5GJGA

Crystal structure of human tak1/tab1 fusion protein in complex with ligand 4
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
307
structure length
289
Chain Sequence
GPLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Development of a Method for Converting a TAK1 Type I Inhibitor into a Type II or c-Helix-Out Inhibitor by Structure-Based Drug Design (SBDD)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords TAK1 kinase - TAB1 chimera fusion protein
total genus 83
structure length 289
sequence length 307
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5gjgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5gjgA01
4QQ5A 2H34A 2A1AB 4O81A 4BWKA 2A0CX 2J0MB 4FTTA 5HD7A 5JN2A 3OWJA 3PDTA 3VF9A 2FSTX 5L6WL 4YHFA 4AT3A 2YISA 4FV2A 4C58A 3HAMA 3OCTA 1OKZA 4MXYA 2ZM1A 3EYGA 2XEZA 2C3JA 3QKLA 4Y46A 1A9UA 3DDPA 5HEZA 3G51A 3DXPA 5DRDA 4CNHA 4OAUC 2RKUA 3ZUTA 5C01A 4BKJA 4FKGA 4CXAA 5KMJA 3AMAA 3MY5A 4F1MA 3WIKA 3GENA 5LVNA 4M67A 4I4FA 4YGAA 2KTYA 5CALA 2YM5A 3LFBA 3QAME 4KIQA 4RFYA 3UP2A 3KXZA 4DINA 5IZFA 4B7TA 4M97A 5GJDA 4AACA 1Q3WA 2FYSA 2HELA 2R3LA 3UPZA 4ERWA 4CG9A 3LVPA 2G1TA 3SOCA 2PVJA 1VR2A 3QCXA 3TCPA 5C26A 2XK7A 4B9DA 3I6UA 3N4UA 3HEGA 2BZKB 3NEWA 3W2CA 2ITPA 4I0SA 5HE0A 1SNXA 4FV7A 3CTHA 3LQ5A 4FTMA 2WMRA 3C5UA 5BX0A 1QPEA 5DGZA 3JR1A 5DT3A 4BDJA 3QRJA 1R0PA 1ZYLA 3FPMA 5FD2A 3VS7A 4FT0A 2YM6A 3ANQA 3QYWA 5HIEA 5TOZA 4ZMFA 4YJVA 4E73A 4TPTA 4AT4A 2OU7A 1UNHA 2CGWA 2QLUA 4O1PA 3NSZA 4AXAA 3QBNA 3Q9ZA 4J98A 4JX7A 3R01A 1BKXA 4RBLA 4YJRA 3D9VA 3U6JA 3EIDA 4JOAA 4PMTA 4X6RA 5BVFA 3TUCA 3DPKA 4BI1A 4LRKA 4W8EA 3I5ZA 1BUHA 4LGGA 3UODA 3KCFA 2VGPA 2P0CA 3EQFA 3CTJA 4DH3A 3NPCA 3ORNA 4NU1A 5HTIA 3UE4A 4XLIA 4C3RA 2I1MA 5ANGA 3VRZA 5L2TA 4BYJA 2GHMA 2F4JA 3EN4A 5CANA 5KMLA 4DLIA 2VGOA 5BVNA 4A4LA 4ANOA 4OTRA 4R3RA 3VS4A 5HU9A 3E7OA 3DKCA 4IIRA 3ZC6A 4AW1A 4PP7A 5KMNA 3QTZA 4NM0A 3SRVB 5KO1A 3TZ8A 2VWUA 2B9FA 1I09A 4Q5EA 3P78A 3IS5A 2ZB0A 3N9XA 2W05A 4ZSLA 2NRUA 3V51A 4BBMA 5EDPA 1LPUA 1P14A 4USEA 3KMMA 3DNDA 1I44A 3E3PA 3QGYA 5E91A 3Q32A 5HICA 2W17A 4R1YA 4CKJA 5BMSA 4HGEA 1H26A 1P4OA 3UOHA 2UZWE 1G3NA 3OXTA 4QMWA 5ACKA 4C37A 4ZAUA 2V62A 1Z9XA 2ZV8A 3DTWA 2BR1A 2WMTA 2YCSA 4W8DA 3C0IA 3D4QA 1DS5A 3VVHA 3C9WA 4EZ5A 3CQWA 2W5AA 4D2SA 4OTPA 2VTTA 4YU2A 2I0HA 1XR1A 1PKGA 5HCYA 4BWXA 3DK6A 3R8PA 3RINA 3FSKA 4UXLA 3EQPA 3DXQA 1H08A 2HW7A 3LOKA 4RJ6A 5HE1A 3UG2A 4NK9A 4AN2A 4FIEA 2WMXA 3QRIA 3R7VA 4FUXA 4X0MA 2FSOX 2X2LA 3QGWA 3R22A 4K8AA 4M7IA 4C2WA 5JH6A 2VO6A 3KVWA 1WBPA 3Q9WA 4LMUA 5G6VA 3UMWA 3HUBA 2O64A 1MRVA 3A4PA 2QOFA 4M69A 4O0YA 1KE9A 5LARA 4O86A 1J91A 1LEZA 3UVQA 3CEKA 2ZV7A 4E26A 3EKKA 3P23A 2W0JA 2WMAA 4MBJA 4A07A 2Z60A 5AUZA 2W1FA 3ORMA 5BVOA 4EH3A 2GHGA 3DBEA 2UVXA 5KZIA 2X39A 3FHIA 4EHZA 4X3JA 3KF4A 3VUHA 4EOKA 4BB4A 2QOIA 1NY3A 4I0RA 4L7FA 3C51A 5IDNA 4TKSA 4BDGA 4N6YA 3MH2A 5A6NA 4I5CA 4RX8A 5HX8A 3D7TB 3V6SA 3TACA 1HOWA 4RFMA 2IJMA 1ZY4A 4G3EA 4OBPA 1XH8A 1BMKA 1FVVA 4PF4A 2ZM4A 3P9JA 2YCQA 2Q0BA 3JVRA 2C3KA 2OIBA 2XCHA 4G34A 3MTLA 1YWNA 5FM3A 3WF8A 3SAYA 3NWWA 4TT7A 2O3PA 1WFCA 5CF6A 3FL4A 4K33A 4D1XA 4O7NA 2VUWA 4O2ZA 3H4JA 3SLSA 4WRGA 4EHVA 3A7JA 3O7LD 1WBTA 4G16A 5AIKA 2J50A 3GC7A 2Y6MA 2UZEA 1OM1A 5F94A 5CASA 4M14A 3A7FA 3L9NA 3B2TA 3OUKA 3PE2A 2BRNA 4IZAA 3R7EA 3AD6A 4BCHA 4UMPA 4RZVA 2ITOA 5D7AA 5ETCA 3IDBA 1KE6A 2CLXA 2JDSA 3OW4A 4J8NA 5EYCA 3TEIA 1SZMA 1R3CA 1T45A 4G3FA 4IB1A 4CGAA 4FVQA 2HWOA 3CIKA 2W1HA 5HCXA 4E4LA 5FTGA 2CCIA 3FHRA 4W4VA 4ZK5A 4BDBA 1JPAA 1W0XC 4FEQA 4QD6A 1PRYA 2PWLA 1Q97A 1ZLTA 1ZAOA 4K77A 2XNOA 4R7IA 3DS6A 4ZTQA 2WMUA 3HA6A 3UVPA 5CSWA 4BBEA 1ZRZA 2WZJA 5IA2A 4HVIA 3VUMA 3DAEA 1OUKA 4HVHA 3TDWA 4EC9A 3Q2JA 3VS5A 3ZSHA 4YNEA 4WSQA 4HYUA 4DGMA 4FZAB 1NXKA 3QTWA 3FKOA 5CU2A 4CRSA 3QLGA 4XLVA 3WARA 3KRWA 4JDHA 3QFVA 3DLZA 4BTFA 4JT3A 1IG1A 2E2BA 2X8IA 3GC8A 4IM3A 2JKKA 3ZZWA 2B55A 5DN3A 5AUVA 1O6LA 4PMSA 3CTQA 4JL9A 4BCQA 2VO0A 4LFIA 3MB6A 4XBRA 4RC4A 2X2MA 3MA6A 3EZVA 4YLKA 3TL8A 4E5BA 2ITXA 1IAHA 4GEOA 3GU6A 5HVKA 3C4CA 4MVFA 2XKDA 3TZ9A 3SXSA 1URCA 3D14A 3E64A 3UBDA 3AC3A 2PE1A 2GNJA 3BHUA 1HCLA 5CEMA 3F3UA 4BCNA 2UZOA 3CY2A 3NNXA 5HKMA 2WIHA 5M53A 4E1ZA 4FEXA 1FMOE 2PZIA 4UMQA 4D55A 3LFNA 5HLNA 3UG1A 2XH5A 4AE6A 3E87A 5IEYA 4ZMEA 3MFSA 3U6IA 5LMKA 3SC1A 2Y6OA 3FZTA 4GKIA 5D41A 2HW6A 1WVXA 2XYNA 3VJNA 5EW9A 4IANA 4LGHA 3UYSA 4R77A 2RFEA 3QC9A 4H05A 4FA2A 1B38A 1OL7A 4TN6A 2UZDA 2VWBA 3UQFA 1OMWA 2R0IA 3FDNA 4YJTA 4IAKA 5KZ0A 3W16A 4NKAA 4YZMA 2WO6A 5AR3A 3F5GA 5DVRA 3TTJA 4UEUA 2ITVA 3ODYX 2HY81 2VNYA 2BZHB 2Q0NA 3Q4ZA 1H0VA 4IZYA 4MCVA 4YNOA 1QPDA 3CD3A 5TKDA 4J71A 5A3XA 2QLQA 4G17A 4YZDA 4R78A 3CSVA 4LUEA 4F6SA 3OS3A 2YCRA 4CT2A 3WI6A 4YLJA 1PJKA 4AFEA 5CX9A 4Q9SA 3BRBA 3R1YA 2PY3A 5HTBA 4BCJA 1DM2A 1YRPA 2WXVA 4EKLA 1Q61A 2VTNA 4FZDB 5GINE 3QHWA 1JKLA 4G3GA 3A61A 4ONAA 3HUCA 1PXKA 4FSRA 3C4WA 5DE2A 2JDRA 4FV1A 3AQVA 4KIKB 2WQMA 2ONLA 3R30A 2JBPA 1XBBA 4TYHB 3PG3A 2DWBA 4YSJA 2GQRA 4FKVA 5K4JA 4UN0C 3V3VA 1NVQA 4YJUA 5IQFA 4CMUA 2PMIA 1O6YA 4R6VA 3VQHA 1VZOA 4FYNA 4EYJA 4E5AX 