3LPBA

Crystal structure of jak2 complexed with a potent 2,8-diaryl-quinoxaline inhibitor
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
290
structure length
278
Chain Sequence
TQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery and SAR of potent, orally available 2,8-diaryl-quinoxalines as a new class of JAK2 inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 278
sequence length 290
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2010-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3lpbA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3lpbA01
4XV3A 3PE2A 5T3QA 3R7GA 3HRCA 2WTVA 4FNWA 5HD4A 2QKWB 2PVHA 4H1MA 4O83A 3ZRKA 5EM5A 3B8RA 5FXSA 3ZEWA 4N4SA 3BLHA 3FZPA 3MVLA 5AR4A 4B99A 4MBJA 5AV1A 2B7AA 4RJ6A 3VS6A 1B38A 1SMHA 2BKZA 2HYYA 1M7QA 2IZUA 5T68A 4NJ3A 2R3IA 3FBVA 5AP1A 4ACHA 5LJJA 5LQFA 5HEZA 4AT5A 3FMMA 1QMZA 1Y8GA 4OT5A 4G1WA 2QOFA 3QKMA 2QONA 3V5QA 2XH5A 4QMTA 2PMIA 5HCYA 4J7BA 3ROCA 1UA2A 4DE4A 2V62A 2CKQA 1ERKA 4A4LA 1H01A 5EDRA 4RA5A 4KUJA 3VUHA 4TWOA 2NPQA 3GCVA 4XG2A 5CZIA 4KIKB 4UWCA 2YACA 1H24A 4TYEA 4Y72A 2E9VA 4E5AX 2QOCA 3CC6A 1W7HA 1PF8A 2UW4A 5B2LA 2E9UA 3D15A 1APME 2OZAB 1Q41A 2R3FA 2ZM4A 3F61A 5HG8A 3LPBA 1ZYDA 4V05A 3JPVA 3L8SA 4DITA 4E4LA 5L4QA 1J7UA 2BIKB 3BHUA 5LVNA 1G8AA 3VUKA 4BCFA 3EQHA 2OFVA 4E6DA 4QOXA 2X81A 3IKAA 4GS6A 3QQLA 4IX6A 4K0YA 4B8MA 5I9UA 3KQ7A 4F63A 3FHRA 3OXIA 4QMZA 5CQUA 5M56A 2A27A 3HMNA 4FSYA 4ANNA 4HNFA 2WTWA 3AC2A 4JQ8A 2Z7RA 3QD3A 4FTMA 4FI1A 4YHJA 4RIXA 3WARA 4Z7HA 2Z2WA 3LW0A 4UWBA 4BHNA 2WXVA 4QTAA 3AGLA 5AP6A 3OW4A 4AXAA 2WO6A 1YW2A 4FT5A 3NUAA 4F0IA 4PPBA 4L01A 3KRXA 3UYTA 3HZTA 3OW3A 1Q8ZA 5JZJA 3Q6WA 2C5VA 4EJ7A 3PJ1A 3NNXA 1MRUA 4RFMA 3FQSA 4FK6A 4JAJA 1ZOEA 2CKOA 3FLWA 2X4FA 2VWUA 3QQUA 5JZNA 3BBTB 3QZGA 5E1EA 5KMJA 5FEEA 2YN8A 4MHAA 2ITWA 3IW4A 2PMLX 2PMOX 4YSJA 4FL3A 3CJGA 5GHVA 1O9UA 4IX5A 3ZMMA 2V22A 2W96B 4AN3A 1Q8TA 4MCVA 5DRBA 5CEIA 1OBGA 5FP6A 3UO6A 3TV7A 1U46A 3NYVA 4P7EA 5E7RA 3TJDA 4BRXA 5A4QA 4X2NA 2PUIA 2CN5A 4FTLA 3FUPA 2KTYA 5CENA 3BU3A 1OB3A 5CEQA 3JXWA 3QTZA 3C0GA 4YBKA 2YIXA 2G1TA 1P5EA 4C7TA 2WMUA 4CKJA 4RLLA 5FG8A 3LVPA 5B2KA 4BWPA 2GS6A 3KRWA 3N4VA 4FKWA 5M51A 3GC8A 3BI6A 2R3PA 2QOQA 3HDMA 2Z7SA 3L8XA 5TF9A 3WBLA 3G9NA 2YM7A 3F3UA 3NNUA 3PZEA 4QMQA 4QTCA 5EQYA 4GFOA 4GW8A 3KULB 4JL9A 2Z7QA 4U41A 5TO8A 2QOHA 1XH7A 2IG7A 1WMKA 3OTVA 3KK9A 4GFGA 1V0BA 3ORZA 4M0ZA 2X9EA 2VZ6A 3AT4A 4XH6A 1J1CA 2XK8A 1OIYA 3WOWA 3MA3A 3KULA 3ZM4A 4UYNA 3JY0A 4BDFA 4BTKA 4AX8A 4YJTA 5EHOA 3ID6C 4X3FC 2OF2A 4BKYA 4M8TA 5DT0A 2A19B 3Q9XA 4AGWA 4EQCA 2VNWA 1FOTA 3KMWA 3SQQA 4PY1A 1WBNA 2YIQA 3PXQA 4I5MA 5AUYA 1URCA 3WE8A 3ZCLA 5K4IA 3KMMA 4EK8A 2PHKA 3H4JA 3HYHA 3ZLXA 4WBBB 4WG3A 1M2RA 2YCQA 2ZB1A 2UW8A 3CR0A 4JIAA 2FSLX 4TT7A 4F65A 3PJ8A 3P7AA 3FLQA 3SW4A 3OEFX 2WMVA 5GIOE 4FEWA 2UW0A 4L00A 5CSVA 2NRYA 5E90A 2H34A 1H00A 5G6VA 3ORNA 3WZKA 3Q4TA 4E4XA 5IU2A 3R02A 4ZJJA 2J0MB 4G3FA 3S2PA 3ZC6A 4CRSA 2XNEA 5CNNA 1WZYA 2E2BA 3LCSA 1H0VA 5BVOA 3RZFA 4P2KA 3LFBA 4RC2A 5ANEA 3EN4A 3AT3A 4FEVA 5D1JA 2CKPA 3QHRA 4HGTA 4RMZA 4F0FA 2WELA 2VNYA 3NIEA 5H8EA 4I5HA 4CV8A 2R4BA 2XA4A 5F20A 4AFJA 5HG5A 5CANA 3PXZA 4GT4A 3LKMA 1H28A 4ZTRA 4IWQA 3PTGA 4IDVA 5C1QB 2IZRA 5DVRA 4XG3A 3TIYA 1XH5A 2PVMA 4LV8A 2HOGA 4MTAA 1JNKA 1ZMUA 4G3DA 5JEBA 2BRBA 3KKVA 5G1XA 5BUJA 3A7HA 4G2FA 3ZUVA 2H6DA 2ZMDA 3D7TB 4RA4A 2O5KA 3FI4A 4EBWA 4F7JA 4MXYA 2YIWA 2B55A 3ALOA 4ZZNA 5EFQA 1AQ1A 5HORA 4ASEA 2BRNA 3KXHA 4KA3A 5L2IA 1XJDA 5HI2A 2HCKA 3NVKI 2CGWA 4F9CA 2OH0E 1G5SA 4GKHA 3KCFA 1GIIA 2W4JA 4CFFA 4TWNA 3QTQA 1ZLTA 3H9RA 1H26A 4NIFB 4M12A 1DM2A 1UWJA 2CGXA 2NP8A 4AW0A 3LZBA 1UWHA 4J53A 4LRMA 2XNOA 3GP0A 4QMWA 1YWRA 3OCGA 4NKAA 4C0TA 2VTIA 3LMHA 2P55A 3BZ3A 1Q61A 5CAPA 2C0OA 4M0YA 4PTCA 1GIHA 1UVRA 3FI3A 4NIFA 4G6LA 5HO6A 2C30A 4YLKA 5TR6A 3S95A 3Q6UA 3PXYA 2W0JA 2G2FA 2QU5A 3Q96A 2QNJA 3A7JA 3PPZA 4MH7A 3R1YA 5E8UA 2VTTA 5IZFA 5FTGA 3AMBA 4NM5A 5FP5A 3FL5A 4W9XA 2RSVA 1YXSA 3VBXA 4DH7A 5FXQA 4XG6A 3MVJA 5J7HA 1OL7A 1OKZA 1ZMVA 3FY2A 3NEWA 3LFCA 5IEXA 2VUWA 3FZRA 4ERWA 4O86A 4D2SA 1OL6A 4RIWA 4NM3A 3FQHA 4C38A 3DZQA 1NVRA 3QTSA 3U6HA 4FKUA 4L8MA 3FL4A 3CEKA 4M7IA 4Y83A 5E9EA 4U3ZA 3OOMA 3MJ1A 1GZKA 3P7BA 3PLSA 4GFMA 3FMKA 3EL7A 4AN2A 2O65A 1ZRZA 2IZTA 4GVAA 5BPYA 4F1MA 4I93A 4CG9A 2WIPA 1KUTA 3S0OA 3O50A 4O7RA 4YNOA 5LCJA 4G3GA 2DWBA 5KUPA 3KK8A 3OC1A 4W4YA 2XRUA 4WSYA 1UKHA 4FKRA 2PVLA 4KIQA 1FMOE 2XKFA 3U6JA 4E4MA 3GCUA 4CFWA 3R2YA 5ANJA 3U9NA 5LWMA 1Q4LA 2CNQA 3RKBA 5KE0A 4ZTSA 2UZBA 4C4IA 3GENA 4O0TA 3LM5A 3QRTA 4L45A 3ENMA 4IIRA 4O0XA 1QPCA 4WOVA 4TTHB 3UNKA 3AC1A 4NSTA 5IQEA 4RVTA 3MJ2A 2F57A 2XBAA 2JAMA 3KXXA 5IA1A 5ICPA 4CQEA 4U79A 1KSWA 4NKSA 3F9NA 4O2PA 4PNIA 1SNUA 4FVQA 4F9YA 2R3OA 2W1FA 5DT3A 3VS5A 3IG7A 3DXPA 2AYPA 2GS2A 2W9ZB 4IAAA 4O7SA 3IS5A 4BCPA 1H1RA 3UQFA 3KL8A 4MBIA 2BZIB 3EZVA 4II5A 3KGAA 2R5TA 3IDCA 1XBBA 3PVUA 4X6RA 1GZOA 4BKZA 3QYWA 3GFEA 2WQEA 4D2PA 4DEHA 3HMPA 2QOOA 2PY3A 4EOIA 3IGOA 3IPHA 5K0KA 4WG5A 3NRMA 2WMXA 2HXLA 5CS6A 5FEQA 3DV3A 4W8EA 4YU2A 4TWPA 1FMKA 