5AJQA

Human lok (stk10) in complex with bosutinib
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
289
structure length
280
Chain Sequence
EHVRRDLDPNEVWEIVGELGDGAFGKVYKAKNKETGALAAAKVIEEEELEDYIVEIEILATCDHPYIVKLLGAYYHDGKLWIMIEFCPGGAVDAIMLELDRGLTEPQIQVVCRQMLEALNFLHSKRIIHRDLKAGNVLMTLEGDIRLADFGVSAKNLKTFIGTPYWMAPEVVMCETMKDTPYDYKADIWSLGITLIEMAQIEPPHHELNPMRVLLKIAKSDPPTLLTPSKWSVEFRDFLKIALDKNPETRPSAAQLLEHPFVSSITSNKALRELVAEAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stk10 with Bosutinib
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE 10
total genus 80
structure length 280
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ajqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ajqA01
4YLKA 3HLLA 3R7IA 1KWPA 3UP2A 4AAAA 2W9FB 3K5VA 3E7OA 3QCYA 4JG8A 4WSYA 1YVJA 4NK9A 3CGOA 2BIYA 3CD8A 5EFQA 3D7ZA 2P2IA 4TWNA 3MPMA 1PKDA 1Y8GA 2C69A 3BE9A 4J7BA 4QMXA 4ZK5A 4E3CA 5IDPA 5EH0A 1FOTA 4ZY6A 3RJCA 2VZ6A 1UA2A 2A0CX 2VRXA 2VX3A 2C5OA 3OS3A 4FOBA 4O1OA 1ZZLA 4D2TA 3IGOA 3UZTA 4L6QA 1M52A 4MBJA 3OUKA 3EOCA 1Z9XA 2KTYA 4FT5A 4M69B 3PA4A 3TJDA 1ZWSA 3V5WA 1H1RA 3DLZA 2UZWE 2XNMA 3L9NA 4OT6A 4IWPA 5DT3A 4FNZA 5GZ9A 4ZSAA 2OJ9A 3R7EA 3SRVA 3S00A 2RFEA 1TQIA 1MRVA 2J51A 1FINA 4OTWA 4IEBA 5AA9A 4JDHA 3QQFA 2B9IA 1WVXA 3ORLA 2XF0A 3KF4A 2XIRA 3TV6A 4F7JA 3MN3A 4C37A 3NYNA 1OBDA 3REPA 5I3RA 4XG3A 3ZUTA 4Z9LA 5BMMA 1W98A 5HNIX 4ZMEA 5IQGA 3OVVA 2XS0A 4J98A 4YZBA 4YTCA 2XEYA 2XEZA 4RIXA 4HW7A 3QHWA 4YMJA 3HRBA 3P9JA 1AGWA 5ANIA 3ORXA 3QLFA 4EQMA 4RJ7A 4K8AA 4A4OA 3E8NA 4DEEA 2UZNA 4ASEA 4EZ5A 4F0IA 3P23A 4X7QA 5CF8A 1YDRE 2C1BA 4MCVA 1APME 4IHPA 4U97A 4CQEA 4HZSA 5CAQA 3QF9A 3QTXA 3R83A 4N6ZA 2VTOA 4BTJA 2BAQA 3LJ1A 3R6XA 4X3FC 4YTFA 4K6ZA 4G3EA 2XNGA 5FG8A 3QKLA 4GFOA 4NTTA 4J53A 3SLSA 5I9WA 3E62A 4IIRA 2HZIA 4FKVA 1UU3A 4D2SA 1FGIA 1SVEA 3KVXA 3W32A 3CXWA 3GP0A 3GBZA 1ZYLA 1OL6A 4ZTMA 4EH4A 1LUFA 4DN5A 4EEVA 3RAKA 5CVGA 4P2KA 4X2KA 5F1ZA 3NEWA 4C4EA 3KXGA 3R2BA 4IBMA 3DJ5A 1RW8A 5AM6A 4USDA 3Q5IA 3F9NA 3DKFA 3KCKA 4LMNA 5DH3A 3R7OA 4RZVA 2WU6A 2OIDA 4P90A 4QOXA 2CPKE 2CKOA 3KRWA 2ERKA 4A06A 4RJ4A 3FZSA 1J91A 2PVRA 2PVJA 4KD1A 3EN5A 4AFJA 3ZEWA 3OOMA 4I93A 2V55A 3MTLA 1H0WA 3P79A 4OTFA 4EH5A 4H39A 5LQFA 2C0TA 3BYMA 3TTJA 5A6NA 4HVHA 4YJTA 4DFUA 2QODA 4FT7A 3QC9A 4GFMA 1YRPA 4FNWA 3RM6A 5HTBA 1ERKA 2SRCA 4GT3A 2C6TA 4ZZNA 3MH0A 2V62A 3RNIA 4BTFA 4CFMA 3NYXA 3LQ5A 3PA3A 4EOSA 5BQ0A 5IU2A 4LYNA 4D2WA 5IA1A 3RGFA 4FSUA 4KINA 3NS9A 5I9ZA 2IZUA 1PYXA 2XNNA 3AOXA 4KBKA 1UNHA 3EN4A 4CQGA 1H26A 3PXZA 4K2RA 4L52A 4W4WA 3WZKA 4FEQA 2Z02A 3FJQE 3AGLA 4FOCA 3FLZA 1B39A 5CU6A 2QOBA 4F6SA 5IEYA 5B2LA 4S33A 1JOWB 3TXOA 1QPJA 2GS2A 3HV6A 2PMIA 1BUHA 2OJFE 4L7FA 4M7IA 3K2LA 4NIFA 2OW3A 4ZSGA 4C57A 3DAKA 3R63A 2OO8X 5L2WA 4PMTA 4O0XA 3W18A 4KKHA 3EQFA 4PTGA 3UC3A 4GYGA 3FZRA 4DCEA 4FKUA 5C26A 3TNIA 4AOIA 1TQPA 5IKWA 3MBLA 1Q8ZA 4PF4A 1HOWA 2NO3A 1JKSA 4ALWA 3K5UA 4FZDB 4OLIA 3QTQA 2O63A 4MNEB 4XP3A 5KNJA 2OLCA 2VAGA 2WMSA 5AV0A 3ZLXA 3LMGA 4W8DA 2PMLX 4EZ7A 3LXKA 3ELJA 4YSJA 3SW7A 4G6NA 3BHTA 4IVDA 5EM5A 3ZZWA 1T46A 1YQJA 2VTSA 4E20A 4D2VA 4JDKA 2B52A 5FP6A 5JFVA 4IB5A 5AP0A 4QP4A 3NSZA 4GH2A 3RP9A 3QUEA 5CEIA 5DR6A 1BL7A 2BZKB 3IECA 4M13A 2X4FA 2R3GA 3OCGA 2PE1A 3ZRKA 5CAPA 4IAFA 1G3NA 4RVMA 3U4UA 5HVJA 1ZOHA 3VRZA 3BYUA 4FV1A 4P5QA 4AN2A 4BRXA 3D0EA 3V51A 3M11A 4E4LA 3FWQA 2JIVA 5LVPA 5KMIA 2BCJA 3GU5A 2QU5A 3GU6A 5D41A 4CVAA 3UP7A 2WOTA 5DNRA 3R01A 4RA4A 4TTHB 2UVYA 5ACKA 5KBRA 4L7SA 4JS8A 4BCIA 2CDZA 3UZPA 4CG9A 5DLSA 4TYGA 3MIYA 2R3MA 1SMHA 4PNIA 3GCQA 1ZY5A 2FUMA 5J9ZA 1OUKA 4L00A 3MA3A 3MH1A 4FV8A 5I9UA 5KMMA 3KKVA 2WIHA 3CPCA 3PG1A 4IFCA 4Y5QA 2EB2A 5AWMA 5IA5A 5DGZA 2QD9A 2FH9A 3QX4A 3KMWA 3OZ6A 5DFPA 4XJ0A 4JBPA 2VTHA 5LVNA 4O7RA 5E91A 3TV4A 4R7HA 3PLSA 4FTNA 4L43A 1XH8A 4HGTA 2OF2A 2WTCA 4LOOA 4BICA 5ANDA 1GZNA 4RC2A 1TQMA 1BX6A 2GMXA 5LOHA 2XNOA 2XK8A 2B54A 3RHKA 5JFSA 4E5BA 5JMSA 4TPTA 1KE9A 4B8LA 4USFA 4TN6A 2V7AA 4D58A 1P4FA 4HZRA 3FMMA 4MD7E 1CKIA 4HGLA 1TVOA 3FL5A 3CJFA 4BI0A 3OBGA 1DI9A 4RFMA 2OICA 2J0JA 2WGJA 4YR8A 3QYZA 1M2QA 3GC9A 3HZTA 2ZM4A 3B2TA 2X8IA 2Z7SA 3NUUA 2UVZA 3AXWA 4JRNA 4QMPA 4B8MA 2R3LA 4NM5A 2R3FA 5AIKA 5M57A 3ZRMA 1I44A 4M69A 3COKA 3R7YA 2Y0AA 2RFDA 4ANQA 3IONA 2KULA 4QRCA 5E9EA 2CKEA 4JR7A 4L42A 4YNEA 2ACXA 4IB0A 2C47A 2GTNA 1OKYA 3R30A 4Q5EA 4RPVA 4DEAA 3GGFA 4F0FA 4FTIA 1LEZA 5E8WA 1PXLA 2O3PA 4WBBB 2OZAA 2VD5A 1YHVA 3MJ1A 4XV3A 4GG5A 4Q9SA 5IUIA 3MFSA 3CS9A 4BGHA 3FZTA 4R3RA 5L2QA 3OXIA 3FEGA 2YIRA 1Q8UA 2PVLA 3OT3A 4P7EA 2XIZA 3BBTB 4X2GA 2X39A 2O64A 1WCCA 3JYAA 4RWLA 3TI1A 1S9IA 3UC4A 2NNWB 5CSPA 4O2ZA 4AZEA 3O8TA 1KOAA 2IZRA 3AT4A 2W1EA 3HX4A 2XH5A 2YIQA 1CMKE 4J97A 1YI6A 3NGAA 4QPSA 3COIA 5EI6A 5FGKA 3VUIA 3U8WA 3UIBA 3V5PA 3HV3A 2XIYA 4WBOA 4EOMA 4E7WA 2OIBA 1CDKA 2QVSE 4X6QC 4YLJA 2A27A 2EU9A 2WOUA 3KK8A 4QNYA 4J96A 1CSNA 4I92A 3MY1A 3R1QA 5EQYA 2AYPA 3FMKA 5EW9A 2VWVA 3LXPA 5M08A 4QPMA 2GSFA 4AZVA 2OBJA 5HHWA 5HG8A 3I7BA 1STCE 3UO6A 3H10A 3MDYA 2IJMA 2WTKB 3Q5ZA 4FKPA 4ZSJA 5HZNA 4GVAA 3VO3A 3BYVA 3QQHA 3IW6A 4KS7A 3EKKA 