3LFDA 3PJ3A 2PSQA 4MBLA 3LHJA 1U54A 5HBHA 1JBPE 5KCVA 2G2HA 4FSNA 2V22A 4IDTA 3ZTXA 3LM0A 3ZHPC 1ZYCA 4IM0A 4FKIA 4K0YA 5DNRA 1OKVA 4MD8E 5L4QA 4L8MA 3E5AA 3RAKA 2OJ9A 3O8PA 3RCJA 1Q8ZA 4FT7A 2Z7LA 4EI4A 4OR5A 2ITNA 5IA4A 3R00A 3DAJA 3RAHA 4JBOA 2H9VA 1FPUA 4MHAA 4BDHA 3AGLA 4JBVA 5D9HA 3MV5A 1Q8WA 4YJSA 3N4VA 4AZWA 3NNVA 5AR4A 2WIPA 3H9RA 5DR9A 4LI5A 1QPCA 4KIKA 5JFXA 5ITAA 4HPUE 2W96B 4W4YA 4JG8A 3ZUVA 4F6UA 3PRIA 5M56A 4HGSA 2LGCA 4A9YA 1GIHA 3MJ1A 4ZLOA 2UVZA 3A7GA 3EQHA 3D83A 3PPJA 4RJ8A 4KSQA 3VO3A 5HBEA 3FUPA 3IGOA 4WSYA 3ZSGA 5A14A 3R2YA 1YQJA 4BHNA 5IDPA 2YN8A 4MXOA 4KS7A 3IO7A 3EKNA 4UWCA 5HIBA 3PA5A 3R6XA 4C36A 1Y8GA 3EFKA 4ZTLA 3KFAA 3O7LB 5I9WA 5DI1A 4WD5A 4DT9A 5FG8A 1PMUA 4XV3A 2BMCA 1YOJA 4QYFA 4DTBA 3EMGA 4FX3A 4KKEA 1V0BA 3COHA 4GUBA 3S0OA 3FLQA 3FLWA 4B8MA 4EK5A 4L3LA 4FSZA 1GAGA 5LMAA 3S4QA 4QP1A 4BTKA 5KUPA 3BYUA 4D2TA 4IVCA 3P7AA 4DFBA 4EOOA 1G5SA 5AWMA 4IM2A 4DAWA 3MI9A 4OAVB 3CKXA 4QMMA 3LJ0A 5ANKA 5IQHA 4X2JA 5CWZA 3MB7A 2BFYA 4ALWA 5BUIA 2ETRA 1WVYA 3FE3A 4OGRA 5C8NA 4O7VA 2IVTA 4IBMA 1R1WA 4JLCA 4WNKA 3VS2A 1IASA 3CLYA 3HA8A 4FNWA 4QTCA 3NUYA 4IB3A 4DGGA 2WAJA 3VW8A 3IOKA 3ZLYA 4RFZA 2X2KA 4E5WA 5G1XA 4S2ZA 5IA5A 2CDZA 3UYTA 4BFMA 5HNBA 4M0ZA 1WZYA 3SA0A 5EKOA 2G15A 3DKGA 4FT5A 5E1SA 5AR2A 3WZKA 2PE0A 4FV9A 2YZAA 3OEFX 4P4CA 5CAUA 3VWAA 3NUUA 4AGUA 4WKQA 3NAYA 2HZIA 4WHZA 2REIA 1LP4A 2UW6A 3II5A 4RVMA 3FI2A 5CSHA 3S3IA 3OHTA 3VAPA 2WELA 2WTKB 3FC1X 3NAXA 3O51A 2O8YA 4FYOA 2QQ7A 3KXHA 5B7VA 2BTSA 3ODZX 1PXLA 3ORTA 5AV0A 4FSMA 4RWIA 1U54B 4V0GB 3V5QA 2B53A 3H30A 3SV0A 5CQUA 3RGFA 2HXLA 3ULZA 2QO9A 4EBVA 3NYXA 3T9TA 3PPZA 5BNJA 2V0DA 3ZONA 4CYIA 2PU8A 2OKRA 2XIXA 3IK3A 3VUIA 5IU2A 3PJ2A 3RJCA 3IGGA 5LCKA 2BRGA 3BBWA 3D5UA 3FMHA 2B0QA 3DB8A 4IX3A 4O7TA 1MP8A 1TQMA 2OW3A 3OBGA 2CGUA 4I21A 4ID7A 4CFNA 4DH1A 4XS2A 3QX2A 3RK9A 4NCTC 1OPJA 3P79A 2PMNX 5DWRA 4EQMA 4OTHA 1OBGA 1A06A 3DK3A 2I0YA 2W7XA 4C02A 4BDDA 4S30A 3KXXA 4PPBA 2ZYBA 3VQUA 5HNGA 5M08A 3RZBA 1WVWA 1V1KA 3FL5A 5IKWA 3ZMMA 3O71A 1YXXA 3LMGA 4U80A 4AP7A 5AV2A 4DEIA 1BYGA 3NUSA 5LMKC 3R71A 1GY3A 1YKRA 2WEIA 2W06A 3IW5A 3DU8A 5L8LA 3Q5ZA 1JKSA 2IW6A 5KMOA 3PLSA 4ASZA 3HMNA 4RA4A 2JDTA 5EI6A 4IC8A 3RALA 1JSUA 2YIXA 4EH7A 5HIDA 1YOLA 3EB0A 3EWHA 4U6RA 2BAKA 4I5PA 1E9HA 2OLCA 4RZWA 3PIXA 3R8LA 4GJ2A 4NIFA 3PYYA 3R8UA 3O8TA 3U9NA 4UV0A 4XBUA 4RLLA 4E93A 2E9OA 3WYYA 1M17A 4BHZA 3PG1A 4DEGA 5JZJA 5JFSA 3MGYA 5CEPA 3WE8A 2BRBA 4XP0A 5DG5A 3P1AA 3PIZA 4EOJA 2OJFE 3AC8A 4JNWA 4KRDA 5BVDA 5AA8A 5CVHA 1XO2B 5E8SA 4BZOA 3WF9A 3UO4A 4B4LA 3COKA 4EYMA 3PSDA 4FKQA 3T3UA 1CSNA 2IZUA 5CT0A 3VUTA 3E8EA 4NWMA 3V8TA 2ZV9A 4TW9A 1U46A 5IQDA 2SRCA 1R0EA 3I0OA 1X8BA 1OKWA 2XMYA 4G2FA 5DEWA 3R8ZA 5CF8A 5KHWA 3TNHA 2XVDA 4YJOA 2O0UA 3NVKI 5JRQA 4DG0E 4DE4A 3ZOSA 1Q3DA 4U8ZA 4PDYA 2YACA 2NO3A 4G5JA 2PVLA 2PVFA 5HTCA 3BGQA 4XOYA 4MXAA 3AGMA 3DB6A 2XJ0A 2CN5A 3TKUA 5DT4A 2VX3A 5LXMA 2HIWA 3P7BA 4JQEA 3CBLA 1QL6A 5BMMA 4HVSA 4MF0A 4GKHA 2XM9A 5FTOA 4IZ7A 4UWBA 3OWKA 3HV7A 3G6GA 2W9ZB 1CM8A 3MA3A 4E20A 2OSCA 4NL0A 5AAEA 2OG8A 1VJYA 4FTAA 1G8SA 3GQIA 3FYJX 3KXGA 5L2WA 2IZSA 4LV5A 4L43A 5GJFA 4ZTNA 5D12A 2PVMA 4HNFA 1SVGA 5H8BA 3SG9A 4DYMA 4UMRA 2JLDA 4NT4A 3VBVA 3ZM9A 2VX0A 4O91A 3G0EA 4KB8A 5IEXA 5CZHA 3IDCA 2OJJA 5CU4A 4C4IA 4BDCA 3BX5A 5AP7A 4EK8A 4AW5A 3C5IA 3VBTA 4YHTA 5EFQA 4OTGA 3HRCA 2XJ2A 2VD5A 2X1NA 3GP0A 4USFA 5T3QA 3KCKA 2WD1A 4BDAA 1O6KA 4RIYB 2OXXA 4EH9A 5D10A 4TZRA 2XK4A 1REJA 2VO7A 4C4HA 1OKYA 3K3IA 5CU6A 4JIAA 4O84A 4L46A 2WQEA 2G9XA 2C6DA 1PYXA 5E90A 5C27A 3RNYA 3ACKA 4GCJA 4RWLA 3E92A 3OMVA 5KHXA 2E9PA 2OJIA 4FOCA 4YZCA 5AIRA 1WBSA 2WU7A 4JI9A 3P5KA 2IZTA 4CEGA 4P2KA 3TUBA 3W10A 3FMLA 4X2GA 1Q5KA 3PXYA 4CFUA 2WU6A 3OTUA 2C0TA 3F2NA 3CXWA 3F82A 2XNPA 4U40A 5EDQA 4QQTA 5JSMA 5KKRC 3GT8A 3R73A 4FK6A 3ZEPA 5JFWA 5ETAA 3D5XA 4J53A 1WAKA 2BIYA 3WZUA 3RBWA 3PZEA 4HCTA 2ZMDA 2WGJA 4IWOA 3EQGA 4XRJA 4Y73A 3WBLA 5CAVA 3P0MA 3DDQA 4GU9A 2XP2A 4PY1A 3V5LA 5TT7A 5K0KA 3VNTA 3D2IA 1H25A 3WZEA 5AV1A 4F1OA 2R64A 5C03A 1JSVA 4QT1A 2C6OA 5CTPA 1CKIA 5H8EA 4DEAA 5L2SA 5HGIA 1B6CB 3FZ1A 4XNEA 1F3MC 4FV5A 4GT5A 3UQCA 5J7HA 4C2VA 4F7JA 3FMMA 3IW6A 3OOGA 4A06A 5H2UA 5E8UA 5DEYA 3UDBA 3OCSA 4MXXA 3V01A 4ASEA 5IA0A 1ZZLA 4U3ZA 5C1QB 2QOBA 1PXNA 3C50A 5I4NA 4I6BA 1IRKA 1WBVA 3RK7A 2CPKE 3PA3A 1H01A 2UZUE 4ALVA 2V5QA 3BKBA 4FTOA 5HO8A 4WIHA 3QTUA 5L8JA 5F95A 5JT2A 4EZ7A 2W1GA 5J5SA 4IQ6A 1Z5MA 3LFFA 5AADA 5E8YA 3R04A 4GG5A 5CNNA 3THBA 3PVBA 4ZJVA 1Y6BA 3TTIA 3UC4A 5LVMA 4FL2A 3M2WA 2C68A 4WNPA 3KK8A 4NCTA 5EW8A 4DFNA 4EZ3A 4H3BA 3UZPA 3VS1A 5KKRB 4MWHA 4IXPA 2UV2A 4CMTA 2GHLA 2GSFA 2ZMCA 4GRBA 3W2SA 4FTNA 3NNWA 2CKOA 3PFQA 5F1ZA 1TKIA 4CSVA 4F9AA 4WNMA 3S2PA 5TR6A 4EH5A 3D7ZA 3E8NA 4XG6A 3TNIA 1ZYSA 4O27B 3R1QA 4YBJA 3RHKA 5M4CA 1YI4A 2O63A 2E9UA 3BU5A 2VAGA 3PPKA 5EH0A 4BTJA 3DJ5A 5GHVA 2PK9A 2I40A 3LMHA 5EHYA 4E7WA 1ZXEA 5JQ5A 3EOCA 4W9XA 4FC0A 2BILB 1XBAA 3F5UA 3P08A 4FKLA 4IACA 4LYNA 4CG8A 2FGIA 4TNBA 1PMVA 3KREA 4XG2A 2UW5A 3CS9A 5GJGA 2RFNA 1YI3A 2Z7RA 3U87A 4G31A 3Q6UA 4QQCA 2VO3A 4YJNA 