2OWBA 4GUBA 3F69A 4GU6A 1PMUA 1FGIA 4DA5A 1GZNA 3HRFA 3P1AA 3SA0A 3UQCA 4D9UA 3A61A 4UV0A 1XH4A 4FSMA 5HTBA 4N57A 3O8PA 3QL8A 4PMTA 4UZHA 3NW7A 2J6MA 4PRJA 4EONA 4EHZA 1ATPE 3VUIA 1OL5A 4I0TA 1WBTA 3V04A 4AZTA 5CALA 3FI8A 2FA2A 3P5KA 3E93A 4WT6A 2J0KA 4HYSA 4S34A 4HVHA 3MY0A 3EB0A 4ZK5A 4R8QA 2VX1A 5EYCA 3VF9A 4DEDA 4OTHA 1PJKA 3CTQA 4O2ZA 3V5LA 2GMXA 3OTUA 4KD1A 2JITA 4WRSA 2JDTA 2JIVA 4DYMA 2QO7A 5FTQA 1DS5A 2GHMA 4LOPA 3F3ZA 1G3NA 5ANDA 3NS9A 4DGNA 2QURA 5C01A 4JNWA 4NW5A 2W1EA 4N6ZA 4U81A 4CFMA 4A4XA 3A8XA 3ANQA 4OTPA 2OGVA 2YERA 4YJPA 3VIDA 5HU9A 2WOUA 3RGFA 2PK9A 5H3QA 4BI1A 2XJ2A 4AZSA 5H2UA 3M42A 2C69A 2E9PA 2XUUA 1PYEA 3C13A 4FTQA 4YMJA 4EK6A 3QTIA 1FGKA 2V7OA 1REJA 1Q8YA 3COKA 4HCUA 3ZUTA 4BVUA 3ZHPC 3DKOA 4HGSA 5AWMA 4BGGA 1G8SA 1S9IA 2VWWA 3UNJA 3PVGA 3LJ0A 5D12A 3RCDA 4D9TA 5JQ8A 5KCVA 4BFMA 4D4RA 2DS1A 3GCPA 2BFXA 2VWXA 4O1OA 3THBA 4TN6A 5JMSA 3GC0A 2X7OA 3A4OX 3O2MA 4FV2A 1U4DA 2QODA 3VBTA 4L52A 4A06A 3VHEA 4E26A 2ZJWA 1PXKA 3RI1A 5KMMA 1VR2A 1Q5KA 4GK2A 4FT0A 2GNIA 4R78A 2WMQA 4EORA 1BX6A 1PXNA 3U6IA 1FINA 4AW1A 2WQNA 5DFPA 4U6RA 1MQ4A 1ZOGA 4WG4A 3GOKA 3OS3A 4MD8E 1Y6BA 3B2TA 4NCTA 4QTDA 4EOOA 3WZJA 2CNVA 3NUPA 4FX3A 3UP7A 4U7ZA 4IWDA 4CGAA 3DZOA 3FLNC 3W8LA 2UW7A 4WUNA 4N0SA 4FTUA 4O0UA 4APCA 5DOSA 4ZS0A 5EDPA 3ERKA 5J5TA 2B9JA 3TZ8A 2UV2A 4V0GB 4C2VA 5IA5A 1XH9A 2G2IA 4G5JA 4QYGA 4HYIA 3ZTXA 4F08A 3O23A 1JKTA 2W17A 1XH8A 4U9AA 3OXTA 4CXAA 1OL2A 4ENXA 3SD0A 3UVRA 4RJ8A 1U5RA 2BAKA 3Q52A 1JKLA 1LEWA 3OMVA 4NZWB 5CSPA 1SNXA 2UZEA 2QCSA 3W55A 4AA4A 4V0GA 2I40A 1IAHA 5ACKA 4KWPA 4R7BA 3LAUA 4K11A 5L2QA 4BDGA 3NW5A 1R3CA 3KC3A 5AV3A 4F09A 4FZ7A 4QYFA 2X2MA 3ORIA 4XP2A 2J0IA 4ITHA 4Q9SA 2QG7A 2VTQA 4MNEA 5AUTA 3BHVA 4YC6A 1PKDA 1Q97A 4KAOA 2JEDA 3NVMB 4IM0A 4O7ZA 4RJ3A 5D11A 3D7ZA 2IN6A 1JQHA 2VX0A 1KE6A 2I0VA 4ENYA 3SLSA 3CD3A 3PY0A 3PP1A 4IVBA 5CF4A 5HX6A 3KREA 3UVQA 2W05A 1PMNA 2R0UA 2W1CA 4C3PA 3AMAA 4RWJA 4CD0A 2FSOX 4M3QA 3BWJA 3F7ZA 3KXGA 3ORKA 4I4EA 2Y6MA 4QQCA 4DG0E 4QMPA 4XG9A 3RAIA 1WCCA 3DU8A 2HWPA 4YJUA 3SRVB 4RT7A 4PTEA 2R3RA 2GU8A 3ZZEA 4JRVA 3WE4A 1KV2A 2OF4A 4UX9A 5LVMA 4O82A 3LLAA 4RRVA 4MX9A 1OBDA 3D5XA 5ETIA 4F0GA 3G0FA 3P4KA 3EHAA 3FMNA 3A2CA 4Q2AA 2VGPA 5KMLA 5HIBA 4XX9A 1E1XA 2XJ1A 4FNZA 2BTRA 1YHWA 2EB3A 3Q2JA 4KBAA 4FKTA 3QLFA 3R1SA 2WQMA 5LVPA 3E8NA 5LVOA 4S2ZA 3DK6A 3C1XA 3FYJX 3KN6A 4O38A 4WNOA 3VBQA 3SKCA 3BWFA 5BVFA 2EXCX 4EC8A 4J52A 3E7OA 3G51A 4IAYA 5AP2A 1OKVA 2PTKA 2IW8A 3UVPA 2OJFE 3LFFA 4CVAA 3ZBFA 4RJ5A 3UG1A 3FSKA 2O2UA 4CCUA 3V3VA 4OGRA 2IVSA 5CXZA 2ITNA 2OXXA 4G3CA 3PSBA 2YCFA 2CCIA 3GT8A 4BYIA 4EK5A 5HO7A 3BGZA 1PYXA 2EU9A 3QX4A 4F6WA 5A54A 2WTKC 3QRUA 3UYSA 2BFYA 4QP6A 4RJ7A 3DQWA 3BKBA 3QZHA 4DGLC 5GZ8A 4BI2A 4O1PA 2HZ0A 3BYMA 3CE3A 4B8LA 4DHFA 2Z7LA 5IQFA 3R22A 3Q4ZA 3TZMA 5CVGA 1WVWA 2WB8A 3FMLA 2P33A 3EKNA 4ZZMA 3ZFXA 2QKRA 3LMIA 1H27A 5CYIA 3KFAA 4QYEA 3OF0A 4KSQA 2XEZA 4FGBA 3DLZA 5BMMA 3OY3A 5AIRA 2YAKA 4EOMA 3PFQA 5AV4A 4PMPA 4ZTNA 3VULA 3QALE 3AD4A 1ZAOA 5M44A 4G31A 5I3OA 2XVDA 4CQGA 4FSTA 4C33A 1GZ8A 1WBPA 2R3KA 4WKQA 5FTOA 5HIDA 2CGUA 2J9MA 4MNFA 1YDRE 4OBQA 3UO4A 2UZWE 1BI7A 2Y0AA 4FYNA 5IMEA 3GVUA 1T46A 3R8UA 4J8MA 3FLYA 3PSDA 5EW8A 3D14A 1OZ1A 5CF6A 4DT8A 5J1WA 3VAPA 4BGHA 3H0ZA 1JSUA 3G33A 4U3YA 2XNNA 2QHMA 4FEUA 3KMUA 5HIEA 4O7NA 2CMWA 4KABA 4E3CA 4FSNA 5L6PA 3CGOA 3M2WA 2B0QA 3DGKA 3TL8A 2OSCA 5E92A 3HMIA 5HNBA 3NPCA 2JD5A 4M67A 4FIIA 3MGYA 4GUEA 3Q3BA 5ACBC 3F2NA 1K2PA 5L8KA 3DBCA 2X8DA 2XK9A 3QYZA 2UZDA 4O7WA 3FZTA 3OT8A 3QFVA 3ZO3A 3C0IA 3BX5A 4KKGA 3E8CA 3LFNA 4LV5A 5FLFA 3A8WA 3IK3A 3UIUA 4DTKA 2J0JA 4XG4A 3UC4A 3MSSA 1UU3A 4U45A 3F7WA 4L3LA 3QCXA 1Z57A 5HKMA 4DCEA 4ID7A 3O0GA 1Q24A 4GJ3A 3D5WA 5CAQA 3QRKA 3Q04A 3RPRA 3I5ZA 4EOKA 4EQMA 1DI9A 4EWHA 3PJCA 2OJ9A 3FKNA 4QQJA 5AM6A 4MF0A 2XB7A 2GQSA 4QT1A 4BDEA 1JBPE 2C6LA 3ZFYA 3EJ1A 5L8LA 4FKGA 1JLUE 2NRUA 4RJ4A 3UC3A 4QYYA 3P78A 5BVKA 3ZO1A 2GQGA 4CTCA 4XLVA 4AGCA 2QC6A 2X2KA 2P0CA 5HLWA 3JVSA 3QHWA 2C4GA 5M4FA 3Q4UA 4BZDA 1WBVA 4AT3A 4LQMA 3I1AA 3HA6A 3VS2A 5IA3A 5HVKA 2HZNA 3PVBA 4WHZA 2HW6A 3PYYA 1O6YA 3NZ0A 3AC8A 3GBZA 2R3JA 3KVXA 5IH4A 3S00A 3RAWA 5E8SA 3T8OA 5IEVA 2JKKA 4BCOA 4X6QC 2PVRA 4F7NA 5DWRA 4FV0A 4D1SA 5TKDA 2VTRA 4ZJIA 2EXEA 2LAVA 1J1BA 4MK0A 3NMUF 5FD2A 4KBKA 1QCFA 4X3FB 1YXUA 5HVJA 5AP7A 5LMAA 3RINA 4IAZA 3W16A 4XBUA 4RG0A 3IW7A 2VTMA 2CKEA 3VRZA 3TKIA 4TXCA 3EN6A 2UUEA 4LMUA 3AC4A 3ZXTA 3RAKA 2ZYBA 3DJ5A 3HECA 3KXNA 2GNHA 3QXPA 4YJSA 5F1ZA 4WNKA 3W2OA 2EXMA 4MXOA 3UJGA 4AU8A 3NCZA 3WZUA 4FE2A 4JDJA 2JDSA 5IDNA 4YBJA 1URWA 3HV4A 5D41A 4JG8A 4KINA 4K6ZA 4Z55A 4M68A 3VUDA 4RFZA 3ULIA 1NVSA 5FEDA 4C02A 1HOWA 2Z02A 3KRRA 2IO6A 3DKCA 3NGAA 3W2PA 2ITTA 4HPTE 5CT7A 3F2AA 3HGKA 3FKLA 3OBJA 3UG2A 4B6LA 5B2MA 1YI3A 5IA4A 5HCZA 2ZB0A 5M06A 4UEUA 4RIYB 1FVTA 5A46A 1JVPP 2OJJA 3E8EA 5HO8A 1M2PA 3FHIA 4KIKA 4D5HA 4FT7A 4JDIA 3DAKA 3ZYAA 2O3PA 4QMSA 3V5TA 5EH0A 3E5AA 5KKRC 1JWHA 2PZPA 3GC7A 2R7BA 3HV6A 2REIA 2OZAA 3QBNA 4RIYA 2C1AA 2XM9A 2W4KA 2Y7JA 3QD0A 3RWPA 4ORKA 4IVAA 3FPMA 1U54B 5K0XA 5AUXA 2BCJA 3AQVA 4PX6A 