3BU3A

Crystal structure of the insulin receptor kinase in complex with irs2 krlb peptide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
297
structure length
294
Chain Sequence
DEWEVSREKITLLRELGQGSFGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords insulin receptor subunit beta
publication title Structural and biochemical characterization of the KRLB region in insulin receptor substrate-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 294
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bu3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bu3A01
4HPUE 3C4XA 4MBLA 4FVRA 3LKMA 2O2UA 3Q52A 4DTAA 4XV9A 3Q2JA 3BRBA 3MTFA 1H1WA 4YJSA 4WG3A 1BKXA 1OPLA 3OC1A 3RKBA 4ZMFA 4CG9A 4XOZA 2R0UA 3F3ZA 2QOOA 4DFZE 2GDOA 3GCUA 5LWNA 2JKKA 2W06A 4RA4A 5HX8A 2UZVA 4R7BA 1PW2A 3MA3A 2GNJA 3RMFA 3G9LX 4XNEA 1YOMA 2PHKA 1DI8A 3OXTA 4BC6A 4YNOA 4EL9A 1H8FA 4TYHA 3PXFA 4FTAA 4KIPA 4BCPA 5K5NA 2Y0AA 4RZWA 3OWJA 4USDA 4LYNA 5DPVA 5E8WA 3UOHA 4ZK5A 3GC7A 1APME 2IZTA 2WOTA 3H10A 4U79A 2C3IB 5DNRA 5LWMA 2HAKA 4UWBA 5J1VA 4GUEA 4DBNA 3G90X 3K5UA 3CY2A 5EOLA 4TYJA 2JDVA 4LI5A 4MBIA 4G6NA 4NCTA 4D1SA 2A4LA 3OMVA 4NYEA 4H1JA 3PWDA 2BKZA 4D4RA 1P5EA 3R73A 3P08A 2QI8A 1WVXA 2VTMA 2W5BA 2G2HA 3HZTA 1OZ1A 4I4FA 2X81A 3SOAA 3D7TA 2V55A 2A19B 4RJ3A 2PL0A 5JN2A 4MQ1A 4D0WA 3MVLA 3GC8A 1U54A 2W9ZB 4BVUA 4AN3A 4F9WA 4FE2A 3MVMA 4Q9SA 2B1PA 3JYAA 1JPAA 4P5QA 2XNPA 3ZC6A 4F7SA 5E9EA 3UQGA 3EMGA 1OL1A 4JG8A 3NVKI 4UMTA 4XHKB 4BN1A 3FUPA 4BZOA 2XK6A 3AC4A 2XB7A 3D9VA 2XK7A 3E8CA 4G2FA 1M7QA 1ZXEA 3MSSA 5C8MA 3CQWA 2VO7A 4BHNA 1XR1A 4D4VA 1PF8A 4QPAA 5M56A 1CSNA 1URWA 5DLSA 3OF0A 3KXHA 3CKWA 2PSQA 3IGOA 4E6CA 4I5MA 3MH1A 4EK3A 4O1PA 4QMTA 2X9EA 3K5VA 4JIAA 4ZJVA 2E9VA 4JRVA 3CPBA 4IADA 3ZBXA 3AD5A 4EKLA 3CC6A 3BU5A 3CTHA 3DB6A 4PF4A 4QQCA 3VJOA 4CTCA 3OY1A 4HVGA 3OW3A 3TUCA 3VS7A 2HENA 1RDQE 1Q8YA 2XNGA 4O91A 4QMNA 5L6OA 2UZEA 4XG6A 3RI1A 2Z02A 1FOTA 2E9PA 3VS6A 3R21A 1FVRA 5LJJA 5FWKK 1TQPA 4E8AA 5M09A 4TNDA 4YGAA 5KKRB 3KULB 2PU8A 2C6KA 3EJ1A 1HCKA 4JRNA 4YURA 5IQBA 2C0TA 3DBEA 4U41A 1E1VA 3DDPA 3BELA 4BDCA 5TT7A 3RCDA 3KU2A 2PZIA 3CGOA 3Q53A 2XMYA 5L2SA 1PMEA 5L2TA 4Y5HA 3C4FA 3LMHA 5CNOA 3W2CA 4OT6A 2Y9QA 5DGZA 4G6OA 4D2WA 3FYJX 4V01A 4ANBA 3AC2A 4D2SA 3PG1A 4YUQA 4K1BA 5K5XA 3EQRA 3PJCA 3ROCA 1O6KA 5FEQA 4F63A 3A8WA 3N4TA 2WTKC 1OKYA 4RVKA 2R3QA 4RA5A 5FEDA 3Q60A 3HUCA 5KZIA 2VNWA 5FDXA 3R2YA 3TT0A 3ZFXA 4QTEA 3AT2A 4TWCA 3PPZA 4F65A 3E64A 4KRCA 4FNWA 3NUAA 4M66A 4I94A 2O65A 3TV7A 2VWUA 3NX8A 4FKRA 1UA2A 4NM3A 5EHYA 3SOCA 2W7XA 3DAJA 4NTSA 3HP2A 1H08A 4JQ8A 2YWVA 4IEBA 3I60A 4BCHA 1L8TA 1LR4A 4R7IA 1NW1A 3G15A 3M42A 3NCZA 1I44A 4ITJA 3V01A 4BDDA 3W8QA 3FMHA 3VBQA 4L52A 3SC1A 2Y8OA 3IDCA 4PL5A 4C59A 2YZAA 2GFCA 3L8XA 4CV9A 1DS5A 4E6QA 1M7NA 4MK0A 5G1XA 3OCGA 2QOIA 3BZ3A 3PE2A 1URCA 3HA6A 5CF6A 2PMNX 2J50A 4B8LA 4NFMA 4UWYA 2BAKA 2XK9A 4OBPA 2ITXA 4RJ4A 1PXPA 4M69B 1UKHA 5CAUA 3RALA 5HCZA 2UZUE 4HYUA 5L8JA 3EQDA 3KRWA 4DHFA 3KXXA 2W17A 2ZYBA 5LVNA 4GT4A 5FXRA 2J6MA 3GOKA 4H3QA 5I3OA 3ZDIA 3OFMA 4GCJA 4QMPA 1OM1A 2X8DA 4IWOA 3QGWA 4DLJA 5HE3A 2ZJWA 5CENA 3SRVB 5DT0A 2HXQA 4BDHA 4DCEA 4KBAA 1H1SA 2OGVA 2J0IA 3KRLA 4R1VA 5CEKA 5J95A 4F9YA 1M2QA 3COKA 5AUUA 4UYNA 2O0UA 1MRUA 2B52A 4WRGA 2GS7A 3E7OA 1W0XC 3O8UA 4TTHB 4U3ZA 4JR7A 4FZFB 4KKGA 3OG7A 3PVWA 4E93A 4UMRA 3WILA 4XLIA 5CVGA 4O84A 1E9HA 1IR3A 5AR3A 2QURA 5J8IA 1F5QA 4R7HA 1KV2A 3UZTA 4FG9A 2WTWA 2PZRA 5DEYA 3FMEA 1WFCA 4GYIA 5IA0A 3U6HA 4I4EA 2DWBA 1M2PA 4O7ZA 2EXCX 3BYOA 3MN3A 4FNYA 4C02A 3OWLA 5KMJA 5AP2A 3SXSA 2XIKA 4HJOA 3ERKA 3EFKA 5BPYA 2RFDA 3E8EA 4WHZA 3V5QA 2EXMA 2VD5A 4IX5A 4YC8A 4NTTA 5HVKA 4ACMA 3GU7A 4QMUA 2B4SB 4CZTA 3IS5A 2WMSA 2C3KA 3H9OA 4AS0A 3AGMA 3IO7A 3UIXA 4E4XA 4BDKA 2Z60A 5EM8A 1ZAOA 4AW2A 4S34A 3VQUA 3COHA 3ZEPA 4CNHA 4D2PA 4UN0C 2WTVA 4EZ5A 3SGCA 1UKIA 1NVQA 3NYXA 2ZAZA 4M0YA 3UDBA 1YW2A 3DBQA 4RJ6A 3VUGA 2AC3A 4GIIA 3TN8A 4DINA 5L3AA 2YDJA 2HW7A 2C0IA 2UW8A 5CSHA 2OZOA 4Q9ZA 3JUHA 3DJ6A 4QP7A 3M1SA 3H0YA 4AA5A 5HO8A 3HV4A 2H34A 3CS9A 2PULA 5EQYA 3R8PA 3QTIA 3OCBA 4TKSA 4YPSA 4DAWA 2X4ZA 4UV0A 1OPJA 2W1FA 3M11A 2PVYA 5HO6A 4EHEA 3MIYA 4PDYA 3TTJA 5D7AA 4W8EA 5C9CA 3KN6A 2VWWA 2QCSA 2FGIA 3NUPA 2ZOQA 3BLRA 3H9RA 3S0OA 3BGPA 4M97A 3FPQA 5BVWA 3ZLYA 3KCFA 3ULIA 4AFJA 1PYXA 4C3PA 2OBJA 4ZS4A 1GIJA 2I0YA 4FL2A 4WBBB 4DT8A 3BHVA 2PUUA 3E3PA 4RIYA 3QRKA 2GNHA 3N51A 4FGBA 3PXKA 4MD8E 5ETAA 3KB7A 1Y8YA 2QOLA 2X9FA 3CBLA 2X39A 4L00A 4MX9A 4I1ZA 5FP6A 5AX9A 4ALUA 3OBGA 4EHGA 3WIGA 2YZLA 4D2RA 4CFXA 3E7VA 2ONLA 1R39A 3U4UA 4ZLOA 5HD7A 3UG1A 5ANIA 4CKRA 3LMIA 2B7AA 3FI8A 5CXHA 3MH0A 1ZRZA 3MYGA 5EI2A 2JBOA 4AGDA 4AU8A 4FTTA 4RIWA 3TG1A 4AGCA 3ZUUA 2GNFA 3FQHA 5A4QA 1PXNA 4FYNA 4YZBA 4EHVA 3CCNA 3GQIA 4EYJA 5HD4A 5M08A 3V6SA 3F5XA 4DCAA 3KRJA 1UVRA 2XKEA 4O1OA 2YDKA 4ACCA 2OO8X 4MH7A 3ZRKA 5FXSA 4AOTA 3P86A 3GGFA 5AA9A 3LCKA 4FNZA 4PDPA 4BTJA 4WG5A 3W10A 1PXOA 5BYYA 5I9XA 3U51A 3WZJA 2VN9A 4TL0A 3BI6A 3GCQA 5AR8A 3B2WA 3VS4A 2QOQA 3I5ZA 4JL9A 5HTIA 5IEYA 3ZLXA 3LZBA 4EONA 3FMLA 4DG3E 3L1SA 2YCFA 