4YSMA 5FTQA 4CZTA 4KD1A 5C8KA 4ZTMA 3CR0A 3O17A 3D15A 4CLJA 4QP6A 2IWIA 3DGKA 1LUFA 4USDA 3KGAA 5HHWA 1ZOGA 2QNJA 4AOTA 3JXWA 2C6KA 1E1XA 3LXPA 5EG3A 5HLWA 5K0XA 4PDPA 4QTEA 4G3DA 2PUIA 1KOBA 4FIJA 4XX9A 3D5WA 2I7QA 4J95A 4PUZA 4FV6A 4K11A 4QOXA 4GT3A 3L9PA 2DQ7X 3LMIA 4R3CA 4S32A 2XNNA 3PSCA 2QVSE 2P4IA 2J6MA 3SDJA 3NYNA 1DI8A 3IPHA 2WKMA 2ERKA 3PVUA 3SQQA 4ZJJA 3BHVA 3DBQA 3AC1A 4DFXE 3R1NA 4JR7A 5JQ8A 3RI1A 2CKQA 4IAYA 3DK7A 1OUYA 4AA5A 4YTHA 3T3VA 4QYGA 4FG8A 5K5NA 5HBJA 2OXDA 5L6PA 2O2UA 4DH7A 4U45A 4WG4A 2RF9A 3W1FA 4QTDA 5M4IA 3QQGA 4YPDA 4ANLA 4PTGA 4TYEA 4ACGA 4TYIA 4C4EA 2HK5A 4CKRA 3UP7A 2BHHA 2JBOA 3Q2MA 3KL8A 4HCVA 4U43A 4TYHA 4ZTRA 3RK5A 3EFWA 5I9ZA 3BCEA 3JY0A 5CEQA 4O0XA 4YURA 4CVAA 5HG7A 4C4FA 3BEGA 1W83A 4ANQA 4X2NA 4FGBA 4G6LA 1SVHA 4U42A 4OT6A 3BGPA 2G01A 3QQLA 2YAKA 5ETIA 4JRNA 4TTHB 4WG3A 3ZRLA 4C7TA 2YIQA 4XH6A 5C4KA 3FZSA 3PSBA 5AP6A 1OL6A 5BPYA 2O5KA 4BZNA 4BKZA 3M11A 3QA0A 1KUTA 1UU3A 1K2PA 4K2RA 5JMSA 3BPRA 3GNIB 4QPMA 1OI9A 4BICA 4FV0A 4C33A 1FMKA 1L8TA 4GIIA 1XH7A 2W1DA 4V05A 3RPSA 4J96A 4S33A 3LCKA 2OICA 3F66A 2GNLA 4QMXA 3RTPA 2QOLA 3GOKA 5DLSA 3SX9A 2WTJA 3MY0A 5FP6A 4XV2A 3V8WA 4RRVA 4NJDA 4PTEA 3F5PA 3NUNA 3RCDA 4ALUA 3TWJA 1HCKA 4NTSA 2C30A 2GNHA 3JS2A 4ZY5A 5EQEA 3Q4TA 3UPXA 3QZIA 4S31A 1R39A 3PXZA 1MUOA 5HE2A 4P5QA 2PZ5A 4I93A 4RQKA 2FSLX 3HV6A 4HZSA 5CEIA 3FXZA 4NFMA 3TNQB 2UZBA 4DEDA 1MRUA 4UYNA 4PPCA 4XV9A 3VHKA 4FZ7A 4GIHA 3UIMA 4BRXA 3U6HA 4PMMA 4O7YA 2VWYA 3DQXA 2VWXA 3K54A 4MYGA 2KULA 3UIBA 2QI8A 4D2WA 4BCOA 3ZU7A 4ZOGA 5GNKA 4DEBA 3E8DA 4EL9A 2VWIA 2XNGA 4IB5A 4O22A 3R63A 3C4FA 4C34A 3QTXA 4D58A 3ATTA 2ITTA 3F2AA 2UUEA 3LJ2A 4ZY4A 3DFCB 1PXMA 2Q83A 2JAVA 4DT8A 3BELA 2BAQA 4AS0A 2ZDUA 1GNGA 4N4SA 2VTIA 2GNIA 1APME 3ORXA 4M84A 5JGDA 4OW8A 5DT0A 2LAVA 3ZUUA 2VWVA 3ZBFA 3DBDA 2PULA 4EKKA 3I5NA 3KN6A 1H24A 3BE9A 4NKSA 4TYGA 5J87A 5AEPA 1V0OA 3G0FA 4ACDA 2ZV2A 4R7BA 3LCSA 4BF2A 4DEEA 2VTJA 3PVWA 3MPAA 3S95A 5C4LA 4QP2A 4DH8A 5T6KA 2RGPA 3GOPA 4ZZMA 1PYEA 5ANJA 1YXTA 4EK6A 4GK2A 2FB8A 3ERKA 3SOAA 3BHTA 5I9VA 4R5YA 4A9RA 4QMUA 4DLJA 2VTRA 2Y8OA 2Z2WA 3I7BA 4KBAA 3C1XA 3GCQA 4APCA 5A4TA 3ID6C 3PJ8A 3DCVA 4E6AA 5AR8A 1OBDA 5J1WA 3CKWA 3VULA 3K2LA 3HRBA 4JDIA 4C61A 2YWVA 4NYEA 3EQRA 2ITQA 4PMPA 3NIEA 5DFPA 3F88A 4YZNA 1P2AA 3VBWA 2P55A 4DHFA 4Z16A 3KF7A 4YTFA 3N4TA 1Z57A 4BGGA 2WHBA 4M15A 1H8FA 2CGXA 3VBXA 5DR2A 3DJ7A 4QMVA 2WTIA 4FSQA 4GS6A 5E8TA 1KWPA 2RFSA 4LMNA 3UMXA 3NCGA 2QG5A 4W4XA 5M07A 4O6LA 2IVVA 4Y5HA 3FMEA 4DH5A 5B2MA 2CGVA 4FEWA 5GIOE 4CZUA 5CSPA 3V5TA 4UZDA 4BCFA 5AX3A 3EN7A 3R9DA 3FPQA 2QR8A 4F4PA 3KVXA 2R3GA 3GC9A 4MH7A 4NW6A 3VUKA 2YHVA 4H36A 3KULA 2A27A 3R7OA 3OBJA 4MNEB 3VBYA 3G6HA 4EOMA 3GXLA 5KMIA 5EK7A 1AQ1A 1QPJA 5ANDA 1ERKA 3I81A 3N51A 4EWHA 3A7IA 4ASXA 3LCDA 4YP8A 2CNVA 3TN8A 4IVBA 1OL1A 4BI0A 4NH1A 4I5MA 5LWNA 5IA3A 4PRJA 4IH8A 1YDRE 5ANOA 1PMEA 2PVHA 4FTKA 5K9IA 3OTVA 4WRSA 2BUJA 2HXQA 2QKWB 2YM8A 3BIZA 4OBOA 4PQNA 3R8VA 1OL2A 2X4FA 4R1VA 5C9CA 4EC8A 4L7SA 1XH4A 4HVGA 2AC3A 3CE3A 5HG5A 3R9RA 4U9AA 4AGWA 4I0TA 3QD3A 3ZFYA 4WBBB 4H3PA 3GCSA 4L68A 1PKDA 3CPCA 4I4EA 4RIYA 2R3HA 4E6QA 2R3OA 2WMQA 2XEYA 3NX8A 1NA7A 3C13A 3LXKA 3MVJA 3VS3A 4CFFA 4S34A 5FUTA 5AUYA 3Q6WA 2QOCA 3GB2A 2JFLA 4FKOA 2PVRA 5AV3A 3LXLA 3TNPC 4O96A 1WBNA 2GU8A 4FVPA 3T8OA 3F6XA 1OPKA 4J97A 3UNZA 4MXCA 1ZMVA 2R5TA 3E8CA 4RJ5A 1KOAA 2YLEA 4FT9A 4RSSA 4D9TA 4QMLA 5AAGA 2EWAA 3BLQA 1Q24A 1LR4A 2BVAA 2IO6A 4RX9A 3NUAA 4XYFA 3H0YA 5BUEA 4MNEA 3DJ6A 4YO4A 3B2WA 4IW0A 4HYHA 5AM7A 4ACHA 5EYDA 4RVLA 1URWA 3BQRA 4FVRA 2JAMA 1OIRA 3FBVA 3RVGA 1GIIA 4ITIA 4F7SA 4QRCA 3F2RA 5I9YA 4RIOA 1OIUA 1XKKA 3KB7A 1KE5A 3O23A 4CLIA 2BRHA 3NGAA 3MIAA 4RC2A 3C7QA 2GMXA 3LXNA 5FBOA 5IQIA 4QP8A 4LM5A 5J7BA 2QOQA 1GOLA 2X6DA 3ZM4A 3HP2A 1IEPA 1M7QA 1TQPA 4JR3A 5HVYA 5JKGA 2WPAA 2G2IA 3R8MA 1GZ8A 1J7LA 5IQBA 4NW5A 4LL0A 5I9XA 2DYLA 4AE9A 4C0TA 4F9YA 3W8QA 4O83A 4RA5A 3RPYA 3VRYA 5JEBA 4IAAA 3L8PA 3FYKX 2J5EA 2EVAA 2X6EA 2PMOX 1PXJA 5AUWA 5BYYA 2J51A 1P5EA 1EH4A 3AC4A 5F4NA 4D5HA 3B8QA 4I6FA 1BX6A 2RIOA 4FKJA 4EUUA 3O2MA 4X2KA 1M52A 3QRKA 2QURA 2OZOA 2C4GA 2WOTA 4KSPA 1ZZ2A 4FKTA 4GL9A 4BGQA 4DC2A 5HO7A 2HZNA 2PZYA 5TO8A 3Q52A 4XG9A 2CNUA 2I0VA 4GVJA 4APPA 4EQUA 3HMOA 1ZOEA 1YWRA 1PXOA 2JKOA 5I3OA 4BCMA 4I94A 2XB7A 2EXCX 3QD2B 2CKPA 2YJRA 3WZJA 4GYGA 5BVEA 3ZLXA 5ETFA 4AA4A 5A54A 1VEBA 3W2QA 2C6TA 4FNXA 3FEGA 3LFQA 2I6LA 4O0UA 4V0GA 3LCTA 5A6OA 5CAOA 4D2PA 2XNMA 2YDIA 2WTVA 4FZ6A 2X7FA 4JS8A 3UOJA 2R2PA 4UXQA 3RPOA 5E9EA 4BY9E 3BE2A 3UOKA 5CF4A 4BTMA 3MH3A 3PRFA 3ITZA 5EKNA 5HLPA 3BI6A 4U79A 3FWQA 3WYXA 4UX9A 4IEBA 4XOZA 3OCGA 2RFDA 4RG0A 3E63A 3ETAA 5CENA 3I60A 1YHWA 2VTSA 2WNTA 2VTMA 5E8VA 2HZ4A 1FBNA 3T9IA 3ZO1A 3V6RA 4PTCA 2YZLA 5EM6A 4A9SA 2ZJWA 3QL8A 5DIAA 3W33A 1KV2A 4FG7A 4FIHA 4Y85A 1ZARA 5L6OA 2UW9A 4XV1A 3PP1A 4Y95A 4X3FC 4IJ9A 2HAKA 3GU8A 3JPVA 4AZFA 3ALNA 4HJOA 2C5OA 2X7GA 4NUSA 4JIKA 4J1RA 3NLBA 2IVSA 3HV5A 4ZS0A 2PPQA 2YAAA 4OUCA 1YI6A 2Z7QA 4DGOA 4ZLZA 1PW2A 2C1AA 4YC6A 2XIKA 5FQDC 3SXRA 4XHKB 3EZRA 4TWNA 4UMTA 3W55A 4EONA 4ZEGA 