5HIDA

Braf kinase domain b3ac loop deletion mutant in complex with az628
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
269
structure length
257
Chain Sequence
DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGLAEQLSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Activation Mechanism of Oncogenic Deletion Mutations in BRAF, EGFR, and HER2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
total genus 78
structure length 257
sequence length 269
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hidA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hidA01
3R9OA 3AT2A 3ZFMA 3ZRMA 4C37A 2O5KA 4PMMA 3MY1A 1UA2A 1VYZA 5K4JA 5K5XA 4IWOA 4IFCA 3UC3A 5IMEA 3UMWA 3WBLA 2W1FA 1CMKE 2E9PA 3ORNA 5CI7A 4M0YA 3UIBA 5C01A 4ZXTA 4BHZA 5BUIA 5KMNA 3CSVA 3R30A 3DGKA 4RIYB 2GNLA 3D5WA 3H9OA 4XOYA 2J0JA 2W1DA 4CFNA 3ZOSA 4ZZMA 4YTIA 4AN3A 3ZO1A 5T3QA 1Q97A 1XH6A 2UZLA 3DV3A 4RIXB 3PSCA 2C6TA 4KBAA 5EW8A 5BQ0A 3P7AA 1ZMUA 4K6ZA 1J7IA 3OXIA 4GV1A 3UQCA 1QPJA 3OY3A 4J97A 1WBTA 5DNRA 4ZZNA 3PZEA 3HA6A 2O8YA 4MXZA 5HX8A 2QVSE 3W2QA 3QGWA 4FE2A 3ZC5A 4RPVA 1H01A 4F6UA 4D2WA 4TKSA 3I7CA 4PY1A 3N4UA 4ZY6A 1FMKA 3ZH8A 3G6HA 3VUDA 3R7VA 4MH7A 5AJQA 3E62A 2VU3A 5J9ZA 4L9IA 4DH1A 1DAYA 1VR2A 3BEAA 4IFGA 3SOCA 4FEQA 1U4DA 3VVHA 1IAHA 1IR3A 3KRLA 4QOXA 4UMRA 3WF7A 2VWZA 4YC3A 5HE0A 4E20A 3EFJA 2R3JA 1ZOHA 1LEWA 4FOCA 4QMVA 4AW5A 4AOJA 4BCMA 3ZRKA 2AC5A 3OFMA 3QTUA 1ZOGA 3QA8A 4WUNA 4JVGA 3VS0A 4USEA 2PYWA 3FKLA 4IAKA 2ZDTA 2QI8A 2QOLA 5EM5A 4F1MA 2B9IA 4EK3A 5CT7A 4KSPA 4H3BA 3IG7A 4BN1A 3TV4A 4UXLA 3V01A 3Q6UA 5KMOA 2F2UA 3E8NA 2ZJWA 3NR9A 1M2PA 4V04A 3ZM9A 5CENA 4L44A 3BCEA 4JRVA 4UWBA 2XRUA 2YAKA 3NUXA 4IAYA 2QU5A 4J1RA 1GZNA 4MWIA 4NH1A 4UWYA 3UNZA 4L3JA 4YGAA 4BVUA 3DXPA 3OEFX 5HG7A 2IG7A 2B9FA 3CLYA 1Q8YA 3RZFA 3ORXA 3FSKA 1H1RA 4NIFA 3UIXA 4ASZA 2XCHA 2C6MA 2R3MA 3GCSA 4FBXA 4H58A 4O27B 4BF2A 2JDRA 1U54A 2G2HA 3LFAA 4GKIA 5CASA 3TT0A 4RJ8A 4GT4A 4R1YA 3UZTA 2UZWE 4MKCA 2IVTA 3A8XA 3FQEA 4EC8A 4RZWA 4BDDA 4PDPA 4PTGA 3BWFA 4BDHA 5IQBA 3WE4A 2CKQA 2GMXA 4O96A 2XF0A 4RFMA 4AZFA 4WSYA 4DA5A 3NW7A 3O71A 2YCRA 3HLLA 4WO5A 3VBVA 3NUPA 4W4XA 1Q8UA 3NVMB 3ZBXA 5IA1A 2GSFA 4HCUA 3RAWA 1OPLA 4YZCA 3KN6A 4FKWA 5J5TA 4F9WA 5EQEA 1OKZA 3EYHA 4YJPA 4JR7A 3AGMA 1GIJA 3V5WA 3HZTA 3P5KA 1R0EA 4H1JA 4PPBA 3U6HA 4FTQA 2XKDA 4EZ3A 2R7IA 3OZ6A 4AT4A 1PXNA 2XYNA 5FG8A 4AWIA 3FLWA 3NW6A 2WZJA 4GUEA 1JWHA 2ZVAA 4HNFA 3R7OA 4XH6A 3NWWA 4O91A 5JGAA 3SQQA 3JYAA 2PZ5A 4TNDA 3HV5A 3MFSA 4FVRA 2ITXA 4EHVA 3Q6WA 4CQGA 4KIKA 4FKRA 4MXYA 1M7QA 2GDOA 3TKIA 3ZC6A 4RIWB 1TKIA 3ENMA 1YXXA 4DFBA 5E92A 4AOIA 3FZRA 2X7FA 4W4WA 5BX0A 3LAUA 4FKLA 3LPBA 3LXKA 3AXWA 4E7WA 4GRBA 4TWNA 2F2CB 4FG9A 3P78A 5LWNA 4UB7A 4UMUA 2BRNA 4ORKA 3DBFA 4C7TA 2R5TA 4CKIA 4YSJA 4G3DA 5AUUA 2PUNA 4JDIA 3RAHA 5AP2A 4A9UA 5M06A 3QTIA 5KE0A 3DBEA 5C8KA 3C0IA 5M08A 3BHHA 4DLJA 3GC7A 4CSVA 3TDWA 5HO8A 3Q4CA 3EQGA 4YURA 4AG8A 3CGFA 2OZAA 1OKWA 3OXZA 3W18A 4DGOA 4FTOA 1UU3A 5AP1A 3FXZA 3VS3A 3KRRA 3E93A 5KNJA 2H96A 4YSMA 5AR7A 5AP7A 3QRKA 5H9BA 1QPEA 1RJBA 1PHKA 2BDJA 4JQEA 2C6DA 4G31A 1ZZLA 4PX6A 2HK5A 2C0OA 4F9BA 3UO5A 3QU0A 4BDGA 2YWPA 3VBTA 3MPAA 3R73A 2YFXA 3ALNA 3FLSA 4PNIA 2VO6A 5A3XA 5AX3A 3F82A 3THBA 3GQLA 3ZLXA 4ACCA 2IVVA 3TZMA 3NNVA 4HJOA 4F7SA 5HVKA 5L2SA 4TYHB 2XNEA 2W1HA 2R3KA 1VJYA 5E8TA 3H4JA 4JT3A 3R7IA 4S34A 5FD2A 3ACKA 2ESMA 3W32A 3W55A 5AUWA 5E8WA 3ZEWA 5JEBA 4C34A 4E5WA 3KXXA 3VUHA 1MRVA 3GC8A 2QO7A 4EH7A 5BVOA 3G5DA 3SA0A 4FOBA 1BX6A 5A6OA 1H24A 2PE2A 4YC8A 3TZ8A 3Q2JA 5DG5A 4BCGA 5EDPA 2WTKC 1B38A 3PVWA 3R04A 4QQ5A 4TPTA 1JQHA 3COIA 4IH8A 1ZYDA 3DKOA 4V0GA 4TT7A 2C68A 3LXNA 1CM8A 2R3GA 1W83A 3VRYA 4I6HA 4FZDB 4AFJA 3MJ2A 3V5LA 4EI4A 5HI2A 4U3YA 4EBVA 3UOJA 3QD2B 3KXGA 2ZV9A 3LFSA 5CEOA 3F3WA 4YJOA 5LOHA 1NA7A 5FTQA 3LLAA 4PDOA 3QKKA 3OT8A 3PP1A 4AFEA 1NT2A 3RAKA 4DE4A 3N4VA 3KREA 4ARKA 2GFCA 4KIPA 1H1WA 3QKMA 2XVDA 2HCKA 4I4EA 2CNUA 1OMWA 5M4CA 1E9HA 4FT3A 4RJ3A 3TDVA 1Z57A 2GNFA 4QYEA 2UUEA 3A4PA 2R3RA 3ODYX 5HESA 4YUQA 3LMGA 1WBOA 5AFVA 3AC4A 3A60A 3FXXA 1YI6A 2IO6A 3MPMA 2WMXA 2XIXA 3GNIB 3MVLA 4IAAA 4M69B 4O7TA 3PYYA 3DJ7A 4NCTA 2BRGA 4LGDA 3SRVB 3V8TA 2QLUA 1ZY4A 2CPKE 5FXRA 2C3LA 2OSCA 5KMIA 1TQMA 4H36A 3E87A 1PXIA 4KNBA 3EN5A 3AT3A 4GT3A 4M15A 3UGCA 2XK6A 2RF9A 3EQFA 4FNXA 4GK3A 4BKZA 4F1OA 4Z7HA 3E7OA 4TYGA 3HNGA 5HIDA 4ZY4A 3HV3A 2Y4IC 5J5SA 1DAWA 3ATTA 2VRXA 3F2NA 2EWAA 2WTVA 2YISA 2VWBA 3GOPA 3F5XA 5A4EA 2ONLC 3OF0A 2G2FA 2X9EA 1S9IA 3COKA 3NAYA 5I3RA 3RINA 2WB8A 3R02A 3OCTA 3PIZA 5B0XA 3O0GA 2QHMA 2ZMDA 4LRJA 4EZ7A 4FKUA 4ZJIA 2CKPA 3DQXA 3FEGA 5ITAA 3KA0A 4XLVA 3VW6A 3R7UA 1JNKA 4K2RA 3R7EA 3FI2A 4IVBA 3VUKA 2W96B 5EYMA 4GU9A 4XG6A 3TKUA 3G0FA 4G9RA 1IG1A 4FZ6A 4O82A 2BDFA 3OW3A 3QQUA 4G6OA 4A06A 2HWOA 5KHWA 3DTCA 2W4OA 4BCKA 3CD8A 5HE1A 4QNYA 5AUZA 4DTKA 2JDOA 4ZLOA 4RZVA 1JAMA 3P4KA 2GHLA 2HXLA 2B54A 2PVJA 2UW6A 4J96A 4WSQA 1IA8A 3PVGA 3O2MA 2FO0A 5GJFA 1B39A 3LJ2A 4M14A 4ZLZA 4U3ZA 5JRQA 5M55A 3Q4ZA 2RFEA 1PXPA 4RBLA 2X4ZA 4YJUA 4DFXE 2ZM4A 1F5QA 2GS7A 3D0EA 4BGQA 2ITNA 