5AJQA

Human lok (stk10) in complex with bosutinib
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
289
structure length
280
Chain Sequence
EHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIEEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE 10
publication title Stk10 with Bosutinib
rcsb
source organism Homo sapiens
total genus 80
structure length 280
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ajqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ajqA01
3FY2A 2OXDA 3Q2MA 4S34A 4BN1A 1FMKA 3FZSA 2OJ9A 3A62A 1GIIA 4L68A 4S32A 3QQLA 4D5HA 2ITOA 5IUGA 2J0IA 3CD8A 4WT6A 4APPA 4ZSEA 4P5QA 4H3PA 4FKJA 5CSHA 3WIKA 4H58A 3AC8A 2YFXA 5HHWA 4MXCA 3FLQA 1R0EA 4XBRA 4U9AA 3Q5IA 4ITJA 4H39A 4UBAA 5H8GA 2GU8A 1PXJA 4RX5A 4G6OA 5IH6A 3QA0A 1P2AA 2PL0A 4YTIA 4DBNA 4XG6A 3F66A 4AW0A 3D4QA 3PG3A 1WBPA 4MNFA 3AD4A 3O17A 4QP6A 4CMTA 3R30A 1SNXA 3P08A 4OT6A 3KVWA 5J5TA 1YXUA 4USFA 2B52A 4AGUA 4A4XA 4ITHA 2X8IA 1LP4A 3G6HA 4XG8A 3VUHA 4ZMFA 5DEYA 1K3AA 5HBJA 4TW9A 1W7HA 2QLUA 2W9ZB 4D4VA 5M44A 2VTLA 3BHYA 4IX4A 4S2ZA 1ZYCA 3MIYA 3UO5A 3TDVA 4BGQA 1GAGA 4GUBA 3F88A 4M0ZA 5AP3A 3RNYA 3TV6A 3LCOA 2XNMA 3LOKA 5JSMA 5CEOA 3TNHA 1B6CB 4ONAA 5FP6A 4I3ZA 3CBLA 4G3CA 5LVLA 1XH4A 4ZP5A 3TI1A 2W96B 4ERKA 1ZYSA 4FSUA 4G5PA 4TWOA 2HXQA 3PJCA 4NW6A 3C4EA 4V01A 5JFVA 2VZ6A 2EU9A 2WMBA 4NTSA 4HYUA 4EBWA 2W1ZA 5IQEA 5KMMA 2Z8CA 3EJ1A 3MFTA 3EIDA 3VRZA 4ZTMA 1JWHA 2FH9A 4OTIA 1KSWA 4RSSA 3C0IA 3ZRMA 3F2RA 3EFKA 1YOMA 4AZSA 5K5NA 3K3JA 3VWAA 5FM3A 1SMHA 2E9PA 2VNYA 1KE6A 4IVDA 1U54B 2YACA 4YHTA 3ZM9A 4RIWA 1WVWA 4Y46A 1ZMWA 3MWUA 1H8FA 2QVSE 3TV7A 1KE7A 2C6EA 3VIDA 4BI2A 5L8JA 1MQBA 3RPVA 4KRDA 3MY5A 3R8LA 2C0OA 2CGWA 4YJUA 4HPTE 5AA8A 3R7YA 1J7UA 1GZ8A 1PMUA 3R7VA 3WF5A 4JG6A 5IZFA 3V5QA 1Y91A 3C13A 4XV1A 5CU2A 3TT0A 2CGVA 4UALA 4MQ2A 4EOMA 2F4JA 3UZRA 4F09A 2PUUA 4FL3A 4A9TA 2IO6A 4L67A 2H6DA 3NIZA 3SGCA 3NRMA 3CD3A 3NVMB 2VWZA 2XCHA 3WZEA 4OUCA 2A19B 5ANEA 5CI6A 3LLTA 3OW4A 4GVAA 1AD5A 2GTNA 4O7ZA 3K5VA 4B8MA 3RINA 4BDFA 3IDCA 3E8DA 4E4LA 4FIGA 3UPXA 4JQ7A 1YW2A 5CAVA 2YIWA 5AV0A 3R9HA 3ZRKA 2OIDA 4GT5A 4FKUA 3OTUA 3O71A 3LFAA 5L8LA 3DZQA 4BWKA 3NUUA 5DYJA 2CMWA 4XG3A 1S9JA 3PIYA 1O6LA 2F57A 2QKRA 2XIRA 3QGYA 4TYHB 4D5KA 4FYOA 4IJ9A 4DN5A 4FEWA 4J8MA 4FKVA 4TTHB 5K4IA 2QLQA 2UZEA 1UKIA 4JJRA 2C6DA 3I0QA 4FSRA 4TWPA 2WZJA 4C4IA 4M0YA 3TACA 2V62A 4NU1A 5DT4A 3SOAA 4CCUA 3EL8A 4TT7A 3LLAA 3EN5A 3OW3A 4C3RA 3VUTA 5LVMA 1YI3A 2OJFE 3HAVA 1JSTA 1WMKA 1YWNA 4UYAA 2PVKA 3C4FA 3KMUA 1URCA 2C6TA 2VTPA 2XJ0A 3MGYA 4L3JA 3CGFA 3QKMA 4FSNA 2H9VA 2VTOA 1H1QA 3R00A 2CKQA 5KHXA 1GY3A 4IJPA 5CXZA 5IUHA 5BUEA 4PNKA 4DTBA 4BCJA 1ZOHA 4V0GB 3VJOA 5FTGA 2C3KA 3FPMA 2IW6A 4PTCA 2DQ7X 5C27A 4EQMA 4CYJA 1U46A 4FKQA 2LGCA 2PMNX 2OXYA 4E6AA 3Q2JA 5KHWA 4N4SA 2JAMA 3VW6A 5FXQA 4AGDA 5TT7A 3ANRA 2PVHA 3PY3A 2BDWA 3NUYA 2QOLA 2PVLA 1J3HA 3DGKA 3FZOA 4I0TA 4ZSJA 4DFUA 2Z7RA 4AGWA 3B2WA 4MNEA 5HOAA 2RG6A 3F3TA 1LEZA 1OIUA 1PMEA 2FO0A 4MAOA 2I7QA 4E7WA 3ITZA 3U8WA 3UE4A 5KCVA 5DEWA 3ZUTA 5IQGA 4BC6A 3D7TA 4II5A 2FSLX 4LYNA 4YZNA 5GJFA 4UWYA 3V6RA 4ACMA 1WBVA 1YXXA 1Q24A 3QC4A 4HVSA 4YBJA 3MDYA 2XRWA 3PIXA 3QX2A 4QTDA 2ITQA 1PY5A 2Z2WA 1R0PA 4H36A 3WE4A 5ANKA 3B8QA 4MF0A 3BYSA 3GB2A 5M4UA 4FEUA 5ETFA 4G1WA 1FBNA 3NUAA 4Y72A 3PVGA 4GK2A 3DY7A 4OTDA 4R7HA 5JFXA 3ZC5A 4ZAUA 5E8TA 1RQQA 1U5QA 3BZ3A 4YU2A 2BFYA 3FBVA 4ANQA 5CEIA 2IW9A 4RMZA 3RGFA 4MBIA 4CFUA 2VO6A 3M2WA 4QTBA 3I1AA 3DKGA 4FG9A 3HEGA 4QQTA 4FGRA 2VWYA 3L9NA 4G6NA 5ETCA 3SRVB 2J5EA 4O0SA 5EDQA 2ITXA 3I60A 4NZWB 4Q2AA 4YNOA 4E6CA 3NZ0A 4AZVA 4YHFA 2WMWA 3RK5A 4GYGA 4UMPA 4C59A 5IA4A 5IQFA 4JLCA 2J0JA 3KRXA 5EI8A 4A7CA 4D55A 3IW7A 3EQDA 3FMJA 2WEIA 4AT3A 4BCHA 4FOBA 4H1JA 5AV2A 5HI2A 2PU8A 5DLSA 3QCSA 2B9HA 3NIEA 4B6LA 3SW7A 3POOA 5M55A 1REKA 4D1SA 4FA2A 3KU2A 2BPMA 4IAAA 4FNYA 2ETRA 5DG5A 4YURA 3DBQA 4QMLA 2YZAA 3CGOA 3G9LX 3QTRA 3QU0A 4C4JA 1E1XA 2W17A 4X2NA 4XG7A 4FGBA 2I0VA 3HL7A 5A4EA 3I7CA 5IA5A 3IONA 3G0FA 5EYCA 3EQRA 5EOBA 5IUIA 2WTCA 3UG2A 3CJGA 4QPAA 3NS9A 1CKPA 4D4YA 4GH2A 2VTSA 3LXKA 4GVJA 1T45A 4XP2A 5EI6A 3KFAA 4B8LA 3MY0A 3GT8A 4MKCA 3UO6A 4FNXA 3CY2A 1BL7A 3SOCA 3KK9A 5GZ9A 4UEUA 1Q61A 1YHWA 3DB6A 2BDJA 3EL7A 4E3CA 4XNEA 5EQYA 1R1WA 4X21A 3A7HA 1DM2A 4M67A 5DIAA 3AC2A 5HG9A 1BI8A 2R5TA 3WYXA 3RCJA 3IDPA 3WI6A 4AUAA 1SNUA 2XEYA 3BYVA 3D5UA 1QPDA 5HESA 5M06A 2XM9A 4NM3A 4DBXA 3U6HA 3DLZA 4MEDA 1LUFA 3FMLA 2IZRA 4NCTA 4A4OA 4DC2A 3IK3A 4C3PA 3OP5A 3AT2A 3TNPC 3BE9A 3GI3A 4J99A 4UXQA 2XZSA 4HNFA 4J71A 1J1CA 3EFLA 4RFYA 5I9WA 4YC3A 2VO7A 2WTDA 4O21A 5DT0A 4F9BA 3PWDA 2C6KA 4JBVA 3HA6A 1XH6A 2YM5A 5IMEA 3UQCA 5IQHA 2WELA 3AC4A 3ORNA 3DB8A 3GU7A 4FIIA 4IW0A 4L46A 3W18A 4AF3A 3GQLA 3IW5A 3QQUA 4GJ2A 5DOSA 5EM6A 2HAKA 4DHFA 4FV8A 2G15A 4EKLA 3ETAA 4L01A 3UC3A 3W16A 1ZYLA 1U54A 2ITWA 4YZ9A 4IBMA 4HVGA 2PZ5A 3DKOA 5AP7A 3THBA 2HCKA 5CZIA 5IQBA 2FUMA 1UU3A 1Y57A 4ZS4A 2VWWA 2VX3A 3ORMA 3WYYA 4N57A 4QYFA 1F5QA 2YHVA 3CXWA 2QOFA 3SQQA 2R3IA 2ZB1A 4DEDA 5D10A 5J8IA 3OWPA 4DAWA 5CEQA 2QONA 3IW4A 3GGFA 