5HIDA

Braf kinase domain b3ac loop deletion mutant in complex with az628
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
269
structure length
257
Chain Sequence
DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGLAEQLSGSILWMAPEVIRMQDSNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELARELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
publication title Activation Mechanism of Oncogenic Deletion Mutations in BRAF, EGFR, and HER2.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 257
sequence length 269
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hidA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hidA01
3VHKA 2ONLA 3DV3A 2UW6A 2JKQA 4WG4A 1NT2A 2P2HA 5M53A 1Q41A 4FSQA 3H0ZA 1KWPA 1JKSA 3IECA 4DCAA 1FQ1B 2WTCA 5FDPA 3TUDA 2BDWA 3ACKA 4PRJA 4QD6A 1W98A 4M7IA 4F65A 3L9MA 3WZJA 1O6YA 3BHYA 4RIXA 3VQUA 5FEQA 1M2PA 2C3IB 5B2LA 3UP7A 2XNOA 4I93A 3RAHA 4FSTA 3LCKA 4O82A 5TKDA 4D4RA 1H24A 3IGGA 4X7QA 4BICA 4ITJA 5AUVA 4RQKA 5J9LA 2XNBA 4S30A 2IWIA 5A4EA 3UC3A 1GZOA 3MIYA 1T45A 1OECA 2BDJA 3QGYA 4UYAA 3VUKA 3U6HA 3V01A 4PX6A 1M17A 1ZLTA 2OF2A 3O17A 4I6BA 4KINA 2C47A 2CGXA 4FNXA 4V0GB 5ANGA 3SW7A 1YOLA 2JKMA 2YM7A 3H0YA 4W4WA 2IZRA 1CKPA 3OWLA 2PVRA 5DE2A 4IM3A 5FG8A 5KE0A 1WAKA 3QBNA 4H3PA 4ZY5A 5EFQA 5AR5A 4IAFA 2G9XA 4O1PA 1M14A 2XNNA 4G6NA 2VUWA 3AOXA 4GK4A 3LFQA 4JAIA 4M67A 4M84A 4F0GA 5DYJA 1KOBA 5DLSA 1WBOA 2ITYA 4ZLZA 4TT7A 4BFMA 4ACGA 4NUSA 3BU3A 3TTJA 3IDPA 3V5TA 4CT1A 2ITQA 4APCA 4W4VA 3W2PA 5FM3A 3B8QA 3FHIA 2V62A 1P4OA 3FI2A 5CU4A 3FZSA 4MBLA 3MH3A 2V22A 3T9IA 2OBJA 5DWRA 2QR7A 2XK9A 5T68A 4GKHA 5GINE 4DFYA 2QLUA 5LXMA 2CGVA 4W4YA 4QMWA 4XHKB 3EIDA 3BWFA 2C0OA 3IQ7A 4UX9A 3VBXA 3BHVA 3AD6A 2GMXA 5FTQA 4EHEA 4AG8A 1ZOHA 2F9GA 2FYSA 3DZQA 3MB7A 3I6WA 4DF3A 3POOA 4XBUA 4L45A 2B4SB 2BAJA 5M55A 3VRYA 4F4PA 4AZWA 5GJFA 4I5MA 5FEDA 4UMUA 5AIRA 5KMKA 1WBTA 4A9SA 3UVQA 4YTCA 3CCNA 1QCFA 5M57A 4TPTA 2BHEA 2X1NA 3QKLA 1DI9A 4NFNA 2FH9A 3S1HA 2X9EA 4YBKA 4XP0A 2RG6A 4W4XA 3SHEA 2RG5A 3WZEA 4FV9A 3AC2A 4Z9LA 1JSVA 3C5IA 2J5FA 2IW8A 4IZAA 4RLLA 3LCDA 3QWJA 5J79A 4TW9A 2FGIA 3QQLA 3FV8A 3KMUA 5JFWA 4KWPA 1U4DA 3UTOA 5J9ZA 3FZRA 1J7LA 1TQIA 2WELA 4GH2A 1OPKA 2UV2A 5HICA 4CZUA 3FZTA 4X6QC 5C4LA 4FUXA 2OK1A 4RZWA 5AR4A 3HV7A 4IAAA 2H9VA 3U55A 4GFMA 1F3MC 4C8BA 5I5ZA 3UQFA 3SW4A 1WBSA 4YLKA 3W32A 4XX9A 5HTBA 4K8AA 