3PP0A 1XH5A 2C6OA 4KAOA 5D9HA 3SV0A 3DCVA 4ACHA 4C58A 4DGNA 5KMJA 5LCJA 4R7BA 3ZS5A 5K0XA 1F3MC 5BYZA 4XV9A 3JVSA 4WNOA 3DAEA 2YJSA 4X3FA 5AP4A 2PVHA 3DBFA 3NCGA 3K54A 4IH8A 5KX8A 4DBXA 3D5XA 3I0QA 4QYYA 5KCVA 4CLIA 3C5IA 3RK9A 4I24A 2YM5A 1H1SA 4BHZA 5CNNA 4GMYA 3ZFYA 4O0VA 4PDOA 3QALE 3QZIA 4JR3A 4XS2A 3ZOSA 4UMUA 4UWCA 4JJRA 4D2PA 4FV3A 4CMOA 4ASZA 2VNYA 4W4YA 3PWDA 2R3NA 5AP7A 1H07A 3QKKA 3MESA 3BU3A 4ZSLA 1G8AA 2YCQA 4V05A 4E6DA 4IZAA 4YSMA 3V3VA 5CZIA 4AFEA 4E26A 3EQPA 4OUCA 3R1NA 4UXQA 5GJGA 4XYFA 3CSVA 4BCGA 4X3FB 3BQCA 5TT7A 1OM1A 4IDVA 4JG6A 4GYIA 4DEIA 5A9UA 4FIHA 2O65A 4BBEA 3A7GA 3Q9XA 4AS0A 1G5SA 4YJSA 4YC3A 2PYWA 2YABA 4FI1A 3WF6A 2W96B 4ZOGA 3QRIA 3VS7A 4R8QA 3MB6A 5BMSA 1KSWA 2R4BA 3OOGA 5HCYA 4AUAA 4D1ZA 5CEMA 3SOCA 4DGGA 4NYEA 3DXPA 4Z7GA 3BGQA 3MJ2A 1V0BA 5JFWA 5D7VA 2CNUA 2YITA 1JLUE 3GC8A 1E9HA 4DINA 1REKA 2ZM1A 5J79A 4FL3A 2QURA 2CJMA 2DS1A 2UZVA 5KZIA 1QPDA 4OAUC 3LJ2A 4NCTA 5GZAA 4KRCA 4AT5A 3O71A 4FZ7A 2XB7A 2QO9A 2HW7A 3A7FA 2PSQA 3ZXTA 1A9UA 3O8PA 2PUIA 2F7XE 4V04A 4ZTRA 3ZLSA 3OW3A 5TO8A 4DT9A 2C30A 3FLWA 3HL7A 3EZVA 4QMUA 4CNHA 4AACA 3UOKA 4FSTA 4XHKB 4QNAA 4YNOA 4O0TA 3VN9A 1ZYCA 3VW8A 4CFVA 4FKOA 3TT0A 3ZTXA 5CF5A 1JKLA 2YERA 5FTQA 1OITA 4C2WA 5CAUA 3KMUA 3UQFA 3BCEA 3G15A 3ALNA 1JAMA 3KRRA 4A7CA 4CEGA 1IASA 1OZ1A 5JSMA 4TL0A 2NRYA 4KBCA 5CSVA 5CEPA 5FXRA 3MYGA 1A06A 2R5TA 4XRJA 2I0YA 4JAJA 2B9HA 2YCFA 3ZUUA 2BMCA 3EQRA 4U81A 3F5UA 1XH7A 3IGGA 4FVQA 3GCVA 2XK6A 2XVDA 3ZXZA 3FZOA 5DEYA 4GT4A 4FE2A 2XM8A 2QR8A 4DH3A 3ODYX 1PYEA 5DT4A 4TNBA 4XH6A 5BVNA 4BDBA 3PIXA 3MB7A 1KV1A 1BYGA 4A9UA 4TKSA 3TNPC 2R9SA 4I22A 3ZSHA 2B0QA 4C3RA 4LG4A 4BDHA 5AADA 4YURA 2Y4IB 2BHHA 3T8OA 3AGMA 4HYSA 3PVUA 4PDPA 2G2IA 3HA6A 4K33A 5AP5A 3TKUA 3VS4A 4DG0E 1MUOA 3PTGA 3FMEA 4IX4A 4IJ9A 4OBOA 3VQHA 1AD5A 3ZEPA 5M4FA 5IF1A 3HV7A 1UU7A 3JUHA 3V5JA 5J9YA 5FTOA 5M51A 1WVYA 4FKRA 5FM2A 3Q53A 4FL1A 4IM3A 5DBXA 3E63A 4CFFA 1R78A 3VNTA 4BCFA 2UW9A 4GV1A 5J1VA 4PUZA 2XK7A 2IVTA 3VJNA 5TOZA 2R3RA 4GT5A 3ZLWA 4QQTA 2UW5A 4L8MA 3IOPA 3ATSA 2VWBA 3MVHA 3VUMA 5LWNA 2PMOX 4OTQA 2P4IA 1WBWA 1ZOGA 3QA0A 1IAHA 3FI8A 3PJ1A 2V5QA 2C6KA 5HD4A 5JK3A 3FPQA 3GC7A 3I5NA 3LM0A 3KN5A 5CYIA 4I4EA 1Y6BA 5B2KA 3VS3A 4BVUA 3HGKA 1K2PA 1GIIA 4MAOA 4AT3A 5HTCA 2Y6OA 2QLQA 3PPJA 5AAGA 4YZCA 3DXNA 3ACKA 3BHYA 4YTIA 2WTKC 2R3IA 4F65A 2WMWA 1IRKA 4I1ZA 4YHFA 3EJ1A 4G1WA 3NRMA 3VHKA 4KS8A 3ZMMA 1H1PA 1NVRA 2VWXA 4G17A 2QR7A 1QMZA 3EZRA 3PP1A 2C3JA 4D9UA 4OT5A 3L8VA 5JKGA 4HJOA 4UMQA 2RF9A 3TUDA 1K3AA 4ZEGA 3N51A 3VS0A 2VO7A 4FSQA 4F08A 4QD6A 3UIXA 5D1JA 3U55A 4FSWA 4ANSA 3DAJA 2W1IA 3Q6WA 4PP7A 2PL0A 2WAJA 3OXZA 4ANBA 4BDDA 4KSPA 5HTIA 2ZYBA 3KRXA 3NYVA 2EXCX 2W5AA 4IAIA 2BRMA 2BZHB 2W7XA 5DRDA 5EYCA 4EJNA 5DG5A 3UNJA 2NPQA 4RC3A 4ASXA 2PWLA 4I5HA 5E8UA 3E5AA 3G0EA 3NUAA 3OCBA 2BVAA 3NAXA 5CY3A 5IEVA 2UW8A 3FMDA 3EYGA 3Q4ZA 1LR4A 3UVRA 4RMZA 4IWDA 1GOLA 3O8UA 3SXFA 3MY0A 2BALA 3EIDA 3R1YA 4Y72A 1XH6A 3C7QA 4QP8A 5DA3A 4QP7A 4WA9A 3ORIA 3RPYA 1PF8A 3TV7A 4ACDA 4AW5A 3ORZA 3D5UA 4D55A 3QA8A 1L3RE 1LP4A 2JIUA 1GZKA 3KY2A 2R2PA 4G5JA 3GCSA 4NW5A 3TZ9A 2F2UA 3JXWA 4KWPA 4UZDA 4GIIA 2W0JA 4JI9A 2WMUA 4LGHA 5BX0A 4BZDA 3AC3A 5IH4A 2YAAA 4E5WA 4C0TA 2PVNA 3T9IA 2WMAA 2BAKA 5FTGA 3GEQA 2H34A 3AQVA 3SXSA 2YHVA 4UYAA 2Q83A 3VS1A 4C8BA 4DGMA 4WRGA 3HMIA 3ID6C 4BL1A 3NUNA 4JX3A 2E9PA 2XBJA 2HK5A 3C51A 3Q96A 4GJ3A 1YXVA 3ULZA 2ZDTA 4DFLA 2OU7A 2OXXA 2F9GA 3VBYA 2Q0NA 3TKIA 3PXKA 3JPVA 3MH3A 4EORA 2A2AA 1W84A 3PIZA 4HOKA 3LFQA 2ITUA 3DY7A 5CWZA 3O7LB 4G3CA 4B7TA 5CAVA 1H08A 4NW6A 4E4XA 1HCKA 4G9RA 3VULA 4JBQA 1GAGA 2QU6A 4IZ5A 4R5SA 4DEBA 4TY1A 1WBOA 5CANA 4ZY4A 2BROA 3G0FA 4TZRA 4TYHA 3IDBA 4MBIA 1KE5A 4M66A 4BIBA 3I7CA 3WI6A 5GIPE 4DFYA 3VBXA 2UW6A 4F63A 2WMBA 3FV8A 4TWOA 2X81A 2WEVA 3MVJA 3KU2A 3SW4A 5LMAA 2E9OA 4HCUA 4CGAA 4EH8A 2XYNA 1PJKA 4KSQA 5HNGA 1V0OA 3PSBA 4CTCA 4JG7A 1H24A 2VTTA 5HLWA 4U8ZA 4UALA 4C4HA 5HBJA 4QMOA 2WTWA 1ZY4A 3ENHA 4KIKA 3AC2A 3UOHA 1PMEA 4U3ZA 1Q62A 4QYGA 3KCFA 1P2AA 3QQJA 5BUIA 3RAHA 4QP6A 2ITPA 2UZUE 4V0GB 2OWBA 3UGCA 2HENA 2B9FA 4KB8A 3CEKA 3UVPA 1ZMUA 4W4XA 3OWKA 3NDMA 4IW0A 2VTQA 4EOPA 3OY3A 3KULB 4H58A 4NFNA 3LQ3A 3ZONA 4IANA 4FZFB 3Q9ZA 4X21A 4C3PA 3LCKA 4IADA 5FBOA 5M07A 5L8JA 4R78A 2R3HA 2OZAB 3BLHA 3V5TA 4BDIA 4J8NA 4FNYA 4IJPA 3HA8A 3RZBA 2J5FA 3QQGA 3L9LA 3R7VA 3ORNA 4M8TA 4PMMA 3EQCA 3C4FA 2JGZA 4IAAA 5DHJA 5DR9A 2ERZE 4BDCA 4QMQA 3I1AA 1PMUA 4FGBA 3MGYA 2UZLA 1OIYA 3QD2B 2RFNA 1NA7A 4O86A 2F49A 2J7TA 4RG0A 4AGDA 4PWNA 3UE4A 3FDNA 2ITNA 4P5ZA 3TM0A 3GC0A 4XP2A 3T3UA 3A7IA 4O0SA 3T9TA 2HZ4A 1A48A 4YPDA 1L8TA 3CE3A 4RLLA 3TZ7A 2Y9QA 2FGIA 3D9VA 3HDNA 3R71A 4RT7A 4CRSA 1TKIA 1OL2A 1S9JA 3PXFA 4ZS4A 3LFDA 4DTAA 5DI1A 1PXIA 4L67A 4QMYA 4G16A 2W1HA 4BI1A 3P0MA 2PUUA 4E6QA 4HVDA 3FHRA 3B2WA 3AMAA 3DV3A 4B0GA 1CKJA 3DJ6A 1OUYA 5CXHA 4BB4A 3FZ1A 3LFFA 3TL8A 5IA4A 4XP0A 3GFWA 3RCJA 2GQSA 5DYJA 2XIXA 4AZFA 4RX7A 5TKDA 1JWHA 2B7AA 3FMNA 3ZFXA 1FGKA 4R7IA 4BCNA 4QQ5A 4MYGA 3JS2A 5HG7A 3DPKA 3W1FA 2PVMA 4QMZA 4K18A 3W2QA 4EQCA 3EQBA 2BRNA 3AC8A 3I4BA 4IMYA 3LFSA 