4FKSA 2P4IA 1H1WA 2V7OA 4DINA 3NR9A 3EN6A 4HYHA 3JYAA 5IH4A 2EXMA 2PHKA 4L6QA 4O7YA 5EYMA 1UV5A 4FEVA 5CASA 2WTVA 4B9DA 3EQGA 3JR1A 2F2CB 1JKSA 4DGLC 4D0XA 1ATPE 4LOPA 3ZDUA 4ZSGA 3BV2A 3R83A 3LFEA 4FV7A 3PXKA 4PDSA 2X9FA 4I93A 1AGWA 3BHTA 4XEYA 4EH7A 4ZTNA 3I6WA 3IG7A 3EQHA 2O2UA 3E63A 3GUBA 3PTGA 4ZXTA 1PJKA 4IMYA 4EONA 5J79A 4I92A 5HCZA 5F95A 1M7QA 3VUMA 3FE3A 2C69A 2WTWA 4BZNA 4EL9A 5CQWA 3MV5A 4EWHA 4A9RA 3PLSA 4YO4A 1DI8A 5K9IA 4Y95A 3HRCA 5AP2A 4EYJA 5E8XA 2PZPA 3A7FA 2BDFA 3N9XA 3VF8A 4JDKA 3L1SA 3VVHA 3VBXA 4DEHA 5T3QA 5DE2A 3U9CA 4OTWA 4ASEA 2UZVA 5H3QA 4WG5A 4TYHA 3RJCA 4CZTA 3O2MA 4D2SA 4ZJVA 5K5XA 5L2WA 5LMKA 4DCAA 2UUEA 2W1FA 3TTJA 5L2QA 1RE8A 5KUPA 1PMVA 2YIRA 4PY1A 3KCKA 2V7AA 3P78A 3TDWA 3OS3A 3CJFA 3UIMA 2YCFA 3TXOA 3FHRA 5FEDA 2VD5A 5B2KA 4I0RA 2GHLA 4D4RA 3SA0A 4CYIA 2QHMA 2J50A 5CU6A 4O7TA 3U55A 5IF1A 4IC8A 2FSTX 1NVSA 2XMYA 1TQIA 2C6MA 3Q6WA 2XP2A 3TZ8A 5J7BA 2OLCA 3LKMA 2BAJA 5HORA 4JX3A 3AC5A 1H24A 4L43A 5EFQA 4O1OA 2BROA 4O86A 4RQKA 5M53A 4YTFA 3VO3A 3FKOA 3HV7A 2WMTA 4WD5A 5EI2A 5TOZA 4V0GA 5IU2A 2F7ZE 4MXAA 4EK3A 5A14A 4YSJA 1XWSA 4FTAA 2OK1A 3KK8A 2J9MA 4MBLA 3FSKA 2JDOA 3LJ2A 3OG7A 3UP7A 1KWPA 2X4ZA 3G0EA 4GU6A 5HD4A 5CVHA 4BCGA 4XG9A 4ZTHA 1Q99A 3OCGA 2R3OA 4I41A 4EH6A 2R3HA 5JEBA 4F08A 4RJ4A 4DTAA 2XRUA 4QOXA 3N51A 3COKA 2RF9A 3O7LD 1OIQA 2WTJA 5DR6A 4AW1A 4B0GA 3W8LA 4EH5A 1PYEA 3VS6A 1JVPP 4FT3A 4XYFA 3BU5A 3JS2A 4ASDA 4OBQA 4MHAA 3BYOA 2YAAA 3SKCA 2X7OA 3OEFX 4I0SA 3LMIA 1Z5MA 4M14A 3TZ7A 1CTPE 3FZPA 2X2MA 4ORKA 2R3QA 4Y73A 4BFMA 4BTJA 4Q5EA 4BIDA 3P7BA 2YN8A 4NT4A 4FT0A 4IX5A 3GFWA 3OWKA 4CFMA 3O50A 3P9JA 4JAIA 2XNBA 3DK3A 1JPAA 1YOJA 2Q0BA 4RWIA 2XJ1A 4WUAA 1V0OA 5LMAA 5CEMA 2VTAA 4J97A 3CSVA 2GNLA 4G3FA 2JDTA 3LM0A 3PIZA 4LI5A 3SRVA 4G2FA 5E91A 2CJMA 2VGOA 5DHJA 2NRUA 2R3MA 3N4UA 2C5OA 4EKKA 4F6SA 4HGTA 3PXZA 3BEGA 2R3NA 3JVSA 2BKKA 5M09A 3ZLYA 2B0QA 2VTQA 2C3JA 3E64A 5AADA 3QTSA 3LZBA 4AZTA 4Z16A 5JT2A 5A46A 4K1BA 5IEXA 1PXNA 4F9AA 3QYWA 1Q3DA 3BWJA 5EYKA 1MP8A 4V05A 4W4YA 2O0UA 5C8MA 4DEAA 4YHJA 4F6UA 5TF9A 4BY9E 2WB8A 4BI0A 3QUDA 2HIWA 2JEDA 5DNRA 4BKZA 2P55A 2E9OA 2JKKA 4GV1A 3RTPA 2QU5A 3SLSA 3TUCA 5C01A 3DK6A 5JMSA 5EM8A 5BQ0A 5HO7A 5BUJA 1K9AA 4K11A 4D2PA 3LFQA 5CQUA 4BDIA 1WAKA 2A1AB 3DXPA 4NFNA 4ZJIA 3AC3A 3K2LA 3ZO3A 2JITA 2BZHB 3LJ1A 4QYEA 3FZ1A 4WUNA 4EEVA 3QBNA 4BVUA 3OEZA 4FIHA 3NUNA 4IX3A 4KIQA 1H26A 3LFBA 3ZO4A 2PVFA 4Z3VA 2F7EE 2HY81 3HDMA 4GSBA 3BHVA 1VR2A 3FMKA 3MFUA 3T8OA 1LEWA 3LFDA 3TN8A 5HVKA 5I4NA 2R7IA 1WBTA 2BR1A 4CGAA 3NSZA 3DU8A 3UNJA 2JDVA 4RA4A 1Z9XA 2REIA 4LGDA 4ANBA 3TIZA 5KKRB 3IKAA 4EZ5A 1OL1A 4UYNA 3N4TA 2CNVA 3OZ6A 3RPYA 4CMOA 5E9EA 3EQFA 3FKLA 4NTTA 4S33A 5CAUA 3E62A 2XK4A 2ERKA 2YM7A 3U4UA 5TKDA 3A2CA 4QP2A 5AR7A 2C1AA 2ITNA 4R5YA 4YZCA 4FX3A 4FKLA 3G15A 2GNHA 3OXTA 2W7XA 1KOAA 4E6DA 3SXRA 2O3PA 1QPCA 4XUFA 3R1YA 2NPQA 5IDPA 2YWVA 4DEEA 2J0MB 5AR8A 1V1KA 4E26A 1YXVA 4OTQA 3CS9A 4MX9A 4RC2A 3W2SA 3FLSA 3WF6A 4BYIA 4FTQA 4C57A 3P86A 4LRMA 3QD4A 5I9VA 3PUPA 2IVUA 4HCUA 4PL4A 4CTCA 4C38A 3FXWA 2GS6A 2R3RA 3H9OA 4IEBA 4LL5A 3ROCA 4ZK5A 2JAVA 4GS6A 4PL3A 3JY0A 4EC8A 4TNBA 3RZBA 4YTCA 4P5ZA 4NJDA 4DGMA 1DS5A 4IQ6A 3HMPA 3R8VA 3BRBA 3PE2A 5FLFA 3R7IA 3EQIA 3QD0A 4FKOA 2PE1A 4LOQA 4A06A 4J95A 5C4KA 1JSVA 2VNWA 3PYYA 3HVCA 3A8XA 3QWKA 4CNHA 4QMSA 4LOOA 4O7VA 1GOLA 3S3IA 2CCHA 1LR4A 1YWVA 2HZ0A 4ENXA 3LCTA 3OY3A 5FXSA 1CKJA 3W32A 3HAMA 5KZIA 4O6LA 5I5ZA 4FIEA 4LGGA 3EMGA 3U87A 4Z7GA 4M8TA 4CV9A 4MNEB 1Q8UA 2ZJWA 4PNIA 3BYUA 4IXPA 4OTGA 2XNEA 4B4LA 4K77A 3COMA 4C2WA 2BRNA 5KNJA 2BAQA 2RG5A 3DOGA 4UB7A 3BI6A 3D7TB 4KBAA 2YM3A 2GNFA 4GIIA 3MVJA 4FUXA 3NMUF 2W1IA 3R8UA 4BR3A 4E8AA 3UGCA 3FWQA 4JAJA 2XF0A 3TZMA 4I94A 2QURA 4FSZA 3UO4A 4M66A 2YEXA 5CAPA 3OOMA 2YABA 3HDNA 4IVBA 2QKWB 4CXAA 1A48A 3HV3A 3POZA 4NKSA 4QP8A 5ETAA 3HUBA 3R04A 2NP8A 2ZMCA 4XV9A 3NCZA 4CLIA 2Y4IC 4H05A 5BYZA 1BKXA 4QMMA 5JRSA 2GQRA 3WBLA 1GNGA 2VX0A 3W55A 5AR5A 3R21A 4HVIA 2Y8OA 4ZTQA 4LMNA 4NH1A 1IASA 3OUKA 1W98A 4GFMA 2PVRA 5HLPA 3DK7A 2J0LA 4ANOA 2OO8X 4E93A 1QPJA 4ENYA 2EWAA 5CENA 1UVRA 2E9NA 4PPBA 3LE6A 3GCUA 4O0XA 3QHRA 4J98A 3FUPA 1J91A 1HCKA 2YJRA 3G9NA 3IECA 4UXLA 1XH8A 4KABA 3G51A 3H4JA 4FV2A 2HZNA 3GU5A 4YPSA 3TJCA 4BDHA 4R3PA 4EOIA 3EWHA 2R3JA 3LFSA 4YJRA 4U79A 3PVUA 3ULZA 5CNOA 5EQPA 3P4KA 3K54A 4BZOA 1M14A 2G9XA 3A4OX 4UWCA 3MESA 2AC3A 2EB2A 3PZHA 3FLZA 1GZKA 5I0BA 5I9XA 4A9YA 5CANA 4TPTA 4GK4A 3GCSA 3SG9A 3COIA 4JBPA 4BTKA 3R7OA 3OFMA 2Z60A 2BZKB 2VTIA 3MI9A 4E5WA 2W0JA 3NUPA 4IFGA 4JVGA 2OH0E 3VUIA 2BKZA 2VWVA 1OPKA 5GNKA 4U41A 2CGXA 3PSDA 4NM0A 4XOYA 4CKJA 3NGAA 1UA2A 4M15A 3C5IA 4N6ZA 4UY9A 4AW2A 4TWNA 5JFSA 2BAKA 2WQMA 3E8CA 4I20A 3ATTA 5IQAA 2XVDA 3TNQB 3UVRA 3DV3A 1A06A 4JR3A 4QP7A 2X8DA 3BE2A 3E93A 4XMOA 1YXTA 3ODZX 4L42A 5FM2A 5GINE 3AGMA 4MD7E 4AZEA 4EH4A 1G8SA 4DT8A 5HVYA 3ZYAA 3C1XA 5BVOA 3HV6A 4O81A 4FI1A 4TYEA 5T6KA 3RVGA 4GT3A 3ZXZA 4EJ7A 3OCBA 2BRBA 4QYYA 1L3RE 4OAVB 2AYPA 3R01A 3FXZA 4X6QC 2JIVA 5KMLA 1NVRA 5M07A 4RJ8A 4KRCA 2GNIA 4EHGA 4UMRA 3AT3A 3MVMA 5EDRA 