3BU3A

Crystal structure of the insulin receptor kinase in complex with irs2 krlb peptide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
297
structure length
294
Chain Sequence
b'DEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords insulin receptor subunit beta
publication title Structural and biochemical characterization of the KRLB region in insulin receptor substrate-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 294
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bu3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bu3A01
3NUSA 4PPCA 3VBXA 3CD3A 4D5HA 2XEZA 3AT4A 5HO7A 1F3MC 4OT5A 4RJ6A 3ZH8A 4UMQA 3D2IA 4PTCA 2HZNA 3ZRLA 3W8LA 3DBDA 5FWKK 5L2QA 3CR0A 4GT3A 4RGJA 3QKKA 4E4LA 2BHHA 5IQCA 2HW6A 3E7VA 5FP5A 4IHPA 3JPVA 3E64A 2GS6A 4OTRA 4H05A 2GNLA 5AP2A 1PKDA 4ARKA 4WD5A 3EL8A 3EQPA 3CEKA 5CZHA 2W05A 2OJFE 3TI1A 1S9JA 4CCUA 5JGDA 3TV6A 4G6OA 4WG3A 2ITOA 1OL6A 3U4UA 3PZHA 3VQUA 3RGFA 2Y7JA 2OICA 1WZYA 3K3JA 3CCNA 2ZV8A 1R0PA 4L9IA 5CAPA 5L2SA 2OIBA 5HZNA 1APME 4AOTA 1YI3A 4DAWA 4C02A 5HE2A 3A7GA 1BMKA 1U59A 4BGHA 3S1HA 2YWVA 5HHWA 5E1SA 4KB8A 2VTJA 4MTAA 3QTWA 4ZLYA 4MKCA 1G3NA 2G2FA 4JLCA 3Q4UA 4YTCA 3DBFA 5IZFA 2RSVA 4Q9ZA 2HXLA 4LFIA 4Y5QA 2VZ6A 4XP3A 5HG8A 5E4HA 5E9EA 3MPTA 3DQXA 4M8TA 2DWBA 4I6FA 3NWWA 5L6PA 3NX8A 5DT0A 4RIWA 3OY1A 4Z7HA 4V04A 4MXXA 3CTJA 3DXPA 4E5AX 4BTMA 3OW4A 3LFEA 4PX6A 1ZOHA 3OCGA 5I9UA 3VBQA 3OXIA 4FTIA 4AA5A 3Q60A 5EDPA 4BB4A 5CU3A 3T9TA 5FTGA 4RLKA 3K5VA 3KA0A 4CTBA 3PZEA 2CJMA 4RA5A 5E8YA 3REPA 1U4DA 1YXVA 2FSMX 2J6MA 4II5A 4M68A 4U97A 4QP7A 4YTFA 4O7NA 3I6WA 3DKFA 4ZIMA 3W8QA 4OTHA 4EONA 3AG9A 2W06A 5JQ5A 2WMTA 4BDEA 3R1SA 4UYNA 5AX3A 5HLPA 3PLAE 4H1MA 1OM1A 1KSWA 3II5A 2JIVA 2Y6OA 5T6KA 2Q0NA 4G5PA 3BBWA 3KFAA 3O50A 4A4XA 3DFAA 3ANQA 3PPKA 3R04A 4Y8DA 1YRPA 3HV3A 3R2YA 5CEMA 3UYSA 3GC8A 3GUBA 4X21A 4AGDA 3P23A 5CEQA 3R8PA 4FT5A 3PSDA 3TUCA 3MESA 3A61A 3IK3A 3JVSA 3LVPA 2VU3A 4RWIA 3V5WA 4I41A 4IB5A 1AD5A 4G9CA 4JIAA 3HMPA 4IJ9A 4DCAA 4F9CA 3KEXA 5EHOA 3RAIA 4UXQA 4YO6A 2HY81 2XVDA 2BAKA 3LOKA 3MY1A 3DQWA 2Y6MA 2O0UA 5CSPA 2V7OA 3PXQA 2VGPA 4C4HA 3QYWA 4J98A 2OXYA 4FT7A 3OOMA 2W99B 2W1ZA 2BZHB 1F5QA 4X3FA 3LCSA 3W18A 4FKLA 2W4KA 2YLEA 4RVKA 5I9ZA 2CLQA 4R1YA 3FSFA 3PIYA 3W2CA 4F09A 4F6UA 3GXLA 1J7UA 3RPYA 4DLIA 1XWSA 1YHWA 3GCSA 4EH6A 2GTNA 4F70A 3LMIA 4TNDA 3N4VA 5A54A 2JFMA 5E8TA 1Q8ZA 2IZUA 3GU8A 2OIQA 4LUEA 2Z7RA 4A4OA 4P90A 3D7TB 4G34A 2YDJA 5KUPA 3I7BA 1PYEA 3FKLA 4JAIA 1YVJA 4JT3A 1V0BA 4R7IA 5CTPA 1WAKA 4UZDA 5FD2A 4BFMA 4BHNA 4PTEA 3ZCLA 3S00A 2WXVA 2PMOX 4EK5A 4JG7A 4JG8A 2XK6A 2YM5A 2OXDA 5L6WL 3HL7A 4FIIA 4UWCA 3ZUVA 3PA4A 4HW7A 3CPBA 4E20A 1SM2A 4MVFA 2R5TA 4TTHB 2VTAA 3V5QA 4DGOA 4EQMA 4PP7A 5BVDA 4YSMA 1FGIA 4WG5A 2ITPA 3QRIA 5CX9A 2WMUA 4WIHA 5KHWA 4I21A 3VRZA 4GIHA 4JQ8A 4BBEA 4KA3A 4QYHA 2IVVA 2W1DA 3KF4A 4WKQA 2J0JA 3QUPA 4DINA 1TVOA 1CSNA 3QQLA 4MBLA 1VYWA 4BKJA 2R64A 1JNKA 3OWPA 3GP0A 2DS1A 3W1FA 2CKEA 5C03A 1H0VA 2JDVA 2GFCA 3HP2A 4TN6A 4D4VA 3QAME 3RK5A 3UZTA 1Q62A 2ZV9A 3HRFA 3BX5A 4KUJA 2PVLA 3HGKA 1JPAA 4HNIA 4GFOA 5CF6A 3U9NA 2HXQA 3EN9A 2C69A 1M2QA 2P2IA 4IX5A 5J1WA 4O0RA 3MFTA 3F7ZA 5CAVA 2WEVA 3QALE 3BGPA 3TKUA 1ZYDA 4D2RA 3NGAA 2Z7LA 3P79A 3W2OA 1Y91A 2ETRA 4LL0A 4EEVA 2Z7QA 4R7BA 2BAJA 4AXAA 4AZFA 3OT8A 3E87A 4FTJA 2KTYA 3C4WA 4IAIA 2DUVA 4IAAA 4FOCA 4IX6A 4KBAA 1UKHA 3VVHA 4HZSA 3WZKA 4O7TA 4FTMA 2CN8A 5D1JA 2YAAA 1PXIA 2X7GA 2PVYA 3QCSA 5CAUA 2ONLA 3PTGA 5BVNA 2CSNA 4D9UA 3A7HA 5EYKA 1YDTE 4ONAA 2IZSA 4TKSA 5FEQA 2QOLA 2OH4A 3PG1A 4A07A 1R39A 4DEIA 5LWMA 1UVRA 3IOPA 3HMMA 5EM7A 4L44A 3VS6A 3GFWA 5CEKA 3W10A 2XNOA 5EQPA 4AOJA 4U44A 3SXFA 5IQGA 4NIFA 4RIYB 4GCJA 4GL9A 1O6LA 5JN2A 4ZTSA 4MK0A 3FI4A 2E2BA 5AJQA 5H8GA 2VWUA 4ZXTA 2UZNA 4D0WA 1UNGA 4JXFA 3R7IA 1LEZA 3P7CA 5KBRA 3VUTA 4FIHA 3MBLA 4FV1A 4RZVA 5FEDA 5AP1A 2CN5A 2VX3A 4O83A 4YPDA 3R9RA 4Z7GA 4PMTA 4DT8A 3ZBFA 4W4WA 3IO7A 4I5CA 2W7XA 1SNXA 3Q96A 4PDYA 3Q6UA 3MB7A 3BLHA 4R5SA 5BUEA 4O7SA 4JBPA 4E6QA 2IVSA 2JFLA 3KRXA 5FXQA 5AX9A 1M17A 4AF3A 3DGKA 3DK3A 4KRCA 2HWPA 2VTHA 4BCNA 1YHSA 3HMNA 4FL2A 4MX9A 4CRLA 5DMZA 4L68A 5DR9A 5GJGA 2W1CA 4A06A 3FKNA 4BCOA 3IW5A 3L8SA 2C6DA 2BAQA 5H8EA 4KSQA 3I4BA 2X39A 3HEGA 2VTLA 3KRRA 3MWUA 4HPTE 3TDVA 3V6RA 3PXZA 3ZEWA 5KNJA 4TYHB 2EXEA 3SOCA 3RHXA 3UE4A 2BFYA 4LGHA 4FG7A 1YOJA 3L9NA 3BHHA 5AP3A 3C50A 4NW5A 4EH4A 4X2FA 4UWYA 3F3UA 3GU5A 5EYMA 4O27B 3VS3A 1Q4LA 2QLQA 3PA3A 2HK5A 3POZA 4MAOA 2SRCA 4RQKA 3O2MA 4IVDA 3BYVA 4QMSA 5C8MA 2V62A 3SXSA 1DS5A 4CSVA 2BKZA 4D1SA 2YITA 4ENXA 2XP2A 4RIXA 2F7EE 4X3JA 2XF0A 4NKSA 3ATTA 3OFMA 2RFEA 5DR2A 3FZRA 3IW6A 4IW0A 3QC4A 5LWNA 3F3ZA 5LVPA 2GNFA 3H0ZA 4ANBA 2PVNA 4HNFA 3G33A 4R7HA 4CD0A 4JBOA 4QMPA 3F3VA 5D7VA 4R3RA 3O71A 4KS8A 3UIMA 4F7LA 4I20A 5H2UA 3EQIA 3RHKA 3OG7A 5CSWA 1B38A 4FL3A 4XBRA 2WTWA 1Q8TA 2W0JA 4JX7A 4USDA 2W1GA 4D2PA 1OL2A 4ZTMA 3I6UA 4QP6A 3ODZX 4FTKA 5GHVA 4RVLA 4FNXA 2ZM1A 2J2IB 1YWNA 2G15A 4YJSA 3NLBA 1VR2A 2HENA 2JDTA 1MRUA 4YJVA 4QMVA 1UNLA 4DGNA 3NVKI 4NM7A 5ETIA 2XZSA 4QTCA 4W9XA 4UMUA 5HTBA 