4WBOA 3AOXA 3C4EA 4K77A 3T3VA 5DHJA 3Q96A 3V8WA 4AA0A 4EUUA 4EZ3A 2E9NA 1LP4A 2UW6A 3OCSA 1H1RA 3ITZA 2PZ5A 3QCQA 2JIUA 4I0RA 1PYEA 4EBWA 1FMKA 2JDSA 1PXIA 4Q2AA 1UU7A 2BKKA 4LM5A 1YOJA 4IM0A 2UV2A 3LMGA 2WQMA 3V04A 3P4KA 5DFPA 5DR6A 3R9HA 1KOAA 5CU3A 2X2KA 5JGAA 5CF4A 2YDIA 3KKVA 4FG7A 3LOKA 4BI1A 4GFMA 2PVKA 3HV5A 4YJNA 1JKKA 3GU6A 2NO3A 4EH4A 4F9BA 1PXKA 3F82A 4EH7A 2NNWB 2QR7A 1ZMUA 2VWYA 2W4JA 3O2MA 2RF9A 1DAYA 1XH4A 5JMSA 4UALA 3VUHA 4UX9A 4XP3A 1ZOGA 2W1HA 2CSNA 4C36A 2BUJA 4OBQA 2VTAA 4CYIA 4NIFB 1P2AA 4K6ZA 5J87A 5JSMA 4YJUA 1XBAA 4RLKA 4PX6A 2ITNA 5HEZA 4JQEA 4AN9A 3E8NA 3L8VA 2VTOA 4BTFA 4PMPA 1Z9XA 4ZSEA 4FTLA 4M3QA 4FSNA 4CFFA 4O82A 4FEQA 4W9WA 4ZTQA 3QWKA 3EL8A 4EOSA 2X8IA 4B6LA 2IZSA 4ZJIA 4CFMA 3PVUA 4X6RA 3CLYA 1UV5A 1BLXA 2F2UA 2UZBA 4BBEA 3IONA 3GFEA 3NYOA 5CU6A 2J0MB 3SG9A 4E4MA 4CEGA 4CT1A 4DGLC 5AADA 2G01A 2J2IB 3W16A 1W82A 4GFGA 4Z3VA 5KMNA 1ZY4A 5JRSA 3BWFA 3CXWA 1OGUA 1Q8ZA 4S2ZA 3UMXA 3JR1A 4TYHB 5KUPA 2FSMX 2JIVA 2OH4A 4BCMA 4F0GA 5KMOA 5DYJA 3R63A 4FSZA 4IVBA 4TNBA 3SKCA 4X3FA 4YJVA 1XHAA 3OEZA 3F9NA 3PLSA 2BALA 2H6DA 2XP2A 3C0IA 2EWAA 3C50A 3EQFA 3LFNA 3I7BA 4AFEA 3EIDA 4R5YA 3UOKA 2WZJA 4ACGA 3RPYA 4BRXA 2VWBA 2BRBA 4O96A 4C4HA 5IDNA 4EEVA 4EC9A 2R7IA 2R3FA 3A4PA 5KMIA 4IJ9A 3NVMB 3GOPA 3D7TB 4DBXA 2VTQA 3WF8A 4IAFA 4EJNA 3PPKA 3OVVA 3SV0A 5F94A 4GG5A 3AC5A 2JDOA 3IW8A 1U54B 2HCKA 3TNHA 5D7VA 3QTXA 4ZSLA 3HMOA 4FKJA 4ZY6A 4MHAA 3R30A 4C7TA 5IF1A 3I5NA 1YI6A 1Z5MA 3BKBA 3CIKA 5AV4A 4RJ8A 3LJ0A 4Y46A 4AN2A 5IG1A 3LIJA 1Q3WA 2P0CA 3O0GA 3ODZX 4EH2A 1FBNA 3T3UA 4P2KA 5A4LA 3F2NA 1AQ1A 3O7LB 2ZDTA 1ZZ2A 3FI3A 4QP1A 4U45A 5A9UA 4BTKA 3LJ2A 4QYFA 3CTJA 2YN8A 2XJ2A 3EKKA 2GQSA 2Y6MA 2JLDA 3MJ2A 4GIHA 3BU6A 3QQGA 3GENA 2R3PA 2R2PA 3OROA 3BX5A 5HESA 2PVFA 3ANRA 4G3GA 5LQFA 1S9JA 3ELJA 3PP1A 5A3XA 1OL2A 4GMYA 3UNZA 2JAMA 4AW5A 3U6JA 3VC4A 4BDAA 3FLNC 1Q8TA 2HK5A 5F4NA 3KXGA 2QQ7A 3DB8A 3F61A 4MF1A 3UC3A 3MBLA 5CTPA 2R3KA 3BYUA 4QP4A 4TYEA 3UPZA 4BDEA 3F3WA 3WYXA 4AE6A 5AR4A 2PVJA 2YA9A 3AMAA 5ICPA 4BFMA 3FEGA 1WBVA 5J79A 4Z9LA 3FAAA 4QD6A 1VJYA 3DQXA 3K3IA 3DCVA 4JDIA 2YJRA 4JLCA 1PXJA 3L8PA 4XP2A 5DH3A 4QTDA 4EQUA 1KUTA 5DBXA 1Z57A 2FA2A 1PXLA 3MV5A 4OTRA 1BMKA 5TR6A 3FZPA 3QTWA 4QO9A 4D55A 3MESA 4BB4A 3KVXA 3AD4A 2WFYA 5TE0A 4J99A 4L8MA 4APCA 4Z55A 4Z7HA 2BZKB 2ITZA 2CKOA 4HYSA 5DVRA 4FTCA 2R64A 3SX9A 3ZRLA 1GZOA 1JVPP 2Z2WA 4XOYA 4JR3A 5AV2A 4E20A 3QCYA 4ACDA 1WBNA 4IAZA 4WO5A 4XBRA 2B0QA 1QPCA 3QHRA 4FTIA 5AR7A 5C27A 5LVLA 3DAKA 4JI9A 5F1ZA 2QOHA 3KEXA 3D5WA 3DFAA 3U55A 3A7JA 3PJ2A 5FG8A 2WO6A 3HYHA 4FIGA 1OUYA 4MXAA 2C6DA 4AF3A 4W9XA 3F3TA 1SZMA 4FVQA 1PMNA 5C26A 2RSVA 5BYZA 4OTFA 4MVFA 4U3YA 2JC6A 3I0OA 5D1JA 2GS2A 5HQ0A 3D7ZA 4DEAA 4G3DA 5HIDA 5IA2A 1Q24A 4DEGA 4LL0A 1YXVA 1KE9A 4FV0A 4HZSA 1MRVA 3TIZA 3F69A 2W5AA 4U7ZA 3GB2A 3I4BA 2PVRA 4FSYA 3BHHA 2C1BA 2F49A 2X7FA 4J8NA 5EYMA 5HBJA 4AACA 5KBQA 4A07A 4O7NA 1YOLA 3EN6A 3PA3A 4W4VA 2WHBA 4Y8DA 3ZH8A 4GVJA 4XS2A 1HCLA 2VTJA 5F9EA 4ZJJA 4N0SA 3ZTXA 3FKNA 1SM2A 5I4NA 4H58A 2W05A 3SW7A 4FUYA 3KXMA 3ZUVA 3B8RA 5GJDA 4CMOA 3DKGA 2WELA 3QRJA 3RBWA 2PMLX 2Y6OA 3GI3A 3RK9A 4F7NA 4ENYA 3V8TA 4U80A 4N6ZA 3KVWA 3MVHA 1Q41A 2GNLA 1T45A 5E92A 2UZWE 2OSCA 4S31A 3LXPA 4MXZA 1IAHA 2JDTA 3UC4A 3OCTA 2WB8A 4MXXA 4ZTLA 4GUBA 4EOIA 3WF6A 2WMQA 1MUOA 3L8SA 4G9CA 1YWVA 4L42A 4II5A 3HMMA 4QTAA 5EOBA 5JT2A 2XVDA 2QG7A 3FYKX 2BDFA 1OB3A 2VAGA 4F7LA 1YDTE 1SMHA 5B2LA 4YJOA 1J1CA 4A9YA 4JNWA 2YWPA 3R00A 5B0XA 1GIIA 3LFCA 4CYJA 4MWHA 3QC9A 1YVJA 3W55A 3FXXA 4QP3A 2O64A 2XZSA 1Q8UA 4EOLA 4FEUA 5GJFA 4EOJA 1CTPE 4QQTA 1MP8A 4LOQA 3ZRMA 4QPSA 3NNXA 1JKSA 2YM8A 4O7RA 2CN8A 5KKRC 2ITOA 4F9CA 2NRUA 1QCFA 4O0RA 2ZB1A 1B39A 2HY0A 5B2MA 4CVAA 5HG8A 3LLAA 1VEBA 3NIZA 3W2OA 4BIEA 5FDPA 2C3JA 2W0JA 3ORLA 4JJRA 3A62A 2CKPA 4OUCA 4QNYA 4GK4A 4O7LA 5AR5A 2OLCA 3U6IA 5DI1A 2J90A 3BEGA 4IZ7A 2R3IA 3ZLSA 4ASZA 4C57A 4TW9A 3H30A 4E5WA 3QLGA 2IVUA 3WIKA 2C47A 4QTCA 2EXEA 5KCVA 3Q3BA 4C62A 3FXWA 3NPCA 2QONA 4ZP5A 3CD3A 3RGFA 4EWQA 3CQEA 3QTQA 4OTQA 5IH4A 1V0BA 2WOUA 3HMPA 4XG8A 3FLYA 4C4GA 1H24A 2V7AA 4HYHA 4AG8A 1OL5A 2I0EA 3FL5A 3QX2A 4O0SA 2LGCA 5IQGA 4IANA 4DE4A 4WIHA 4APPA 2XS0A 3RM7A 3SAYA 1KSWA 2CJMA 4G16A 3E62A 3PPJA 3F88A 3S95A 4YBJA 2W1CA 5HVJA 4IVCA 4OTHA 4JX7A 4AQCA 4YC3A 1ZWSA 2EVAA 2XH5A 3GBZA 4DH5A 5IQCA 5AJQA 3NUUA 4E4NA 4FV9A 4RIYB 3D2IA 4QYGA 4O7WA 4ZLYA 3FQSA 3ZOSA 4O0YA 4RIXA 1OKVA 2C6MA 1ZMVA 5D41A 3MI9A 3ZM4A 3ZSGA 4ASEA 4BWKA 3QCSA 3ZSHA 5E90A 3PXRA 3LVPA 2H9VA 2C69A 2XYNA 2F2CB 4IZAA 4J97A 3AGLA 4I6BA 3PY3A 4NFNA 4DEHA 1Q97A 3VW8A 4NH1A 4BYJA 3V5WA 2VWXA 3QTRA 1FGIA 5J9YA 4QQ5A 4BY9E 3C1XA 3FZTA 4FV6A 3BBWA 4O81A 1OITA 2XIRA 1H0WA 1WBPA 3LPBA 5ANEA 3T9IA 4O7YA 4CKJA 3UTOA 3R71A 3DDQA 2HWPA 3IW5A 4EQMA 4I41A 2GFSA 3QZFA 4MEDA 4IC8A 4QMYA 5A14A 5IMXA 5AX3A 2BR1A 3WZDA 3OZ6A 5E1EA 5JFWA 4M15A 5K3YA 5DA3A 5HKMA 2EUFB 3ZO3A 3UZRA 4D2TA 2ZV9A 3NR9A 3GFWA 3MWUA 4TYGA 4Z16A 2PYWA 3S1HA 3DOGA 2CDZA 3FKOA 3LXKA 3OTUA 1A9UA 3HDNA 4KD1A 5TKDA 4FKGA 5CI6A 3QUDA 1ZYJA 3QQLA 5EHOA 4D9UA 3IW4A 4EC8A 4X2NA 