1A 4B4LA 4DT9A 4KIQA 2HENA 3PSBA 3LFEA 5IQDA 3QQHA 4CD0A 5AP2A 3ZTXA 2NO3A 2R64A 4M12A 4PF4A 1NA7A 2BRHA 2QR7A 3FYKX 5BUJA 3F61A 4E73A 4WRSA 3O96A 3TWJA 4QP3A 4OT6A 3C4FA 5A4TA 3ZSHA 4ASDA 5CAVA 4GFMA 5DT0A 5KCVA 2VRXA 4QPAA 2ZV8A 2R0UA 2VTAA 3NDMA 1ZRZA 3MDYA 1WBWA 1LUFA 4NCTA 3TXOA 1F3MC 1FINA 4AZVA 2GFCA 4W9XA 1JVPP 2OH4A 4EH7A 4K18A 4DH5A 5IA1A 4TYHB 2C5VA 2UVYA 3PTGA 3PSCA 2YITA 4R3RA 2W4KA 4FTUA 3D7ZA 3MH1A 5AWMA 3SXRA 2GNGA 3O7LB 2QVSE 5CXZA 5KMOA 2YM4A 3R22A 3PZHA 4OT5A 3QKKA 4IZ7A 3LMIA 2YWPA 4QO9A 4BRXA 2XMYA 1JWHA 3QWKA 3EQRA 4MKCA 1YHVA 4AGCA 3ORTA 2BTSA 4DN5A 1FMOE 3KULB 4QYFA 4PMSA 3O7LD 2EXMA 4BCJA 4RLKA 4BDKA 3OCTA 2IO6A 4RVMA 4IAIA 4J8MA 2V5QA 1LEZA 3WE8A 4LV5A 2UUEA 4RWJA 4DLJA 4ZY5A 1IG1A 5LWMA 1VEBA 2XKCA 3SOCA 4JR3A 5CEQA 2BROA 4O6EA 3PIXA 2Q83A 4L43A 4F0IA 4IFCA 5AM7A 4KRDA 5HG9A 2YDKA 4ZZNA 3C5UA 3F3UA 1QPEA 5C03A 3UOLA 3BBWA 4PMPA 4NTTA 4AOIA 3TV4A 3BX5A 4F08A 4UBAA 3NYXA 4J7BA 5CS6A 3PXQA 5AR7A 5KMNA 4H3PA 5JFXA 3PFQA 4CZTA 2VUWA 3EQIA 4W9WA 4JQEA 4L52A 4IVCA 4ZMEA 4UMPA 2IVSA 1SVGA 2W1CA 2QOQA 3HLLA 4EH4A 2OF2A 3V5TA 4JL9A 1T46A 2XM9A 3NX8A 3OOMA 4QMSA 4J8NA 3UTOA 2Z7QA 4JG8A 3CJGA 4X3FC 4AAAA 1FVVA 4ITIA 3L1SA 2ITNA 1KOBA 4M3QA 3SC1A 4RIYA 2X4ZA 2QOCA 3LCTA 4H3BA 1B39A 3ERKA 3EZRA 3KVWA 3AGLA 4WG5A 2VO7A 2OXDA 4B9DA 3F3ZA 2YAAA 2HAKA 1G3NA 3EN7A 3QTWA 2EB3A 2PVJA 4Q9ZA 3OTUA 3EQDA 2R3RA 1Q8WA 3ZMMA 1ZYLA 4KINA 4WNKA 4F99A 4ZTQA 4PMMA 4IZ5A 3ZFYA 1W82A 4N4SA 4XG3A 2CKOA 4AZTA 5HI2A 4U97A 3KXZA 3NWWA 3FMDA 2YM6A 4A06A 1GY3A 2R2PA 2CPKE 4G2FA 1V1KA 3CQUA 5J5TA 2PVHA 5FBNC 1PXPA 4FTCA 4IX5A 4FZAB 3PRIA 5A3XA 2BRMA 4EOPA 4YJPA 4J95A 4ZY6A 2ITOA 4FSWA 3C7QA 4ZY4A 5L2TA 2HZ4A 3KA0A 2VTMA 3DZQA 5CF4A 3WZDA 1YOLA 5AUXA 3AT4A 3EQFA 3PWYA 4ZS4A 2VWXA 3V5QA 5EI2A 4IE9A 1TKIA 3KCKA 5BMSA 3SG8A 2OICA 2OU7A 3ODZX 3CIKA 4L45A 4K8AA 3II5A 4CRSA 5LVMA 1KUTA 4JDJA 4D1XA 4TXCA 2WMTA 5AP4A 4IAYA 1NT2A 4DHFA 3F5UA 2OLCA 5IQEA 3KXHA 4A9RA 3ZS5A 3SQQA 3GQIA 1J1CA 3F9NA 4P90A 2HYYA 2VTSA 5AUZA 4DH3A 1JAMA 3OEZA 5ANIA 3LKMA 3BV3A 4K2RA 5D11A 2QO9A 3HZTA 1NW1A 2W5AA 4RFMA 3IW6A 3TV7A 3LQ3A 3V5WA 4WIHA 4CZYB 4BTJA 3R7VA 3MPMA 3ELJA 5DIAA 3HVCA 5HG8A 1R0PA 2QO2A 4D2WA 4WBBB 3GFWA 3V6RA 5AP0A 3BEAA 3GB2A 4RT7A 4UMUA 2OWBA 2XKFA 3QX4A 4CCBA 3C5IA 2QOFA 3DK6A 3ANQA 2QU6A 5CSPA 5HE1A 3O8UA 3SHEA 5BQ0A 2O65A 2XA4A 3RAKA 3HKOA 5HIEA 4C3FA 3OY3A 4FEWA 2YDIA 4I21A 3HX4A 3P79A 4O7VA 3P78A 2JKQA 2JKMA 3WF9A 1OIUA 5GINE 1STCE 