1QMZA 2F49A 4QP3A 4HZRA 1OPJA 3D7TB 2G01A 2X81A 3SHEA 4GFGA 2OFVA 4FV0A 3O50A 2QCSA 2HZNA 4O38A 4BDJA 3QFVA 4JRNA 4QYHA 2A2AA 2WU7A 2YIYA 3BE9A 4D2VA 3KKVA 2Y4IB 2Q0NA 4P5ZA 5HG8A 4EOKA 4RX8A 2PVKA 3NIZA 4BDAA 2OXYA 2A0CX 3B2WA 4R78A 1XH7A 3P7BA 4F0IA 3NYVA 3AC3A 4YLJA 3NYOA 1KSWA 4MAOA 4BTFA 5GJGA 4PPAA 4E73A 2PUPA 5EYCA 2VWVA 3OBGA 4U8ZA 3NUUA 3WOWA 3D14A 3O8PA 3ZXTA 1OGUA 4RRVA 4TWCA 4AXAA 3M1SA 3K54A 4S2ZA 4GIIA 3VS5A 3M42A 4QMWA 4KD1A 2XNBA 4DEDA 3QUEA 3PWYA 4LFIA 3RPOA 2ITTA 4OTGA 5L6OA 1R3CA 2WIPA 3F6XA 3TL8A 5H3QA 3D2KA 4FKTA 2PZYA 2YITA 3OMVA 1FOTA 4QMPA 4NM5A 3TNPC 4BDBA 2R3HA 4LL5A 2WTCA 5DEYA 5DGZA 4AN2A 1G8AA 1V0PA 5IH5A 2ITQA 4HGSA 3POOA 4BCPA 2WOUA 4HYUA 3BHVA 2XEYA 4JLCA 1JKKA 4HGLA 1BLXA 1DM2A 3MFTA 3VJOA 4ACHA 4IDTA 2XKFA 4FSQA 3QZHA 4QMUA 5JN2A 3CQEA 3D4QA 3KXNA 2PVFA 4FIHA 4RC2A 4BTKA 4JBOA 4CV8A 4NIFB 3CY3A 3DFCB 3R9RA 2DQ7X 1A06A 2CJMA 3F3TA 4FK6A 4NCTC 2ZM3A 3UIUA 4GG5A 3V5JA 2YDKA 4ZY5A 5DE2A 2ITZA 1Y6AA 1MQBA 3A7HA 3ZRLA 4FL1A 4AW0A 2F7ZE 3NIEA 2C30A 1A48A 2LGCA 2R3NA 4PP9A 4HPTE 1BKXA 4FZAB 3TWJA 5C8NA 1UV5A 3EQDA 5D41A 3F3ZA 5C27A 3PJ2A 1V0BA 3Q52A 1U5RA 2WMSA 4PQNA 5HCXA 3QCYA 3PVUA 2BDWA 2ETMA 1OL6A 4LRKA 1BI8A 4AU8A 3GU7A 2BZKB 4PUZA 4WKQA 4C58A 4R77A 4GL9A 3EIDA 5IPJA 2J5EA 3LM5A 4JG6A 3VUGA 2HELA 5DEWA 2R0UA 5TT7A 3GU6A 2FB8A 4KAOA 4G3EA 4MYGA 4O6LA 3M2WA 4LM5A 3OEZA 3ORKA 3CS9A 3S1HA 5FTGA 2V62A 3KEXA 5EOLA 4P90A 3NW5A 4CLJA 5J7HA 4F08A 4WUAA 2XK3A 3OBJA 4JAJA 4YBKA 4C4FA 5CNOA 3A2CA 4BRXA 4O0XA 5EM6A 3U87A 1GNGA 3GFWA 1ERKA 3DQWA 3V5PA 4DINA 4JG8A 2NPQA 3DZQA 2C5XA 4IAFA 1H1SA 3R9DA 2OJGA 3D7TA 4IB0A 5I9YA 5J87A 3RPVA 3ZLYA 3HYHA 3KMUA 3UBDA 5M07A 2QOOA 3SW4A 4K8AA 4MBJA 2VTTA 1GZOA 3DXQA 1WVWA 3EQHA 5FBNC 3ELJA 3TNWA 4RLLA 4GEOA 1UWJA 4EH9A 2HW7A 3ATSA 3KRXA 4BIBA 4C3PA 4TXCA 4DCAA 4ALUA 4DEAA 2YA9A 2Y8OA 3MVMA 5F9EA 3PJCA 4BWPA 2C6IA 3PDTA 1Q8ZA 1BMKA 4UV0A 4D0WA 2WHBA 3KL8A 2H9VA 1M52A 4FMQA 2CGVA 3QXOA 1E1VA 1OZ1A 2ITPA 1IEPA 3BZ3A 5L6WL 2YWVA 4ZS4A 4TY1A 2C0TA 4YBJA 3ZFXA 2HY0A 4HVDA 4DG3E 2X4FA 2C0IA 3RPSA 2PVHA 2QONA 2EB2A 4NM3A 4O7LA 1I09A 5G1XA 2C4GA 2CNQA 1VYWA 3LXPA 5LARA 3RVGA 3E3PA 5CT0A 5HGIA 1CDKA 3BLQA 1H07A 3QTQA 1UU7A 5CSWA 4F6WA 4NJ3A 3F69A 2FVDA 3H10A 4NFNA 4NSTA 3COMA 3QXPA 2VGPA 2WGJA 4R5SA 2UZNA 3Q4UA 3R71A 1OPKA 5KKRC 3ZFYA 3CKXA 5CF5A 3DB6A 3JY9A 3QQHA 4XX9A 2Y6OA 3Q96A 5E8SA 4C33A 3JS2A 3I0OA 1DI8A 1FVTA 1NVQA 4S31A 3MW1A 4R3RA 5DI1A 1Q61A 2C6OA 4GT5A 1BYGA 4XV9A 4YTFA 4A4XA 3QTXA 2OGVA 4JDHA 4FTNA 1MQ4A 2B9JA 5ANOA 4BI2A 1K3AA 2XK9A 3BI6A 5KX8A 5A14A 3TKHA 3C9WA 2HZIA 2YM5A 3F5UA 2J51A 4KSQA 4ITHA 5CVHA 2QR7A 2QR8A 3VC4A 5IUGA 2BRHA 5HOAA 5FM2A 4ZIMA 4CRLA 1PKGA 4F63A 3TUDA 2JKOA 5IDPA 1AGWA 3CIKA 2VUWA 4AAAA 2P0CA 5HORA 2DWBA 3BHUA 4QYYA 5HLWA 2W05A 3JVRA 4JJRA 4Z9LA 5BYLA 3FMLA 2WMAA 4OBQA 4E4LA 4HW7A 4K77A 2C5VA 3WZJA 4FZ7A 1GY3A 2EXEA 3OW4A 3PXQA 3U4UA 3KVWA 2BFXA 4IC7A 4JIAA 2YCQA 2XNGA 1XR1A 5IEXA 3NSZA 2GNIA 3V3VA 4HVGA 3OWPA 2XNOA 5IA0A 4AP7A 5HTIA 3CTHA 3KB7A 3VS4A 1UNGA 3HP5A 3PSBA 2IZSA 1GOLA 4YJNA 4QTEA 5BUJA 4D4RA 1P2AA 2XKEA 5F20A 2WMWA 4IVAA 1Z5MA 3KRWA 2ZMCA 2PUIA 4P7EA 3ORZA 2WD1A 5LJJA 2JLDA 4XV3A 3QZIA 3FC2A 3PA5A 3JPVA 4BWXA 3RPYA 2C6KA 3QCQA 4NKAA 3SLSA 4O84A 3QRIA 2OIQA 4UEUA 4O0UA 2I0YA 4E4NA 2OBJA 2CGXA 4E6AA 2XZSA 2RFSA 3IW5A 4J52A 1PY5A 4MXXA 4JDJA 4KB8A 4NL0A 4RIOA 4FGBA 3RP9A 3SGCA 4L7FA 4E6DA 3FZPA 5AV4A 4RWIA 3FL5A 5CU0A 2IVSA 4RQVA 4JOAA 3VUMA 2V5QA 4HGTA 4NEUA 2EVAA 3QZFA 3TTIA 3R22A 5DFPA 3D5VA 3FMMA 4XUFA 5IQEA 4BIDA 3EMGA 1O9UA 3BYVA 3C4WA 2UW0A 3LFDA 3QWJA 2YJSA 5DR9A 3RK7A 3VW8A 3FY2A 4HCTA 4BDFA 4ENYA 4FTTA 4R1VA 2VWXA 2QKRA 4AW2A 2JITA 2I6LA 3TZ7A 4U6RA 3GFEA 4O86A 4BZOA 4FIGA 4WG3A 5DT3A 5ICPA 3TZ9A 3BYUA 3UOHA 3BX5A 3WYYA 2PHKA 3IOKA 4AF3A 4O81A 4FG8A 4L67A 4EJNA 4FKQA 3EKKA 1KE5A 4I0TA 5EH0A 4EOSA 2JKQA 4DFUA 2F7XE 3LFFA 2PWLA 4YZBA 3IONA 3MS9A 4ACGA 4I22A 5KMLA 1UNHA 3OOGA 4UN0C 5J9LA 4G3GA 4HGEA 4DFLA 1APME 3RI1A 4TL0A 4GVAA 3C4CA 4I5PA 2XBAA 5E8UA 5IA5A 4YHFA 3VULA 4FEXA 5FP6A 4BCJA 4JS8A 3C7QA 2Y4PA 2HENA 3F88A 3R1YA 5AUXA 5LCJA 2BZJA 2W99B 2PK9A 2QOHA 3C4EA 2XNNA 5CSPA 5JK3A 4O6EA 4CG8A 1XJDA 3PIXA 4QT1A 2VV9A 4K0YA 4GW8A 4RC4A 3VJNA 5IF1A 3OCGA 1XHAA 5A4TA 4RLKA 4EH6A 4UY9A 5CALA 1KOAA 3F3VA 5JQ8A 2H6DA 1BL7A 4I5HA 3OP5A 4EOIA 4D55A 2BIKB 3KQ7A 1OBDA 3RWQA 4YJVA 5KZ0A 4BBFA 5JFSA 4WOVA 3OTUA 3TI1A 4EOOA 3ACJA 3ZO2A 4OTWA 4FA2A 5JKGA 4D1XA 4USDA 4P5QA 4D1ZA 4U42A 4EYJA 3OT3A 4IQ6A 2ITUA 4ZTNA 5LVPA 1JKSA 4IZ5A 5F94A 3U6IA 4O7ZA 2I0VA 3NZ0A 5FXSA 3HV7A 4E93A 4NKSA 5L2WA 4QMYA 2WIHA 4F7LA 4TW9A 5C26A 1W0XC 5AV1A 3WZEA 4FVPA 3DB8A 3N4TA 5EI8A 2REIA 1PMNA 2UW3A 3IPHA 5AAFA 2BTSA 4UZDA 4FNYA 3K5UA 5ANIA 4OW8A 1SZMA 2BPMA 1I44A 3LVPA 4WNPA 3HV4A 4K9YA 4C4HA 5GIPE 2BKZA 2J2IB 3HVCA 4FODA 3TTJA 3GB2A 1WFCA 1URWA 3RKBA 5AR3A 3O7LD 3FPMA 4DFZE 3CBLA 5A4QA 4F6SA 4U81A 4R3PA 4CMTA 4E4XA 3EQBA 1ZYJA 4P2KA 5M09A 5CZIA 3NAXA 1FVVA 4R7HA 1R39A 4M84A 4PF4A 3UC4A 5DMZA 5LWMA 3UPXA 4NM7A 3QTRA 4APCA 2EB3A 4CCBA 3EL7A 4BB4A 3ZZWA 4G9CA 2KULA 1NXKA 3K3IA 