2FSTX 3PXYA 4R5SA 5LMKA 2PTKA 5AP4A 3R1QA 2X6DA 4FTNA 4BZDA 5I9VA 3OS3A 1KE8A 4KIKB 4NU1A 4FIJA 4IZ5A 1IEPA 2FVDA 4L44A 1KE7A 3EQHA 1J3HA 3MY5A 1VR2A 4NW5A 1PXMA 4ITHA 3TACA 4JAJA 1AGWA 1PKGA 3UNKA 4DGNA 2UZNA 5CSVA 1V0PA 2PK9A 3TWJA 2BRHA 3DPKA 2CPKE 3GXLA 4DG0E 3PY0A 4GYGA 3UODA 3DTCA 4XV2A 3GCSA 3W32A 3AT3A 4XH6A 5EI8A 4JBOA 1FINA 3EN7A 3EFJA 4DLIA 3DLZA 4RX5A 5BX0A 3GUBA 3BE2A 1JQHA 4GU6A 4D4SA 1P4OA 3A7GA 4UBAA 4FT9A 4XRLA 1OBGA 5IQAA 5K4JA 4XRJA 4AW0A 4XJ0A 2WMRA 2R3HA 2UW9A 3RAHA 3PP0A 2CHLA 1CM8A 5C01A 4BWPA 3VS2A 5CF8A 2BRGA 3LJ1A 1W83A 1KWPA 4AGWA 2R0IA 5IQIA 2V7OA 4MD9E 5HNGA 3KL8A 5AWMA 5HBHA 3W2PA 4A9TA 2R3OA 3BHUA 4DF3A 4CZUA 3GU5A 4IAYA 2YEXA 2XRWA 1U5QA 4ALWA 4DEIA 1REKA 3GT8A 5I0BA 3QFVA 4TZRA 1XH8A 4XEYA 4RSSA 3DQWA 3TJCA 3VJNA 1Y8GA 5AP1A 3BIZA 2XK3A 1OPKA 3AG9A 2ESMA 2O63A 3QA8A 4O0XA 1JNKA 2BFYA 4QRCA 4RC2A 2OF4A 3QYWA 4RX9A 5ANKA 3UO4A 4UMPA 4YTCA 5C8KA 3E87A 4QT1A 3RHXA 1UU9A 3FBVA 3R22A 5EI6A 2QVSE 2F7XE 1Q3DA 2Z7QA 1NA7A 3F3VA 3HDMA 3Q4UA 4Y85A 3ZMMA 2QLQA 1O6LA 2WQNA 4C4EA 3P79A 2I7QA 4YZDA 1CMKE 2YISA 4X3FB 4I22A 4DGMA 4B4LA 3RNYA 2Y7JA 2HWOA 3DS6A 4RGJA 1E1XA 2ITUA 4OBOA 4IW0A 2XYUA 3SD0A 5DEWA 5H8BA 5IA5A 4BCIA 2XF0A 4R78A 5BQ0A 2NPQA 2XCKA 3QALE 4CCBA 3G0FA 2VX1A 2OJ9A 3FMDA 2UW3A 3OOMA 4FV7A 4NZWB 1A06A 4AA4A 3V5LA 1YHVA 4V04A 3A2CA 5IUHA 2ETKA 4DT9A 4GJ3A 4WSYA 1OIRA 3ZFMA 4RLLA 3ZHPC 5KHXA 1ZOEA 3UIMA 4DEEA 5ITAA 5E8SA 4BBFA 4KINA 2ZM1A 3CJGA 3G0EA 4G3EA 3QD0A 4ZZNA 4JBVA 3CJFA 3R7UA 3JVSA 3DZOA 3QD2B 1YHWA 2JBPA 3EHAA 4J52A 4YHJA 4BL1A 5CAOA 5E8UA 4M13A 3F66A 5AAGA 3NWWA 2C5NA 2WTCA 4BCQA 2ERKA 4D2VA 1PKDA 2YIXA 4ANOA 3HUBA 3FLQA 3GU8A 4V05A 5IUIA 4L67A 3E88A 5LCKA 4W4YA 5IH6A 1L3RE 2OJIA 1GZKA 5AV0A 3JPVA 4PQNA 3T8OA 3ALNA 1PJKA 4LMNA 5G6VA 4GFOA 4ZMEA 3QRTA 1XH9A 3KRXA 4WUAA 2FO0A 3UO5A 4S30A 3TUDA 2ETRA 3Q4CA 1GOLA 2KTYA 1OUKA 4YTIA 4HGEA 1YQJA 3CD8A 1QPDA 5DWRA 3OUNB 2WMXA 2R3JA 4IQ6A 4YR8A 2XKDA 1H07A 4LRMA 4EOKA 3O50A 3RVGA 4D9TA 4X21A 4P5ZA 4IHPA 3KXZA 4FEVA 4ZTMA 1IRKA 3W1FA 3LCOA 4IB0A 4IWDA 3F2RA 3U8WA 3QQHA 5EKNA 3G51A 4DTBA 1G5SA 5J9ZA 5AIRA 2XNBA 2A27A 5HG5A 4EHZA 3EFLA 5BUJA 3D94A 3WE4A 3TV4A 2VV9A 3AC8A 4NEUA 3GEQA 4XX9A 4XUFA 5KE0A 4GJ2A 1U59A 5ANGA 2VTHA 1OL6A 4QYHA 3R7EA 3PFQA 3NGAA 3Q04A 5DT4A 4ANQA 4YO4A 2Y4IC 3WF5A 4BIDA 5EYCA 4C34A 4C37A 5E1SA 4IBMA 3R8UA 3KK8A 4PP7A 2IVVA 3DLSA 4PL4A 4KIOA 3OD6X 3BHYA 4IAIA 2VO3A 4FTMA 1KV1A 1YXUA 2V5QA 4J98A 4OAUC 2BHHA 3P7AA 2Q0NA 3PUPA 5E8YA 2WQBA 4H05A 4O7SA 4L3JA 4U9AA 2C5OA 4NM0A 3PXZA 3PSCA 4FTJA 2UUEA 2IJMA 3G33A 4OTDA 3V6RA 1FVVA 2JKOA 4EOOA 3A60A 3FLWA 3QTZA 1ZY5A 1YXTA 2VWIA 3QUEA 3VUKA 3TNIA 3ZS5A 3UJGA 3TV6A 3U4WA 3CTQA 2W96B 5AIKA 4R77A 4G3CA 5AV3A 5FD2A 3NNWA 3ZCLA 3FSFA 3DKFA 4Y83A 2QOKA 4IDTA 3SDJA 3GCPA 3GC9A 4JBQA 4PMMA 4NCTC 5HI2A 4HNFA 4QP6A 4YP8A 4F64A 2VGOA 4AXAA 2OI4X 2Z8CA 4FV5A 2J0JA 4DG2E 5ETIA 3UYSA 5ETFA 4IB3A 3O8TA 5FUTA 2JIIA 4FKIA 1QMZA 4UXLA 2OK1A 3MB7A 3LFDA 4J1RA 5HICA 3UVRA 1SNUA 4NUSA 2F7EE 4JDKA 3LFSA 4YC6A 3HV3A 5M4FA 1M2RA 3NW6A 1GZ8A 4BZNA 1VZOA 3SHEA 5BVOA 3JS2A 4GK2A 4J53A 4NM5A 3P78A 4FV1A 4WOVA 5L2IA 5L6PA 4GKIA 1Y6BA 4KBCA 2YIQA 5M44A 3V5PA 5HZNA 3TDWA 4X0MA 3UVQA 3VBXA 3VBVA 5L2WA 4U42A 4RX7A 4IWPA 3WOWA 4PY1A 4TWNA 5L4QA 4UZHA 1NVSA 3HMNA 2XA4A 4FSWA 4O6EA 3TDVA 1TVOA 3RZFA 4RZVA 4GH2A 4D4YA 5JK3A 3PDTA 5GINE 4I6QA 3R8MA 4C3RA 4XG7A 5H2UA 3TZ9A 2GHLA 4PPCA 5AP6A 1ZYCA 3MY0A 4O38A 5T6KA 4DYMA 4FTRA 4BDGA 1TQIA 3TNWA 4AUAA 5IU2A 4GVAA 1XJDA 2PE1A 5EM5A 2OFUA 4IVAA 3R7IA 3ZEWA 4YSMA 1YDSE 2IW9A 1F0QA 3QHWA 4F1OA 4ZLZA 3RINA 3BQCA 4O0TA 3QTSA 4XG3A 3PA4A 5LMAA 2XBJA 1G3NA 3QTUA 2WIHA 3TI1A 4PDSA 1YWRA 2ZV2A 3AC1A 4PMSA 2ITQA 4TWPA 4WNPA 5DR9A 5IQFA 3FDNA 4S33A 5DRBA 3OHTA 3RPOA 2CGWA 4F4PA 2BAJA 5AP3A 4WNMA 2CGVA 3V51A 4CFVA 4D1XA 5IA1A 4ZTSA 2OICA 1ZLTA 2XM9A 2YCRA 3CKXA 4EH6A 5M4IA 4CTBA 5AAEA 3MDYA 5DOSA 3POZA 5LOHA 4O83A 4FTOA 1OIYA 2RFEA 3EYHA 2C6EA 2ERZE 3HX4A 2FUMA 1XH7A 4EH5A 4ZSAA 2WAJA 4O7TA 2J51A 3BWJA 2BZIB 4K11A 1UU3A 3VQHA 3V3VA 3VRZA 3C4ZA 4DGOA 2V22A 3FI4A 4KKEA 4YMJA 5IEVA 3GU4A 4NKAA 5J9LA 3IOPA 3HRFA 3FE3A 4FKWA 5D10A 3IOKA 4C4FA 4AT3A 4G1WA 4K9YA 4FICA 2ITPA 2HELA 1SVGA 5EW8A 2OG8A 2BDJA 2GMXA 4BBMA 5M51A 5F20A 1OVEA 2UW4A 2LAVA 3HP5A 3LXNA 4JOAA 2P3GX 3ZO4A 4OTIA 5CEIA 5KMKA 3SVVA 5CZIA 4MD7E 3E5AA 4NM7A 4M12A 2H96A 5CWZA 4CRSA 5I9ZA 4IH8A 3KC3A 4R1YA 1O9UA 1NY3A 4RIXB 5IDPA 4QTBA 3S4QA 5HORA 3R9OA 2YCQA 2R9SA 4RRVA 2C5VA 4HW7A 4UY9A 1LPUA 3DBFA 4LUDA 3SQQA 3L9NA 5HTCA 3OWPA 3E63A 3N9XA 3UBDA 5JRQA 4B8MA 3MFTA 2DUVA 3A61A 2J9MA 4D28A 4E1ZA 4DITA 3LFFA 2BRNA 4IDVA 5DN3A 1YWNA 2BCJA 3P5KA 4I0TA 4UWCA 3ODYX 5HLPA 3DK7A 3A7FA 2GQGA 4RVLA 4I23A 2P4IA 1W98A 2B9FA 3JXWA 4FKVA 5KZ0A 5HU9A 4K33A 5CALA 2XJ0A 5LMBA 5J1WA 4KRDA 4J71A 4K18A 1IA8A 2DS1A 3KULA 2YJSA 4KSQA 5E8ZA 2WQEA 4PNKA 2WQOA 4R3PA 4RIOA 4R3RA 2XIZA 3PVGA 3JVRA 1Y6AA 2HOGA 5FM2A 5EFQA 5KNJA 3T9TA 4L45A 4N4SA 4RFZA 3AD6A 3QL8A 3DV3A 3RK7A 3TNQB 3R1NA 5FTOA 1Q62A 1H25A 1KE6A 2Q83A 1H27A 3Q9XA 4FNXA 3FZSA 4RQVA 5TOZA 3FL4A 2VX0A 