3LXNA 3G2FA 2C0IA 4KA3A 2HZ0A 4DCEA 5AP6A 4P5QA 5ETCA 2DYLA 1QPDA 3FPMA 3Q9YA 3RVGA 5M4CA 1WBPA 3QRJA 5D9HA 4DFLA 4QQTA 4CGAA 3DJ6A 3ZO1A 4TYGA 4BDAA 3BI6A 1PKGA 3DK3A 2J0IA 3OT3A 4IVDA 4RIWA 4X21A 5L4QA 3DDQA 1WBOA 1OZ1A 4JR7A 1IASA 4UY9A 4AN2A 3ULZA 4EHZA 2CKEA 4Z9LA 4CG8A 2YM5A 3CPBA 2QKRA 3NW5A 2GHGA 3MB6A 3W55A 3HV5A 3AT3A 4YO4A 2Z02A 4HCUA 4XG2A 3R8MA 1UU9A 5KX8A 3C0GA 1BL6A 4KS8A 3R8ZA 3FWQA 4JG7A 3HRBA 5IEYA 1Q41A 2W1IA 2J0JA 2OJIA 4IH8A 2XIKA 2XIXA 5J9YA 3OMVA 4NCTC 1IA8A 4EBWA 4CVAA 5M57A 3HMOA 4IANA 2X6DA 2JIUA 4PNIA 2NP8A 3ZEPA 3RKBA 1UKHA 4FYOA 1CM8A 2FGIA 2YCRA 3UP2A 3V8WA 2HWOA 2X7OA 4RVLA 2BAKA 2OZAA 4GYGA 5HKMA 2Y6OA 5EW8A 3DXNA 4C4JA 5M44A 1MQBA 3R8LA 5J9LA 3E88A 1X8BA 3GXLA 1IR3A 3R1NA 4C4EA 4JLCA 4EOMA 3TI1A 5ANKA 1UKIA 4WG4A 3FC1X 4PDSA 3KRLA 3LJ1A 4FG7A 5DH3A 4R78A 3H30A 4JDKA 5CQUA 4H05A 4YTCA 4DH7A 5DWRA 2Y4PA 3NRMA 3OXIA 3R6XA 4MXOA 2BZKB 2JDTA 3RPRA 3U9NA 3MH2A 3F3TA 3E87A 4O84A 4MNEB 2HZNA 2VTPA 5D7AA 2UVZA 3LXLA 5CU0A 5CTPA 3FLZA 5FTGA 4BI0A 4GK4A 4F6WA 3P86A 4AP7A 4B7TA 4GH2A 4C34A 3COMA 3LM5A 4OTIA 2W5BA 2RF9A 1H1SA 4WD5A 1ZYDA 4EKKA 2BVAA 3S3IA 2CGWA 3GU8A 1SYKA 2GDOA 3D9VA 4LUDA 3TG1A 5JGDA 4G9CA 1O6KA 4X2NA 4AFEA 4CTCA 3RM7A 5IUHA 5M4FA 3VN9A 3TUBA 1GZOA 2R3OA 3PP0A 5I9YA 4DTAA 5IU2A 5AR3A 5AV2A 3PXZA 4MX9A 3QCSA 3P7AA 1YI6A 2VWVA 4AGUA 1BI8A 3RWPA 3MBLA 4YJVA 3F2AA 4R77A 3PA5A 1PW2A 3FKLA 5AMNA 5E91A 5HD7A 4BIEA 5B7VA 2UW7A 4B6LA 1ZOHA 1OKYA 4EWHA 3GU5A 3MVJA 2X8IA 3G9NA 1S9JA 2V62A 4O0YA 3WYYA 4MNEA 2W17A 4FEQA 5HBJA 3FI4A 5T6KA 5KO1A 4ORKA 1H1WA 4BCIA 3FZRA 3UODA 4BDHA 4BCKA 1REJA 2HW6A 2WMSA 4LGGA 4RJ3A 1M7NA 3NUUA 2YZLA 3IGGA 4E26A 4XG8A 4FZFB 4FV7A 1OMWA 4ZTHA 2OG8A 4HYIA 4MQ2A 4UWYA 4XLIA 3QQUA 3EQGA 4FZDB 2LAVA 2YIXA 5LMAA 2YA9A 2IWIA 4QPMA 4XV1A 5IH4A 5C4LA 2QOOA 2E9VA 2YIWA 2Y0AA 4YJRA 3F2NA 2JBOA 3NCZA 3QRTA 4D5KA 5LMBA 2C3KA 5EM7A 3NW7A 4A9YA 2ESMA 4QQCA 3O17A 4X7QA 3OXTA 3Q2JA 5KMIA 1PF8A 2UV2A 3GBZA 3ORPA 1YWRA 2W1DA 2OXYA 1IA9A 4FKIA 4AE9A 3SG9A 4JNWA 2HY81 4BYJA 4NL0A 1YXVA 4G3EA 2RGPA 3I79A 2VTLA 2XF0A 4FKOA 1ZZLA 3ZUVA 3U6HA 4L42A 4H58A 4E5BA 1XH6A 3MN3A 4GV1A 4JDIA 5DT3A 3ZC5A 2ZV9A 4DFUA 4FIIA 2XNNA 3AMAA 3UZRA 4FBXA 4EUUA 4OAUC 5BVNA 1M2PA 2Y7JA 3UVQA 3GT8A 4EK4A 4FSUA 2OKRA 2ZB0A 4E6QA 3ZEWA 2QCSA 5E8XA 3DLZA 2YLEA 5D10A 4GVJA 4O0VA 4UWBA 3TN8A 5EM5A 4CYIA 3MESA 4H1JA 4YO6A 4BCHA 1MRUA 4FIFA 5B0XA 3EYHA 4AW2A 4FYNA 3A8WA 5BVKA 4EWQA 2ONLA 4L7FA 1FBNA 4WSQA 4YHJA 