2PUUA 4TNDA 5FM2A 5L2WA 3SA0A 2YZLA 2WMRA 2Z7SA 4ZZNA 3EJ1A 4F9YA 2Z7LA 1OIQA 3OVVA 4FEXA 5KZ0A 5FUTA 5BUEA 1VR2A 3UIMA 3POZA 5F20A 3TNHA 2LAVA 3KGAA 3G0EA 4FKQA 2IW6A 4U0IA 4L46A 4ACMA 3DT1A 3QL8A 4KSPA 3GCPA 4ZTRA 4EYJA 2QOCA 5DBXA 3F2AA 1KE8A 3P7CA 3RZFA 2CDZA 5AMNA 3O23A 4ACDA 2XF0A 4YJOA 5CX9A 2VWBA 4IWPA 1PXOA 2WTWA 1O6LA 4S31A 4YHJA 2P2IA 5LWMA 3PP0A 3KQ7A 4AT3A 4HVHA 2ITOA 1Y6AA 4P2KA 4HCVA 4GK2A 2IG7A 3FLSA 3U6IA 3ZFYA 2R4BA 3C4ZA 3MVHA 3WYYA 2J50A 2PZIA 4WRSA 4U42A 3EHAA 2OU7A 4KIQA 1Q61A 4U43A 1APME 5CNNA 4DGMA 5EW8A 1MRVA 2R5TA 3PJ3A 5FTOA 5IQFA 5AM6A 4HYIA 4E4MA 2W9FB 2A1AB 1M2QA 2C5XA 2PE0A 4Q5HA 3FQEA 2C5OA 1PYEA 3GB2A 4XRLA 5CZIA 1YW2A 3IOPA 3PWDA 2FSOX 5HBHA 5CF6A 3VBQA 5BVFA 1JVPP 3DCVA 4FNWA 4X0MA 5HE0A 3I0OA 4J52A 2VTPA 3D5WA 3PA3A 4M0ZA 3GU4A 4QMXA 4BWKA 3UO5A 2WPAA 4FNYA 2IVVA 2PSQA 2BZHB 2VTRA 3TJCA 2FO0A 2JEDA 4FK3A 5L2QA 1OIUA 4C7TA 4D4YA 5D9HA 2P4IA 5AV2A 3FLNC 1NVRA 4CKJA 1URCA 2YCRA 3AC3A 5E8TA 2I1MA 3IG7A 1OBDA 4DG0E 2J90A 3IKAA 4FKPA 3VBWA 4QP2A 4P5QA 3O0GA 4BDGA 4R6VA 4PP9A 1PW2A 4W9WA 4CZTA 1GNGA 4AU8A 5IDPA 3R8UA 2PUPA 5E8SA 5EYDA 3RHKA 2QCSA 4PPCA 3UO6A 3DKCA 3F3TA 4F7JA 2UZWE 3NAXA 3VF8A 1PJKA 2I6LA 3KRRA 5E91A 4IB0A 3FMDA 5CAPA 1PRYA 4GT3A 5C03A 3NEWA 2ZOQA 3MWUA 1PYXA 4FYOA 4IX5A 2UZBA 2CGWA 4I41A 4OW8A 4XV2A 3WZUA 4C4IA 5C4KA 4ZS0A 3RINA 4HOKA 2IZUA 2B54A 1ZMWA 4BCKA 4JT3A 4D5HA 3A8WA 3D7ZA 3M11A 3NUXA 4WSQA 4BTFA 2BKKA 4UXLA 2WTVA 3VW8A 2J6MA 1XJDA 3UNJA 3QTXA 4Y5QA 4BWPA 3MH0A 3TEIA 1SVHA 2VWIA 2ITXA 3BE2A 1P5EA 4GCJA 4I0TA 3W33A 1STCE 2QHMA 3WF6A 1BYGA 4D2PA 2WQMA 4K0YA 4BC6A 5J1WA 5JK3A 2B9HA 4ID7A 4O6LA 4UMTA 1MRUA 3CTJA 1XH8A 4YC6A 2IZSA 3LXNA 5IQGA 3NMUF 3ERKA 4DA5A 2YAAA 2PVLA 1UNLA 3V04A 4EH4A 5KO1A 2QONA 1XBAA 2X7FA 5AV4A 2W1EA 4ZJJA 3NUYA 2SRCA 3HMOA 4EH8A 5HI2A 3TKUA 4IX3A 2WD1A 3ZMMA 2CLXA 3R7OA 3QHRA 3RMFA 4FTCA 2C4GA 2VTIA 3JY9A 3PTGA 3KXXA 4QMUA 4BN1A 3K54A 4O0TA 3UVPA 2CKPA 3HP2A 4IFGA 4USDA 4E5WA 2VNYA 2VO0A 4UN0C 2QG7A 4WBBB 1JWHA 3QQHA 5M07A 4YJQA 4BIBA 4QP8A 4F1MA 5K4JA 1FGKA 4O7LA 2C6EA 2XNPA 4HCTA 4RT7A 4YNOA 2XK7A 4P7EA 4MKCA 5AIKA 1Z57A 4EK6A 3LCTA 5KMMA 3MI9A 4ZS4A 1FMOE 2C5VA 4TWPA 2QURA 2Z7RA 3QQJA 5CT7A 4EH9A 3N9XA 4YO6A 1IRKA 3L9PA 4BL1A 3PDTA 4CRLA 4RX8A 3FL5A 4PMSA 4GFGA 3I5NA 1TVOA 2BRGA 3ZXZA 2YEXA 2OH0E 2QO9A 3DQWA 2V7AA 4V0GA 3Q53A 5EM7A 3VS6A 4PY1A 4UEUA 3BPRA 4J7BA 