2W5BA 3P08A 4EOJA 1FGKA 2WZJA 4BDFA 2WIPA 4EH3A 5HLWA 5K4IA 4JG6A 2XMYA 4FKIA 2Q0BA 3D7ZA 3E92A 4KRDA 4IC8A 2BMCA 3DJ5A 4HVIA 3C7QA 3EJ1A 3LFAA 5M51A 4FV4A 2C3JA 3HP5A 4DT9A 3TWJA 5CU0A 2W1EA 4M14A 4RJ3A 4NTTA 2IG7A 3BLQA 3LCKA 4B7TA 5CF8A 4ZMEA 4YJTA 3PWDA 3QTQA 3QD0A 3R7GA 4I23A 5JZNA 3TNPC 4BBMA 4CT2A 3EOCA 1H1QA 4FTAA 2NRYA 3IQ7A 4HGTA 3OC1A 2B9HA 3QHRA 1X8BA 5ANEA 4PNKA 5CQUA 4FR4A 2QOFA 3EQDA 4QP1A 3ZFXA 4EORA 2C1AA 3KULA 3QQUA 4RRVA 1E1VA 1W0XC 4V0GB 5KMJA 2QOHA 2CGWA 2PTKA 4C4IA 3QX4A 4TXCA 4J8NA 4QP8A 4YR8A 1QMZA 1H8FA 5DT3A 4FSYA 3R28A 5B2KA 4W4XA 3C9WA 4C61A 3ZEPA 2NRUA 3UPZA 2J5FA 3LIJA 3VUMA 3QZIA 2R3KA 4CRSA 3Q6WA 4FNWA 4LI5A 4EOPA 3RP9A 1S9IA 3UO6A 4GVJA 4O0WA 4U5JA 3R01A 4MNEA 2YIQA 4ENYA 4IB3A 2RFNA 4O0YA 5AA8A 3U55A 3NZ0A 1Y6BA 4XP0A 4F9YA 2OJIA 2X6DA 4LM5A 3OS3A 3FYKX 2R3QA 4BDIA 2XKDA 3G9LX 3P9JA 3QCQA 3BEAA 3HYHA 4M97A 3LQ5A 4HVSA 4PDSA 1BX6A 1WVYA 3E93A 4PMPA 1H4LA 3ZTXA 4FIEA 4BCMA 3CE3A 2JAMA 3TUDA 4DFXE 2WIHA 3FLSA 4O21A 2XK8A 5JEBA 2BTRA 2I7QA 1H07A 3P5KA 4FG9A 3OCBA 3A62A 2PVRA 3UG2A 4EHGA 1FVVA 2XK3A 5DLSA 3ACJA 5HI2A 5AA9A 1OPKA 4FSRA 4GK2A 5AP4A 2BUJA 2LAVA 3TV7A 4QOXA 1URWA 4G5JA 4L8MA 5AV2A 3F61A 3L9MA 5HCXA 5CF4A 2O63A 2X9FA 3LAUA 3OMVA 2BCJA 2I0VA 2BROA 3OCTA 4QMYA 3ZONA 4FSUA 2ZM3A 4IM0A 2C5XA 5EHYA 2JIUA 4YZCA 5L8JA 3ZRKA 1K3AA 4ANMA 5JGBA 3HRCA 5FGKA 3VS5A 3L9PA 1V0PA 3PXYA 3OXZA 3C1XA 4NSTA 3DAKA 4X2NA 3ORTA 4YBJA 1R0EA 2XIRA 1ZAOA 2YIRA 4IVCA 4NFNA 3QXOA 3TTJA 1ZWSA 2QC6A 2RGPA 3NNVA 2JKMA 4N6YA 5JZJA 3NUAA 3LFQA 3OF0A 2WQOA 2OH0E 3H3CA 3DT1A 3OTUA 3D5WA 3PVBA 4O0VA 2BRNA 4OBOA 5ANOA 1I44A 1TQIA 3R83A 3RK7A 3SAYA 5EQYA 3PRIA 4I92A 1CM8A 4KIKB 1XQZA 3R1QA 4YJUA 4K11A 2BVAA 2CCHA 3AGLA 4ITHA 4ASEA 5J9LA 5GINE 1CDKA 2XNMA 4C57A 4FSTA 3R8MA 2UZVA 4U6RA 4ZZNA 2GMXA 4DC2A 2BDWA 4JDJA 4YJOA 3QL8A 4I5PA 5BPYA 4TYGA 5HD7A 5E8ZA 4ZZMA 3G6HA 2IVUA 4IANA 1XBCA 3LCTA 3KK8A 1GOLA 4IX4A 4U41A 4ZJVA 4M15A 2RFSA 4FZ7A 4GUBA 3VS2A 2R2PA 2B9JA 4APPA 4PMMA 2YIXA 3NYVA 3SG9A 5HIBA 4WRGA 5AR5A 2EWAA 4BC6A 3R9HA 4BCGA 2O3PA 4ZSEA 3QTXA 5LMKA 2CKPA 3DB6A 1Q61A 2ITWA 4FUXA 4MXZA 5IU2A 4XLIA 3BHVA 1WCCA 4EH7A 4W8DA 1XO2B 4BCKA 1A9UA 2UZUE 2PK9A 4AZSA 3R8ZA 5HX8A 4NM5A 1VEBA 2YA9A 3BKBA 2C5VA 3QYZA 4EZ3A 2ACXA 2QO7A 4MD7E 1VYZA 4AT3A 4USEA 1IA8A 1CKJA 1WBSA 5TR6A 2BDFA 3TJCA 4E73A 4ZY4A 4ZY5A 2C3KA 3F3WA 3U87A 4PY1A 3WE8A 2HYYA 1OL7A 2AUHA 4WBOA 2OLCA 3U51A 4F0FA 4MEDA 4XBUA 2GNIA 3P4KA 4YTHA 4F6SA 3BBTB 4OAUC 3MH2A 2GCDA 4U80A 4FL1A 5C8NA 5FLFA 3BLRA 2WPAA 4IWOA 2PVHA 1RDQE 2OFVA 1W98A 4CQGA 1PXKA 2W5HA 3VRYA 4IAYA 4BTKA 3D4QA 1FVTA 2A2AA 4DLJA 3M11A 3W2SA 5AUTA 2W96B 1G8AA 3OP5A 2WELA 4YURA 3ROYA 3C51A 3E8NA 2BZJA 4G2FA 4N70A 1NT2A 4FKJA 2YJSA 4O86A 1Q99A 4AE9A 2NP8A 2WFYA 4N6ZA 5AR4A 2QHMA 4IWPA 4UMTA 3B8RA 4O0XA 3C0HA 3NYOA 4EK6A 3EZRA 5DRDA 4QP3A 5EFQA 1DI9A 4ZLZA 4IDTA 5IA5A 1NVRA 3UOKA 3SW7A 3ZC6A 3ATSA 5I5ZA 1GY3A 4NEUA 1ZYJA 3KMUA 2QONA 4RZWA 2ITTA 3FQEA 1PMEA 1PKGA 2J9MA 5FUTA 2VTMA 1WBPA 1XH4A 4B8MA 4FEWA 3BHUA 1U54B 4KD1A 5HU9A 4KS7A 4DH3A 2R0UA 2XBAA 3FXWA 3QLGA 4FKWA 5TKDA 1YOMA 4CFNA 3QQJA 4D2TA 3MVHA 3CKXA 4W9WA 4FSMA 4H3QA 3B2WA 3QBNA 3KF7A 4PP9A 4ZLOA 3A99A 4M69A 2PE0A 4OT6A 1J3HA 3R02A 4XG3A 2OK1A 3VBWA 4BI1A 4CCBA 2PWLA 3D83A 1YI4A 3BQRA 2DQ7X 2QOBA 3DU8A 3LXNA 1PXOA 4YJRA 3WYYA 4BZNA 5L2WA 2CNVA 2XH5A 3DDQA 1BL7A 3DLSA 5CEPA 1GAGA 3QKLA 4OTFA 4RVTA 3VW8A 1A48A 2I40A 2OF2A 2R3FA 1JSTA 3R7EA 4BBFA 4FV6A 4DG2E 4YC6A 1XBAA 3M1SA 4IAFA 5HBJA 3D0EA 1W83A 4F4PA 1YWVA 4C33A 4K1BA 4D9TA 2C5NA 4EL9A 1H26A 5IH6A 3A7IA 3ZO2A 5F4NA 1AQ1A 3CGOA 4NUSA 2QR7A 2VNYA 2FA2A 3E62A 3LJ0A 3KCKA 4BCFA 4CZUA 4ZAUA 3W33A 4USFA 1P4FA 5T3QA 3ID6C 3DPKA 4D4RA 5LOHA 4Y5HA 3QTUA 5J95A 1R1WA 3HMOA 5CQWA 3MPMA 3CJGA 3UOJA 2PL0A 4Y95A 2WO6A 5KO1A 2Z7SA 4JL9A 3PFQA 5IF1A 3RZBA 5TOZA 2VX0A 4GSBA 5I9WA 3UVRA 5IQFA 2Z2WA 1WFCA 5CZIA 3FMEA 3OY3A 3VBYA 4J97A 3KRWA 4NFMA 4YC3A 4GEOA 4C62A 3UIUA 4C4FA 4S32A 4EHZA 2B55A 2YIWA 3MA3A 3TM0A 2ITQA 3QHWA 4QP4A 2Z02A 3CIKA 3DA6A 4X6RA 3VUDA 3EFKA 3UMWA 5AAGA 3BWFA 4AQCA 5HO6A 4O7YA 2EVAA 3LLTA 4ASXA 2BKKA 1CKIA 3BIZA 4IB1A 3TT0A 3F66A 4QRCA 4EOQA 3BU6A 4UXLA 5GZ8A 4ALUA 4TRLA 3P7AA 5L2IA 4PMSA 5HLNA 4EHVA 4LRKA 3I60A 2YERA 3LPBA 5J79A 1SVEA 4G3DA 1OITA 4FSZA 3ZC5A 4UB7A 3F5PA 4BRXA 5A4LA 4W8EA 4GMYA 3OTVA 4XRLA 3FC1X 1ZXEA 2QKWB 4PPAA 2GS7A 2I0YA 3TACA 4JDHA 4U42A 4BDGA 3VC4A 4BWPA 4BDJA 2IO6A 4MYGA 3NS9A 4O81A 3QCYA 4PWNA 1H25A 2ITVA 3P0MA 3D94A 4OGRA 5E8UA 4WUNA 3R21A 5BMSA 3BYOA 3HKOA 5A6OA 1ZZ2A 2XIXA 3BGZA 2R7BA 3D15A 1OI9A 2PY3A 3Q5IA 3QRTA 3MN3A 3UP7A 4CFWA 4AX8A 1Y6AA 3RM6A 5L3AA 2XIKA 4FODA 2GHGA 4IZ7A 3VQHA 4RFMA 1BLXA 2XJ1A 2XJ2A 5AR8A 4ALWA 1PXJA 2AC5A 1L3RE 1O9UA 5FM3A 4EBWA 3UQFA 1BL6A 3LXKA 3Q5ZA 4U8ZA 3Q9WA 5AP7A 5ETCA 4I0RA 3EN4A 4ZS0A 4EH8A 1Y8GA 2QODA 3ZLXA 1QL6A 1FOTA 5HCZA 5AP0A 1LEWA 5ACBC 4AOIA 3GCVA 4GYGA 3JS2A 4FV5A 4RX5A 2YM6A 3GC7A 3FZPA 4C36A 3R1NA 2J7TA 4BDBA 4UV0A 3SV0A 4FTRA 3ZXZA 4YSJA 4D4YA 3UIXA 3PA5A 4DEEA 2JGZA 4JR7A 3DBCA 3WYXA 4ITIA 4JNWA 3R7UA 4JQ7A 3FWQA 3SXRA 4DGGA 