5I3OA 3H10A 2ZB1A 4NIFB 5LWNA 3RK7A 5KE0A 5GIPE 4GYIA 3BEGA 3DV3A 5CEMA 2YABA 5BVEA 3TUCA 1Q5KA 3ZU7A 1KV1A 5H8BA 2P55A 2QONA 3F5GA 2UZVA 2YHVA 2XZSA 1QCFA 3A61A 5L8LA 3ZONA 4IWPA 4PDYA 1RDQE 3VS3A 5FEEA 2IZUA 4UZDA 3ET7A 2BMCA 4YZNA 3GCUA 4L00A 4C4IA 1OKVA 2C47A 4NZWB 4M66A 4C59A 4MCVA 2PZRA 4BGQA 3AD5A 2UZNA 2NRUA 4GRBA 3GC8A 4GJ3A 3MJ1A 2PMLX 3EFJA 4YHTA 2GNIA 5BUEA 2J6MA 3RPVA 5BVDA 2QNJA 3M1SA 3FMKA 1M17A 4H1MA 4JAJA 3D2IA 5KKRB 3NUPA 4FE2A 2WEVA 1Y91A 4IIRA 4YNEA 3FZ1A 3LCSA 5IQCA 4OTGA 2WMXA 2X39A 4M7IA 2IW8A 3OCBA 5A54A 2B9IA 4D0WA 3FE3A 5JKGA 3PDTA 4CMUA 2QU5A 2YJRA 2G2HA 2UW8A 3CXWA 2W1GA 2VX0A 3BU6A 3ANRA 2J5FA 2CCHA 2J7TA 4FICA 4L53A 2WD1A 4C33A 5L3AA 3ZLWA 3UYSA 2UZBA 5HQ0A 4FT0A 5G6VA 3MY0A 4IEBA 4NFMA 1ZLTA 4D1ZA 3F5PA 4K33A 4GKIA 4MXAA 2BZJA 3D0EA 3R1YA 4O6LA 3RPOA 2W1ZA 5HE2A 4W4YA 4IAAA 4AN9A 2QOIA 3GGFA 3OWJA 4ALUA 1U59A 5FXQA 3QYZA 3LIJA 2BCJA 2X6EA 4RJ8A 2WU6A 4ACGA 5E8UA 3QALE 4I22A 1FMKA 3G6HA 4E4LA 3G5DA 3PPZA 4ZS0A 2WOTA 5GNKA 4ALWA 4LOQA 4ANSA 5CENA 4YMJA 4M0ZA 5L8JA 3VRZA 4R7BA 4TYJA 4QYEA 2R4BA 4JT3A 4X3JA 2C0TA 1BKXA 4IAFA 4FV8A 4RRVA 5EW9A 3D7TB 5CAUA 2I7QA 4PV0A 2WQOA 3PJ1A 3F3VA 3RMFA
chains in the Genus database with same CATH superfamily
4BWXA 1LP4A 5HNBA 5H3QA 3PJ2A 1RJBA 3SVVA 3WZEA 4EH3A 4YLKA 3RGFA 2CGVA 1UU7A 1SVEA 3JUHA 3LQ8A 3A4OX 4EYJA 2JIIA 2BPMA 1AD5A 3I1AA 3K54A 1V0OA 5JK3A 4I94A 5FGKA 4CLJA 2XVDA 3AT2A 5E8TA 3IO7A 2HK5A 2IJMA 5HO8A 4L3LA 3HGKA 4DEEA 3EHAA 3TNWA 3MSSA 3CD3A 1Q97A 3GQLA 3NUNA 3EQBA 3KY2A 3NUAA 4ZSJA 2OJ9A 3EWHA 4NKAA 3CP9A 4AN3A 2C6TA 3CKXA 2HELA 3PJ8A 4I6HA 1ZZ2A 4D58A 4JBPA 2C6OA 2ERKA 2WTKB 3PA4A 4I24A 2QOBA 2REIA 4C2WA 3A7JA 4X2GA 1HCKA 2C30A 4YJQA 2RFSA 2ZDUA 3KF7A 3C0IA 5I3RA 4FV5A 3R83A 4FV3A 3LQ5A 4OBPA 3MGYA 5GHVA 3PRFA 3ODYX 1KE9A 2A98A 2OFUA 4CKJA 3UG2A 3O2MA 2RG5A 4RX9A 1GIJA 4I5PA 4YZBA 3R28A 4PDOA 4RLLA 3OF0A 5GJGA 5L2QA 4I41A 3E92A 5ETFA 4FX3A 5HLWA 4XHKB 2PMOX 2C6DA 2IPXA 1KWPA 3QQKA 3TMOA 2P3GX 4UB7A 4ERWA 2E9PA 2GHLA 3ULIA 3L8VA 5C26A 3RAIA 4GJ2A 3CGFA 3GOKA 3E3PA 3G6GA 5AV3A 1YHSA 5HEZA 4HVGA 2Y4IC 1XBAA 4FL2A 3DNDA 4IX4A 2WQMA 1Q8ZA 3QBNA 3CY3A 3WI6A 2WZJA 4K11A 1AGWA 3DTCA 5CY3A 4O7NA 4DDGA 3CQEA 4RJ6A 4OGRA 1OL6A 1SNUA 2UW5A 3D5XA 3KRRA 3BGPA 4I0SA 4UWCA 3VIDA 4ARKA 3ZM9A 1OKZA 2OJFE 4QMQA 3HECA 3UBDA 4XH6A 4FTQA 1JSVA 5CQWA 2O2UA 2YCQA 2XNOA 4FV9A 2XRWA 4J98A 4EHEA 4IDTA 4HOKA 4F9CA 3QQLA 4QTCA 5EM6A 3ZZEA 3EN5A 5BVWA 1UNGA 3UMXA 4AXCA 