2VO0A 4L9IA 4FV4A 3V5TA 4F99A 2WXVA 4FIEA 4FV3A 4OLIA 4YZNA 4QMSA 2GHMA 2RG5A 4ACHA 3F2AA 2ITVA 4PDOA 2R3NA 2R4BA 2QU6A 3NNVA 3ALOA 3KMUA 3ORMA 3VF9A 4CQEA 1KOBA 1Q99A 2QOFA 1MRYA 2VNYA 1SYKA 4AZFA 4FT3A 2JEDA 3QF9A 3D5UA 4ERKA 1QL6A 5H3QA 4FEXA 4AX8A 1M17A 3MIAA 2JITA 3WBLA 4D0XA 3I81A 3F5PA 4CFUA 4HCVA 4LL5A 1YKRA 4NT4A 2FYSA 4FKQA 2VUWA 4DFUA 2J0LA 4DFBA 3PE1A 4NWMA 4Y72A 5L8KA 1M52A 2I0VA 2BHEA 4JIKA 2RKUA 3ZUTA 5CXZA 2WPAA 4NKSA 3FMJA 5A6NA 5AUXA 2PUPA 5JFVA 3GVUA 5AV1A 3WZEA 4QP8A 4DN5A 3TZMA 2UW7A 3ORKA 1WBWA 3NSZA 4NL0A 5CSWA 2WNTA 4JS8A 3DXPA 4FV2A 1KE5A 2IW6A 3VUMA 3W8LA 4E6DA 4PL3A 4E7WA 5BVNA 5M06A 2J5EA 3QYZA 2ETMA 4GG7A 4BDJA 1UNHA 4EK8A 2IW8A 4BYIA 3EZRA 3COIA 1Y57A 3RTPA 3O71A 3WF7A 5BNJA 4X2FA 2DYLA 4R6VA 4I0SA 5HG7A 2YERA 3VS3A 3BLQA 3O23A 1ZYDA 2PZPA 5EK7A 2E9UA 2VTPA 2UZOA 4QMMA 4RWLA 3C4CA 5KX8A 3A7IA 3NCGA 1OKWA 3G5DA 3MY1A 4BGHA 1FVTA 5AM6A 2XNNA 4A4XA 3NAXA 3CE3A 2W1DA 4TY1A 1W84A 5A4EA 1RQQA 3IGGA 4AZEA 4EK4A 3Q6UA 3ZXZA 2ONLC 4MWIA 2IZUA 5DT3A 4CV8A 2C6LA 4CLJA 4H3PA 4CMTA 3DTWA 3RWQA 1YXSA 4A4LA 3W2QA 5HIEA 3U9NA 3OXIA 3L9LA 4ONAA 3MS9A 5CS6A 5FBNC 4H36A 3CGFA 4PP9A 3P0MA 4RWJA 4MF0A 5EDRA 3QKMA 4LRKA 4NW6A 2ZB0A 2YM7A 3VHEA 3MFSA 1JOWB 4TN6A 3VW6A 3MGYA 5EQPA 4F6SA 5B2KA 2G9XA 3F5UA 4WNKA 3MW1A 4EK5A 5DMZA 1OMWA 3BQRA 3LHJA 3C0HA 4Z7GA 3WZUA 1WBSA 1PY5A 5ANOA 3NMUF 2YM3A 3U54A 4OR5A 4ZTHA 3RCJA 2ZV8A 4HZRA 3C4WA 3Q2MA 5I3RA 3DKCA 3OT8A 3VIDA 1JWHA 3CEKA 4L68A 1BI8A 3LFEA 2IZRA 4KUJA 5AM7A 4UYAA 3W33A 3ORTA 5AR2A 5LARA 5GZ8A 5CQWA 2BDWA 2O8YA 2C4GA 2FSOX 5EM7A 5IISA 1A48A 3CY3A 4PTEA 2GTMA 1RJBA 3QZHA 5CVHA 3QKKA 4EQCA 2YLEA 4FTQA 5CAVA 1J7LA 2BIKB 1U46A 4F09A 5I9YA 3U9CA 1NXKA 1XBCA 4FK3A 5EM6A 2GQRA 4WSQA 4EH9A 4Y73A 1BL6A 3TNPC 4BI2A 3R1YA 3FC2A 3R02A 2CNVA 4FEWA 3OWKA 2Q0BA 3K2LA 3COMA 4N70A 3HV7A 2HYYA 3PJ8A 4IM2A 5CU2A 5GNKA 4LGHA 4R3CA 4NSTA 1FGKA 1H1QA 2WEIA 3NYVA 2SRCA 4FT0A 1IAJA 1OIQA 3RAWA 4YLJA 3EFWA 3TEIA 3WZKA 1B38A 3FWQA 1REJA 5KHWA 2A1AB 4FIFA 4X6QC 5C4KA 1STCE 4IB1A 1LUFA 3IDBA 3VBTA 4I92A 4LFIA 2NP8A 2WIPA 4CFWA 4OTWA 3JY9A 2G2IA 4FOBA 4LRJA 5CI7A 4C38A 3G2FA 3UZPA 3RAKA 4GU9A 5M57A 4KA3A 3UOJA 5AA8A 4AT5A 4QMLA 3UMWA 2VTRA 4C33A 4JX3A 1TKIA 4KB8A 1WMKA 3V5JA 3TZ7A 1UNGA 5DG5A 1IASA 3QX4A 3EB0A 4GS6A 5K4IA 4OGRA 5EYKA 4EJ7A 3KF4A 3EKNA 2FH9A 3NS9A 3UE4A 3R8VA 1XBBA 3MFUA 5C8NA 4C4IA 5LXMA 4MNFA 3QZGA 4G5JA 4RPVA 2PUIA 3ORZA 3OT3A 5EW3A 5FQDC 4ZTNA 2BIYA 4WA9A 1H26A 3VWAA 3W2SA 4ZSJA 1JAMA 5A4TA 5KO1A 3FKLA 5FBOA 4EOMA 4BDIA 3TCPA 2I6LA 5CEPA 4YSJA 5CT0A 1ZZLA 3B8QA 4IXPA 4U97A 3OY3A 4X3FC 5BUIA 5J7HA 4BKJA 4N6YA 4C35A 2QOCA 5JGBA 2QO7A 3D4QA 5EKOA 2W1GA 3MFRA 4WT6A 4LOOA 5HCYA 5F95A 3FHIA 1YHSA 3N4VA 5AUTA 4FKSA 4FSTA 3EYGA 3H4JA 3DNDA 4QYEA 4BKYA 5JZJA 2G1TA 5AUWA 3BEAA 4ENXA 5M4CA 5GHVA 4L6QA 4DGGA 2PVHA 3ZXTA 4BR3A 5IZFA 3VRYA 2OJGA 4BCKA 3LAUA 5FEEA 3BYVA 1LEWA 4I6FA 4O27B 4PRJA 4QQJA 4DEDA 2PUNA 3IKAA 4U40A 1IG1A 4MXCA 1BYGA 4O86A 3TL8A 3FY2A 4IIRA 3FMMA 3LQ8A 4ZY4A 2W4OA 4FG8A 2UW0A 2JDRA 3BPRA 4RJ7A 2YCSA 3CP9A 1JBPE 4LG4A 2CGUA 3NIEA 4Y95A 2QHNA 4NIFA 4J7BA 4M84A 3TIYA 3U87A 4DH7A 1XQZA 4ZOGA 2JFLA 2WU6A 3BV3A 4BGQA 4RIWB 5AUZA 3QQUA 3NUXA 3KRRA 4PUZA 5CEQA 4F1TA 5B7VA 3FQEA 4CGAA 3OEFX 1XWSA 5AMNA 5E7RA 4K2RA 3F3UA 4NJDA 3QKLA 1V1KA 3FLSA 1UWHA 2YFXA 4DH1A 3ZU7A 4C61A 2QOBA 3FPMA 2OJFE 4ZZMA 4ASDA 3ZM9A 4X2KA 5AP5A 1WBOA 2HXLA 3FJQE 4PPAA 5KMLA 5C1QB 3ATTA 4PV0A 3ORIA 2XEYA 5AAFA 2BAQA 2WMVA 4KBKA 5CNNA 3MH3A 3KFAA 4EORA 5CYIA 4M68A 3F7ZA 3RM6A 3E3BX 4B99A 3AMYA 2PMIA 2OIDA 4O0WA 4FMQA 3QAME 2OFVA 2QO9A 5FM3A 1YRPA 3CPCA 2BZJA 3ULZA 3QQFA 4B7TA 4BGGA 5HIBA 2ZMCA 2UW5A 4ZXTA 4IX6A 5KMMA 4XLVA 5HHWA 4D5KA 3C5IA 2DQ7X 1WCCA 4L3LA 4O0UA 2RFNA 3EN5A 5A46A 4PMTA 4TPTA 2VU3A 4FZDB 2XNMA 4GV1A 1H01A 4O2ZA 3GCVA 3TKIA 4D58A 4MNEA 2RL5A 2R5TA 4M0ZA 4LV5A 1I09A 4ZS0A 4C8BA 2C6TA 3GP0A 3LW0A 4FKLA 4LGGA 4CXAA 2HZ4A 5IUGA 3IPHA 4I20A 2WTJA 4KABA 3PIYA 2ZV7A 1U5RA 1W7HA 4WKQA 5EG3A 1GJOA 4YLKA 1WBTA 2CMWA 3QQJA 3Q9WA 4PPBA 4L53A 1BI7A 3AQVA 1CDKA 3ZFYA 3HAMA 3IK3A 2WD1A 4L01A 1S9IA 2WMAA 3QD3A 4XBUA 4MXOA 4FT5A 2QC6A 3MVJA 2WTDA 4MQ2A 2EB2A 5M4UA 5JZNA 4BICA 1ND4A 3BE9A 3C5UA 5EDQA 5K9IA 3FZOA 3PA5A 4LQMA 3CSVA 3O96A 3F7WA 2R3RA 3TTIA 4UMQA 3RZBA 4YBKA 2YIWA 5JFSA 5BVFA 4V0GA 2PVMA 3Q9ZA 5FTQA 3ZDUA 5JEBA 2B55A 4ASXA 5K0KA 2A0CX 3I0QA 4OAVB 1J91A 2X7GA 1JSVA 3E92A 4QYYA 4KS7A 4FA2A 4PWNA 3VN9A 5H8EA 4RWKA 2H8HA 1QPEA 4Q5EA 4GT3A 4XG4A 4EBVA 2P2HA 3I79A 3LXLA 3PJ3A 3R7YA 1R1WA 3D14A 4NK9A 4WG4A 2P55A 3ATSA 4AZWA 3NUYA 2JKMA 3PVBA 3BU3A 2ZDUA 4RVTA 4K8AA 4E6AA 1R0EA 3LM0A 3EQGA 4RX8A 4BDBA 1PHKA 3A8XA 1K3AA 2IVSA 3C51A 4YNEA 3FSKA 4QMOA 3K54A 3NEWA 1PMUA 2YM6A 4H3BA 4A7CA 4FYOA 4U81A 3QCXA 4CD0A 4FZ6A 4AW1A 2GS6A 4LMUA 2YACA 2RIOA 5T68A 3VUTA 3G6GA 2J5FA 2Z7SA 1M14A 3D5VA 5GJGA 5K0XA 3AC3A 2WKMA 3DGKA 5KBRA 2A2AA 5DIAA 2GPHA 4YJQA 4E26A 5JQ8A 2PZYA 2RG6A 3PIXA 2W1ZA 3BLHA 4ITIA 2CNUA 5GIPE 2JGZA 2ZMDA 2R3LA 4RWIA 2CLQA 3PXQA 3UIBA 2ZM3A 2PMOX 4XG2A 5M07A 1V0OA 4Y5QA 5HGIA 3VS5A 4ID7A 3NRMA 3Q4TA 5CF5A 