4YPSA 4O96A 3VW8A 3VS1A 3PSCA 5A4LA 2BVAA 3PY3A 4IANA 4UYAA 4DEGA 5CSWA 2BPMA 3BGPA 1MP8A 4XG7A 4ITJA 4S31A 4ZP5A 5E1SA 4UMPA 3E3BX 2UZLA 3GNIB 2H8HA 4KS7A 5AR8A 4BZOA 2ITVA 1YOJA 4CNHA 1U54A 4M14A 4G6OA 4F6UA 3SVVA 2OH4A 2XIXA 3I6WA 2GHLA 4RWIA 1ZXEA 1Q3DA 2X4ZA 5HG7A 5CXHA 3FZOA 3R2BA 4L6QA 4R3RA 4GK3A 4ASXA 3OOGA 2ERKA 1H4LA 2Z60A 3DA6A 4MAOA 3TNQB 4CMOA 3ODYX 4G9RA 5DI1A 1O6KA 1XWSA 2BR1A 3WF7A 3U54A 2UW5A 2CN8A 4RPVA 3ATSA 4LMNA 4GRBA 3MDYA 5E8WA 2WTJA 1OKYA 5EM8A 1VJYA 2Y9QA 3MIYA 1XO2B 3WZDA 3E63A 4I5CA 5A4EA 1KE9A 4EH8A 5J79A 4HZRA 2XKEA 4O22A 4CMUA 3L9MA 5EDQA 5AUUA 5DEYA 1W98A 2BHEA 2JDRA 1PXJA 3FE3A 2YZAA 4BBFA 4DFNA 2XM8A 3DS6A 4FL2A 4HYHA 1OGUA 3FMDA 4DTAA 2W99B 4NYEA 2R2PA 2VO6A 2YCRA 4X2KA 4FSUA 3C5UA 4BCNA 3D2IA 4C35A 4K18A 3R71A 3P23A 3CKXA 4MEDA 2C0IA 4WO5A 2QI8A 2YZLA 3U55A 5HTCA 5KBRA 3F5GA 4YZMA 2YEXA 4ALWA 3WI6A 5IKWA 2YWPA 2XCKA 3PUPA 4EUUA 5AAEA 4CLJA 3Q32A 3LHJA 2VTAA 4CKRA 4A7CA 3ZUUA 2FVDA 2WPAA 2J2IB 3A7GA 3R1NA 4XV9A 3ZOSA 4EOSA 1ZZ2A 3PA3A 4CYJA 4C3RA 1E9HA 1BL6A 4QMXA 3F82A 2CPKE 3HDNA 3R8PA 4FTKA 5HG9A 4EZ7A 2XK6A 3BPRA 3SXRA 4I94A 3AMYA 4IQ6A 5FQDC 2XF0A 3QU0A 2BHHA 3QGWA 2EVAA 2Q0BA 4FNYA 4H3PA 4NK9A 4D58A 2ZDTA 4O6EA 3VN9A 4K9YA 3QQHA 4JT3A 4A9UA 4MXCA 5CU0A 3L1SA 3MYGA 2HY81 2OBJA 4WIHA 1H1WA 4FNXA 5LARA 4L46A 2R64A 4XHKB 3RAHA 3HMOA 3WF6A 1KOBA 3LXPA 5GZ9A 4IWPA 3D4QA 1MUOA 1SZMA 4X21A 2VTNA 2JLDA 2XS0A 4GCJA 3LFAA 2ITOA 4C59A 3QQFA 3OCSA 4J95A 1QPEA 1OM1A 2WTCA 4R7IA 3CPCA 1EH4A 2YA9A 4QP9A 2OZOA 1ZYJA 4H3BA 4R3CA 5BVEA 4E6CA 1A48A 4OTIA 4CYIA 4QMMA 4M13A 2QR8A 5B7VA 2G01A 4D0XA 3LIJA 3UNZA 4IXPA 3RNIA 4EKKA 4CFXA 1BMKA 1W82A 4RX7A 3C9WA 3VBWA 4KRDA 4HPUE 2PVKA 5CLPA 5KX8A 5BYYA 3ORPA 4C4GA 3H10A 3RHXA 3SDJA 4EHVA 4EKLA 5HHWA 3UODA 3OG7A 3HNGA 5DG5A 4D4SA 2C47A 4RC3A 1CM8A 3ACJA 3M11A 4Y46A 4HJOA 4BWKA 5E8ZA 3UQGA 5JGAA 3CY2A 3C0HA 1YHVA 1SYKA 3UO5A 5J9YA 2IWIA 4FSQA 3R6XA 3EFJA 4FODA 4Y5HA 4PL3A 5CTPA 1PHKA 2P4IA 1F3MC 5AP5A 5GZAA 3OXZA 3BU6A 5LMKC 5FBOA 3VS4A 3O8UA 3OEZA 1R78A 1STCE 3RBWA 3RVGA 1YVJA 2WMTA 2XNGA 5E8TA 4GT3A 4FA2A 4USFA 4ZY6A 4MVFA 3ZM9A 3TV6A 3PE1A 2XJ0A 3MN3A 4ZEGA 3ULZA 4C3FA 2XIRA 3SW7A 4XCUA 5C03A 4BGQA 4EYMA 3SXFA 3LE6A 1ZYLA 3BYSA 3D7TA 5K3YA 4AGDA 2W1IA 3MBLA 2PMNX 3BHTA 4OTGA 4TZRA 1WBSA 5IF1A 3QD2B 3BV2A 5FRIA 5M4IA 4C34A 2GPHA 3HV3A 1M7NA 3SAYA 3HAVA 3SGCA 4MBLA 4TYGA 5KMKA 3Q2MA 2YITA 3FDNA 3W32A 2FGIA 4QP4A 5IH5A 2WEVA 5H8BA 4IZ7A 3F5UA 1K9AA 5JSMA 3MIAA 3POZA 4FEQA 4LRKA 3SG8A 4YC8A 2VTLA 3TN8A 1FVRA 2CJMA 3DK3A 4BCKA 3DNDA 1M52A 4OW8A 4AUAA 2I6LA 2VWBA 4RZWA 3ORTA 3KCKA 3N4UA 4QP3A 4XUFA 3TKUA 4D1XA 3I0OA 3PRFA 3V8TA 5CEOA 4IB3A 2NO3A 4O7LA 2OJGA 3DCVA 3TKHA 4DGOA 3OZ6A 4HGLA 3L9LA 2OU7A 2IVVA 4OTWA 2BRHA 4AN9A 5DYJA 4DCAA 3QUDA 1W8CA 4KNBA 5HGIA 4CRLA 4Y5QA 4CTBA 2UZVA 4GIIA 2ZMCA 3ZS5A 3V8WA 4AF3A 4CKIA 4FKPA 4F9BA 3UIXA 3E64A 4QMUA 1V0PA 2Q0NA 3PIZA 4DH3A 2W9FB 2QOIA 3EN7A 1OVEA 4BN1A 3TUCA 2ZV9A 3RP9A 1V1KA 3OWPA 3LFEA 2WMWA 4IFGA 1BI8A 3I7BA 3DBDA 3NAYA 3SOAA 4F7LA 2I0YA 1TVOA 2HWOA 3NYOA 3QWJA 3HP2A 4OR5A 4BTFA 5D10A 3E7VA 3R8VA 1CKPA 3T3VA 2WQOA 3B2WA 5AUVA 4I0RA 1REKA 1OI9A 3OD6X 4XP0A 2JIUA 3PP0A 4IZYA 5CWZA 3V51A 3WF9A 5IEYA 3S1HA 3UMWA 2ETMA 3L9NA 3MFTA 4ZSJA 4IAFA 3FC2A 4D2VA 3Q60A 4KSPA 4ZSEA 1YOMA 3UBDA 2R3MA 5I3RA 4LM5A 4DGGA 3R01A 1YXTA 3QRJA 1R0EA 5BUEA 2BZJA 3BGQA 1YWNA 5HQ0A 4P5ZA 2J90A 5EM6A 3R7EA 2WU7A 2WIHA 3I81A 3KY2A 2PZYA 3NUXA 3HLLA 4QRCA 4ZSLA 5BYZA 4EH9A 3LQ3A 2XNMA 5FM3A 5HE1A 4ANLA 4FTJA 4DEIA 4FEXA 5E4HA 4JX3A 5EI2A 2VGOA 3EN9A 2PVNA 3F5XA 3OWLA 4FUYA 4UB7A 5CU2A 5J8IA 3FXZA 3R83A 4ZAUA 5C4KA 3EFLA 4XV1A 3R9NA 4Q5EA 3C4WA 3DFCB 3TACA 4F9AA 2OG8A 4R1VA 4K1BA 5JN2A 2JKMA 3HP5A 3DTCA 3W1FA 3QTRA 1MRVA 4UBAA 2C3LA 3GU6A 4QD6A 1F0QA 2W1HA 4O7YA 4JDKA 4QYHA 3R63A 4WRGA 3TTIA 5AFVA 2HW7A 2OICA 1SVEA 1UNGA 2O63A 2V5QA 3PG3A 2IW6A 4YO4A 2BUJA 4C4HA 3S4QA 3CY3A 2VTPA 3DBQA 4LOQA 4KKHA 4MQ2A 5C27A 3R8LA 3WILA 5CU4A 4TL0A 3BYOA 5DBXA 4FF8A 3GQLA 3IDBA 3QC9A 4E5WA 3FXXA 4FOCA 4FV8A 3QRIA 4BICA 5D7AA 5EM7A 3GB2A 3H30A 1TQIA 2YM3A 2GSFA 4XRLA 3RK5A 3SG9A 4RFYA 3C4CA 4LGGA 5F4NA 4HVGA 3ZZWA 3NX8A 4PPCA 3L8PA 4G16A 4JBQA 3GFWA 4D4VA 2PZRA 3HEGA 4FVRA 2O64A 3ZFMA 5K5XA 2XNBA 5EHYA 3RTPA 2F7ZE 4YLLA 3POOA 3FKOA 2B9HA 5ANIA 1WVXA 3KVWA 3FEGA 4ZJVA 4ZIMA 5CEPA 4O91A 4XMOA 4FSRA 5KO1A 2XK7A 3RPOA 2WTKB 3BHYA 3IW8A 3W2SA 4ACMA 3L9PA 4AG8A 4PMSA 3O7LD 2C6IA 2VTHA 4BDDA 2XRWA 4BCHA 4D5KA 5I5ZA 1JSTA 2C6EA 3DB8A 4QP2A 2QQ7A 4ASZA 1J91A 3A60A 4FG7A 5ETAA 4L7FA 1H1QA 1QPDA 4AE9A 4Y73A 3A7FA 3VUMA 3MH3A 4Y95A 3Q5IA 4H39A 4NW6A 5CF5A 1VZOA 5IQBA 4FT3A 1ZOHA 2FH9A 3CJFA 2JIIA 3ZRMA 4EQUA 2R0IA 2PL0A 3GQIA 5J87A 3HL7A 3MESA 2GS7A 4L3PA 5CSHA 5HLNA 1CKJA 3QX2A 3BHHA 4QMVA 3TNWA 4J71A 4GK4A 4PDOA 4QNYA 5K9IA 3COIA 4D1ZA 3QKKA 4O0VA 1W83A 3I6UA 4ACCA 1U5QA 4CT1A 2BMCA 1M2QA 3R1QA 4L3JA 4LRJA 4O27B 4AW5A 4LL0A 4FBXA 1J7LA 3JYAA 1PXOA 1BUHA 4FZDB 3ENHA 4BDCA 4D28A 2VX3A 5DE2A 4O21A 4DF3A 4UN0C 3VQHA 3R7UA 4XRJA 3OROA 3EOCA 3R73A 3I0QA 2X8IA 3RPSA 1VYWA 2GNGA 2JC6A 2X7FA 1B39A 