3L9PA 3VS4A 2ZVAA 3KEXA 3MI9A 1YDTE 4M14A 4DDIA 2CHLA 2NRYA 4AW1A 5IZFA 4BDBA 2W1EA 3W1FA 4CFNA 1FPUA 4NK9A 4DEGA 3T3UA 4BZNA 3GNIB 5I9XA 2ETMA 2X81A 4WNMA 1YXUA 2BUJA 2H96A 3KK9A 4D2SA 5CAOA 4FF8A 5IA3A 3DFCB 3S4QA 2BALA 2WMVA 4YP8A 2P2IA 3RM6A 3FYJX 1VYWA 4O96A 3UC4A 2FSLX 4UXLA 5E8VA 3PY0A 1WZYA 3Q4ZA 3Q4CA 2DQ7X 4W8DA 3BU3A 4FIGA 1KV2A 3AC2A 1DI9A 5HD4A 3NMUF 3R30A 3ALNA 3F7ZA 5CU4A 4BKZA 2XARA 2X7GA 1PY5A 4R7HA 3UOKA 5E90A 3NNUA 4OAVB 3A7FA 2NPQA 4FC0A 2JC6A 5J8IA 3S00A 3F3WA 2FSMX 1TFFA 4CCUA 4O21A 1BX6A 2XBAA 5IA4A 3PJCA 1WBNA 4QOXA 4IZAA 5I4NA 4BDGA 3UYTA 3EN9A 5HVKA 3QHRA 2VTHA 4RZVA 4UYAA 3BIZA 3VNTA 2RSVA 3G9LX 5L6WL 4C0TA 4LOOA 5GJDA 1YDRE 3ZRMA 4FKGA 4ALVA 4GMYA 4TN6A 4ANOA 2CGUA 4PWNA 1YRPA 1WMKA 2R3PA 3CY2A 3LJ0A 5E8ZA 3RWQA 5AUTA 3ZZWA 4BCPA 3PZEA 2FYSA 4QQ5A 4GU9A 4XX9A 3QD3A 4E4NA 1XQZA 5FEQA 5JRSA 4FTAA 4ZSGA 5I9UA 5HTCA 5D41A 4ASZA 2F49A 3ZO3A 2PZPA 4LYNA 4F0FA 3QLFA 2UW4A 3QU0A 4O86A 4XCUA 1Y8YA 2DS1A 4FKSA 2EXCX 3OS3A 2AEGA 4A07A 3VO3A 5CF5A 3GCVA 4L3JA 2QQ7A 3CEKA 5CSXA 3I7BA 5HIDA 3VUKA 4AZEA 3QFVA 3OCGA 1W2CA 2V7AA 5T68A 3E5AA 3S0OA 3AOXA 3KMUA 3TNHA 3U8WA 4NJ3A 4ANLA 5F20A 5AX9A 2I0VA 2PZ5A 4ANNA 1K3AA 1KE8A 2CDZA 4EK8A 5HZNA 5L8KA 2VTJA 2YIYA 3KRWA 3UC3A 2NYAA 3R9HA 4EH5A 3MIAA 4D9UA 3R1SA 5ANOA 5E4HA 2B54A 3IW5A 2CN5A 4NWMA 1H28A 4GT3A 4DGGA 1BLXA 1OL5A 4QP9A 2WNTA 4GU6A 4F65A 3QTSA 1ST4A 5FM3A 3TTIA 2PSQA 1TZDA 3PE2A 3NVKI 5HNGA 4EBVA 3TKHA 4IM2A 4WO5A 4C4GA 4FUYA 3MY5A 2X2MA 4RIWB 4RVKA 2WTDA 4B99A 2UW3A 3B8RA 3FC2A 1OB3A 3HA8A 5L2SA 3D5WA 1OUKA 2RG6A 5DHJA 2XCHA 2JGZA 2QODA 4JBQA 5CEIA 2BIKB 4F7NA 4Y46A 5A4QA 2RFDA 3N51A 2I1MA 2QHMA 5IH6A 3TIYA 2FSOX 4U8ZA 1J91A 1OKWA 2R3QA 5IQFA 1MP8A 4I92A 4TW9A 2I6LA 5F4NA 4M8TA 4FZ7A 3BE9A 3VRYA 4W4VA 4V0GB 3SRVB 2PMNX 3TYKA 1XO2B 4S33A 4DEDA 4QMPA 1T45A 5JGBA 4XV3A 1V0BA 2A27A 3HRFA 4BHZA 4IWOA 4YJUA 4G5PA 5JT2A 3ENHA 2YEXA 4BGHA 3FBVA 4QTDA 2VTNA 5CF8A 2C5NA 1LPUA 1XHAA 3FKOA 4IJ9A 4O22A 4KNBA 3TKIA 4D4VA 5A14A 4HNFA 4M67A 1O6YA 2J5EA 3V8SA 1VYZA 1J7IA 1PHKA 2CMWA 5LVPA 1PXIA 3CS9A 3VUMA 3VS1A 4BCOA 4DC2A 3DFAA 2PE0A 4ZP5A 1YI3A 2ZV2A 4PDPA 4KRCA 2BDWA 3BGZA 1XR1A 2WAJA 4RGJA 2ITQA 3WF7A 2GNJA 2RFNA 4C57A 5K4JA 4XG6A 4W4WA 5EYKA 4XOYA 2WTKC 5HCXA 4I3ZA 2W5HA 3C4EA 4ZTNA 3HDMA 3ZFMA 3ORZA 5TO8A 1YW2A 1AQ1A 1YXXA 3F6XA 2CNVA 3MVHA 4XLVA 3NYOA 3V5PA 3QD0A 3MVLA 3GENA 3FZSA 1CKPA 3RNIA 3OTVA 5EI6A 4I4FA 4ID7A 5CT0A 5IMXA 1GZKA 3QGWA 4L01A 3UG1A 