1OBDA 2XKFA 1H1PA 4RMZA 4X7QA 3SXRA 3TXOA 3UP7A 4DA5A 3DBCA 4YJPA 3UVPA 3DJ5A 2F57A 2ZVAA 4A4OA 5CASA 5L8LA 2O5KA 3IQ7A 4RFMA 1J7IA 2XK8A 4BTMA 2C5XA 2ACXA 4OW8A 5ETCA 3KQ7A 1B6CB 3ZLWA 3SLSA 4BF2A 3NNUA 5EHLA 2JD5A 4XV1A 1HOWA 4ZTRA 4AOIA 4FT7A 5BMSA 3SXFA 3HVCA 4RQKA 4A9RA 2X4FA 5BMMA 4B0GA 4C4JA 3C13A 3I6WA 4KNBA 2OZAA 2BVAA 5EDPA 2B53A 4E3CA 2YM4A 3C0GA 2VO6A 3OTVA 4H1MA 4X2JA 3WF9A 4G5PA 3Q5ZA 5J7BA 5CEMA 3KCKA 4XYFA 3HGKA 3VBWA 4IMYA 4O2PA 4EH3A 3RJCA 2IWIA 5ANJA 3EOCA 2OIQA 2VTSA 2F4JA 3B2TA 3RK5A 3E8DA 4JT3A 4OT5A 4FKTA 2VZ6A 3IECA 3WARA 1YXXA 4TRLA 1R3CA 5BVKA 4CCUA 4ZZOA 3HMIA 3R8ZA 2YLFA 1H28A 1FPUA 3UQCA 2ITYA 4IZYA 1DM2A 3DK3A 3W18A 1JLUE 3HL7A 2BPMA 4USEA 3BV2A 4EYMA 5D11A 3LM5A 3FMKA 3LFAA 3SA0A 1YI3A 4IFGA 4TYIA 1IA9A 5CEOA 2QKWB 3PWYA 1Q5KA 4P7EA 4X3JA 3ET7A 3RPRA 3F5GA 4XCUA 5CX9A 4C2WA 4EK6A 1EH4A 2OJJA 2XBAA 3R0TA 5GZAA 4ANSA 1H0VA 4IB5A 5CLPA 4BCOA 4PTGA 4AAAA 4F0FA 3D2KA 5EW9A 1WZYA 2B9JA 2V0DA 4YZ9A 3BYMA 4FZAB 3ENHA 4D1ZA 5HVYA 4YZMA 4AE9A 4U0IA 3ZO1A 1ZARA 1JSUA 2C6OA 3D5XA 3NUNA 1CKJA 3OUKA 4CKIA 4EH8A 4AZTA 2HW6A 2WMWA 3LCDA 4A9UA 5HLWA 3R9DA 5CAQA 4IFCA 3FXZA 4E5AX 3FY0A 5DRDA 3S00A 4IC7A 3UPXA 2F9GA 2PVNA 2VGPA 3VUDA 4ZY5A 1OL7A 4RBLA 4X2GA 3SW4A 4F70A 4HPTE 1ZYLA 4DH8A 2QODA 2VRXA 4I6HA 3FZ1A 3LQ5A 1YI4A 3QC4A 2XNOA 5LMKC 2CNQA 4YTFA 3ZC5A 4Q5HA 3DJ7A 3C7QA 2F7ZE 2QO2A 4FSMA 4F1MA 4YO6A 5D9HA 2AC5A 2WU7A 3UG2A 3BCEA 3DK6A 4J8MA 4AP7A 4G6LA 3PG3A 2UZTA 2WMTA 4FSQA 4MAOA 4UB7A 3VUIA 2BFXA 3TKUA 5LCJA 2J7TA 3QD4A 2B9HA 2XIYA 3NYNA 4WNOA 3PZEA 2E9OA 1QPJA 3IDPA 1Q4LA 4RC4A 2PVLA 3KXNA 2C68A 3R7VA 4DFNA 2QU5A 2XM8A 4EOQA 3EH9A 5A4CA 3TJDA 3VNTA 4CMUA 5LVOA 3HLLA 3R28A 4FIIA 4EI4A 5IMEA 1GNGA 4JG6A 4HYIA 2WTKB 5H8GA 5I9UA 5CU0A 3V8SA 3HRCA 3A99A 2XRUA 5FGKA 3R2BA 4HVSA 1BL7A 1UWJA 4FKOA 4BKZA 3RPVA 1H4LA 4FV8A 4QP9A 4G9RA 3QXPA 1XH6A 4UZDA 4GK3A 5HO7A 1CKPA 4M67A 3MPMA 5L6WL 4XMOA 3BGZA 4F6WA 3LCTA 3PYYA 4G17A 3A4OX 2OU7A 4YJTA 4UEUA 3ZBFA 3PSDA 3UO6A 3KREA 4OTPA 5CT7A 1LEZA 2UZDA 1K2PA 4ANLA 3R7OA 1OECA 4YPDA 2IVTA 4O7VA 4FSUA 3THBA 3QUPA 3WI6A 4E5BA 5CANA 3EQIA 3FLZA 4HOKA 3JY0A 5IQEA 5HE0A 4UXQA 3PSBA 2RGPA 2WTIA 1JKLA 3LLTA 4EZ7A 2UVYA 3Q5IA 4F6UA 2WMUA 3UNJA 4BCNA 5CVFA 5HU3A 1R78A 1R0PA 2X1NA 2C6IA 4GW8A 4IE9A 5EYDA 5BVDA 1PMVA 4FKUA 4J96A 4ZEGA 1J1BA 2AYPA 2GNIA 4P4CA 4KIQA 5J5SA 3MA6A 1GAGA 4FOCA 4HGTA 5HBEA 4I3ZA 4FODA 4CZYB 4MBJA 3HAVA 2GSFA 4FF8A 2ZM4A 1DI9A 4C58A 3UOLA 3I1AA 3Q9YA 3IW7A 4KIKA 4EOPA 2ITWA 4P90A 5I9WA 2HZIA 4M14A 5H9BA 5JFXA 3G6HA 2OF2A 4R8QA 3TUBA 4RG0A 3NLBA 3NUSA 1XKKA 4LV8A 5EQEA 3Q4ZA 2IO6A 2PY3A 2XKCA 2X2LA 3QBNA 3H9FA 1NT2A 4AZVA 2PE2A 3LFBA 4FIHA 5DE2A 5HCXA 2C30A 2J0KA 2P2IA 3R6XA 4L43A 4QMWA 4U43A 2XEZA 4U5JA 2UVXA 4QNAA 2XUUA 5FP5A 4XP0A 4BI0A 1XO2B 3VAPA 1OI9A 1JKTA 4BWXA 1UU8A 4FTKA 3QZIA 4ALVA 5CZHA 3FZRA 2Y4IB 1BX6A 3ZZEA 3ORXA 4HVDA 2YAAA 4ZSGA 4HVHA 3EL7A 2CCIA 5T3QA 3R1SA 3BHTA 3HRBA 2OIBA 3BYSA 2C0OA 2X7OA 4MYGA 4WUNA 4A9SA 3MJ1A 4S32A 2XJ1A 2E2BA 3EN4A 4ZIMA 4HNIA 4JDHA 3DBDA 2VTLA 2CLXA 3A7HA 5EH0A 5E8VA 2YM5A 4HGSA 4YHFA 3UGCA 3DAEA 4QP2A 4EUTA 4KAOA 3ACKA 4HCTA 4G34A 2IN6A 2Z7RA 5FXQA 5JGDA 2PE0A 3AT4A 4FTUA 2VWVA 1SVEA 4FX3A 4FKPA 4IVDA 2EU9A 3DXNA 3KGAA 4ARKA 3P23A 5AUVA 4I21A 3VBYA 4FK6A 5HNIX 4L46A 4G3FA 3QQKA 4XG9A 5HX6A 1UNLA 4RC3A 3ZZWA 4M8TA 3R7GA 2CGXA 5C03A 1O6YA 4EWHA 3MB6A 5TF9A 4GT5A 3EWHA 1ZOHA 3OP5A 3OXZA 2YITA 3KMMA 5JQ5A 4MCVA 4F9AA 4GSBA 2I1MA 3TZ8A 3ZSIA 3IW6A 3D83A 5J5TA 1Y91A 2B9IA 5JKGA 1NVRA 4IX4A 4LGDA 2GNGA 4FGRA 2JKQA 4CRLA 4ORKA 2OXXA 5FRIA 4BHZA 5JH6A 1VYZA 4WRSA 5ACKA 4MNEB 2W1EA 2BZHB 4F7JA 4A06A 4UMUA 1AD5A 1OIUA 2GCDA 3RHKA 1GIHA 3O7LD 2BTRA 4IWQA 2IPXA 3GC0A 1W8CA 2GU8A 3E93A 4TT7A 5M55A 2OXDA 3CQUA 1K9AA 5HE2A 2OWBA 4CSVA 3ENMA 3H3CA 4TXCA 4F0IA 1ATPE 4G31A 2YIRA 4AWIA 2YAKA 3DNEA 5M53A 4IX3A 4PTCA 4O6LA 3TKHA 3MPAA 4L7SA 1ZYSA 1BUHA 2XCHA 4CFNA 3LCSA 4YJRA 4QMQA 4GL9A 2OH0E 2FSLX 2XNEA 5HTBA 4M69A 5GIOE 4BCFA 3HA8A 4IACA 3EZVA 3MH2A 4LUEA 5ANDA 3FC1X 4I5PA 4RJ5A 1PRYA 4AZSA 4DFXE 5IA3A 2WEVA 4V0GB 2I40A 2R7BA 3PIZA 4U8ZA 2WMBA 4WD5A 3PLAE 1SNXA 4CG8A 3UP2A 3SRVA 4HVIA 2J4ZA 4ERWA 2BROA 2WGJA 4JAIA 4NJ3A 3KF7A 1T46A 3ZO2A 3UYTA 4AGUA 4BCJA 5HNBA 3IG7A 4DFYA 1GY3A 1Q8WA 4C2VA 4TWOA 5GZ9A 5HLNA 1TQMA 3UQFA 2YIYA 3G9NA 4ANNA 3RAIA 2C3LA 4AOJA 3HEGA 4ANMA 4AT4A 2VTTA 3NDMA 4QMXA 3W2RA 2G2FA 2X0GA 3HKOA 3ORPA 2OKRA 3REPA 4O22A 3HECA 4BCGA 3FI2A 4FL3A 4U44A 3NAYA 3VHKA 2QLUA 1ZMWA 3NZ0A 3QGYA 3VS0A 3DXQA 3DY7A 3DZQA 3KK9A 3F6XA 2R3GA 2HZNA 2QR8A 4IJPA 3WE8A 2EB3A 5DR2A 4I24A 5AP0A 1X8BA 2FB8A 3DA6A 4FZ7A 4JXFA 1G8AA 3FV8A 3R8LA 1MQ4A 1VYWA 2UZLA 4OTGA 2XIXA 3ZONA 1J7UA 4KKHA 3ETAA 3R9RA 2VX3A 5BVEA 4B9DA 2G15A 1H00A 2KULA 2V62A 4C3FA 2OW3A 3HNGA 1XH5A 2W9FB 3QXOA 5BYLA 3D0EA 4YHTA 3EQPA 4JBPA 5D12A 4IAAA 4FSRA 2IG7A 3PJ1A 3P7BA 3ACJA 4PNIA 3P1AA 4W4XA 4FL1A 5E91A 4RT7A 3UIUA 3BGQA 4F08A 4IM3A 3P9JA 3KMWA 2CN5A 3AXWA 4FBXA 4FC0A 5IPJA 2CKQA 4GKHA 4KS8A 3ANQA 2QKRA 2VWZA 5LVMA 3QRUA 4JDJA 3TM0A 2BILB 2P33A 1MQBA 3MPTA 4C0TA 1OKZA 1WVYA 3VF8A 