5FM3A 4MEDA 4Q2AA 4AGUA 3EQIA 5BVOA 3DKCA 2X6EA 5CSHA 4IM0A 3VBVA 2AC5A 2ETMA 3E92A 3R28A 4YJRA 1YHSA 4IVAA 5K0KA 4EH7A 1OPJA 2OK1A 4AWIA 3QD4A 5HNBA 3DZOA 3HUCA 3CIKA 2I1MA 3R7UA 2X6DA 3G33A 4TWCA 2XNBA 4RX5A 3FAAA 3TIYA 2ZV2A 4QTAA 3NZ0A 1NY3A 2VV9A 2FSMX 4U43A 5HLNA 4WT6A 4DBNA 3G9LX 3MS9A 4PDSA 3W2SA 4B9DA 3GQIA 3E88A 4BHNA 2CN8A 4UMRA 3IPHA 5IQEA 3HMMA 1KUTA 1GNGA 4PTCA 4PPAA 2RSVA 4U5JA 4Y73A 1PMVA 3HVCA 4BCJA 2F4JA 2J9MA 4TNDA 3PYYA 5J5SA 3RNYA 3WE8A 2Z8CA 5EW8A 4L3PA 2BHEA 4NZWB 3A8WA 4V01A 4YP8A 4EI4A 3P1AA 4DYMA 3D2IA 3C4WA 4CCUA 3F66A 1CM8A 4GUBA 3VS2A 2QOCA 1IG1A 2Z60A 2WXVA 5EDPA 2Y8OA 4I4FA 4IAYA 1SM2A 3BEAA 2FSTX 1PXMA 5E92A 5F95A 3RALA 1JVPP 3ERKA 2YEXA 4U6RA 3DK6A 3NNVA 2JC6A 4L3LA 5GJDA 3SVVA 2IW6A 5JN2A 4MD8E 3IO7A 2G15A 3W2PA 4WG5A 3AD5A 5LVLA 3KULA 4WSQA 4H1JA 3VRYA 3IW5A 2G9XA 5LCKA 3KMMA 4GK2A 1REJA 3D14A 3GOPA 2I0VA 1GJOA 3E3PA 2HWPA 3POOA 4GW8A 4LUEA 4RIOA 2XYUA 3QXOA 2BDJA 3NNXA 1W7HA 2C68A 4GEOA 4N70A 3LMHA 3DBDA 1Y8YA 2ITQA 3WILA 5AMNA 4XG4A 1MRYA 4YO4A 3KB7A 4LGDA 4E4MA 3ZSGA 4BYIA 4DFXE 5HX6A 5EOBA 3FYKX 1WBNA 3P86A 3PIYA 1VEBA 2IVVA 4Q5HA 4BCPA 4E1ZA 3S1HA 2XKFA 5HIDA 4RX9A 3JVRA 1WBTA 3FE3A 4FIEA 1XHAA 5CNOA 2OZOA 4ITHA 4I21A 4O7LA 4D1SA 2JKQA 4UMPA 4MHAA 1HCLA 4D0XA 4W8EA 2W17A 3NLBA 3HNGA 4C4JA 3QUPA 1DAYA 4U3YA 5AAFA 3LJ0A 2UW4A 4NCTC 3SQQA 4ENXA 2PK9A 4G31A 3RBWA 4EH2A 3K3IA 1OKZA 5C27A 2P33A 3FYJX 2YZAA 5FQDC 1P14A 3SD0A 2V7OA 4ITIA 4TW9A 4IZYA 1ZRZA 3EFLA 3JY9A 2ETRA 4BIDA 2OFUA 4HVGA 2CGXA 3OY1A 4RVKA 3D15A 4CMTA 2FSLX 4DEGA 2XJ0A 3NUSA 4NM7A 4QTDA 4APPA 1JSUA 4DGOA 3FMHA 2Z7RA 5IPJA 2VWWA 4S31A 3FHIA 5CF6A 2HY0A 1OECA 2PY3A 3UDBA 3BZ3A 4CT2A 3FKLA 2W9ZB 3CLYA 4X2JA 2P3GX 3H9FA 1QL6A 4FVRA 3DK7A 3L8XA 3V5LA 3TNQB 2QG5A 2VWIA 3TZ8A 3EKNA 4BWKA 1PXJA 4FT0A 3ZSIA 4JDJA 5HGIA 1ATPE 1YI4A 3ORKA 3PPKA 3I6UA 3N9XA 2JEDA 2G2HA 2YJRA 2CKQA 3PVWA 4NIFB 3WF5A 4C02A 3W2RA 4A9TA 4EC9A 3OCSA 3DBQA 1YXTA 4G3FA 4U7ZA 4D9TA 4AQCA 5KMNA 5GJFA 5FBNC 2GNHA 4O27B 2V22A 4ZTQA 2XMYA 1YXXA 3VBQA 1IEPA 4I5PA 1RQQA 5CSXA 1XR1A 3GQLA 2PE0A 3D5VA 3PSDA 4UY9A 3KXZA 3WIKA 3VW6A 3KRLA 3ROCA 4BDFA 3LVPA 1DAWA 4MNEA 4KIPA 4A4XA 1T45A 2OF4A 4H05A 3VS6A 4JT3A 4CV9A 4YBJA 3II5A 4BKZA 4DLJA 3HV4A 1Q3WA 5GINE 2O5KA 3R21A 2RGPA 3OEFX 3RWQA 5LVMA 4KBAA 3NR9A 4E73A 2C6IA 4JBVA 4BBFA 4BDKA 2RL5A 4TYEA 3R73A 2RKUA 2VGOA 3QXPA 1URWA 3GVUA 3PG3A 2UZEA 4JIKA 4QYHA 1WMKA 4BF2A 3BBWA 4B99A 5IH6A 4MF1A 5DIAA 5FXQA 2OXDA 4LFIA 3Q4UA 3N4VA 2XRWA 1UNLA 1W0XC 5FRIA 3SAYA 3WF9A 3KFAA 2IWIA 4F7LA 3RK5A 4HGSA 2WPAA 3ZU7A 3OUNB 5GNKA 2REIA 4Y95A 4XBRA 3GENA 1YW2A 3KQ7A 5C8KA 4FV7A 3OTVA 1FPUA 3BE2A 4WKQA 4ONAA 5J8IA 4BCKA 5DRBA 3F5XA 4WOVA 4F7SA 1KE8A 5CVHA 2PULA 3EB0A 3BV2A 4RIWB 4Y46A 1Q8WA 5CALA 1KE7A 4BTKA 5M56A 4BIEA 5ANGA 4LRJA 2R0UA 4BDAA 4XNEA 2EWAA 5ETFA 5L2IA 1H1WA 3ORMA 5HOAA 3BYSA 2YDJA 4UV0A 3C13A 4FBXA 4IQ6A 3QTRA 5AX3A 4ALUA 1R39A 2UW0A 4U45A 5JZNA 1U54A 3QAME 3R7GA 2P55A 3I79A 5EM6A 3FY2A 4ENYA 3H9RA 3E64A 3LPBA 2C5VA 2O0UA 3OP5A 1QCFA 2DQ7X 2IG7A 4PNKA 3DBCA 2C3LA 3A99A 5AFVA 2WMTA 4LQMA 4CD0A 2WO6A 3UNKA 2G2FA 5TE0A 2HIWA 5AP2A 4MXXA 3U87A 2OFVA 5B0XA 4BTMA 2JDVA 4MWHA 4BKJA 2F7ZE 2J0IA 5HESA 1U46A 3C4XA 4JVGA 4CXAA 3W2CA 4BCMA 5AR5A 2Y7JA 3FKOA 3SKCA 2Z7QA 4DG2E 2X8EA 4QTCA 3OEZA 3RWPA 5EDRA 3Q6UA 4F1TA 3ORTA 1FBNA 2WMVA 3RPSA 3UPXA 2QQ7A 2PZYA 4EBVA 4BYJA 2X9EA 4Y83A 2VN9A 5E8VA 3NYOA 4EH6A 3E7VA 3QRTA 3BKBA 4M67A 2ONLC 4MVFA 2CLXA 4EOKA 4QO9A 4NL0A 3IDCA 4ACGA 4FKSA 4DF3A 3UJGA 2GHMA 2PVYA 2AC3A 4JIAA 2YDIA 2FA2A 3C1XA 2YM3A 5C4LA 2BPMA 5GIOE 3PWYA 4AW1A 2HOGA 3LOKA 3UPZA 3OD6X 4CZYB 4HGEA 4O38A 1W83A 3PA5A 4PMSA 3SOAA 2EXMA 4QP1A 3O17A 2F7EE 5F4NA 4AA0A 3DFCB 3IDPA 4O81A 3DFAA 1XJDA 4NJDA 4DC2A 4G34A 4NEUA 5CEKA 2DYLA 3GFEA 4XG8A 3TJCA 5M06A 3EN6A 3NMUF 3LAUA 3LQ8A 3BWFA 3ZRLA 3FXWA 2Z2WA 1M7QA 2G01A 5IQBA 3PFQA 5AR8A 5FWKK 3W10A 1IA8A 4X0MA 1WBSA 3R8VA 2BKZA 3VIDA 1U5RA 5LXMA 3PPZA 3ENMA 5D12A 2JLDA 1OL5A 2GS7A 2WIPA 4FV2A 1M17A 2ITTA 3A2CA 4GVJA 5BVKA 4AX8A 2YZLA 3E8EA 5E90A 3ANQA 4RJ8A 1H0VA 2C6LA 3OF0A 4DFZE 3PXYA 5KMOA 4C3FA 4NU1A 5LMBA 3ULIA 2XKCA 5CEOA 4P4CA 2B1PA 3DB8A 4U44A 4U41A 3S95A 5E8SA 4O83A 3DS6A 4G3GA 4YJUA 4UN0C 4FZAB 5L4QA 4FIJA 5AP1A 5L8LA 5M4CA 2BDFA 3V8TA 4RVLA 1OPKA 4FSYA 4X2FA 2VO0A 3KVWA 3BEGA 4YJNA 4EUTA 3OTUA 3WF7A 3EQGA 4UYNA 3U51A 1PXPA 2UVXA 3ZC6A 5GHVA 4C34A 4FYOA 4O7VA 4GRBA 4FK6A 4DEHA 2WTJA 3NPCA 3U9NA 3EWHA 1M2RA 4LL5A 4EK4A 4F1MA 4LGGA 4CYJA 3V04A 1WBPA 2B4SB 3QGYA 2UZTA 3RMFA 4F6WA 4UZHA 3U4WA 3VUGA 4XV1A 3HYHA 4FEVA 2LGCA 3MFRA 4W9WA 4D2RA 3QQUA 1YOMA 4I0SA 3ZC5A 4NUSA 5K5NA 3ANRA 4FIIA 4FEWA 3JR1A 4WHZA 4MXOA 1J1BA 4BY9E 4CT1A 3DGKA 4J99A 5CU0A 4RFZA 4NKSA 2HCKA 3VUHA 2P0CA 2OIQA 2YIWA 2WQBA 4RJ3A 3UG1A 4WRSA 4IDTA 4BI2A 1O9UA 1YWRA 1URCA 5A3XA 2V0DA 3QL8A 3D94A 3QZFA 4RA5A 4OTHA 4RSSA 4Q9ZA 5JQ8A 4CFWA 4YTHA 4LV8A 4FGRA 3HKOA 3R8UA 5AR3A 1H27A 4UWYA 3TG1A 2W1GA 3A60A 1OKWA 4FTQA 4HVIA 2ZM3A 5DMZA 4KRDA 3LCTA 2QOLA 5L2TA 4A9YA 1JSTA 2VTPA 4EOIA 3OBJA 1FVRA 5AUVA 5J7HA 4RVTA 1JNKA 5C1QB 5I0BA 1B6CB 4LV5A 