1JBPE 5CWZA 5HNBA 3EH9A 1X8BA 1Q62A 1FINA 3HMIA 4EQCA 3QXOA 2UW3A 4FTMA 3DXNA 4RLLA 3WILA 3WOWA 4CQGA 4GFOA 2WMRA 3Q52A 3FQHA 3V01A 1OECA 2UW9A 4UZDA 4B99A 2VRXA 2IG7A 2VTNA 3HYHA 2BTSA 4N6YA 1O6KA 3GOPA 3QTIA 4IAYA 4FKWA 4HYSA 3LJ0A 4QMPA 3OTVA 2HZIA 4I4EA 1NY3A 2I1MA 4I5HA 1JNKA 3SW4A 5HE0A 4FVRA 5JGDA 5DRDA 3PP0A 2C47A 4G9CA 4FTRA 2UZWE 2XYNA 3FHIA 3LFNA 3RWQA 2O65A 4E5AX 4BHZA 4KD1A 3ZZEA 5HNIX 3OWLA 2WOUA 2PMOX 4G3EA 3L8XA 4MWIA 2F49A 2JIUA 1OITA 2C5VA 3I6UA 3CQUA 4NL0A 5BVEA 3GC0A 1YXSA 2J51A 1M17A 4V04A 1QPEA 4AGCA 3AD6A 3MH2A 2GQSA 3KC3A 3VBWA 4BDCA 2OU7A 1JKKA 4RX9A 5CX9A 2JBOA 3T9TA 3PLAE 2YITA 3DBFA 1F3MC 5EW9A 1RJBA 1SVGA 3RKBA 2Q83A 3I5NA 3Q9ZA 3D9VA 3PA5A 1JKTA 1IA9A 3F2AA 4USEA 4FYNA 4FODA 4YJPA 4HGLA 3ZTXA 4W4WA 2OXXA 1FMOE 3ZSIA 4JNWA 3GP0A 3VRYA 1OPJA 1H0WA 4FL1A 4KAOA 2PUNA 5CLPA 3MA6A 2B55A 1OKVA 2ERZE 2X1NA 4XH6A 4AN3A 2WTKB 5HG5A 4IM3A 4LRKA 4FSWA 1BX6A 4IAIA 4O0UA 4RGJA 5IA0A 3ORTA 1IAJA 5D11A 4DH1A 3C5UA 2YCRA 5CVFA 4ACGA 5M08A 3NYNA 3ORXA 1ZY5A 4U8ZA 4KKGA 3BYMA 3OWJA 1XR1A 3QLGA 1IEPA 4IADA 3DKCA 1YWRA 3TUBA 1OZ1A 2DYLA 4UMQA 1V0PA 1WZYA 2WMUA 4YJOA 5E7RA 4A9SA 4F7NA 5EG3A 2AUHA 2Y4PA 4NIFA 5AUXA 2JDRA 3FMDA 3MPTA 4ASZA 3EQCA 3F5PA 3AD5A 4DGOA 5J87A 4DH7A 2F7XE 3QZHA 2C5XA 5FXRA 2WQNA 3KQ7A 4GRBA 5LMBA 1M7NA 2XB7A 5D41A 3ZZWA 3FPQA 2VU3A 5LWNA 5HTBA 1GZNA 1OGUA 2BIYA 2FSOX 4O96A 3WF7A 1XBCA 2YDIA 1OKWA 2XIKA 2WIPA 4BCMA 4ZLZA 3KL8A 3Q4UA 4Y5HA 2R3FA 2JLDA 2A4LA 3IW8A 3GBZA 4IZAA 3Q60A 2W1EA 3DAKA 4FICA 2BILB 4R5SA 5IA3A 3MPMA 5I9UA 1H1PA 2ZB0A 3FJQE 3Q9WA 2Z02A 2HXLA 2IWIA 5D9HA 2XIYA 3KMMA 4G17A 4EOSA 2JC6A 4GK3A 5FEEA 3I5ZA 4IH8A 4KIOA 3ODYX 3NYVA 5DGZA 4DFZE 4YZMA 3BIZA 3UJGA 4HVHA 4FTJA 3BELA 1Q5KA 2A27A 2RFEA 5EM5A 2NRYA 2O8YA 2QHNA 2UVXA 3M11A 4RWJA 4PMPA 3F9NA 4KKHA 5AWMA 4AXAA 2C3IB 3JY9A 1S9IA 2X7GA 3OVVA 4S30A 5AX9A 4EK8A 4BIBA 3TWJA 4EYMA 1FPUA 4ZZNA 4YUQA 2XIZA 2W5AA 2Z7SA 4DLIA 2OW3A 5CI7A 4O7LA 2IW8A 5HBEA 4EOOA 2WQEA 3HP2A 5L2IA 4W4VA 1TVOA 4OR5A 5TR6A 3UNZA 4ARKA 4AA0A 4EOKA 2CKEA 3QCQA 4G6LA 4JRNA 4QYHA 2B9IA 3D0EA 4L8MA 5E8SA 5CZHA 2CHLA 1XBBA 5CEKA 3Q04A 2YM8A 1B38A 3V8TA 3GVUA 4DFYA 2ITTA 3ELJA 4O2PA 2JKQA 1PXIA 3G6GA 3U9NA 2XEZA 3GC7A 1WBSA 2W06A 2PK9A 3HUCA 1YVJA 5DMZA 5AP4A 1DAYA 5EKNA 4EH8A 4AZWA 5DA3A 2J0KA 4WG4A 2OI4X 3EN9A 4I6FA 5HGIA 4RJ5A 3Q53A 2YIYA 3LCDA 4IM0A 4X3JA 1MQ4A 4FUYA 3KMWA 4EWQA 2WPAA 2ZV7A 4AA4A 4GEOA 2YIQA 4RVKA 5JN2A 1ZZ2A 4DEIA 2FB8A 2QOCA 5H2UA 3RALA 4RVMA 5D12A 5HLNA 5E8ZA 4OAUC 5EK7A 3H9FA 5I3RA 2EUFB 3RPSA 2R3GA 3HMOA 3QF9A 2ETMA 3Q4TA 3V8WA 4KINA 4IAFA 2A2AA 3CLYA 2QNJA 3LFFA 2CNQA 2DWBA 4RVLA 2Y6MA 1JOWB 2H96A 2QCSA 3D5VA 4WHZA 3PJ2A 2XCKA 5TE0A 4D4SA 3E3BX 3O96A 5CF4A 4RA5A 3F3WA 4YP8A 4I22A 4UMTA 2R0IA 5GZ8A 4EHVA 4LG4A 3R9OA 5IEYA 2CKPA 2RFSA 2E9UA 2XIXA 2ZM1A 3HV5A 3IQ7A 4MXOA 4X2KA 2CNUA 3W2CA 3FI8A 3UVQA 2OH4A 5IDNA 4PDOA 3LQ3A 4XS2A 4O7RA 1O9UA 1P4FA 2G2IA 3IOPA 2CN8A 5FDXA 3VN9A 2XBJA 4HZRA 5CEPA 1OBDA 1Q3WA 2P2IA 3ZSHA 2X81A 1Q4LA 1H28A 4YJQA 5HVJA 4IVAA 1MRYA 3G33A 4JIKA 5FGKA 3P1AA 1UNHA 3FLYA 4R7IA 5M4FA 5M4CA 3UNKA 4ANNA 2GHGA 3LCKA 5BMSA 5CY3A 4JBQA 3UMWA 2VTTA 5DVRA 1JQHA 4I5PA 3W2OA 2C0IA 2C6LA 4K8AA 2VO3A 2WAJA 5BNJA 5GJDA 5KO1A 2R3KA 3ZFMA 3RMFA 3AXWA 4TKSA 3K5UA 1G5SA 3GU4A 3I81A 5E8WA 2BCJA 3IGOA 3RM6A 1AQ1A 2ITYA 3FL5A 4I23A 1M2RA 3V5PA 1KE5A 4AT4A 4P2KA 3PY0A 1ZYJA 3ORLA 3JPVA 4ACCA 3HX4A 3P5KA 4MBJA 4FZ7A 2EXEA 3LHJA 4FOCA 2ACXA 5AP6A 3NW6A 2JD5A 3DBEA 3HV4A 4TYJA 3NNWA 3PZEA 1OI9A 1STCE 2OG8A 3OC1A 4IZYA 4QQJA 4UZHA 5BVFA 2XK9A 4QP4A 5HO8A 4IB5A 3TV4A 2KTYA 3GCVA 1FVRA 3RZFA 2HW6A 3OOGA 4FEQA 5A4LA 5AV4A 3EKNA 4FZDB 1J7LA 2IN6A 4FK3A 4ANMA 4NEUA 1P5EA 3NWWA 4XV2A 2VWIA 1PXOA 2KULA 5E1EA 4C4EA 3GXLA 3JXWA 2XYUA 4IWOA 2PZIA 4X2FA 2W1CA 2PVJA 4J1RA 5HE2A 2QC6A 3CY3A 3DZOA 2PTKA 1ERKA 3FI2A 4FT5A 3QQFA 1V0BA 2OGVA 4IFCA 2I0EA 4PMSA 3ZUUA 4D2RA 4E4MA 4IE9A 4KNBA 4OTRA 1GIJA 4KBKA 4R3CA 5HX6A 4OT5A 1OUKA 2E9VA 3EFWA 4E73A 4FTNA 3KB7A 3PG1A 3NNVA 5ACKA 3BLQA 3H3CA 2Y7JA 5L6OA 5IQIA 2PMIA 5TO8A 2X9EA 3RK9A 2W1DA 3MYGA 4AN9A 4RZVA 4LMUA 1L8TA 1M2PA 1CKIA 4U81A 3KN6A 4CFFA 4BCOA 1YRPA 4A07A 4ZLOA 4NM7A 3G5DA 2PY3A 1W83A 4PMTA 3ZEPA 5AUUA 2J6MA 4UN0C 2WXVA 5CAQA 4FE2A 4NM5A 1W0XC 3D83A 5KKRC 2GSFA 3CKXA 5IG1A 4MXYA 1OPLA 4QQCA 2HK5A 2BMCA 4ZIMA 3W2RA 4RRVA 4F0FA 3UPZA 3GU6A 5HNGA 3V5LA 1LPUA 4IWPA 2ZM3A 4AW5A 2HY0A 3NW5A 4U42A 5DT3A 4PP9A 2C0TA 1F0QA 4CFXA 2QG5A 3BGQA 3P0MA 5LARA 4CQEA 5LWMA 3HLLA 2QOHA 1PMNA 3MTLA 5CSVA 4QMWA 4QMVA 2C30A 3QTUA 4IVCA 1E9HA 3BGPA 5L8KA 3RM7A 3VAPA 4GU9A 5LQFA 4C33A 2YZLA 5GZAA 4WSYA 1YOLA 4X2JA 4MF1A 5AR2A 3R7EA 1ZRZA 3LQ8A 2OF4A 4E4XA 2BZIB 1QCFA 2XM8A 1URWA 5HG7A 1RDQE 4BIEA 5FDPA 3ID6C 2BRGA 2XK8A 3C4CA 3R9NA 4FV6A 3QKLA 3FL4A 4D2WA 2F9GA 2J90A 2CN5A 3R9DA 4F9YA 1EH4A 4PF4A 4Y85A 4E4NA 3NAYA 2XK6A 1SZMA 3F69A 4HGSA 4L44A 4NKAA 4O27B 1SVHA 1TQMA 5EH0A 3WF9A 5HCYA 1R39A 2ZYBA 4ALUA 3TZ9A 5BPYA 1ZXEA 4FNWA 3UG1A 2UV2A 4F1TA 4C4FA 4Q9SA 4GYIA 4FG8A 2J2IB 2GS2A 3QTQA 4FC0A 4MK0A 4YC8A 3UOJA 3LAUA 