3KN5A 2HIWA 5IEXA 2GTNA 3FMNA 4CQGA 1CKIA 4DTKA 1U4DA 2Y4PA 4E73A 5HG9A 4RVMA 3Q32A 3HV6A 4U6RA 5E8XA 3QU0A 5L2QA 1RW8A 3ORNA 2XK4A 3H0ZA 4XV3A 1JSTA 1FMOE 4L3PA 5CQUA 4W4WA 5E8TA 3EQCA 4E4LA 3GNIB 1YDRE 3CR0A 5FTGA 1F3MC 3S2PA 5HOAA 3I6UA 2OZAB 4QMZA 1RE8A 3DKOA 5CSPA 4I5CA 2GHGA 3PRIA 3OW4A 3RWPA 4O21A 4YZCA 3Q6WA 5A6OA 2BMCA 4FVPA 3O51A 3KY2A 1GZNA 2HY81 2AUHA 3K3JA 2C5YA 4FUXA 3SG8A 3VO3A 5C4LA 3NW5A 4M7IA 2YABA 3GQLA 3POOA 2VTIA 3L9MA 3D15A 4DEBA 5AP7A 2W1IA 4GRBA 4L7FA 4BIBA 2JFMA 3DT1A 2X6EA 3C9WA 4KSPA 3S3IA 3R04A 3II5A 4QOXA 3OOGA 5AUYA 3O8PA 5AEPA 2QG5A 4QPMA 3RPSA 1G8SA 3PRFA 2REIA 4JVGA 3QA0A 2RFSA 2VTNA 3BBTB 3RNIA 3PTGA 2Z7LA 4MTAA 4BDFA 5A54A 2B54A 2CCHA 4JG7A 5AFVA 2QD9A 1WAKA 3DU8A 5IA4A 5E4HA 3OBJA 4FR4A 3VS1A 3L9PA 2UVZA 4DH3A 3QWJA 4K0YA 4CLIA 3FHRA 4GEOA 4JQ7A 2R3MA 3ZYAA 2CKEA 3LQ3A 5ACBC 3RP9A 4LOPA 2PWLA 3R9NA 4KWPA 2OXYA 3ROYA 2W5HA 3PZHA 4IAKA 3R83A 3M2WA 3N4UA 3O17A 3DFCB 3KA0A 2W99B 4YTHA 1SVHA 3R01A 4USFA 4HCUA 1WVWA 5IKWA 3WYYA 5I5ZA 1P4FA 4DC2A 4RFYA 5IH5A 2JAVA 4D5HA 1FQ1B 3I7CA 3QRIA 4ZAUA 4EKKA 3LFQA 4O0VA 2ITTA 3ID6C 4I93A 4MXYA 5TO8A 3P7CA 3VULA 4N57A 4I5HA 2NRYA 2O3PA 2PPQA 5LVPA 3NW7A 5CU4A 2W4KA 5CSXA 1DAWA 2YHVA 3LE6A 2QNJA 4QMVA 3PY1A 4YLLA 5CY3A 5FLFA 2X8EA 4H39A 4HGLA 2C1AA 2I0HA 5BUEA 4MKCA 3MTLA 3EQBA 4J95A 4FI1A 3AMBA 1Q61A 4DFLA 5HE1A 1P14A 2BTSA 3EN9A 3QLFA 2X2MA 2HZ0A 5IQHA 5CAPA 4CT2A 2BRMA 5IQDA 3VVHA 4YU2A 1ERKA 4W8DA 2QHMA
chains in the Genus database with same CATH superfamily
4HPUE 3C4XA 4MBLA 4FVRA 3LKMA 2O2UA 3Q52A 4DTAA 4XV9A 3Q2JA 3BRBA 3MTFA 1H1WA 4YJSA 4WG3A 1BKXA 1OPLA 3OC1A 3RKBA 4ZMFA 4CG9A 4XOZA 2R0UA 3F3ZA 2QOOA 4DFZE 2GDOA 3GCUA 5LWNA 2JKKA 2W06A 4RA4A 5HX8A 4DHJA 2UZVA 4R7BA 1PW2A 3MA3A 2GNJA 3RMFA 3G9LX 4XNEA 1YOMA 2PHKA 1DI8A 3OXTA 4BC6A 4YNOA 4EL9A 1H8FA 4TYHA 3PXFA 4FTAA 4KIPA 4BCPA 5K5NA 2Y0AA 4RZWA 3OWJA 4USDA 4LYNA 5DPVA 5E8WA 3UOHA 4ZK5A 1ST0A 3GC7A 1APME 2IZTA 2WOTA 3H10A 4U79A 2C3IB 5DNRA 5LWMA 2HAKA 4UWBA 5J1VA 4GUEA 4DBNA 3G90X 3K5UA 3CY2A 5EOLA 4TYJA 2JDVA 4LI5A 4MBIA 4G6NA 4NCTA 4D1SA 2A4LA 3OMVA 4NYEA 4H1JA 3PWDA 2BKZA 4D4RA 1P5EA 3R73A 3P08A 2QI8A 1WVXA 4QEBA 2VTMA 2W5BA 2G2HA 3HZTA 1OZ1A 4I4FA 2X81A 3SOAA 3D7TA 4AXDA 2V55A 2A19B 4RJ3A 2PL0A 5JN2A 4MQ1A 4D0WA 3MVLA 3GC8A 1U54A 2W9ZB 4BVUA 4AN3A 4F9WA 4FE2A 3MVMA 4Q9SA 2B1PA 3JYAA 1JPAA 4P5QA 2XNPA 3ZC6A 4F7SA 5E9EA 3UQGA 3EMGA 1OL1A 4JG8A 3NVKI 4UMTA 4XHKB 4BN1A 3FUPA 4BZOA 2XK6A 3AC4A 2XB7A 2AEGA 2IEWA 2XK7A 3D9VA 3E8CA 1M7QA 4G2FA 1ZXEA 3MSSA 5C8MA 3CQWA 2VO7A 4BHNA 1XR1A 4D4VA 1PF8A 4QPAA 5M56A 1CSNA 1URWA 5DLSA 3OF0A 3KXHA 3CKWA 2PSQA 3IGOA 4E6CA 4I5MA 3MH1A 4EK3A 4O1PA 4QMTA 2X9EA 3K5VA 4JIAA 4ZJVA 2E9VA 4JRVA 3CPBA 4IADA 3ZBXA 3AD5A 4EKLA 3CC6A 3BU5A 3CTHA 3DB6A 4PF4A 4QQCA 3VJOA 4CTCA 3OY1A 4HVGA 3OW3A 3TUCA 3VS7A 2HENA 1RDQE 1Q8YA 2XNGA 4O91A 4QMNA 5L6OA 2UZEA 4XG6A 3RI1A 2Z02A 1FOTA 2E9PA 3VS6A 3R21A 1FVRA 5LJJA 5FWKK 1TQPA 4E8AA 5M09A 4TNDA 4YGAA 5KKRB 3KULB 2PU8A 2C6KA 3EJ1A 1HCKA 4JRNA 4YURA 5IQBA 2C0TA 3DBEA 4U41A 1E1VA 3DDPA 3BELA 4BDCA 5TT7A 3RCDA 3KU2A 2PZIA 3CGOA 3Q53A 4O4FA 2XMYA 5L2SA 1PMEA 5L2TA 4Y5HA 3C4FA 3LMHA 5BV3A 5CNOA 3W2CA 4OT6A 2Y9QA 5DGZA 4G6OA 4D2WA 3FYJX 4V01A 4ANBA 3AC2A 2XAMA 4D2SA 3PG1A 4YUQA 4K1BA 5K5XA 3EQRA 3PJCA 3ROCA 1O6KA 5FEQA 4F63A 3A8WA 3N4TA 2WTKC 1OKYA 4RVKA 2R3QA 4RA5A 5FEDA 3Q60A 3HUCA 5KZIA 2VNWA 5FDXA 3R2YA 3TT0A 3ZFXA 4QTEA 3AT2A 4TWCA 3PPZA 4F65A 3E64A 4KRCA 2X0QA 4FNWA 3NUAA 4M66A 4I94A 2O65A 3TV7A 2VWUA 3NX8A 4FKRA 1UA2A 4NM3A 5EHYA 3SOCA 2W7XA 3DAJA 4NTSA 3HP2A 1H08A 4JQ8A 2YWVA 4IEBA 3I60A 4BCHA 1L8TA 1LR4A 4R7IA 1NW1A 3G15A 3M42A 3NCZA 1I44A 4ITJA 3V01A 4BDDA 3W8QA 3FMHA 3VBQA 4L52A 3SC1A 3UDZA 2Y8OA 3IDCA 4PL5A 4C59A 2YZAA 2GFCA 3L8XA 4CV9A 1DS5A 4E6QA 1M7NA 4MK0A 5G1XA 3OCGA 2QOIA 3BZ3A 3PE2A 1URCA 3HA6A 5CF6A 2PMNX 2J50A 4B8LA 4NFMA 4UWYA 2BAKA 2XK9A 4OBPA 2ITXA 4RJ4A 1PXPA 4M69B 1UKHA 5CAUA 3RALA 5HCZA 2UZUE 4HYUA 5L8JA 3EQDA 3KRWA 4DHFA 3KXXA 2W17A 2ZYBA 5LVNA 4GT4A 5FXRA 2J6MA 3GOKA 4H3QA 5I3OA 3ZDIA 3OFMA 4GCJA 4QMPA 1OM1A 2X8DA 4IWOA 4MUQA 3QGWA 4DLJA 5HE3A 2ZJWA 5CENA 3SRVB 5DT0A 2HXQA 4BDHA 4DCEA 4KBAA 1H1SA 2OGVA 2J0IA 3KRLA 4R1VA 5CEKA 5J95A 4F9YA 1M2QA 3COKA 5AUUA 4UYNA 2O0UA 1MRUA 2B52A 4WRGA 2GS7A 3E7OA 1W0XC 3O8UA 4TTHB 4U3ZA 4JR7A 4FZFB 4KKGA 3OG7A 3PVWA 4E93A 4UMRA 3WILA 4XLIA 5CVGA 4O84A 1E9HA 1IR3A 5AR3A 2QURA 5J8IA 1F5QA 4R7HA 1KV2A 3UZTA 4FG9A 2WTWA 2PZRA 5DEYA 3FMEA 1WFCA 4GYIA 5IA0A 3U6HA 4I4EA 2DWBA 1M2PA 4O7ZA 2EXCX 3BYOA 3MN3A 4FNYA 4C02A 3OWLA 5KMJA 5AP2A 3SXSA 2XIKA 4HJOA 3ERKA 3EFKA 5BPYA 2RFDA 3E8EA 4WHZA 3V5QA 2EXMA 2VD5A 4IX5A 4YC8A 4NTTA 5HVKA 4ACMA 3GU7A 4QMUA 2B4SB 4CZTA 3IS5A 2WMSA 2C3KA 3H9OA 4AS0A 3AGMA 3IO7A 3UIXA 4E4XA 4BDKA 2Z60A 5EM8A 1ZAOA 4AW2A 4S34A 3VQUA 3COHA 3ZEPA 4CNHA 4D2PA 4UN0C 2WTVA 4EZ5A 3SGCA 1UKIA 1NVQA 3NYXA 2ZAZA 4M0YA 3UDBA 1YW2A 3DBQA 4RJ6A 3VUGA 2AC3A 4GIIA 3TN8A 4DINA 5L3AA 2YDJA 2HW7A 2C0IA 2UW8A 5CSHA 2OZOA 4Q9ZA 3JUHA 3DJ6A 4QP7A 3M1SA 3H0YA 4AA5A 5HO8A 3HV4A 2H34A 3CS9A 2PULA 5EQYA 3R8PA 