2B1PA 1H8FA 3IOPA 4BDCA 1WBPA 4M7IA 2XJ0A 3F2RA 1PXKA 3T9IA 4KWPA 3BU3A 5GZAA 3PRFA 3QYZA 4DG2E 2VTAA 2A27A 2R3IA 4O7WA 3OHTA 2IZUA 4A4LA 4CFFA 2QG5A 5D11A 4X6QC 5HCYA 3FL4A 1YHVA 4GMYA 1GZKA 5EYKA 5LMKC 1QL6A 4BDIA 5A4CA 5HIEA 3G6GA 1KE9A 3LCDA 4QTCA 1J3HA 5IISA 2FGIA 2Y0AA 5TO8A 2CMWA 1U59A 4ZOGA 4RX7A 3KMMA 5HVJA 3VF9A 4ZLYA 3RMFA 4MXCA 1ZAOA 2VWIA 3B8RA 3QTWA 4CFUA 4WHZA 3DLZA 4D5KA 2R3QA 3I81A 3CTQA 5AV3A 3QCSA 5AX9A 1G8SA 1LEZA 2O3PA 2CGUA 5EG3A 4S30A 3L9LA 5EKNA 4HVHA 3FJQE 5CSXA 3TN8A 3DS6A 1O6KA 2BILB 3ORMA 5CZHA 3ZSHA 4FC0A 2OXDA 1JBPE 3BV2A 3MTFA 5FTOA 4TYHA 4EKKA 5AAGA 4NWMA 4HNIA 3QKLA 5CU3A 3EFLA 5DVRA 3WYXA 5EFQA 1PRYA 4M69A 5IZFA 2G9XA 2Z7LA 3FQHA 3GI3A 1STCE 4BDEA 4EBWA 5E4HA 3E92A 1YDSE 3ZUTA 1A9UA 4GFMA 3CP9A 2R3FA 5CANA 2UZVA 3V5QA 2LAVA 4BGHA 5IG1A 2PY3A 1O6LA 2AUHA 2XYUA 2J5FA 3IW8A 5DLSA 3RZBA 4C62A 4E5AX 4CEGA 4CZTA 2P3GX 1PXOA 2Z8CA 1Q8TA 2F7EE 4IM3A 5K5NA 3LQ3A 3C51A 2R3PA 4QMNA 3ANRA 4UBAA 3D15A 4AN9A 4BBEA 2QNJA 3JY0A 5HICA 1AQ1A 2I0EA 3FE3A 4K33A 3KK9A 4QTDA 3FMEA 3IDPA 4YP8A 4DG0E 3MGYA 3E64A 2JFLA 2OH0E 5C03A 5KHXA 3K5VA 2O2UA 1K9AA 4BKYA 2VX0A 3PSDA 3LFBA 3LMIA 5LMAA 3H0ZA 1R78A 2WAJA 5AP4A 3RK5A 3ZO4A 4EH4A 1UVRA 1H26A 2IZRA 4OTQA 3EL8A 1F0QA 5ETAA 2PVLA 2ITYA 2XJ1A 5IQIA 3FC1X 4II5A 2HW6A 3ZM4A 2O64A 4NM0A 4V0GB 4AACA 5LVNA 3Q04A 4F9YA 5I9XA 3W2SA 1W7HA 3O23A 4J7BA 4O7RA 3V6RA 4RFZA 5M4UA 2WQNA 4WT6A 4YLLA 5DHJA 4PDYA 2F4JA 4H3PA 4LRMA 1WBSA 2H8HA 3EN9A 3F7ZA 4XOZA 3C13A 3DBQA 3QD4A 3PJ1A 1ZY5A 4IJPA 2QOBA 1UU8A 2W5AA 1YDTE 3ZMMA 2V55A 3DT1A 3GEQA 4NT4A 5LMBA 3I0QA 3WIGA 2XEZA 2PPQA 4OTIA 4QD6A 3O8UA 2XKCA 3R7YA 3SAYA 3PZHA 5E1EA 3BBWA 1OECA 3OVVA 5DPVA 4AZTA 3UO6A 5D7VA 3MPTA 1RQQA 5CU2A 2E9NA 2X7GA 5E9EA 2C6EA 5BYYA 5A6NA 4D2SA 1FGKA 5F95A 2YLFA 4K11A 4UMPA 3L9PA 4M67A 2VTHA 1DS5A 3MYGA 4KBKA 4CMOA 4EHEA 5K0XA 4B9DA 1WMKA 3V51A 4RJ6A 3DU8A 3W2CA 4WRGA 2VX3A 2UZDA 4EOJA 3RCJA 3NUYA 5L3AA 4O1PA 1PXJA 2UVYA 5JZJA 3BGQA 1KUTA 3DBDA 4IX5A 4L00A 1Q3WA 2ZAZA 2OIBA 5AR8A 5EW3A 3CJFA 4EWHA 4PNKA 4RMZA 5CF6A 2EU9A 5EK7A 5L2QA 4ZZOA 4FEUA 5AP3A 2RIOA 5KKRB 4XV2A 4NU1A 1YDRE 2XK4A 3II5A 4X0MA 3DK6A 3JVSA 4DH8A 3P79A 1PXMA 2VWYA 3RM6A 5KMJA 3PLAE 2UZBA 4A07A 3PXFA 4FT9A 4PL5A 5G6VA 5KBQA 2YZAA 3PG1A 5ANEA 4AGWA 3GOKA 5CAUA 1ND4A 1CSNA 3WIKA 4DHFA 3R1NA 1XWSA 4AZSA 3ZSIA 4C4JA 2JDTA 2CCIA 3AD5A 4R8QA 4CQEA 3HAMA 4AZWA 2Z60A 4LI5A 2OW3A 2XIRA 2C3KA 3FYJX 1JSTA 2BHEA 3OUKA 3HRBA 3UOKA 4UZHA 4F9CA 3A7JA 4I5CA 2JDVA 1KE8A 3F7WA 4TN6A 4X3FC 1OI9A 1YI3A 2XA4A 4YC6A 3ZXZA 4MD7E 5KMMA 3EH9A 3AOXA 1P4OA 3COHA 3GCQA 1KE6A 3F66A 3IW4A 4PPCA 4S33A 4XYFA 5BYZA 3QRUA 1XH9A 1REKA 4IIRA 2GPHA 4XG3A 3VWAA 4J71A 3C4FA 3OG7A 4CT1A 4FKIA 3ULIA 3R28A 1F3MC 2OIDA 3PA3A 5DA3A 3CPCA 4Y8DA 3W2RA 5IA3A 1OB3A 3REPA 1H25A 1BUHA 3I60A 4YZMA 4DITA 4KS7A 4OBOA 3E88A 4CT2A 4DH5A 2FSMX 4FSZA 1SYKA 4W4YA 3RNIA 4PV0A 3R1QA 3WARA 4YMJA 2E9UA 3BYSA 5CU4A 5E90A 3VS6A 5CF4A 4IBMA 2J90A 4JBVA 4C2VA 1Q3DA 4ZK5A 4J8MA 2CHLA 2CNVA 3K3JA 4U41A 3TUBA 4HPUE 1H1PA 5K0KA 3EN7A 2QG7A 3IKAA 2EXCX 4I4FA 1YRPA 4X2KA 1YVJA 3K2LA 4GG7A 4L6QA 4EOMA 4G6LA 4B6LA 2GFSA 3FMHA 4HYIA 4QP2A 5EHLA 2OK1A 3LCKA 2EUFB 1KOBA 2OH4A 5AUVA 3FZSA 3BWJA 1ZMVA 3C4XA 5EI2A 3RPRA 1U46A 4B8MA 4AQCA 3BIZA 4JNWA 5IMXA 5A54A 3DAEA 3CCNA 4FTJA 3LQ5A 3D2IA 3VAPA 2ZM1A 3RCDA 4A7CA 4GKHA 4OTHA 2JAVA 4EQCA 4YZNA 3FMJA 3NVKI 4H1MA 5K4IA 4IADA 1OIRA 1FMOE 3FLQA 3ZONA 2VO0A 4L01A 4G6NA 1SNUA 2J0LA 3HV6A 3Q5IA 4QMSA 4KBCA 1OITA 2AYPA 4WG4A 1U54B 2ZB1A 2Y7JA 5IQCA 1NVSA 1UNLA 3FLZA 3I7BA 3GXLA 2QD9A 2X39A 3KCFA 3HGKA 3ET7A 4HYSA 4H05A 4C4IA 3BV3A 2BTRA 5JQ5A 4U80A 4CXAA 4FICA 4U79A 4Y5HA 3FKOA 3BGZA 4E6CA 3ROCA 3AG9A 4O0WA 2ZV8A 3HX4A 4P4CA 5D9HA 4ZTHA 5JZNA 2J0MB 4CRSA 3BQRA 2C3IB 2XIZA 5FDXA 4AA4A 4QNAA 2NNWB 4R3CA 3T3VA 3U4WA 4YJRA 5DRDA 2RFNA 1LPUA 3OC1A 4G17A 4QTBA 4GJ2A 5L2TA 2P33A 3E5AA 3PIYA 5JFVA 4FTLA 1B6CB 3LMHA 3HMMA 3VBYA 2BUJA 2HWPA 3OWLA 5M51A 5AMNA 4QPSA 3D9VA 4A9SA 4EK6A 4X21A 2OJIA 3O51A 3GQIA 1T46A 1AD5A 1H27A 2R2PA 3R01A 5HNIX 3ZCLA 5HEZA 4ZTRA 1NW1A 2BHHA 3UQGA 3IECA 5HTBA 3ORIA 5I9WA 4EWQA 1XBBA 3HAVA 3MTLA 4EK4A 4XRLA 1PMUA 4FK3A 3VHKA 2BAQA 4FL2A 3S2PA 3DK7A 3LJ0A 3FBVA 3ENHA 4QP7A 4ZTLA 2UW7A 4RIXA 4ONAA 4MQ1A 1BL6A 3I6WA 3R8MA 3ZUUA 5BMSA 4OR5A 5HG5A 4DC2A 2YIXA 3CJGA 1OKVA 4IWPA 5DN3A 3E7VA 2XS0A 4QQJA 3HRFA 4U97A 5AR4A 1J7UA 1SM2A 5FGKA 5GHVA 2OU7A 4RIYA 4DEHA 1MP8A 4XP2A 3R9HA 2O65A 3Q9ZA 2B52A 4L3LA 2P55A 4DGNA 4OBPA 2ZB0A 4A4OA 4ITIA 1FINA 4PL3A 1G5SA 3HUBA 3IGGA 2PMIA 1UKHA 5AP0A 3LOKA 4O21A 1OIYA 4KRDA 2BKKA 1XH5A 4EUTA 3OROA 1YXVA 4Y46A 4APPA 4IM0A 5AAEA 4DEGA 2HZ0A 5BVNA 5AUYA 3PXKA 3DNEA 2YZLA 4IX6A 4NW6A 4DAWA 2G1TA 5AWMA 4UXQA 5KMKA 4Q2AA 4IX3A 5CXHA 3T9TA 3LCTA 4ZTSA 2C5NA 3OOMA 4E3CA 5E8YA 4I93A 1IAJA 1H0WA 3G33A 2QU6A 3UJGA 2XB7A 4RX9A 5FLFA 4CFWA 4OT5A 4X3FA 4BI1A 3UNJA 3RNYA 4MNFA 3LXLA 4H39A 3FWQA 1XBAA 4ANMA 5LMKA 2BVAA 2A19B 4H3QA 4LV8A 2OJ9A 4ERKA 4WG5A 5KUPA 4ANNA 4G16A 2CN8A 4B99A 2PVYA 3MWUA 2I7QA 3TM0A 2WMUA 4TRLA 4HVIA 1ZRZA 4FT5A 3W16A 2WMQA 4RQKA 3G9NA 