2RG5A 2WMRA 2OWBA 4BDKA 4JR3A 3QWKA 4RSSA 3PXFA 1OPJA 1ZMUA 3VUGA 1SNUA 2BIYA 3ORMA 4DH1A 4NJDA 4XG2A 4NU1A 5D12A 3UIBA 2QI8A 4BKZA 5M08A 2OJJA 2XK7A 2PHKA 2QURA 3Q4ZA 3ZDIA 1OKYA 3E63A 5AEPA 1A06A 3F2RA 5KX8A 4J1RA 4L7SA 3AT3A 4IAZA 3PXRA 2J90A 1LP4A 5AV3A 4I24A 2HY0A 3EYGA 3TKHA 4NW6A 1LUFA 3UYTA 3COIA 3Q4CA 3T9IA 4ACMA 4BDDA 4KNBA 4F65A 4L3LA 2YZLA 3LKMA 4GT4A 1M52A 4L67A 3KGAA 2CGXA 2OIDA 4IBMA 3EFLA 4FK3A 3QUEA 4FIGA 4I0SA 2J0LA 2JBOA 1MRYA 1KUTA 3ZU7A 2OZOA 2B54A 3R9OA 4DH5A 4OTPA 5BVKA 3RAHA 3U6IA 2WMWA 3TL8A 2WU7A 4EZ7A 2BRBA 1KE5A 4FTQA 3E8CA 2HCKA 1JVPP 4FKRA 5CXHA 2KULA 2O64A 3ZFMA 5HD4A 3AGMA 3L1SA 3LXPA 3TEIA 3UMXA 3CGFA 4AN3A 3AMAA 5EM5A 4H39A 3WF8A 4E6DA 2UW3A 3COMA 4CGAA 3G9NA 4WUAA 1K9AA 3BE9A 5D9HA 5HNBA 4D5KA 4EOSA 3MJ1A 3PUPA 3EKNA 3ELJA 3C4CA 4PTGA 4LV8A 4MWHA 4C3FA 5TE0A 2C68A 2PZPA 4DFZE 3KU2A 4BY9E 3FY2A 3EL7A 5CEIA 2WOUA 4AZVA 3MTFA 3FMKA 3UNJA 4LGGA 5LVNA 3CBLA 3FI8A 3GOKA 3A8XA 2F9GA 5AUZA 3SDJA 4E5WA 2BHEA 3V5PA 2V0DA 1LPUA 2QVSE 4YU2A 1W84A 4AE6A 3ORIA 4E5BA 5KHXA 1FVRA 1GZ8A 2OZAA 3U8WA 4BL1A 4HPUE 4DEBA 3MVJA 4DA5A 2I0EA 3C5UA 3QZGA 5DEWA 4AFJA 4KINA 3RMFA 4QQCA 4CMOA 3DNEA 1OBDA 4FSNA 4C2VA 3WIGA 4I0TA 3HUBA 4AGUA 2ITXA 4NT4A 2RG6A 4S30A 4D28A 1ZZLA 3RNYA 1SMHA 3IONA 4DH7A 2XYNA 3Q53A 4DG0E 5CENA 4GFGA 4IDVA 3SG8A 5BUIA 3V6SA 3FYJX 1MQBA 3BEGA 2PZIA 3CC6A 3S2PA 5E91A 3Q2JA 3R73A 4ALVA 3DK6A 1M2RA 3QZHA 4F1OA 1PMNA 2WEIA 2XJ0A 3JVRA 4L45A 2VD5A 4RX7A 3EQCA 3RALA 2CKOA 5KZIA 4WSQA 2HAKA 4AZTA 3KXHA 3RWQA 2XS0A 4CG8A 3NUYA 4J96A 1Z5MA 3OWJA 5CS6A 3OXTA 4C3RA 2J50A 1FMKA 2C6IA 4DHFA 2RL5A 5C1QB 4HGEA 5ANDA 3MY0A 1PHKA 4OBQA 5G1XA 5HVJA 2JC6A 5FEEA 3QA8A 4AP7A 4YBKA 2XKEA 3UJGA 4XH6A 4O82A 1NW1A 3HDNA 4KWPA 1PXNA 3MH3A 3PIZA 4C4GA 3ANRA 4BTJA 3Q2MA 4GK3A 4TYHA 4X3FC 5EOBA 5KKRC 5F95A 4ZSLA 5EKNA 2ZMCA 4GK4A 3G15A 4FUYA 5D7AA 5GIPE 3MI9A 4FV7A 1UA2A 3QTZA 3GCPA 3WZDA 3HV5A 3MIYA 5CI6A 4FICA 4IAKA 5CAOA 3DTCA 4FT9A 5HG7A 3C0GA 2QNJA 5H9BA 3FQSA 4IZ5A 4PF4A 3D5UA 3I0QA 4I4EA 4EHEA 1SZMA 4TWPA 5E8SA 2B53A 1YOLA 1JKTA 3PJ2A 4MHAA 1H1RA 2C6EA 2IZRA 4MH7A 4B6LA 3MVMA 5C4KA 4IZYA 3MFSA 2GU8A 4DE4A 2OW3A 3PY1A 3RK9A 4X3FB 2IW6A 3JYAA 1UU8A 4ZP5A 5BUJA 1H27A 1F0QA 4O91A 4RLLA 5LVOA 2BR1A 3FEGA 3I0OA 3MVLA 3HDMA 4QMXA 2C47A 4X2JA 3UZPA 5HX6A 3EN6A 3R22A 1Q41A 5EKOA 3C13A 4QQ5A 5JGAA 3OEZA 3NUPA 4KSPA 4B9DA 4DTBA 4CFFA 3QRUA 3N9XA 4LMNA 2WMBA 2J0MB 2BPMA 2VTPA 3OBGA 3ZM4A 4D58A 2ITNA 3CXWA 5J8IA 4ANQA 3I7CA 3MFUA 5AADA 3C5IA 4YHTA 5CALA 3HUCA 4GRBA 2XNGA 5B2LA 4ZJIA 3I81A 4EC8A 3ORZA 2GHLA 4A9YA 2OXXA 4WA9A 4CV9A 4QMQA 5A3XA 3F88A 4FA2A 4CG9A 4MXYA 4K0YA 4EOKA 3KMWA 4J53A 3A4OX 3GOPA 2PVJA 2VX1A 4UMPA 1ZLTA 2GQRA 2O65A 2XIYA 1JBPE 1YW2A 3PY0A 4XG4A 4YJNA 2WQMA 2BDJA 4XV9A 1HCLA 2HZIA 3PXKA 3NNXA 5IEVA 4YLKA 4M12A 2A4LA 4O1PA 3PSBA 1OL1A 4NM0A 4QMWA 4QPMA 3FMMA 3GT8A 3QRKA 2X81A 5LVMA 2FB8A 4G3EA 2IPXA 2GS2A 5I9YA 3FI2A 3ZSGA 2AC3A 1BUHA 5AUUA 4Q5EA 3BHTA 2H34A 1MUOA 4HYSA 2ONLC 4GS6A 1MQ4A 3PVUA 4FKOA 4HYUA 4KIPA 3EN7A 4Y73A 2OBJA 3DBQA 3WF5A 2QKRA 2VTOA 4V0GA 4LUDA 2CLXA 3DZQA 1QPCA 5AM6A 3DB8A 4BWKA 3BRBA 1WBWA 3HZTA 3EQHA 3LHJA 2PUIA 4I5HA 3CKWA 4ZTRA 2HZ4A 2X0GA 3PJ8A 4J7BA 5JKGA 3AMYA 3RCJA 2GNJA 1QPJA 5HTIA 2YCFA 3ZLSA 3QUDA 4ZTHA 3G5DA 4J8MA 4X0MA 1FQ1B 3F5XA 3BI6A 3O8PA 3LFFA 2R0IA 3IS5A 2XNBA 4UALA 2ERZE 3E5AA 3OVVA 3UC3A 3KMMA 4DTKA 2WTKC 4ANSA 2X2MA 3NUUA 4GVAA 3QTSA 4WT6A 5E90A 2YHVA 4G1WA 2XYUA 4ACCA 1ZY4A 4G3FA 3U9CA 3VN9A 4EWQA 4FVPA 3BV2A 4U81A 5M44A 3HAVA 1QPEA 4K8AA 4DFLA 2B9IA 4E93A 3KRLA 3KVWA 4H3PA 2FH9A 2ZMDA 3FKOA 5ETAA 5CU4A 5IH4A 2XK9A 4RWKA 2XIZA 3FPMA 5K4JA 2ERKA 3FAAA 1XH7A 2GSFA 3NR9A 2I6LA 4ZJJA 2XB7A 1E1XA 4TYIA 1GZKA 4FZ6A 5AP5A 2UW6A 4CTCA 1NA7A 4JS8A 3GENA 3WF9A 3WZUA 3VF8A 4IVBA 2XA4A 3H10A 2V7AA 4IC7A 1ND4A 5CAQA 2YM7A 3C4EA 3GBZA 4TWCA 3ZFYA 2VWZA 1GIIA 3FMHA 4RWJA 2OI4X 1YWRA 3V5TA 3OW3A 4QTDA 1FBNA 4QP2A 2QCSA 4C35A 2X8EA 4NCTA 2W1HA 3HX4A 4PNIA 3WOWA 1IAHA 4QMMA 4L42A 3NCGA 4ID7A 4U3ZA 4CKIA 5IA0A 5JFXA 3R1YA 1YKRA 3SVVA 2E9UA 1Q97A 3FLNC 4HGLA 2EU9A 2CNQA 4KKGA 4KIKA 3CQUA 3DAJA 4OR5A 3OOGA 2OGVA 4ITJA 4AG8A 4U9AA 4A9RA 4F6WA 1GIHA 2B52A 3G2FA 2AYPA 4GG7A 3H9OA 5C9CA 3FSKA 4IADA 4E4NA 4EKKA 3VS1A 2UW5A 5M56A 3RAKA 5L8KA 3IOKA 4FV3A 4C4JA 3BPRA 3DKGA 3L9LA 4QTEA 4H3BA 4P2KA 5EK7A 1GZOA 4IM3A 3FPQA 1R3CA 5J87A 4GKIA 5DT4A 4I94A 4D0XA 3MV5A 3TIZA 3QD4A 4U3YA 2WMAA 1CMKE 1Z9XA 5FBNC 3SD0A 4AT5A 3AOXA 1ZRZA 4R8QA 1B39A 2O5KA 2C5OA 4JRNA 4TT7A 4UBAA 4V01A 4OTQA 4AAAA 4O6LA 4L52A 4N4SA 4DF3A 3PJCA 5CSVA 3ZXTA 4FC0A 4ACHA 2V55A 3NW5A 3HV6A 5E1EA 1BKXA 4FTCA 1UV5A 3AD6A 3CJFA 3O17A 3Q04A 5DBXA 3LM5A 3RPSA 3W16A 4C38A 3BYUA 4RFZA 4G3GA 2J0IA 5M06A 4NM3A 4XHKB 3S0OA 4O22A 5GJFA 4FG8A 1WMKA 4RX8A 1IRKA 4CYIA 2QO2A 3O0GA 2QG7A 5CY3A 4EK8A 2UVYA 5LMBA 4HCVA 3KREA 5HG9A 5LCKA 4D1XA 4GV1A 3MA6A 3LZBA 3H9FA 3QQFA 5FTOA 3DKOA 2PUPA 3HLLA 4XG7A 3L8PA 5EI2A 3BWJA 2FUMA 5AUVA 2VO7A 5M09A 2HWOA 1PXPA 4JIKA 4IJPA 4AW2A 4EUUA 3FHRA 4TNBA 2BFXA 5L4QA 4BN1A 2C4GA 5JFVA 2XM9A 2YACA 3CLYA 5KZ0A 4NTSA 2VNWA 