3R71A 2JFMA 2RKUA 4LFIA 3UOKA 4FKPA 2YISA 1H07A 4QRCA 4ZSAA 3D5WA 3BEAA 3OBJA 1XBAA 4FG7A 4GG5A 2GNGA 3RHXA 5JGAA 2W1HA 4QMOA 4FTIA 1YDTE 5EHYA 1R3CA 4BGHA 3QZGA 2PE2A 3EKKA 4WA9A 4FV9A 4QTCA 3M42A 3QKKA 1Y8YA 3EYHA 3MIAA 4ID7A 2G01A 4AE6A 1GZOA 3PJ3A 3H10A 1FGKA 4RJ3A 5FWKK 2V22A 5D7VA 2HYYA 5CSXA 4IWDA 4CZYB 5KE0A 5IA2A 2XK3A 3NAXA 5E1SA 3KRJA 1NW1A 4PQNA 2W9FB 1BI7A 3FSFA 4HCTA 4QTAA 4JDHA 4W9WA 2DS1A 4K2RA 3KF7A 1YDRE 3GENA 3BBWA 4R3RA 3DAJA 5G1XA 3ZLWA 2XNPA 5DN3A 3A61A 3AMBA 4FV4A 2G1TA 3KY2A 1UWHA 3KXMA 2C4GA 5K0XA 2WMQA 2OZOA 3FEGA 4BI1A 1QMZA 3MTFA 2CDZA 2B9FA 4TRLA 4DFLA 1OL7A 3SC1A 1I44A 4P90A 3DTCA 3C7QA 3O23A 2BRHA 2ESMA 4GL9A 4BDBA 4ZMEA 5A6NA 1WFCA 1WVXA 3FDNA 4G34A 4CT2A 5AIKA 3UZTA 2C5NA 3VJNA 4AN2A 2QD9A 3GFEA 4BDGA 5HO6A 3VS2A 4CT1A 1FVTA 3SXSA 3ZLXA 5A4TA 5AAGA 1Y6AA 4GW8A 4DG2E 2JFLA 3MVLA 4OGRA 2V5QA 4YJVA 3ORIA 5FEQA 3ZO1A 3CC6A 2YLEA 4FV0A 1WBOA 4RIOA 2UZLA 2QOKA 3VF9A 4BWXA 4Z9LA 4B7TA 2I6LA 3ZOSA 4N70A 4AAAA 2OIQA 2PUPA 3LMHA 4O7NA 2WOTA 5K3YA 5A4CA 5BX0A 4PTGA 4YR8A 5ANIA 4R1YA 1WCCA 4O6EA 5E90A 3DQWA 3VBYA 4BCFA 4L7FA 2B9JA 4MTAA 3ZFXA 2PVMA 3ACKA 2QU6A 1H25A 3A7IA 3NVKI 2IVVA 3BU3A 2UW6A 3KULB 5EKOA 3BPRA 2R3LA 4Q5HA 4IC7A 3DLSA 2W99B 3W10A 4QPSA 1JAMA 3DTWA 5FP5A 1MRVA 3GOKA 4OTPA 3ZBFA 3D2IA 3HP5A 4YJSA 4DTKA 1H08A 1UU8A 4KIKB 4EK5A 1J7IA 5FBNC 4M84A 4EQUA 4F65A 1Q8TA 4ANLA 4D2TA 3EHAA 5HU3A 3UIUA 2XJ2A 4X3FB 4C36A 1YI4A 5C26A 2XKFA 4LUEA 2XKEA 3LIJA 5HX8A 3DNEA 4K9YA 1PYXA 3DAEA 3HGKA 4FTTA 3FMHA 3U51A 2F2UA 1OL6A 2GMXA 2HW7A 4NIFB 5HBHA 3P23A 5A9UA 3E5AA 4PDYA 4EK4A 4E5BA 1VYZA 4IB1A 4NWMA 5AP5A 3RBWA 1KV2A 2VO0A 3LXLA 2WGJA 4NCTC 4QP1A 4DG3E 5M56A 3PSBA 3TUDA 3UVPA 1FOTA 4PX6A 3WZJA 5I9YA 4QP3A 1M52A 1NVQA 3ZMMA 4DA5A 3MW1A 2CLXA 4PPCA 3PA3A 2O64A 4HJOA 2I40A 2UZBA 2FVDA 1BYGA 3MPAA 5ANGA 4QMNA 2G2FA 5J5SA 4Y8DA 4YPDA 2ZV2A 2RFDA 5IQCA 5B2MA 4PL5A 2HZ4A 3UC4A 3GNIB 3MSSA 2VWBA 3BGZA 2B7AA 2DUVA 3B2TA 4I6HA 5I3OA 2CSNA 4DH5A 5A6OA 4TYIA 4E1ZA 5AFVA 2IPXA 5DWRA 2LAVA 4BCIA 4CFNA 5L6PA 1Y6BA 5DR9A 1OL5A 5ICPA 3QTZA 4GCJA 4IDVA 5DBXA 3BHUA 5FTQA 4GUEA 5AAFA 4RFMA 3S4QA 4Y5QA 3I7BA 5CYIA 3AT4A 4BDJA 2WU7A 3V5JA 3Q5ZA 3B8RA 4O22A 5KZ0A 5AUWA 2IVSA 2YM4A 2R7BA 3H0YA 1T46A 4D1ZA 3QTWA 2WMXA 4EZ7A 5IMXA 5CSPA 1XHAA 5CF6A 2JDSA 5ETIA 3C0HA 4RJ7A 3IGGA 2SRCA 1KOBA 2WO6A 2XNGA 2CLQA 3QQHA 2YJSA 3IOKA 3BX5A 3NYOA 3ZH8A 2OIBA 3F5GA 4NSTA 5ANOA 3DCVA 4EH2A 3TG1A 4QTEA 5I9ZA 1ZAOA 5JQ5A 1APME 5BVKA 1IRKA 4R1VA 3KXZA 4JDJA 3WARA 5GIOE 3L9PA 4YBKA 2RFNA 1ZLTA 4HZSA 3QTXA 4GG7A 4RT7A 5LVNA 2HOGA 5BVDA 3U4WA 4C34A 3NLBA 4IZ5A 4NUSA 3QL8A 1UWJA 3DJ5A 3S00A 3MFRA 4R6VA 2WTKC 4U44A 2R4BA 5K0KA 4DEGA 5F9EA 3QFVA 4GT4A 5B2LA 1PXPA 2P3GX 4YTHA 4J8NA 4KUJA 4AACA 4KS8A 3KCFA 5EYDA 2UW7A 3KEXA 1TKIA 2GFSA 4JBOA 4QPMA 4YC6A 3CQWA 4W4XA 3KXXA 4IB0A 3ZXTA 1XH5A 5JZJA 4I24A 2QR7A 2XNOA 4QMXA 2HELA 3I79A 4AG8A 4IWQA 4WRSA 4CV8A 5LMKC 5G6VA 2BHEA 2PMLX 5T68A 3S95A 4BKJA 4CMUA 3G2FA 4U80A 4U6RA 5CVGA 3ZLSA 4WNKA 2RL5A 5C9CA 1Q8ZA 4C35A 2WIHA 3OCTA 2ZV9A 3VNTA 4QMQA 5HU9A 4CFWA 4IANA 2OJIA 4XP3A 5DFPA 5EM7A 5HEZA 4C0TA 3JVRA 4RIXB 4ALVA 3EFJA 3HNGA 3GEQA 3W2PA 4EJNA 4L00A 4FZAB 2IVTA 2VN9A 4F64A 5J9YA 5FD2A 3CCNA 4QMYA 4EI4A 1BUHA 4KBCA 3DFAA 4UV0A 4WG3A 4FSYA 4FZ6A 1PKDA 5CXHA 4A4LA 2EVAA 5CF5A 3NPCA 4CEGA 2YLFA 3DNDA 2XBAA 4ASXA 5FUTA 3ALNA 4RZWA 4E6QA 2R9SA 2UZTA 4PWNA 5F94A 5H8EA 2BRMA 3FYJX 4GMYA 2ZDUA 2OZAB 1GJOA 1H4LA 1O6YA 4U3YA 4AU8A 3VS5A 4R78A 5H8BA 2VWXA 4WNPA 2XA4A 4TZRA 4S31A 1OVEA 3LVPA 4N0SA 4DCEA 4HYIA 3F3ZA 2UZNA 3OUNB 4F7JA 5B0XA 3WZDA 2JKOA 3LXNA 5HICA 2WQBA 4ZOGA 2ETKA 3PXQA 5AP0A 5EHLA 5HG8A 4EUTA 5KMIA 5LCJA 3OT3A 4C3FA 2ONLA 1YQJA 3F3VA 4YMJA 5AM7A 3FQEA 3L9LA 3LCSA 2XH5A 5AR3A 2JGZA 5FG8A 2G2HA 4IDTA 4JRVA 3DDPA 3OT8A 4F0GA 4EORA 2ZDTA 5CT7A 3NDMA 4DFBA 5AUTA 2PWLA 3F61A 5E8UA 2P0CA 2C5YA 2NO3A 4RC4A 3VUDA 4AOJA 4BYJA 1H1SA 3F7WA 4C4GA 2J5FA 2QO2A 2VTRA 3H30A 3VC4A 4Q9ZA 3FY0A 4WNMA 3UMXA 4AFEA 5AA9A 4BCKA 5AUVA 5C8KA 2QO7A 3KRRA 3DQXA 4F63A 4F1OA 1MRUA 2QR8A 4M12A 4F99A 4XHKB 2X39A 4YZBA 4U40A 1CM8A 3SX9A 3FKNA 4LV8A 3RAHA 3D15A 2YM6A 3LMGA 3R7GA 4HGEA 4QMZA 4FTOA 3BWFA 5A4QA 3WF8A 3F82A 4H3QA 3QGWA 3T9IA 3ORKA 5BYLA 4DFNA 2FA2A 3KULA 4LQMA 5C4LA 5JZNA 2QO9A 1BL6A 4WSQA 5HE3A 3VS7A 1ZYDA 4Y83A 3PFQA 2QI8A 4CLJA 4I6BA 4U45A 3ZO2A 4AOIA 1PRYA 3C4XA 3R28A 4CTBA 2C1BA 1UNLA 4K0YA 4F7SA 3FC2A 4KIKA 3RNIA 5F4NA 5J9LA 3ET7A 4RC3A 3VUKA 2YAKA 3DDQA 4YZDA 4L3LA 4X3FA 1NA7A 4U7ZA 3O8UA 4YLJA 4JIAA 3QC9A 5BVNA 3C9WA 4DH8A 4RIYB 3TKIA 2BTRA 2Y4IB 3BHHA 1PF8A 2UW8A 2ZAZA 3A7GA 4WBOA 2I0HA 4JQEA 5DR2A 3SDJA 4USDA 5LVPA 4I5MA 3A7JA 5LVOA 5C1QB 2X6DA 3TNWA 4F9WA 2XNNA 4HPUE 5CTPA 1OUYA 2GS7A 4F70A 2V0DA 4KSPA 2RIOA 2J7TA 2P33A 3TEIA 4LUDA 5L6WL 4PRJA 1PHKA 3QZFA 1ZMUA 3VQHA 3LFCA 3Q6UA 3TIYA 1U5RA 3MJ1A 2OICA 4JXFA 4DH3A 3R1QA 2IZSA 4JG7A 3TTIA 3QZIA 5AIRA 4XG2A 2GNJA 1XH7A 2R2PA 3F6XA 4DG0E 3BU6A 4WOVA 3S0OA 4YJTA 4BTFA 2VWUA 3ZM4A 2VUWA 5JH6A 1XO2B 3V5TA 4WIHA 5F1ZA 3AC1A 3OF0A 4WKQA 5E92A 4AX8A 3EQBA 2CKOA 5CNNA 