4KIKB 1V0OA 2V7OA 3EQCA 4CZUA 2YM6A 4M0ZA 3MH0A 3AMBA 5HIBA 3VIDA 2XIYA 4C4GA 4D58A 3E63A 4EQMA 4IB3A 2JGZA 3PFQA 3NNUA 4LL0A 5HE2A 3F2AA 4Y72A 1XH8A 2C5YA 3AMAA 3ODZX 4QP1A 3ULZA 2R3OA 2XK7A 3NEWA 2IWIA 2ETRA 4NYEA 4HOKA 2VNYA 3EZVA 5IQGA 2YM4A 1SVGA 1VEBA 4YJSA 1Y8GA 3FXWA 4I1ZA 5JFXA 2CDZA 3G90X 5FDPA 4F99A 3NUNA 3KXMA 4CV9A 2B9HA 4L8MA 4QRCA 2HZ4A 3VBWA 3W8LA 4TWPA 1H1QA 2JEDA 2Z02A 2XJ2A 3QQKA 5CS6A 4G2FA 2W7XA 3KGAA 3TUCA 3PRIA 5K3YA 4KS8A 2PVNA 4F70A 4C61A 1MRUA 3L8SA 1URCA 2X2LA 5I4NA 4WA9A 4BC6A 4ASEA 4CG9A 4XG2A 4FTUA 5HU9A 2VTMA 4FR4A 2UW4A 4DGMA 4MBIA 4EHZA 3QX4A 2WFYA 5J1VA 3UMXA 1FVRA 1NY3A 2Q83A 4OTFA 3HMIA 3TXOA 4FV3A 5TR6A 4AA5A 4YNEA 1FQ1B 4CYIA 3FUPA 3PPJA 4FGRA 4MTAA 3RHKA 3SXRA 3TACA 4ANSA 1BI7A 2UW5A 3POZA 4UALA 2QURA 2VN9A 3EN6A 3NS9A 4EZ5A 5IDNA 3MH3A 4C38A 2A1AB 5M57A 1V1KA 4FKJA 3OUNB 2PMNX 3L9NA 4Y85A 1H00A 4BYIA 3SOAA 2X8EA 3C0HA 5HE3A 1HOWA 4FTAA 3SXSA 3NUAA 3R8PA 4R5YA 2OO8X 3S4QA 4FIIA 5EKOA 4RC3A 3DFAA 4XP0A 2X7OA 3ORTA 5CAOA 3LHJA 3KFAA 4O22A 2YIWA 1SMHA 4IDVA 5D1JA 3QLGA 1LUFA 3B8QA 3DXNA 4YR8A 2W1EA 5HBJA 3I4BA 4RJ7A 1H08A 1OL5A 2DUVA 1IASA 3U8WA 3WF5A 4FKVA 3B2TA 4JAIA 4D9TA 3GCPA 3VUTA 4JX3A 4PTEA 5AA9A 4JG7A 1P5EA 2YEXA 3QLFA 3C0GA 4W8DA 4X2FA 5EW9A 3NCZA 5HU3A 4DGGA 5HO7A 2YHVA 1LR4A 5CAVA 5EQYA 1YWRA 3EB0A 3NLBA 3HEGA 5I3OA 2WEIA 4N0SA 3DAKA 4I24A 4MHAA 4DT9A 4ZSEA 4QQCA 1P14A 1SVHA 2DS1A 4IC8A 1M17A 4XP3A 5JGDA 3SC1A 5J1WA 2O63A 1R0PA 5DIAA 4ZSJA 5HVYA 4E26A 2PZPA 4IE9A 4IHPA 4RJ5A 2WMTA 3KN5A 5HHWA 3Q9XA 1Q62A 2WQOA 4NUSA 4N6YA 4OTRA 5GINE 3OD6X 5I9UA 4YNOA 5H8GA 3U55A 2WXVA 4FV4A 3ZYAA 5C9CA 3IW7A 1CTPE 3UQFA 2WO6A 3A7IA 4Q9SA 5E8ZA 5E8XA 3MESA 4W8EA 3Q32A 4R7IA 3CPBA 2WQMA 1Q5KA 3KF4A 3WZDA 3H3CA 1WZYA 4JR3A 3WF9A 1Z9XA 3I79A 3VUIA 3FY0A 4K18A 3BU6A 4D4SA 2PMOX 3G0EA 5M44A 2B7AA 2IVUA 3HECA 5CEQA 2X6DA 4EK5A 4ZMEA 3TG1A 3S00A 5IQAA 1QCFA 4D2PA 4E5BA 4O0YA 2BALA 1J1BA 3PJ8A 4GUBA 4PMSA 4JI9A 3AD6A 1M7NA 2VTJA 4GVJA 3G51A 3OCSA 4MF0A 5JFWA 5JT2A 3PE1A 4BICA 3LM0A 3PLSA 3MDYA 2IZTA 3PG3A 4FKGA 4MD9E 3C1XA 5EHOA 3SVVA 1REJA 2RG5A 3PY0A 2W1CA 5K9IA 4C35A 2ITVA 2J7TA 2V7AA 4MX9A 3BLRA 4N57A 2XK8A 1H28A 4U43A 4DBXA 2WQBA 4FV7A 1NVRA 1WVXA 3MY5A 4OAVB 1TVOA 2YLEA 3QQGA 3DK3A 4RWLA 5M53A 4DH7A 5IUHA 2J6MA 4N4SA 4BTJA 2BROA 4Y5QA 3VS7A 4NZWB 2F9GA 4EUUA 5LVOA 4M97A 4IAZA 3E8CA 5BNJA 1T45A 4DCEA 3AC5A 3EQPA 1XO2B 2WELA 3FYKX 3UOLA 3BYOA 2JD5A 4QP6A 4R6VA 3ORLA 2W4JA 5T68A 5IU2A 3QYWA 4B7TA 1YXTA 3OS3A 3IO7A 2P2HA 3ZHPC 4ANOA 3NRMA 3QQLA 2YCSA 5I9ZA 1W8CA 4U7ZA 3MIYA 1JSUA 4EL9A 2JBOA 5AV2A 3MIAA 5LVMA 5IQDA 3G9LX 3KCKA 3Q4TA 4IXPA 2NRYA 2PZRA 4X2NA 4F7JA 1QPDA 4KIOA 3KXZA 3E8DA 3GBZA 3BEGA 4S32A 4D9UA 3UIMA 1Q24A 4EQUA 4NW5A 2B0QA 2BAJA 5AP5A 2QLQA 4FTKA 2A4LA 3P9JA 2FSLX 3FSFA 3BGPA 2FSTX 3GENA 2JIIA 4MNEA 4WRSA 4IJ9A 3TIZA 3EZRA 5DBXA 4WBBB 1HCKA 3FLYA 2R3LA 1GAGA 5CI6A 5LVLA 1PKDA 2VTSA 3CE3A 2BIYA 3P1AA 4YJTA 5FEDA 5IH6A 4BCQA 3EQIA 2BRMA 4D4YA 4RA4A 2CN5A 4EYMA 3MFUA 1Y8YA 4RG0A 2UZUE 2WMRA 3NYNA 3QTZA 2WPAA 3GC0A 5FRIA 4JBPA 5AR5A 2AC3A 4G34A 1W82A 4I20A 4PDSA 4V05A 3VRZA 4UX9A 2BZHB 2YIRA 4YO4A 2X8IA 2XNMA 3PPZA 4GYGA 2OLCA 3QUDA 2GCDA 3GU8A 3NNXA 4U44A 4AGUA 4GK4A 4QYGA 5AP6A 2J9MA 4EOQA 3KK8A 1H0VA 4YU2A 2HOGA 4GSBA 4KKHA 4L53A 3TNHA 4QQTA 1H4LA 4XNEA 5J79A 3EYGA 2GTNA 1OM1A 2W1IA 5GNKA 4CTCA 5JSMA 3I1AA 2OICA 3P08A 3PVBA 2PULA 5E1SA 5DYJA 1Q8WA 2VO3A 4BR3A 4EH2A 3QBNA 1SNXA 2Z7RA 3L1SA 4RSSA 4I41A 4Q5HA 3V6SA 4YZ9A 4KKEA 3R8ZA 5DWRA 3CTJA 2WKMA 2VTQA 2JKMA 3HL7A 2OJJA 3ANQA 1YXSA 5J9YA 4YHJA 4I0SA 4QPMA 3UPZA 2VZ6A 3EFKA 2ZDUA 4O0VA 3UVPA 2BMCA 5BUEA 4DT8A 4E8AA 2VAGA 1JKLA 4LOPA 4QTAA 4XHKB 4U40A 3R9NA 4I0RA 4JXFA 4L3PA 5FP5A 3LLTA 3CKWA 4MCVA 3CR0A 1YI4A 4A9TA 1M2QA 3PE2A 2RFDA 3UO4A 3GUBA 3QX2A 5AEPA 2GQSA 2GNJA 3H0YA 3GCUA 3HDNA 4G5JA 2QOKA 2G15A 4EK8A 5CSHA 3EN4A 4ASXA 4ZMFA 5JRSA 3W2OA 2H34A 4AUAA 2FSOX 4OUCA 4CKJA 1CKJA 5E8VA 4EHGA 4F4PA 4I21A 3OWJA 3GU5A 4UMQA 1XKKA 4Y73A 2JIVA 2YM7A 4EC9A 3OWKA 3FPQA 4U9AA 4QMTA 4YLKA 2EXMA 4LUDA 3QA0A 3L8PA 2E9OA 4MWHA 4OAUC 1UU9A 3RK9A 2RSVA 5M4IA 5E7RA 1CKPA 1XBCA 3OY1A 4K1BA 5JH6A 4L42A 2VTNA 3R0TA 5AM6A 3UG1A 5F1ZA 2GQRA 5HG9A 2VD5A 2YN8A 5H8BA 3TIYA 3V5TA 4RFYA 2ITOA 5CLPA 2F57A 3VHEA 2QOCA 4GH2A 4GFOA 4EH8A 3WF6A 4OLIA 3F5GA 1M14A 5EI6A 2WTIA 2X2MA 2YAAA 1U5QA 3VQUA 5GIOE 1OUYA 2OZAB 3P0MA 2WTJA 1EH4A 4XLIA 2BR1A 5CQWA 4IX4A 5I9VA 4JIKA 3MV5A 5FM3A 1ZWSA 2XM9A 5IUIA 1KV2A 4FSUA 4M12A 2UZTA 1WCCA 2B53A 4FV2A 2R64A 3LFQA 4YZDA 5J7BA 5L6PA 3BHTA 1PYXA 2UW8A 1TQPA 2GU8A 3PY1A 1FPUA 2HYYA 1PXLA 1MUOA 3MFRA 4FSMA 1R1WA 5ANJA 3TNQB 3OTVA 5LXMA 3R63A 2WMBA 3A99A 4DYMA 4CGAA 2I0HA 3CC6A 3EWHA 2QODA 4FVQA 3Q2MA 1KE7A 4L43A 4UYNA 2B4SB 1RW8A 3CEKA 4B8LA 5C4KA 2QQ7A 4CD0A 4MVFA 3HDMA 3SW7A 2WEVA 4G5PA 3BYMA 4F1TA 2X9FA 4KIQA 3UVRA 3UZPA 3O96A 3FZOA 4F64A 2B55A 1UWHA 3DJ6A 5DR6A 3W33A 3UODA 3QHWA 4LV5A 1XQZA 3PXYA 2WTDA 4MF1A 5A9UA 4F0GA 5IQHA 5EOBA 3QAME 4D0XA 2IW6A 3QALE 5D10A 4MK0A 4Y95A 1QPCA 1SVEA 4IM2A 4BHNA 2UZOA 1ZMWA 3V04A 3DDQA 4EH3A 2PVRA 4FSNA 