5AA8A 3HUCA 1PKDA 5DOSA 4DH3A 3R9RA 3QQKA 5AP3A 2VV9A 3CD3A 2PMIA 5ETCA 5AP2A 4LG4A 3UOLA 2YIRA 4U41A 2NP8A 1KE7A 2IJMA 4O0WA 5EKOA 5HKMA 5IA3A 3VWAA 2PE2A 4AWIA 3U8WA 1YKRA 3CR0A 3MFSA 4MH7A 1LP4A 1BKXA 2RKUA 3GEQA 2WTJA 5HU3A 1OKYA 1XH4A 5CF5A 4Q9SA 2XJ1A 3Q3BA 4NTSA 5CT0A 1XKKA 2LGCA 3O7LD 1Q8TA 3VW6A 2WTKC 4V05A 5EQPA 2W1CA 3U6JA 4GT4A 5KMIA 5FP5A 4JLCA 2JC6A 2YDKA 3QX4A 4KBAA 4MX9A 4EZ7A 2HELA 4E4XA 3MH1A 3UC4A 1U54B 1OKVA 3HLLA 1ZRZA 1JOWB 3FWQA 3ORTA 4CQEA 2C3JA 4ZIMA 3RTPA 1QPJA 5EI6A 5DGZA 3UOHA 3EYHA 1W7HA 3DDPA 3N4VA 4II5A 4DHFA 4G34A 3N4UA 5KUPA 2X8DA 3G2FA 2WHBA 3I79A 4C38A 3LAUA 2UUEA 5D12A 3F7WA 5KCVA 4GYGA 3KY2A 1JLUE 5AX9A 2ITPA 4O22A 3UZTA 2VZ6A 4MCVA 4YPDA 3HMMA 3KMMA 3ZUTA 4A9RA 2OJIA 1W8CA 4JNWA 2YM5A 4BKZA 3TZ7A 3BWJA 4K77A 3MS9A 3ZBFA 2BZIB 4S34A 1LEZA 3AMBA 3FXXA 2XKDA 4G31A 1DAYA 2YJSA 3BBTB 3V5JA 4R1VA 2BALA 2EB2A 2PPQA 3ORZA 2XZSA 3GU6A 3KKVA 3VAPA 5LVNA 1ZZ2A 4FK6A 4J96A 2CPKE 4JL9A 4E7WA 4AOTA 4AW0A 4DGLC 3P0MA 5CU3A 2W05A 3NYNA 3OCBA 4L6QA 4BGQA 3NUUA 1OUKA 2H8HA 4FT0A 4I0SA 1P4FA 4LRJA 5HG7A 3MY0A 4O0YA 5IUGA 4JX3A 5HVKA 5IU2A 1YDRE 4K11A 4KNBA 5ANIA 4EOMA 4IANA 4ZMEA 5CANA 1ZMVA 4I21A 4L3JA 4AF3A 4IAKA 4IZ5A 5ETFA 3EZVA 3COMA 5GJGA 3L9LA 4X2NA 4PF4A 2XS0A 3RGFA 4AGWA 4E6AA 2J0IA 2BRBA 2PK9A 3HYHA 4PWNA 2BROA 3GCUA 2FSMX 2F57A 3ZXTA 4BDBA 4L67A 1UU7A 2ITTA 3DAJA 4BCPA 4L8MA 1QMZA 4S2ZA 4F7SA 2PHKA 1YOMA 4IZ7A 2YACA 4YZDA 4TTHB 3VUTA 3K5VA 1BMKA 4JBVA 3MPMA 1FMKA 2R64A 2C6LA 3P23A 3WBLA 1L3RE 2UW9A 1PXJA 2OG8A 3TDVA 4WBOA 3A2CA 3AGMA 5EOBA 4CZYB 2GQGA 4EQMA 4FA2A 3OXZA 3OG7A 3RK5A 4IZYA 1GJOA 1PXMA 4W8DA 4H1MA 1K9AA 2OJFE 2WAJA 3Q04A 4P90A 4X3FB 5AUUA 3BIZA 5EYKA 2XRUA 3W2OA 3EQPA 1UKHA 2QOKA 3F3WA 3NYOA 5JSMA 2OW3A 3MSSA 1T46A 2Y7JA 4RC2A 1E9HA 2ZM4A 4DGOA 4QYEA 1WVWA 3GNIB 4G3CA 4Z55A 3EFLA 2HZNA 3MYGA 3KC3A 4E5AX 5E92A 3S4QA 1YI6A 2C0TA 1ZWSA 3CLYA 3R73A 2PMLX 5AR3A 4C4EA 1CTPE 1M7NA 2P3GX 4I5HA 3R83A 3D14A 4M8TA 4O2PA 4XG8A 5FD2A 3FQSA 5FDXA 1UVRA 1PY5A 2ZM1A 5EHLA 3REPA 3U54A 5JFVA 5DEYA 4AZVA 4D58A 4CCBA 4B7TA 4U40A 4YUQA 4RIYA 3KULB 3R7IA 1BUHA 2HZ4A 3QYWA 2ZM3A 4J98A 1KSWA 4WKQA 3ZM9A 3LFDA 2F49A 2PVNA 3HMIA 4D55A 4KBCA 2WKMA 3SC1A 4BY9E 4LL0A 2ERKA 2BAQA 2VTAA 2E2BA 4ZLYA 4MBJA 3EKKA 1Q3WA 2GS7A 2I40A 3QKMA 4EH7A 3WF8A 2F7XE 3GBZA 2CNQA 4M69B 5HLPA 2ETKA 5GIPE 3EQDA 3BV3A 4ZSAA 5JGBA 1OVEA 3P86A 