3R7GA 2XNBA 3G90X 3EH9A 2F7XE 3HVCA 2OF2A 4MX9A 4BYIA 1F5QA 3FLZA 5M4FA 1IA9A 1OB3A 1STCE 2GFCA 4G5PA 4AW2A 4F99A 5JGBA 2F2UA 3BU3A 2X4ZA 4QNAA 3G15A 4KINA 4QMZA 5B0XA 2XM8A 2IPXA 2VTAA 1Y8YA 4U0IA 2R9SA 2W5HA 3O0GA 1BL7A 2ETKA 4MAOA 4BKYA 4QP9A 1CTPE 3WIGA 3CY3A 4PL3A 2HENA 3HMIA 5H9BA 4D9UA 2XBAA 3VS0A 5J1VA 4DN5A 4FEVA 5EM7A 2XUUA 4LOOA 2R7IA 2XBJA 3R28A 1IAJA 3QWJA 2BTRA 3GCVA 3QTRA 2JKMA 4CFWA 1XH9A 2JKQA 3D2KA 3DZQA 4OTIA 2PYWA 4O82A 4IE9A 2A19B 1RQQA 3R2BA 4JBQA 4ASDA 2WQBA 5D1JA 4XG4A 2FVDA 3F3ZA 2CMWA 4PP9A 4UALA 4R7HA 3MS9A 4L01A 3DFAA 3PY0A 1SVEA 3IW7A 2J0KA 3V04A 4I24A 5FDXA 4ZJIA 3SXFA 3EQIA 3NUXA 3BZ3A 2QODA 4D2VA 4CKIA 4GH2A 4J52A 4LRJA 4YZBA 4A9UA 4YR8A 4ANBA 4J7BA 4JG7A 5BQ0A 5KX8A 3OP5A 4ZSAA 2Y9QA 1DAWA 4FTCA 3PZHA 3ZLWA 3WOWA 1CDKA 1REKA 2OZAB 5AM6A 5EOLA 4CD0A 3KQ7A 3L8XA 4KBKA 3ZH8A 2DUVA 4KWPA 4B6LA 2QONA 4LUDA 4UWYA 4TL0A 2EB2A 4BDEA 4F1TA 2WTDA 3SHEA 1YVJA 4QMPA 3LLTA 3FKNA 4CFMA 5EYMA 4AOJA 1JSTA 5EOBA 1S9JA 4FK3A 5DR6A 4AW0A 2P33A 4BI2A 4NM7A 4WG5A 4XEYA 4FGRA 4IHPA 3DTCA 4F7NA 5BYZA 3DBFA 3QZGA 5CQWA 2ERZE 4FTJA 3MVLA 4DF3A 2YLFA 5FEDA 1BL6A 3LM5A 3POOA 3NZ0A 5A4CA 4FTLA 3SGCA 3IDPA 3R0TA 3TJDA 4BIBA 1H1WA 2J2IB 2R4BA 3PLAE 3NMUF 2BCJA 4Q9ZA 2PUNA 1CMKE 4L42A 2Y4IB 1IR3A 3G9LX 3NW5A 4H3QA 3ATSA 3DXNA 3ZZEA 3BV2A 4YTCA 4BCGA 4RIWB 5KMMA 2XRUA 2R3JA 3VIDA 4BL1A 4EORA 4NM5A 2XIYA 3FI4A 5EHLA 3QQUA 4WUAA 3Q4UA 5J79A 3HMPA 4ANMA 5IPJA 3CC6A 2BRMA 2XNEA 3LFEA 3VUDA 3ZRKA 5IH5A 4ZZNA 5M4UA 4F9BA 2C5YA 3A60A 3MH0A 4QP3A 3MPTA 5AUTA 2CNQA 4JDJA 3JUHA 4TXCA 2Z8CA 3SW4A 5A46A 1ZYJA 1OPLA 3G33A 4LV8A 3W2OA 5LVOA 1M7NA 4L67A 1KE8A 2RG6A 3FAAA 3I6WA 3I1AA 2BPMA 2WQNA 4TYJA 3CQUA 3FZOA 4RC3A 3Q5IA 2FA2A 4L3PA 4TNDA 5FRIA 4TWCA 4K18A 4CYJA 4FTIA 4MK0A 5A4EA 4RPVA 2CKEA 3SW7A 5IISA 3MWUA 1UNGA 4I1ZA 4ZY6A 5IEVA 3FMJA 2F2CB 1NT2A 1FVRA 2Y0AA 2GS2A 3MH1A 3NR9A 4PDSA 3A7HA 3BGZA 3MIYA 4DTKA 3OWPA 2XYUA 4ZP5A 2PL0A 3IONA 3H0ZA 2OH4A 2WOUA 2OJGA 3KN5A 3L1SA 4L44A 4QQJA 4XG7A 5CU3A 4AN9A 4YPSA 3AC2A 3DKFA 2X8EA 4FBXA 1W98A 2W1ZA 3GGFA 3DLSA 1RE8A 3QUDA 4KKHA 2VTOA 4CFVA 1H1RA 2OGVA 4NIFB 4AZVA 4F65A 4UMUA 4BR3A 4JX3A 1J1BA 2PVNA 2YFXA 3DBCA 4BN1A 4O7WA 5CEOA 3MW1A 3IW4A 3ANRA 4IADA 4IVDA 3ZRMA 1PXIA 2UW3A 2R3MA 2XCKA 5FEEA 3WILA 4AUAA 4RWJA 4IWPA 1W82A 2XK9A 4OTQA 4IDVA 4D4YA 2O65A 3ZLSA 4EH4A 4O7RA 3PIYA 4BC6A 5CAQA 3UZRA 5AAFA 5EI2A 3GCPA 4FICA 4EH6A 3Q9XA 5K5XA 3GEQA 2B54A 2C6IA 4F64A 4QMNA 3TXOA 4AZTA 3VJOA 3SVVA 4RJ3A 5AX9A 3U55A 3QXOA 1RW8A 5A9UA 4PL5A 5J9YA 3B8RA 2IW8A 4CCUA 4N0SA 3CP9A 4I6HA 4FNYA 4HVDA 1JVPP 1GIJA 3F7WA 3V5JA 4Z7HA 3F69A 4AN3A 4H39A 4O7SA 2X9FA 3ZSIA 2C3IB 4YO6A 5HG8A 5CYIA 2WTKC 4RIWA 4MD7E 4Z3VA 2JFMA 5H8GA 2J4ZA 4P7EA 3ALOA 3GFWA 5DPVA 2G2FA 4XG8A 3ZXZA 1OVEA 3F9NA 3KRLA 5T68A 4DFUA 1IA8A 3GBZA 2NRYA 4TY1A 3LZBA 4YBKA 4CTBA 3D0EA 3PJCA 3UJGA 3W18A 4M12A 4WOVA 3DNEA 4GV1A 4Y83A 4O21A 4AG8A 4RWKA 3GU7A 1KE7A 3POZA 5EM8A 3PE1A 3A99A 2OI4X 4J8MA 5IUIA 4YZ9A 2ITZA 3UIXA 5IH6A 1A48A 2F57A 1VYWA 3HZTA 3QTQA 3FQHA 3MTFA 5FEQA 1H00A 1PY5A 5HE3A 3L9MA 2PHKA 4CTCA 1UU8A 4GW8A 2YIWA 4FNZA 4ITJA 4JBPA 3MFRA 4E4MA 3EL7A 4D4SA 3G5DA 4U7ZA 5IF1A 2C3LA 3TIZA 2B4SB 1XBCA 1Q8YA 1V0PA 1M2QA 4ZS4A 1Q62A 1DAYA 4FV3A 4M69B 5GIPE 4O38A 3UNJA 1Q41A 3U4WA 3UTOA 3QZHA 3ET7A 3QC4A 3VW6A 4C57A 3AT4A 3P4KA 3NW6A 3EN9A 1WBWA 3TM0A 3MVHA 3HNGA 4WA9A 5FXSA 4A4XA 4AZEA 2PZRA 4EJNA 1G8AA 4XJ0A 2JIVA 2QOHA 3TDVA 4FSWA 4MBIA 2GQGA 2JDOA 3QCYA 3FLNC 3FV8A 3RP9A 1PXPA 4CV9A 4Z7GA 3C4XA 4PV0A 4GYIA 4HCUA 2R0UA 3ROCA 1OZ1A 5HNIX 3AD5A 2Y7JA 1Q99A 4X21A 3QYZA 4RJ7A 4GFOA 4JRVA 3TV4A 2Z02A 4ERKA 5EQPA 1YW2A 4F9WA 2YM7A 5J5TA 1M14A 3TZMA 4I23A 4OTWA 3TIYA 4LGDA 3VUGA 4M66A 4YTIA 2RL5A 4C35A 5FDPA 2J9MA 4UB7A 3UVRA 4D0XA 2QG7A 1YDSE 4RX5A 3LLAA 3MPMA 1UU9A 5CT7A 5AFVA 4UBAA 2JIIA 3KK9A 4EQCA 5JK3A 4WBOA 2PUPA 5K3YA 4M13A 2FO0A 4QP7A 5E8ZA 4GK3A 2WMSA 3EFLA 2YABA 5FLFA 2W4KA 4IFGA 4QTAA 4BCIA 2XA4A 4IFCA 3OEZA 2C5XA 2QR7A 3E7VA 5AJQA 2GQSA 1FGIA 4X3FB 3C4EA 2VTPA 2X0GA 4IWDA 2BZIB 4FZFB 4F6WA 3KU2A 4FKUA 2GNFA 4N6ZA 2EU9A 4KABA 4ZSJA 3FXWA 3HMMA 2BKKA 3K3JA 3Q60A 5IH4A 4CCBA 5IQEA 4R3PA 4C8BA 3AT3A 3KRRA 3KC3A 4PL4A 4QYYA 3AOXA 4E6CA 3CD8A 5ICPA 3G2FA 3ORZA 5DYJA 2JIUA 4DBXA 5IQGA 3BLHA 4ANSA 5EYKA 4A9TA 3MBLA 4KAOA 4GU6A 4MF1A 2GTNA 2YIRA 3G9NA 2UVYA 3ORLA 3AXWA 3L9LA 1YDTE 2EXEA 3BHHA 4FI1A 1UV5A 4KBCA 2WMWA 4FF8A 4X7QA 3BWFA 5KMKA 4QP4A 2P2IA 3R7UA 3HP5A 2HY0A 3LQ8A 2IW9A 4F9CA 1FVTA 4XRLA 2ONLC 3A62A 5KE0A 1H1SA 3ZDIA 4RGJA 2VN9A 3OCBA 3QTSA 2BKZA 4KIOA 3NW7A 3Q04A 4XCUA 4O7LA 4IJPA 1RJBA 2J5FA 3GVUA 5CS6A 4RVKA 5CF5A 3CPBA 1J7IA 4IAZA 4E6DA 3BLRA 2HCKA 4NTTA 4ITHA 2AUHA 4C4JA 4GK4A 2F9GA 4FKWA 5L2IA 3O96A 4TWOA 3HX4A 5ANEA 5I3RA 3R7IA 2ITUA 4IMYA 3CGFA 4ZSEA 4G9RA 2QCSA 2X9EA 5B2KA 2GTMA 5EW3A 3ELJA 4LRMA 4AZSA 2X7OA 3V5WA 3AC5A 3VHEA 3QD0A 3COIA 4IVAA 2BZJA 3I4BA 3M1SA 2XKCA 3HDMA 4JVGA 4CV8A 3TJCA 4ENXA 5HVJA 2Z7SA 5EM5A 3EFJA 4IC7A 5JZNA 4QMYA 4FSTA 3GQLA 3RPVA 4DG3E 2I0EA 3CQEA 2X81A 3FQEA 2W99B 3NIZA 2R3FA 1UA2A 4ORKA 2V7OA 1ZMUA 2W1IA 3HLLA 