5EM7A 4AS0A 4LGGA 2JDSA 5A4LA 2J50A 3RBWA 2PE0A 3ITZA 3PA4A 2XM8A 4AT3A 2ZV2A 5B7VA 5CEKA 4L45A 4FT7A 4ITJA 4FIJA 4Y83A 5KZIA 4PTCA 2E9VA 2WOTA 5L8KA 4FT0A 3QTSA 4O0SA 4CVAA 4FKPA 3Q5ZA 4G1WA 2XRWA 4RVLA 2QOQA 4AT5A 2GNHA 3U51A 2HIWA 5CAQA 4ZEGA 2JBPA 1HCLA 3MB7A 3MH1A 2XBJA 5A46A 3MA6A 1YKRA 2C47A 4C02A 3ZDUA 3NCGA 4W9XA 4I3ZA 3QCXA 5C8MA 3ZDIA 3IK3A 2UV2A 4YPSA 4DGLC 2ERKA 4FTIA 4USFA 3UNKA 3G15A 4I23A 4AOTA 1PW2A 3DOGA 3FQSA 5J95A 4MXOA 4DLIA 3ETAA 5B2LA 3RM7A 2RGPA 4BIEA 2JAMA 5IKWA 5L8JA 3EKNA 2W06A 4FV9A 3BHYA 4QP9A 2VGOA 2QC6A 4QMLA 3FI3A 5BVDA 1IA9A 3MSSA 2ETKA 4AE9A 1OL2A 2PSQA 4XBRA 2W17A 4ACDA 5C1QB 2X8DA 5I5ZA 2ITWA 4KRCA 2CSNA 4IWDA 3UE4A 2JFMA 1GIHA 1XH4A 5CQUA 3SV0A 5L2IA 1WBNA 3ZEPA 3KRJA 3ZLWA 3D94A 4TZRA 4RJ4A 4HVSA 3SRVA 4C2WA 3O7LB 3ZTXA 3PXZA 4AW1A 4CZYB 4LQMA 4ACMA 4GYIA 2YM3A 3OCBA 2J4ZA 4FIFA 4FV5A 3R7GA 4J53A 2PE1A 4XCUA 3L9MA 4BZNA 1Q99A 2W1ZA 4FEWA 2VTPA 3SG9A 3KMWA 3LZBA 4ZS0A 4EOLA 3FMKA 1OL7A 3LW0A 4FZFB 4WNOA 5AIRA 1J1CA 4F65A 4ZAUA 5AV0A 5EHYA 2IN6A 5GZ9A 5BPYA 1X8BA 2IPXA 1ZLTA 3D5XA 4JQ7A 3FMDA 4DTBA 3AC8A 3E8EA 2PZIA 1PF8A 3LJ1A 5BVWA 4ANLA 4FTMA 5M4FA 2ZOQA 3EOCA 3R8LA 4U0IA 3BPRA 5C4LA 4WBOA 5D7AA 3LCSA 2Y9QA 4F0FA 4F9AA 4L7SA 1OIQA 2ERZE 3VBXA 5F4NA 5HNGA 4TNBA 3JXWA 3LFCA 2XMYA 3WZUA 4IEBA 4D1SA 4RVMA 2E2BA 2W5HA 3HKOA 4LMNA 3WI6A 4ZJVA 4IZYA 3D83A 3DPKA 3PJ3A 4O0TA 4RIWA 5HBEA 3PY3A 4RWJA 3FI4A 4XG9A 3TEIA 4Z55A 1GJOA 1FGIA 3S95A 2NP8A 4DEEA 5AUTA 4IB1A 4TYEA 1W98A 3KU2A 4A9RA 4QP8A 1K2PA 1PMEA 5DOSA 3AD4A 3VS2A 4TTHB 4U5JA 4FNWA 4JBQA 2Z7QA 5AR2A 5HZNA 3ALOA 5TF9A 4N70A 4O0RA 4QO9A 4AGDA 2GS6A 4EORA 1VZOA 5IH4A 2Y6MA 5HKMA 3JUHA 3R21A 3KULA 3CQUA 1ATPE 1ZXEA 5HQ0A 2XIKA 1OL1A 2OFUA 5KBRA 2CLQA 4EJ7A 4D5HA 4DEIA 4JDKA 4FKOA 4I6BA 4OTPA 1JLUE 3F9NA 3LCOA 1E1XA 4M3QA 4I6QA 4RX5A 4WIHA 4O2PA 3NYXA 2C1AA 5AA8A 2C5OA 3D5UA 3CGOA 5DT0A 2QKWB 5AM7A 1L8TA 4IWQA 3U9NA 3QZGA 3I6UA 5M56A 5DR2A 4ASDA 4LMUA 4YO6A 4KABA 2W1GA 3QC4A 3DCVA 2RKUA 1YHSA 5LCKA 2DYLA 2OKRA 3R6XA 4YTHA 4E1ZA 4ZSGA 4A9YA 4DFYA 4YHTA 2GTMA 4AA0A 2WU6A 1G3NA 2VTLA 1OIUA 1UKIA 4FV1A 4FEVA 3TJDA 3LIJA 2IJMA 4FSWA 4BI0A 5CX9A 4EH5A 2VNWA 3RJCA 1S9JA 3DJ5A 4CKRA 3QHRA 3MVHA 3ZSGA 2YIQA 3QWKA 4PMPA 4Z16A 3AGLA 4D28A 2C6LA 3R00A 4ERWA 3R8VA 4J8NA 1JVPP 2OI4X 3MBLA 3ZU7A 4OT6A 3M11A 4QP4A 3ZZEA 4WNMA 4LOQA 3PUPA 5FUTA 4BCHA 4E4MA 3VQHA 5HD7A 2JKKA 2CKOA 2VTRA 3NUSA 3WE8A 5CF8A 3GP0A 4GIHA 2OXXA 4O83A 3GGFA 3I5NA 3MN3A 4LG4A 4FSYA 1PJKA 1FBNA 3IGOA 4RWKA 5FQDC 4B0GA 2OG8A 3H30A 3CY2A 4XG4A 2QO2A 2XCKA 2YACA 3GU4A 2ONLA 3C5UA 3D7ZA 3HMNA 4ZP5A 2J0IA 3QD3A 3F5PA 4I92A 4GJ3A 2FYSA 3A7GA 5BVEA 4TYJA 4RVTA 4AZVA 2WTWA 3PTGA 2YABA 3QRTA 4YTCA 4QMXA 4ANBA 1Y57A 3T3UA 5L8LA 5CNNA 5HNBA 4ZJJA 4E6QA 5E91A 3L8VA 1JOWB 4FKSA 2X6EA 4PMTA 5CVGA 5ACBC 4DH3A 1ZYSA 4IAIA 5CAPA 3FI8A 4BBMA 2IW9A 5CTPA 5CVFA 2W0JA 4JX7A 3EHAA 3BQCA 4CYJA 4QMQA 4O7YA 3UZRA 4LOOA 4EOPA 3R1SA 5FEQA 5KO1A 4O7NA 2CKEA 2PVMA 1Y6BA 3F3UA 2PTKA 3ROYA 1MRYA 3C4ZA 2X1NA 4AGCA 4IVDA 4WNKA 3MH2A 3RALA 3V8SA 3PWDA 2FH9A 4GK2A 3KY2A 4HCVA 3KXHA 2HAKA 4NFMA 4X3FB 1ZYCA 4BWKA 3DLSA 4FV6A 1L3RE 3UP2A 1RDQE 3FLNC 2VWUA 4XG8A 2UW9A 4W9WA 4NK9A 3DNDA 3BLHA 4M8TA 5HLNA 4RVKA 2BZIB 3CQWA 3SXFA 3U54A 4LGHA 4ZSAA 5JGBA 4MNEB 4LUEA 4FTCA 4CLIA 2CGWA 3IDBA 3AT4A 4TWOA 4C4EA 3JR1A 4NJDA 2QOIA 3A61A 3UYTA 4O7SA 1YQJA 3T8OA 2C3JA 2WMVA 3DZOA 2PU8A 4BGGA 3ID6C 2BRBA 2SRCA 4C8BA 3DKCA 2KTYA 4I6FA 1ZOEA 3Q60A 1JPAA 5CY3A 3H9FA 3RWPA 4FTRA 4DFNA 4FI1A 3F61A 4X2JA 3A8WA 2OWBA 4V01A 1JKTA 4G3CA 2CCHA 3ZUVA 2IW8A 3CD3A 3DDPA 2VX1A 1DI9A 2WTKB 3IW6A 3VN9A 5HTCA 1KWPA 4DBNA 4O7VA 4L52A 3PXRA 4CTBA 1YWVA 3P86A 4R7BA 5AADA 4J99A 3NDMA 4O1OA 4FL3A 5CEIA 1ZYLA 4XEYA 4Z7GA 2C69A 1OVEA 1WVYA 4O2ZA 4EKLA 1OUKA 3O8TA 4IVCA 4MD8E 4ANQA 5IEYA 4CMUA 4LYNA 4M13A 1WBWA 2GNGA 2BCJA 2GS2A 4QPAA 2XP2A 2J0KA 4UMTA 5BMMA 4DF3A 3EJ1A 2Z2WA 3GT8A 3HMOA 3RTPA 1GIIA 3E3BX 5IA2A 4CCUA 2R9SA 3FZTA 2PMLX 5EDQA 4PWNA 4YPDA 4BYJA 3R2YA 3UVQA 4QMOA 3FHIA 3QF9A 4RT7A 4XV1A 4M66A 3IQ7A 5H8EA 3NPCA 4UYAA 1YOJA 3V8WA 4GCJA 4D4VA 1KV1A 1YW2A 4M68A 4FUXA 2UVXA 5CEMA 3HA8A 5DRBA 4ZTMA 1J7LA 3A62A 4FV8A 2W4KA 4QYFA 3TV6A 3P7CA 4IW0A 3WZKA 3SDJA 4QMMA 4XBUA 4W4VA 3C5IA 2RL5A 2XNPA 4X7QA 3SG8A 3HP2A 3FZ1A 3HRCA 3MB6A 2GHGA 4X2GA 3BU5A 2OJFE 3TJCA 3ZLSA 3BKBA 4ENXA 4NTTA 2FUMA 2X0GA 3OXTA 3AC1A 3DTWA 5FEEA 5H2UA 4QMZA 5FBOA 3S3IA 4BCIA 1ZZ2A 3MY0A 2VTOA 4KINA 3I5ZA 3CXWA 3NNWA 1Q4LA 2ZYBA 1YWNA 3DA6A 3KF7A 4FSTA 5KCVA 5EQPA 5CYIA 1PYEA 4UWCA 5GJDA 3RAIA 5B2MA 2I1MA 2JIUA 5EYDA 5IQFA 4C3RA 3NX8A 4MXAA 3UG2A 2XUUA 3QQFA 4DTAA 3NGAA 2P4IA 3FKNA 5CU6A 5HCZA 2YERA 4FUYA 3UTOA 4C57A 4EONA 5ANKA 2CLXA 3PPKA 4J98A 4F7NA 2BAKA 2OF2A 2WQEA 2P2IA 3DKFA 2R4BA 2PL0A 3DAJA 4GS6A 2BFYA 4YJQA 3QQJA 2R7BA 1OKYA 5TE0A 3R2BA 2W5BA 3R83A 2C1BA 4PL4A 3U6JA 4OTDA 5J8IA 3IS5A 4BTMA 2XH5A 3QRJA 2OF4A 1RE8A 1TQIA 5ANDA 2QOFA 2JC6A 2ZV7A 4ZTQA 1ZARA 3R8UA 5BVFA 3KC3A 2OZOA 3MVJA 5DT4A 4D2RA 2I40A 3HMPA 4XG7A 3QGYA 3W8QA 2O0UA 3BELA 4L68A 2NRUA 4Q5EA 4FX3A 3FHRA 4C59A 3N51A 4BZDA 3KVXA 