4ZEGA 4TYIA 3KN6A 3SAYA 4HGTA 4TZRA 1PXKA 4XYFA 3UQCA 3UOKA 3FMJA 5AAEA 2IW9A 2KULA 1OI9A 5E8WA 5BVEA 2UW8A 2QOBA 1YOJA 4ACHA 2PWLA 3WF9A 4ZXTA 4C57A 2O63A 4E6CA 4LOPA 1UKIA 4RX5A 4CYIA 4EWHA 4EH3A 2CSNA 5HVJA 3DK3A 3CY3A 3RPYA 4D0WA 4EHGA 4FX3A 4L00A 4YJVA 3W2SA 3OP5A 2ZV2A 4BZDA 3R7UA 4ZTHA 3IONA 3FI8A 2C0IA 4J97A 2Y6MA 1YXSA 3DJ6A 4HNIA 1OKWA 1OB3A 1PF8A 3NYXA 3ZBXA 3CQEA 3G9LX 4OTDA 3QZIA 3ZUUA 1SYKA 4TYJA 2W9ZB 5AEPA 3A7IA 3LFNA 4ZTSA 4CT2A 5HBJA 1FGIA 3E7OA 1H4LA 5E8XA 1OIRA 4QMZA 5IQIA 2B9FA 3QWKA 4I92A 3QALE 3R22A 3CXWA 3LJ2A 2RSVA 4R1YA 4WIHA 3FXZA 3VRZA 5EHYA 3KL8A 2XMYA 3EMGA 3HZTA 3BELA 4GL9A 4AA4A 2GU8A 3Q5ZA 5IA1A 3FZOA 3NVMB 3A4OX 3NDMA 4QT1A 4DEEA 4E3CA 4EUTA 2BUJA 2R3IA 5CEMA 5J7HA 3KB7A 1REKA 3UO4A 4QRCA 2VGOA 3AMAA 4NTTA 5LARA 3W10A 4O0XA 5L3AA 4EH6A 4GV1A 2R3GA 3FUPA 4FUYA 4RJ4A 5CVHA 2W1DA 3JUHA 4Q9ZA 4D2SA 1OBGA 1UU3A 3NNUA 4ZP5A 4DN5A 4FZFB 5EG3A 5IQBA 3R2YA 3RNYA 4JI9A 2WOUA 2X8IA 4F6WA 3F88A 2IN6A 3NW5A 4CFNA 3SXSA 3HNGA 2GQSA 3EFJA 2YDJA 1VYZA 3LIJA 4BDFA 3CPCA 3A7JA 4YO4A 3FYJX 3R30A 3D7TB 3RVGA 3NPCA 4UMQA 4YU2A 4R3RA 2BR1A 5I9ZA 5EHOA 2WNTA 4TWNA 2HYYA 3F3UA 3MFTA 4IBMA 4E93A 3FXWA 1LPUA 4AZFA 4EOQA 5BUJA 2GSFA 3OCSA 1BI8A 1PXLA 4O7TA 4IADA 3DKGA 1ZYJA 1A48A 2XH5A 4GKIA 4YGAA 2Y4IB 4MF1A 4IDTA 3VIDA 3E3BX 4FSMA 3NWWA 4G5JA 4WOVA 4QMYA 2VO3A 1G3NA 2FVDA 4DAWA 4U7ZA 5E90A 5GZAA 2YIQA 3QZGA 4LYNA 3FZ1A 4L42A 2WIPA 4R3PA 2XEZA 3ZLSA 4DFUA 3CKWA 1WFCA 2H6DA 3DBQA 4XCUA 4ZZOA 4FGRA 1Y8GA 4IAIA 5BVKA 4OBOA 1OL1A 2XA4A 1J1BA 4KB8A 5DMZA 4DBXA 2R3PA 2BIYA 2R3QA 4MXOA 3THBA 2OFUA 1LUFA 1YVJA 2ITVA 3QD3A 4D2RA 5K9IA 3VBVA 3S3IA 2QD9A 4L43A 3WZDA 2ITWA 2OWBA 3WIKA 3IW4A 4GSBA 4X21A 5D41A 3I60A 4E4NA 3R00A 4J8MA 5LVPA 2PVHA 4QMSA 1Y91A 4RJ5A 3IDBA 5DR2A 2WMVA 4UMRA 3H9RA 2PZPA 3EQRA 4BTKA 2FA2A 3MY1A 4G3FA 3ANRA 5HCXA 1JKKA 3EWHA 4U5JA 3D0EA 1AGWA 3R8MA 2REIA 2OIBA 1ZOGA 2YIYA 4HYSA 4O6EA 4AGCA 5B2MA 4C4GA 3Q4TA 4FIJA 4WD5A 5HORA 1Q62A 4ITHA 3MJ2A 2AC3A 4IVAA 3HVCA 4WHZA 4X3FC 3BX5A 3D5XA 2JDTA 3E8NA 2RFSA 4B4LA 1L8TA 2XUUA 2QODA 4MD7E 4NT4A 3C51A 2GNJA 3H4JA 3BQRA 3HKOA 1UU9A 4QOXA 3P4KA 3T9TA 2B0QA 3LLTA 4KD1A 3UZPA 3QD0A 4JG7A 4Z7GA 4ZJIA 2PZRA 4BCJA 2ERZE 4K9YA 4TYHB 4CFMA 2OJ9A 2O3PA 2XK4A 3QU0A 4RA4A 3R8PA 2XRWA 2UVZA 5HLNA 2I0VA 3O71A 3PFQA 1UWHA 3P5KA 4OTFA 3FKLA 4MWIA 2R3LA 4C59A 3LW0A 2GS2A 1UV5A 3ORNA 3UP2A 1Y8YA 