3DNEA 5IDPA 4PDPA 2F2CB 2A4LA 3FYKX 4X2JA 3T9TA 4H36A 2DUVA 4FZFB 3U51A 2HXQA 5BQ0A 1TKIA 5GNKA 3LLTA 3QCSA 5BUIA 5BVNA 3QLGA 3TZ7A 3PG1A 4TWCA 3G6GA 4FKIA 3TNHA 1RW8A 1YWVA 4C57A 3GCQA 3KF4A 5HD7A 3TWJA 2WD1A 3KN5A 4FYOA 3ZLSA 4TY1A 2WMRA 3E3PA 4XNEA 5EYKA 4AACA 3MV5A 2PU8A 4BDIA 2GQRA 2SRCA 4I41A 4QTEA 5E8XA 4JRNA 3SV0A 5I9WA 4A9YA 1OL1A 3FLSA 4DEAA 5D9HA 4EHGA 3KRJA 2JBPA 4W4XA 2XYUA 5I0BA 2OKRA 2WFYA 5EOLA 1A9UA 3CD8A 1WFCA 3IW5A 3MY5A 4IADA 1U59A 1I09A 5EYDA 4BKJA 4OAVB 4CFNA 4K33A 3QAME 5AUZA 3NUYA 2ZM3A 4FIGA 4RIOA 4D2WA 5JRSA 3DXNA 2YCSA 5AADA 4JG7A 4TYHB 3DFAA 3EQGA 3TIZA 2P2IA 3I60A 4ZMEA 1XBCA 2YM5A 4UMTA 2YJRA 2IVUA 2PUUA 1J3HA 1GJOA 2Y8OA 4W4WA 3SRVA 1PMEA 2XZSA 2YIRA 5DIAA 3E62A 1JKKA 4TYHA 2BRMA 2ITZA 5L6WL 2VWZA 4NFMA 1KE5A 3Q5ZA 4EI4A 3K3JA 2PVYA 2HY0A 1VYZA 2W1ZA 4L68A 5DPVA 3UZPA 3GU5A 4R7HA 4NL0A 1PXPA 1Q62A 4RLKA 5AP0A 3VJNA 4ACDA 1PW2A 5KHXA 5AR7A 3DOGA 2YLFA 1GOLA 4JDHA 1RE8A 2QD9A 2R7IA 3BQCA 3ZSHA 2BALA 4CV9A 5IUGA 5CQWA 4JIKA 1F5QA 2RKUA 4TYIA 4R3PA 4APPA 4RQKA 3FSFA 5DR6A 2QOKA 4IE9A 3R9OA 5JFXA 3HAMA 4RZVA 5FUTA 3C7QA 2FUMA 4DLIA 4E20A 3HUCA 3PJ2A 5DLSA 2WEIA 4GG5A 4K2RA 4EEVA 5HE2A 3EQDA 3OCBA 2WNTA 3MH0A 4I1ZA 4PV0A 5AR2A 4BYJA 2ITPA 3FMJA 1KV1A 3K2LA 4YJOA 2Y4IC 4KS8A 3RCJA 4F70A 1UU9A 4J96A 2VWYA 3ZO2A 3D94A 3VF8A 3FMHA 4E5BA 2UZNA 5GIPE 3CP9A 4FKQA 4IH8A 4J8NA 4QO9A 2PZ5A 3OVVA 2PUPA 4QMLA 3I4BA 4BZNA 3MPAA 1RDQE 2QLUA 1GIJA 5CASA 1MRYA 2PVJA 4B9DA 2PYWA 1IEPA 2GHGA 3W18A 4BF2A 5KKRB 4M97A 4AZEA 4XBRA 2ERZE 3FQEA 2X39A 5DH3A 4LL5A 4WNMA 1R0PA 4KIOA 1JKSA 4CEGA 4A9RA 2FSTX 5FWKK 1SVGA 3ORLA 3QGYA 1ZARA 2WMAA 3V5JA 1B6CB 2GNFA 4OTFA 4Q5HA 5HBJA 5JH6A 1YXXA 4I21A 5DR2A 5IQCA 3CTJA 3MPTA 4FUXA 1H1SA 1OUKA 2AC5A 1BLXA 4U80A 1Y6AA 4B0GA 2ETKA 2YDIA 4FKVA 3UIBA 1NY3A 3F66A 5EKOA 5IA2A 2IPXA 4EH6A 4PP9A 3DXQA 4YJRA 2J50A 3UGCA 3V6SA 3NWWA 3DKGA 5L3AA 4ERKA 2IVTA 3VS3A 2WU6A 5KNJA 1PXMA 3P08A 3F88A 3LCDA 3UIMA 3ZLYA 4AOJA 4QNAA 3VQUA 4FSZA 3ELJA 3LXKA 5AP4A 4EH4A 1H1PA 4CFUA 3A4PA 2B9IA 2GTMA 2CGVA 4IJ9A 3TJCA 1OKWA 3VUTA 4IW0A 4PMMA 3Q9YA 3UPXA 4IC8A 5DT4A 5M53A 4K77A 5EG3A 3DJ6A 3O7LB 4G5PA 1NVQA 4EBVA 5AMNA 4BTJA 3PIYA 4PQNA 4DGMA 3NW6A 3HX4A 2HAKA 3BBWA 2RF9A 3V01A 2FSMX 4F7SA 3EQBA 2VTOA 2VN9A 2GNLA 2XCHA 2CLQA 3FWQA 4FR4A 5EQEA 2QU6A 2AUHA 4JJRA 1R1WA 3H0YA 4BHZA 3GOPA 3RALA 3FY0A 4CZTA 3KF7A 1XH6A 2WZJA 4AZFA 2ONLC 1OUYA 4ZY4A 3GUBA 2HIWA 4GH2A 4MQ1A 3U8WA 4FV9A 3ZDUA 3DLSA 2ZAZA 4C37A 4FTAA 4BC6A 4HVIA 5M07A 2I7QA 3R9RA 3V6RA 3AD5A 3AD6A 2BDFA 2C0TA 2OI4X 3W33A 3AG9A 4OTDA 5DN3A 3HV7A 2O8YA 2RFNA 2VO3A 4GIHA 4WA9A 4MWHA 3GXLA 1Q8UA 4GV1A 4ZTLA 1R39A 1ZWSA 3I5NA 4LOOA 3W8QA 5DA3A 1M17A 4AW2A 4DAWA 1KWPA 3P9JA 3R00A 4DFLA 5KHWA 4FK3A 1JSVA 3QQKA 3TCPA 3TG1A 5IA0A 3NAXA 3MB6A 2BROA 4BDBA 4O7VA 3ROYA 2XIKA 4N70A 4IB0A 4MYGA 4AZVA 4F64A 3OUKA 5L8JA 4RGJA 4X3FA 3RNYA 2BDWA 3S3IA 4DN5A 2LGCA 3MS9A 4L44A 4I0SA 5AR5A 5HU3A 1OIQA 1WVYA 1XBAA 4OBPA 5KZ0A 2YFXA 3O96A 5EW9A 4LGDA 2W7XA 4YP8A 5EW3A 3P0MA 4S30A 5CT0A 4YTIA 4CT2A 4XS2A 3PRIA 4YC3A 4UXQA 1YRPA 3AT2A 4DG2E 4XV2A 3VRYA 1H07A 5M55A 4LUEA 3W2QA 3QCQA 3BQRA 3R28A 3K5UA 5DRDA 2YDJA 5A4TA 3F2RA 2C6OA 3HVCA 5A14A 3BELA 5IG1A 5AIKA 3UE4A 4AA5A 4FTNA 4AS0A 3MY1A 4C4EA 1HCLA 2C5XA 2UVYA 3EYHA 5DMZA 4IAIA 3R8MA 5E8VA 1PXIA 3IW6A 3C4ZA 4YJQA 4AT4A 4ZLOA 1LEZA 2R3QA 2H96A 4NWMA 3OFMA 3TV4A 5TE0A 5HESA 3ZSIA 2CDZA 3EMGA 4NM0A 1FBNA 3NUNA 2YM6A 3QZFA 1Y91A 3OWKA 4JAIA 3IOPA 2WQBA 4FT9A 4BBEA 4BTMA 1UNLA 4ZSGA 5ETFA 4QP7A 4RX9A 1LR4A 3DTWA 5CU3A 2RFDA 4GSBA 2V55A 2BKKA 3GU8A 2VRXA 1OIUA 2J5EA 1JAMA 2JGZA 2X6DA 3PJ3A 4TW9A 3F3VA 3QUPA 5BMSA 5CAUA 2X9FA 3ZLWA 3C4FA 5HVYA 4RIXB 5LWNA 3QUEA 3ZEPA 4PWNA 2YM4A 3UDBA 2BAQA 2UZOA 3TUBA 5CNOA 3D9VA 2ZV2A 3ALNA 4GG7A 5I9XA 4ZTHA 3EQIA 3I79A 5F94A 4DBNA 4E8AA 3V8SA 3FAAA 5C26A 5KBQA 5HICA 4D4YA 1W84A 5I9VA 2JDOA 5E91A 5LMKA 2A0CX 2RG6A 2WTDA 5BVWA 4RX5A 4RX8A 3DK7A 5LXMA 1IASA 4RBLA 4C36A 4F99A 3BU5A 4XLIA 5J95A 4E6QA 5EYMA 1ZZLA 1IRKA 5TOZA 4LG4A 4O81A 4IBMA 4IWOA 3UOJA 1ZY5A 3FC1X 4USDA 3TZ9A 2GCDA 4JBOA 4UZDA 4CSVA 1RJBA 1S9JA 4OT6A 3RHKA 4YTFA 2XIYA 1O6LA 2ACXA 2QOLA 5AX3A 3EKKA 4PL5A 1TQPA 2BTSA 5DEWA 4J98A 2P3GX 4ZXTA 2PE0A 4IAKA 4D2RA 5HBEA 5FDPA 1KOAA 4M66A 4EZ3A 3CGFA 3MW1A 4KKEA 4IVDA 4O84A 1K3AA 4U43A 2DYLA 1H0WA 1DAYA 4A4OA 3R21A 4RQVA 5HE3A 5C8NA 3FPQA 2EUFB 4X0MA 1X8BA 3NDMA 3CIKA 4BDHA 4FVPA 2G9XA 5JFVA 1NXKA 1KE8A 1GY3A 2ZV8A 2X0GA 4FSWA 4YGAA 4C4FA 5CAVA 4CG8A 3VJOA 3R0TA 4IMYA 1YXVA 3VS7A 4EH2A 4IX4A 4JBVA 5AA9A 5JT2A 3ET7A 4JX7A 3RMFA 4JS8A 3WIGA 4PP7A 3IONA 1IA8A 3ORXA 4JLCA 3FI2A 3O71A 3DAJA 3HRBA 3BV3A 4GKIA 4I6FA 4EOJA 4DTBA 3BE2A 1LUFA 3OUNB 3VWAA 4BDAA 4PDYA 3TT0A 3EQCA 2XP2A 3NNWA 4QTBA 2C6TA 2QVSE 5AJQA 4LI5A 4S33A 4I22A 5JFWA 1CKIA 4EH7A 3F3TA 4DINA 3ZRLA 4R5SA 3UZTA 1FQ1B 3O51A 4NTTA 3BYVA 3IDPA 4EZ5A 3MH1A 3QC4A 2C5YA 5DNRA 1HCKA 3LFSA 4GU9A 2J5FA 3LJ2A 4YZCA 4DH1A 3SHEA 3Q9WA 3CSVA 2HELA 3JUHA 5HE0A 4PL4A 3GI3A 5HZNA 4FIJA 2OIBA 2B54A 3VBVA 1BKXA 3R7IA 4F1TA 2A2AA 3AOXA 2QG5A 3VO3A 4O0SA 5KZIA 4FZAB 