4U40A 5CQUA 4EUUA 2CNQA 3LIJA 4O1PA 3MY5A 4AZSA 3P7AA 1FVVA 5BVDA 3A62A 5HU3A 2VUWA 3I0OA 4KA3A 5CEQA 5EYDA 3BV3A 3KK9A 5DT0A 5AR7A 5FEEA 5I9XA 2X7FA 4RWKA 4NM0A 2YACA 3TNWA 3TZMA 4O6EA 3PZEA 1JQHA 4F9YA 3COMA 3M42A 3ZCLA 5KKRC 3KRJA 4D1XA 4ORKA 3IS5A 4ANMA 2JKMA 3SC1A 4M0YA 3BU5A 2YWPA 4NH1A 4BWPA 4CLJA 4IE9A 4U9AA 3RKBA 3C50A 1EH4A 4YJPA 3ZBFA 3V8WA 3Q04A 4FSNA 1MRUA 3BIZA 3P4KA 5HE3A 5HQ0A 2EUFB 3GT8A 4FV0A 4UB7A 4EJ7A 2CLQA 3HRCA 4YZMA 3CBLA 3VS5A 2QOOA 1OI9A 2GTMA 3L8PA 4I6QA 4AXAA 4U42A 5CLPA 5K3YA 2E9UA 4C7TA 3EFJA 3GXLA 4FUYA 5IQCA 3R04A 5HLPA 3LHJA 2XM9A 2XKDA 1MQ4A 3OT8A 4IVCA 4MBLA 4I0RA 5HE2A 4CKRA 1MP8A 2OJGA 5T68A 3LM5A 3B8RA 4DA5A 4I41A 3VBWA 5IA3A 3Q52A 1H4LA 3D5WA 2PZPA 5FUTA 3MTFA 1PRYA 1U4DA 2B53A 2ITVA 1OKVA 3DTWA 3MIAA 2QOFA 4O7NA 5A6OA 3O51A 5HBHA 4DT8A 1YWVA 4WUNA 2GDOA 3LZBA 1Q3DA 1WVWA 5HCXA 3R9OA 5IQDA 4F4PA 4QMNA 3V6SA 2BZIB 3FSKA 3GCPA 4W9XA 3PXRA 3P78A 2Y4PA 2ITWA 3R8PA 4BCOA 1XBAA 4FTMA 4F9BA 3FLNC 3K3JA 4YZNA 4DH8A 3SA0A 4K0YA 3RM7A 3UO4A 2YA9A 1J7LA 4EOOA 2QI8A 3OG7A 3ZLYA 4BBMA 1CKPA 2CCIA 4JBOA 5J1WA 2JDTA 3FQHA 2C6DA 4YGAA 4OTDA 1VYZA 4IX6A 1WFCA 3GUBA 2PE2A 5H3QA 3W16A 2UZDA 4FG9A 2YN8A 5C4KA 4JL9A 5ANJA 2QLUA 4FC0A 3FL4A 5JZJA 1J1CA 4USEA 5ITAA 2G1TA 3OWPA 4XG7A 2WKMA 2I0HA 3C4CA 4RGJA 5CS6A 5M55A 4NWMA 3VWAA 2HY81 5J9LA 3V8SA 2CSNA 4XLVA 3FI2A 2OH0E 3MPAA 3C4ZA 4ID7A 4M0ZA 3R8MA 3NVMB 4ZZMA 5CASA 1DS5A 2HELA 2JD5A 3U9CA 4C36A 3LCOA 4RRVA 2IVSA 4I3ZA 3MVMA 3QWJA 1ZZ2A 3MSSA 3QRUA 4N6YA 4FK3A 1SNXA 4K9YA 4YJOA 4EHVA 5HO7A 5IA0A 1OIRA 3PUPA 3L1SA 3PY3A 4GFGA 4CCBA 4F0GA 2BILB 2FVDA 2XP2A 1NW1A 5IISA 4DG3E 3LFAA 1FMOE 4RQVA 3PXQA 3NWWA 2X0GA 3LE6A 3DT1A 3DZQA 4LRKA 3FXZA 5B7VA 3P08A 5IQIA 4C4FA 3IOKA 3EL7A 4FUXA 2YIXA 5AX9A 2YCSA 4RIYA 4I5MA 2GNFA 4FG7A 4J1RA 3BLRA 4M68A 1DM2A 3AMBA 5M4UA 3Q4TA 4IFGA 4WUAA 4D4RA 4FV9A 4Y85A 4I94A 2OXYA 5L2SA 3LLTA 1CTPE 4MD9E 4E93A 1H25A 1ZAOA 3H0ZA 4ZLYA 2XRUA 3ET7A 2QCSA 3TDVA 2OG8A 4OBQA 2PMNX 2PVKA 4IXPA 3W8QA 3EFKA 3ZDIA 4AW0A 1E1XA 5EM7A 4QYFA 3VC4A 4QTEA 3PLAE 4BDGA 5EK7A 2OH4A 4AN9A 5EKOA 4JX7A 4I20A 2BKKA 4R6VA 2F57A 5HCZA 1ZARA 3VBTA 1ZXEA 5HIBA 4C61A 5HI2A 2X9FA 3KA0A 3GI3A 4RX8A 5AA8A 4EONA 4FKGA 4NM3A 5A14A 4D28A 1NT2A 4D4YA 2W5BA 3EQHA 4ZP5A 2WEIA 5HVKA 3WBLA 3POZA 4GJ2A 4FF8A 3RPOA 3D2KA 1P4OA 4JNWA 5CU3A 2YIYA 3FLYA 3KGAA 5I4NA 2FO0A 2WTDA 3SGCA 3QTIA 5JQ5A 2J90A 3E8CA 5D7AA 5DR2A 1FQ1B 2PUNA 5M44A 5IH5A 2XIKA 5BVFA 4BZOA 4EKLA 4YHJA 5AIRA 3GOKA 1ZYSA 4GG7A 2WQNA 4GSBA 1RDQE 3Q4CA 3QWKA 3TEIA 2AUHA 2OJJA 4O96A 4RIWA 4J52A 3AMYA 4HYHA 1UWJA 2PTKA 3S0OA 4ZIMA 4R5YA 2I7QA 3BLQA 4F09A 2XNEA 4O91A 3F6XA 4U0IA 4J8MA 3ALOA 4FA2A 3QTUA 4C35A 4AW2A 2CN5A 3ZM4A 5L6PA 3BELA 1M14A 4WD5A 2F2CB 2Y4IC 3CPBA 4EH3A 2WQEA 2YDKA 2FYSA 2CGVA 3KXHA 4OGRA 1JSVA 3UQGA 3DDPA 1Q4LA 3ZDUA 1F5QA 3RK7A 5BUJA 1MQBA 3RI1A 3FI3A 5LWMA 3WZDA 3F7ZA 4AZWA 4TT7A 4N57A 3AG9A 3F2NA 1Q24A 2XCKA 4FKJA 1QPCA 1U59A 2GHLA 3R9RA 1W82A 5EG3A 3O23A 5CENA 3A4OX 3WZUA 4OW8A 4XLIA 3EHAA 4FV5A 2WMXA 2IO6A 5AV2A 3G9NA 4KNBA 3HMNA 4XCUA 4FTRA 5G6VA 4XOYA 4XG9A 3DNDA 4IZ7A 5E8XA 3ZFMA 4WNKA 2X4ZA 5FLFA 5A46A 5AR2A 4D4SA 2IZTA 2WB8A 4PTEA 3UODA 3R9HA 1YDSE 1H00A 3OMVA 4I5CA 2J2IB 4KKGA 3NIEA 4IVBA 1JBPE 4M14A 4RQKA 3E3BX 3MVLA 3MFTA 4BR3A 3FLQA 3KC3A 1OB3A 3LXNA 5E1EA 5HX8A 3AC5A 3QTWA 4RBLA 4FKWA 3AD6A 4YJVA 2GS6A 3WZJA 3FMLA 3GCUA 1XBCA 4ANLA 3O2MA 3U6IA 3QQLA 3R00A 1YI3A 5ICPA 5KE0A 4DE4A 3U6HA 3P7BA 4JQEA 4AGCA 2YM8A 4DFBA 4QQCA 2R0IA 3DLSA 3DTCA 2EB3A 5L6WL 5F9EA 1OIUA 4DFNA 2HW6A 4FKIA 3NNUA 2O2UA 5KHWA 1R1WA 1XWSA 4ZY5A 1ND4A 4EYJA 2O8YA 4EK3A 4D5HA 5IA2A 3BX5A 5AP6A 4CSVA 1VYWA 3IQ7A 3BPRA 1VZOA 3OW4A 4E8AA 3EL8A 1O6KA 2ZV9A 2JDSA 2WMRA 4WNMA 3WARA 4S2ZA 4FT9A 3PDTA 3PZHA 4TYIA 4S34A 4FL2A 3WOWA 3CP9A 4EK8A 1ZMWA 5H9BA 3F5GA 3QGWA 1BI7A 3GB2A 5FEDA 5KZ0A 2HYYA 4M3QA 3LFCA 1NXKA 4LRMA 3BHHA 3CJGA 3ROYA 2CCHA 4TXCA 4L44A 4N4SA 5T3QA 3WF8A 2JITA 3EH9A 3HMOA 1YOLA 4OBPA 4EK6A 4MK0A 2BTSA 4L45A 5B2MA 5DPVA 2NRUA 1R0EA 4M12A 4YO6A 3UG2A 4MH7A 3Q9YA 5E8YA 5C01A 2WMQA 4G9CA 5C9CA 3RPRA 3ZO2A 2PPQA 1GIHA 1Y57A 4O22A 3ZH8A 3ZM9A 4H3QA 4H3BA 4QP3A 1I09A 3CC6A 4PX6A 3S4QA 2E2BA 2VTRA 4YPSA 3V5QA 4ASDA 3HECA 1ZLTA 2BAJA 5FD2A 4I6BA 5KUPA 4KUJA 2VTJA 3WZEA 3NVKI 2ONLA 3FC1X 4KIOA 4C4GA 1RJBA 4G6OA 4AG8A 2WTVA 4EL9A 5HU9A 4MTAA 3BGPA 3PE1A 3F82A 4N0SA 5JT2A 4FSMA 4ZLZA 2ZOQA 5FEQA 4EHGA 3UQCA 2Z7LA 4A9RA 4X6RA 4R1YA 5IUHA 5HG5A 3HAVA 4PV0A 4O7TA 1M2PA 2J5EA 5IUGA 3BI6A 4DTBA 3UOJA 3UIMA 2GPHA 5HICA 1IAJA 4O7YA 3DOGA 3DNEA 5KMLA 4C38A 4C33A 3QBNA 4JQ8A 3RAIA 5L3AA 4IWQA 3MI9A 5M09A 4I0TA 4RZWA 3HEGA 2X2MA 3O96A 5I9YA 2XBAA 3TUCA 2IW8A 1W8CA 4PL5A 3CKXA 1JKTA 3FLSA 2UW3A 2VO3A 3R2YA 4LOQA 2XKEA 4RLKA 4ZTSA 1X8BA 4F9AA 4IWOA 4OTIA 3ACJA 2VNWA 2YM4A 3H9OA 3IG7A 5DWRA 2B9JA 3VF8A 4ZJVA 4FR4A 5EI2A 4JOAA 4O2PA 3W2OA 5HO8A 2VWYA 4UEUA 3QX2A 2JDRA 4AU8A 3RINA 1QPEA 4EYMA 4DCAA 4TYJA 1GY3A 1AQ1A 2QNJA 3ZYAA 2BIKB 2C0IA 5IEXA 4FIFA 4DHFA 1YDTE 4A07A 4NSTA 4LL0A 2BDWA 4EWHA 1XBBA 4E6AA 3D4QA 3KXNA 5FXSA 4WG3A 4ZXTA 5M53A 2YWVA 1OMWA 