2RF9A 2XM8A 3HV3A 1CM8A 5L8KA 5CALA 3PXFA 2IO6A 3S0OA 4GUBA 3PVUA 4M0YA 5AR7A 5JGDA 2UW4A 2B53A 3DLZA 4BIEA 3MTFA 3GQIA 1J7IA 1KE9A 5ANEA 4ALUA 3LHJA 4FZAB 3V8WA 2JDRA 3PE1A 3Q2MA 2JBOA 1ZAOA 4EBVA 4AQCA 3V8SA 3ZO1A 4X3FA 2GNFA 1QPEA 3BU6A 1XH5A 2CN8A 2X39A 3Q4ZA 3SQQA 3TKIA 3E87A 5A3XA 4JXFA 4YSJA 4DTAA 3PSBA 5T6KA 1JSTA 3IPHA 4NW6A 4OT5A 4F9WA 2YM3A 5JQ5A 5E9EA 1JKTA 4YZCA 4D4VA 2Y0AA 4N57A 5ANOA 4XEYA 3RPOA 4BHZA 4YSMA 3LMIA 3R6XA 4I20A 4H36A 5AX3A 4EORA 1Q97A 4WSYA 4B9DA 1J1CA 4FL1A 1YDSE 4DGNA 4GMYA 2XIRA 2XB7A 3OROA 2QC6A 4KIKA 3PLAE 2E9OA 2XIKA 4NCTC 3KRLA 3TNWA 4BDDA 4BYJA 2X9FA 4FKTA 1FVTA 4LM5A 4IH8A 3TV4A 5L4QA 3NVKI 4XLIA 5LCJA 3VC4A 4G16A 2JLDA 4TWOA 1OL6A 5AM7A 2JFMA 3KA0A 4YJSA 5L6WL 3BQCA 4X2JA 2QOOA 2DS1A 2YWVA 3I4BA 5KMOA 4KRDA 4NFMA 4XG9A 4D1SA 3QA0A 4JRVA 3NR9A 3IS5A 3R9DA 4JRNA 5BYYA 3SX9A 2BRMA 2PZ5A 1GZNA 3R9NA 5E4HA 4PUZA 5CSWA 4KBKA 3O96A 5KX8A 3OBJA 4RPVA 3EH9A 5I4NA 1I09A 2XIZA 1K2PA 4GVJA 3WE8A 3RBWA 3UVRA 4EOPA 2OO8X 3P9JA 4Z16A 4CFVA 2X2LA 3UIXA 2OFVA 3EOCA 3I1AA 3R8VA 2V55A 2B52A 5EOLA 4EOOA 5LJJA 4QNYA 4DEDA 4DT8A 4KUJA 5TE0A 3C4WA 3PLSA 5GHVA 4O86A 3IW5A 5CLPA 4BBMA 2G2FA 4QP3A 2OJJA 4AA0A 5BUIA 5BQ0A 1JSUA 1WZYA 2R0IA 4FSYA 4QTBA 3OEZA 4FT7A 4EWQA 3VS1A 4EONA 2CKOA 3ORLA 3TM0A 3OCGA 5CAQA 3F5XA 4Y8DA 3RALA 3NSZA 3A7HA 4R7HA 4FIIA 4GFOA 4YP8A 2BTSA 4CTCA 3DK6A 4C02A 4EUUA 4XJ0A 3E3PA 3RPRA 2E9VA 2ZVAA 3GXLA 4F6SA 2HXQA 2UZEA 3QCXA 4FL2A 3MGYA 4BTJA 5JZNA 5IMXA 3R8LA 3M42A 5DNRA 4UWYA 4Q2AA 3NW7A 1MP8A 5BYLA 2UW3A 1H1RA 4JQEA 3HV6A 4JVGA 4EHVA 3JS2A 5K5XA 3RCDA 5CENA 2GHGA 3QCYA 4CG8A 1DAWA 4PL3A 4CSVA 4LGDA 5G6VA 4J8NA 4LOQA 3KK8A 3SVVA 4KS8A 4EOKA 3E62A 3VS2A 4OR5A 5HX6A 3RP9A 3A99A 1QPCA 2VTSA 3FJQE 4MD8E 1YQJA 5DG5A 4MK0A 4FZ6A 3KRWA 2UZOA 5M4FA 4YZMA 3I5ZA 4QTAA 4U97A 3CKXA 1HCLA 5HQ0A 3G15A 3Q52A 3BHTA 3R7GA 2EXEA 3EYGA 4FV0A 5IUHA 5CF4A 5EW9A 2BRHA 3TACA 2IZTA 2VX3A 2ZV8A 3AGLA 4AZSA 4AN2A 1VJYA 4NIFB 1A9UA 1X8BA 2RFDA 3DAKA 3SOAA 3KXZA 4RMZA 4L3PA 2WMBA 3W1FA 4C62A 4PPBA 4XMOA 5M4CA 3VUIA 3WILA 1ZXEA 2YM6A 3BE9A 1VYWA 3F3VA 4ITIA 3VS7A 2UZDA 1XHAA 3BYOA 3O8TA 4U79A 4DBNA 3CIKA 4PMMA 1H1SA 3BCEA 3WIGA 2OH4A 4JBQA 2O65A 4B0GA 3A8XA 3LFCA 3VS5A 4BCMA 3OOGA 4MAOA 4EOLA 5IEYA 3VQHA 2WQNA 4F99A 3W2CA 1Q4LA 3ENHA 5HCYA 4BI1A 2OLCA 4AGDA 4ASZA 3UQGA 2WOTA 1CSNA 4XS2A 5HEZA 2O8YA 4ZY4A 3PG1A 5AV0A 5JH6A 2PMNX 