4ANSA 3N4TA 3BRBA 3CKWA 4MD7E 5FXRA 3PIXA 4G34A 3RPVA 3E8DA 2B1PA 2J51A 4YHFA 4DFUA 3ACKA 5GJDA 2CHLA 2JAVA 2C1BA 5H9BA 4EUTA 3V5PA 4ZLYA 1GNGA 3C4XA 4V04A 5HCXA 1XR1A 3GEQA 3MH2A 2IW9A 3KRLA 4WD5A 1Y8YA 2WGJA 3BCEA 3E87A 3QTXA 4O0WA 5EK7A 2YIYA 1JPAA 3SX9A 1OIRA 2YISA 5IQAA 2C6MA 2IJMA 3TNIA 3SC1A 3OWJA 5A6NA 4AZWA 4CFVA 4L7SA 3VUGA 3EFKA 4FMQA 5BYLA 3A7IA 4NUSA 4EYJA 4FKJA 2ETRA 4R1YA 2BRGA 3RJCA 4BB4A 2X1NA 3PDTA 4NJDA 4CZUA 4UMQA 3G6HA 5C8MA 3WZEA 1ZYCA 4QPAA 3DQXA 3NNVA 4O0YA 1XHAA 2WMSA 5L2TA 4R6VA 4YPDA 1YKRA 4JG6A 1RQQA 1BYGA 3DJ7A 4ZSAA 4ANQA 4DT9A 1P4OA 2PE1A 4E93A 1QL6A 4LGHA 4YO6A 2VTJA 3Q53A 1T45A 4KBCA 2G15A 2UW6A 4R77A 3PA5A 4FTOA 3MVMA 2R3HA 2FYSA 3G0EA 1FPUA 2RIOA 1SM2A 2C6DA 3ZBXA 2PWLA 3D5VA 4TYJA 4EOLA 1CTPE 2JFMA 5AR3A 3VC4A 5JQ5A 2W4OA 2B9FA 1YHSA 1P4FA 4QQ5A 5IISA 4BL1A 4YJVA 4XEYA 3ATTA 2F9GA 4HNIA 2ZV7A 5HLPA 1M14A 2WOTA 4FL1A 4EOQA 2UVZA 3IGGA 4JQ7A 4O0RA 4C58A 5A3XA 2GNJA 3HKOA 2UW9A 3EN5A 2RFSA 3ZXZA 4YLJA 1UU7A 2BILB 3AC5A 3E88A 4OLIA 2F49A 4EH5A 1I44A 3NYXA 3H3CA 5GINE 3C5IA 3EL8A 4NEUA 4RSSA 5IPJA 3UOHA 2ITXA 4U42A 4FIFA 3NUSA 3EFWA 4W9WA 2WAJA 1WBWA 3KXMA 3PWYA 3SOCA 1P14A 4Z3VA 3QA0A 3HMMA 5FM2A 3VS0A 4GMYA 5JK3A 5C4LA 2YM8A 5HNIX 5FGKA 3CQEA 4BDKA 4MKCA 3DY7A 5A4CA 5J9ZA 5CF8A 4KB8A 4HGEA 4IZ5A 2OFUA 4IM2A 4U8ZA 5BNJA 3SXSA 4PUZA 3DDQA 4YR8A 5CAOA 1PY5A 4FGRA 3DAEA 5IQGA 1GAGA 2XKCA 3P86A 4I92A 5DHJA 5AAGA 3UPZA 2YJSA 4J1RA 1J7IA 5IUIA 1NA7A 3G90X 3GC9A 4DFBA 4RIWB 4NM7A 4DFYA 5L6OA 3EYGA 3TTJA 4IACA 4DEEA 4BCJA 5DGZA 2XIZA 3BIZA 2HENA 4YTHA 3TDWA 3FJQE 4RWLA 5I4NA 2UZTA 3QA8A 3R30A 2QR7A 2JBOA 2PSQA 5FDXA 3C51A 5H8GA 2OXDA 3FZ1A 1SVHA 4X2GA 2X2LA 3BE9A 3EH9A 3Q4CA 1KE7A 4JR3A 1LPUA 3MPMA 3UOLA 3VW6A 1OMWA 3F3WA 5KMNA 4IB5A 2GTNA 5CSXA 2W5HA 4IVCA 3COMA 4AWIA 3O17A 4FC0A 1YDTE 3JVRA 4I6QA 3HUBA 3QWKA 3H9OA 3RZBA 5CZHA 5CX9A 3ANRA 2OLCA 3TDVA 1ND4A 4ZTQA 3EQPA 4DG3E 2HZ4A 4IEBA 2E9NA 5CU6A 3QXOA 5KMOA 3JS2A 4MD9E 2JKOA 3ZC5A 1P2AA 3LXLA 3PY1A 4XOZA 4EHEA 4ZTMA 2C3JA 3EQFA 3II5A 1OPJA 4YSMA 1CMKE 4GEOA 3QZIA 1ZMWA 3T9IA 2C6KA 3ETAA 4A07A 4FV6A 1PKGA 2VO7A 4JR7A 4FTTA 2UW3A 3CBLA 4C2WA 5AA8A 2PPQA 4I6HA 4L43A 3REPA 3F5PA 3MB7A 1NW1A 4GJ2A 4ITIA 4XP3A 2VD5A 4LYNA 4P90A 3U4UA 4UMUA 5M09A 1OPKA 2JDVA 3D83A 3K54A 4ZS4A 2V7AA 5CVHA 3BEAA 2C3IB 2RL5A 3P7CA 2OO8X 3KU2A 3WF5A 3EZRA 3OT3A 1E1VA 1L3RE 2X8EA 4M84A 2BAJA 2UZUE 3I7CA 1OECA 5ETCA 5BVDA 1JOWB 4GVJA 1ZY4A 1NT2A 3MFSA 4UALA 4AGUA 3EIDA 4BI0A 3AGMA 4FV3A 1CSNA 3UP2A 1Z5MA 4L42A 4NT4A 3KXZA 2ZOQA 4PF4A 5BX0A 4EOPA 3A99A 5M08A 4RC4A 2CLXA 4I4FA 4PDSA 4U97A 4BR3A 4AOTA 2X6EA 5HX8A 2CNUA 4DC2A 4XJ0A 4HW7A 4E4NA 1WAKA 3NCGA 2W1DA 3IO7A 5T6KA 5J5SA 5J7BA 2IZSA 3EQRA 4YZDA 4H1JA 5A9UA 3NSZA 2R3NA 4C62A 2PUNA 5HBHA 2C5NA 4DH5A 4MXAA 3TUDA 3LQ8A 5J1VA 2I0HA 2OJIA 3QD4A 4FTRA 1Z9XA 4TNDA 1QPJA 4HVDA 4FV5A 4BDJA 4AAAA 2VWVA 2Y4IB 5CY3A 4DFZE 1DAWA 4QP1A 1H08A 3DPKA 3RWQA 5M4UA 4F4PA 5IUHA 4OBOA 2ITUA 3LJ1A 4NTSA 3CQUA 2F7EE 4YHTA 4M69B 5JKGA 3PWDA 3R8ZA 5IMXA 4OTRA 4WNPA 3UMXA 4X2FA 3WF8A 5HNGA 5CEMA 4JOAA 4AQCA 4HCTA 4W8DA 4NU1A 5ANGA 4EWQA 1Q3WA 2B53A 2WHBA 1YOLA 4BCGA 3LQ5A 3TI1A 4AOIA 3NLBA 4AFEA 3WIKA 4D55A 3IECA 1DI8A 5GJFA 4M69A 4RVLA 3MTFA 1IG1A 4QP8A 3CLYA 2EB2A 2XKDA 4JQEA 2OIDA 3GU7A 4NH1A 5ANOA 1PRYA 5HTIA 3LFDA 5CEKA 3FLZA 5AEPA 2YABA 4IJPA 5IH6A 3C50A 3COHA 2ZVAA 2ITYA 4YNEA 2R3LA 4MXXA 3U87A 3CTHA 3ORMA 3D2KA 3IQ7A 1OITA 2ESMA 2X7GA 3MFUA 4C4JA 2PULA 3RM7A 1FVVA 3QKLA 2J0LA 5LVLA 4KRCA 1BL7A 2B52A 5TT7A 3RK7A 4EJNA 2F4JA 3CQWA 4IC7A 5AM7A 3R7OA 2W5BA 4QMOA 4Y8DA 1OPLA 2QLQA 4BIEA 3VVHA 3GGFA 5AV0A 4C61A 3AXWA 5K5NA 3AC3A 4FV4A 4JI9A 4FTCA 4P4CA 3PXRA 4EK4A 4F6SA 5A6OA 2BZKB 4QMNA 2PE2A 2XK4A 3R7YA 3TNPC 3HA8A 3QQGA 2OIQA 4U0IA 2C68A 3QTWA 4W4VA 3DT1A 4I24A 4E73A 5LMBA 4AA0A 2FO0A 3DB6A 4XG8A 2EWAA 2XYNA 4K8AA 4YURA 4DEBA 4QPSA 4QQTA 2E9OA 3VNTA 3B8QA 4I6BA 4UXLA 4AE6A 4CMTA 3UOKA 4L67A 2C3KA 3JY9A 3JR1A 3HV5A 4DBXA 4J97A 3ZH8A 4FV7A 2XNPA 5JRQA 1V0OA 2VO0A 5J9LA 4CLIA 2V0DA 2J7TA 3DBEA 4MNEB 3R9HA 2AC3A 4E6AA 4BIBA 3VHKA 4Z7GA 3RM6A 1XKKA 2YWVA 4R5YA 4IFCA 5D7VA 1ZYSA 3L8VA 3MTLA 4IB1A 4IX3A 4KIPA 5ANKA 5EOBA 4FKSA 4FICA 3NIZA 4O6LA 4EC9A 4Z16A 2WMBA 3NUUA 4EK3A 4B7TA 4YTCA 4FKLA 4FOBA 3BLRA 4U5JA 2B4SB 3MFRA 1UKIA 2HK5A 4A9SA 3CXWA 5EI8A 3OY1A 4RVKA 3H9FA 4ZLZA 2RG5A 4NFNA 4ONAA 1PXLA 4M15A 1YI4A 3ITZA 4DLJA 1YI6A 4IHPA 2GFSA 2F2UA 5JGDA 2VWIA 4RWKA 4L53A 4YJNA 4ACGA 4I5PA 2YLEA 5EI6A 2ONLA 4HVSA 2Q83A 4FV1A 4F1OA 3R04A 4N6YA 3FV8A 2BZHB 5EQPA 4BIDA 5C8KA 2VU3A 4ARKA 2CCHA 4E7WA 1IA9A 3W2RA 4GYGA 4P5QA 4PTGA 2ZM1A 4FKOA 4YZBA 5I9ZA 2I0EA 3ZONA 3FMEA 2VTSA 3DDPA 4LFIA 2RGPA 5B0XA 5L2WA 5L2SA 1AGWA 3U4WA 4OAUC 4PNKA 2GDOA 3ODZX 5DR9A 4LUDA 3PLAE 2H9VA 3VBYA 4XOYA 2OXYA 4UWYA 3OP5A 4WSQA 3MWUA 4FIEA 4WBOA 2QOBA 3DKFA 3N9XA 5ITAA 4BY9E 3W10A 5LCKA 5JFSA 3Q9ZA 1H25A 2ITQA 4Z9LA 3R7VA 1A06A 1Q99A 1VEBA 3PPKA 4I3ZA 3BEGA 1PMVA 2A1AB 1IR3A 5AX9A 4EH3A 4L9IA 4S32A 4HZSA 2YHVA 2HZIA 4MF1A 5FBNC 3E92A 4BCIA 4G3EA 4GT5A 1YDSE 4DFXE 5CI7A 2NNWB 3MI9A 2QO9A 3G9LX 2Y4PA 