5AIKA 3LQ8A 3Q3BA 4CNHA 3QUPA 4BDKA 2VTIA 2GHMA 4X6RA 4C3FA 3GVUA 4XRJA 5ETCA 5ACKA 4AX8A 2FA2A 3IDCA 2Q0BA 3H9RA 3BRBA 4AE6A 3FAAA 4MBLA 1CKIA 5I0BA 3QL8A 4IB5A 4BCNA 5JMSA 3O17A 4PP7A 4I5MA 4FG7A 2X2KA 3ORPA 4MEDA 4RA5A 3TNIA 3EQRA 1P4FA 5ETIA 2V22A 5ETFA 3MI9A 4DN5A 1WBVA 5T6KA 3W1FA 1PMVA 4HZSA 5CSVA 3HUCA 4GU6A 5DH3A 3UYSA 1GZ8A 2RG6A 2W9ZB 3ZBFA 4FNZA 3FV8A 3LE6A 3FDNA 4JL9A 3PP0A 5HLPA 2W9FB 3S0OA 1YOMA 4XMOA 2PUUA 3W10A 3VF8A 1WAKA 3P23A 4D2TA 4NTSA 4G3FA 5HO6A 4IZ7A 4CFMA 4KUJA 4KKGA 2G2IA 4IZAA 2VWWA 4Z3VA 3DKGA 2WNTA 3QD0A 1J91A 3AC2A 3MA3A 4J95A 4JQ8A 4XJ0A 5FXQA 3BE2A 5B2KA 4C36A 3A7FA 1JSVA 3SX9A 4ALVA 5CXZA 3LFEA 4OGRA 5EM8A 3U9CA 5HX6A 4IACA 5TKDA 1YXUA 2YDIA 3LFNA 4MQ2A 5IA4A 5TOZA 2V0DA 4IMYA 4FYNA 3SKCA 5ANGA 4U45A 2ACXA 4N6ZA 2UVZA 4L46A 4BKJA 4HYHA 3RHXA 2YJRA 4FSRA 5D12A 4ALWA 1IRKA 5HBHA 3UP7A 2YCFA 3FMNA 4KA3A 4EEVA 4BL1A 4ZSLA 3DY7A 2YDJA 4FIEA 3ZS5A 3TV7A 4AZEA 4IANA 1YOLA 2HY81 3RGFA 3ERKA 4I94A 3Q9WA 2QO9A 3UDBA 5L4QA 5GZ8A 4BFMA 3A4OX 4B4LA 5EDRA 4F09A 2UZEA 3LKMA 4RGJA 2GQGA 3KULB 3MJ1A 3WILA 3EFWA 1Y91A 2HXQA 1W84A 3TCPA 1YHWA 3VNTA 3L8XA 4PRJA 4C0TA 2R0IA 4BCFA 4Q9ZA 2YM8A 4BCOA 1O6YA 1Q41A 3BBTB 3GC9A 3WF8A 5FWKK 3AMYA 3AQVA 3G2FA 2NO3A 5IEVA 4TYIA 3ZO3A 4BY9E 3SD0A 5HD4A 5LQFA 3W2PA 4DEBA 4X3JA 4ID7A 1M2RA 3QC9A 3Q53A 4FYOA 4XS2A 4FF8A 2QHNA 4WD5A 5CEPA 3VS1A 3GCVA 5BVKA 3NMUF 3DBCA 2Z7SA 1LP4A 3N9XA 3Q9YA 3VO3A 1OBGA 4CFXA 2VO7A 3VBQA 5CWZA 3C50A 4CFVA
chains in the Genus database with same CATH superfamily
3R9OA 3AT2A 3ZFMA 3ZRMA 4C37A 2O5KA 4PMMA 3MY1A 1UA2A 1VYZA 5K4JA 5K5XA 4IWOA 4IFCA 3UC3A 5IMEA 3UMWA 3WBLA 2W1FA 1CMKE 2E9PA 3ORNA 5CI7A 4M0YA 3UIBA 5C01A 4ZXTA 4BHZA 5BUIA 5KMNA 3CSVA 3R30A 3DGKA 4RIYB 2GNLA 3D5WA 3H9OA 4XOYA 2J0JA 2W1DA 4CFNA 3ZOSA 4ZZMA 4YTIA 4AN3A 3ZO1A 5T3QA 1Q97A 1XH6A 2UZLA 3DV3A 4RIXB 3PSCA 2C6TA 4KBAA 5EW8A 5BQ0A 3P7AA 1ZMUA 4K6ZA 1J7IA 3OXIA 4GV1A 3UQCA 1QPJA 3OY3A 4J97A 1WBTA 5DNRA 4ZZNA 3PZEA 3HA6A 2O8YA 4MXZA 5HX8A 2QVSE 3W2QA 3QGWA 4FE2A 3ZC5A 4RPVA 1H01A 4F6UA 4D2WA 4O4FA 4TKSA 3I7CA 4PY1A 3N4UA 4ZY6A 1FMKA 3ZH8A 3G6HA 3VUDA 3R7VA 4MH7A 5AJQA 3E62A 2VU3A 5J9ZA 4L9IA 4DH1A 1DAYA 1VR2A 3BEAA 4IFGA 3SOCA 4FEQA 1U4DA 3VVHA 1IAHA 1IR3A 3KRLA 4QOXA 4UMRA 3WF7A 2VWZA 4YC3A 5HE0A 4E20A 3EFJA 2R3JA 1ZOHA 1LEWA 4FOCA 4QMVA 4AW5A 4AOJA 4BCMA 3ZRKA 1VLRA 2AC5A 3OFMA 3QTUA 1ZOGA 3QA8A 4WUNA 4JVGA 3VS0A 4USEA 2PYWA 3FKLA 4IAKA 2ZDTA 2QI8A 2QOLA 5EM5A 4F1MA 2B9IA 4EK3A 5CT7A 4KSPA 4H3BA 3IG7A 4BN1A 3TV4A 4UXLA 3V01A 3Q6UA 5KMOA 2F2UA 3E8NA 2ZJWA 3NR9A 1M2PA 4V04A 3ZM9A 5CENA 4L44A 3BCEA 4JRVA 4UWBA 2XRUA 2YAKA 3NUXA 4IAYA 2QU5A 4J1RA 1GZNA 4MWIA 4NH1A 4UWYA 3UNZA 4L3JA 4YGAA 4BVUA 3DXPA 3OEFX 5HG7A 2IG7A 2B9FA 3CLYA 1Q8YA 3RZFA 3ORXA 3FSKA 1H1RA 4NIFA 3UIXA 4ASZA 2XCHA 2C6MA 2R3MA 3GCSA 4FBXA 4H58A 4O27B 4BF2A 2JDRA 1U54A 2G2HA 3LFAA 4GKIA 5CASA 3TT0A 4RJ8A 4GT4A 4R1YA 3UZTA 2UZWE 4MKCA 2IVTA 3A8XA 3FQEA 4EC8A 4RZWA 4BDDA 4PDPA 4PTGA 3BWFA 4BDHA 5IQBA 3WE4A 4LV7A 2CKQA 2GMXA 4O96A 2XF0A 4RFMA 4AZFA 4WSYA 4DA5A 3NW7A 3O71A 2YCRA 3HLLA 4WO5A 3VBVA 3NUPA 4W4XA 1Q8UA 3NVMB 3ZBXA 3TMOA 5IA1A 2GSFA 4HCUA 3RAWA 1OPLA 4YZCA 3KN6A 4FKWA 5J5TA 1G8JA 4F9WA 5EQEA 1OKZA 3EYHA 4YJPA 4JR7A 3AGMA 1GIJA 3V5WA 3HZTA 3P5KA 1R0EA 4H1JA 4PPBA 3U6HA 4FTQA 2XKDA 4EZ3A 2R7IA 3OZ6A 4AT4A 1PXNA 2XYNA 5FG8A 4AWIA 3FLWA 3NW6A 2WZJA 4GUEA 1JWHA 2ZVAA 4HNFA 3R7OA 4XH6A 3NWWA 4O91A 5JGAA 3SQQA 3JYAA 2PZ5A 4TNDA 3HV5A 3MFSA 4FVRA 2ITXA 4EHVA 3Q6WA 4CQGA 4KIKA 4FKRA 4MXYA 1M7QA 2GDOA 3TKIA 3ZC6A 4RIWB 1TKIA 3ENMA 1YXXA 4DFBA 5E92A 4AOIA 3FZRA 2X7FA 4W4WA 5BX0A 3LAUA 4FKLA 3LPBA 3LXKA 3AXWA 4E7WA 1W2DA 4GRBA 4TWNA 2F2CB 4FG9A 3P78A 5LWNA 4UB7A 4UMUA 2BRNA 4ORKA 3DBFA 4C7TA 2R5TA 4CKIA 4YSJA 4G3DA 5AUUA 2PUNA 4JDIA 3RAHA 5AP2A 4A9UA 5M06A 3QTIA 1TFFA 5KE0A 3DBEA 5C8KA 3C0IA 5M08A 3BHHA 4DLJA 3GC7A 4CSVA 3TDWA 5HO8A 3Q4CA 3EQGA 4YURA 4AG8A 3CGFA 2OZAA 1OKWA 3OXZA 3W18A 4DGOA 4FTOA 1UU3A 5AP1A 3FXZA 3VS3A 3KRRA 2XALA 3E93A 5KNJA 2H96A 4YSMA 5AR7A 5AP7A 3QRKA 5H9BA 1QPEA 1RJBA 1PHKA 2BDJA 4JQEA 2C6DA 4G31A 1ZZLA 4PX6A 2HK5A 2C0OA 4F9BA 3UO5A 3QU0A 4BDGA 2YWPA 3VBTA 3MPAA 3R73A 2YFXA 3ALNA 3FLSA 4PNIA 2VO6A 5A3XA 5AX3A 3F82A 3THBA 3GQLA 3ZLXA 4ACCA 2IVVA 3TZMA 3NNVA 4HJOA 4F7SA 5HVKA 5L2SA 4TYHB 2XNEA 2W1HA 2R3KA 1VJYA 5E8TA 3H4JA 4JT3A 3R7IA 4S34A 5FD2A 3ACKA 2ESMA 3W32A 3W55A 5AUWA 5E8WA 3ZEWA 5JEBA 4C34A 4E5WA 3KXXA 3VUHA 1MRVA 3GC8A 2QO7A 4EH7A 5BVOA 3G5DA 3SA0A 4FOBA 1BX6A 5A6OA 1H24A 2PE2A 4YC8A 3TZ8A 3Q2JA 5DG5A 4BCGA 5EDPA 2WTKC 1B38A 3PVWA 3R04A 4QQ5A 4TPTA 4FJVA 1JQHA 3COIA 4IH8A 1ZYDA 3DKOA 4V0GA 4TT7A 2C68A 3LXNA 1CM8A 2R3GA 1W83A 3VRYA 4I6HA 4FZDB 4AFJA 3MJ2A 3V5LA 4EI4A 5HI2A 4U3YA 4EBVA 3UOJA 3QD2B 3KXGA 2ZV9A 3LFSA 5CEOA 3F3WA 4YJOA 5LOHA 1NA7A 5FTQA 3LLAA 4PDOA 3QKKA 3OT8A 3PP1A 4AFEA 1NT2A 3RAKA 4DE4A 3N4VA 3KREA 4ARKA 2GFCA 2X0PA 4KIPA 1H1WA 3QKMA 2XVDA 2HCKA 4I4EA 2CNUA 1OMWA 5M4CA 1E9HA 4FT3A 4RJ3A 3TDVA 1Z57A 2GNFA 4QYEA 2UUEA 3A4PA 2R3RA 3ODYX 5HESA 4YUQA 3LMGA 1WBOA 5AFVA 3AC4A 3A60A 3FXXA 1YI6A 