4KS7A 2P33A 3ROYA 4BB4A 5F95A 2ZV9A 1WBNA 2PUIA 3VJOA 2XK8A 3B2WA 3HMNA 4F1OA 4LRKA 5ACBC 4ANMA 4W9XA 5KKRC 1GIIA 5C27A 2DWBA 3GOKA 3SXRA 3RCJA 2W1GA 1JBPE 3A4PA 2R7BA 3ZC6A 3CTQA 4O0VA 4A9TA 3SOCA 4IFCA 1UNGA 1Q5KA 4JX7A 3PVGA 4OUCA 4YURA 3DTWA 3EN4A 3UGCA 3CPBA 4YNEA 5HE2A 3PY3A 4JR7A 2JFLA 3LFBA 4J1RA 3SG8A 1KE6A 4GK3A 3QUPA 1ZZLA 3K3JA 2C5YA 3C0HA 3MVJA 4WG3A 2XKCA 3ZS5A 1PXPA 4FTAA 3WARA 4DITA 4DG2E 5M08A 4Y73A 3UYSA 5LOHA 4I22A 5EK7A 4GIIA 4M13A 4BDJA 5E1SA 4D28A 3JPVA 3QC4A 2PMOX 3CJFA 3OUNB 5IA0A 1EH4A 4FVRA 2VRXA 3EQGA 3TV7A 4DH5A 3COIA 3ZHPC 4D4SA 3PSCA 5A46A 3AT4A 4IX6A 1NXKA 1FINA 3UPZA 4TXCA 3V6RA 4IVCA 4ASDA 3UIUA 2BFXA 4CKIA 2ESMA 5IUIA 3II5A 4I24A 3ZO2A 3C9WA 5E8ZA 4BDIA 4RIWA 4BCIA 4J71A 5DT0A 4QQTA 4RX7A 4XG6A 5KMNA 1UU8A 3GC0A 4QYFA 3PWYA 3QHWA 4LQMA 5D7VA 3ZSHA 5IMEA 3R71A 4PDSA 2GNHA 3RAWA 4OAVB 4CV8A 3NUAA 3DBEA 3R01A 4EK5A 2X4ZA 1CKJA 2GFCA 3LOKA 3BYVA 4UZDA 4AZEA 4HPUE 5TF9A 1OL7A 2PVKA 3HEGA 2UZTA 3F61A 3ZM4A 3VUGA 5FBOA 4FTKA 3W2QA 2GQRA 2XNGA 4PNKA 3ZEWA 4O7WA 3IOKA 3TUCA 4MBIA 3AT3A 4U9AA 5HO8A 4FODA 4EZ3A 4FG8A 4RGJA 2ZV7A 2GPHA 4XLVA 3A62A 1ZY5A 4NK9A 1GOLA 3L8PA 4IMYA 2QO2A 4BCHA 5CTPA 3NUSA 3KCKA 4UZHA 3WF7A 5HIDA 1Y6BA 2R0UA 3TN8A 5J95A 3ZLWA 4O0UA 3H10A 5CZHA 3ID6C 2VTHA 4KKHA 3CGOA 4ANLA 5A4CA 4HVGA 3PJ8A 5EI8A 2YCQA 2YLFA 2BPMA 4TY1A 3OW4A 4AACA 4HVSA 1IR3A 2WB8A 4BHNA 2WMTA 4QQ5A 5M51A 4I4EA 2YJRA 5HG8A 4CEGA 5KHWA 3LLAA 2VNWA 4PL4A 4FEUA 2HOGA 2J9MA 2NRUA 3ORPA 1FVRA 2XP2A 4FC0A 4F09A 2OZAB 1WMKA 2X7OA 3ZSGA 4K1BA 4PDYA 2YHVA 2W1ZA 2HY81 3DOGA 4EHZA 3LFAA 4C4JA 4QMQA 2RFEA 4GU9A 5AR8A 1TKIA 2X6EA 4Q5EA 5CNOA 4DFNA 4I0RA 5C9CA 4ZY6A 4DC2A 4M3QA 4JAJA 3W16A 3RKBA 2GTNA 1PXNA 4FKIA 2CLQA 4ONAA 4A4OA 2ZAZA 3GC7A 3KVWA 3NX8A 2FB8A 3QC9A 4FZ7A 4YPSA 3E93A 5F4NA 3FSKA 3ZEPA 3E7VA 2EXMA 2AUHA 4QMTA 3MTLA 2C68A 3M2WA 3P1AA 4AFEA 3I6UA 3OOMA 3O8UA 1CMKE 4PPAA 4YJPA 3SRVB 4E6DA 1ZY4A 3O50A 4EBWA 2ZDUA 3FMKA 2J4ZA 3D4QA 4DEBA 4I5CA 5CU0A 2ACXA 3LFSA 5C26A 1JKLA 2B55A 3FMMA 4E73A 5H8GA 4RJ8A 4NSTA 4C35A 4CTBA 5A9UA 4XG7A 3PXKA 3NCGA 4ZSEA 2VGPA 2VTNA 2XYNA 3ORXA 4CYJA 3QTQA 3NLBA 3QF9A 1QL6A 1JAMA 3DU8A 3GU8A 3WOWA 2BKZA 4XBRA 5HE1A 3ZZWA 4ASEA 2X2KA 3PA5A 3AC4A 4WT6A 2GTMA 4CCUA 1ND4A 1OMWA 3NIEA 3QTIA 5I9WA 4GW8A 4ZZMA 5DR6A 2J5EA 4YJRA 3PXZA 1S9JA 3OY1A 3RK9A 3TZ8A 4AW5A 3E92A 5HX8A 5AUZA 2YA9A 1BLXA 1SZMA 