4G6NA 4E1ZA 4BBMA 2XMYA 4ANMA 4MXZA 4FG8A 1MQBA 3OHTA 3QQJA 4Q9ZA 2J4ZA 2XEYA 2YDKA 3QF9A 4G9CA 5CVFA 3OBGA 2Z8CA 5M4CA 3UTOA 4B4LA 1TQMA 4O7TA 3PPJA 4G17A 3UZRA 3C4EA 4OTQA 2GFCA 4H05A 3LFQA 4DH8A 4A9TA 4BCMA 4U40A 4UY9A 3BLQA 3D0EA 4Y85A 4AP7A 5GJGA 3U9CA 2F7XE 4ALUA 4ALVA 3WYXA 5IQHA 3K3IA 3M1SA 3G2FA 4IDTA 4NCTC 3PZHA 1IAJA 3BYUA 2VAGA 4HCVA 3TXOA 3MVHA 2RFEA 3ZSGA 2YAAA 2WKMA 5EKNA 2PVFA 4F9WA 2OK1A 4IM3A 5AUWA 5IQIA 4ANOA 3A62A 4WUAA 4CZYB 4TPTA 3OCTA 4JXFA 4PPAA 2QO2A 3KB7A 4D0WA 4IZAA 3ZDIA 3V5WA 1XQZA 4FTIA 5EHLA 2JFLA 4YZ9A 3RPYA 2XBJA 2G2HA 2C5OA 2FB8A 3MA6A 3F6XA 2W06A 2R9SA 4FIHA 5K4JA 3CCNA 5C9CA 4UMRA 4J99A 3TEIA 5F9EA 4H3QA 1LP4A 2JKQA 3LMGA 5M57A 2CSNA 3PVWA 4GL9A 5JGBA 1CDKA 1W0XC 2W1GA 2OW3A 3FZSA 3CS9A 4HOKA 4QPMA 3CPBA 5HOAA 3DBFA 3QCYA 3O8TA 3K5VA 1UV5A 3LCKA 5AV2A 2W5AA 2ZDUA 3LCOA 4TKSA 1YQJA 4JVGA 3G5DA 5LOHA 4I23A 3R9DA 3WYYA 4EL9A 3LM0A 1L8TA 3RK9A 2I1MA 1Q8WA 3GCSA 4X3JA 3T3UA 4U44A 3GU4A 4I20A 4XYFA 3P79A 1UU8A 5E8YA 2R3GA 5KMIA 3ZU7A 4C8BA 2P2HA 5F95A 3ZO4A 3LCTA 3KEXA 2WTIA 4ANBA 3W2CA 5AP3A 1UNHA 5CI6A 3PXFA 5IQDA 1AD5A 1Y57A 3KA0A 3NYNA 3LOKA 2BIYA 4TNBA 4HYUA 2DQ7X 4BWXA 4ZOGA 3PXKA 2O0UA 4ZZOA 2BDJA 3NR9A 4YUQA 1WBOA 2QHNA 4TRLA 3FXWA 2PZIA 4QMYA 4ZMFA 4ZY5A 4H58A 5AAFA 3G15A 4RVMA 3IOKA 3TM0A 4D2TA 3QTUA 4FZ6A 4MWIA 3LXNA 5I9YA 4USEA 2UVXA 3EWHA 3D5UA 4GYIA 4OUCA 4FG9A 3PA4A 4X7QA 4YZNA 1H8FA 2VV9A 4CCBA 4V01A 2KULA 4JBPA 4BCQA 3N51A 4ASDA 2Y6OA 2XK3A
chains in the Genus database with same CATH superfamily
4XV3A 4QDVA 3PE2A 5T3QA 3R7GA 3HRCA 2WTVA 4FNWA 5HD4A 2QKWB 2PVHA 4H1MA 4O83A 3ZRKA 5EM5A 3B8RA 5FXSA 3ZEWA 4N4SA 3BLHA 3FZPA 3MVLA 5AR4A 4B99A 4MBJA 5AV1A 2B7AA 4RJ6A 3VS6A 1B38A 1SMHA 2BKZA 2HYYA 1M7QA 2IZUA 5T68A 4NJ3A 2R3IA 3FBVA 5AP1A 4ACHA 5LJJA 5LQFA 4AXCA 5HEZA 4AT5A 1W2FA 3FMMA 1QMZA 1Y8GA 4OT5A 4G1WA 2QOFA 3QKMA 2QONA 3V5QA 2XH5A 4QMTA 2PMIA 5HCYA 4J7BA 3ROCA 1UA2A 4DE4A 2V62A 2CKQA 1ERKA 4A4LA 1H01A 5EDRA 4RA5A 4KUJA 3VUHA 4TWOA 2NPQA 3GCVA 4XG2A 5CZIA 4KIKB 4UWCA 2YACA 1H24A 4TYEA 4Y72A 2E9VA 4E5AX 2QOCA 3CC6A 1W7HA 1PF8A 2UW4A 5B2LA 2E9UA 3D15A 4AXDA 1APME 2OZAB 1Q41A 2R3FA 2ZM4A 3F61A 5HG8A 3LPBA 1ZYDA 4V05A 3JPVA 3L8SA 4DITA 4E4LA 5L4QA 1J7UA 2BIKB 3BHUA 5LVNA 1G8AA 3VUKA 4BCFA 3EQHA 2OFVA 4E6DA 4QOXA 2X81A 3IKAA 4GS6A 3QQLA 4IX6A 4K0YA 4B8MA 5I9UA 3KQ7A 4F63A 3FHRA 3OXIA 4QMZA 5CQUA 5M56A 2A27A 2A98A 3HMNA 4FSYA 4ANNA 4HNFA 2WTWA 3AC2A 4JQ8A 2Z7RA 3QD3A 4FTMA 4FI1A 4YHJA 4RIXA 3WARA 4Z7HA 2Z2WA 3LW0A 4UWBA 4BHNA 2WXVA 4QTAA 3AGLA 5AP6A 3OW4A 4AXAA 2WO6A 1YW2A 4FT5A 3NUAA 4F0IA 4PPBA 4L01A 3KRXA 3UYTA 3HZTA 3OW3A 1Q8ZA 5JZJA 3Q6WA 2C5VA 4EJ7A 3PJ1A 3NNXA 1MRUA 4RFMA 3FQSA 4FK6A 4JAJA 1ZOEA 2CKOA 3FLWA 2X4FA 2VWUA 3QQUA 5JZNA 3BBTB 3QZGA 5E1EA 5KMJA 5FEEA 2YN8A 4MHAA 2ITWA 3IW4A 2PMLX 2PMOX 4YSJA 4FL3A 3CJGA 5GHVA 1O9UA 4IX5A 3ZMMA 2V22A 2W96B 4AN3A 1Q8TA 4MCVA 5DRBA 5CEIA 1OBGA 5FP6A 3UO6A 3TV7A 1U46A 3NYVA 4P7EA 5E7RA 3TJDA 4BRXA 5A4QA 4X2NA 2PUIA 2CN5A 4FTLA 3FUPA 2KTYA 5CENA 3BU3A 1OB3A 5CEQA 3JXWA 3QTZA 3C0GA 4YBKA 2YIXA 2G1TA 1P5EA 4C7TA 2WMUA 4CKJA 4RLLA 5FG8A 3LVPA 5B2KA 4BWPA 2GS6A 3KRWA 3N4VA 4FKWA 5M51A 3GC8A 3BI6A 2R3PA 2QOQA 3HDMA 2Z7SA 3L8XA 5TF9A 3WBLA 3G9NA 2YM7A 3F3UA 3NNUA 3PZEA 4QMQA 4QTCA 5EQYA 4GFOA 4GW8A 3KULB 4JL9A 2Z7QA 4U41A 5TO8A 2QOHA 1XH7A 2IG7A 1WMKA 3OTVA 3KK9A 4GFGA 1V0BA 3ORZA 4M0ZA 2X9EA 2VZ6A 3AT4A 4XH6A 1J1CA 2XK8A 1OIYA 3WOWA 3MA3A 3KULA 3ZM4A 4UYNA 3JY0A 4BDFA 4BTKA 4AX8A 4YJTA 5EHOA 3ID6C 4X3FC 2OF2A 4BKYA 4M8TA 5DT0A 2A19B 3Q9XA 4DHZA 4AGWA 4EQCA 2VNWA 1FOTA 3KMWA 3SQQA 4PY1A 1WBNA 2YIQA 3PXQA 4I5MA 5AUYA 1URCA 3WE8A 3ZCLA 5K4IA 2ZFYA 3KMMA 4EK8A 2PHKA 3H4JA 3HYHA 3ZLXA 4WBBB 4WG3A 1M2RA 2YCQA 2ZB1A 2UW8A 3CR0A 4JIAA 2FSLX 4TT7A 4F65A 3PJ8A 3P7AA 3FLQA 3SW4A 3OEFX 3P5JC 2WMVA 5GIOE 4FEWA 2UW0A 4L00A 5CSVA 2NRYA 5E90A 2H34A 1H00A 5G6VA 3ORNA 3WZKA 3Q4TA 4E4XA 5IU2A 3R02A 4ZJJA 2J0MB 4G3FA 3S2PA 3ZC6A 4CRSA 2XNEA 5CNNA 1WZYA 2E2BA 3LCSA 1H0VA 5BVOA 3RZFA 4P2KA 3LFBA 4RC2A 5ANEA 3EN4A 3AT3A 4FEVA 5D1JA 2CKPA 3QHRA 4HGTA 4RMZA 4F0FA 2WELA 2VNYA 3NIEA 5H8EA 4I5HA 4CV8A 2R4BA 2XA4A 5F20A 4AFJA 5HG5A 5CANA 3PXZA 4GT4A 3LKMA 1H28A 4ZTRA 4IWQA 2XARA 3PTGA 4IDVA 5C1QB 2IZRA 5DVRA 4XG3A 3TIYA 1XH5A 2PVMA 4LV8A 2HOGA 4MTAA 1JNKA 1ZMUA 4G3DA 5JEBA 2BRBA 3KKVA 5G1XA 5BUJA 3A7HA 4G2FA 3ZUVA 2H6DA 2ZMDA 3D7TB 4RA4A 2O5KA 3FI4A 4EBWA 4F7JA 4MXYA 2YIWA 2B55A 3ALOA 4ZZNA 5EFQA 1AQ1A 5HORA 4ASEA 2BRNA 3KXHA 4KA3A 5L2IA 1XJDA 4AXEA 5HI2A 2HCKA 3NVKI 2CGWA 4F9CA 2OH0E 1G5SA 4GKHA 3KCFA 1GIIA 2W4JA 4CFFA 4TWNA 3QTQA 1ZLTA 3H9RA 1H26A 4NIFB 4M12A 1DM2A 1UWJA 2CGXA 2NP8A 4AW0A 3LZBA 1UWHA 4J53A 4LRMA 2XNOA 3GP0A 4QMWA 1YWRA 3OCGA 4NKAA 4C0TA 2VTIA 3LMHA 2P55A 3BZ3A 1Q61A 5CAPA 2C0OA 4M0YA 4PTCA 1GIHA 1UVRA 3FI3A 4NIFA 4G6LA 2IF8A 2C30A 4YLKA 5HO6A 5TR6A 3S95A 3Q6UA 3PXYA 2W0JA 2G2FA 2QU5A 3Q96A 2QNJA 3A7JA 3PPZA 4MH7A 3R1YA 5E8UA 2VTTA 5IZFA 5FTGA 3AMBA 4NM5A 5FP5A 3FL5A 4W9XA 2RSVA 1YXSA 3VBXA 4DH7A 5FXQA 4XG6A 3MVJA 5J7HA 4AAYA 1OL7A 1OKZA 1ZMVA 3FY2A 3NEWA 3LFCA 5IEXA 