3DPKA 1ZY4A 2UZUE 4AE9A 5LOHA 4X7QA 3N4VA 2ITZA 4MH7A 2ZOQA 3H9RA 2PVNA 3LPBA 3PP1A 3QQKA 5AV3A 3V5WA 3TL8A 4FSMA 4ZY5A 5K4JA 3MFSA 3OCSA 3KF4A 1UU7A 1ZWSA 2UZDA 4D1XA 2PUIA 1WVYA 4C8BA 4R8QA 3VS1A 4BDEA 3TKUA 1NT2A 4FT9A 3ZHPC 1G3NA 3VS4A 3CIKA 5AAEA 4FT7A 3IPHA 1Q8YA 4IHPA 4O0TA 5EW3A 5AUYA 2WQOA 2O5KA 4J53A 5AP1A 4QO9A 2HWOA 4AA5A 4ZJJA 3QUPA 3RK7A 3DA6A 2W4JA 4BZDA 2UW4A 4NYEA 1H1RA 2VTHA 3R22A 3ZRLA 3RAWA 2VX1A 3F7ZA 2W5HA 3PPKA 4JR7A 3PPZA 4X2GA 3GCPA 4YO6A 1UNGA 4H1MA 3P7CA 4I6QA 1ZOGA 3QAME 3RCDA 4G3GA 4FNZA 4XRJA 3RP9A 3PWYA 3R7UA 1WBNA 4FV3A 4M3QA 1M2QA 2WEVA 4D9TA 3KREA 4L53A 3COHA 5FRIA 4M69A 5M4IA 3HA8A 2UW5A 5IPJA 5E4HA 4YLKA 3CP9A 2UZOA 4M68A 5AM6A 2QQ7A 3UYSA 3VHKA 1OBGA 3ERKA 3R8MA 3UOLA 1BMKA 1P4OA 1YI6A 2OJJA 3IO7A 4F0IA 4PP7A 4EHZA 5BVWA 2Y0AA 3O7LB 3NW7A 3RHKA 2IZUA 4FKGA 4G31A 4NJ3A 3C51A 3GQIA 3F5XA 3QRKA 1Q8WA 4OW8A 4MYGA 4ZZOA 5L3AA 2PULA 5ITAA 3C0GA 3OD6X 3Q3BA 4OBOA 4XP0A 5HD7A 3MH0A 2X4FA 1FVVA 4EBVA 3PA4A 4XLVA 3C50A 3KRWA 4JI9A 4RIXA 3P79A 1H00A 4CSVA 5HIDA 3TCPA 3NUXA 4FTUA 4FVQA 3R2BA 5EDPA 5J7HA 3VW8A 4FZFB 3QQJA 5AV1A 4IM2A 5H9BA 3NEWA 4EK6A 4DEBA 2BHHA 3AQVA 3E8EA 4HW7A 4FF8A 3E88A 2EB3A 3E8NA 4GKIA 4ZLYA 3BKBA 2RSVA 4TNDA 5AMNA 3RAIA 2OJGA 2WKMA 4PMMA 3ANQA 2I0YA 1WBWA 3PRFA 1A9UA 5HLWA 3LXPA 4G16A 4O82A 2YWPA 3KXNA 1U59A 5FTOA 2Z7QA 2OZAA 4GFGA 4CFVA 1Z57A 3DBDA 4C4HA 5JFWA 1ZMVA 4Z7HA 4XCUA 3VBTA 2BZJA 5CU3A 3EZRA 4KIPA 4ZTSA 2BVAA 3KN5A 2PZRA 4MXXA 3R1SA 4TN6A 4W8EA 4AS0A 3E7VA 1PXMA 3MN3A 3Q9YA 5C8NA 2B53A 5HQ0A 5J1WA 4M7IA 2YCSA 4IB3A 2FGIA 4L3PA 1ND4A 4RX8A 2UVYA 5EQEA 3FI3A 4NFMA 4BTMA 2WD1A 4O7WA 3QHWA 3GCQA 4UWBA 1SM2A 2WTIA 5EHOA 4R77A 3QCYA 2FSMX 1OL2A 3V51A 1OMWA 2GCDA 2W5BA 3EN7A 4BKYA 4EH9A 5L2SA 4BCNA 4YSMA 4G5JA 5BYYA 3U54A 1YKRA 3KA0A 4FVPA 4XOZA 5IKWA 2R64A 3FMMA 2OFVA 3II5A 5HCXA 1ZARA 4FTCA 5ACBC 3S2PA 5LCKA 1ZZLA 3NCGA 5CAOA 3HECA 3ENMA 4FIFA 2A0CX 4KWPA 2PVYA 1I09A 3HKOA 4ALWA 4K18A 5B7VA 4U43A 2XKCA 3SXFA 4BCPA 1SVEA 2YIXA 4WBBB 3ZBXA 2YERA 3CTQA 3OXIA 3W2QA 3F2NA 3UP2A 3E87A 4XRLA 4O0YA 4P4CA 4XJ0A 3IS5A 4J7BA 2GPHA 4C37A 3UIXA 4BDDA 4DGNA 2GTMA 1RW8A 3VQUA 4RWKA 3Q96A 3ZEWA 4JL9A 2R0UA 3EN4A 3ENHA 3D14A 2ZVAA 3LQ5A 4RLKA 3FZTA 1SYKA 4AT5A 3BLHA 4F6WA 3A99A 4FIJA 2NNWB 2VGPA 1E1VA 2ONLC 3R6XA 3EB0A 3VS3A 3QYZA 4RPVA 4GKHA 3FMNA 3MVHA 5EW8A 4O0RA 3ZS5A 2P2HA 4RG0A 3EQPA 4C62A 2JKMA 3PDTA 1CDKA 4FL2A 4WO5A 3R73A 5HZNA 2UVZA 3L8PA 4JOAA 2EXCX 3V04A 4C61A 1YDSE 4RVTA 2OKRA 3AMYA 5J9ZA 1REJA 3LW0A 5L4QA 1OKYA 5CF8A 3UODA 4CRSA 2C6IA 4L7SA 1KE9A 4RFZA 1YHVA 2W4OA 1UKHA 1PXLA 3CTHA 4BHNA 3ORZA 4RIYA 2IZTA 3VUGA 4X6RA 3F3UA 3QWJA 3V3VA 4XV3A 1KUTA 2GHMA 4O91A 5DI1A 1W82A 2FYSA 3FMEA 2HENA 3O51A 5LJJA 1B39A 3KXGA 1U4DA 3HRFA 4O83A 3E7OA 4U5JA 4TYGA 4GIHA 2XKDA 4QNYA 2B4SB 4WNOA 3CQEA 4CKIA 3ALOA 4AP7A 5KMNA 4F1MA 3VHEA 3NUSA 1TQPA 2H34A 5KMKA 3QQGA 3QD2B 3SHEA 4BICA 2VV9A 4CKRA 1FQ1B 2ITPA 4FSTA 4HVDA 2WU6A 3AGLA 3WZUA 2X6EA 5ANDA 4MD8E 3KXHA 2YA9A 3UTOA 3QUEA 5C03A 3PY1A 4AQCA 3RPOA 2X0GA 4LGHA 4X3FC 3O8PA 3Q32A 4PPAA 1XJDA 4IAKA 3OHTA 4C2VA 2QG7A 3NNXA 3VULA 2JBPA 1VYWA 2RGPA 3KRLA 4U97A 4O0WA 4BCQA 4YLLA 3WZKA 3ZC6A 3WIGA 1QL6A 5LXMA 3DKFA 2HWPA 3M1SA 3MB7A 3MH3A 3CE3A 2JIIA 4YNEA 4FSQA 3RWPA 1CMKE 2VTJA 2C3LA 4M13A 4ZTRA 3ZFYA 3ZDIA 5HE1A 1Q97A 2ZMDA 4BBEA 4EHEA 3BBTB 3IDBA 4FKIA 4F7LA 2R3PA 1JLUE 3MBLA 4ZY4A 4MD9E 3ATSA 2QOOA 4CCBA 2W1GA 2OFUA 3FQSA 3R0TA 2BFXA 4ERWA 1PKGA 3A4PA 2XK7A 4D2VA 2OBJA 2QOBA 3AMAA 3PXYA 1XQZA 4I5CA 1W8CA 5KX8A 3GC8A 2PYWA 4ZEGA 3HZTA 5JQ8A 3GC9A 2XUUA 4AFJA 1J1BA 3DJ7A 4CRLA 4I21A 3S1HA 3HRBA 5M51A 3W8QA 3ZCLA 3SV0A 3C4WA 1IA8A 3O8TA 3D94A 4FMQA 3ULIA 3CPCA 2J4ZA 3PRIA 5L2TA 3R8PA 3UBDA 4RX7A 3ZSGA 5KBRA 1FGIA 4QMTA 4MCVA 4FKRA 5HKMA 4QT1A 5IQDA 4BL1A 2PE0A 3BCEA 2E2BA 1OM1A 3CR0A 4P7EA 3W1FA 4BF2A 3H0ZA 3QRJA 3R9RA 4RWLA 1H27A 4XX9A 3QLFA 3KVXA 3JUHA 4DE4A 4Z55A 1JSUA 3SD0A 4FK6A 3VBQA 4RQVA 3P7AA 3FLNC 3F5UA 3LM5A 4BGGA 4BWPA 2ZV8A 2YDJA 5D7AA 4FTLA 4IX6A 4FV5A 1XKKA 3ORPA 4D0WA 2WMVA 5JK3A 3GU8A 4PUZA 4RJ6A 4R7BA 5CALA 4OBPA 4ANSA 5HIEA 3FYKX 3QA8A 2X8EA 2AC5A 3QCXA 4QD6A 5A54A 3UIBA 3UQGA 4ZSLA 3SAYA 5CT0A 5JGBA 5E8YA 3REPA 2QODA 5GIPE 4QQ5A 1OIRA 4O0VA 3FZRA 3WE8A 2WFYA 3DBCA 4IACA 4EUUA 5M57A 1DI9A 4FEXA 5KMJA 2QOIA 3V6SA 3RPRA 4ZTLA 4DITA 4TY1A 1ZOEA 4FBXA 4EOQA 1PW2A 3HMNA 3QX4A 2B1PA 4D9UA 3IW6A 4DLJA 1OIYA 2CPKE 4L45A 2Y9QA 3FLWA 3I0OA 4F9CA 2OSCA 4TWCA 4CG8A 3BV3A 4RIWB 5AJQA 4L9IA 3HMMA 4BBMA 5AUZA 4ZZMA 5DH3A 5FBOA 5AR4A 4OLIA 2C6OA 3ROYA 4KA3A 5BMMA 2YDKA 4EOLA 3TJDA 2B54A 4L52A 3AG9A 2XS0A 3QRIA 3CPBA 3PJ8A 4BBFA 1GIHA 1W84A 1KE8A 2VTMA 2ITUA 4DT9A 5E8VA 4BDKA 4YJNA 4C58A 3W33A 3PPJA 1H0VA 2Y6OA 4FTKA 4WRGA 4QYGA 3OBGA 5FQDC 5GHVA 5GJGA 5KBQA 1P14A 2CCIA 2WMSA 5J95A 3UYTA 5CU4A 4OTFA 4AOTA 3VS0A 5JKGA 4JX7A 2X2LA 3UZPA 2VAGA 5CU0A 3QRTA 4G3DA 3PXFA 4DYMA 4EH3A 4NK9A 4W8DA 4I4FA 2PSQA 4DFXE 3QXPA 4HCVA 2X2KA 4GJ3A 5A3XA 4D58A 1YHSA 3PVBA 3Q4CA 3V8SA 5AEPA 1UU9A 3G90X 1Y8GA 4CG9A 3L9MA 3TNIA 3TM0A 4JDIA 3MB6A 4K33A 4KKEA 