1O9UA 1R1WA 1ZMUA 4UXQA 4ORKA 1KE5A 2WQEA 5CQWA 1PXIA 3O2MA 4KIOA 4MYGA 2QI8A 3IK3A 4L53A 5CVFA 3GCQA 3C4XA 3VUHA 4A7CA 2YM8A 4QP1A 4IJPA 2XM9A 1OUYA 2OKRA 4JS8A 5CWZA 3RAIA 3OHTA 4CG9A 3G0FA 4M68A 1TQMA 2WEVA 4MNEB 1IA8A 2NO3A 3KU2A 3H9FA 3LE6A 4GU6A 5FXSA 5IKWA 2C3LA 2QOIA 2C6DA 3L8XA 2JDVA 4J99A 2I7QA 4EJ7A 3TNPC 2JBPA 3BEGA 4TWCA 1OL5A 3R0TA 5CS6A 5JFSA 5BNJA 2J0MB 4LMNA 4EH2A 3PXRA 4IIRA 1H28A 3WE4A 5KMLA 1P2AA 3EQCA 4G3GA 4YHFA 4R3CA 3ZYAA 2OICA 3LCOA 3M1SA 3PUPA 4IE9A 1RDQE 2HIWA 3GOPA 2BZJA 3QD2B 4FKSA 4YLJA 4FSWA 4MXCA 4QQCA 2XJ0A 3LPBA 5C1QB 3RK7A 1WBWA 2NRYA 3AXWA 4IC8A 4MVFA 4BCQA 3PSDA 5M4IA 4QNAA 3FY2A 5TR6A 4DE4A 3GP0A 4ASXA 1GZKA 4YHTA 4C36A 4DFXE 3OC1A 1YRPA 3G6GA 2VWYA 3NAYA 4FVQA 4ZMFA 4AAAA 3ZRKA 2J51A 4BDEA 2BMCA 3UODA 3DB6A 4TRLA 4APPA 4O7NA 4C4HA 5I3RA 3PVWA 3U4UA 5GZ8A 2PVJA 3C7QA 4IAZA 2PL0A 2YM4A 3V5LA 5HHWA 3ODYX 3I0QA 1DM2A 5AJQA 2O64A 4GIHA 3HP5A 4BGGA 4ZLOA 5HTCA 3BHUA 4C37A 5CAVA 3N4TA 3A60A 4FKWA 3VNTA 4O2ZA 3Q4CA 2XNMA 5BVWA 4F7LA 2EUFB 3TJDA 3HRBA 1H8FA 5DRDA 1GAGA 3FI3A 4BYIA 2JAVA 5E8UA 1LEWA 3QAME 3BI6A 5H9BA 3SKCA 1H07A 2UVXA 4RVLA 2JD5A 5DN3A 2WQOA 4RIXB 4I23A 2IPXA 3MFUA 4I6QA 3TI1A 5DA3A 3FKOA 4UALA 4TN6A 4RIOA 1M7QA 5B0XA 2CCIA 1IAJA 4A07A 3MESA 5DR9A 4IHPA 1AD5A 4PMTA 2ZB0A 4CFUA 2WTIA 4IQ6A 4FICA 2XEYA 5J8IA 2QKRA 4FE2A 4PNIA 3RM7A 3VVHA 2P55A 4IEBA 4GG7A 3NIZA 2DQ7X 4XV1A 1XWSA 4G6LA 3QQUA 4ZTNA 2B1PA 1A06A 3AT2A 3KXGA 5HU9A 3MH2A 4OAUC 3GFEA 3OT3A 2CJMA 3DGKA 3TT0A 4IB1A 3FZPA 4RRVA 3HDNA 1DS5A 4H58A 3UE4A 4EKLA 5FXRA 1WBPA 5J9YA 2IVUA 3R28A 4L9IA 4ZOGA 2HENA 2Q0BA 3EKNA 3UDBA 4FV3A 4RWKA 4NH1A 3FC2A 3FLZA 2ZMDA 3D94A 4A4XA 4ZAUA 3ROCA 1R0EA 5IQAA 1V1KA 1URWA 4WA9A 5J7BA 3H30A 4MXYA 1XR1A 4JR3A 5JRQA 3LZBA 3T3VA 4FV6A 2PTKA 3GT8A 2C30A 3ZDIA 2WMSA 1IAHA 2YIXA 3LJ1A 4QO9A 4O21A 4HYUA 1OPLA 2BVAA 2V7OA 5D11A 4B99A 4IC7A 3KF7A 3HRFA 5AFVA 2OXDA 4B6LA 4IXPA 3HAVA 3PY0A 4P4CA 4QMVA 5ETAA 1G5SA 1O6KA 4B8LA 2UVYA 2VN9A 3F7ZA 5L2TA 2B7AA 3CEKA 1YI3A 2WU7A 4L52A 4R5SA 3MIAA 3QTZA 3QGWA 3DAEA 4BIDA 3A61A 3BYMA 4W8EA 4DTKA 5FLFA 3PIYA 4I3ZA 2UZNA 4QP6A 4PDPA 1XBCA 3R1QA 2A2AA 3ENMA 4XOYA 4BBFA 2VO7A 3S95A 5D1JA 4IWQA 4WUAA 5IEXA 3NS9A 3CP9A 4NWMA 1LR4A 2VTOA 4JOAA 3U9NA 3EN9A 5IF1A 4CKRA 3I7CA 3UNKA 5AP7A 3UIBA 3ATTA 4U45A 1NY3A 2G01A 2QQ7A 2ZMCA 1H01A 5EDPA 2VU3A 3U87A 2VWUA 3PYYA 4UB7A 2V5QA 5EDRA 4S33A 