2VUWA 3FZRA 4ERWA 4O86A 4D2SA 1OL6A 4RIWA 4NM3A 3FQHA 4C38A 3DZQA 1NVRA 3QTSA 3U6HA 4FKUA 4L8MA 3FL4A 3CEKA 4M7IA 4Y83A 5E9EA 4U3ZA 3OOMA 3MJ1A 1GZKA 3P7BA 3PLSA 4GFMA 3FMKA 3EL7A 4AN2A 2O65A 1ZRZA 2IZTA 4GVAA 5BPYA 4F1MA 4I93A 4CG9A 2WIPA 1KUTA 3S0OA 3O50A 4O7RA 4YNOA 5LCJA 4G3GA 2DWBA 5KUPA 3KK8A 3OC1A 4W4YA 2XRUA 4WSYA 1UKHA 4FKRA 2PVLA 4KIQA 1FMOE 2XKFA 3U6JA 4E4MA 3GCUA 4CFWA 3R2YA 5ANJA 3U9NA 5LWMA 1Q4LA 2CNQA 3RKBA 5KE0A 4ZTSA 2UZBA 4C4IA 3GENA 4O0TA 3LM5A 3QRTA 4L45A 3ENMA 4IIRA 4O0XA 1QPCA 4WOVA 4TTHB 3UNKA 3AC1A 4NSTA 5IQEA 4RVTA 3MJ2A 2F57A 2XBAA 2JAMA 3KXXA 5IA1A 5ICPA 4CQEA 4U79A 1KSWA 4NKSA 3F9NA 4O2PA 4PNIA 1SNUA 4FVQA 4F9YA 2R3OA 2W1FA 5DT3A 3VS5A 3IG7A 3DXPA 2AYPA 2GS2A 2W9ZB 4IAAA 4O7SA 3IS5A 4BCPA 1H1RA 3UQFA 3KL8A 4MBIA 2BZIB 3EZVA 4II5A 3KGAA 2R5TA 4BJJA 4DDGA 3IDCA 1XBBA 3PVUA 4X6RA 1GZOA 4BKZA 3QYWA 3GFEA 2WQEA 4D2PA 4DEHA 3HMPA 2QOOA 2PY3A 4EOIA 3IGOA 3IPHA 5K0KA 4WG5A 3NRMA 2WMXA 2HXLA 5CS6A 5FEQA 3DV3A 4W8EA 4YU2A 4TWPA 1FMKA 2OWBA 4GUBA 3F69A 4GU6A 1PMUA 1FGIA 4DA5A 1GZNA 3HRFA 3P1AA 3SA0A 3UQCA 4D9UA 3A61A 4UV0A 1XH4A 4FSMA 5HTBA 4N57A 3O8PA 3QL8A 4PMTA 4UZHA 3NW7A 2J6MA 4PRJA 4EONA 4EHZA 1ATPE 3VUIA 1OL5A 4I0TA 1WBTA 3V04A 4AZTA 5CALA 3FI8A 2FA2A 3P5KA 3E93A 4WT6A 2J0KA 4HYSA 4S34A 4HVHA 3MY0A 3EB0A 4ZK5A 4R8QA 2VX1A 5EYCA 3VF9A 4DEDA 4OTHA 1PJKA 3CTQA 4O2ZA 3V5LA 2GMXA 3OTUA 4KD1A 2JITA 4WRSA 2JDTA 2JIVA 4DYMA 2QO7A 5FTQA 1DS5A 2GHMA 4LOPA 3F3ZA 1G3NA 5ANDA 3NS9A 4DGNA 2QURA 5C01A 4JNWA 4NW5A 2W1EA 4N6ZA 4U81A 4CFMA 4A4XA 3A8XA 3ANQA 4OTPA 2OGVA 2YERA 4YJPA 3VIDA 5HU9A 2WOUA 3RGFA 2PK9A 5H3QA 4BI1A 2XJ2A 4AZSA 5H2UA 3M42A 2C69A 2E9PA 2XUUA 1PYEA 3C13A 4FTQA 4YMJA 4EK6A 3QTIA 1FGKA 2V7OA 1REJA 1Q8YA 3COKA 4HCUA 3ZUTA 4BVUA 3ZHPC 3DKOA 4HGSA 5AWMA 4BGGA 1G8SA 1S9IA 2VWWA 3UNJA 3PVGA 3LJ0A 5D12A 3RCDA 4D9TA 5JQ8A 5KCVA 4BFMA 4D4RA 2DS1A 3GCPA 2BFXA 2VWXA 4O1OA 3THBA 4TN6A 5JMSA 3GC0A 2X7OA 3A4OX 3O2MA 4FV2A 1U4DA 2QODA 3VBTA 4L52A 4A06A 3VHEA 4E26A 2ZJWA 1PXKA 3RI1A 5KMMA 1VR2A 1Q5KA 4GK2A 4FT0A 2GNIA 4R78A 2WMQA 4EORA 1BX6A 1PXNA 3U6IA 1FINA 4AW1A 2WQNA 5DFPA 4U6RA 1MQ4A 1ZOGA 4WG4A 3GOKA 3OS3A 4MD8E 1Y6BA 3B2TA 4NCTA 4QTDA 4EOOA 3WZJA 2CNVA 3NUPA 4FX3A 3UP7A 4U7ZA 4IWDA 4CGAA 3DZOA 3FLNC 3W8LA 2UW7A 4WUNA 4N0SA 4FTUA 4O0UA 4APCA 5DOSA 4ZS0A 5EDPA 3ERKA 5J5TA 2B9JA 3TZ8A 2UV2A 4V0GB 4C2VA 5IA5A 1XH9A 2G2IA 4G5JA 4QYGA 4HYIA 3ZTXA 4F08A 1G8KA 3O23A 1JKTA 2W17A 1XH8A 4U9AA 3OXTA 4AXFA 4CXAA 1OL2A 4ENXA 3SD0A 3UVRA 4RJ8A 1U5RA 2BAKA 3Q52A 1JKLA 4O4DA 1LEWA 3OMVA 4NZWB 5CSPA 1SNXA 2UZEA 2QCSA 3W55A 4AA4A 4V0GA 2I40A 1IAHA 5ACKA 4KWPA 4R7BA 3LAUA 4K11A 5L2QA 4BDGA 3NW5A 1R3CA 3KC3A 5AV3A 4F09A 4FZ7A 4QYFA 3AKLA 2X2MA 3ORIA 4XP2A 2J0IA 4ITHA 4Q9SA 2QG7A 2VTQA 4MNEA 5AUTA 3BHVA 4YC6A 1PKDA 1Q97A 4KAOA 2JEDA 3NVMB 4IM0A 4O7ZA 4RJ3A 5D11A 3D7ZA 2IN6A 1JQHA 2VX0A 1KE6A 2I0VA 4ENYA 3SLSA 3CD3A 3PY0A 3PP1A 4IVBA 5CF4A 5HX6A 3KREA 3UVQA 2W05A 1PMNA 2R0UA 2W1CA 4C3PA 3AMAA 4RWJA 4CD0A 2FSOX 4M3QA 3BWJA 3F7ZA 3KXGA 3ORKA 4I4EA 2Y6MA 4QQCA 4DG0E 4QMPA 4XG9A 3RAIA 1WCCA 3DU8A 2HWPA 4YJUA 3SRVB 4RT7A 4PTEA 2R3RA 2GU8A 3ZZEA 4JRVA 3WE4A 1KV2A 2OF4A 4UX9A 5LVMA 4O82A 3LLAA 4RRVA 4MX9A 1OBDA 3D5XA 5ETIA 4F0GA 3G0FA 3P4KA 3UDSA 3EHAA 3FMNA 3A2CA 4Q2AA 2VGPA 5KMLA 5HIBA 4XX9A 1E1XA 2XJ1A 4FNZA 2BTRA 1YHWA 2EB3A 3Q2JA 4KBAA 4FKTA 3QLFA 3R1SA 2WQMA 5LVPA 3E8NA 5LVOA 4S2ZA 3DK6A 3C1XA 3FYJX 3KN6A 4O38A 4WNOA 3VBQA 3SKCA 3BWFA 5BVFA 2EXCX 4EC8A 4J52A 3E7OA 3G51A 4IAYA 5AP2A 1OKVA 2PTKA 2IW8A 3UVPA 2OJFE 3LFFA 4CVAA 3ZBFA 4RJ5A 3UG1A 3FSKA 2O2UA 4CCUA 3V3VA 4OGRA 2IVSA 5CXZA 2ITNA 2OXXA 4G3CA 3PSBA 2YCFA 2CCIA 3GT8A 4BYIA 4EK5A 5HO7A 3BGZA 1PYXA 2EU9A 3QX4A 4F6WA 5A54A 2WTKC 3QRUA 3UYSA 2BFYA 4QP6A 4RJ7A 3DQWA 3BKBA 3QZHA 4DGLC 5GZ8A 4BI2A 4O1PA 2HZ0A 3BYMA 3CE3A 4B8LA 4DHFA 2Z7LA 5IQFA 3R22A 3Q4ZA 3TZMA 5CVGA 1WVWA 2WB8A 3FMLA 2P33A 3EKNA 4F78A 4ZZMA 3ZFXA 2QKRA 3LMIA 1H27A 5CYIA 3KFAA 4QYEA 3OF0A 4KSQA 2XEZA 3UDTA 4FGBA 3DLZA 5BMMA 3OY3A 5AIRA 2YAKA 4EOMA 3PFQA 5AV4A 4PMPA 4ZTNA 3VULA 3QALE 3AD4A 1ZAOA 5M44A 4G31A 5I3OA 2XVDA 4CQGA 4FSTA 4C33A 1GZ8A 1WBPA 2R3KA 4WKQA 5FTOA 5HIDA 2CGUA 2J9MA 4MNFA 1YDRE 4OBQA 3UO4A 2UZWE 1BI7A 2Y0AA 4FYNA 5IMEA 3GVUA 1T46A 3R8UA 4J8MA 3FLYA 3PSDA 5EW8A 3D14A 1OZ1A 5CF6A 4DT8A 5J1WA 3VAPA 3PFYA 4BGHA 3H0ZA 1ST4A 1JSUA 3G33A 4U3YA 2XNNA 2QHMA 4FEUA 3KMUA 5HIEA 4O7NA 2CMWA 4KABA 4E3CA 4FSNA 5L6PA 3CGOA 3M2WA 2B0QA 3DGKA 3TL8A 2OSCA 5E92A 3HMIA 5HNBA 3NPCA 2JD5A 4M67A 4FIIA 3MGYA 4GUEA 3Q3BA 5ACBC 3F2NA 1K2PA 5L8KA 3DBCA 2X8DA 2XK9A 3QYZA 2UZDA 4O7WA 3FZTA 3OT8A 3QFVA 3ZO3A 3C0IA 3BX5A 4KKGA 3E8CA 3LFNA 4LV5A 5FLFA 3A8WA 3IK3A 3UIUA 4DTKA 2J0JA 4XG4A 3UC4A 3MSSA 1UU3A 4U45A 3F7WA 4L3LA 3QCXA 1Z57A 5HKMA 4DCEA 4ID7A 3O0GA 1Q24A 4GJ3A 3D5WA 5CAQA 3QRKA 3Q04A 3RPRA 3I5ZA 4EOKA 4EQMA 1DI9A 4EWHA 3PJCA 2OJ9A 3FKNA 4QQJA 5AM6A 4MF0A 2XB7A 2GQSA 4QT1A 4BDEA 1JBPE 2C6LA 3ZFYA 3EJ1A 5L8LA 4FKGA 1JLUE 2NRUA 4RJ4A 3UC3A 4QYYA 3P78A 5BVKA 3ZO1A 2GQGA 4CTCA 4XLVA 4AGCA 2QC6A 2X2KA 2P0CA 4FJVA 5HLWA 3JVSA 3QHWA 2C4GA 5M4FA 