2IO6A 3MPMA 2WMXA 2XIXA 3GNIB 3MVLA 4IAAA 4M69B 4O7TA 3PYYA 3DJ7A 4NCTA 2BRGA 4LGDA 3SRVB 3V8TA 2QLUA 1ZY4A 2CPKE 5FXRA 2C3LA 2OSCA 5KMIA 1TQMA 4H36A 3E87A 1PXIA 4KNBA 3EN5A 3AT3A 4GT3A 4M15A 3UGCA 2XK6A 2RF9A 3EQFA 4FNXA 4GK3A 4BKZA 4F1OA 4Z7HA 3E7OA 4TYGA 3HNGA 5HIDA 4ZY4A 3HV3A 2Y4IC 5J5SA 1DAWA 3ATTA 1OGYA 2VRXA 3F2NA 2EWAA 2WTVA 2YISA 2VWBA 3GOPA 3F5XA 5A4EA 2ONLC 4AXEA 3OF0A 2G2FA 2X9EA 1S9IA 3COKA 3NAYA 5I3RA 3RINA 2WB8A 3R02A 3OCTA 3PIZA 5B0XA 3O0GA 2QHMA 2ZMDA 4LRJA 4EZ7A 4FKUA 4ZJIA 2CKPA 3DQXA 3FEGA 5ITAA 3KA0A 4XLVA 3VW6A 3R7UA 1JNKA 4K2RA 3R7EA 3FI2A 4IVBA 3VUKA 2W96B 5EYMA 4GU9A 4XG6A 3TKUA 3G0FA 4BJJB 4G9RA 1IG1A 4FZ6A 4O82A 2BDFA 3OW3A 3QQUA 4G6OA 4A06A 2HWOA 5KHWA 3DTCA 2W4OA 4BCKA 3CD8A 5HE1A 4QNYA 5AUZA 4DTKA 2JDOA 4ZLOA 4RZVA 1JAMA 3P4KA 2GHLA 2HXLA 2B54A 2PVJA 2UW6A 4J96A 4WSQA 1IA8A 3PVGA 3O2MA 2FO0A 5GJFA 1B39A 3LJ2A 4M14A 4ZLZA 4U3ZA 5JRQA 5M55A 3Q4ZA 2RFEA 1PXPA 4RBLA 2X4ZA 4YJUA 4DFXE 2ZM4A 1F5QA 2GS7A 3D0EA 4BGQA 2ITNA 1QMZA 2F49A 4QP3A 4HZRA 1OPJA 3D7TB 2G01A 2X81A 3SHEA 4GFGA 5BV3A 2OFVA 4FV0A 3O50A 2QCSA 2HZNA 4O38A 4BDJA 3QFVA 4JRNA 4QYHA 2A2AA 2WU7A 2YIYA 3BE9A 4D2VA 3KKVA 2Y4IB 2Q0NA 4P5ZA 5HG8A 4EOKA 4RX8A 2PVKA 3NIZA 4BDAA 2OXYA 2A0CX 3B2WA 4R78A 1XH7A 3P7BA 4F0IA 3NYVA 3AC3A 4YLJA 3NYOA 1KSWA 4MAOA 4BTFA 5GJGA 4PPAA 4E73A 2PUPA 5EYCA 2VWVA 3OBGA 4U8ZA 3NUUA 3WOWA 3D14A 3O8PA 3ZXTA 1OGUA 4RRVA 4TWCA 4AXAA 3M1SA 3K54A 4S2ZA 4GIIA 3VS5A 3M42A 4QMWA 4KD1A 2XNBA 4DEDA 3QUEA 3PWYA 4LFIA 3RPOA 2ITTA 4OTGA 5L6OA 1R3CA 2WIPA 3F6XA 3TL8A 5H3QA 3D2KA 4FKTA 2PZYA 2YITA 2IF8A 3OMVA 1FOTA 4QMPA 4NM5A 3TNPC 4BDBA 2R3HA 4LL5A 2WTCA 5DEYA 5DGZA 4AN2A 1G8AA 1V0PA 3PUFC 5IH5A 2ITQA 4HGSA 3POOA 4BCPA 2WOUA 4HYUA 3BHVA 2XEYA 4JLCA 1JKKA 4HGLA 1BLXA 1DM2A 3MFTA 3VJOA 4ACHA 4IDTA 2XKFA 4FSQA 3QZHA 4QMUA 5JN2A 3CQEA 3D4QA 3KXNA 2PVFA 4FIHA 4RC2A 4BTKA 4JBOA 4CV8A 4NIFB 3CY3A 3DFCB 3R9RA 1W2CA 2DQ7X 1A06A 2CJMA 3F3TA 4FK6A 4NCTC 2ZM3A 3UIUA 4GG5A 3V5JA 2YDKA 4ZY5A 5DE2A 2ITZA 1Y6AA 1MQBA 3A7HA 3ZRLA 4FL1A 4AW0A 2F7ZE 3NIEA 2C30A 1A48A 2LGCA 2R3NA 4PP9A 4HPTE 1BKXA 4FZAB 3TWJA 5C8NA 1UV5A 3TYKA 3EQDA 5D41A 3F3ZA 5C27A 3PJ2A 1V0BA 3Q52A 1U5RA 2WMSA 4PQNA 5HCXA 3QCYA 3PVUA 2BDWA 2ETMA 1OL6A 4LRKA 1BI8A 4AU8A 3GU7A 2BZKB 4PUZA 4WKQA 4C58A 4R77A 4GL9A 3EIDA 5IPJA 2J5EA 3LM5A 4JG6A 3VUGA 2HELA 5DEWA 2R0UA 5TT7A 3GU6A 2FB8A 4KAOA 4G3EA 4MYGA 4O6LA 3M2WA 4LM5A 3OEZA 3ORKA 3CS9A 3S1HA 5FTGA 2V62A 3KEXA 5EOLA 4P90A 3NW5A 4CLJA 5J7HA 4F08A 4WUAA 2XK3A 3OBJA 4JAJA 4YBKA 4C4FA 5CNOA 3A2CA 4BRXA 4O0XA 5EM6A 3U87A 1GNGA 3GFWA 1ERKA 3DQWA 3V5PA 4DINA 4JG8A 2NPQA 3DZQA 2C5XA 4IAFA 1H1SA 3R9DA 2OJGA 3D7TA 4IB0A 5I9YA 5J87A 3RPVA 3ZLYA 3HYHA 3KMUA 3UBDA 5M07A 2QOOA 3SW4A 4K8AA 4MBJA 2VTTA 1GZOA 3DXQA 1WVWA 3EQHA 5FBNC 3ELJA 3TNWA 4RLLA 4GEOA 1UWJA 4EH9A 2HW7A 3ATSA 3KRXA 4BIBA 4C3PA 4TXCA 4DCAA 4ALUA 4DEAA 2YA9A 2Y8OA 3MVMA 5F9EA 3PJCA 4BWPA 2C6IA 3PDTA 1Q8ZA 1BMKA 4UV0A 4D0WA 2WHBA 3KL8A 2H9VA 1M52A 4FMQA 2CGVA 3QXOA 1E1VA 1OZ1A 2ITPA 1IEPA 3BZ3A 5L6WL 2YWVA 4ZS4A 4TY1A 2C0TA 4YBJA 3ZFXA 2HY0A 4HVDA 4DG3E 2X4FA 2C0IA 3RPSA 2PVHA 2QONA 2EB2A 4NM3A 4O7LA 1I09A 5G1XA 2C4GA 2CNQA 1VYWA 3LXPA 5LARA 3RVGA 3E3PA 5CT0A 5HGIA 1CDKA 3BLQA 1H07A 3QTQA 1UU7A 5CSWA 4F6WA 4NJ3A 3F69A 2FVDA 3H10A 4NFNA 4NSTA 3COMA 3QXPA 2VGPA 2WGJA 4R5SA 2UZNA 3Q4UA 3R71A 1OPKA 5KKRC 3ZFYA 3CKXA 5CF5A 3DB6A 3JY9A 3QQHA 4XX9A 2Y6OA 3Q96A 5E8SA 4C33A 3JS2A 3I0OA 1DI8A 1FVTA 1NVQA 4S31A 3MW1A 4R3RA 5DI1A 1Q61A 2C6OA 4GT5A 1BYGA 4XV9A 4YTFA 2XARA 4I6LA 4A4XA 3QTXA 2OGVA 4JDHA 4FTNA 1MQ4A 2B9JA 5ANOA 4BI2A 1K3AA 2XK9A 3BI6A 5KX8A 5A14A 3TKHA 3VONA 3C9WA 2HZIA 2YM5A 3F5UA 2J51A 4KSQA 4ITHA 5CVHA 2QR7A 2QR8A 3VC4A 5IUGA 2BRHA 5HOAA 5FM2A 4ZIMA 4CRLA 1PKGA 4F63A 3TUDA 2JKOA 5IDPA 1AGWA 3CIKA 2VUWA 4AAAA 2P0CA 5HORA 2DWBA 3BHUA 4QYYA 5HLWA 2W05A 3JVRA 4JJRA 4Z9LA 5BYLA 3FMLA 2WMAA 4OBQA 4E4LA 4HW7A 4K77A 2C5VA 3WZJA 4FZ7A 1GY3A 2EXEA 3OW4A 3PXQA 3U4UA 3KVWA 2BFXA 4IC7A 4JIAA 2YCQA 2XNGA 1XR1A 5IEXA 3NSZA 2GNIA 3V3VA 4HVGA 3OWPA 2XNOA 5IA0A 4AP7A 5HTIA 3CTHA 3KB7A 3VS4A 1UNGA 3HP5A 3PSBA 2IZSA 1GOLA 4YJNA 4QTEA 5BUJA 4D4RA 1P2AA 2XKEA 5F20A 2WMWA 4IVAA 1Z5MA 3KRWA 2ZMCA 2PUIA 1G8KA 4P7EA 3ORZA 2WD1A 5LJJA 2JLDA 4XV3A 3QZIA 2X0OA 3FC2A 3PA5A 3JPVA 4BWXA 3RPYA 2C6KA 3QCQA 4NKAA 3SLSA 4O84A 3QRIA 2OIQA 4UEUA 4O0UA 2I0YA 4E4NA 2OBJA 2CGXA 4E6AA 2XZSA 2RFSA 3IW5A 4J52A 1PY5A 4MXXA 4JDJA 4KB8A 4NL0A 4RIOA 4FGBA 3RP9A 3SGCA 4L7FA 4E6DA 3FZPA 5AV4A 4RWIA 3FL5A 5CU0A 2IVSA 4RQVA 4QDEA 4JOAA 3VUMA 2V5QA 4HGTA 4NEUA 2EVAA 3QZFA 3TTIA 3R22A 5DFPA 3D5VA 3FMMA 4XUFA 5IQEA 4BIDA 3EMGA 1O9UA 3BYVA 3C4WA 2UW0A 3LFDA 3QWJA 2YJSA 5DR9A 3RK7A 3VW8A 3FY2A 4HCTA 4BDFA 4ENYA 4FTTA 4R1VA 2VWXA 2QKRA 4AW2A 2JITA 2I6LA 3TZ7A 4U6RA 3GFEA 4O86A 4BZOA 4FIGA 4WG3A 5DT3A 5ICPA 3TZ9A 3BYUA 3UOHA 3BX5A 3WYYA 2PHKA 3IOKA 4AF3A 4O81A 4FG8A 4L67A 4EJNA 4FKQA 3EKKA 1KE5A 4I0TA 5EH0A 4EOSA 2JKQA 4DFUA 2F7XE 3LFFA 2PWLA 4YZBA 3IONA 3MS9A 4ACGA 4I22A 5KMLA 1UNHA 3OOGA 4UN0C 5J9LA 4G3GA 4HGEA 4DFLA 1APME 3RI1A 4TL0A 4GVAA 3C4CA 