5JGAA 1SNUA 3C4ZA 3UZTA 2F7EE 3W2RA 3O8UA 1NW1A 3CCNA 4G3CA 4EH8A 3OOMA 4LQMA 3KRXA 3OFMA 1H0WA 5FXQA 2YWPA 1SM2A 3HV4A 4EK4A 3A8XA 2QHNA 3FLSA 2R7BA 3LFAA 4IX5A 5CNOA 2IN6A 3RNIA 3PXKA 4GVAA 4HGTA 4GG7A 4FMQA 2OF4A 3A4OX 4O6EA 3MSSA 3UQGA 4L00A 4Y72A 4D5KA 2P2HA 3ACJA 4D4VA 5KBQA 4O1OA 3HDNA 1E1VA 3OT3A 3QUPA 3QZFA 5M55A 2PVYA 1Y6AA 4W9WA 4AFJA 5LCJA 5LJJA 3DA6A 2ZOQA 4G6OA 3F7ZA 2WTCA 3NVMB 4FE2A 4K1BA 4JDKA 5DHJA 3H9FA 3RHXA 2EB3A 3FZPA 1CKJA 3PXFA 4M8TA 5AMNA 3ZC5A 3BYOA 4DBNA 5CXZA 4MQ1A 3JYAA 1UWJA 3DV3A 5IQAA 4EWQA 2C6EA 1J7UA 3U51A 4YJPA 3KEXA 4FSUA 4JG6A 3RZFA 3PVGA 1MRYA 2XS0A 3LCOA 2ACXA 3QUEA 3I7CA 4LOQA 3U8WA 3K5UA 4C38A 2H8HA 3NRMA 4KNBA 1ZY5A 2GPHA 3GFEA 3K5VA 4GMYA 3D5VA 2CSNA 3HECA 5IA1A 5J9ZA 5BVKA 3C0GA 3HGKA 2W4JA 3VN9A 3UIUA 1P4FA 4KUJA 2R3KA 4EOIA 2VU3A 5AR7A 4MNFA 4K9YA 3GC0A 3VC4A 2YERA 5ACBC 4V04A 5HORA 1H4LA 1T46A 2JC6A 4FTRA 4QO9A 4R5SA 4YC3A 1Q8UA 4I41A 4U44A 2XF0A 4U3YA 3QQJA 3BWJA 4O0VA 4WO5A 2OZAA 4DEHA 3EJ1A 3E62A 3WF7A 3R9NA 3NDMA 5AP3A 5FGKA 4EH2A 2R3RA 2W5BA 3MDYA 4FUYA 3D7TA 4K6ZA 4BGHA 3SKCA 5AUUA 4FIFA 3LFCA 2B9IA 2RG5A 3KMUA 4B0GA 2OIQA 2B1PA 2ESMA 3MN3A 3NS9A 4MQ2A 4U5JA 4EHGA 4HW7A 2IG7A 3FI3A 1UKIA 2W1CA 2BFXA 1CKPA 5I5ZA 3KRJA 2QO2A 3S1HA 2J0LA 1WBOA 5CXHA 3QTIA 3WF5A 4EOSA 3KXNA 2UZLA 3LKMA 1NVRA 4M3QA 4I22A 5B2LA 2ZVAA 4C4GA 4I92A 4IZ5A 4F0GA 1PF8A 3COMA 3UNKA 4HYIA 1QMZA 4D1ZA 3KA0A 4EOPA 4RVTA 3JY9A 4JAIA 4NZWB 3ROYA 5L2QA 1K3AA 5FP5A 5AR5A 1JAMA 3PJ1A 4II5A 4CQGA 2OIDA 1ND4A 4R8QA 4A7CA 5AP4A 5DA3A 5AV4A 4OTFA 4U41A 5FBNC 4ENYA 2HOGA 3U54A 3DZOA 2JEDA 2B52A 4LL5A 4F0FA 4FL3A 1GZKA 1OIQA 4EBWA 2BDJA 4I5HA 2OK1A 1OIYA 3GI3A 4RIXB 5EQYA 1WMKA 3TKHA 1XJDA 4LG4A 3TG1A 4TWPA 5LOHA 2FUMA 5CZIA 5HCZA 3RAIA 1JQHA 1OECA 1W7HA 2QU5A 2DS1A 3KKVA 4N57A 3VBQA 2GFSA 4OT5A 3ZFMA 3ENHA 4U97A 5CSVA 2C5VA 2HZ0A 5E7RA 3QKKA 3FC2A 5BYLA 2QOOA 1DI9A 2OO8X 1AD5A 3IQ7A 3TUDA 5E4HA 1FOTA 1XQZA 1YXVA 5CLPA 3MYGA 3KMWA 5DBXA 2C6LA 3IKAA 2XIRA 4PNIA 3TV7A 4D4RA 3HRFA 4W4WA 3FZRA 2XZSA 2BHEA 4O2PA 1Q4LA 5J9LA 2RSVA 3MFTA 1U59A 5H3QA 4RIXA 1YWVA 4MTAA 5HU3A 2YCFA 3CJGA 1YHVA 4FG9A 2H6DA 3I0QA 4QMTA 1TVOA 3OW3A 3UO6A 3PXRA 4I3ZA 3HL7A 4OTDA 3ZO3A 3OUNB 4EK3A 2R3IA 2QD9A 4DG2E 1GZOA 3A2CA 4XMOA 4ZTSA 3WF6A 1W8CA 4JJRA 4IWQA 4AA0A 1MQ4A 3HYHA 3QQFA 1B39A 3CJFA 4P90A 1JKKA 4FT3A 3OG7A 4QMOA 2A2AA 4GSBA 4QMQA 5IMEA 3Q3BA 4AF3A 3P7CA 4AGCA 3ZFXA 4O0TA 1BI8A 1K9AA 4E4XA 3BYMA 2VV9A 2OWBA 3IECA 3LAUA 4H1MA 4BBFA 5IUHA 5KNJA 3BQCA 4WUNA 4NFNA 1L3RE 3AMYA 1H07A 3QLFA 2VWZA 2UZTA 2E9VA 3IOPA 4CMOA 1KV1A 4E3CA 1XH6A 4CT1A 2JDVA 2OFVA 2Y4IC 2PUUA 3M42A 1XHAA 3AT2A 3U9CA 4O7ZA 2XRWA 5D11A 1Q8TA 2FH9A 3EHAA 5EHOA 1H1QA 4MEDA 5JFVA 3U4UA 1AGWA 3FMDA 3OROA 3QU0A 4Z55A 2QKRA 4XG3A 4G1WA 1M2PA 4L53A 5HX6A 3KXMA 4MXZA 3LW0A 3RMFA 3DOGA 2VTQA 4XP3A 2ZAZA 5CAPA 2F49A 3OD6X 4ARKA 3E88A 3DQWA 4U81A 1SYKA 1XH5A 2ZB1A 3E3BX 3PY1A 4HOKA 4AQCA 3MFUA 3MY1A 2IVUA 3FXXA 3LIJA 5JRSA 5L3AA 2C1BA 4M68A 1FQ1B 3ORIA 4IAIA 4QPSA 5J8IA 2YM3A 5HZNA 2VX1A 4JAJA 5BVWA 4CZYB 2VZ6A 5AA9A 5K4IA 3H3CA 2B7AA 4I6QA 1W84A 1J3HA 2FSMX 4H58A 3W8LA 3ZDUA 4UY9A 4AOIA 2B9HA 3MVMA 2PE2A 5CY3A 3E93A 3BHYA 4L45A 2XJ1A 5EDRA 3GCUA 2JGZA 4RLKA 2YJSA 3NYOA 1PMNA 4JQ8A 4QYHA 5GZ8A 2GS6A 3EN5A 3WZDA 4FV8A 3TI1A 3ZYAA 1GZNA 4BVUA 2YDJA 3ENMA 4E8AA 4FIIA 4PNKA 1SMHA 2WFYA 2XK3A 3OVVA 4YC8A 4L52A 3V5PA 5ANIA 3A8WA 1ZMWA 1BI7A 3S00A 5M57A 2UW8A 4ANNA 2QU6A 3PUPA 4I20A 4MKCA 4M0YA 3DAKA 4HYSA 4C59A 2VTHA 4X3FA 4FEUA 5AP1A 5HI2A 2OBJA 4F7LA 3F5XA 3FSFA 5CVFA 2V55A 4C3PA 3D94A 5LVLA 2PMLX 4GFMA 2QOKA 4QPAA 1BLXA 4JXFA 4OLIA 3REPA 4D28A 3C0HA 3F3WA 2GCDA 3QRTA 2R3QA 2A4LA 2BDFA 3H10A 4YJQA 2E9NA 1UVRA 1Y91A 4MWIA 4YUQA 4Z9LA 4EUTA 5CEKA 2YIYA 5GZ9A 3RWQA 3VS6A 2VRXA 4CQEA 4BZDA 5AP2A 3FMNA 4F63A 3EL8A 3UO5A 2NPQA 3RWPA 5HD4A 2EUFB 4WT6A 3ULIA 5M44A 2BDWA 5HOAA 1J1CA 4BDIA 3RM7A 5HO6A 2R3NA 1OITA 4HZRA 2VNWA 3SRVA 4D2RA 4L3JA 4QYEA 2UZNA 3QX4A 3R9HA 4DITA 3KY2A 3F61A 1U4DA 5AP5A 3HKOA 4F0IA 1JOWB 3MJ2A 4UZHA 2C0IA 5D7VA 4BCKA 3IG7A 1YXSA 2C5NA 4AX8A 3ZEWA 4D1SA 2P3GX 2WQOA 4NJ3A 4BDKA 5DOSA 5LVPA 4F70A 3IW8A 4DFLA 3PWDA 3NYVA 2QC6A 1WCCA 3RAWA 4C3FA 3HAVA 2J7TA 2WEVA 3UOLA 4D0WA 4TRLA 4IX6A 1YHSA 3FY0A 3QA8A 3LE6A 2YM4A 2CLQA 2GDOA 3BYSA 3QF9A 2YITA 1FGKA 3PA4A 5DH3A 4DCEA 3KULB 2GNGA 2QO7A 4FTUA 3MESA 3EN6A 3ZCLA 1F0QA 1ZOHA 3OY1A 2OH0E 5HQ0A 2UW7A 4XUFA 4EOLA 1MQBA 3DT1A 3AD4A 4QTBA 1R78A 4Q5HA 3R02A 5TF9A 4A4OA 3R21A 2CJMA 5EI8A 3EQCA 1PHKA 4RT7A 4RX7A 4ZXTA 3Q53A 4RQVA 3LQ3A 5KBRA 3RKBA 5CI6A 5F20A 4DFZE 4FKRA 3PWYA 4Y8DA 5E1EA 3FI8A 4B99A 4O0RA 4V01A 3R1SA 1H27A 1UNLA 1XWSA 2C6MA 1U5RA 3OXIA 4NM3A 3LJ1A 3GUBA 4QMSA 5CVGA 3Q4CA 2PVKA 3Q96A 4JQ7A 5DRBA 2J0JA 3TT0A 3AG9A 4FL1A 3LPBA 1S9IA 4RMZA 4H1JA 4F08A 4YMJA 2ITWA 4L6QA 4BIDA 2WMVA 3QD4A 1UWHA 4FOBA 4Q2AA 2UW0A 2Y4PA 3F3TA 3QWKA 4C62A 3NUPA 2YA9A 1ATPE 5IUGA 2XK6A 2CN8A 5F9EA 3SG8A 1YXUA 4YLLA 3R83A 3OZ6A 5M06A 1QCFA 2QHMA 4CFXA 2BIKB 1KSWA 4KA3A 3UGCA 5M51A 3QQHA 3PY3A 4DGNA 5IQCA 4ZSGA 4B8LA 4AT5A 4ZLYA 2WMBA 3UC3A 1NVSA 3OWLA 