3W55A 3HRBA 4FI1A 2YEXA 3NVMB 4IX3A 4UY9A 3R7YA 3KRJA 2IW9A 3UOHA 3NW7A 4FZAB 4U45A 2ZB1A 4B4LA 4XMOA 3LE6A 2FYSA 3MW1A 3EQRA 4LQMA 4FZDB 4K2RA 2PU8A 4ANOA 1ZYLA 2VTTA 2HIWA 3ENMA 5AMNA 4MBJA 3G0FA 5A6NA 3QF9A 2XNPA 4FTNA 5KCVA 2C6TA 2ZDUA 2PE2A 3LQ3A 3IECA 4YGAA 3CTHA 3F9NA 2VGOA 3FDNA 3KXXA 3E7OA 3QX2A 3RI1A 4ZMFA 3V04A 4S33A 4EOLA 3H4JA 2BIKB 3JR1A 3FL4A 5KMOA 5AR7A 1BI8A 1SVGA 2OSCA 2HELA 3PP0A 4PRJA 2YZAA 4PQNA 4TYJA 5AR2A 3SRVB 2HZ0A 3A4PA 3BU3A 3FY0A 4FYOA 2UV2A 4LV5A 1LR4A 4A4LA 1OL5A 4L6QA 4MNEB 1W7HA 4QQTA 5DN3A 4R78A 3L8VA 5IUIA 3HMIA 3P7BA 4RJ5A 4E8AA 5CSXA 4YJPA 5FXRA 1L8TA 5H8BA 5B0XA 1H24A 3F82A 4MQ2A 2BTSA 4F7SA 3NMUF 3GFEA 3H9RA 1J1BA 4AFEA 2JD5A 4AZWA 5HQ0A 3TIYA 3E3PA 4YTIA 3KK9A 4ZTNA 3UVPA 4D2SA 4DCEA 3FI3A 4QYEA 5I9VA 1REJA 5E8VA 1IASA 3VS4A 2NO3A 3OZ6A 5ITAA 2YM3A 1U5QA 4GH2A 4FBXA 1UKIA 4JBQA 4RC2A 3CPCA 2R3RA 3LFNA 1OZ1A 4FF8A 4ZSJA 4E1ZA 1PYXA 3QU0A 4XG8A 3KY2A 4KIOA 2R3PA 4U79A 2Q83A 4CT1A 1NVQA 3QTRA 2OF4A 4FKUA 2RKUA 1M7NA 2XM8A 3OD6X 4XV2A 5DIAA 3U6JA 4F0GA 2IN6A 4E4XA 2CKQA 4K77A 4IFGA 4XCUA 5IQDA 4BTFA 4IEBA 3ZDUA 2V22A 2BZKB 3V8WA 5BNJA 1OUYA 4QYFA 3GU7A 3OCSA 2B4SB 5IEXA 3NEWA 3SA0A 3WZEA 3K2LA 5A9UA 3FLQA 4YHJA 5J5TA 2ZM4A 2F2CB 4FX3A 2VUWA 2QG5A 4TPTA 5BYZA 4X6QC 3VBTA 2WTCA 1MP8A 3LMHA 1G5SA 4FTLA 4NL0A 2X7OA 2X7FA 4R1VA 1E9HA 4L7FA 3EFJA 4GYIA 3ZMMA 1YDSE 3FQHA 2XRWA 3EQFA 4HYIA 1GZNA 4EBVA 4KKHA 3CSVA 5DNRA 3NDMA 1OUKA 5FTQA 3AC2A 3R00A 2OO8X 5EYDA 4BWXA 5AFVA 4EC9A 4AU8A 4XYFA 2J5EA 3MYGA 5F1ZA 4ZSAA 5LMKC 3ZSHA 2RIOA 4HZRA 4C4EA 4F1TA 4Y85A 4YNEA 4F9WA 2JAVA 4FNYA 3GVUA 4FYNA 3SKCA 3ALNA 1SVHA 1KE7A 3BV3A 4LMUA 2QQ7A 1XH8A 5ANIA 3MTLA 3QZFA 2E9VA 4DYMA 2PZ5A 3CS9A 5AP6A 1CTPE 1H08A 5FM2A 4R3PA 3ROCA 2F4JA 2WTJA 4O6EA 3S95A 5IA4A 4JDKA 2E9PA 4E6CA 1SYKA 4ASZA 4O7WA 3EH9A 3TXOA 2VTIA 3ENHA 1OB3A 3FMLA 3TDWA 4Q9SA 4CXAA 2UZOA 3BE2A 5C26A 4FEXA 4DH8A 3FMNA 2YJRA 4KBCA 3NAXA 2WQBA 4NYEA 2QOQA 4XNEA 2F49A 2BILB 3JY0A 4MD9E 4OTDA 5DOSA 3TZ8A 2YISA 1XBBA 3ET7A 4ERWA 5IEYA 3VJNA 5AIKA 4HVDA 1XR1A 5HESA 3UQCA 4EUTA 3VAPA 2VWXA 3IGGA 2G2HA 3QD2B 4NJ3A 4BCJA 4Z16A 5AAFA 1XJDA 4F9BA 1JOWB 3RCDA 4PL5A 3A8WA 3NRMA 5ANJA 3HVCA 4RQVA 4DEHA 3GU4A 2XEYA 4N57A 4K6ZA 3SW4A 4BVUA 3THBA 2X9EA 2UZDA 4QQJA 5EI6A 3LMGA 4BIBA 4A9SA 2XNNA 2EXMA 4AGCA 2VWWA 2R7IA 4E4MA 1XH5A 3NNUA 4FTTA 4L01A 4RWLA 2GHMA 3COHA 2I1MA 4NH1A 3O51A 4CNHA 2C5YA 4DEAA 4F1MA 2C6KA 5EW9A 3R6XA 1O6KA 5IQEA 3Q4TA 4DN5A 3NYXA 3FZ1A 4GW8A 2ZVAA 4WNOA 2ZOQA 3DDPA 4MXCA 2YM8A 4YP8A 3WF6A 2WTVA 1NY3A 4YZBA 4G16A 5CSHA 4QMOA 3IW4A 4EH5A 5HOAA 4ACGA 2YCQA 5ICPA 3D9VA 3D5XA 4ZTLA 3FC2A 3UO4A 3IGOA 4GKHA 5IQBA 3RBWA 3LQ8A 4QO9A 5LXMA 1WVXA 1P4OA 2QD9A 2H9VA 3TG1A 2WQEA 4XV3A 3PPJA 4WRSA 3KN5A 3NAYA 3RPOA 4O7VA 4LOQA 4BR3A 2B1PA 5IUHA 5HGIA 5C01A 5HE3A 2J4ZA 4TZRA 3ZLWA 2X2LA 3VULA 1YDRE 2P55A 3BYMA 4YZDA 5AUXA 2UVZA 2P4IA 3UOLA 3RPRA 4M69B 3P86A 3MH0A 2A0CX 3PPZA 4IACA 4U40A 1NXKA 3PE2A 4QNYA 4EH9A 4XRJA 4IZAA 2ZV2A 5E92A 5D41A 3PJ1A 4AN9A 3VO3A 1U46A 4GIIA 3RVGA 2EB3A 4IMYA 3KN6A 4RIOA 3QFVA 3KXZA 2BRMA 2C3IB 2VTSA 5I4NA 2JKOA 1M14A 5A14A 4Q5HA 1OIQA 2R3HA 4QYGA 2ITYA 5EYCA 3KVXA 3KB7A 4XLVA 4PV0A 2WHBA 5IA2A 4YPSA 3JY9A 3DS6A 3O23A 2CPKE 4FVRA 2FGIA 4G31A 1FPUA 2W9ZB 1ZMVA 3R63A 2BALA 3FBVA 4S34A 3TNWA 4ZS4A 2QOCA 4JVGA 2PULA 4FKPA 1WBTA 5LJJA 4FV8A 2GTMA 1DAYA 2ETMA 2P3GX 3UQGA 1QCFA 4F64A 4KKEA 5EI8A 1Q3DA 3FZTA 4JOAA 4C7TA 3G51A 3O8TA 5DH3A 3FLWA 5EM8A 3D7TA 4EQCA 4PDOA 4F08A 2GFSA 3TNHA 1PF8A 4PDPA 3RINA 5GJDA 3ZZEA 5DRBA 3R0TA 4UZHA 4CV8A 5IG1A 4G6LA 4BZOA 1Y8YA 2VO3A 4O38A 4C0TA 2IWIA 2OKRA 4MQ1A 4FT3A 4L3PA 4ZOGA 4H36A 2W4JA 3N4UA 4XV1A 5AV1A 4I6HA 2Y4IC 3DXNA 3P78A 2QO9A 4EWHA 4P7EA 2Y9QA 2WOTA 3N4TA 2UZWE 4FV9A 1V0OA 4K18A 3VHEA 5FQDC 4O0SA 5H3QA 1ZOGA 3GI3A 2Z60A 4QTBA 3H0YA 5CXZA 3FXZA 3F2NA 3HV4A 4L53A 3GEQA 4FIFA 5HIDA 3WARA 1QPDA 4ANNA 4BIDA 2CNUA 3Q32A 2UW7A 4M67A 4PL3A 2X4ZA 5LCJA 1OIRA 4CLJA 4ACDA 5D10A 4TYEA 3FXXA 4UEUA 3C4XA 3A7FA 3NYNA 4BI0A 2IZTA 4XS2A 2Y4IB 4IQ6A 3FL5A 1IAJA 3EFWA 3VW6A 5B2MA 4O0UA 5J9ZA 3IPHA 1AGWA 2VTRA 5CLPA 3FMJA 3C4FA 3W32A 5HNIX 2X2KA 4HYHA 5CT0A 5DFPA 5J1VA 5BVOA 2G9XA 3AMBA 2UW4A 3NIEA 5HBEA 5A4QA 2FSLX 2VRXA 3LJ1A 5EDQA 3R9NA 4J95A 5JH6A 3W2QA 4AA0A 5KMLA 2YLFA 1XH9A 2R9SA 5IDNA 5M57A 3VBVA 2H6DA 4LL5A 3ZOSA 3F5GA 4RX9A 2B7AA 3SLSA 3R8UA 1RW8A 1URCA 3AD5A 4S31A 4U43A 3VUHA 4OUCA 1IA9A 3R9DA 1W82A 4F7NA 5IUGA 2QU6A 1JKLA 5EDRA 3DKCA 4G6NA 4DFNA 2WTDA 1KE9A 2E9OA 4O7RA 5C8KA 5CANA 1RQQA 4IH8A 3OUKA 2CCIA 1OIYA 2J0KA 2VO0A 3HA6A 1YI6A 2QOKA 4RIYA 5E8XA 4YLJA 4BCHA 4BICA 1H1WA 4XUFA 5FXSA 3TN8A 3DAEA 1Z57A 4BDCA 3RTPA 1JKKA 1RJBA 3ORLA 4K33A 3IW7A 3Q9ZA 4I22A 3LJ2A 5I9XA 2YFXA 3VIDA 2NNWB 3PIXA 4MBIA 2YN8A 1OKWA 4OTWA 3TZ7A 5K0XA 4AT4A 3FJQE 4CFXA 5KMIA 5LQFA 2PUUA 1IEPA 4RVMA 3ALOA 3MIAA 3UDBA 4AW5A 4RIWB 4C8BA 1XH6A 4YZNA 5DGZA 2JDRA 1Q8WA 3VF9A 3JXWA 4XP2A 4TL0A 3TKIA 4BYJA 2V5QA 2ZAZA 3I5NA 2R4BA 5J9YA 2W17A 5CVFA 4O2ZA 2P0CA 3QKMA 5CU6A 3FLZA 4WNPA 1P5EA 4EK4A 4BGQA 1M2PA 2CGUA 3ZO4A 2C6LA 5L2TA 2R3JA 2X1NA 3M2WA 