4DG3E 5B2LA 4D2TA 1U4DA 3CKWA 4FV0A 3NNVA 4OTDA 2IW6A 5IISA 3CQWA 3MV5A 2IZTA 4FTRA 2YZAA 3RK5A 4ACHA 3S1HA 1ERKA 3PUFC 3EKKA 2XIZA 3U6IA 1XH9A 5JZNA 2GSFA 3PLSA 2PVMA 2PVNA 4G31A 4GG7A 4KABA 3TUDA 4KSPA 4O81A 1M52A 2J50A 3FXWA 1VZOA 5JMSA 5IDPA 3LMHA 5BMMA 2PZYA 4B0GA 3GU6A 4P7EA 4NJDA 4AQKA 2Z7LA 3QUDA 1M7QA 4YHFA 4FSYA 4DG0E 5KBRA 3IKAA 4JX7A 3WOWA 2V22A 4XV9A 3FI3A 4AT4A 4E20A 1DS5A 1B6CB 4C7TA 3QCYA 4NKSA 3FQSA 3COKA 2ITTA 1H08A 3BWFA 4AW0A 4HGTA 2YERA 4AA5A 4USDA 4AE6A 4C3PA 3IOKA 5IQHA 5DEYA 2P33A 5M56A 2PYWA 4FT5A 2ZOQA 3DDPA 2C6KA 4XNEA 5IH5A 3LFQA 3L8SA 3UP7A 3HV7A 4ACCA 3IW7A 3QXOA 4WA9A 3MH0A 4YC3A 3UDBA 4DITA 4ZZOA 5LJJA 4X3FA 3UZTA 5CX9A 3W33A 3VS0A 2ETKA 3ZXZA 3UDTA 4BTMA 2CGXA 3DAEA 2F2UA 1ZYSA 3IW4A 4QMOA 4BDIA 1OBDA 4MUQA 2F7ZE 3FY2A 1ZMUA 4BCGA 5CVFA 1A06A 2FA2A 3PYYA 5K5XA 1CDKA 3NAYA 4IHPA 5AX3A 4G1WA 4HGLA 3HDNA 4BIDA 3EYGA 4OTHA 3UNZA 1KOAA 2BFYA 1JBPE 3R04A 4TL0A 2WPAA 4FKUA 4XP3A 1O6LA 5ETIA 2HXQA 4A4LA 2PUNA 3O23A 4ZLYA 1Z5MA 4AA4A 1DAYA 1DM2A 1Q4LA 1ZAOA 1M2RA 1H0VA 2B9JA 4PTCA 3ZRLA 5K5NA 4S2ZA 5EK7A 1RW8A 4LRKA 3ROCA 2DWBA 4FKVA 4TNBA 1ZXEA 3R2BA 4HGSA 3VF8A 4DTKA 5K0KA 4QP8A 3QHWA 5J87A 2O0UA 3R73A 2WTJA 4CV8A 3QYWA 4MK0A 3W16A 4R6VA 4L7SA 5EH0A 3HL7A 3OCSA 4UMRA 1OECA 1H25A 3FI2A 4F78A 4FVRA 3C9WA 4G16A 3TJDA 1LR4A 4DG2E 5KNJA 4HZSA 5AAGA 3FI8A 4AOJA 5M55A 2ZM4A 3PY3A 4IC8A 4WBOA 3KC3A 4AZFA 4FV6A 4G5JA 3I60A 4PTGA 5DR2A 3MWUA 3DBQA 5FTQA 1H24A 3RINA 3WBLA 4XS2A 3S95A 1H0WA 4XG7A 4BHNA 4ZJVA 4BBMA 5A6NA 3FMHA 5AA9A 2JD5A 3FUPA 3PP1A 5GZ9A 3H0YA 1URWA 3UNJA 5DR6A 4CFUA 4ZLOA 5L2IA 4G34A 1U5RA 1KE7A 4XG9A 5M4IA 1H01A 2OK1A 3QTUA 2Y9QA 5DI1A 3GVUA 2BKKA 3MY1A 3LFBA 3WF8A 3HAVA 2B1PA 3H4JA 4JQ8A 4GIHA 3V5JA 2XJ2A 3QKMA 4CMOA 2I40A 5IMEA 2IZSA 3PY1A 4JX3A 3ZUUA 1GZ8A 3MW1A 3DU8A 4IB1A 3OUNB 4YGAA 4GT4A 4O0WA 3RHKA 4BIBA 1PJKA 4F64A 4DT8A 3POZA 2C0OA 4F0GA 5BV3A 4MBLA 2HXLA 2A1AB 3BHYA 3MVMA 4W8EA 4A9TA 4DINA 4FUXA 3EZVA 5DT4A 3W2PA 5BYYA 4HW7A 3FLWA 3A60A 3VBVA 5M53A 5E8WA 1KE5A 4F4PA 2B52A 5EDQA 1P5EA 3NIEA 4AS0A 2ACXA 4QQJA 5IEXA 2XK4A 4E8AA 2WKMA 1DI8A 4I1ZA 4IWDA 4DA5A 3HP2A 3KN6A 3BLRA 4II5A 2VV9A 3P23A 4BN1A 4ONAA 5LCJA 2VTRA 2G2FA 1XKKA 1PYXA 3V04A 4BCFA 3RBWA 3U55A 4FT7A 5FLFA 2XEYA 4BCQA 3SV0A 4V01A 3AC5A 4ZZMA 1CKIA 5FRIA 3VHKA 4MBJA 2BAQA 5BNJA 4MD8E 1JKLA 3FY0A 3JXWA 3BHUA 4D4SA 2XM8A 5A4LA 1PXOA 3R9RA 3AQVA 2Q0BA 2GU8A 4GCJA 3Q52A 4FTIA 4ZSEA 5LQFA 2CNUA 2HZIA 1BL7A 4E7WA 4RWIA 