5E8WA 3ZO2A 5CSXA 5I9UA 3OY3A 4HGLA 4EJ7A 3LFSA 2IZRA 3H9OA 3L8VA 4IB0A 4NEUA 5TE0A 4PX6A 4BDFA 1H1PA 3HV3A 4OBQA 4P5ZA 2W9FB 4XP2A 3ORPA 2WB8A 4DCAA 4FV4A 3CGOA 1UU7A 3P86A 3PP0A 4N70A 4J99A 4HPTE 4FSYA 4O0SA 3EQBA 4RJ4A 3EQDA 5AUXA 3F3VA 2W4OA 5E8XA 4AAAA 4FKSA 5FM2A 4ZIMA 4DA5A 2XIZA 2V7AA 2J0IA 4FR4A 2X8DA 2ZDTA 4BIEA 1ZYDA 2ZM3A 4L9IA 2C69A 4NSTA 3GU5A 3FJQE 4AWIA 2HWPA 3W32A 4IAFA 5FXRA 2W1EA 1U5QA 4GJ3A 1JLUE 2OFUA 2PTKA 3FMKA 2UZVA 3BEAA 3I79A 1YOMA 3EYHA 2JITA 3OC1A 4X6QC 1M2RA 2PZPA 3ORKA 4KRCA 4FKPA 4PWNA 2XKFA 1H28A 3NNUA 5I0BA 4DFYA 1JNKA 3NCZA 3GU4A 3FKLA 4FTQA 4LOPA 4AU8A 2XK8A 4BWPA 1LEWA 4EHEA 4EOQA 5A4LA 4HNIA 2UW4A 2VWWA 3OF0A 3RPRA 2EXMA 5GZAA 4EEVA 5CI7A 3ZBXA 2YDKA 2C0OA 5J95A 2AC5A 4G6NA 3QXPA 2VTLA 5DMZA 4MD9E 1OGUA 4GFGA 2B9JA 5HESA 3TV6A 3ZS5A 3QALE 2WTWA 4IX4A 4F09A 1RDQE 2YEXA 2R3PA 2JD5A 3L8SA 4G9CA 4BCPA 5BUJA 4GUEA 3RM6A 5LWMA 4WNOA 3R7YA 3VF8A 2CHLA 5M09A 4KS8A 1O9UA 3PTGA 4FIGA 5A4QA 4ACCA 3QCQA 3BU6A 3QCSA 4PPAA 4ACMA 4KKGA 4Y5QA 4ZZOA 3TNWA 5IG1A 2CCHA 4AGDA 2OXYA 1ZWSA 4DGLC 1FINA 4DTAA 3FY2A 3SD0A 4CRLA 3OT8A 2BAJA 2ITYA 3PXQA 5E92A 5L8KA 1JKTA 3FLYA 3DY7A 4UYAA 1UKHA 4O0WA 3ZXTA 4X2FA 2HYYA 3QQKA 2AYPA 5CU0A 1GJOA 2BALA 3W2PA 5LMBA 3TZ7A 3BBTB 5LQFA 5C8MA 3BV3A 2NP8A 3QKMA 4ZTHA 4PDOA 1OL5A 3FQSA 3AMBA 3ZO4A 3JVSA 3QHRA 5AP0A 1VYZA 2ETMA 4E4NA 2J90A 4KIPA 3O50A 4GT4A 2GS7A 4QNYA 4FODA 5IMXA 2C47A 1JWHA 3R9OA 2H96A 3TKIA 2XKEA 1Y57A 3V8SA 3WE4A 3BYVA 5FWKK 3Q9YA 5HG9A 2NNWB 2BROA 4YHJA 1TQIA 2F7ZE 3OXZA 3DKOA 3QRUA
chains in the Genus database with same CATH superfamily
4QQ5A 2H34A 2A1AB 4O81A 4BWKA 2A0CX 2J0MB 4FTTA 5HD7A 5JN2A 3OWJA 3PDTA 3VF9A 2FSTX 5L6WL 4YHFA 4AT3A 2YISA 4FV2A 4C58A 3HAMA 3OCTA 1OKZA 4MXYA 2ZM1A 3EYGA 2XEZA 2C3JA 3QKLA 4Y46A 1A9UA 3DDPA 5HEZA 3G51A 3DXPA 5DRDA 4CNHA 4OAUC 2RKUA 3ZUTA 5C01A 4BKJA 4FKGA 4CXAA 5KMJA 3AMAA 3MY5A 4F1MA 3WIKA 3GENA 5LVNA 4M67A 4I4FA 4YGAA 2KTYA 5CALA 2YM5A 3LFBA 3QAME 4KIQA 4RFYA 3UP2A 3KXZA 4DINA 5IZFA 3P5JC 4B7TA 4M97A 5GJDA 4AACA 1Q3WA 2FYSA 2HELA 2R3LA 3UPZA 4ERWA 4CG9A 3LVPA 2G1TA 3SOCA 2PVJA 1VR2A 3QCXA 3TCPA 5C26A 2XK7A 4B9DA 3I6UA 3N4UA 3HEGA 2BZKB 3NEWA 1OGYA 3W2CA 2ITPA 4I0SA 5HE0A 1SNXA 4FV7A 3CTHA 3LQ5A 4FTMA 2WMRA 3C5UA 5BX0A 1QPEA 5DGZA 3JR1A 5DT3A 4BDJA 3QRJA 2ZFYA 1R0PA 1ZYLA 3FPMA 1ST0A 5FD2A 3VS7A 4FT0A 2YM6A 3ANQA 3QYWA 5HIEA 5TOZA 4ZMFA 4YJVA 4E73A 4TPTA 4AT4A 2OU7A 1UNHA 2CGWA 2QLUA 4O1PA 3NSZA 4AXAA 3QBNA 3Q9ZA 4J98A 4JX7A 3R01A 1BKXA 4RBLA 4YJRA 3D9VA 3U6JA 3EIDA 4JOAA 4PMTA 4X6RA 5BVFA 3TUCA 3DPKA 4BI1A 4LRKA 4W8EA 3I5ZA 1BUHA 4LGGA 4BJJB 3UODA 3KCFA 2VGPA 2P0CA 3EQFA 3CTJA 4DH3A 3NPCA 3ORNA 4NU1A 5HTIA 3UE4A 4XLIA 4C3RA 2I1MA 5ANGA 3VRZA 5L2TA 4BYJA 2GHMA 2F4JA 3EN4A 5CANA 5KMLA 1G8KA 4DLIA 2VGOA 5BVNA 4A4LA 4ANOA 4OTRA 4R3RA 3VS4A 5HU9A 3E7OA 3DKCA 4IIRA 3ZC6A 4AW1A 4PP7A 5KMNA 3QTZA 4NM0A 3SRVB 5KO1A 3TZ8A 2VWUA 2B9FA 1I09A 4Q5EA 3P78A 3IS5A 2ZB0A 3N9XA 2W05A 4ZSLA 2NRUA 3V51A 4BBMA 5EDPA 1LPUA 1P14A 4USEA 3KMMA 3DNDA 1I44A 2X0QA 3E3PA 3QGYA 5E91A 3Q32A 5HICA 2W17A 4R1YA 4CKJA 5BMSA 4HGEA 3BL7A 1H26A 1P4OA 3UOHA 2UZWE 1G3NA 3OXTA 4QMWA 5ACKA 4C37A 4ZAUA 2V62A 1Z9XA 2ZV8A 3DTWA 2BR1A 2WMTA 2YCSA 4LDTA 4W8DA 3C0IA 3D4QA 1DS5A 3VVHA 3C9WA 4EZ5A 3CQWA 2W5AA 4D2SA 4OTPA 2VTTA 4YU2A 2I0HA 1XR1A 1PKGA 5HCYA 4BWXA 3DK6A 3R8PA 3RINA 3FSKA 4UXLA 3EQPA 3DXQA 1H08A 2HW7A 3LOKA 4RJ6A 5HE1A 3UG2A 4NK9A 4AN2A 4FIEA 2WMXA 3QRIA 3R7VA 4FUXA 4X0MA 2FSOX 2X2LA 3QGWA 3R22A 4K8AA 4M7IA 4C2WA 5JH6A 2VO6A 3KVWA 1WBPA 3Q9WA 4LMUA 5G6VA 3UMWA 3HUBA 2O64A 1MRVA 3A4PA 2QOFA 4M69A 4O0YA 1KE9A 5LARA 4O86A 1J91A 1LEZA 3UVQA 3CEKA 2ZV7A 4E26A 3EKKA 3P23A 2W0JA 2WMAA 4MBJA 4A07A 2Z60A 5AUZA 2W1FA 3ORMA 5BVOA 4EH3A 2GHGA 3DBEA 2UVXA 5KZIA 2X39A 3FHIA 4EHZA 4X3JA 3KF4A 3VUHA 4EOKA 4BB4A 2QOIA 1NY3A 4I0RA 4L7FA 3C51A 5IDNA 4TKSA 4BDGA 4N6YA 3MH2A 5A6NA 4I5CA 4RX8A 5HX8A 3D7TB 3V6SA 3TACA 1HOWA 4RFMA 2IJMA 1ZY4A 4G3EA 4OBPA 1XH8A 1BMKA 1FVVA 4PF4A 2ZM4A 3P9JA 2YCQA 2Q0BA 3JVRA 2C3KA 2OIBA 2XAOA 2XCHA 4G34A 3MTLA 1YWNA 5FM3A 3WF8A 3SAYA 3NWWA 4TT7A 2O3PA 1WFCA 5CF6A 3FL4A 4K33A 4D1XA 4O7NA 2VUWA 4O2ZA 3H4JA 3SLSA 4WRGA 4EHVA 3A7JA 4QDEA 3O7LD 1WBTA 4G16A 5AIKA 2J50A 3GC7A 2Y6MA 2UZEA 1OM1A 5F94A 5CASA 4M14A 3A7FA 3L9NA 3B2TA 3OUKA 3PE2A 2BRNA 4IZAA 3R7EA 3AD6A 4BCHA 4UMPA 4RZVA 2ITOA 5D7AA 5ETCA 3IDBA 1KE6A 2CLXA 2JDSA 3OW4A 4J8NA 5EYCA 3TEIA 1SZMA 1R3CA 1T45A 4G3FA 4IB1A 4CGAA 4FVQA 2HWOA 3CIKA 2W1HA 5HCXA 4E4LA 5FTGA 2CCIA 3FHRA 4W4VA 4ZK5A 4BDBA 1JPAA 1W0XC 4FEQA 4QD6A 1PRYA 2PWLA 1Q97A 1ZLTA 1ZAOA 4K77A 2XNOA 4R7IA 3DS6A 4ZTQA 2WMUA 3HA6A 3UVPA 5CSWA 4BBEA 1ZRZA 2WZJA 5IA2A 4HVIA 3VUMA 3DAEA 1OUKA 4HVHA 3TDWA 4EC9A 3Q2JA 3VS5A 3ZSHA 4YNEA 4WSQA 4HYUA 4DGMA 4FZAB 1NXKA 1VLRA 3QTWA 3FKOA 5CU2A 4CRSA 3QLGA 4XLVA 3WARA 3KRWA 4JDHA 3QFVA 3DLZA 4BTFA 4JT3A 1IG1A 2E2BA 2X8IA 3GC8A 4IM3A 2JKKA 3ZZWA 2B55A 5DN3A 5AUVA 1O6LA 4PMSA 3CTQA 4JL9A 4BCQA 2VO0A 4LFIA 3MB6A 4XBRA 4RC4A 2X2MA 3MA6A 3EZVA 4YLKA 3TL8A 4E5BA 2ITXA 1IAHA 4GEOA 3GU6A 5HVKA 3C4CA 4MVFA 2XKDA 3TZ9A 3SXSA 