3QTIA 3OCBA 4TKSA 4YPSA 4DAWA 2X4ZA 4UV0A 1OPJA 2W1FA 3M11A 2PVYA 5HO6A 4EHEA 3MIYA 4O4CA 3TTJA 3P5JC 4PDYA 5D7AA 4W8EA 5C9CA 3KN6A 2VWWA 2QCSA 2FGIA 3NUPA 2ZOQA 3BLRA 3H9RA 3S0OA 3BGPA 4M97A 3FPQA 5BVWA 3ZLYA 3KCFA 3ULIA 4AFJA 1PYXA 4C3PA 2OBJA 4ZS4A 1GIJA 2I0YA 4FL2A 4WBBB 4DT8A 3BHVA 2PUUA 3E3PA 4RIYA 3QRKA 2GNHA 3N51A 4FGBA 3PXKA 4MD8E 5ETAA 3KB7A 1Y8YA 2QOLA 2X9FA 3CBLA 2X39A 4L00A 4MX9A 4I1ZA 5FP6A 5AX9A 4ALUA 3OBGA 4EHGA 3WIGA 2YZLA 4D2RA 4CFXA 3E7VA 2ONLA 1R39A 3U4UA 4ZLOA 5HD7A 3UG1A 4AAYA 5ANIA 4CKRA 3LMIA 2B7AA 3FI8A 5CXHA 3MH0A 1ZRZA 3MYGA 5EI2A 2JBOA 4AGDA 4AU8A 4FTTA 4RIWA 3TG1A 4AGCA 3ZUUA 2GNFA 3FQHA 5A4QA 1PXNA 4FYNA 4YZBA 4EHVA 3CCNA 3GQIA 4EYJA 5HD4A 5M08A 3V6SA 3F5XA 4DCAA 3KRJA 1UVRA 2XKEA 4O1OA 2YDKA 4ACCA 4DHIB 2OO8X 4MH7A 3ZRKA 5FXSA 4AOTA 3P86A 3GGFA 5AA9A 3LCKA 4FNZA 4PDPA 4BTJA 4WG5A 3W10A 1PXOA 5BYYA 5I9XA 3U51A 3WZJA 2VN9A 4TL0A 3BI6A 3GCQA 5AR8A 3B2WA 3VS4A 2QOQA 3O5AA 3I5ZA 4JL9A 5HTIA 5IEYA 3ZLXA 3LZBA 4EONA 3FMLA 4DG3E 3L1SA 2YCFA 4WBOA 3AOXA 3C4EA 4K77A 3T3VA 5DHJA 3Q96A 3V8WA 4AA0A 4EUUA 4EZ3A 2E9NA 1LP4A 2UW6A 3OCSA 1H1RA 3ITZA 2PZ5A 3QCQA 2JIUA 4I0RA 1PYEA 4EBWA 1FMKA 3W0PA 2JDSA 1PXIA 4Q2AA 1UU7A 2BKKA 4LM5A 1YOJA 4IM0A 2UV2A 3LMGA 2WQMA 3V04A 3P4KA 5DFPA 5DR6A 3R9HA 1KOAA 5CU3A 2X2KA 5JGAA 5CF4A 2YDIA 3KKVA 4FG7A 3LOKA 4BI1A 4GFMA 2PVKA 3HV5A 4YJNA 1JKKA 3GU6A 2NO3A 4EH4A 4F9BA 1PXKA 3F82A 4EH7A 2NNWB 2QR7A 1ZMUA 2VWYA 2W4JA 3O2MA 2RF9A 1DAYA 1XH4A 5JMSA 4UALA 3VUHA 4UX9A 4XP3A 1ZOGA 2W1HA 2CSNA 4C36A 2BUJA 4OBQA 2VTAA 4CYIA 4NIFB 1P2AA 4K6ZA 5J87A 5JSMA 4YJUA 1XBAA 1OGYA 4RLKA 4PX6A 2ITNA 5HEZA 4JQEA 4AN9A 3E8NA 3L8VA 2VTOA 4BTFA 4PMPA 1Z9XA 4ZSEA 4FTLA 4M3QA 4FSNA 4CFFA 4O82A 4FEQA 4W9WA 4ZTQA 3QWKA 3EL8A 4EOSA 2X8IA 4B6LA 2IZSA 4ZJIA 4CFMA 3PVUA 4X6RA 3CLYA 1UV5A 1BLXA 2F2UA 2UZBA 4BBEA 3IONA 3GFEA 3NYOA 2AQXA 2J0MB 5CU6A 3SG9A 4E4MA 4CEGA 4CT1A 4DGLC 5AADA 2G01A 2J2IB 3W16A 1W82A 4GFGA 4Z3VA 5KMNA 1ZY4A 5JRSA 3BWFA 3CXWA 1OGUA 1Q8ZA 4S2ZA 3UMXA 3JR1A 4TYHB 5KUPA 2FSMX 2JIVA 2OH4A 4BCMA 4F0GA 5KMOA 5DYJA 3R63A 4FSZA 4IVBA 2X0PA 4TNBA 3SKCA 4X3FA 4YJVA 1XHAA 3OEZA 3F9NA 3PLSA 2BALA 2H6DA 2XP2A 3C0IA 2EWAA 3C50A 3EQFA 3LFNA 3I7BA 4AFEA 3EIDA 4R5YA 3UOKA 2WZJA 4ACGA 3RPYA 4BRXA 2VWBA 2BRBA 4O96A 4C4HA 5IDNA 4EEVA 4EC9A 2R7IA 2R3FA 3A4PA 5KMIA 4IJ9A 3NVMB 3UDTA 3GOPA 3D7TB 4DBXA 2VTQA 3WF8A 4IAFA 4EJNA 3PPKA 3OVVA 3SV0A 5F94A 4GG5A 3AC5A 2JDOA 3IW8A 1U54B 2HCKA 3TNHA 5D7VA 3QTXA 4ZSLA 3HMOA 4FKJA 4ZY6A 4MHAA 3R30A 4C7TA 5IF1A 3I5NA 1YI6A 1Z5MA 3BKBA 3CIKA 5AV4A 4RJ8A 3LJ0A 4Y46A 4AN2A 5IG1A 3LIJA 1Q3WA 2P0CA 3O0GA 3ODZX 4EH2A 1FBNA 3T3UA 4P2KA 5A4LA 3F2NA 1AQ1A 3O7LB 2ZDTA 1ZZ2A 3FI3A 4QP1A 4U45A 5A9UA 4BTKA 3AKLA 3LJ2A 4QYFA 3CTJA 2YN8A 2XJ2A 3EKKA 2GQSA 2Y6MA 2JLDA 3MJ2A 4GIHA 3BU6A 3QQGA 3GENA 2R3PA 2R2PA 3OROA 3BX5A 5HESA 2PVFA 3PFYA 3ANRA 4G3GA 5LQFA 1S9JA 3ELJA 3PP1A 5A3XA 1OL2A 4GMYA 3UNZA 2JAMA 4AW5A 3U6JA 3VC4A 4BDAA 3FLNC 1Q8TA 2HK5A 5F4NA 3KXGA 2QQ7A 3DB8A 3F61A 4MF1A 3UC3A 3MBLA 5CTPA 2R3KA 3BYUA 4QP4A 4TYEA 3UPZA 2NYAA 4BDEA 3F3WA 3WYXA 4AE6A 5AR4A 2PVJA 2YA9A 3AMAA 5ICPA 4BFMA 3FEGA 1WBVA 5J79A 4Z9LA 3FAAA 4QD6A 1VJYA 3DQXA 3K3IA 3DCVA 4JDIA 2YJRA 4JLCA 1PXJA 3L8PA 4XP2A 5DH3A 4QTDA 4EQUA 1KUTA 5DBXA 1Z57A 2FA2A 1PXLA 3MV5A 4OTRA 1BMKA 5TR6A 3FZPA 3QTWA 4QO9A 4D55A 3MESA 4BB4A 3KVXA 3AD4A 2WFYA 5TE0A 4J99A 2X0OA 4L8MA 4APCA 4Z55A 4Z7HA 2BZKB 2ITZA 2CKOA 4HYSA 5DVRA 4FTCA 2R64A 3SX9A 3ZRLA 1GZOA 1JVPP 2Z2WA 4XOYA 4JR3A 5AV2A 4E20A 3QCYA 4ACDA 1WBNA 4IAZA 4WO5A 4XBRA 2B0QA 1QPCA 3QHRA 4FTIA 5AR7A 5C27A 5LVLA 3DAKA 4JI9A 5F1ZA 2QOHA 3KEXA 3D5WA 3DFAA 3U55A 3A7JA 3PJ2A 5FG8A 2WO6A 3HYHA 4FIGA 1OUYA 4MXAA 2C6DA 4AF3A 4W9XA 3F3TA 1SZMA 4FVQA 1PMNA 5C26A 2RSVA 5BYZA 4OTFA 4MVFA 4U3YA 2JC6A 3I0OA 5D1JA 2GS2A 5HQ0A 3D7ZA 4DEAA 4G3DA 5HIDA 5IA2A 1Q24A 4DEGA 4LL0A 4DHZA 1YXVA 1KE9A 4FV0A 4HZSA 1MRVA 3TIZA 3F69A 2W5AA 4U7ZA 3GB2A 3I4BA 2PVRA 4FSYA 3BHHA 2C1BA 2F49A 2X7FA 4J8NA 5EYMA 5HBJA 4AACA 5KBQA 4A07A 4O7NA 1YOLA 3EN6A 3PA3A 4W4VA 2WHBA 4Y8DA 3ZH8A 4GVJA 4XS2A 1HCLA 2VTJA 5F9EA 4ZJJA 4N0SA 3ZTXA 3FKNA 4I6LA 1SM2A 5I4NA 4H58A 2W05A 3SW7A 4FUYA 3KXMA 3ZUVA 3B8RA 5GJDA 4CMOA 3DKGA 2WELA 3QRJA 3RBWA 2PMLX 2Y6OA 3GI3A 3RK9A 4F7NA 4ENYA 3V8TA 4U80A 4N6ZA 3KVWA 3MVHA 1Q41A 2GNLA 1T45A 5E92A 2UZWE 2OSCA 4S31A 3LXPA 4MXZA 1IAHA 2JDTA 3UC4A 3OCTA 2WB8A 1XMMA 4MXXA 4ZTLA 4GUBA 4EOIA 3WF6A 2WMQA 1MUOA 3L8SA 4G9CA 1YWVA 4L42A 4II5A 3HMMA 4QTAA 5EOBA 5JT2A 2XVDA 2QG7A 3FYKX 2BDFA 1OB3A 2VAGA 4F7LA 1YDTE 1SMHA 5B2LA 4YJOA 1J1CA 4A9YA 4JNWA 2YWPA 3R00A 5B0XA 1GIIA 3LFCA 4CYJA 4MWHA 3QC9A 1YVJA 3W55A 3FXXA 4QP3A 2O64A 2XZSA 1Q8UA 4EOLA 4FEUA 5GJFA 4EOJA 1CTPE 4QQTA 1MP8A 4LOQA 3ZRMA 4QPSA 3NNXA 1JKSA 2YM8A 4O7RA 2CN8A 5KKRC 2ITOA 4F9CA 2NRUA 1QCFA 4O0RA 2ZB1A 1B39A 2HY0A 5B2MA 4CVAA 5HG8A 3LLAA 1VEBA 3NIZA 3W2OA 4BIEA 5FDPA 2C3JA 2W0JA 3ORLA 4JJRA 3A62A 2CKPA 4OUCA 4QNYA 4GK4A 4O7LA 5AR5A 2OLCA 3U6IA 5DI1A 2J90A 3BEGA 4IZ7A 2R3IA 3ZLSA 4ASZA 4C57A 4TW9A 3H30A 4E5WA 3QLGA 2IVUA 3WIKA 2C47A 4QTCA 2EXEA 5KCVA 3Q3BA 