4MVFA 4M97A 1IAHA 2OF2A 3RAKA 3QRUA 5F20A 4PTEA 2UW0A 2WMAA 3DXQA 1K2PA 5J1VA 2BIKB 5CSWA 4E20A 3T3UA 4I1ZA 3VBVA 4C7TA 2H8HA 2W4KA 4IZ7A 3CEKA 4JG8A 2Q0NA 4TXCA 3K3IA 1XH9A 3OROA 2W05A 4KS7A 4XG4A 3C4ZA 3BQRA 5EOLA 3RI1A 3ZUVA 3PJ1A 3UQFA 2PPQA 4QMUA 2CGUA 1MUOA 2Z7LA 3ACJA 3FXXA 3PXRA 3CTJA 4O1PA 4A9UA 5IEVA 3R2YA 4HNIA 1CSNA 4O84A 4CZUA 4D28A 3OXZA 2GFCA 3BLRA 3QALE 5JRQA 3AOXA 1JKLA 4APCA 4IIRA 3OY1A 4YGAA 3MH1A 3EOCA 3FV8A 4AZFA 4K6ZA 4LRJA 2V55A 4C02A 3I4BA 4G9RA 3L8SA 4ZS0A 3R8ZA 1BLXA 1G8AA 3EZVA 3NX8A 3R1NA 2GDOA 4O7SA 4IAZA 4KSQA 3U6JA 4PV0A 1OKZA 5BUIA 1VEBA 4QP9A 5IISA 3T3VA 4KB8A 2O63A 4MWHA 4BB4A 4BDAA 2WNTA 3CKWA 5IA1A 4CD0A 5KMOA 3SVVA 4MXZA 1VZOA 3D2KA 4MQ1A 3FI4A 2BALA 5DRBA 3UOHA 3D5XA 4ITIA 3Q4ZA 4ZY6A 3SG8A 3Q9XA 4TL0A 1HCLA 4J96A 4O38A 3U6IA 4AWIA 4LL0A 2BUJA 1R78A 4UMUA 2ITVA 2YCQA 3QD3A 4OTHA 3UDBA 2IJMA 3NYXA 4JQ8A 5HIBA 4DGGA 5AX3A 4BRXA 3E3PA 5HTIA 4EOJA 1VJYA 1KV1A 2X7FA 2C68A 3MY1A 2OWBA 1IG1A 4LV5A 3E92A 4EOPA 5D1JA 4JS8A 3FAAA 3DJ6A 3R02A 1H01A 1DAWA 3KGAA 3TKHA 4ACDA 3PE1A 3O0GA 4PDPA 5DPVA 4U0IA 4EC9A 4M69B 4CVAA 4HOKA 3PVWA 4O2ZA 2ZM4A 5ANJA 3DS6A 1Q41A 4RBLA 4ACHA 4LM5A 3MJ2A 5HTCA 3MS9A 3MA3A 4NW5A 1NXKA 4UX9A 2WHBA 4FKTA 2GQGA 4XBUA 3A60A 3BQCA 3L8VA 4H3BA 4W9XA 3PSCA 5CS6A 3DFCB 4QNAA 3NNUA 4J52A 1IR3A 3D7ZA 3FC1X 4JT3A 1HOWA 3KKVA 3R63A 1PXKA 4X0MA 3ZU7A 4FR4A 2PZYA 4DF3A 4FV1A 1OB3A 4XLIA 3EYGA 3ZONA 4EZ3A 3DT1A 3A8WA 2QOQA 3OMVA 4U3ZA 4F4PA 5IH5A
chains in the Genus database with same CATH superfamily
3FY2A 2OXDA 3Q2MA 4S34A 4BN1A 1FMKA 3FZSA 2OJ9A 3A62A 1GIIA 4L68A 4S32A 3QQLA 4D5HA 2ITOA 5IUGA 2J0IA 3CD8A 4WT6A 4APPA 4ZSEA 4P5QA 4H3PA 4FKJA 5CSHA 3WIKA 4H58A 3AC8A 2YFXA 5HHWA 4MXCA 3FLQA 1R0EA 4XBRA 4U9AA 1OGYA 3Q5IA 4ITJA 4H39A 4UBAA 5H8GA 2GU8A 1PXJA 4RX5A 4G6OA 5IH6A 3QA0A 1P2AA 2PL0A 4YTIA 4DBNA 2XAOA 4XG6A 3F66A 4AW0A 3D4QA 3PG3A 1WBPA 4MNFA 3AD4A 3O17A 4QP6A 4CMTA 4DHIB 3R30A 1SNXA 3P08A 4OT6A 3KVWA 5J5TA 1YXUA 4USFA 2B52A 4AGUA 4A4XA 4ITHA 2X8IA 1LP4A 3G6HA 4XG8A 3VUHA 4ZMFA 5DEYA 1K3AA 5HBJA 4TW9A 1W7HA 2QLUA 2W9ZB 4D4VA 5M44A 2VTLA 3BHYA 4IX4A 4S2ZA 1ZYCA 3MIYA 3UO5A 3TDVA 4BGQA 1GAGA 4GUBA 3F88A 4M0ZA 5AP3A 3RNYA 3TV6A 3LCOA 2XNMA 3LOKA 5JSMA 5CEOA 3TNHA 1B6CB 4ONAA 5FP6A 4I3ZA 3CBLA 4G3CA 5LVLA 1XH4A 4ZP5A 3TI1A 2W96B 4ERKA 1ZYSA 4FSUA 4G5PA 4TWOA 2HXQA 3PJCA 4NW6A 3C4EA 4V01A 5JFVA 2VZ6A 2EU9A 2WMBA 4NTSA 4HYUA 4EBWA 2W1ZA 5IQEA 5KMMA 2Z8CA 3EJ1A 3MFTA 3EIDA 3VRZA 4ZTMA 1JWHA 2FH9A 4OTIA 1KSWA 4RSSA 3C0IA 3ZRMA 3F2RA 3EFKA 1YOMA 4AZSA 5K5NA 3K3JA 3VWAA 5FM3A 1SMHA 2E9PA 2VNYA 1KE6A 4IVDA 1U54B 2YACA 4YHTA 3ZM9A 4RIWA 1WVWA 4Y46A 1ZMWA 3MWUA 1H8FA 2QVSE 3TV7A 1KE7A 2C6EA 3VIDA 4BI2A 5L8JA 1MQBA 3RPVA 4KRDA 3MY5A 3R8LA 2C0OA 2CGWA 4YJUA 4HPTE 5AA8A 3R7YA 1J7UA 1GZ8A 1PMUA 3R7VA 3WF5A 4O4CA 4JG6A 5IZFA 3V5QA 1Y91A 3C13A 4XV1A 5CU2A 3TT0A 2CGVA 4UALA 4MQ2A 4EOMA 2F4JA 3UZRA 4F09A 2PUUA 4FL3A 4A9TA 2IO6A 4L67A 2H6DA 3NIZA 3SGCA 3NRMA 3CD3A 3NVMB 2VWZA 2XCHA 3WZEA 4OUCA 2A19B 5ANEA 5CI6A 3LLTA 3OW4A 4GVAA 1AD5A 2GTNA 4O7ZA 3K5VA 4B8MA 3RINA 4BDFA 3IDCA 3E8DA 4E4LA 4FIGA 3UPXA 4JQ7A 1YW2A 5CAVA 2YIWA 5AV0A 3R9HA 3ZRKA 2OIDA 4GT5A 4FKUA 3OTUA 3O71A 3LFAA 5L8LA 3DZQA 4BWKA 3NUUA 5DYJA 2CMWA 4XG3A 1S9JA 3W0PA 3PIYA 1O6LA 2F57A 2QKRA 2XIRA 3QGYA 4TYHB 4D5KA 4FYOA 4IJ9A 4DN5A 4FEWA 4J8MA 4FKVA 4TTHB 5K4IA 2QLQA 2UZEA 1UKIA 4JJRA 2C6DA 3I0QA 4FSRA 4TWPA 2WZJA 4C4IA 4M0YA 3TACA 2V62A 4NU1A 5DT4A 3SOAA 4CCUA 3EL8A 4TT7A 3LLAA 3EN5A 3OW3A 4C3RA 3VUTA 5LVMA 1YI3A 2OJFE 3HAVA 1JSTA 1WMKA 1YWNA 4UYAA 2PVKA 3C4FA 3KMUA 1URCA 2C6TA 2VTPA 2XJ0A 3MGYA 4L3JA 3CGFA 3QKMA 4FSNA 2H9VA 2VTOA 1H1QA 3R00A 2CKQA 5KHXA 1GY3A 4IJPA 5CXZA 5IUHA 5BUEA 1TFFA 4PNKA 4DTBA 4BCJA 1ZOHA 4V0GB 3VJOA 5FTGA 2C3KA 3FPMA 2IW6A 4PTCA 2DQ7X 5C27A 4EQMA 4CYJA 1U46A 4FKQA 4DHJA 2LGCA 2PMNX 2OXYA 4E6AA 3Q2JA 5KHWA 4N4SA 2JAMA 3VW6A 5FXQA 4AGDA 5TT7A 3ANRA 2PVHA 3PY3A 2BDWA 3NUYA 2QOLA 2PVLA 1J3HA 3DGKA 3FZOA 4I0TA 4ZSJA 4DFUA 2Z7RA 4AGWA 1ST0A 3B2WA 4MNEA 5HOAA 2RG6A 3F3TA 1LEZA 1OIUA 1PMEA 2FO0A 4MAOA 2I7QA 4E7WA 3ITZA 3U8WA 3UE4A 5KCVA 5DEWA 3ZUTA 5IQGA 4BC6A 3D7TA 4II5A 2FSLX 4LYNA 4YZNA 5GJFA 4UWYA 3V6RA 4ACMA 1WBVA 1YXXA 1Q24A 3QC4A 4HVSA 4YBJA 3MDYA 2XRWA 3PIXA 3QX2A 4QTDA 2ITQA 1PY5A 2Z2WA 1R0PA 4H36A 3WE4A 5ANKA 3B8QA 4MF0A 3BYSA 3GB2A 5M4UA 4FEUA 5ETFA 4G1WA 1FBNA 3NUAA 4Y72A 3BLAA 3PVGA 4GK2A 3DY7A 4OTDA 4R7HA 5JFXA 3ZC5A 4ZAUA 5E8TA 1RQQA 1U5QA 3BZ3A 4YU2A 2BFYA 3FBVA 4ANQA 5CEIA 2IW9A 4RMZA 3RGFA 4MBIA 4CFUA 2VO6A 3M2WA 4QTBA 3I1AA 3DKGA 4FG9A 3HEGA 4QQTA 4FGRA 2VWYA 3L9NA 4G6NA 5ETCA 3SRVB 2J5EA 4O0SA 5EDQA 2ITXA 3I60A 4NZWB 4Q2AA 4YNOA 4E6CA 3NZ0A 4AZVA 4YHFA 2WMWA 3RK5A 4GYGA 4UMPA 4C59A 5IA4A 5IQFA 4JLCA 2J0JA 3KRXA 5EI8A 4A7CA 4D55A 3IW7A 3EQDA 3FMJA 2WEIA 4AT3A 4BCHA 4FOBA 4H1JA 5AV2A 5HI2A 2PU8A 5DLSA 3QCSA 2B9HA 3NIEA 4B6LA 3SW7A 3POOA 5M55A 1REKA 4D1SA 4FA2A 3KU2A 2BPMA 4IAAA 4FNYA 2ETRA 5DG5A 4YURA 3DBQA 4QMLA 2YZAA 3CGOA 3G9LX 3QTRA 3QU0A 4C4JA 1E1XA 2W17A 4X2NA 4XG7A 4FGBA 2I0VA 3HL7A 5A4EA 