1URCA 3D14A 3E64A 3UBDA 3AC3A 2PE1A 2GNJA 3BHUA 1HCLA 5CEMA 3F3UA 4BCNA 2UZOA 3CY2A 3NNXA 5HKMA 2WIHA 5M53A 4E1ZA 4FEXA 1FMOE 2PZIA 4UMQA 4D55A 3LFNA 5HLNA 3UG1A 4I6LA 2XH5A 4AE6A 3E87A 5IEYA 4ZMEA 3MFSA 3U6IA 5LMKA 3SC1A 2Y6OA 3FZTA 4GKIA 5D41A 2HW6A 1WVXA 2XYNA 3VJNA 5EW9A 4IANA 4LGHA 3UYSA 4R77A 2RFEA 3QC9A 4H05A 4FA2A 1B38A 1OL7A 4TN6A 2UZDA 2VWBA 3UQFA 1OMWA 2R0IA 3FDNA 4YJTA 4IAKA 5KZ0A 3W16A 4NKAA 4YZMA 2WO6A 5AR3A 3F5GA 5DVRA 4LV7A 3TTJA 4UEUA 2ITVA 4DDGA 3ODYX 2HY81 2VNYA 2BZHB 2Q0NA 3Q4ZA 1H0VA 4IZYA 4MCVA 4YNOA 1QPDA 3CD3A 5TKDA 4J71A 5A3XA 2QLQA 4G17A 4YZDA 4R78A 3CSVA 4LUEA 4F6SA 3OS3A 2YCRA 4CT2A 3WI6A 4YLJA 1PJKA 4AFEA 5CX9A 4Q9SA 3BRBA 3R1YA 2PY3A 5HTBA 4BCJA 1DM2A 1YRPA 2WXVA 4EKLA 1Q61A 2VTNA 4FZDB 5GINE 3QHWA 1JKLA 4G3GA 3A61A 4ONAA 3HUCA 1PXKA 4FSRA 3C4WA 5DE2A 2JDRA 4FV1A 3AQVA 4KIKB 2WQMA 2ONLA 3R30A 2JBPA 1XBBA 4TYHB 3PG3A 2DWBA 4YSJA 2GQRA 4FKVA 5K4JA 4UN0C 3V3VA 1NVQA 4YJUA 5IQFA 4CMUA 2PMIA 1O6YA 4R6VA 3VQHA 1VZOA 4FYNA 4EYJA 4E5AX 3LFDA 3PJ3A 2PSQA 4MBLA 3LHJA 1U54A 5HBHA 1JBPE 5KCVA 2G2HA 4FSNA 2V22A 4IDTA 3ZTXA 1XMMA 3LM0A 3ZHPC 1ZYCA 4IM0A 4FKIA 4K0YA 5DNRA 1OKVA 4MD8E 5L4QA 3UDSA 2X0PA 3E5AA 4L8MA 3RAKA 2OJ9A 3O8PA 3RCJA 1Q8ZA 4FT7A 2Z7LA 4EI4A 4OR5A 2ITNA 4QEBA 5IA4A 3R00A 3DAJA 3RAHA 4JBOA 2H9VA 1FPUA 4MHAA 4BDHA 3AGLA 4JBVA 5D9HA 3MV5A 1Q8WA 4YJSA 3N4VA 4AZWA 3NNVA 5AR4A 2WIPA 3H9RA 5DR9A 4LI5A 1QPCA 4KIKA 5JFXA 5ITAA 4HPUE 2W96B 4W4YA 4JG8A 3ZUVA 4F6UA 3PRIA 5M56A 4HGSA 2LGCA 3UDZA 4A9YA 1GIHA 3MJ1A 4ZLOA 2UVZA 3A7GA 3EQHA 3D83A 3PPJA 4RJ8A 4KSQA 3VO3A 5HBEA 3FUPA 3IGOA 4WSYA 3ZSGA 5A14A 3R2YA 1YQJA 4O4DA 4BHNA 5IDPA 2YN8A 4MXOA 4KS7A 3IO7A 3EKNA 4UWCA 5HIBA 3PA5A 3R6XA 4C36A 1Y8GA 3EFKA 4ZTLA 3KFAA 3O7LB 5I9WA 5DI1A 4WD5A 4DT9A 5FG8A 1PMUA 4XV3A 2BMCA 1YOJA 4QYFA 4DTBA 3EMGA 4FX3A 4KKEA 1V0BA 3COHA 4GUBA 3S0OA 3FLQA 3FLWA 4B8MA 4EK5A 4L3LA 4FSZA 1GAGA 5LMAA 3S4QA 4QP1A 4BTKA 5KUPA 3BYUA 4D2TA 4IVCA 3P7AA 4DFBA 4EOOA 1G5SA 5AWMA 4IM2A 4DAWA 3MI9A 4OAVB 3CKXA 4QMMA 3LJ0A 5ANKA 5IQHA 4X2JA 5CWZA 3MB7A 2BFYA 4ALWA 5BUIA 2ETRA 1WVYA 3FE3A 4OGRA 5C8NA 4O7VA 2IVTA 4IBMA 1R1WA 4JLCA 4WNKA 3VS2A 1IASA 3CLYA 3HA8A 4FNWA 4QTCA 3NUYA 4IB3A 4DGGA 2WAJA 3VW8A 3IOKA 3ZLYA 4RFZA 2X2KA 4BJJA 4E5WA 5G1XA 4S2ZA 5IA5A 2CDZA 3UYTA 4BFMA 5HNBA 4M0ZA 1WZYA 3SA0A 5EKOA 2G15A 3DKGA 4FT5A 5E1SA 5AR2A 3WZKA 2PE0A 4FV9A 3PUFC 2YZAA 3OEFX 4P4CA 5CAUA 3VWAA 3NUUA 4AGUA 4WKQA 3NAYA 2HZIA 4WHZA 2REIA 1LP4A 2UW6A 3II5A 4RVMA 3FI2A 5CSHA 3S3IA 3OHTA 3VAPA 2WELA 2WTKB 3FC1X 3NAXA 3O51A 2O8YA 4FYOA 2QQ7A 3KXHA 5B7VA 2BTSA 3ODZX 1PXLA 3ORTA 5AV0A 4FSMA 4RWIA 1U54B 4V0GB 3V5QA 2B53A 3H30A 3SV0A 5CQUA 3RGFA 2HXLA 3ULZA 2QO9A 4EBVA 3NYXA 3T9TA 3PPZA 5BNJA 2V0DA 3ZONA 4CYIA 2PU8A 2OKRA 2XIXA 3IK3A 3VUIA 5IU2A 3PJ2A 3RJCA 3IGGA 5LCKA 2BRGA 3BBWA 3D5UA 3FMHA 2B0QA 3DB8A 4IX3A 4O7TA 1MP8A 1TQMA 2OW3A 3OBGA 2CGUA 4I21A 4ID7A 4CFNA 4DH1A 4XS2A 3QX2A 3RK9A 4NCTC 1OPJA 3P79A 2PMNX 5DWRA 4EQMA 4OTHA 1OBGA 1A06A 3DK3A 2I0YA 2W7XA 4C02A 4BDDA 4S30A 3KXXA 4PPBA 2ZYBA 3VQUA 5HNGA 5M08A 3RZBA 1WVWA 1V1KA 3FL5A 5IKWA 3ZMMA 3O71A 1YXXA 3LMGA 4U80A 4AP7A 3ML1A 5AV2A 4DEIA 1BYGA 3NUSA 4O4BB 5LMKC 3R71A 1GY3A 1YKRA 2WEIA 1TZDA 2W06A 3IW5A 3DU8A 5L8LA 3Q5ZA 1JKSA 2IW6A 5KMOA 3PLSA 4ASZA 3HMNA 4RA4A 2JDTA 5EI6A 4IC8A 3RALA 1JSUA 2YIXA 4EH7A 5HIDA 1YOLA 3EB0A 3EWHA 4U6RA 2BAKA 4I5PA 1E9HA 2OLCA 4RZWA 3PIXA 3R8LA 4GJ2A 4NIFA 3PYYA 3R8UA 3O8TA 3U9NA 4UV0A 4XBUA 4RLLA 4E93A 2E9OA 3WYYA 1M17A 4BHZA 3PG1A 4DEGA 5JZJA 5JFSA 3MGYA 5CEPA 3WE8A 2BRBA 4XP0A 5DG5A 3P1AA 3PIZA 4EOJA 2OJFE 3AC8A 4JNWA 4KRDA 5BVDA 5AA8A 5CVHA 1XO2B 5E8SA 4BZOA 3WF9A 3UO4A 4B4LA 3COKA 4EYMA 3PSDA 4FKQA 3T3UA 1CSNA 2IZUA 5CT0A 3VUTA 3E8EA 4NWMA 3V8TA 2ZV9A 4TW9A 1U46A 5IQDA 2SRCA 1R0EA 3I0OA 1X8BA 1OKWA 2XMYA 4G2FA 5DEWA 3R8ZA 5CF8A 5KHWA 3TNHA 2XVDA 4YJOA 2O0UA 3NVKI 5JRQA 4DG0E 4DE4A 3ZOSA 1Q3DA 4U8ZA 4PDYA 2YACA 2NO3A 4G5JA 2PVLA 2PVFA 5HTCA 3BGQA 4XOYA 4MXAA 3AGMA 3DB6A 2XJ0A 2CN5A 3TKUA 5DT4A 2VX3A 5LXMA 2HIWA 3P7BA 4JQEA 3CBLA 1QL6A 5BMMA 1W2DA 4HVSA 4MF0A 4GKHA 2XM9A 5FTOA 4IZ7A 4UWBA 3OWKA 3HV7A 3G6GA 2W9ZB 1CM8A 3MA3A 4E20A 2OSCA 4NL0A 5AAEA 2OG8A 1VJYA 4FTAA 1G8SA 3GQIA 3FYJX 3KXGA 5L2WA 2IZSA 4LV5A 4L43A 5GJFA 4ZTNA 5D12A 2PVMA 4HNFA 1SVGA 5H8BA 3SG9A 4DYMA 4UMRA 2JLDA 4NT4A 3VBVA 3ZM9A 2VX0A 4O91A 3G0EA 4KB8A 5IEXA 5CZHA 3IDCA 2OJJA 5CU4A 4C4IA 4BDCA 3BX5A 5AP7A 4EK8A 4AW5A 3C5IA 3VBTA 4YHTA 5EFQA 4OTGA 3HRCA 2XJ2A 2VD5A 2X1NA 3GP0A 4USFA 5T3QA 3KCKA 2WD1A 4BDAA 1O6KA 4RIYB 2OXXA 4EH9A 5D10A 4TZRA 2XK4A 1REJA 2VO7A 4C4HA 1OKYA 3K3IA 5CU6A 4JIAA 4O84A 4L46A 2WQEA 2G9XA 2C6DA 1PYXA 5E90A 5C27A 3RNYA 3ACKA 4GCJA 4RWLA 3E92A 3OMVA 5KHXA 2E9PA 2OJIA 4FOCA 4YZCA 5AIRA 1WBSA 2WU7A 4JI9A 3P5KA 2IZTA 4CEGA 4P2KA 3TUBA 3W10A 3FMLA 4X2GA 1Q5KA 3PXYA 3KIOC 4CFUA 2WU6A 3OTUA 2C0TA 3F2NA 3CXWA 3F82A 2XNPA 4U40A 5EDQA 4QQTA 5JSMA 5KKRC 3GT8A 1W2CA 3R73A 4FK6A 3ZEPA 5JFWA 5ETAA 3D5XA 4J53A 1WAKA 2BIYA 3WZUA 3RBWA 3PZEA 4HCTA 2ZMDA 2WGJA 4IWOA 3EQGA 4XRJA 4Y73A 3WBLA 5CAVA 3P0MA 3DDQA 4GU9A 4O4FA 