2C4GA 4FX3A 3TIZA 4IC8A 1E1VA 2ITZA 4V0GA 3ZHPC 4PPBA 3VQUA 4BGQA 4ANOA 3NIZA 1BL6A 4BZNA 4NJ3A 5J7BA 4BDJA 5EI8A 4F6UA 4PMPA 4MQ2A 4FYNA 4MXYA 5BYYA 3VAPA 3H30A 4CRLA 4ACMA 3U54A 3E93A 3UMXA 3G6GA 2C3KA 5AP3A 4FKQA 4K77A 1OVEA 4RC4A 5CTPA 4PPCA 3Q2JA 3PJ3A 4HPTE 3DQXA 5E8ZA 4IB1A 4FODA 5BNJA 2HAKA 3PJCA 2VGPA 4PRJA 4R3CA 3AC4A 4G3DA 4C62A 1M7NA 4JRVA 4FVPA 4MXCA 3PJ2A 4GUEA 4ITJA 3G5DA 4CV8A 5IQHA 2J6MA 2OI4X 4IB3A 3NUYA 4LMUA 5CXZA 4K11A 2C0OA 1H1QA 1Z57A 1FMKA 4O84A 3EN7A 5DEWA 3BQRA 2GU8A 2ITOA 2W1FA 3FSFA 4GCJA 3WYXA 3FMJA 3MV5A 3QC4A 4EHZA 3C4EA 3NUPA 3DBEA 5AJQA 3TKHA 5EDQA 3VUKA 3A7JA 2YAKA 4ZJIA 4RWJA 2UW7A 4ZTLA 4DITA 4NKAA 1B38A 3O0GA 4FG8A 3TACA 5HIEA 4FTOA 4MF0A 2VWUA 4MXZA 3RCDA 4QP9A 5KO1A 4F70A 2WQMA 3UNZA 2R64A 1ZYJA 2R3QA 3FUPA 3CGFA 4WO5A 1H01A 3DU8A 2BFXA 4HCTA 4AGWA 2IN6A 2QOKA 2X8DA 5HE0A 3F3UA 3F88A 2YISA 3ETAA 4O0RA 3FQEA 4FMQA 4IX3A 4LI5A 4EKKA 2I40A 2J0KA 4MNFA 1Q97A 3EFWA 1J7IA 3D7TA 3O7LD 2A4LA 5LMKA 3P7CA 3D7TB 3UMWA 4AN3A 3R1SA 4K1BA 4D0WA 4EOLA 5IMEA 5HEZA 3PRFA 2BRGA 3QRJA 3PE2A 4O0YA 4UXLA 1FVTA 3FI4A 3RHXA 4CFUA 5K5XA 2IPXA 3W55A 4F64A 1OPLA 1G8SA 4Z16A 2W1DA 3F69A 5DE2A 4BC6A 4CKIA 3BHVA 4L68A 2BFYA 2C3IB 4XG6A 4XEYA 5DOSA 3KXMA 4I6HA 3LW0A 1DI8A 5A4LA 1XO2B 5A54A 5CT0A 4GS6A 3L8SA 2YFXA 3P5KA 4U80A 2PZ5A 2R3KA 3COHA 4OTRA 3SXRA 4O7WA 4QMMA 3IW4A 1PXNA 2ZMCA 4PY1A 4YZ9A 5JRQA 3ODZX 5I3OA 5CSWA 3ZO4A 4WNPA 1R0PA 4BFMA 2QG7A 3DDQA 5KBQA 3NAYA 5CAOA 3S2PA 2JBPA 3Q32A 4IX5A 4FTLA 3SG9A 1PXOA 2CGUA 3OROA 3F3ZA 3F61A 1PXKA 1UWHA 2R3JA 2C6MA 3BRBA 4WIHA 3F2RA 5JGBA 1OGUA 4MXAA 4FIGA 3QKMA 2W4OA 4IAKA 3U6JA 3SX9A 3A4PA 2QONA 4PDYA 4LM5A 3UYTA 5HD7A 2XK4A 2P2HA 4KKEA 2JFLA 3QCQA 4EOJA 4AOTA 2UUEA 4NT4A 4JXFA 2WZJA 4EZ3A 3Q3BA 4BDEA 4DH7A 4H36A 3I5ZA 3MFUA 2WD1A 5AUYA 1ZMVA 5CVFA 5EYMA 2WTIA 5CI7A 5ANEA 3OWJA 4EOQA 2JIIA 3OWLA 3BHUA 5JGDA 3HP2A 4ZS0A 4FSRA 3TN8A 3NUXA 4HNIA 5IQAA 3RAWA 3FKNA 3FZPA 2OSCA 4QP2A 2QOQA 3HAMA 2ZJWA 4FICA 2J50A 3HRFA 4F9CA 3BU6A 4RWIA 4F9WA 5A4CA 4H1MA 5AUTA 5IMXA 1OBGA 4PP9A 5E1SA 3SRVB 4UX9A 4UWBA 3NW6A 1KOBA 5LVOA 5H8GA 2X7OA 3VHEA 4CMUA 1BLXA 2X2LA 3C0HA 4FTAA 1WAKA 5HKMA 3NCZA 3E87A 1VR2A 3TNHA 4NFMA 3TTIA 5A4TA 2QKRA 4II5A 3BWJA 4RFYA 3RZFA 5L6OA 1OIQA 2JAMA 4FV4A 3LKMA 1UKHA 3KF7A 3F3TA 5ANOA 5TR6A 1SVGA 2QC6A 2IZSA 4QMTA 4PL4A 5AV1A 5C8NA 3QTZA 5LMKC 4MX9A 4IC7A 2W06A 4ERWA 4FSZA 5F20A 1U5QA 3Q60A 4HYUA 5JRSA 2J0LA 4XG2A 3R8LA 1YOJA 3DKOA 4CFXA 1GIJA 1JKKA 3O50A 2J4ZA 4HPUE 5A4EA 3ATTA 2CHLA 3H4JA 3CQWA 4XOZA 5KKRB 3FY0A 2WHBA 5AR4A 2BUJA 2QOIA 2UZBA 2XNPA 4KABA 1SZMA 2H9VA 2HXLA 2R7BA 4FNXA 5J95A 4YZDA 3V6RA 4ARKA 3WYYA 4BCHA 3KL8A 3PJ8A 3EN9A 4IM2A 3PY0A 3QFVA 3KN6A 2H6DA 3FXXA 3PRIA 2W1ZA 4O21A 4HCVA 2PZIA 3DK3A 2ZAZA 3I6WA 4JLCA 3QZGA 4OTPA 4APCA 3CY2A 1WZYA 3ORPA 3R02A 2DWBA 1PMNA 4RIXB 1BI8A 5H8BA 3PVGA 4FTKA 3CR0A 4R3PA 2JKOA 4JQ7A 5IZFA 4EWQA 1UU9A 4YBKA 5JGAA 4ZLOA 4L3JA 4GKIA 4G2FA 5HE1A 3BYOA 2ZVAA 5LJJA 2VX0A 2Y6MA 3L9MA 3G6HA 1YKRA 1GZ8A 3QCSA 2E9VA 4FTTA 2FB8A 2YM7A 5J87A 2XUUA 2CGWA 4S30A 3ZO1A 3R8ZA 3A61A 4O7ZA 1J7UA 3GU4A 2QHMA 4RJ6A 4QQJA 4ALVA 4C59A 3EMGA 4EC8A 3CY3A 4XRLA 4AA5A 2HWOA 4Z55A 3IKAA 4J95A 5AUXA 5E7RA 5HG9A 5KHXA 3OCTA 1XKKA 4H3PA 5EKNA 3QZHA 2GFSA 3KEXA 5G1XA 4O7SA 2CNVA 1YHWA 4O6LA 4UMTA 4XMOA 2BRBA 3H0YA 2C5YA 4S32A 4EK5A 2A1AB 3F7WA 3UVQA 3FQSA 3TUBA 5AEPA 3RVGA 4CG8A 4RJ5A 1V1KA 2ITYA 4YHTA 2QO7A 5A4QA 2W5HA 1K9AA 2WU7A 3S3IA 3N4TA 5AM7A 4CFNA 3HMPA 3NW7A 3SHEA 5IQFA 2NP8A 4HVSA 1SNUA 4I23A 1Q61A 3TCPA 4J71A 3GNIB 3I60A 1Q5KA 4FZ6A 3VUTA 5EHLA 2PVFA 5J5TA 2WQOA 3G51A 1Y6AA 1UV5A 5CQWA 3QUDA 2IW9A 4YU2A 3DKGA 5E8TA 3ITZA 4L46A 2ZV8A 4RIYB 2W99B 2VX1A 2C6EA 3HP5A 5IG1A 1Y91A 4MKCA 3MW1A 2GNIA 3QTSA 3HDMA 4HNFA 3WIGA 1Q8TA 2FSOX 4MWIA 4ANNA 5JFXA 1YWNA 5CT7A 5BVEA 5ETAA 4G6LA 2JKKA 5CX9A 3DJ7A 5C03A 3QD3A 4AF3A 4CZTA 3F2AA 2QO2A 3AT2A 5HORA 4YUQA 4O0UA 2W1CA 3UIUA 5CU4A 3TDWA 3DQWA 5F94A 2W4KA 2XK3A 5I9VA 4QYEA 4FKTA 5AUZA 4FTUA 4Z7HA 3UYSA 5IDNA 5HBEA 1O6LA 4OAVB 4C4IA 4YJQA 1P5EA 5D10A 3M1SA 2QKWB 5HVYA 4X2NA 3GU7A 5CZHA 2VWZA 3Q9WA 3MA6A 1RE8A 2HXQA 4CKJA 1PHKA 4QMWA 3CTJA 1OL7A 1U54B 5EOLA 4DLIA 5FDXA 4GK3A 3QHRA 1F0QA 3D83A 3BGZA 5C8MA 2YLFA 3FC2A 2RG5A 3FBVA 2GNLA 2GFCA 2H8HA 4A4LA 1VJYA 1IR3A 3I81A 4ZTNA 2GNGA 3PVBA 2LAVA 3IW7A 3CTQA 4CTBA 4LUDA 4Y8DA 3UOLA 4QTBA 1V0PA 4PQNA 2B55A 3M2WA 4ERKA 5M4IA 2HZNA 3LXLA 2X2KA 2XA4A 2QOHA 5BVWA 5GZ8A 2WNTA 4G5PA 3F3VA 5EW3A 3QLGA 5K4IA 4TYHB 3OHTA 3R9NA 2I6LA 4GL9A 3HV5A 2UZOA 4OTGA 4XV2A 3CCNA 2ZMDA 4QT1A 4D5KA 2PUPA 3NW5A 4FKLA 3KREA 3KXXA 4OR5A 5CI6A 4F7NA 3UZRA 3LMIA 5D11A 3UTOA 4AA4A 4C2VA 4R77A 3L9PA 4JAIA 2JBOA 2GCDA 3CTHA 3IW8A 2EVAA 2WFYA 3MWUA 5ACBC 2XZSA 3OFMA 4F1OA 4X3JA 2ITXA 1R3CA 2C5NA 1IA9A 3A8XA 4QPAA 5JH6A 3Q2MA 4QMVA 4XX9A 4DH1A 3QU0A 4GIHA 5JEBA 2X7GA 3B8QA 3FPMA 5K9IA 5EM8A 5CF4A 4E4NA 4YC8A 4XBUA 2VTMA 4GKHA 2ZB1A 3SDJA 2RIOA 3PY1A 2R3OA 1PY5A 4L9IA 1H8FA 3VJOA 2YLEA 3WE4A 1Q41A 2BTRA 5KMKA 2OJIA 3SG8A 2VO6A 1UU8A 5BYLA 1UNGA 2GNJA 4UBAA 5ANKA 2ETKA 2HZ0A 2W4JA 3CKWA 4AOJA 4E6CA 3ZUVA 