1JKKA 3HMNA 5J95A 3WILA 2BRGA 2WXVA 2YISA 4YBKA 5JQ5A 4IADA 1UWHA 4C4FA 4ZTRA 3WE4A 4FA2A 3QQFA 4I5CA 3OD6X 4NM3A 3NNXA 4FG9A 4QNYA 4LG4A 2B9FA 4YTIA 5AR5A 3UPXA 5ACKA 2ITVA 4G3CA 1JOWB 3TNQB 5A4CA 1G5SA 3VUTA 4DGMA 3UIXA 2PVRA 1I09A 4LRMA 1JLUE 2IVTA 4RIOA 4WUNA 1IAHA 3Q5IA 3E93A 4JBOA 3A62A 2C4GA 2F57A 2OH0E 2KULA 4DEBA 3VQUA 3BYOA 4WT6A 4DFNA 2Y6MA 2CCIA 3SXFA 4YJTA 2F9GA 1J3HA 2E9NA 3RZFA 4Z7HA 3AC8A 2B9HA 3NYNA 5H2UA 1TQMA 4MXXA 4BICA 4K6ZA 3E7VA 3KVXA 3AC1A 4CSVA 4YURA 4KBKA 4AFJA 3BGQA 5M08A 4BDEA 3MPAA 4RIXB 2PZIA 3KULA 1ZMWA 4GVAA 4RJ5A 5K3YA 2YIRA 4JDHA 4OUCA 4R5YA 5DVRA 1G8JA 3LLTA 4FSTA 5GZ8A 3WIGA 3DXQA 4YSMA 3KL8A 3WYXA 2XNEA 4B8MA 4BJJB 1P4FA 3H3CA 3IOPA 3KGAA 3DPKA 3W2CA 3WIKA 5C1QB 1FQ1B 3DKOA 5BUIA 5BPYA 3CTQA 4C3RA 3NAXA 4XRJA 4WHZA 5HORA 4FR4A 1APME 3CD8A 2Z8CA 4B8LA 5CALA 4HVDA 2ONLC 4O7ZA 1WVWA 2ITYA 3BPRA 3BRBA 2IF8A 3CE3A 4FIJA 3C4XA 1QL6A 4MQ1A 4X2JA 3WF6A 4ACMA 2JKKA 3D2KA 3GC7A 3R01A 3LOKA 4M13A 4AUAA 3BKBA 4R3CA 3UQCA 5ANDA 4F1MA 4JBVA 5ANGA 3DKGA 2QLUA 2WU7A 3HMPA 5F1ZA 5H8GA 3AD4A 1PMVA 2XK7A 3SA0A 3ZC6A 4D5HA 3GU7A 4AGDA 2BAJA 3PA3A 1W7HA 3PIZA 2YM8A 2UZDA 4M84A 4CT2A 4OTFA 2XK8A 4R7IA 2PE2A 5CANA 4WNOA 3PWDA 2VWYA 2WO6A 2ZV7A 2H34A 4ZXTA 2I0YA 5KMKA 2BFXA 3A4PA 1XWSA 3VBYA 4EQMA 5BVOA 2QOLA 3BL7A 4PTEA 4DFZE 2W7XA 3Q9ZA 3R02A 3FMLA 2BHHA 3AXWA 3E7OA 3ETAA 5FQDC 1OL1A 5J7BA 3ORMA 2CLQA 2J9MA 4U9AA 4Z3VA 2BHEA 3SW4A 2CNQA 4OBOA 2I0EA 3FEGA 4FEUA 1YWVA 3V3VA 2BDJA 2XNMA 1WVXA 3QRIA 5CWZA 4EHGA 4BF2A 3FQHA 5FDPA 5HU9A 2X2LA 4O7LA 3EL7A 4KD1A 2P2HA 1XMMA 1QMZA 5FM2A 4DBXA 4FEVA 4UX9A 4EOJA 4FKLA 2A19B 3U4WA 4EC8A 4RWLA 4J99A 3HV6A 5DG5A 4RC2A 2CLXA 1A9UA 4RA5A 5DYJA 4CQEA 3QC4A 4MAOA 2VAGA 3OEFX 3RPYA 3TACA 3DJ5A 4GW8A 3ZSGA 3AGMA 4YC6A 5TE0A 4LQMA 3RNYA 2UW9A 4HGEA 3Q4TA 2VX1A 3QAME 2PY3A 1E9HA 3A99A 2FO0A 3QTZA 4CFXA 2WMWA 4FKWA 2QKWB 2R7BA 4LRJA 3WZKA 2QOHA 2W1FA 5B2MA 5CVHA 4WNPA 3MH3A 2ITWA 2PMIA 4BI1A 4EK5A 3D15A 2WEIA 1ZARA 3F69A 3QRUA 3OC1A 4FKJA 2BIYA 1YDSE 3O8TA 4Y73A 2YJSA 3GOPA 5AA8A 3HA6A 2YIQA 2R3NA 2V0DA 3DBDA 3NEWA 4GFGA 4HPUE 5EFQA 4TRLA 4DEIA 5ANJA 4QMUA 3FJQE 4F6UA 4I5MA 3TM0A 2XNGA 4EEVA 4Y8DA 3Q96A 4DEHA 3W0SA 3EFWA 4C2VA 3MJ2A 4IFGA 5TT7A 2OBJA 3R8VA 4I0TA 3VS6A 4MF1A 4S32A 4U0IA 3CC6A 4GK2A 5AUWA 1Q62A 1E1XA 2ZMCA 4Q2AA 4EONA 2XUUA 3UVPA 3FV8A 3HMMA 4O82A 5I0BA 4R8QA 4Z16A 2XEZA 4Y95A 3D94A 3SAYA 4QMLA 2FVDA 3FSFA 4AOTA 4HZRA 5K4IA 3QD4A 5CU6A 3NIZA 4U40A 5LVOA 3Q60A 