3I7CA 5IA5A 3IONA 3G0FA 5EYCA 3EQRA 5EOBA 5IUIA 2WTCA 3UG2A 3CJGA 4QPAA 3NS9A 1CKPA 4D4YA 4GH2A 2VTSA 3LXKA 4GVJA 1T45A 4XP2A 5EI6A 3KFAA 4B8LA 3MY0A 3GT8A 4MKCA 3UO6A 4FNXA 3CY2A 1BL7A 3SOCA 3KK9A 5GZ9A 4UEUA 1Q61A 1YHWA 3DB6A 2BDJA 3EL7A 4E3CA 4XNEA 5EQYA 1R1WA 4X21A 3A7HA 1DM2A 4M67A 5DIAA 3AC2A 5HG9A 1BI8A 2R5TA 3WYXA 3RCJA 3IDPA 3WI6A 4AUAA 1SNUA 2XEYA 3BYVA 3D5UA 1QPDA 5HESA 5M06A 2XM9A 4NM3A 4DBXA 3U6HA 3DLZA 4MEDA 1LUFA 3FMLA 2IZRA 4NCTA 4A4OA 4DC2A 3IK3A 4C3PA 3OP5A 3AT2A 4FRFA 3TNPC 3BE9A 3GI3A 4J99A 4UXQA 2XZSA 4HNFA 4J71A 1J1CA 3EFLA 4RFYA 5I9WA 4YC3A 2VO7A 2WTDA 4O21A 5DT0A 4F9BA 3PWDA 2C6KA 4JBVA 3HA6A 1XH6A 2YM5A 5IMEA 3UQCA 3NFGB 5IQHA 2WELA 3AC4A 3ORNA 3DB8A 3GU7A 4FIIA 4IW0A 4L46A 3W18A 4AF3A 3GQLA 3IW5A 3QQUA 4GJ2A 5DOSA 5EM6A 2HAKA 4DHFA 4FV8A 2G15A 4EKLA 3ETAA 4L01A 3UC3A 3W16A 1ZYLA 1U54A 2ITWA 4YZ9A 4IBMA 4HVGA 2PZ5A 3DKOA 5AP7A 3THBA 2HCKA 5CZIA 5IQBA 2FUMA 1UU3A 1Y57A 4ZS4A 2VWWA 2VX3A 3ORMA 3WYYA 4N57A 4QYFA 1F5QA 2YHVA 3CXWA 2IEWA 2QOFA 3SQQA 2R3IA 2ZB1A 4DEDA 5D10A 5J8IA 3OWPA 4DAWA 5CEQA 2QONA 3IW4A 3GGFA 4FKSA 2P4IA 1H1WA 2V7OA 4DINA 3NR9A 3EN6A 4HYHA 3JYAA 5IH4A 2EXMA 2PHKA 4L6QA 4O7YA 5EYMA 1UV5A 4FEVA 5CASA 2WTVA 4B9DA 3EQGA 3JR1A 2F2CB 1JKSA 4DGLC 4D0XA 1ATPE 4AXFA 4LOPA 3ZDUA 4ZSGA 3BV2A 3R83A 3LFEA 4FV7A 3PXKA 4PDSA 2X9FA 4I93A 1AGWA 3BHTA 4XEYA 4EH7A 4ZTNA 3I6WA 3IG7A 3EQHA 2O2UA 3E63A 3GUBA 3PTGA 4ZXTA 1PJKA 4IMYA 4EONA 5J79A 4I92A 5HCZA 5F95A 1M7QA 3VUMA 3FE3A 2C69A 2WTWA 4BZNA 4EL9A 5CQWA 3MV5A 4EWHA 4A9RA 3PLSA 4YO4A 1DI8A 5K9IA 4Y95A 3HRCA 5AP2A 4EYJA 5E8XA 2PZPA 3A7FA 2BDFA 3N9XA 3VF8A 4JDKA 3L1SA 3VVHA 3VBXA 4DEHA 5T3QA 5DE2A 3U9CA 4OTWA 4ASEA 2UZVA 5H3QA 4WG5A 4TYHA 3RJCA 4CZTA 3O2MA 4D2SA 4ZJVA 5K5XA 5L2WA 5LMKA 4DCAA 2UUEA 2W1FA 3TTJA 3VONA 5L2QA 1RE8A 5KUPA 1PMVA 2YIRA 4PY1A 3KCKA 2V7AA 3P78A 3TDWA 3OS3A 3CJFA 3UIMA 2YCFA 3TXOA 3FHRA 5FEDA 2VD5A 5B2KA 4I0RA 2GHLA 4D4RA 3SA0A 4CYIA 2QHMA 2J50A 5CU6A 4O7TA 3U55A 5IF1A 4IC8A 2FSTX 1NVSA 2XMYA 1TQIA 2C6MA 3Q6WA 2XP2A 3TZ8A 5J7BA 2OLCA 3LKMA 2BAJA 5HORA 4JX3A 3AC5A 1H24A 4L43A 5EFQA 4O1OA 2BROA 4O86A 4RQKA 5M53A 4YTFA 3VO3A 3FKOA 3HV7A 2WMTA 4WD5A 5EI2A 5TOZA 4V0GA 5IU2A 2F7ZE 4MXAA 4EK3A 5A14A 4YSJA 1XWSA 4FTAA 2OK1A 3KK8A 2J9MA 4MBLA 3FSKA 2JDOA 3LJ2A 3OG7A 3UP7A 1KWPA 2X4ZA 3G0EA 4GU6A 5HD4A 5CVHA 4BCGA 4XG9A 4ZTHA 1Q99A 3OCGA 2R3OA 4I41A 4EH6A 2R3HA 5JEBA 4F08A 4RJ4A 4DTAA 2XRUA 4QOXA 3N51A 3COKA 2RF9A 3O7LD 1OIQA 2WTJA 5DR6A 4AW1A 4B0GA 3W8LA 4EH5A 1PYEA 3VS6A 1JVPP 4FT3A 4XYFA 3BU5A 3JS2A 4ASDA 4OBQA 4MHAA 3BYOA 2YAAA 2AQXA 3SKCA 2X7OA 3OEFX 4I0SA 3LMIA 1Z5MA 4M14A 3TZ7A 1CTPE 3FZPA 2X2MA 3BL7A 2R3QA 4ORKA 4Y73A 4BFMA 4BTJA 4Q5EA 4BIDA 3P7BA 2YN8A 4NT4A 4FT0A 4IX5A 3GFWA 3OWKA 4CFMA 3O50A 3P9JA 4JAIA 2XNBA 3DK3A 1JPAA 1YOJA 2Q0BA 4RWIA 2XJ1A 4WUAA 1V0OA 5LMAA 5CEMA 3NFFB 2VTAA 4J97A 3CSVA 2GNLA 4G3FA 2JDTA 3LM0A 3PIZA 4LI5A 3SRVA 4G2FA 5E91A 2CJMA 2VGOA 5DHJA 2NRUA 2R3MA 3N4UA 2C5OA 4EKKA 4F6SA 4HGTA 3PXZA 3BEGA 2R3NA 3JVSA 2BKKA 5M09A 3ZLYA 2B0QA 2VTQA 2C3JA 3E64A 5AADA 3QTSA 3LZBA 4AZTA 4Z16A 5JT2A 5A46A 4K1BA 5IEXA 1PXNA 4F9AA 3QYWA 1Q3DA 3BWJA 5EYKA 1MP8A 4V05A 4W4YA 2O0UA 5C8MA 4DEAA 4YHJA 4F6UA 5TF9A 4BY9E 2WB8A 4BI0A 3QUDA 2HIWA 2JEDA 5DNRA 4BKZA 2P55A 2E9OA 4QDEA 2JKKA 4GV1A 3RTPA 2QU5A 3SLSA 3TUCA 5C01A 3DK6A 5JMSA 5EM8A 5BQ0A 5HO7A 5BUJA 1K9AA 4K11A 4D2PA 3LFQA 5CQUA 4BDIA 1WAKA 2A1AB 3DXPA 4NFNA 4ZJIA 3AC3A 3K2LA 3ZO3A 2JITA 2BZHB 3LJ1A 4QYEA 3FZ1A 4WUNA 4EEVA 3QBNA 4BVUA 3OEZA 4FIHA 3NUNA 4IX3A 4KIQA 1H26A 3LFBA 3ZO4A 2PVFA 4Z3VA 2F7EE 2HY81 3HDMA 4GSBA 3BHVA 1VR2A 3W0SA 3FMKA 3MFUA 3T8OA 1LEWA 3LFDA 3TN8A 5HVKA 5I4NA 2R7IA 1WBTA 2BR1A 4CGAA 3NSZA 3DU8A 3UNJA 2JDVA 4RA4A 1Z9XA 2REIA 4LGDA 4ANBA 3TIZA 5KKRB 3IKAA 4EZ5A 1OL1A 4UYNA 3N4TA 2CNVA 3OZ6A 3RPYA 4CMOA 3O5AA 5E9EA 3EQFA 3FKLA 4NTTA 4S33A 5CAUA 3E62A 2XK4A 2ERKA 2YM7A 3U4UA 5TKDA 3A2CA 4QP2A 5AR7A 2C1AA 2ITNA 4R5YA 4YZCA 4FX3A 4FKLA 3G15A 2GNHA 3OXTA 2W7XA 1KOAA 4E6DA 3SXRA 2O3PA 1QPCA 4XUFA 3R1YA 2NPQA 5IDPA 2YWVA 4DEEA 2J0MB 5AR8A 1V1KA 4E26A 1YXVA 4OTQA 3CS9A 4MX9A 4RC2A 3W2SA 3FLSA 3WF6A 4BYIA 4FTQA 4C57A 3P86A 4LRMA 3QD4A 5I9VA 3PUPA 2IVUA 4HCUA 4PL4A 4CTCA 4C38A 3FXWA 2GS6A 2R3RA 3H9OA 4IEBA 4LL5A 3ROCA 4ZK5A 2JAVA 4GS6A 4PL3A 3JY0A 4EC8A 4TNBA 3RZBA 4YTCA 4P5ZA 4NJDA 4DGMA 1DS5A 4IQ6A 3HMPA 3R8VA 3BRBA 3PE2A 5FLFA 3R7IA 3EQIA 3QD0A 4FKOA 2PE1A 4LOQA 4A06A 4J95A 5C4KA 1XMLA 1JSVA 2VNWA 3PYYA 3HVCA 3A8XA 3QWKA 4CNHA 4QMSA 4LOOA 4O7VA 1GOLA 3S3IA 2CCHA 1LR4A 1YWVA 2HZ0A 4ENXA 3LCTA 3OY3A 5FXSA 1CKJA 3W32A 1G8JA 3HAMA 5KZIA 4O6LA 5I5ZA 4FIEA 4LGGA 3EMGA 3U87A 4Z7GA 4M8TA 4CV9A 4MNEB 1Q8UA 2ZJWA 4PNIA 3BYUA 4IXPA 4OTGA 2XNEA 4B4LA 4K77A 3COMA 4C2WA 2BRNA 5KNJA 2BAQA 2RG5A 3DOGA 4UB7A 3BI6A 3D7TB 4KBAA 2YM3A 2GNFA 4GIIA 3MVJA 4FUXA 3NMUF 2W1IA 3R8UA 4BR3A 4E8AA 3UGCA 3FWQA 4JAJA 2XF0A 3TZMA 4I94A 2QURA 4FSZA 3UO4A 4M66A 2YEXA 5CAPA 3OOMA 2YABA 3HDNA 4IVBA 2QKWB 4CXAA 1A48A 3HV3A 3POZA 4NKSA 4QP8A 5ETAA 3HUBA 3R04A 2NP8A 2ZMCA 4XV9A 3NCZA 4CLIA 2Y4IC 