4I5PA 2XBAA 5E8UA 5IA5A 4YHFA 3VULA 4FEXA 5FP6A 4BCJA 4JS8A 3C7QA 2Y4PA 2HENA 3F88A 3R1YA 5AUXA 5LCJA 2BZJA 2W99B 2PK9A 2QOHA 3C4EA 2XNNA 5CSPA 5JK3A 4O6EA 4CG8A 1XJDA 3PIXA 4QT1A 2VV9A 4K0YA 4GW8A 4RC4A 3VJNA 5IF1A 3OCGA 1XHAA 5A4TA 4RLKA 3AKJA 4EH6A 4UY9A 5CALA 1KOAA 3F3VA 5JQ8A 2H6DA 1BL7A 4I5HA 3OP5A 4EOIA 4D55A 2BIKB 3KQ7A 1OBDA 4DDGA 3RWQA 4YJVA 5KZ0A 4BBFA 5JFSA 4WOVA 3OTUA 3TI1A 4EOOA 3ACJA 3ZO2A 4OTWA 4FA2A 5JKGA 4D1XA 4USDA 4P5QA 4D1ZA 4U42A 4EYJA 3OT3A 4IQ6A 2ITUA 4ZTNA 5LVPA 1JKSA 4IZ5A 5F94A 3U6IA 4O7ZA 2I0VA 3NZ0A 5FXSA 3HV7A 4E93A 4NKSA 5L2WA 4QMYA 2WIHA 4F7LA 4TW9A 5C26A 1W0XC 5AV1A 3WZEA 4FVPA 3DB8A 3N4TA 5EI8A 2REIA 1PMNA 2UW3A 3IPHA 5AAFA 2BTSA 4UZDA 4FNYA 3K5UA 5ANIA 4OW8A 1SZMA 2XAMA 2BPMA 1I44A 3LVPA 4WNPA 3HV4A 4K9YA 4C4HA 5GIPE 2BKZA 2J2IB 3HVCA 4FODA 3TTJA 3GB2A 1WFCA 1URWA 3RKBA 5AR3A 3O7LD 3FPMA 4DFZE 3CBLA 5A4QA 4F6SA 4U81A 4R3PA 4CMTA 4E4XA 3EQBA 1ZYJA 4P2KA 5M09A 5CZIA 3NAXA 1FVVA 4O4CA 4R7HA 1R39A 4M84A 4PF4A 3UC4A 5DMZA 5LWMA 3UPXA 4NM7A 3QTRA 4APCA 2EB3A 4CCBA 3BLAA 3EL7A 4BB4A 3ZZWA 4G9CA 2KULA 1NXKA 3K3IA 2B1PA 1H8FA 3IOPA 4BDCA 1WBPA 4M7IA 2XJ0A 3F2RA 1PXKA 3T9IA 4KWPA 3BU3A 5GZAA 3PRFA 3QYZA 4DG2E 4BJJA 2VTAA 2A27A 2R3IA 4O7WA 3OHTA 2IZUA 4A4LA 4CFFA 2QG5A 5D11A 4X6QC 5HCYA 3FL4A 1YHVA 4GMYA 1GZKA 5EYKA 5LMKC 2XAOA 1QL6A 4BDIA 5A4CA 5HIEA 3G6GA 1KE9A 3LCDA 4QTCA 1J3HA 5IISA 2FGIA 2Y0AA 5TO8A 2CMWA 1U59A 4ZOGA 4RX7A 3KMMA 5HVJA 3VF9A 4ZLYA 3RMFA 4MXCA 4QEBA 1ZAOA 2VWIA 3B8RA 3QTWA 4CFUA 4WHZA 3DLZA 4D5KA 2R3QA 3I81A 3CTQA 5AV3A 3QCSA 5AX9A 1G8SA 1LEZA 2O3PA 2CGUA 5EG3A 4S30A 3L9LA 5EKNA 4HVHA 3FJQE 5CSXA 3TN8A 3DS6A 1O6KA 2BILB 3ORMA 5CZHA 3ZSHA 4FC0A 2OXDA 1JBPE 3BV2A 3MTFA 5FTOA 4TYHA 4EKKA 5AAGA 4NWMA 4HNIA 3QKLA 5CU3A 3EFLA 5DVRA 3WYXA 5EFQA 1PRYA 4M69A 5IZFA 2G9XA 2Z7LA 3FQHA 3GI3A 1STCE 4BDEA 4EBWA 5E4HA 3E92A 1YDSE 3ZUTA 1A9UA 4GFMA 3CP9A 2R3FA 1TZDA 5CANA 2UZVA 3V5QA 2LAVA 4BGHA 5IG1A 2PY3A 1O6LA 2AUHA 2XYUA 2J5FA 3IW8A 5DLSA 3RZBA 4C62A 4E5AX 4CEGA 4CZTA 2P3GX 1PXOA 2Z8CA 1Q8TA 2F7EE 4IM3A 5K5NA 3LQ3A 3C51A 2R3PA 4QMNA 3ANRA 4UBAA 3D15A 4AN9A 4BBEA 2QNJA 3JY0A 5HICA 1AQ1A 2I0EA 3FE3A 4K33A 3KK9A 4QTDA 3FMEA 3IDPA 4YP8A 4DG0E 3MGYA 3E64A 2JFLA 2OH0E 5C03A 5KHXA 3K5VA 2O2UA 1K9AA 4BKYA 2VX0A 3PSDA 3LFBA 3LMIA 5LMAA 3H0ZA 1R78A 2WAJA 5AP4A 3RK5A 3ZO4A 3UDZA 4EH4A 1UVRA 1H26A 2IZRA 4OTQA 3EL8A 1F0QA 5ETAA 2PVLA 2ITYA 2XJ1A 5IQIA 3FC1X 4II5A 2HW6A 3ZM4A 2O64A 4NM0A 4V0GB 4AACA 5LVNA 3Q04A 4F9YA 5I9XA 3W2SA 1W7HA 3O23A 4J7BA 4O7RA 3V6RA 4RFZA 5M4UA 2WQNA 4QDVA 4WT6A 4YLLA 5DHJA 4PDYA 2F4JA 4H3PA 4LRMA 1WBSA 2H8HA 3EN9A 3F7ZA 4XOZA 3C13A 3DBQA 3QD4A 3PJ1A 1ZY5A 4IJPA 2QOBA 1UU8A 2W5AA 1YDTE 3ZMMA 2V55A 3DT1A 3GEQA 4NT4A 5LMBA 3I0QA 3WIGA 3W0PA 2XEZA 2PPQA 3W0OA 4OTIA 4QD6A 3O8UA 2XKCA 3R7YA 3SAYA 3PZHA 5E1EA 3BBWA 1OECA 3OVVA 5DPVA 4AZTA 3UO6A 5D7VA 3MPTA 1RQQA 5CU2A 2E9NA 2X7GA 5E9EA 2C6EA 5BYYA 5A6NA 4D2SA 1FGKA 5F95A 2YLFA 4K11A 4UMPA 3L9PA 4M67A 2VTHA 1DS5A 3MYGA 4KBKA 4CMOA 4EHEA 5K0XA 4B9DA 1WMKA 3V51A 4RJ6A 3DU8A 3W2CA 4WRGA 2VX3A 2UZDA 4EOJA 3RCJA 3NUYA 5L3AA 4O1PA 1PXJA 2UVYA 5JZJA 3BGQA 1KUTA 3DBDA 4IX5A 4L00A 1Q3WA 2ZAZA 2OIBA 5AR8A 5EW3A 3CJFA 4EWHA 4PNKA 4RMZA 5CF6A 2EU9A 5EK7A 5L2QA 4ZZOA 4FEUA 5AP3A 2RIOA 5KKRB 4XV2A 4NU1A 1YDRE 2XK4A 3II5A 4X0MA 3NFFB 3DK6A 3JVSA 4DH8A 3P79A 1PXMA 2VWYA 3RM6A 5KMJA 3PLAE 2UZBA 4A07A 3PXFA 4FT9A 4PL5A 5G6VA 5KBQA 2YZAA 3PG1A 5ANEA 4AGWA 3GOKA 5CAUA 1ND4A 1CSNA 3WIKA 4DHFA 3R1NA 1XWSA 4AZSA 3ZSIA 4C4JA 2JDTA 2CCIA 3AD5A 4R8QA 4CQEA 3HAMA 4AZWA 2Z60A 4LI5A 2OW3A 2XIRA 2C3KA 3FYJX 1JSTA 2BHEA 3OUKA 4MUQA 3HRBA 3UOKA 4UZHA 4F9CA 3A7JA 4I5CA 2JDVA 1KE8A 3F7WA 4TN6A 4X3FC 1OI9A 1YI3A 2XA4A 4YC6A 3ZXZA 4MD7E 5KMMA 3EH9A 3AOXA 1P4OA 3COHA 3GCQA 1KE6A 3F66A 3IW4A 4PPCA 4S33A 4XYFA 5BYZA 3QRUA 1XH9A 1REKA 4IIRA 2GPHA 4XG3A 3VWAA 4J71A 3C4FA 3OG7A 4CT1A 4FKIA 2ZFYA 3ULIA 3R28A 1F3MC 2OIDA 3PA3A 5DA3A 3CPCA 4Y8DA 3W2RA 5IA3A 3PFYA 1OB3A 3REPA 1H25A 1BUHA 3I60A 4YZMA 4DITA 4KS7A 4OBOA 3E88A 4CT2A 4DH5A 2FSMX 4FSZA 1SYKA 4W4YA 3RNIA 4PV0A 3R1QA 3WARA 4YMJA 2E9UA 3BYSA 5CU4A 5E90A 3VS6A 5CF4A 4IBMA 2J90A 4JBVA 4C2VA 1Q3DA 4ZK5A 4J8MA 2CHLA 2CNVA 3K3JA 4U41A 3TUBA 4HPUE 1H1PA 5K0KA 3EN7A 2QG7A 3IKAA 2EXCX 4I4FA 1YRPA 4X2KA 1YVJA 3K2LA 4GG7A 4L6QA 4EOMA 4G6LA 3O5AA 4B6LA 2GFSA 3FMHA 4HYIA 4QP2A 5EHLA 2OK1A 3LCKA 2EUFB 1KOBA 2OH4A 5AUVA 3FZSA 3BWJA 1ZMVA 3C4XA 5EI2A 3RPRA 1U46A 4B8MA 4AQCA 3BIZA 4JNWA 5IMXA 5A54A 3DAEA 3CCNA 4FTJA 3LQ5A 3D2IA 3VAPA 2ZM1A 3RCDA 4A7CA 4GKHA 4OTHA 2JAVA 4EQCA 4YZNA 3FMJA 3NVKI 4H1MA 5K4IA 4IADA 1OIRA 1FMOE 3FLQA 3ZONA 2VO0A 4L01A 4G6NA 1SNUA 2J0LA 3HV6A 3Q5IA 4QMSA 4KBCA 1OITA 2AYPA 4WG4A 1U54B 2ZB1A 2Y7JA 5IQCA 1NVSA 1UNLA 3FLZA 3I7BA 3GXLA 2QD9A 2X39A 3KCFA 3HGKA 3ET7A 4HYSA 4H05A 4C4IA 3BV3A 2BTRA 5JQ5A 4U80A 4CXAA 4FICA 4U79A 4Y5HA 3FKOA 3BGZA 4E6CA 4F78A 3ROCA 3AG9A 4O0WA 2ZV8A 3HX4A 4P4CA 5D9HA 4ZTHA 5JZNA 2J0MB 4CRSA 3BQRA 2C3IB 2XIZA 5FDXA 4AA4A 4QNAA 2NNWB 4R3CA 3T3VA 3U4WA 4YJRA 5DRDA 2RFNA 1LPUA 3OC1A 4G17A 4QTBA 4GJ2A 5L2TA 2P33A