5EYCA 4O7TA 3DA6A 3VONA 5IG1A 2XAOA 2AC5A 3VJNA 3FQEA 3JS2A 4OTPA 4CYJA 4X3FB 3W0NA 4LGDA 3EFKA 5CEOA 4MD9E 2QD9A 5L6OA 1R3CA 1P2AA 3W8QA 2BRBA 2C69A 2XK3A 4F7LA 2BDFA 4K9YA 4RC3A 5A4EA 5EQEA 1JSUA 3PXYA 4QMNA 2W9FB 2EVAA 3DOGA 3OG7A 4G6LA 3C4CA 2BR1A 4A9SA 2BTRA 4E5WA 3DLSA 4G6OA 3THBA 3VHEA 3R63A 4OLIA 5HCZA 5HICA 4GUEA 4DH1A 3HP5A 4D1SA 5AM6A 4I93A 4H3QA 4BY9E 4U79A 3PPJA 5LOHA 4JQ7A 2FSTX 5E8SA 5FXRA 4NM5A 2XYUA 4RQKA 4NW5A 4D28A 5EKNA 1XH4A 3L9MA 3NSZA 3TNIA 3F7WA 4EOQA 5KHXA 4QMZA 2C3IB 2XKEA 4BDDA 3IECA 3T9TA 3LFSA 2WTVA 3KQ7A 2YACA 4FTTA 4EZ5A 3UGCA 3K3IA 3PUPA 3LCDA 4EI4A 2I0HA 3KXGA 2X9EA 1PYEA 2HY0A 2UW6A 3MFUA 5JZJA 1MRVA 5HIBA 2PUUA 2X7FA 4HNIA 2ETRA 2HW7A 2RKUA 4FSQA 3UJGA 4E6CA 5CZIA 4TZRA 3L8PA 4WSYA 3ACKA 5HBHA 5HTIA 4ZK5A 2XKDA 4L9IA 4A7CA 2AC3A 5HVJA 3O8PA 4G6NA 2XJ0A 3A2CA 3D7TA 3R0TA 3QC9A 4R1YA 3RK9A 3ZLXA 4AGWA 3DGKA 5ACBC 2W96B 3UVRA 3TZ9A 2GTMA 2GQGA 4E5AX 2JDRA 4XP0A 2W9ZB 1PMNA 1K9AA 5I9ZA 2AYPA 4IWQA 4O7WA 5F95A 3FMNA 3OXZA 2VO0A 4YTFA 3W8LA 5AV1A 2C3LA 4CNHA 3WZJA 4MNFA 3LLAA 5HNIX 3ZLYA 3QWJA 5M4UA 1KSWA 2XH5A 5E92A 2OJJA 3N4VA 3ZO4A 1XMLA 4PPAA 5HESA 2WIPA 5EW3A 1JPAA 4IJPA 1Y57A 3ORIA 5FXSA 3QL8A 4C58A 1NY3A 2XJ1A 3VBQA 4J71A 4PL5A 3KREA 3LFDA 1Q24A 4IDVA 2XK9A 3PVWA 4FODA 3OBJA 4FSZA 2A2AA 3QGYA 4H36A 3FL4A 2BRNA 5CVGA 3UIUA 3LW0A 2A4LA 3FHRA 3QXPA 3BYSA 5A9UA 3DBFA 1H1QA 3GC0A 4FKRA 4RC4A 4KKEA 2C6EA 4PP7A 4YU2A 3FMJA 4ENYA 3LHJA 1YXSA 2OW3A 4RWKA 4ZEGA 3Q6WA 4MWHA 4Q5EA 3PVGA 5AV0A 3C4ZA 5CU3A 1XH8A 2GHMA 2QURA 2X0GA 2WB8A 5C8MA 4D0XA 4OTQA 1XH5A 5FDXA 2UZUE 2ZM1A 4LFIA 2WOUA 4RVTA 2CKQA 3DZOA 3A7GA 5CI6A 4F7JA 4IC7A 4ITHA 4K0YA 3NLBA 5CT7A 3LM0A 3CSVA 4QRCA 5J5SA 4HYHA 5J1WA 3IS5A 2H9VA 3DAKA 4YR8A 3PJ3A 1PKDA 2O5KA 3IGOA 3LCOA 4GEOA 5ITAA 4I0RA 3NFGB 2O8YA 3UO6A 4QDEA 4ZSAA 4C38A 4FKQA 2JLDA 4GG5A 5AADA 4CFMA 5F9EA 3W10A 3COHA 4J96A 4V04A 4PX6A 4RIYB 2XCKA 5FP6A 2H6DA 2OZAB 4EOKA 5DFPA 3D83A 3ZH8A 4RPVA 1OL2A 4D9TA 3KRJA 1ZOGA 5JN2A 2FB8A 1RQQA 2C6MA 4UV0A 3JVSA 5HGIA 5M06A 4RX7A 4EZ7A 5AFVA 2QC6A 4KBAA 3RPSA 1F5QA 4EOSA 1A48A 3RP9A 3FKNA 4NW6A 4DTBA 2B53A 3LFNA 5HCYA 4JOAA 4P2KA 2YCFA 4KWPA 2PHKA 4J1RA 2J51A 5EYDA 1I44A 2IG7A 3KKVA 2XP2A 4GL9A 3U87A 1NVQA 2WMAA 3SKCA 4IACA 5CAQA 3RJCA 5LVNA 4DHIB 4TNDA 4BYIA 1TVOA 4ENXA 2RIOA 4KSQA 3BLHA 4CT1A 5DE2A 5DBXA 1GJOA 5HO7A 3IDPA 4AXEA 3DKFA 5D7VA 3QTIA 3L8XA 4AA0A 2X0PA 4U7ZA 1R0EA 4FTOA 2QG5A 3FL5A 3H9FA 4QMTA 3OW3A 3UIBA 3PE1A 5EHLA 