4XG6A 5F94A 2UVXA 4KBKA 4W4YA 5FRIA 3R7OA 3TUBA 2GQSA 3G0EA 4F9AA 2FSTX 1B6CB 3CTQA 3TZ9A 3WI6A 1W8CA 5DE2A 4WO5A 3NIZA 3EKKA 2A1AB 1H1PA 2VWYA 3D2KA 4RT7A 1R78A 1J7IA 4FEQA 3DK7A 3QRJA 2PMLX 3NCZA 5EQEA 4ZZOA 4V05A 5DI1A 3ULZA 4BHZA 3AC3A 4OAVB 4W4VA 3AQVA 4FK6A 3WILA 4FOBA 3HECA 4HCTA 3OWLA 4MXAA 5JT2A 1OKVA 3SHEA 2PPQA 4JDIA 5J5SA 4CFVA 3EYHA 5AIRA 3CP9A 1WBNA 4CKJA 5IA3A 3ORNA 5EHLA 5K9IA 1WVWA 1ATPE 3DJ6A 3GNIB 5GNKA 5HBHA 5KKRB 5E7RA 1STCE 1PXLA 5BMMA 5KMMA 3MY5A 3ZO3A 4FEVA 2UW8A 2I0HA 5CNOA 2YDIA 1UWHA 3WF7A 3EQBA 3R30A 1H1SA 3MGYA 4J71A 5CI7A 4KABA 5GIOE 3PWYA 5AUWA 5A4EA 5I3RA 5DPVA 3MDYA 3KXNA 3HAMA 3ERKA 4NWMA 5K3YA 4YZ9A 2OZAB 2R3LA 3QA0A 4G3CA 3PLSA 1OBGA 1P2AA 4FTOA 4G9RA 3RKBA 3TNQB 5JRQA 2OJ9A 3PRFA 4GU6A 2W5AA 4IWDA 4JJRA 4D2VA 2PYWA 4Y72A 3R8LA 2REIA 1XHAA 4EI4A 3M42A 4YUQA 4S2ZA 4DITA 3W2RA 1PW2A 4ASDA 3ZHPC 2WU6A 3B8QA 3QQGA 4L43A 5M4IA 3ZUTA 4R77A 2GNGA 2J51A 4X2KA 3GCQA 3K5UA 2XRUA 3BCEA 4I5MA 4NK9A 4O2PA 5TT7A 4BCPA 3CD8A 4CFUA 4XG9A 5AV0A 4BCQA 3EB0A 1PXMA 4WSYA 3UNKA 3I79A 4J52A 4APCA 4OTGA 5JSMA 3IDPA 2OU7A 2C6MA 4CLIA 4Z3VA 4JQEA 3MH1A 2WMXA 1DM2A 1VZOA 3PDTA 1UU3A 1V1KA 3E8DA 2QOOA 1JSVA 4L3JA 2UW9A 3W2PA 5AM7A 3DXQA 3ZM9A 3UPXA 3A60A 3RM7A 4GT5A 1KV1A 2JIIA 3GCUA 2C0OA 4WG4A 4EJNA 5FBOA 1REKA 4EK3A 4DG3E 4C3PA 2R3GA 4HCUA 3KXGA 3WE4A 4O7ZA 3QCXA 2PSQA 3U54A 2X8IA 3RZFA 3ZSIA 5AV4A 3C4ZA 3EQGA 4IWQA 4FE2A 4B99A 2UUEA 2G01A 4I4FA 3TZMA 3CQWA 2BZIB 2WKMA 2F57A 2A19B 2EB2A 2G1TA 5LMAA 1IG1A 5HTCA 2VV9A 4G17A 5DYJA 3CY2A 2PZYA 5EM6A 4WNMA 3VUIA 2A27A 3T3UA 5HIEA 2WNTA 3GC9A 4RG0A 4D2WA 4F63A 2ETKA 4FKGA 4C58A 5ETFA 3LXLA 5DWRA 1KE6A 4QPSA 4Y83A 4NZWB 3R7VA 5EH0A 4E3CA 1OPLA 3MS9A 4EJ7A 5AUYA 1OIUA 2UW0A 5JRSA 2JKKA 1M7QA 4P5ZA 1KV2A 4Y46A 3UTOA 4HVHA 3A7JA 1H28A 3HA8A 3ZRMA 4NIFB 1XKKA 4EOIA 2JDSA 2QU5A 4E26A 4FKQA 5F20A 3GU6A 5BX0A 5J7HA 3K54A 2OFUA 3PVGA 4E7WA 3TNIA 4CEGA 3DBEA 3AD4A 4GJ3A 2WQNA 2ZB0A 4RC3A 5HO8A 5LVLA 4IIRA 4EYJA 3LLAA 3UVQA 4U0IA 4CVAA 3FUPA 2GNHA 2WTKB 5AWMA 4AUAA 2W1IA 3BQCA 1VJYA 3O7LB 1H01A 5EG3A 4BZDA 5L8LA 4I6QA 2F2UA 4CZTA 3V01A 2VO6A 3ORKA 5HORA 3KXMA 4MNFA 4RJ8A 4DEGA 3GQIA 2HOGA 3O8UA 1PRYA 2RFDA 1T46A 3U6HA 3KKVA 3E88A 3G6GA 3ZYAA 2ZDTA 2JEDA 3Q9XA 2Z8CA 3RPVA 4M66A 3H30A 2W9FB 4I3ZA 2BRHA 3LM0A 3LFSA 3ORPA 5HVKA 3E8EA 5IKWA 3TV4A 4FGBA 3ZUUA 4C2WA 1OGUA 2FSOX 1ZYCA 4C37A 3CQEA 3HNGA 3IG7A 3OUNB 4J99A 4LRMA 2EUFB 4LYNA 1YQJA 3SX9A 3DCVA 5ANGA 5KMNA 3DZOA 3FE3A 3EMGA 3O96A 4QD6A 4U7ZA 4E6AA 4UX9A 5B7VA 2VN9A 4H58A 1OECA 2X8DA 2YAKA 2VWBA 5BQ0A 2X4FA 3G90X 4EOOA 4DGLC 2VAGA 2PVFA 4LRJA 2C6OA 3V8TA 3PSCA 2E9NA 4FZFB 1GJOA 4GFMA 4MD8E 5TF9A 5IDPA 3PJ3A 4WOVA 2GQGA 4D1ZA 3E3BX 3LCDA 5LARA 2WB8A 3D5VA 4GUEA 5BVFA 3FHIA 4UMRA 3UODA 4XJ0A 5JFWA 3B2TA 4RIXB 4FMQA 4KIQA 4KAOA 4X2GA 5FG8A 3V5LA 3ZLYA 5JFSA 3LFCA 3FMDA 1U5RA 3ULIA 3DLZA 2QHNA 2C0IA 3TTIA 4AGWA 2XKCA 5CVHA 5DA3A 3T3VA 3NPCA 1RE8A 4BDAA 4AZEA 3VNTA 5C4LA 3SRVA 3DV3A 5AAEA 2WGJA 3KC3A 4RPVA 4TWNA 4BI2A 3LCOA 4XOZA 4L46A 2B9FA 4I6BA 4YO4A 1H0WA 5IPJA 2PMIA 3SOAA 3F2AA 3QTIA 3EWHA 1JKSA 4OBPA 3F6XA 5CT7A 5CYIA 3R8VA 3VHKA 4OW8A 4AN2A 3V3VA 4BF2A 4DBNA 1JLUE 4QTAA 3LFBA 4ZEGA 5BYYA 5IMEA 3CY3A 3RAWA 4WNKA 4YHFA 2XNEA 3AC1A 1J91A 5EW3A 2R3IA 5M07A 4Q2AA 5EOLA 4CYJA 4EQUA 5GZAA 1JSUA 4C59A 5CU2A 5KMKA 3V51A 3GC0A 2OJGA 1FINA 2R3NA 4NCTC 2QLUA 2XK4A 2NPQA 5EW8A 1HCKA 5GZ9A 4AS0A 1UNHA 3ZZWA 3DTWA 4F99A 2YABA 3AT2A 5CASA 4Z55A 3KQ7A 5K5XA 5M4UA 2FVDA 2PVMA 3AC5A 3O7LD 3DY7A 4LOOA 1BYGA 4B8LA 1K2PA 1WBOA 5A4TA 3BELA 2F7ZE 4YMJA 5ACKA 2RF9A 3FZSA 4DFUA 4TW9A 4JX3A 1KOAA 4O1OA 1BI7A 2CHLA 3BHYA 5FDPA 4M0ZA 2H96A 2GPHA 4FV2A 4ANLA 1G8SA 4MF1A 2UZEA 3R2BA 4N0SA 5HCYA 3AXWA 4R5YA 4O0TA 4YNOA 3KULB 2Y4PA 4F7JA 5J7BA 2ITZA 2F7XE 2LGCA 4O84A 5CVGA 4WBBB 5HE0A 1UU9A 4DTAA 3MFRA 3UC4A 4QP9A 4O96A 3DFCB 3NW6A 4RFYA 1ZYSA 2FO0A 4IM2A 4UWBA 3SGCA 2CDZA 3SC1A 3PYYA 4R6VA 4M0YA 2WMQA 4RMZA 4YC8A 4F0IA 2XCKA 3QGWA 1HOWA 2WTIA 4H1JA 5M55A 4D55A 3WIKA 1U54A 3OROA 3OWKA 2Y8OA 3C0IA 4JRVA 5CWZA 3T8OA 4D4SA 5CNNA 5BYLA 3EZVA 5T68A 5HEZA 1Q5KA 5BVEA 4XOYA 1Y57A 1KWPA 3ODYX 3QD3A 3MB6A 4QT1A 5DEYA 3EIDA 3VWAA 2XUUA 2B0QA 2JLDA 4CMUA 5IISA 4LGDA 1O6YA 2C1BA 4MWIA 5DHJA 5IQAA 2H8HA 2ESMA 2XKFA 5HE1A 1FMOE 4YJQA 2IW8A 3GQLA 3OHTA 3Q52A 5K5NA 1DAWA 1TKIA 3EHAA 4JBVA 2YCSA 1IR3A 3GGFA 4NKAA 4AW1A 4FGRA 3UNZA 3UG1A 4I93A 2WMVA 3QQHA 2VTQA 3V8SA 4CFMA 5M4CA 4PUZA 4A9TA 3TJDA 4FSQA 4AACA 2PVKA 4CMTA 5L6OA 3DJ7A 3PG3A 3R71A 3PVWA 5HNGA 5IQHA 4PPBA 3TCPA 4BDHA 1JAMA 2P33A 5DR6A 3UGCA 4AWIA 4BKYA 5IMXA 3KCFA 3OT3A 4HJOA 5CF5A 3RJCA 2QR8A 5JQ8A 2ZJWA 5HKMA 4DEDA 4LG4A 4GU9A 3L8XA 3RWPA 2YDKA 5IA1A 3IKAA 3UBDA 4DFYA 1ZMWA 5HU3A 3ACKA 1J7LA 2JITA 2YCRA 4FKVA 3F69A 4FSWA 2VTNA 4IE9A 4LOPA 3KL8A 4IXPA 4M13A 4MF0A 1YXXA 1J1CA 3HV7A 4BCIA 1OKZA 3JUHA 4OTIA 4A7CA 3FZOA 2WD1A 5KE0A 2EXCX 4ORKA 1UWJA 3EN5A 3NSZA 4BYIA 1KE8A 1KOBA 4GJ2A 4OLIA 5CEOA 4CKRA 5FP6A 2P2HA 1NVSA 4JAJA 2PMNX 2YWPA 4PL4A 3QWJA 4FEUA 3VUKA 1JWHA 3IW8A 5ANKA 4RBLA 1GNGA 3I1AA 3NNWA 5E8WA 1PMUA 3UO5A 4IVAA 