4EQUA 3NX8A 4FV6A 4DGLC 5EQPA 2Q0BA 4Z3VA 5DN3A 3CD3A 4I6FA 2IVUA 3LFNA 4QMSA 5DVRA 4IAZA 3DA6A 3QYWA 1PW2A 5T6KA 2JDOA 4M97A 2ESMA 3C9WA 3T3VA 4BCQA 3DXQA 4TWPA 4KIKB 1UVRA 5HO6A 3R9DA 2GQGA 4B6LA 3RPVA 3C0IA 4ACCA 2ZDUA 5BUEA 3UBDA 4R1VA 4U79A 4HYIA 2BZJA 2PZRA 3NNWA 4PL3A 2PU8A 2XJ1A 2E9NA 3THBA 2BR1A 4YC6A 1YXSA 2R7IA 2YCRA 2ZB0A 4XUFA 5EYKA 4DEDA 4CZUA 5FP5A 3E8DA 2VU3A 3MH2A 1SYKA 4GU6A 4TRLA 3C0GA 4L01A 3AC1A 4BGGA 4FEXA 5E4HA 4LOPA 3AT3A 1OL1A 2VTNA 4QMLA 2OKRA 5CU2A 3VVHA 1LEWA 4AE6A 3AD4A 2UV2A 4JDIA 4GK4A 3QRKA 2H96A 1ZOEA 4ZMFA 1KV2A 3R0TA 4NTSA 4BWXA 4FEUA 3LLAA 2VTAA 3CQEA 3F5PA 2OGVA 1XH4A 2RG6A 4AZTA 3OC1A 5EHYA 4EH9A 5H8EA 4F99A 5ETCA 4ZAUA 1NVQA 1Q8YA 3LCDA 2CKPA 3G2FA 1XQZA 2C5XA 3EYHA 1O6YA 4A9SA 4DTKA 4IACA 3W33A 3UO5A 3ZBXA 2EXEA 3PSCA 4GU9A 4ZTHA 5LARA 3RTPA 5L8KA 2XJ2A 1BKXA 1Z5MA 3C5UA 2GHGA 2R3PA 5AUWA 3EQDA 4EHEA 4BN1A 1UKIA 3LFEA 4ZJJA 1KE6A 1SVHA 3W8LA 3CQUA 5AUUA 4FTCA 1YXUA 1PKGA 1Q99A 5K4JA 5AAEA 3OXTA 4L53A 4ZSEA 2XCHA 2A19B 2QHNA 3QD0A 3R22A 2YM6A 3LFBA 4E5AX 3ZO3A 3JY0A 4CYIA 4MQ1A 4BKYA 1BMKA 3IK3A 5TF9A 3MPTA 1H28A 2PHKA 2ZV7A 3H3CA 2C1AA 4WG4A 3ZZEA 2JAVA 4AP7A 5AV4A 4DH5A 5I5ZA 5BPYA 3N4UA 4M84A 3VUDA 4AE9A 4D4VA 2WELA 2BRHA 4YLLA 4W4VA 3LCSA 4FT3A 4ZZOA 3HUBA 1LPUA 3F3WA 5AV3A 2W05A 1J3HA 1JPAA 1XH9A 1ZYDA 4Y5HA 3G90X 5ETIA 3DB6A 1WBVA 2JFMA 3A7HA 4KIQA 2VTLA 3QCXA 4B4LA 2CMWA 2RFSA 4O0WA 1NVSA 5FDPA 2XK9A 4AT4A 5H2UA 1GZOA 2DUVA 3GU8A 2X1NA 3QQKA 5EHOA 5EQEA 4DAWA 3V01A 2VTIA 3VF9A 2I0EA 2GQRA 2J0MB 4EBWA 4M15A 3TWJA 4O82A 4FTJA
chains in the Genus database with same CATH superfamily
4YLKA 3HLLA 3R7IA 1KWPA 3UP2A 4AAAA 2W9FB 3K5VA 3E7OA 3QCYA 4JG8A 4WSYA 1YVJA 4NK9A 3CGOA 2BIYA 3CD8A 5EFQA 3D7ZA 2P2IA 4TWNA 3VONA 3MPMA 1PKDA 1Y8GA 2C69A 3BE9A 4J7BA 4QMXA 4ZK5A 4E3CA 5IDPA 5EH0A 1FOTA 4ZY6A 3RJCA 2VZ6A 1UA2A 2A0CX 2VRXA 2VX3A 2C5OA 3OS3A 4FOBA 4O1OA 1ZZLA 4D2TA 3IGOA 3UZTA 4L6QA 1M52A 4MBJA 3OUKA 3EOCA 1Z9XA 2KTYA 4FT5A 4M69B 3PA4A 3TJDA 1ZWSA 3V5WA 1H1RA 3DLZA 2UZWE 2XNMA 3L9NA 4OT6A 4IWPA 5DT3A 4FNZA 5GZ9A 4ZSAA 2OJ9A 3R7EA 3SRVA 3S00A 2RFEA 1TQIA 1MRVA 2J51A 1FINA 4OTWA 4IEBA 5AA9A 4JDHA 3QQFA 2B9IA 1WVXA 3ORLA 2XF0A 3KF4A 2XIRA 3TV6A 4F7JA 3MN3A 4C37A 3NYNA 1OBDA 3REPA 5I3RA 4XG3A 3ZUTA 4Z9LA 5BMMA 1W98A 5HNIX 4MUQA 4ZMEA 5IQGA 3OVVA 2XS0A 4J98A 4YZBA 4YTCA 2XEYA 2XEZA 4RIXA 4HW7A 3QHWA 4YMJA 3HRBA 3P9JA 1AGWA 5ANIA 3ORXA 3QLFA 4EQMA 3W0NA 4RJ7A 4K8AA 4A4OA 3E8NA 4DEEA 2UZNA 4ASEA 4EZ5A 4F0IA 3P23A 4X7QA 5CF8A 1YDRE 2C1BA 4MCVA 1APME 4IHPA 4O4EA 4U97A 4HZSA 4CQEA 3QF9A 3QTXA 3R83A 4N6ZA 5CAQA 2VTOA 4BTJA 2BAQA 3LJ1A 3R6XA 4X3FC 4YTFA 4K6ZA 4G3EA 2XNGA 5FG8A 3QKLA 4GFOA 4NTTA 4J53A 3SLSA 5I9WA 3E62A 4IIRA 2HZIA 4FKVA 1UU3A 4D2SA 1FGIA 1SVEA 3KVXA 3W32A 3CXWA 3GP0A 3GBZA 1ZYLA 1OL6A 4ZTMA 4EH4A 1LUFA 4DN5A 4EEVA 3RAKA 5CVGA 4P2KA 4X2KA 5F1ZA 3NEWA 4C4EA 3KXGA 3R2BA 4IBMA 3DJ5A 1RW8A 5AM6A 4USDA 3Q5IA 3F9NA 3DKFA 3KCKA 4LMNA 5DH3A 3R7OA 4RZVA 4AXFA 2WU6A 2OIDA 4P90A 4QOXA 2CPKE 2CKOA 3KRWA 2ERKA 4A06A 4RJ4A 3FZSA 1J91A 2PVRA 2PVJA 4KD1A 3EN5A 4AFJA 3ZEWA 3OOMA 4I93A 2V55A 3MTLA 1H0WA 3P79A 4OTFA 4EH5A 4H39A 5LQFA 2C0TA 3BYMA 3TTJA 5A6NA 4HVHA 4YJTA 4DFUA 2QODA 4FT7A 3QC9A 4GFMA 1YRPA 4FNWA 3RM6A 5HTBA 1ERKA 2SRCA 4GT3A 2C6TA 4ZZNA 3MH0A 2V62A 3RNIA 4BTFA 4CFMA 3NYXA 3LQ5A 3PA3A 4EOSA 5BQ0A 5IU2A 4LYNA 4D2WA 5IA1A 3RGFA 4FSUA 1G8JA 4KINA 3NS9A 5I9ZA 2IZUA 1PYXA 2XNNA 3AOXA 4KBKA 1UNHA 3EN4A 4CQGA 1H26A 3PXZA 4K2RA 4L52A 4W4WA 3WZKA 4FEQA 2Z02A 3FJQE 3AGLA 4FOCA 3FLZA 1B39A 5CU6A 2QOBA 4F6SA 5IEYA 5B2LA 4S33A 1JOWB 4AAYA 3TXOA 1QPJA 2GS2A 3HV6A 2PMIA 1BUHA 2OJFE 4L7FA 4M7IA 3K2LA 4NIFA 2OW3A 4ZSGA 4C57A 3DAKA 3R63A 4BJJB 2OO8X 5L2WA 4PMTA 4O0XA 3W18A 4KKHA 3EQFA 4PTGA 3UC3A 4GYGA 3FZRA 4DCEA 4FKUA 5C26A 3TNIA 4AOIA 1TQPA 5IKWA 3MBLA 1Q8ZA 4PF4A 1HOWA 2NO3A 1JKSA 4ALWA 3K5UA 4FZDB 4OLIA 3QTQA 2O63A 4MNEB 4XP3A 5KNJA 2OLCA 2VAGA 2WMSA 5AV0A 3ZLXA 3LMGA 4W8DA 2PMLX 4EZ7A 3LXKA 3ELJA 4YSJA 3SW7A 4G6NA 3BHTA 4IVDA 5EM5A 3ZZWA 1T46A 1YQJA 2VTSA 4E20A 4D2VA 4JDKA 2X0OA 2B52A 5FP6A 5JFVA 4IB5A 5AP0A 4QP4A 3NSZA 4GH2A 3RP9A 3QUEA 2AQXA 5CEIA 5DR6A 1BL7A 2BZKB 3IECA 4M13A 2X4FA 2R3GA 3OCGA 2PE1A 3ZRKA 5CAPA 4IAFA 1G3NA 4RVMA 3U4UA 5HVJA 1ZOHA 3VRZA 3BYUA 4FV1A 4P5QA 4AN2A 4BRXA 3D0EA 3V51A 3M11A 4E4LA 3FWQA 2JIVA 5LVPA 5KMIA 2BCJA 3GU5A 2QU5A 3GU6A 5D41A 4CVAA 3UP7A 2WOTA 5DNRA 3R01A 4RA4A 4TTHB 2UVYA 5ACKA 5KBRA 4L7SA 4JS8A 4BCIA 2CDZA 3UZPA 4CG9A 5DLSA 4TYGA 3MIYA 2R3MA 1SMHA 4PNIA 3GCQA 1ZY5A 2FUMA 5J9ZA 1OUKA 4L00A 3MA3A 3MH1A 4FV8A 5I9UA 5KMMA 3KKVA 2WIHA 3CPCA 3PG1A 4IFCA 4Y5QA 2EB2A 5AWMA 5IA5A 5DGZA 2QD9A 2FH9A 3QX4A 3KMWA 3OZ6A 5DFPA 4XJ0A 4JBPA 2VTHA 5LVNA 4O7RA 5E91A 3TV4A 4R7HA 3PLSA 4FTNA 4L43A 1XH8A 4HGTA 2OF2A 2WTCA 4LOOA 4BICA 5ANDA 1GZNA 4RC2A 1TQMA 1BX6A 2GMXA 5LOHA 4DDIA 2XNOA 2XK8A 2B54A 3RHKA 5JFSA 4E5BA 5JMSA 4TPTA 1KE9A 4B8LA 4USFA 4TN6A 2V7AA 4D58A 1P4FA 4HZRA 3FMMA 4MD7E 1CKIA 4HGLA 1TVOA 3FL5A 3CJFA 4BI0A 3OBGA 1DI9A 4RFMA 2OICA 2J0JA 2WGJA 4YR8A 3QYZA 1M2QA 3GC9A 3HZTA 2ZM4A 3B2TA 2X8IA 2Z7SA 