3BQCA 4QYGA 2VWBA 3O51A 4IB0A 3CGOA 3U51A 3VF9A 4KBCA 1PMUA 2CJMA 4L67A 2UZOA 1NVSA 2PVFA 3G51A 3KRXA 1ZYCA 2BKZA 4O0SA 3R9OA 2IZRA 4RX5A 4C8BA 3JY9A 3MIYA 3K5VA 4AZSA 4BKYA 3VVHA 3EOCA 3C1XA 2JDVA 4C02A 3MFRA 3TZ7A 4JIAA 4RA4A 2QO7A 3I0OA 3NUSA 4FTNA 4GT5A 3VBWA 4U44A 1JNKA 1HCLA 4FNYA 3HYHA 4AT5A 2XALA 1UU8A 2ERZE 4CKRA 3VS5A 3MPTA 2OIQA 3F5XA 2YM3A 3PSDA 1OGYA 5CZHA 3TDVA 4D55A 1GIIA 1UA2A 4PL4A 5LXMA 3BQRA 4RMZA 4PPCA 2R0IA 4QP2A 4ZTLA 4AZWA 4S34A 1V0PA 1MUOA 4CMTA 1G8SA 1JQHA 3CCNA 5GZAA 3QUPA 1J7LA 4XUFA 4DHJA 3COIA 2PK9A 3DBCA 4YNOA 2BZIB 3D4QA 4LMUA 3UQGA 3ZBXA 4AWIA 4FGBA 5IA2A 4TKSA 3VQHA 3VJOA 3OWLA 4AG8A 4FEXA 5CNOA 1TQIA 4IX3A 4N57A 5CASA 4QP4A 4L3PA 4XBUA 4BZOA 1IEPA 5IDNA 4WOVA 4FV4A 4O4BB 2VN9A 3F82A 3HUBA 5CSWA 5JFVA 2P4IA 2YWVA 2WIHA 3OY1A 5L2WA 1DAWA 3MYGA 4L44A 4BGGA 4CKIA 4ANQA 5IPJA 2GS2A 2XYNA 4F70A 2OJGA 5AUYA 4U6RA 5DNRA 4EZ3A 2B55A 4JI9A 4O7YA 5JEBA 1UU3A 2XB7A 5IA5A 4EOIA 3ZOSA 2X4FA 2WTIA 4RJ4A 4HCTA 3TJCA 4YLLA 5AEPA 1CTPE 3QD2B 1L8TA 4FVPA 3EKNA 3KXNA 4AW5A 3U4UA 1OGUA 4NFNA 4QTAA 3QZFA 3VC4A 3I81A 3ZSIA 3QX2A 4QP7A 4J52A 1H00A 3JPVA 4EHVA 3R7EA 3AG9A 1PMEA 3T9IA 4O91A 2W1HA 4BTKA 3BE2A 3U6JA 2VX3A 3FXXA 2G01A 4RFZA 3UZPA 3V6SA 4O2PA 4TWCA 2CN8A 4FSRA 3DJ7A 4XRLA 5DRBA 3S2PA 1U54A 1ZMVA 5HG5A 1PXMA 2A0CX 4EOLA 4FL1A 5AP3A 5IA0A 2VGPA 2OSCA 4NIFA 3LCKA 4U80A 3LFAA 5AP1A 1Y6AA 2R3FA 5AUVA 3TV6A 4IBMA 4L8MA 3FLYA 4P4CA 5EHOA 3KCFA 4ZJJA 3VW6A 4CFFA 4FGRA 4APPA 3ZRKA 5CAPA 3ATTA 2WMRA 5LMKA 4O0TA 4UYNA 3QKLA 5EOLA 3ATSA 4O4CA 4MYGA 3UE4A 3K5UA 4J97A 3VUDA 2CSNA 5LARA 2V7OA 2VU3A 4OTRA 1KE6A 5FEDA 3ALOA 3QRKA 1YOJA 3Q5ZA 4LOPA 4HPTE 1B38A 3G90X 5ETAA 5G1XA 3RI1A 2R3KA 3W0PA 1YQJA 2ZFYA 4ZIMA 5KMLA 4Y85A 3FZOA 5HX6A 3NUYA 3OOGA 2X1NA 2H8HA 2JBPA 5K0XA 3GUBA 2IN6A 4F7SA 4XBRA 4DLIA 4NUSA 4D2VA 4HVHA 3QLGA 2EXEA 4DFYA 3PIYA 4CXAA 4Z7GA 1J1BA 4EK3A 4FZ6A 5CXHA 4NT4A 3GI3A 1W83A 3Q3BA 1FVRA 4FK3A 1ZY4A 4QDVA 2J90A 3FSKA 2ZM3A 4EOOA 4PP9A 4XYFA 4LMNA 4FRFA 4EUTA 4IXPA 1H8FA 2XBJA 3I5NA 4HYUA 3GFEA 3WARA 3P7CA 4ASXA 4FOBA 4FTKA 4KB8A 4BTFA 4DGNA 2C5OA 4FL3A 3IG7A 4WUAA 3DB6A 4G3DA 4M69A 5DN3A 3GP0A 4G9RA 4I6BA 3E8CA 2ZYBA 4PMTA 3UO5A 3QZGA 5FP5A 3IW8A 4I6FA 4TYHA 1H27A 5H9BA 5TF9A 3FZTA 3TZ8A 1Z57A 2FH9A 5DGZA 2O3PA 3PXRA 2HIWA 4NM7A 4BWPA 2B7AA 3EFLA 2VWUA 4NTSA 4RSSA 5B2KA 3NVMB 2G9XA 1ZWSA 4RG0A 4YPSA 5LVLA 3LXKA 4EK6A 5EDRA 3I6WA 3R9DA 3PLAE 2R3IA 5DLSA 2E2BA 4PPBA 4XV2A 4F63A 1VJYA 1OBGA 5FUTA