1YXTA 4QYYA 3F7WA 4CQEA 2GDOA 5A46A 4IB0A 4EOMA 4ZTQA 4K9YA 2C3LA 1EH4A 3K3IA 4XEYA 2W4OA 4ZK5A 3V5JA 2C30A 2JDOA 3VS0A 4GG5A 5G6VA 3QGYA 1DI8A 3A2CA 3AC4A 3F5UA 1OMWA 4YLLA 3FLYA 2R3OA 5KBQA 1T45A 4O7LA 5IQIA 5TO8A 2XCHA 3MJ2A 1PJKA 2Y0AA 1ERKA 4ERKA 4QMNA 2YIYA 4RA4A 1TQPA 4TWOA 4FV0A 4JI9A 3MSSA 2HW7A 3QC9A 4QPAA 1H00A 2X6EA 4TY1A 5A4CA 2ZYBA 1ZY5A 4BGGA 3D14A 5I3OA 3OBJA 3U4WA 5C27A 4MXOA 4ZY6A 3IDBA 1P14A 1ZOEA 1UU7A 4AW0A 3ZS5A 4DGMA 4A9UA 3RNIA 1Q8YA 2ZV7A 4HGSA 1TQMA 2O2UA 3BU5A 4MCVA 5F9EA 5JK3A 3COKA 3BYSA 4L00A 5DVRA 4FTUA 1ZARA 3WZJA 4YZMA 3DNDA 1JQHA 2O8YA 2IVTA 3I5ZA 4X7QA 1GIJA 2CMWA 3QLFA 3WBLA 2WAJA 2IJMA 4QNAA 4FKTA 4FNZA 4UN0C 4QMZA 1I09A 2ITUA 4QMLA 3QQKA 4EZ5A 3PY3A 3NUXA 3PP1A 4I1ZA 3UZRA 4DBXA 3PE1A 4WHZA 1MRVA 4Z9LA 5M4FA 3ETAA 4R3CA 2PE1A 3S4QA 2DYLA 4M84A 1PMVA 4UYAA 3S3IA 3P1AA 4ZSGA 5D11A 2C0TA 4HVGA 3VS7A 1PY5A 2PZRA 4FT0A 2JBPA 3NUNA 2VWIA 3FV8A 4M3QA 4QMTA 4EH2A 3ITZA 2W1FA 4B0GA 4EKLA 5HICA 2QOIA 3ZO1A 2R3MA 4FVQA 5IH5A 2G2IA 2UZTA 2XBJA 4RC4A 1Q8UA 2UZLA 4AA4A 1Q24A 2JKQA 4BIEA 4M7IA 4FIJA 3IDCA 5DG5A 5HVYA 3LFDA 5K0KA 3Q3BA 4RJ4A 4P5QA 1YXSA 2CGVA 3ORXA 3OEFX 4IFCA 3ZBXA 5JMSA 3Q9YA 1CKPA 3MPAA 3UP2A 5HG5A 2PUNA 2BRGA 2OG8A 3BZ3A 3LW0A 3QXPA 4EYMA 4DFBA 1WBVA 3AC8A 4P4CA 5BVWA 5M53A 4QMUA 3VJOA 3N51A 3POOA 4HOKA 4CZYB 5FDXA 2YM4A 5AR3A 3DOGA 1Q3WA 1YXUA 1OVEA 2VWVA 3BGQA 4XX9A 5I0BA 4FKSA 4C34A 2UZBA 2WMSA 3GB2A 3SQQA 1YHVA 3F3TA 4RJ7A
chains in the Genus database with same CATH superfamily
3NUSA 4PPCA 3VBXA 3CD3A 4D5HA 2XEZA 3AT4A 5HO7A 1F3MC 4OT5A 4RJ6A 3ZH8A 4UMQA 3D2IA 4PTCA 2HZNA 3ZRLA 3W8LA 3DBDA 5FWKK 5L2QA 3CR0A 4GT3A 4RGJA 3QKKA 4E4LA 1OGYA 2BHHA 5IQCA 2HW6A 3E7VA 5FP5A 4IHPA 3JPVA 3E64A 2GS6A 4OTRA 4H05A 2GNLA 5AP2A 1PKDA 4ARKA 4WD5A 3EL8A 3EQPA 3CEKA 5CZHA 1W2FA 2W05A 2OJFE 3TI1A 1S9JA 4FRFA 4CCUA 5JGDA 3TV6A 4G6OA 4WG3A 2ITOA 1OL6A 3U4UA 3PZHA 3VQUA 3RGFA 2Y7JA 2OICA 1WZYA 3K3JA 3CCNA 2ZV8A 4LDTA 1R0PA 4L9IA 5CAPA 5L2SA 2OIBA 5HZNA 1APME 4AOTA 1YI3A 4DAWA 4C02A 5HE2A 3A7GA 1BMKA 1U59A 4BGHA 3S1HA 2YWVA 5HHWA 5E1SA 4KB8A 2VTJA 4MTAA 3QTWA 4ZLYA 4MKCA 1G3NA 2G2FA 4JLCA 3Q4UA 4YTCA 3DBFA 5IZFA 2RSVA 4Q9ZA 2HXLA 4LFIA 4Y5QA 2VZ6A 4XP3A 5HG8A 5E4HA 5E9EA 3MPTA 3DQXA 4M8TA 2DWBA 4I6FA 3NWWA 5L6PA 3NX8A 5DT0A 4RIWA 3OY1A 4Z7HA 4V04A 4MXXA 3CTJA 3DXPA 4E5AX 4BTMA 3OW4A 3LFEA 4PX6A 1ZOHA 3OCGA 5I9UA 3VBQA 3OXIA 4FTIA 4AA5A 3Q60A 5EDPA 4BB4A 5CU3A 3T9TA 5FTGA 4RLKA 3K5VA 3KA0A 4CTBA 3PZEA 2CJMA 4RA5A 5E8YA 3REPA 1U4DA 1YXVA 2FSMX 2J6MA 4II5A 4M68A 4U97A 4QP7A 4YTFA 4O7NA 3I6WA 3DKFA 4ZIMA 3W8QA 4OTHA 4EONA 3AG9A 2W06A 5JQ5A 2WMTA 4BDEA 3R1SA 4UYNA 5AX3A 5HLPA 3PLAE 4H1MA 1OM1A 1KSWA 3II5A 2JIVA 2Y6OA 5T6KA 2Q0NA 4G5PA 3BBWA 3KFAA 3O50A 4A4XA 3DFAA 3ANQA 3PPKA 3R04A 4Y8DA 1YRPA 3HV3A 3R2YA 5CEMA 3UYSA 3GC8A 3GUBA 4X21A 4AGDA 3P23A 5CEQA 3R8PA 4FT5A 3PSDA 3TUCA 3MESA 3A61A 3IK3A 3JVSA 3LVPA 2VU3A 4RWIA 3V5WA 4I41A 4IB5A 1AD5A 4G9CA 4JIAA 3HMPA 4IJ9A 4DCAA 4F9CA 3KEXA 5EHOA 3RAIA 4UXQA 4YO6A 3AKJA 2HY81 2XVDA 2BAKA 3LOKA 3MY1A 3DQWA 2Y6MA 2O0UA 5CSPA 2V7OA 3PXQA 2VGPA 4C4HA 3QYWA 4J98A 2OXYA 4FT7A 3OOMA 2W99B 2W1ZA 2BZHB 1F5QA 4X3FA 3LCSA 3W18A 4FKLA 2W4KA 2YLEA 2X0PA 4RVKA 5I9ZA 2CLQA 4R1YA 3FSFA 3PIYA 3W2CA 4F09A 4F6UA 3GXLA 1J7UA 3RPYA 4DLIA 1XWSA 1YHWA 3GCSA 4EH6A 2GTNA 4F70A 3LMIA 4TNDA 3N4VA 5A54A 2JFMA 5E8TA 1Q8ZA 2IZUA 3GU8A 2OIQA 4LUEA 2Z7RA 4A4OA 4P90A 3D7TB 4G34A 2YDJA 5KUPA 3I7BA 1PYEA 3FKLA 4JAIA 1YVJA 4JT3A 1V0BA 4R7IA 5CTPA 1WAKA 4UZDA 5FD2A 4BFMA 4BHNA 4PTEA 3ZCLA 3S00A 2WXVA 2PMOX 4EK5A 4JG7A 4JG8A 2XK6A 2YM5A 2OXDA 5L6WL 3HL7A 4FIIA 4UWCA 3ZUVA 3PA4A 4HW7A 3CPBA 4E20A 1SM2A 4MVFA 2R5TA 4TTHB 2VTAA 3V5QA 4DGOA 4EQMA 4PP7A 5BVDA 4YSMA 1FGIA 4WG5A 2ITPA 3QRIA 5CX9A 2WMUA 4WIHA 5KHWA 4I21A 3VRZA 4GIHA 4JQ8A 4BBEA 4KA3A 4QYHA 2IVVA 2W1DA 3KF4A 4WKQA 2J0JA 3QUPA 4DINA 1TVOA 1CSNA 3QQLA 4MBLA 1VYWA 4BKJA 2R64A 1JNKA 3OWPA 3GP0A 2DS1A 3W1FA 2CKEA 5C03A 1H0VA 2JDVA 2GFCA 3HP2A 4TN6A 4D4VA 3QAME 3RK5A 3UZTA 1Q62A 2ZV9A 3HRFA 3BX5A 4KUJA 2PVLA 3HGKA 1JPAA 4HNIA 4GFOA 5CF6A 3U9NA 2HXQA 3EN9A 2C69A 1M2QA 2P2IA 4IX5A 5J1WA 4O0RA 3MFTA 3F7ZA 5CAVA 2WEVA 3QALE 3BGPA 3TKUA 1ZYDA 4D2RA 3NGAA 2Z7LA 3P79A 3W2OA 1Y91A 2ETRA 4LL0A 4EEVA 2Z7QA 4R7BA 2BAJA 4AXAA 4AZFA 3OT8A 3E87A 4FTJA 2KTYA 3C4WA 4IAIA 2DUVA 4IAAA 4FOCA 4IX6A 4KBAA 1UKHA 3VVHA 4HZSA 3WZKA 4O7TA 4FTMA 2CN8A 5D1JA 2YAAA 1PXIA 2X7GA 2PVYA 3QCSA 5CAUA 2ONLA 3PTGA 5BVNA 2CSNA 4D9UA 3A7HA 5EYKA 1YDTE 4ONAA 2IZSA 4TKSA 5FEQA 2QOLA 2OH4A 3PG1A 4A07A 1R39A 4DEIA 5LWMA 1UVRA 3IOPA 3HMMA 5EM7A 4L44A 3VS6A 3GFWA 5CEKA 3W10A 2XNOA 5EQPA 4AOJA 4U44A 3SXFA 5IQGA 4NIFA 4RIYB 4GCJA 4GL9A 3W0OA 1O6LA 5JN2A 4ZTSA 4MK0A 3FI4A 2E2BA 5AJQA 5H8GA 2VWUA 4ZXTA 2UZNA 4D0WA 1UNGA 4JXFA 3R7IA 1LEZA 3P7CA 5KBRA 3VUTA 4FIHA 3MBLA 4FV1A 4RZVA 5FEDA 5AP1A 2CN5A 2VX3A 4O83A 4YPDA 3R9RA 4Z7GA 4PMTA 4DT8A 3ZBFA 4W4WA 3IO7A 4I5CA 2W7XA 1SNXA 3Q96A 4AXCA 4PDYA 3Q6UA 3MB7A 3BLHA 4R5SA 5BUEA 4O7SA 4AXEA 4JBPA 4E6QA 2IVSA 2JFLA 3KRXA 5FXQA 2ZFYA 5AX9A 1M17A 4AF3A 3DGKA 3DK3A 4KRCA 2HWPA 