4H05A 5BYZA 1BKXA 4QMMA 5JRSA 2GQRA 3WBLA 1GNGA 2VX0A 3W55A 5AR5A 3R21A 4HVIA 2Y8OA 4ZTQA 4LMNA 4NH1A 1IASA 3OUKA 1W98A 4GFMA 2PVRA 5HLPA 3DK7A 2J0LA 4ANOA 2OO8X 4E93A 1QPJA 4ENYA 2EWAA 5CENA 1UVRA 2E9NA 4PPBA 3LE6A 3GCUA 4O0XA 3QHRA 4J98A 3FUPA 3PFYA 1J91A 1HCKA 2YJRA 3G9NA 3IECA 4UXLA 1XH8A 4KABA 3G51A 3H4JA 4FV2A 2HZNA 3GU5A 4YPSA 3TJCA 4BDHA 4R3PA 4EOIA 3EWHA 2R3JA 3LFSA 4YJRA 4U79A 3PVUA 3ULZA 5CNOA 5EQPA 3P4KA 3K54A 4BZOA 1M14A 2G9XA 3A4OX 4UWCA 3MESA 2AC3A 2EB2A 3PZHA 3FLZA 1GZKA 5I0BA 5I9XA 4A9YA 5CANA 4TPTA 4GK4A 3GCSA 3SG9A 3COIA 4JBPA 4BTKA 3R7OA 3OFMA 2Z60A 2BZKB 2VTIA 3MI9A 4E5WA 2W0JA 3NUPA 4IFGA 4JVGA 2OH0E 3VUIA 2BKZA 2VWVA 1OPKA 5GNKA 4U41A 2CGXA 3PSDA 4NM0A 4XOYA 4CKJA 3NGAA 1UA2A 4M15A 3C5IA 4N6ZA 4UY9A 4AW2A 3TMOA 4TWNA 5JFSA 2BAKA 2WQMA 3E8CA 4I20A 3ATTA 5IQAA 2XVDA 3TNQB 3UVRA 3DV3A 1A06A 4JR3A 4QP7A 2X8DA 3BE2A 3E93A 4XMOA 1YXTA 3ODZX 4L42A 5FM2A 5GINE 3AGMA 4MD7E 4AZEA 4EH4A 1G8SA 4DT8A 5HVYA 3ZYAA 3C1XA 5BVOA 3HV6A 4O81A 4FI1A 4TYEA 5T6KA 3RVGA 4GT3A 3ZXZA 4EJ7A 3OCBA 2BRBA 4QYYA 1L3RE 4OAVB 2AYPA 3R01A 3FXZA 4X6QC 2JIVA 5KMLA 1NVRA 5M07A 4RJ8A 4KRCA 2GNIA 4EHGA 4UMRA 3AT3A 3MVMA 5EDRA 1JBPE 5CWZA 5HNBA 3EH9A 1X8BA 1Q62A 1FINA 3HMIA 4EQCA 3QXOA 2UW3A 4FTMA 3DXNA 4RLLA 3WILA 3WOWA 4CQGA 4GFOA 2WMRA 3Q52A 3FQHA 3V01A 1OECA 2UW9A 4UZDA 4B99A 2VRXA 2IG7A 2VTNA 3HYHA 2BTSA 4N6YA 1O6KA 3GOPA 3QTIA 4IAYA 4FKWA 4HYSA 3LJ0A 4QMPA 3OTVA 2HZIA 4I4EA 1NY3A 2I1MA 4I5HA 1JNKA 3SW4A 5HE0A 4FVRA 5JGDA 5DRDA 3PP0A 2C47A 4G9CA 4FTRA 2UZWE 2XYNA 3FHIA 3LFNA 3RWQA 2O65A 4E5AX 4BHZA 4KD1A 3ZZEA 5HNIX 3OWLA 2WOUA 2PMOX 4G3EA 3L8XA 4MWIA 2F49A 2JIUA 1OITA 2C5VA 3I6UA 3CQUA 4NL0A 5BVEA 3GC0A 1YXSA 2J51A 1M17A 4V04A 1QPEA 4AGCA 3AD6A 3MH2A 2GQSA 3KC3A 3VBWA 4BDCA 2OU7A 1JKKA 4RX9A 5CX9A 2JBOA 3T9TA 3PLAE 2YITA 3DBFA 1F3MC 5EW9A 1RJBA 3BL9A 1SVGA 3RKBA 2Q83A 3I5NA 3Q9ZA 3D9VA 3PA5A 1JKTA 1IA9A 3F2AA 4USEA 4FYNA 4AQKA 4FODA 4YJPA 4HGLA 3ZTXA 4W4WA 2OXXA 1FMOE 3ZSIA 4JNWA 3GP0A 3VRYA 1OPJA 1H0WA 4FL1A 4KAOA 2PUNA 5CLPA 3MA6A 2B55A 1OKVA 2ERZE 2X1NA 4XH6A 4AN3A 2WTKB 5HG5A 4IM3A 4LRKA 4FSWA 1BX6A 4IAIA 4O0UA 4RGJA 5IA0A 3ORTA 1IAJA 5D11A 4DH1A 3C5UA 2YCRA 5CVFA 4ACGA 5M08A 3NYNA 3ORXA 1ZY5A 4U8ZA 4KKGA 3BYMA 3OWJA 1XR1A 3QLGA 1IEPA 4IADA 3DKCA 1YWRA 3TUBA 1OZ1A 2DYLA 4UMQA 1V0PA 1WZYA 2WMUA 4YJOA 5E7RA 4A9SA 4F7NA 5EG3A 2AUHA 2Y4PA 4NIFA 5AUXA 2JDRA 3FMDA 3MPTA 4ASZA 3EQCA 3F5PA 3AD5A 4DGOA 5J87A 4DH7A 2F7XE 3QZHA 2C5XA 5FXRA 2WQNA 3KQ7A 4GRBA 5LMBA 1M7NA 2XB7A 5D41A 3ZZWA 3FPQA 2VU3A 5LWNA 5HTBA 1GZNA 1OGUA 2BIYA 2FSOX 4O96A 3WF7A 1XBCA 2YDIA 1OKWA 2XIKA 2WIPA 4BCMA 4ZLZA 4I6LA 3KL8A 3Q4UA 4Y5HA 2R3FA 2JLDA 2A4LA 3IW8A 3GBZA 4IZAA 3Q60A 2W1EA 3DAKA 4FICA 2BILB 4R5SA 5IA3A 3MPMA 5I9UA 1H1PA 2ZB0A 1TZDA 3FJQE 3Q9WA 2HXLA 2IWIA 5D9HA 2X0PA 2Z02A 2XIYA 5BV3A 3KMMA 4G17A 4EOSA 2JC6A 4GK3A 5FEEA 3I5ZA 4IH8A 4KIOA 3ODYX 3NYVA 5DGZA 4DFZE 4YZMA 3BIZA 3UJGA 4HVHA 4FTJA 3BELA 1XMMA 1Q5KA 2A27A 2RFEA 5EM5A 2NRYA 2O8YA 2QHNA 2UVXA 3M11A 4RWJA 4PMPA 3F9NA 4KKHA 5AWMA 4AXAA 2C3IB 3JY9A 1S9IA 2X7GA 3OVVA 4S30A 5AX9A 4EK8A 4BIBA 3TWJA 4EYMA 1FPUA 4ZZNA 4YUQA 2XIZA 2W5AA 2Z7SA 4DLIA 2OW3A 5CI7A 4O7LA 2IW8A 5HBEA 4EOOA 2WQEA 3HP2A 5L2IA 4W4VA 1TVOA 4OR5A 5TR6A 3UNZA 4ARKA 4AA0A 4EOKA 2CKEA 3QCQA 4G6LA 4JRNA 4QYHA 2B9IA 3D0EA 4L8MA 5E8SA 5CZHA 2CHLA 1XBBA 3UDSA 5CEKA 3Q04A 2YM8A 1B38A 3V8TA 3GVUA 4DFYA 2ITTA 3ELJA 4O2PA 2JKQA 1PXIA 3G6GA 3U9NA 3KIOC 2XEZA 3GC7A 1WBSA 2W06A 2PK9A 3HUCA 1YVJA 5DMZA 5AP4A 1DAYA 3W0MA 5EKNA 4EH8A 4AZWA 5DA3A 2J0KA 4WG4A 2OI4X 3EN9A 4I6FA 5HGIA 4RJ5A 3Q53A 2YIYA 3LCDA 4IM0A 4X3JA 1MQ4A 4FUYA 3KMWA 4EWQA 2WPAA 2ZV7A 4AA4A 4GEOA 2YIQA 4RVKA 4O4DA 5JN2A 1ZZ2A 4DEIA 2FB8A 2QOCA 5H2UA 3RALA 4RVMA 5D12A 5HLNA 5E8ZA 4OAUC 5EK7A 3H9FA 5I3RA 2EUFB 3RPSA 2R3GA 3HMOA 3QF9A 2ETMA 3Q4TA 3V8WA 4KINA 4IAFA 2A2AA 3CLYA 2QNJA 3LFFA 2CNQA 2DWBA 4RVLA 2Y6MA 1JOWB 2H96A 2QCSA 3D5VA 4WHZA 3PJ2A 2XCKA 5TE0A 4D4SA 3E3BX 3O96A 5CF4A 4RA5A 3F3WA 4YP8A 4I22A 4UMTA 2R0IA 5GZ8A 4EHVA 4LG4A 3R9OA 5IEYA 2CKPA 2RFSA 2E9UA 2XIXA 2ZM1A 3HV5A 3IQ7A 4MXOA 4X2KA 2CNUA 3W2CA 3FI8A 3UVQA 2OH4A 5IDNA 4PDOA 3LQ3A 4XS2A 4O7RA 1O9UA 1P4FA 2G2IA 3IOPA 2CN8A 5FDXA 3VN9A 2XBJA 4HZRA 5CEPA 1OBDA 1Q3WA 2P2IA 3ZSHA 2X81A 1Q4LA 1H28A 4YJQA 5HVJA 4IVAA 1MRYA 3G33A 4JIKA 5FGKA 3P1AA 4AXDA 1UNHA 3FLYA 4R7IA 5M4FA 5M4CA 3UNKA 4ANNA 2GHGA 3LCKA 5BMSA 5CY3A 4JBQA 3UMWA 2VTTA 5DVRA 1JQHA 3UDTA 4I5PA 3W2OA 2C0IA 2C6LA 4K8AA 2VO3A 2WAJA 5BNJA 5GJDA 5KO1A 2R3KA 3ZFMA 3RMFA 3AXWA 4TKSA 3K5UA 1G5SA 3GU4A 3I81A 5E8WA 2BCJA 3IGOA 3RM6A 1AQ1A 2ITYA 3FL5A 4I23A 1M2RA 3V5PA 1KE5A 4AT4A 4P2KA 3PY0A 1ZYJA 3ORLA 3JPVA 4ACCA 3HX4A 3P5KA 4MBJA 4FZ7A 2EXEA 3LHJA 4FOCA 2ACXA 5AP6A 3NW6A 2JD5A 3DBEA 3HV4A 4TYJA 3NNWA 3PZEA 1OI9A 1STCE 2OG8A 3OC1A 4IZYA 4QQJA 4UZHA 5BVFA 2XK9A 4QP4A 5HO8A 4IB5A 3TV4A 2KTYA 3GCVA 1FVRA 3RZFA 2HW6A 3OOGA 4FEQA 5A4LA 5AV4A 3EKNA 4FZDB 1J7LA 2IN6A 4FK3A 4ANMA 4NEUA 1P5EA 3NWWA 4XV2A 2VWIA 1PXOA 2KULA 5E1EA 4C4EA 3GXLA 3JXWA 2XYUA 4IWOA 2PZIA 4X2FA 2W1CA 2PVJA