3NUUA 2UVZA 3AXWA 4JRNA 4QMPA 4B8MA 2R3LA 4NM5A 2R3FA 5AIKA 5M57A 3ZRMA 1I44A 4M69A 3COKA 3R7YA 2Y0AA 1W2CA 2RFDA 4ANQA 3IONA 2KULA 4QRCA 5E9EA 2CKEA 4JR7A 4L42A 4YNEA 2ACXA 4IB0A 2C47A 2GTNA 1OKYA 3R30A 4Q5EA 4RPVA 4DEAA 3GGFA 4F0FA 4FTIA 1XMLA 1LEZA 5E8WA 1PXLA 2O3PA 4WBBB 2OZAA 2VD5A 1YHVA 3MJ1A 4XV3A 4GG5A 4Q9SA 5IUIA 3MFSA 3CS9A 4BGHA 3FZTA 4R3RA 5L2QA 3OXIA 3FEGA 2YIRA 3W0QA 1Q8UA 2PVLA 3OT3A 4P7EA 2XIZA 3BBTB 4X2GA 2X39A 2O64A 1WCCA 3JYAA 4RWLA 3TI1A 1S9IA 3UC4A 2NNWB 5CSPA 4O2ZA 4AZEA 3O8TA 1KOAA 3W0SA 2IZRA 3AT4A 2W1EA 3HX4A 2XH5A 2YIQA 1CMKE 4J97A 1YI6A 3NGAA 4QPSA 3COIA 5EI6A 5FGKA 3VUIA 3U8WA 3UIBA 3V5PA 3HV3A 2XIYA 4WBOA 4EOMA 4E7WA 2OIBA 1CDKA 2QVSE 4X6QC 4YLJA 2A27A 2EU9A 2WOUA 3KK8A 4QNYA 4J96A 4F78A 1CSNA 4I92A 3MY1A 3R1QA 5EQYA 2AYPA 3FMKA 5EW9A 2VWVA 3LXPA 5M08A 4QPMA 2GSFA 4AZVA 2OBJA 5HHWA 5HG8A 3I7BA 1STCE 3UO6A 3H10A 3MDYA 2IJMA 2WTKB 3Q5ZA 4FKPA 4ZSJA 5HZNA 4GVAA 3VO3A 3BYVA 3QQHA 3IW6A 4KS7A 3EKKA 3PP0A 1XH5A 2C6OA 4KAOA 5D9HA 3SV0A 3DCVA 4ACHA 4C58A 4DGNA 5KMJA 5LCJA 4R7BA 3ZS5A 5K0XA 1F3MC 5BYZA 4XV9A 3JVSA 4WNOA 3DAEA 2YJSA 4X3FA 5AP4A 2PVHA 3DBFA 3NCGA 3K54A 4IH8A 5KX8A 4DBXA 3D5XA 3I0QA 4QYYA 5KCVA 4CLIA 3C5IA 3RK9A 4I24A 2YM5A 1ST4A 1H1SA 4BHZA 5CNNA 4GMYA 3ZFYA 4O0VA 4PDOA 3QALE 3QZIA 4JR3A 4XS2A 3ZOSA 4UMUA 4UWCA 4JJRA 4D2PA 4FV3A 4CMOA 4ASZA 2VNYA 4W4YA 3PWDA 2R3NA 5AP7A 1H07A 3QKKA 3MESA 3BU3A 4ZSLA 1G8AA 2YCQA 4V05A 4E6DA 4IZAA 4YSMA 3V3VA 5CZIA 4AFEA 4E26A 3EQPA 4OUCA 5BV3A 3R1NA 4UXQA 5GJGA 4XYFA 3CSVA 4BCGA 4X3FB 3BQCA 5TT7A 1OM1A 4IDVA 4JG6A 4GYIA 4DEIA 5A9UA 4FIHA 2O65A 4BBEA 3A7GA 3Q9XA 4AS0A 1G5SA 4YJSA 4YC3A 2PYWA 2YABA 4FI1A 3WF6A 2W96B 4ZOGA 3UDTA 3QRIA 3VS7A 4R8QA 3MB6A 5BMSA 1KSWA 2R4BA 3OOGA 5HCYA 4AUAA 4D1ZA 5CEMA 3SOCA 4DGGA 4NYEA 3DXPA 4Z7GA 3BGQA 3MJ2A 1V0BA 5JFWA 5D7VA 2CNUA 4JMQA 2YITA 1JLUE 3GC8A 1E9HA 4DINA 1REKA 4LDTA 2ZM1A 5J79A 4FL3A 2QURA 2CJMA 2DS1A 2UZVA 5KZIA 1QPDA 4OAUC 3LJ2A 4NCTA 5GZAA 4KRCA 4AT5A 3O71A 4FZ7A 2XB7A 2QO9A 2HW7A 3A7FA 2PSQA 3ZXTA 1A9UA 3O8PA 2PUIA 2F7XE 4V04A 4ZTRA 3ZLSA 3OW3A 5TO8A 4DT9A 2C30A 3FLWA 3HL7A 3EZVA 4QMUA 4CNHA 4AACA 3UOKA 4FSTA 4XHKB 4QNAA 4YNOA 4O0TA 3VN9A 1ZYCA 3VW8A 4CFVA 4FKOA 3TT0A 3ZTXA 5CF5A 1JKLA 2YERA 5FTQA 1OITA 4C2WA 5CAUA 3KMUA 3UQFA 3BCEA 3G15A 3ALNA 1JAMA 3KRRA 4A7CA 4CEGA 1IASA 1OZ1A 5JSMA 4TL0A 2NRYA 4KBCA 1TZDA 5CSVA 5CEPA 5FXRA 3MYGA 1A06A 2R5TA 3W0RA 4XRJA 2I0YA 4JAJA 2B9HA 2YCFA 3ZUUA 2BMCA 1ST0A 3EQRA 4U81A 3F5UA 1XH7A 3IGGA 4FVQA 3GCVA 2XK6A 2XVDA 3ZXZA 3FZOA 5DEYA 4GT4A 4FE2A 2XM8A 2QR8A 4DH3A 3ODYX 1PYEA 5DT4A 4TNBA 4XH6A 5BVNA 4BDBA 3PIXA 3MB7A 1KV1A 1BYGA 4A9UA 4TKSA 3TNPC 2R9SA 4I22A 3ZSHA 2B0QA 4C3RA 4LG4A 4BDHA 5AADA 4YURA 2Y4IB 2BHHA 3T8OA 3AGMA 4HYSA 3PVUA 4PDPA 2G2IA 3HA6A 4K33A 5AP5A 3TKUA 3VS4A 4DG0E 1MUOA 3PTGA 3FMEA 4IX4A 4IJ9A 4OBOA 3VQHA 1AD5A 3ZEPA 5M4FA 5IF1A 3HV7A 1UU7A 3JUHA 3V5JA 5J9YA 5FTOA 5M51A 1WVYA 4FKRA 5FM2A 3Q53A 4FL1A 4IM3A 5DBXA 3E63A 4CFFA 1R78A 3VNTA 4BCFA 2UW9A 4GV1A 5J1VA 4PUZA 2XK7A 2IVTA 3VJNA 5TOZA 2R3RA 4GT5A 3ZLWA 4QQTA 2UW5A 4L8MA 3IOPA 3ATSA 2VWBA 3MVHA 3VUMA 3W0MA 5LWNA 2PMOX 4OTQA 2P4IA 1WBWA 1ZOGA 3QA0A 1IAHA 3FI8A 3PJ1A 2V5QA 2C6KA 5HD4A 5JK3A 3FPQA 3GC7A 3I5NA 3LM0A 3KN5A 5CYIA 4I4EA 1Y6BA 5B2KA 3VS3A 4BVUA 3HGKA 1K2PA 1GIIA 4MAOA 4AT3A 5HTCA 2Y6OA 2QLQA 3PPJA 5AAGA 4YZCA 2X0QA 3DXNA 3ACKA 3BHYA 4YTIA 2WTKC 2R3IA 4F65A 2WMWA 1IRKA 4I1ZA 4YHFA 3EJ1A 4G1WA 3NRMA 3VHKA 4KS8A 3ZMMA 1H1PA 1NVRA 2VWXA 4G17A 2QR7A 1QMZA 3EZRA 3PP1A 2C3JA 4D9UA 4OT5A 3L8VA 5JKGA 4HJOA 4UMQA 2RF9A 3TUDA 1K3AA 4ZEGA 3N51A 3VS0A 2VO7A 4FSQA 4F08A 3KIOC 4QD6A 3UIXA 5D1JA 3U55A 1W2FA 4FSWA 4ANSA 3DAJA 2W1IA 3Q6WA 4PP7A 2PL0A 2WAJA 3OXZA 4ANBA 4BDDA 4KSPA 5HTIA 2ZYBA 3KRXA 3NYVA 2EXCX 2W5AA 4IAIA 2BRMA 2BZHB 2W7XA 5DRDA 5EYCA 4EJNA 5DG5A 3UNJA 2NPQA 4RC3A 4ASXA 2PWLA 4I5HA 5E8UA 3E5AA 3G0EA 3NUAA 3OCBA 2BVAA 3NAXA 5CY3A 5IEVA 2UW8A 3FMDA 3EYGA 3Q4ZA 1LR4A 3UVRA 4RMZA 4IWDA 1GOLA 3O8UA 3SXFA 3MY0A 2BALA 3EIDA 3R1YA 4Y72A 1XH6A 3C7QA 4QP8A 5DA3A 4QP7A 4WA9A 3ORIA 3RPYA 1PF8A 3TV7A 4ACDA 4AW5A 3ORZA 3D5UA 4D55A 3QA8A 1L3RE 1LP4A 2JIUA 1GZKA 3KY2A 2R2PA 4G5JA 3GCSA 4NW5A 3TZ9A 2F2UA 3W0PA 3JXWA 4KWPA 4UZDA 4GIIA 2W0JA 4JI9A 2WMUA 4LGHA 5BX0A 3AKLA 4BZDA 3AC3A 5IH4A 2YAAA 4E5WA 4C0TA 2PVNA 3T9IA 2WMAA 2BAKA 5FTGA 3GEQA 2H34A 3AQVA 3SXSA 2YHVA 4UYAA 2Q83A 3VS1A 4C8BA 4DGMA 4WRGA 3HMIA 3ID6C 4BL1A 3NUNA 4JX3A 2E9PA 2XBJA 2HK5A 3C51A 3Q96A 4GJ3A 1YXVA 3ULZA 2ZDTA 4DFLA 2OU7A 2OXXA 2F9GA 3VBYA 2Q0NA 3TKIA 3PXKA 3JPVA 3MH3A 4EORA 2A2AA 1W84A 3PIZA 4HOKA 3LFQA 2ITUA 3DY7A 5CWZA 3O7LB 4G3CA 4B7TA 5CAVA 1H08A 4NW6A 4E4XA 1HCKA 4G9RA 3VULA 4JBQA 1GAGA 2QU6A 4IZ5A 4R5SA 4DEBA 4TY1A 1WBOA 5CANA 4ZY4A 2BROA 3G0FA 4TZRA 4TYHA 3IDBA 4MBIA 1KE5A 4M66A 4BIBA 3I7CA 3WI6A 5GIPE 4DFYA 3VBXA 2UW6A 4F63A 2WMBA 3FV8A 4TWOA 2X81A 2WEVA 3MVJA 3KU2A 2XARA 3SW4A 5LMAA 2E9OA 4HCUA 4CGAA 4EH8A 2XYNA 1PJKA 4KSQA 5HNGA 1V0OA 3PSBA 4CTCA 4JG7A 1H24A 2VTTA 5HLWA 4U8ZA 4UALA 4C4HA 5HBJA 4QMOA 2WTWA 1ZY4A 3ENHA 4KIKA 3AC2A 3UOHA 1PMEA 4U3ZA 1Q62A 4QYGA 