2VTHA 4BCNA 1YHSA 3HMNA 4FL2A 4MX9A 4CRLA 5DMZA 4L68A 5DR9A 5GJGA 2W1CA 4A06A 3FKNA 4BCOA 3IW5A 3L8SA 2C6DA 2BAQA 5H8EA 4KSQA 3I4BA 2X39A 3HEGA 2VTLA 3KRRA 3MWUA 4HPTE 3TDVA 3V6RA 3PXZA 3ZEWA 5KNJA 4TYHB 2EXEA 3SOCA 3RHXA 2A98A 3UE4A 2BFYA 4LGHA 4FG7A 1YOJA 3L9NA 3BHHA 5AP3A 3C50A 4NW5A 4EH4A 4X2FA 4UWYA 3F3UA 3GU5A 5EYMA 4O27B 3VS3A 1Q4LA 2QLQA 3PA3A 2HK5A 3POZA 4MAOA 2SRCA 4RQKA 3O2MA 4IVDA 3BYVA 4QMSA 5C8MA 2V62A 3SXSA 1DS5A 4CSVA 2BKZA 4D1SA 2YITA 4ENXA 2XP2A 4RIXA 2F7EE 4X3JA 2XF0A 4NKSA 3ATTA 3OFMA 2RFEA 5DR2A 3FZRA 3IW6A 4IW0A 3QC4A 5LWNA 3F3ZA 5LVPA 2GNFA 3H0ZA 4ANBA 2PVNA 4HNFA 3G33A 4R7HA 4CD0A 4JBOA 4QMPA 3F3VA 5D7VA 4R3RA 3O71A 4KS8A 3BL9A 3UIMA 4F7LA 4I20A 5H2UA 3EQIA 3RHKA 3OG7A 5CSWA 1B38A 4FL3A 4XBRA 2WTWA 1Q8TA 2W0JA 4JX7A 4USDA 2W1GA 4D2PA 1OL2A 4ZTMA 3I6UA 4QP6A 3ODZX 4FTKA 5GHVA 4RVLA 4FNXA 2ZM1A 2J2IB 1YWNA 2G15A 4YJSA 3NLBA 1VR2A 2HENA 2JDTA 1MRUA 4YJVA 4QMVA 1UNLA 4DGNA 3NVKI 4NM7A 5ETIA 2XZSA 4QTCA 4W9XA 4UMUA 5HTBA 2W5BA 3P08A 4EOJA 1FGKA 2WZJA 4BDFA 2WIPA 4EH3A 5HLWA 5K4IA 4JG6A 2XMYA 4FKIA 2Q0BA 3D7ZA 3E92A 4KRDA 4IC8A 2BMCA 3DJ5A 4HVIA 3C7QA 3EJ1A 3LFAA 5M51A 4FV4A 2C3JA 3HP5A 4DT9A 3TWJA 5CU0A 2W1EA 4M14A 4RJ3A 4NTTA 2IG7A 3BLQA 3LCKA 4B7TA 5CF8A 4ZMEA 4YJTA 3PWDA 3QTQA 3QD0A 3R7GA 4I23A 5JZNA 3TNPC 4BBMA 4CT2A 3EOCA 1H1QA 4FTAA 2NRYA 3IQ7A 4HGTA 3OC1A 2B9HA 3QHRA 1X8BA 5ANEA 4PNKA 5CQUA 4FR4A 2QOFA 3EQDA 4QP1A 3ZFXA 4EORA 2C1AA 3KULA 3QQUA 4RRVA 1E1VA 1W0XC 4V0GB 5KMJA 2QOHA 2CGWA 2PTKA 4C4IA 3QX4A 4TXCA 4J8NA 4QP8A 4YR8A 1QMZA 1H8FA 5DT3A 4FSYA 3R28A 5B2KA 4W4XA 3C9WA 4C61A 3ZEPA 2NRUA 3UPZA 2J5FA 3LIJA 3VUMA 3QZIA 2R3KA 4CRSA 3Q6WA 4FNWA 4LI5A 4EOPA 3RP9A 1S9IA 3UO6A 4GVJA 4O0WA 4U5JA 3R01A 4MNEA 2YIQA 4ENYA 4IB3A 2RFNA 4O0YA 5AA8A 3U55A 3NZ0A 1Y6BA 4XP0A 4F9YA 2OJIA 2X6DA 4LM5A 3OS3A 3FYKX 2R3QA 4BDIA 2XKDA 3G9LX 3P9JA 3QCQA 3BEAA 3HYHA 4M97A 3LQ5A 4HVSA 4PDSA 1BX6A 1WVYA 3E93A 4PMPA 1H4LA 3ZTXA 4FIEA 4BCMA 3CE3A 2JAMA 3TUDA 4DFXE 2WIHA 3FLSA 4O21A 2XK8A 5JEBA 2BTRA 2I7QA 1H07A 3P5KA 4FG9A 3OCBA 3A62A 2PVRA 3UG2A 4EHGA 1FVVA 2XK3A 5DLSA 3ACJA 5HI2A 5AA9A 1OPKA 4FSRA 4GK2A 5AP4A 2BUJA 2LAVA 3TV7A 4QOXA 1URWA 4G5JA 4L8MA 5AV2A 3F61A 3L9MA 5HCXA 5CF4A 2O63A 2X9FA 3LAUA 3OMVA 2BCJA 2I0VA 2BROA 3OCTA 4QMYA 3ZONA 4FSUA 2ZM3A 4IM0A 2C5XA 5EHYA 2JIUA 4YZCA 5L8JA 3ZRKA 1K3AA 4ANMA 5JGBA 3HRCA 5FGKA 3VS5A 3L9PA 1V0PA 3PXYA 3OXZA 3C1XA 4NSTA 3DAKA 4X2NA 3ORTA 4YBJA 1R0EA 2XIRA 1ZAOA 2YIRA 4IVCA 4NFNA 3QXOA 3TTJA 1ZWSA 2QC6A 2RGPA 3NNVA 2JKMA 4N6YA 5JZJA 3NUAA 3LFQA 3OF0A 2WQOA 2OH0E 3H3CA 3DT1A 3OTUA 3D5WA 3PVBA 4O0VA 2BRNA 4OBOA 5ANOA 1I44A 1TQIA 3R83A 3RK7A 3SAYA 5EQYA 3PRIA 4I92A 1CM8A 4KIKB 1XQZA 3R1QA 4YJUA 4K11A 2BVAA 2CCHA 3AGLA 4ITHA 4ASEA 5J9LA 5GINE 1CDKA 2XNMA 4C57A 4FSTA 4QDEA 3R8MA 2UZVA 4U6RA 4ZZNA 2GMXA 4DC2A 2BDWA 4JDJA 4YJOA 3QL8A 4I5PA 5BPYA 4TYGA 5HD7A 5E8ZA 4ZZMA 3G6HA 2IVUA 4IANA 1XBCA 3LCTA 3KK8A 1GOLA 4IX4A 4U41A 4ZJVA 4M15A 2RFSA 4FZ7A 4GUBA 3VS2A 2R2PA 2B9JA 4APPA 4PMMA 2YIXA 3NYVA 3SG9A 5HIBA 4WRGA 5AR5A 2EWAA 4BC6A 3R9HA 4BCGA 2O3PA 4ZSEA 3QTXA 5LMKA 2CKPA 3DB6A 1Q61A 2ITWA 4FUXA 4MXZA 5IU2A 4XLIA 3BHVA 1WCCA 4EH7A 4W8DA 1XO2B 4BCKA 1A9UA 2UZUE 2PK9A 4AZSA 3R8ZA 5HX8A 4NM5A 1VEBA 2YA9A 3BKBA 2C5VA 3QYZA 4EZ3A 2ACXA 2QO7A 4MD7E 1VYZA 4AT3A 4USEA 1IA8A 1CKJA 1WBSA 5TR6A 2BDFA 3TJCA 4E73A 4ZY4A 4ZY5A 2C3KA 3F3WA 3U87A 4PY1A 3WE8A 2HYYA 1OL7A 2AUHA 4WBOA 2OLCA 3U51A 4F0FA 4MEDA 4XBUA 2GNIA 3P4KA 4YTHA 4F6SA 3BBTB 3W0QA 4OAUC 3MH2A 2GCDA 4U80A 4FL1A 5C8NA 5FLFA 3BLRA 2WPAA 4IWOA 2PVHA 3W0NA 1RDQE 2OFVA 1W98A 4CQGA 1PXKA 2W5HA 3VRYA 4IAYA 4BTKA 3D4QA 1FVTA 2A2AA 4DLJA 3M11A 3W2SA 5AUTA 2W96B 1G8AA 3OP5A 3UDZA 2WELA 4YURA 3ROYA 3C51A 3E8NA 2BZJA 4G2FA 4N70A 1NT2A 4FKJA 2YJSA 4O86A 1Q99A 3UDTA 4AE9A 2NP8A 2WFYA 4N6ZA 5AR4A 2QHMA 4IWPA 4UMTA 3B8RA 4O0XA 3C0HA 3NYOA 4EK6A 3EZRA 5DRDA 4QP3A 5EFQA 1DI9A 4ZLZA 4IDTA 5IA5A 1NVRA 3UOKA 3SW7A 3ZC6A 3ATSA 5I5ZA 1GY3A 4NEUA 1ZYJA 3KMUA 2QONA 4RZWA 2ITTA 3FQEA 1PMEA 1PKGA 2J9MA 5FUTA 2VTMA 1WBPA 1XH4A 4B8MA 4FEWA 3BHUA 1U54B 4KD1A 5HU9A 4KS7A 4DH3A 2R0UA 2XBAA 3FXWA 3QLGA 4FKWA 5TKDA 1YOMA 4CFNA 3QQJA 4D2TA 3MVHA 3CKXA 4W9WA 4FSMA 4H3QA 3B2WA 3QBNA 3KF7A 4PP9A 4ZLOA 3A99A 4M69A 2PE0A 4OT6A 1J3HA 3R02A 4XG3A 2OK1A 3VBWA 4BI1A 4CCBA 2PWLA 3D83A 1YI4A 3BQRA 2DQ7X 2QOBA 3DU8A 3LXNA 1PXOA 4YJRA 3WYYA 4BZNA 5L2WA 2CNVA 2XH5A 3DDQA 1BL7A 3DLSA 5CEPA 1GAGA 3QKLA 4OTFA 4RVTA 3VW8A 1A48A 2I40A 2OF2A 2R3FA 1JSTA 3R7EA 4BBFA 4FV6A 4DG2E 4YC6A 1XBAA 3M1SA 4IAFA 5HBJA 3D0EA 1W83A 4F4PA 1YWVA 4C33A 4K1BA 4D9TA 2C5NA 4EL9A 1H26A 5IH6A 3A7IA 3ZO2A 5F4NA 1AQ1A 3CGOA 4NUSA 2QR7A 2VNYA 2FA2A 3E62A 3LJ0A 3KCKA 4BCFA 4CZUA 4ZAUA 3W33A 4USFA 1P4FA 5T3QA 3ID6C 3DPKA 4D4RA 5LOHA 4Y5HA 3QTUA 5J95A 1R1WA 3HMOA 5CQWA 3MPMA 3CJGA 3UOJA 2PL0A 4Y95A 2WO6A 5KO1A 2Z7SA 4JL9A 3PFQA 5IF1A 3RZBA 5TOZA 2VX0A 4GSBA 5I9WA 3UVRA 5IQFA 2Z2WA 1WFCA 5CZIA 3FMEA 3OY3A 3VBYA 4J97A 3KRWA 4NFMA 4YC3A 4GEOA 4C62A 3UIUA 4C4FA 4S32A 4EHZA 2B55A 2YIWA 3MA3A 3TM0A 2ITQA 3QHWA 4QP4A 2Z02A 3CIKA 3DA6A 4X6RA 