2XP2A 4PY1A 3V5LA 5TT7A 5K0KA 3VNTA 3D2IA 1H25A 3WZEA 5AV1A 4F1OA 2R64A 5C03A 1JSVA 4QT1A 2C6OA 5CTPA 1CKIA 5H8EA 4DEAA 5L2SA 5HGIA 1B6CB 3FZ1A 4XNEA 1F3MC 4FV5A 4GT5A 3UQCA 5J7HA 4C2VA 4F7JA 3FMMA 3IW6A 3OOGA 4A06A 5H2UA 5E8UA 5DEYA 3UDBA 3OCSA 4MXXA 3V01A 4ASEA 5IA0A 1ZZLA 4U3ZA 5C1QB 2QOBA 1PXNA 3C50A 5I4NA 4I6BA 1IRKA 1WBVA 3RK7A 2CPKE 3PA3A 1H01A 2UZUE 4ALVA 2V5QA 3BKBA 4FTOA 5HO8A 4WIHA 3QTUA 5L8JA 5F95A 5JT2A 4EZ7A 2W1GA 5J5SA 4IQ6A 1Z5MA 3LFFA 5AADA 5E8YA 3R04A 4GG5A 5CNNA 3THBA 3PVBA 4ZJVA 1Y6BA 3TTIA 3UC4A 5LVMA 4FL2A 3M2WA 2C68A 4WNPA 3KK8A 4NCTA 5EW8A 4DFNA 2XAMA 4EZ3A 4H3BA 3UZPA 3VS1A 5KKRB 4MWHA 4IXPA 2UV2A 4CMTA 2GHLA 2GSFA 2ZMCA 4GRBA 3W2SA 4FTNA 3NNWA 2CKOA 3PFQA 5F1ZA 1TKIA 4CSVA 4F9AA 4WNMA 3S2PA 5TR6A 4EH5A 3D7ZA 3E8NA 4XG6A 3TNIA 1ZYSA 4O27B 3R1QA 4YBJA 3RHKA 5M4CA 1YI4A 2O63A 2E9UA 3BU5A 2VAGA 3PPKA 5EH0A 4BTJA 3DJ5A 5GHVA 2PK9A 2I40A 3LMHA 5EHYA 4E7WA 1ZXEA 5JQ5A 3EOCA 4W9XA 4FC0A 2BILB 1XBAA 3F5UA 3P08A 4FKLA 4IACA 4LYNA 4CG8A 2FGIA 4TNBA 1PMVA 3KREA 4XG2A 2UW5A 3CS9A 5GJGA 2RFNA 1YI3A 2Z7RA 3U87A 4G31A 3Q6UA 4QQCA 2VO3A 4YJNA 4YSMA 5FTQA 4CZTA 4KD1A 5C8KA 4ZTMA 3CR0A 3O17A 3D15A 4CLJA 4QP6A 2IWIA 3DGKA 1LUFA 4USDA 3KGAA 5HHWA 1ZOGA 2QNJA 4AOTA 3JXWA 2C6KA 1E1XA 3LXPA 2XALA 5EG3A 5HLWA 5K0XA 4PDPA 4QTEA 4G3DA 2PUIA 1KOBA 4FIJA 4XX9A 3D5WA 2I7QA 4J95A 4PUZA 4FV6A 4K11A 4QOXA 4GT3A 3L9PA 2DQ7X 3LMIA 4R3CA 4S32A 2XNNA 3PSCA 2QVSE 2P4IA 2J6MA 3SDJA 3NYNA 1DI8A 3IPHA 2WKMA 2ERKA 3PVUA 3SQQA 4ZJJA 3BHVA 3DBQA 3AC1A 4DFXE 3R1NA 4JR7A 5JQ8A 3RI1A 1TFFA 2CKQA 4IAYA 3DK7A 1OUYA 4AA5A 4YTHA 3T3VA 4QYGA 4FG8A 5K5NA 5HBJA 2OXDA 5L6PA 2X0OA 2O2UA 4DH7A 4U45A 4WG4A 2RF9A 3W1FA 4QTDA 5M4IA 3QQGA 4YPDA 4ANLA 4PTGA 4TYEA 4ACGA 4TYIA 4C4EA 2HK5A 4CKRA 3UP7A 2BHHA 2JBOA 3Q2MA 3KL8A 4HCVA 4U43A 4TYHA 4ZTRA 3RK5A 3EFWA 5I9ZA 3BCEA 3JY0A 5CEQA 4O0XA 4YURA 4CVAA 5HG7A 4C4FA 3BEGA 1W83A 4ANQA 4X2NA 4FGBA 4G6LA 1SVHA 4U42A 4OT6A 3BL9A 3BGPA 2G01A 3QQLA 2YAKA 5ETIA 4JRNA 4TTHB 4WG3A 3ZRLA 4C7TA 2YIQA 4XH6A 5C4KA 3FZSA 3PSBA 5AP6A 1OL6A 5BPYA 2O5KA 4BZNA 4BKZA 3M11A 3QA0A 1KUTA 1UU3A 1K2PA 4K2RA 5JMSA 3BPRA 3GNIB 4QPMA 4JMQA 1OI9A 3AKJA 4BICA 4FV0A 4C33A 1FMKA 1L8TA 4O4EA 4GIIA 1XH7A 2W1DA 4V05A 3RPSA 4J96A 4S33A 3LCKA 2OICA 3F66A 2AEGA 3W0OA 2GNLA 4QMXA 3RTPA 2QOLA 3GOKA 5DLSA 3SX9A 2WTJA 3MY0A 5FP6A 3NFGB 4XV2A 3V8WA 4RRVA 4NJDA 2IF8A 4PTEA 3F5PA 3NUNA 3RCDA 4ALUA 3TWJA 1HCKA 4NTSA 2C30A 2GNHA 3JS2A 4ZY5A 1G8JA 5EQEA 3Q4TA 3UPXA 3QZIA 4S31A 1R39A 3PXZA 1MUOA 5HE2A 4P5QA 2PZ5A 4I93A 4RQKA 2FSLX 3HV6A 4HZSA 5CEIA 3FXZA 4NFMA 3TNQB 1XMLA 2UZBA 4DEDA 1MRUA 4UYNA 4PPCA 4XV9A 3VHKA 4FZ7A 4GIHA 3UIMA 4BRXA 3U6HA 3W0RA 4PMMA 4O7YA 2VWYA 3DQXA 2VWXA 3K54A 4MYGA 2KULA 3UIBA 2QI8A 4D2WA 4BCOA 3ZU7A 4ZOGA 5GNKA 4DEBA 3E8DA 4EL9A 2VWIA 2XNGA 4IB5A 4O22A 5BV3A 3R63A 3C4FA 4C34A 3QTXA 4D58A 3ATTA 2ITTA 3F2AA 2UUEA 3LJ2A 4ZY4A 3DFCB 1PXMA 2Q83A 2JAVA 4DT8A 3BELA 2BAQA 4AS0A 2ZDUA 1GNGA 4N4SA 2VTIA 2GNIA 1APME 3ORXA 4M84A 5JGDA 4OW8A 5DT0A 2LAVA 3ZUUA 2VWVA 3ZBFA 3DBDA 2PULA 4EKKA 3I5NA 3KN6A 1H24A 3BE9A 4NKSA 4TYGA 5J87A 5AEPA 1V0OA 3G0FA 4ACDA 2ZV2A 4R7BA 4DHJA 3LCSA 4BF2A 4DEEA 2VTJA 3PVWA 3MPAA 3S95A 5C4LA 4QP2A 4DH8A 5T6KA 2RGPA 3GOPA 4ZZMA 1PYEA 5ANJA 1YXTA 4EK6A 4GK2A 2FB8A 3ERKA 3SOAA 3BHTA 5I9VA 4R5YA 4A9RA 4QMUA 4DLJA 2VTRA 2Y8OA 2Z2WA 3I7BA 4KBAA 3C1XA 3GCQA 4APCA 5A4TA 3ID6C 3PJ8A 3DCVA 4E6AA 5AR8A 1OBDA 5J1WA 3CKWA 3VULA 3K2LA 3HRBA 4JDIA 4C61A 2YWVA 4NYEA 3EQRA 2ITQA 4PMPA 3NIEA 5DFPA 3F88A 4YZNA 1P2AA 3VBWA 2P55A 4DHFA 4Z16A 3KF7A 4YTFA 3N4TA 1Z57A 4BGGA 2WHBA 4M15A 1H8FA 2CGXA 3VBXA 5DR2A 3DJ7A 4QMVA 2WTIA 4FSQA 4GS6A 5E8TA 1KWPA 2RFSA 4LMNA 3UMXA 3NCGA 2QG5A 4W4XA 5M07A 4O6LA 2IVVA 4Y5HA 3FMEA 4DH5A 5B2MA 2CGVA 4FEWA 5GIOE 4CZUA 5CSPA 3V5TA 4UZDA 4BCFA 5AX3A 3EN7A 3R9DA 3FPQA 2QR8A 4F4PA 3KVXA 2R3GA 3GC9A 4MH7A 4NW6A 3VUKA 4AAYA 2YHVA 4H36A 3KULA 2A27A 3R7OA 3OBJA 4MNEB 3VBYA 3G6HA 4EOMA 3GXLA 5KMIA 5EK7A 1AQ1A 1QPJA 5ANDA 1ERKA 3I81A 3N51A 4EWHA 3A7IA 4ASXA 3LCDA 4YP8A 2CNVA 3TN8A 4IVBA 1OL1A 4BI0A 4NH1A 4I5MA 5LWNA 5IA3A 4PRJA 4IH8A 1YDRE 5ANOA 1PMEA 2PVHA 4FTKA 5K9IA 3OTVA 4WRSA 2BUJA 2HXQA 2QKWB 2YM8A 3BIZA 4OBOA 4PQNA 3R8VA 1OL2A 2X4FA 4R1VA 5C9CA 4EC8A 4L7SA 1XH4A 4HVGA 2AC3A 3CE3A 5HG5A 3R9RA 4U9AA 4AGWA 4I0TA 3QD3A 3ZFYA 4WBBB 4H3PA 3GCSA 4L68A 1PKDA 3CPCA 4I4EA 4RIYA 2R3HA 4E6QA 2R3OA 3W0NA 2WMQA 2XEYA 3NX8A 1NA7A 3C13A 3LXKA 3MVJA 3VS3A 4CFFA 4S34A 5FUTA 5AUYA 3Q6WA 2QOCA 3GB2A 2JFLA 4FKOA 2PVRA 5AV3A 3LXLA 3TNPC 4O96A 1WBNA 2GU8A 4FVPA 3T8OA 3F6XA 1OPKA 4J97A 3UNZA 4MXCA 1ZMVA 2R5TA 3E8CA 4RJ5A 1KOAA 2YLEA 4FT9A 4RSSA 4D9TA 4QMLA 5AAGA 2EWAA 3BLQA 1Q24A 1LR4A 2BVAA 2IO6A 4RX9A 3NUAA 4XYFA 3H0YA 5BUEA 4MNEA 3DJ6A 4YO4A 3B2WA 4IW0A 4HYHA 5AM7A 4ACHA 5EYDA 4RVLA 1URWA 3BQRA 4FVRA 2JAMA 1OIRA 3FBVA 3RVGA 1GIIA 4ITIA 4F7SA 4QRCA 3F2RA 5I9YA 4RIOA 1OIUA 1XKKA 3KB7A 1KE5A 3O23A 4CLIA 2AQXA 2BRHA 3MIAA 3NGAA 3C7QA 2GMXA 3LXNA 4RC2A 5FBOA 5IQIA 4QP8A 4LM5A 5J7BA 2QOQA 1GOLA 2X6DA 3ZM4A 3HP2A 1IEPA 1M7QA 1TQPA 4JR3A 5HVYA 5JKGA 2WPAA 2G2IA