3Q4UA 4BZDA 1WBVA 4AT3A 4LQMA 3I1AA 3HA6A 3VS2A 5IA3A 5HVKA 2HZNA 3PVBA 4WHZA 1W2CA 2HW6A 1O6YA 3NZ0A 3AC8A 3PYYA 3GBZA 2R3JA 3KVXA 5IH4A 3S00A 3RAWA 5E8SA 3T8OA 5IEVA 2JKKA 4BCOA 4X6QC 2PVRA 4F7NA 5DWRA 4FV0A 4D1SA 5TKDA 2VTRA 4ZJIA 2EXEA 2LAVA 1J1BA 4MK0A 3NMUF 5FD2A 4KBKA 1QCFA 4X3FB 1YXUA 5HVJA 5AP7A 5LMAA 3RINA 4IAZA 3W16A 4XBUA 4RG0A 3IW7A 2VTMA 2CKEA 3VRZA 3TKIA 4TXCA 3EN6A 2UUEA 4LMUA 3AC4A 3ZXTA 3RAKA 2ZYBA 3DJ5A 3HECA 3KXNA 2GNHA 3QXPA 4YJSA 5F1ZA 4WNKA 3W2OA 2EXMA 4MXOA 3UJGA 4AU8A 3NCZA 3WZUA 4FE2A 4JDJA 2JDSA 5IDNA 4YBJA 1URWA 3HV4A 5D41A 4JG8A 4KINA 4K6ZA 4Z55A 4M68A 3VUDA 3BLAA 4RFZA 3ULIA 1NVSA 5FEDA 4C02A 1HOWA 2Z02A 3KRRA 2IO6A 3DKCA 3NGAA 3W2PA 2ITTA 4HPTE 5CT7A 3F2AA 3HGKA 3FKLA 3OBJA 3UG2A 4B6LA 5B2MA 1YI3A 5IA4A 5HCZA 2ZB0A 5M06A 4UEUA 4RIYB 1FVTA 5A46A 1JVPP 2OJJA 3E8EA 5HO8A 1M2PA 3FHIA 4KIKA 4D5HA 4FT7A 4JDIA 3AKKA 3DAKA 3ZYAA 2O3PA 4QMSA 3V5TA 5EH0A 3E5AA 5KKRC 1JWHA 2PZPA 3GC7A 2R7BA 3HV6A 2REIA 2OZAA 3QBNA 4RIYA 2C1AA 2XM9A 2W4KA 2Y7JA 3QD0A 3RWPA 4ORKA 4IVAA 3FPMA 1U54B 5K0XA 5AUXA 2BCJA 3AQVA 4PX6A 4YPSA 4O96A 3VW8A 3VS1A 3PSCA 5A4LA 2BVAA 3PY3A 4IANA 4UYAA 4DEGA 2NYAA 5CSWA 2BPMA 3BGPA 1MP8A 4XG7A 4ITJA 4S31A 4ZP5A 5E1SA 4UMPA 3E3BX 2UZLA 3GNIB 2H8HA 4KS7A 5AR8A 4BZOA 2ITVA 1YOJA 4CNHA 1U54A 4M14A 4G6OA 4F6UA 3SVVA 2OH4A 2XIXA 3I6WA 2GHLA 4RWIA 1ZXEA 1Q3DA 2X4ZA 5HG7A 5CXHA 3FZOA 3R2BA 4L6QA 4R3RA 4GK3A 4ASXA 3OOGA 2ERKA 1H4LA 2Z60A 3DA6A 4MAOA 3TNQB 4CMOA 3ODYX 4G9RA 5DI1A 1O6KA 1XWSA 2BR1A 3WF7A 2XAMA 2UW5A 3U54A 2CN8A 4RPVA 3ATSA 4LMNA 4GRBA 3MDYA 5E8WA 2WTJA 1OKYA 5EM8A 1VJYA 2Y9QA 3MIYA 1XO2B 3WZDA 3E63A 4I5CA 5A4EA 1KE9A 4EH8A 5J79A 4HZRA 2XKEA 4O22A 4CMUA 3L9MA 5EDQA 5AUUA 5DEYA 1W98A 2BHEA 2JDRA 1PXJA 3FE3A 2YZAA 4BBFA 4DFNA 2XM8A 3DS6A 4FL2A 4HYHA 1OGUA 3FMDA 4DTAA 2W99B 4NYEA 2R2PA 2VO6A 2YCRA 4X2KA 4FSUA 3C5UA 4BCNA 3D2IA 4C35A 4K18A 3R71A 3P23A 3CKXA 4MEDA 2C0IA 4WO5A 2QI8A 2YZLA 3U55A 5HTCA 5KBRA 3F5GA 4YZMA 2YEXA 4ALWA 3WI6A 5IKWA 2YWPA 2XCKA 3PUPA 4O4BB 4EUUA 5AAEA 4CLJA 3Q32A 3LHJA 2VTAA 4CKRA 4A7CA 3ZUUA 2FVDA 2WPAA 2J2IB 3A7GA 3R1NA 4XV9A 3ZOSA 4EOSA 1ZZ2A 3PA3A 4CYJA 4C3RA 1E9HA 1BL6A 4QMXA 3F82A 2CPKE 3HDNA 3R8PA 4FTKA 5HG9A 4EZ7A 2XK6A 3BPRA 3SXRA 4I94A 3AMYA 4IQ6A 5FQDC 2XF0A 3QU0A 2BHHA 3QGWA 2EVAA 2Q0BA 4FNYA 4H3PA 4NK9A 4D58A 2ZDTA 4O6EA 3VN9A 4K9YA 3QQHA 4JT3A 4A9UA 4MXCA 5CU0A 3L1SA 3MYGA 2HY81 2OBJA 4WIHA 1H1WA 4FNXA 5LARA 4L46A 2R64A 4XHKB 3RAHA 3HMOA 3WF6A 1KOBA 3W0RA 3LXPA 5GZ9A 4O4CA 4IWPA 3D4QA 1MUOA 1SZMA 4X21A 2VTNA 2JLDA 2XS0A 4GCJA 3LFAA 2ITOA 4C59A 3QQFA 3OCSA 4J95A 1QPEA 1OM1A 2WTCA 4R7IA 3CPCA 1EH4A 2YA9A 4QP9A 2OZOA 1ZYJA 4H3BA 4R3CA 5BVEA 4E6CA 1A48A 4OTIA 4CYIA 4QMMA 4M13A 2QR8A 5B7VA 2G01A 4D0XA 3LIJA 3UNZA 4IXPA 3RNIA 4EKKA 4CFXA 1BMKA 1W82A 4RX7A 3C9WA 3VBWA 4KRDA 4HPUE 2PVKA 5CLPA 5KX8A 5BYYA 3ORPA 4C4GA 3H10A 3RHXA 3SDJA 4EHVA 4EKLA 5HHWA 3UODA 3OG7A 1W2DA 3HNGA 5DG5A 4D4SA 2C47A 4RC3A 1CM8A 3ACJA 3M11A 4Y46A 4HJOA 4BWKA 5E8ZA 3UQGA 5JGAA 3CY2A 3C0HA 1YHVA 1SYKA 3UO5A 5J9YA 2IWIA 4FSQA 3R6XA 3EFJA 4FODA 4Y5HA 4PL3A 5CTPA 1PHKA 2P4IA 1F3MC 5AP5A 5GZAA 3OXZA 3BU6A 5LMKC 5FBOA 1VLRA 3VS4A 3O8UA 3OEZA 1R78A 1STCE 3RBWA 3RVGA 1YVJA 2WMTA 2XNGA 5E8TA 4GT3A 4FA2A 4MUQA 4USFA 2XALA 4ZY6A 4MVFA 3ZM9A 3TV6A 3PE1A 2XJ0A 3MN3A 4ZEGA 3ULZA 4C3FA 2XIRA 3SW7A 4XCUA 5C03A 4BGQA 4EYMA 3SXFA 3LE6A 1ZYLA 3BYSA 3D7TA 5K3YA 4AGDA 2W1IA 3MBLA 2PMNX 3BHTA 4OTGA 4TZRA 1WBSA 5IF1A 3QD2B 3BV2A 5FRIA 5M4IA 4C34A 2GPHA 3HV3A 1M7NA 3SAYA 3HAVA 3SGCA 4MBLA 4TYGA 5KMKA 3Q2MA 2YITA 3FDNA 3W32A 2FGIA 4QP4A 4DHIB 5IH5A 2WEVA 5H8BA 4IZ7A 1ST0A 3F5UA 1K9AA 5JSMA 3MIAA 3POZA 4FEQA 4LRKA 4LDTA 3SG8A 4YC8A 2VTLA 3TN8A 1FVRA 2CJMA 3DK3A 4BCKA 3DNDA 1M52A 4OW8A 4AUAA 2I6LA 2VWBA 4RZWA 3ORTA 3KCKA 3N4UA 4QP3A 4XUFA 3TKUA 4D1XA 3I0OA 3PRFA 3V8TA 5CEOA 4IB3A 2NO3A 4O7LA 2OJGA 3DCVA 3TKHA 4DGOA 3OZ6A 4HGLA 3L9LA 2OU7A 2IVVA 4OTWA 2BRHA 4AN9A 5DYJA 4DCAA 3QUDA 1W8CA 4KNBA 5HGIA 4CRLA 4Y5QA 4CTBA 2UZVA 4GIIA 2ZMCA 3ZS5A 3V8WA 4AF3A 4CKIA 4FKPA 4F9BA 3UIXA 3E64A 4QMUA 1V0PA 2Q0NA 3PIZA 4DH3A 2W9FB 2QOIA 3EN7A 4JMQA 1OVEA 2AQXA 4BN1A 3TUCA 2ZV9A 3RP9A 1V1KA 3OWPA 3LFEA 2WMWA 4IFGA 1BI8A 3I7BA 3DBDA 3NAYA 3SOAA 4F7LA 2I0YA 1TVOA 2HWOA 3NYOA 3QWJA 3HP2A 4OR5A 4BTFA 5D10A 3BL9A 3E7VA 3R8VA 1CKPA 3T3VA 2WQOA 3B2WA 5AUVA 4I0RA 1REKA 1OI9A 3OD6X 4XP0A 2JIUA 3PP0A 4IZYA 5CWZA 3V51A 3WF9A 5IEYA 3S1HA 3UMWA 2ETMA 3L9NA 3MFTA 4ZSJA 4IAFA 3FC2A 4D2VA 3Q60A 4KSPA 4ZSEA 1YOMA 3UBDA 2R3MA 5I3RA 4LM5A 4DGGA 3R01A 1YXTA 3QRJA 1R0EA 5BUEA 2BZJA 3BGQA 1YWNA 5HQ0A 4P5ZA 2J90A 5EM6A 3R7EA 2WU7A 2WIHA 3I81A 3KY2A 2PZYA 3NUXA 3HLLA 4QRCA 4ZSLA 5BYZA 4EH9A 3LQ3A 2XNMA 5FM3A 5HE1A 4ANLA 4FTJA 4DEIA 4FEXA 5E4HA 4JX3A 5EI2A 2VGOA 3EN9A 2PVNA 3F5XA 3OWLA 4FUYA 4UB7A 5CU2A 5J8IA 3FXZA 3R83A 4ZAUA 5C4KA 3EFLA 4XV1A 3R9NA 4Q5EA 3C4WA 3DFCB 3TACA 4F9AA 2OG8A 4R1VA 4K1BA 5JN2A 2JKMA 3HP5A 3DTCA 3W1FA 3QTRA 1MRVA 4UBAA 2C3LA 3GU6A 4QD6A 1F0QA 3W0PA 2W1HA 4O7YA 4JDKA 4QYHA 3R63A 4WRGA 5BV3A 3TTIA 5AFVA 2HW7A 2OICA 1SVEA 1UNGA 2O63A 2V5QA 3PG3A