3VUDA 3EFKA 3UMWA 5AAGA 3BWFA 4AQCA 5HO6A 4O7YA 2EVAA 3LLTA 4ASXA 2BKKA 1CKIA 3BIZA 4IB1A 3TT0A 3F66A 4QRCA 4EOQA 3BU6A 4UXLA 5GZ8A 4ALUA 4TRLA 3P7AA 5L2IA 4PMSA 5HLNA 4EHVA 4LRKA 3I60A 2YERA 3LPBA 5J79A 1SVEA 4G3DA 1OITA 4FSZA 3W0SA 3ZC5A 4UB7A 3F5PA 2XARA 4BRXA 5A4LA 4W8EA 4GMYA 3OTVA 4XRLA 3FC1X 1ZXEA 2QKWB 4PPAA 2GS7A 2I0YA 3TACA 4JDHA 4U42A 4BDGA 3VC4A 4BWPA 4BDJA 2IO6A 4MYGA 3NS9A 4O81A 3QCYA 4PWNA 1H25A 3UDSA 2ITVA 3P0MA 3D94A 4OGRA 5E8UA 4WUNA 3R21A 5BMSA 3BYOA 3HKOA 5A6OA 1ZZ2A 2XIXA 3BGZA 2R7BA 3D15A 1OI9A 2PY3A 3Q5IA 3QRTA 3MN3A 3UP7A 4O4BB 4CFWA 4AX8A 1Y6AA 3RM6A 5L3AA 2XIKA 4FODA 2GHGA 4IZ7A 3VQHA 4RFMA 1BLXA 2XJ1A 2XJ2A 4DDGA 5AR8A 4ALWA 1PXJA 2AC5A 1L3RE 1O9UA 5FM3A 4EBWA 3UQFA 1BL6A 3LXKA 3Q5ZA 4U8ZA 3Q9WA 5AP7A 5ETCA 4I0RA 3EN4A 4ZS0A 4EH8A 1Y8GA 2QODA 3ZLXA 1QL6A 1FOTA 2IEWA 5AP0A 5HCZA 1LEWA 5ACBC 4AOIA 3GCVA 4GYGA 3JS2A 4FV5A 4RX5A 2YM6A 3GC7A 3FZPA 4C36A 3R1NA 2J7TA 4BDBA 4UV0A 2XAOA 3SV0A 4FTRA 3ZXZA 4YSJA 4D4YA 3UIXA 3PA5A 4DEEA 2JGZA 2X0QA 3DBCA 4JR7A 3WYXA 4QEBA 4ITIA 4JNWA 3R7UA 4JQ7A 3FWQA 3SXRA 4DGGA 2RG5A 2WMRA 2OWBA 4BDKA 4JR3A 4MUQA 3QWKA 4RSSA 3PXFA 1OPJA 1ZMUA 3VUGA 1SNUA 2BIYA 3ORMA 4DH1A 4NJDA 4XG2A 4NU1A 5D12A 3UIBA 2QI8A 4BKZA 5M08A 2OJJA 2XK7A 2PHKA 2QURA 3Q4ZA 3ZDIA 1OKYA 3E63A 5AEPA 1A06A 3F2RA 5KX8A 4J1RA 4L7SA 3AT3A 4IAZA 3PXRA 2J90A 1LP4A 5AV3A 4I24A 2HY0A 3EYGA 3TKHA 4NW6A 1LUFA 3UYTA 3COIA 3Q4CA 3T9IA 4ACMA 4BDDA 4KNBA 4F65A 4L3LA 2YZLA 3LKMA 4GT4A 1M52A 4L67A 3KGAA 2CGXA 2OIDA 4IBMA 3EFLA 4FK3A 3QUEA 3AKKA 4FIGA 4I0SA 2J0LA 2JBOA 1MRYA 1KUTA 3ZU7A 2OZOA 2B54A 3R9OA 4DH5A 4OTPA 5BVKA 3RAHA 3U6IA 2WMWA 3TL8A 2WU7A 4EZ7A 2BRBA 1KE5A 4FTQA 3E8CA 2HCKA 1JVPP 4FKRA 5CXHA 2KULA 2O64A 3ZFMA 5HD4A 3AGMA 3L1SA 3LXPA 3TEIA 3UMXA 3CGFA 4AN3A 3AMAA 5EM5A 4H39A 3WF8A 4E6DA 2UW3A 3COMA 4CGAA 3G9NA 4WUAA 1K9AA 3BE9A 5D9HA 5HNBA 4D5KA 4EOSA 3MJ1A 3PUPA 3EKNA 3ELJA 3C4CA 4PTGA 4LV8A 4MWHA 4C3FA 5TE0A 2C68A 2PZPA 4DFZE 3KU2A 4BY9E 3FY2A 3EL7A 5CEIA 2WOUA 4AZVA 3MTFA 3FMKA 3UNJA 4LGGA 5LVNA 3CBLA 3FI8A 3GOKA 3A8XA 2F9GA 5AUZA 3SDJA 4E5WA 2BHEA 3V5PA 2V0DA 1LPUA 3ML1A 2QVSE 4YU2A 1W84A 4AE6A 3ORIA 4E5BA 5KHXA 1FVRA 1GZ8A 2OZAA 3U8WA 4BL1A 4HPUE 4DEBA 3MVJA 4DA5A 2I0EA 3C5UA 3QZGA 5DEWA 4AFJA 4KINA 3RMFA 4QQCA 4CMOA 3DNEA 1OBDA 4FSNA 4C2VA 3WIGA 4I0TA 3HUBA 4AGUA 2ITXA 4NT4A 2RG6A 4S30A 4D28A 1ZZLA 3RNYA 1SMHA 3IONA 4DH7A 2XYNA 3Q53A 4DG0E 5CENA 4GFGA 4IDVA 3SG8A 5BUIA 3V6SA 3FYJX 1MQBA 3BEGA 2PZIA 3CC6A 3S2PA 5E91A 3Q2JA 3R73A 4ALVA 3DK6A 1M2RA 3QZHA 4F1OA 1PMNA 2WEIA 2XJ0A 3JVRA 4L45A 2VD5A 4RX7A 3EQCA 3RALA 2CKOA 5KZIA 4WSQA 2HAKA 4AZTA 3KXHA 3RWQA 2XS0A 4CG8A 3NUYA 3O5AA 4J96A 1Z5MA 3OWJA 5CS6A 3OXTA 4C3RA 2J50A 1FMKA 2C6IA 4DHFA 2RL5A 5C1QB 4HGEA 5ANDA 3MY0A 1PHKA 4OBQA 5G1XA 5HVJA 2JC6A 5FEEA 3QA8A 4AP7A 4YBKA 2XKEA 3UJGA 4XH6A 4O82A 1NW1A 3HDNA 4KWPA 1PXNA 1XMLA 3MH3A 3PIZA 4C4GA 3ANRA 4BTJA 3Q2MA 4GK3A 4TYHA 4X3FC 5EOBA 5KKRC 5F95A 4ZSLA 5EKNA 2ZMCA 4GK4A 3G15A 4FUYA 5D7AA 5GIPE 3MI9A 4FV7A 1UA2A 3QTZA 3GCPA 3WZDA 3HV5A 3MIYA 5CI6A 4FICA 4IAKA 5CAOA 3DTCA 4FT9A 5HG7A 3C0GA 2QNJA 5H9BA 3FQSA 4IZ5A 4PF4A 3D5UA 3I0QA 4I4EA 4EHEA 1SZMA 4TWPA 5E8SA 2B53A 1YOLA 1JKTA 3PJ2A 4MHAA 1H1RA 2C6EA 2IZRA 4MH7A 4B6LA 3MVMA 5C4KA 4IZYA 3MFSA 2GU8A 4DE4A 2OW3A 3PY1A 3RK9A 1VLRA 4X3FB 2IW6A 3JYAA 1UU8A 4ZP5A 5BUJA 1H27A 1F0QA 4O91A 4RLLA 5LVOA 2BR1A 3FEGA 3I0OA 3MVLA 3HDMA 4QMXA 2C47A 4X2JA 3UZPA 5HX6A 3EN6A 3R22A 1Q41A 5EKOA 3C13A 4AXFA 4QQ5A 5JGAA 3OEZA 3NUPA 4KSPA 4B9DA 4DTBA 4CFFA 3QRUA 3N9XA 4LMNA 2WMBA 2J0MB 2BPMA 2VTPA 3OBGA 3ZM4A 4D58A 2ITNA 3CXWA 5J8IA 4ANQA 3I7CA 3MFUA 5AADA 3C5IA 4YHTA 5CALA 3HUCA 4GRBA 2XNGA 5B2LA 4ZJIA 3I81A 4EC8A 3ORZA 2GHLA 4A9YA 2OXXA 4WA9A 4CV9A 4QMQA 5A3XA 3F88A 4FA2A 4CG9A 4MXYA 4K0YA 4EOKA 3KMWA 4J53A 3A4OX 3GOPA 2PVJA 2VX1A 4UMPA 1ZLTA 2GQRA 2O65A 2XIYA 1JBPE 1YW2A 3PY0A 4XG4A 4YJNA 2WQMA 2BDJA 4XV9A 1HCLA 2HZIA 3PXKA 3NNXA 5IEVA 4YLKA 4M12A 2A4LA 4O1PA 3PSBA 1OL1A 4BJJB 4AAYA 4NM0A 4QMWA 4QPMA 3FMMA 3GT8A 3QRKA 2X81A 5LVMA 2FB8A 4G3EA 2IPXA 2GS2A 5I9YA 3FI2A 3ZSGA 2AC3A 1BUHA 5AUUA 4Q5EA 3BHTA 2H34A 1MUOA 4HYSA 2ONLC 4GS6A 1MQ4A 3PVUA 4FKOA 4HYUA 4KIPA 4QDVA 3EN7A 4Y73A 2OBJA 3DBQA 3WF5A 2QKRA 2VTOA 4V0GA 4LUDA 2CLXA 3DZQA 1QPCA 5AM6A 2XAMA 3DB8A 4BWKA 3BRBA 1WBWA 3HZTA 3EQHA 3LHJA 2PUIA 4I5HA 3CKWA 4ZTRA 2HZ4A 2X0GA 3PJ8A 4J7BA 5JKGA 3AMYA 3RCJA 2GNJA 1QPJA 5HTIA 2YCFA 3ZLSA 3QUDA 4ZTHA 3G5DA 4J8MA 4X0MA 1FQ1B 3F5XA 3BI6A 3O8PA 3LFFA 2R0IA 3IS5A 2XNBA 4UALA 2ERZE 3E5AA 3OVVA 3UC3A 3KMMA 4DTKA 2WTKC 4ANSA 3AKLA 2X2MA 3NUUA 4GVAA 3QTSA 4WT6A 5E90A 2YHVA 4G1WA 2XYUA 4ACCA 1ZY4A 4G3FA 3U9CA 3VN9A 4EWQA 3PFYA 4FVPA 3BV2A 4U81A 5M44A 3HAVA 1QPEA 4K8AA 4DFLA 2B9IA 4E93A 3KRLA 3KVWA 4H3PA 2FH9A 2ZMDA 3FKOA 5ETAA 5CU4A 5IH4A 2XK9A 4RWKA 2XIZA 3FPMA 5K4JA 2ERKA 3FAAA 1XH7A 2GSFA 3NR9A 2I6LA 4ZJJA 2XB7A 1E1XA 4TYIA 1GZKA 4FZ6A 5AP5A 2UW6A 4CTCA 1NA7A 4JS8A 3GENA 3WF9A 3WZUA 3VF8A 4IVBA 2XA4A 3H10A 2V7AA 4IC7A 1ND4A 5CAQA 2YM7A 3C4EA 3GBZA 4TWCA 3ZFYA 2VWZA 1GIIA 3FMHA 4RWJA 2OI4X 1YWRA 3V5TA 3OW3A