4C62A 1ST4A 3FXWA 3NPCA 2QONA 4ZP5A 3CD3A 3RGFA 4EWQA 3ML1A 3CQEA 3QTQA 4AXFA 4OTQA 5IH4A 1V0BA 2WOUA 3HMPA 4XG8A 3FLYA 4C4GA 1H24A 2V7AA 4HYHA 4AG8A 1OL5A 2I0EA 3FL5A 3QX2A 4FRFA 4O0SA 2LGCA 5IQGA 4IANA 4DE4A 4WIHA 4APPA 2XS0A 3RM7A 3SAYA 1KSWA 2CJMA 4G16A 3E62A 3PPJA 3F88A 3S95A 4YBJA 2W1CA 5HVJA 4IVCA 4OTHA 4JX7A 4AQCA 4YC3A 1ZWSA 2EVAA 2XH5A 3GBZA 4DH5A 5IQCA 5AJQA 3NUUA 4E4NA 4FV9A 4RIYB 3D2IA 4QYGA 1G8KA 4ZLYA 4O7WA 3FQSA 3ZOSA 4O0YA 4RIXA 1OKVA 2C6MA 1ZMVA 5D41A 3MI9A 3ZM4A 3ZSGA 4ASEA 4BWKA 3QCSA 3ZSHA 5E90A 3PXRA 3LVPA 2H9VA 2C69A 2XYNA 2F2CB 4IZAA 4J97A 3AGLA 4I6BA 3PY3A 4NFNA 4DEHA 1Q97A 3VW8A 4NH1A 4BYJA 3V5WA 2VWXA 3QTRA 1FGIA 5J9YA 4QQ5A 4BY9E 3C1XA 3FZTA 4FV6A 3BBWA 4O81A 1OITA 2XIRA 1H0WA 1WBPA 3LPBA 5ANEA 3T9IA 4O7YA 4CKJA 3UTOA 3R71A 3DDQA 2HWPA 3IW5A 4EQMA 4I41A 2GFSA 3QZFA 4MEDA 4IC8A 4QMYA 5A14A 5IMXA 5AX3A 2BR1A 3WZDA 3OZ6A 5E1EA 5JFWA 4M15A 5K3YA 5DA3A 5HKMA 2EUFB 3ZO3A 4QDEA 3UZRA 4D2TA 2ZV9A 3NR9A 3GFWA 3MWUA 4TYGA 4Z16A 2PYWA 3S1HA 3DOGA 2CDZA 3FKOA 3LXKA 3OTUA 4O4BB 1A9UA 3HDNA 4KD1A 5TKDA 4FKGA 5CI6A 3QUDA 1ZYJA 3QQLA 5EHOA 4D9UA 3IW4A 4EC8A 4X2NA 2FSTX 3PXYA 4R5SA 5LMKA 2PTKA 5AP4A 3R1QA 2X6DA 4FTNA 4BZDA 5I9VA 3OS3A 1KE8A 4KIKB 4NU1A 4FIJA 4IZ5A 1IEPA 2FVDA 4L44A 1KE7A 3EQHA 1J3HA 3MY5A 1VR2A 4NW5A 1PXMA 4ITHA 3TACA 4JAJA 1AGWA 1PKGA 3UNKA 4DGNA 2UZNA 5CSVA 1V0PA 2PK9A 3TWJA 2BRHA 3DPKA 2CPKE 3GXLA 4DG0E 3PY0A 4GYGA 3UODA 3DTCA 4XV2A 3GCSA 3W32A 3AT3A 4XH6A 5EI8A 4JBOA 1FINA 3EN7A 3EFJA 4DLIA 3DLZA 4RX5A 3NFFB 5BX0A 3GUBA 3BE2A 1JQHA 4GU6A 4D4SA 1P4OA 3A7GA 4UBAA 4FT9A 4XRLA 1OBGA 5IQAA 5K4JA 4XRJA 3AKKA 4AW0A 4XJ0A 2WMRA 2R3HA 2UW9A 3RAHA 3PP0A 2CHLA 1CM8A 5C01A 4BWPA 3VS2A 5CF8A 2BRGA 3LJ1A 1W83A 1KWPA 4AGWA 2R0IA 5IQIA 2V7OA 4MD9E 5HNGA 3KL8A 5AWMA 5HBHA 3W2PA 4A9TA 2R3OA 3BHUA 4DF3A 4CZUA 3GU5A 4IAYA 2YEXA 2XRWA 1U5QA 4ALWA 4DEIA 1REKA 3GT8A 5I0BA 3QFVA 4TZRA 1XH8A 4XEYA 4RSSA 3DQWA 3TJCA 3VJNA 1Y8GA 5AP1A 3BIZA 2XK3A 1OPKA 3AG9A 2ESMA 2O63A 3QA8A 4O0XA 1JNKA 2BFYA 4QRCA 4RC2A 2OF4A 3QYWA 4RX9A 5ANKA 3UO4A 4UMPA 4YTCA 5C8KA 3E87A 4QT1A 3RHXA 1UU9A 3FBVA 3R22A 4AQKA 5EI6A 2QVSE 2F7XE 1Q3DA 2Z7QA 1NA7A 3F3VA 3HDMA 3Q4UA 4Y85A 3ZMMA 2QLQA 1O6LA 2WQNA 4C4EA 3P79A 2I7QA 4YZDA 1CMKE 2YISA 4X3FB 4I22A 4DGMA 4B4LA 3RNYA 2Y7JA 2HWOA 3DS6A 4RGJA 1E1XA 2ITUA 4OBOA 4IW0A 2XYUA 3SD0A 4DDGA 5DEWA 5H8BA 5IA5A 4BCIA 2XF0A 4R78A 5BQ0A 2NPQA 2XCKA 3QALE 4CCBA 3G0FA 2VX1A 2OJ9A 3FMDA 2UW3A 3OOMA 4FV7A 4NZWB 1A06A 4AA4A 3V5LA 1YHVA 4V04A 3A2CA 5IUHA 2ETKA 4DT9A 4GJ3A 4WSYA 1OIRA 3ZFMA 4RLLA 3ZHPC 5KHXA 1ZOEA 3UIMA 4DEEA 5ITAA 5E8SA 4BBFA 4KINA 2ZM1A 3CJGA 3G0EA 4G3EA 3QD0A 4ZZNA 4JBVA 3CJFA 3R7UA 3JVSA 3DZOA 3QD2B 1YHWA 2JBPA 3EHAA 4J52A 4YHJA 4BL1A 5CAOA 5E8UA 4M13A 3F66A 5AAGA 3NWWA 2C5NA 2WTCA 4BCQA 2ERKA 4D2VA 1PKDA 2YIXA 4ANOA 3HUBA 3FLQA 3GU8A 4V05A 5IUIA 4L67A 3E88A 5LCKA 4W4YA 5IH6A 1L3RE 2OJIA 1GZKA 5AV0A 3JPVA 4PQNA 3T8OA 3ALNA 1PJKA 4LMNA 5G6VA 4GFOA 4ZMEA 3QRTA 1XH9A 3KRXA 4WUAA 3W0MA 2FO0A 3UO5A 4S30A 3TUDA 2ETRA 3Q4CA 1GOLA 2KTYA 1OUKA 4YTIA 4HGEA 1YQJA 3CD8A 1QPDA 5DWRA 3OUNB 2WMXA 2R3JA 4IQ6A 4YR8A 2XKDA 1H07A 4LRMA 4EOKA 3O50A 3RVGA 4D9TA 4X21A 4P5ZA 4IHPA 3KXZA 4FEVA 4ZTMA 1IRKA 3W1FA 3LCOA 4IB0A 4IWDA 3F2RA 3U8WA 3QQHA 5EKNA 3G51A 4DTBA 1G5SA 5J9ZA 5AIRA 2XNBA 2A27A 5HG5A 4EHZA 3EFLA 5BUJA 3D94A 3WE4A 3TV4A 2VV9A 3AC8A 4NEUA 3GEQA 4XX9A 4XUFA 5KE0A 4GJ2A 1U59A 5ANGA 2VTHA 1OL6A 4QYHA 3R7EA 3PFQA 3NGAA 3Q04A 5DT4A 4ANQA 4YO4A 2Y4IC 3WF5A 4BIDA 5EYCA 4C34A 4C37A 5E1SA 4IBMA 3R8UA 3KK8A 4PP7A 2IVVA 3DLSA 4PL4A 4KIOA 3OD6X 3BHYA 4IAIA 2VO3A 4FTMA 1KV1A 1YXUA 2V5QA 4J98A 4OAUC 2BHHA 3P7AA 2Q0NA 3PUPA 5E8YA 2WQBA 4H05A 4O7SA 4L3JA 4U9AA 2C5OA 4NM0A 3PXZA 3PSCA 4FTJA 2UUEA 2IJMA 3G33A 4OTDA 3V6RA 1FVVA 2JKOA 4EOOA 3A60A 3FLWA 3QTZA 1ZY5A 1YXTA 2VWIA 3QUEA 3VUKA 3TNIA 3ZS5A 3UJGA 3TV6A 3U4WA 3CTQA 2W96B 5AIKA 4R77A 4G3CA 5AV3A 5FD2A 3NNWA 3ZCLA 3FSFA 3DKFA 4Y83A 2QOKA 4IDTA 3SDJA 3GCPA 3GC9A 4JBQA 4PMMA 4NCTC 5HI2A 4HNFA 4QP6A 4YP8A 4F64A 2VGOA 4AXAA 2OI4X 2Z8CA 4FV5A 2J0JA 4DG2E 5ETIA 3UYSA 5ETFA 4IB3A 3O8TA 5FUTA 2JIIA 4FKIA 1QMZA 4UXLA 2OK1A 3MB7A 3LFDA 4J1RA 5HICA 3UVRA 1SNUA 4NUSA 2F7EE 4JDKA 3BL9A 3LFSA 4YC6A 3HV3A 5M4FA 1M2RA 3NW6A 1GZ8A 4BZNA 1VZOA 3SHEA 5BVOA 3JS2A 4GK2A 4J53A 4NM5A 3P78A 4FV1A 4WOVA 5L2IA 5L6PA 4GKIA 1Y6BA 4KBCA 2YIQA 5M44A 3V5PA 5HZNA 3TDWA 4X0MA 3UVQA 3VBXA 3VBVA 5L2WA 4U42A 4RX7A 4IWPA 3WOWA 4PY1A 4TWNA 5L4QA 4UZHA 1NVSA 3HMNA 2XA4A 4FSWA 4O6EA 3TDVA 1TVOA 3RZFA 4RZVA 4GH2A 4D4YA 5JK3A 3PDTA 5GINE 4I6QA 3R8MA 4C3RA 4XG7A 5H2UA 3TZ9A 2GHLA 4PPCA 5AP6A 1ZYCA 3MY0A 4O38A 5T6KA 4DYMA 4FTRA 4BDGA 1TQIA 3TNWA 4AUAA 5IU2A 4GVAA 1XJDA 4BJJA 2PE1A 5EM5A 2OFUA 4IVAA 3R7IA 3ZEWA 4YSMA 1YDSE 2IW9A 1F0QA 3QHWA 4F1OA 4ZLZA 3RINA 3BQCA 4O0TA 3QTSA 4XG3A 3PA4A 5LMAA 2XBJA 1G3NA 3QTUA 2WIHA 3TI1A 4PDSA 1YWRA 2ZV2A 3AC1A 4PMSA 2ITQA 4TWPA 4WNPA 5DR9A 5IQFA 3FDNA 3TMOA 4S33A 5DRBA 3OHTA 3RPOA 2CGWA 4F4PA 2BAJA 5AP3A 4WNMA 2CGVA 3V51A 4CFVA 4D1XA 5IA1A 4ZTSA 2OICA 1ZLTA 2XM9A 2YCRA 3CKXA 4EH6A 5M4IA 4CTBA