3KCFA 1P2AA 3QQJA 5BUIA 3RAHA 4QP6A 2ITPA 2UZUE 4V0GB 2OWBA 3UGCA 2HENA 2B9FA 4KB8A 3CEKA 3UVPA 1ZMUA 4W4XA 3OWKA 3NDMA 4IW0A 2VTQA 4EOPA 3OY3A 3KULB 4H58A 4NFNA 3LQ3A 3ZONA 4IANA 4FZFB 3Q9ZA 4X21A 4C3PA 3LCKA 4IADA 5FBOA 5M07A 5L8JA 4R78A 2R3HA 2OZAB 3BLHA 3V5TA 4BDIA 4J8NA 4FNYA 4IJPA 3HA8A 3RZBA 2J5FA 3QQGA 3L9LA 3R7VA 3ORNA 4M8TA 4PMMA 3EQCA 3C4FA 2JGZA 4IAAA 5DHJA 5DR9A 2ERZE 4BDCA 4QMQA 3W0OA 3I1AA 1PMUA 4FGBA 3MGYA 2UZLA 1OIYA 3QD2B 4BJJA 2RFNA 1NA7A 4O86A 2F49A 2J7TA 4RG0A 4AGDA 4PWNA 3UE4A 3FDNA 2ITNA 4P5ZA 3TM0A 3GC0A 4XP2A 3T3UA 3A7IA 4O0SA 3T9TA 2HZ4A 1A48A 4YPDA 1L8TA 3TYKA 3CE3A 4RLLA 3TZ7A 2Y9QA 2FGIA 3D9VA 3HDNA 3R71A 4RT7A 4CRSA 1TKIA 1OL2A 1S9JA 3PXFA 4ZS4A 3LFDA 4DTAA 5DI1A 1PXIA 4L67A 4QMYA 4G16A 2W1HA 4BI1A 3P0MA 2PUUA 4E6QA 4HVDA 3FHRA 3B2WA 3AMAA 3DV3A 4B0GA 1CKJA 3DJ6A 1OUYA 5CXHA 4BB4A 3FZ1A 3LFFA 3TL8A 5IA4A 4XP0A 3GFWA 3RCJA 2GQSA 5DYJA 2XIXA 4AZFA 4RX7A 5TKDA 1JWHA 2B7AA 3FMNA 3ZFXA 1FGKA 4R7IA 4BCNA 4QQ5A 4MYGA 3JS2A 5HG7A 3DPKA 3W1FA 2PVMA 4QMZA 4K18A 3W2QA 4EQCA 3EQBA 2BRNA 3AC8A 3I4BA 4IMYA 3LFSA 5FM3A 4MEDA 4Q2AA 4AGUA 3EQIA 5BVOA 3DKCA 2X6EA 5CSHA 4IM0A 3VBVA 2AC5A 2ETMA 3E92A 3R28A 4YJRA 1YHSA 4IVAA 5K0KA 4EH7A 1OPJA 2OK1A 4AWIA 3QD4A 5HNBA 3DZOA 3HUCA 3CIKA 2I1MA 3R7UA 2X6DA 3G33A 4TWCA 2XNBA 4RX5A 3FAAA 3TIYA 2ZV2A 4QTAA 3NZ0A 1NY3A 2VV9A 2FSMX 4U43A 5HLNA 4WT6A 4DBNA 3G9LX 3MS9A 4PDSA 3W2SA 4B9DA 3GQIA 3E88A 4BHNA 2CN8A 4UMRA 3IPHA 5IQEA 3HMMA 1KUTA 4AXCA 1GNGA 4PTCA 4PPAA 2RSVA 4U5JA 4Y73A 1PMVA 3HVCA 4BCJA 2F4JA 2J9MA 4TNDA 3PYYA 5J5SA 3RNYA 3WE8A 2Z8CA 5EW8A 4L3PA 2BHEA 4NZWB 3A8WA 4V01A 4YP8A 4EI4A 3P1AA 4DYMA 3D2IA 3C4WA 4CCUA 3F66A 1CM8A 4GUBA 3VS2A 2QOCA 1IG1A 2Z60A 2WXVA 5EDPA 2Y8OA 4I4FA 4IAYA 3ML1A 1SM2A 3BEAA 2FSTX 1PXMA 5E92A 5F95A 3RALA 1JVPP 3ERKA 2YEXA 4U6RA 3DK6A 3NNVA 2JC6A 4L3LA 5GJDA 3SVVA 2IW6A 5JN2A 4MD8E 3IO7A 2G15A 3W2PA 4WG5A 3AD5A 5LVLA 3KULA 4WSQA 4H1JA 3VRYA 3IW5A 2G9XA 5LCKA 3KMMA 4GK2A 1REJA 3D14A 3GOPA 2I0VA 1GJOA 3E3PA 2HWPA 3POOA 4GW8A 4LUEA 4RIOA 2XYUA 3QXOA 2BDJA 3NNXA 1W7HA 2C68A 4GEOA 4N70A 3LMHA 3DBDA 1Y8YA 2ITQA 3WILA 5AMNA 4XG4A 1MRYA 4YO4A 3KB7A 4O4CA 4LGDA 4E4MA 3ZSGA 4BYIA 4DFXE 5HX6A 5EOBA 3FYKX 1WBNA 3P86A 3PIYA 4QDVA 1VEBA 2IVVA 4Q5HA 4BCPA 4E1ZA 3S1HA 2XKFA 5HIDA 4RX9A 3JVRA 1WBTA 3FE3A 4FIEA 1XHAA 5CNOA 2OZOA 4ITHA 4I21A 4O7LA 4D1SA 2JKQA 4UMPA 4MHAA 1HCLA 4D0XA 4W8EA 2W17A 3NLBA 3HNGA 4C4JA 3QUPA 1DAYA 4U3YA 5AAFA 3LJ0A 2UW4A 4NCTC 3SQQA 4ENXA 2PK9A 4G31A 3RBWA 4EH2A 3K3IA 1OKZA 5C27A 2P33A 3FYJX 2YZAA 5FQDC 1P14A 3SD0A 3UDZA 2V7OA 4ITIA 4TW9A 4IZYA 1ZRZA 3EFLA 3JY9A 2ETRA 4BIDA 2OFUA 4HVGA 2CGXA 3OY1A 4RVKA 3D15A 4CMTA 2FSLX 4DEGA 2XJ0A 3NUSA 4NM7A 4QTDA 4APPA 1JSUA 4DGOA 3FMHA 2Z7RA 5IPJA 2VWWA 4S31A 3FHIA 5CF6A 2HY0A 1OECA 2PY3A 3UDBA 3BZ3A 4CT2A 3FKLA 2W9ZB 3CLYA 4X2JA 2P3GX 3H9FA 1QL6A 4FVRA 3DK7A 3L8XA 3V5LA 3TNQB 2QG5A 2VWIA 3TZ8A 3EKNA 4BWKA 1PXJA 4FT0A 3ZSIA 4JDJA 5HGIA 1ATPE 1YI4A 3ORKA 3PPKA 3I6UA 3N9XA 2JEDA 2G2HA 2YJRA 2CKQA 3PVWA 4NIFB 3WF5A 4C02A 3W2RA 4A9TA 4EC9A 3OCSA 3DBQA 1YXTA 4G3FA 4U7ZA 4D9TA 4AQCA 5KMNA 5GJFA 5FBNC 2GNHA 4O27B 2V22A 4ZTQA 2XMYA 1YXXA 3VBQA 1IEPA 4I5PA 1RQQA 5CSXA 1XR1A 3GQLA 2PE0A 3D5VA 3PSDA 4UY9A 3KXZA 3WIKA 3VW6A 3KRLA 3ROCA 4BDFA 3LVPA 1DAWA 2XAOA 4MNEA 4KIPA 4A4XA 1T45A 2OF4A 4H05A 3VS6A 4JT3A 4CV9A 4YBJA 3II5A 4BKZA 4DLJA 2XAMA 3HV4A 1Q3WA 5GINE 2O5KA 3R21A 2RGPA 3OEFX 3RWQA 5LVMA 4KBAA 3NR9A 4E73A 2C6IA 4JBVA 4BBFA 4BDKA 2RL5A 4TYEA 3R73A 2RKUA 2VGOA 3QXPA 1URWA 3GVUA 3PG3A 2UZEA 4JIKA 4QYHA 1WMKA 4BF2A 3BBWA 4B99A 5IH6A 4MF1A 5DIAA 5FXQA 2OXDA 4LFIA 3Q4UA 3N4VA 2XRWA 1UNLA 1W0XC 5FRIA 2ZFYA 3SAYA 3WF9A 3KFAA 2IWIA 4F7LA 3RK5A 4HGSA 2WPAA 3ZU7A 3OUNB 5GNKA 2REIA 4Y95A 4XBRA 3GENA 1YW2A 3KQ7A 5C8KA 4FV7A 3OTVA 1FPUA 3BE2A 4WKQA 4ONAA 5J8IA 4BCKA 5DRBA 3F5XA 4WOVA 4F7SA 1KE8A 5CVHA 2PULA 3EB0A 3BV2A 4RIWB 4Y46A 1Q8WA 5CALA 1KE7A 4BTKA 5M56A 4BIEA 5ANGA 4LRJA 2R0UA 4BDAA 4XNEA 2EWAA 5ETFA 5L2IA 1H1WA 3ORMA 5HOAA 3BYSA 2YDJA 4UV0A 3C13A 4FBXA 4IQ6A 3QTRA 5AX3A 4ALUA 1R39A 2UW0A 4U45A 5JZNA 1U54A 3QAME 3R7GA 2P55A 3I79A 5EM6A 3FY2A 4ENYA 3H9RA 3E64A 3LPBA 2C5VA 2O0UA 3OP5A 1QCFA 2DQ7X 2IG7A 4PNKA 3DBCA 2C3LA 3A99A 5AFVA 2WMTA 4LQMA 4CD0A 2WO6A 3UNKA 2G2FA 5TE0A 4FJVA 2HIWA 5AP2A 4MXXA 3U87A 2OFVA 5B0XA 4BTMA 2JDVA 4MWHA 4BKJA 2F7ZE 2J0IA 5HESA 1U46A 3C4XA 4JVGA 4CXAA 3W2CA 4BCMA 5AR5A 2Y7JA 3FKOA 3SKCA 2Z7QA 4DG2E 2X8EA 4QTCA 3OEZA 3RWPA 5EDRA 3Q6UA 4F1TA 3ORTA 1FBNA 2WMVA 3RPSA 3UPXA 2QQ7A 2PZYA 4EBVA 4BYJA 2X9EA 4Y83A 2VN9A 5E8VA 3NYOA 4EH6A 3E7VA 3QRTA 3BKBA 4M67A 2ONLC 4MVFA 2CLXA 4EOKA 4QO9A 4NL0A 3IDCA 4ACGA 4FKSA 4DF3A 3UJGA 2GHMA 2PVYA 2AC3A 4JIAA 2YDIA 2FA2A 3C1XA 2YM3A 5C4LA 2BPMA 5GIOE 3PWYA 4AW1A 2HOGA 3LOKA 3UPZA 3OD6X 4CZYB 4HGEA 4O38A 1W83A 3PA5A 4PMSA 3SOAA 2EXMA 4QP1A 3O17A 2F7EE 5F4NA 4AA0A 3DFCB 3IDPA 4O81A 3DFAA 1XJDA 4NJDA 4DC2A 4G34A 4NEUA 5CEKA 2DYLA 3GFEA 4XG8A 3TJCA 5M06A 3EN6A 3NMUF 3LAUA 3LQ8A 3BWFA 3ZRLA 3FXWA 1W2DA 2Z2WA 1M7QA 2G01A 5IQBA 3PFQA 5AR8A 5FWKK 3W10A 1IA8A 4X0MA 1WBSA 3R8VA 2BKZA