2XBJA 1H25A 4O7RA 4O0SA 2HW7A 5A4TA 3FHRA 4DYMA 4CMOA 4AOJA 4NW5A 2YISA 4EZ5A 4FT9A 1V0OA 3QRKA 1Y57A 2HK5A 3DFCB 3O7LB 3QTWA 2CCHA 3C5UA 3ET7A 3ODZX 4ZK5A 5TT7A 4FEQA 4CFXA 2VTTA 2FSTX 3NYVA 4QPAA 3DKFA 5LVOA 3WZKA 2QU5A 5TOZA 3HUBA 5IQDA 4IACA 1PMVA 2R3JA 2GNLA 2OXXA 3CC6A 2WMUA 3SRVA 3C0GA 1XH6A 3HGKA 3I81A 2F7EE 3OEFX 4IB5A 4AOIA 5LVMA 3PIXA 3DK7A 4U3YA 4HW7A 2XK3A 3GCSA 3ALOA 2UZVA 5L2SA 5C8KA 2BFYA 3ZTXA 3D83A 4NKAA 4L01A 5I9VA 3Q60A 4HPTE 5CVGA 1U54A 3JR1A 3VUMA 5AUTA 4FIGA 3F5GA 4E6QA 3B2TA 3EFWA 4NEUA 3GC9A 2HZ0A 3OMVA 4G1WA 4BZOA 2HW6A 1Z9XA 5I9UA 2JIUA 3ZDUA 1YXTA 2OZOA 3VF9A 3ZLYA 3QLFA 5CXZA 5TO8A 2RL5A 2X6DA 4YC8A 5HTIA 4BI0A 5CSHA 3TIYA 3ZU7A 3FMEA 3LCSA 4DH8A 1E1VA 2G1TA 3ZO4A 5AUWA 3TZMA 4NKSA 4MWHA 4FSNA 4H1JA 5DI1A 3DXPA 4IDVA 5D7AA 3UNZA 4WG5A 2PVMA 1H1WA 5K3YA 3R04A 1DI8A 5IH6A 2WQBA 4X2GA 2OXYA 5J5SA 3C1XA 2F4JA 5JQ8A 3DDQA 2F2CB 4FBXA 3T3UA 4BDKA 4K2RA 1WVYA 3NW6A 2VO6A 4IJ9A 4XG3A 1YXXA 3O51A 4FSUA 2J0JA 2P0CA 3E88A 1R78A 5FGKA 3MJ1A 4NM0A 3U9CA 2I0YA 4MNEA 4X2KA 3PZEA 4RA5A 4XV3A 4D9UA 4NZWB 4ZSJA 4H3QA 2C6TA 5L8LA 1JPAA 1OM1A 4X6RA 5HIEA 4YZBA 4YJTA 5HNGA 4N0SA 3UYTA 4EQCA 4ANBA 4X3JA 5AP0A 4CXAA 3D2KA 2R3RA 3OF0A 5HG5A 4F70A 2C1AA 2XCHA 2RGPA 4O84A 2PVYA 4AZTA 3RNIA 3P08A 2R3HA 5KBRA 3R63A 3G5DA 3QTSA 4RVMA 3OZ6A 2ZJWA 1WCCA 5HG9A 2YIWA 4CLJA 4AT4A 5KNJA 1Q24A 2VWZA 5LQFA 2A27A 3IO7A 3JXWA 2PUNA 3E8CA 4FG7A 4EK3A 4A06A 2JGZA 2PULA 2V0DA 3DA6A 2YLEA 4AGUA 4EOJA 3AMYA 4E20A 1ATPE 3QFVA 4E8AA 3BLRA 3BU5A 4QTCA 5JRSA 3RPSA 2BIKB 4ANOA 4QMPA 4I6FA 4RQVA 3CJGA 4ZTLA 3G9NA 4FV4A 1FBNA 5M44A 2VWVA 3FE3A 4G9CA 4RVTA 2JAMA 4RZVA 3R7YA 5F9EA 4AW2A 5IQCA 3BZ3A 3KRJA 3PXYA 4R8QA 2EVAA 5BMSA 3S2PA 3U4WA 4O7ZA 4G17A 5EM5A 4U8ZA 4I6HA 1REJA 3VN9A 2QNJA 5DEWA 5M4UA 3L9NA 4AN9A 4C3PA 3GFWA 2W4KA 4YJNA 1V0PA 1PMUA 3D15A 3BHHA 5JEBA 4FTTA 3VHEA 1RQQA 4RC3A 4F6UA 4BR3A 2ITZA 3Q9XA 3PIZA 4IB3A 4NM3A 2JITA 2R3NA 2C3KA 4FYNA 4F9CA 2BILB 2E9PA 4ANSA 3TDWA 2O0UA 3B8RA 5DH3A 3KULA 5M06A 1PKGA 4KABA 2C69A 2R3MA 5BPYA 1OGUA 1G8SA 4N4SA 5KMJA 4JJRA 2VX1A 4XOZA 3F6XA 1B39A 4AUAA 4O81A 2UZLA 5HVYA 5B7VA 3F3ZA 1NW1A 5AR2A 3P7AA 4JDKA 3BEAA 4LFIA 4C3FA 4FEWA 4M69A 2PY3A 3FAAA 3MVMA 4PTGA 5AWMA 1SNXA 3D5UA 3FBVA 1KOAA 4FI1A 4RWLA 2Y6OA 5AAGA 1P14A 5C8NA 3QUEA 4LGHA 4QMOA 3C0IA 3L1SA 1KV2A 2EXCX 5IH4A 1H1QA 5EW3A 2QOFA 4DG3E 3QX2A 2WTDA 4HYHA 3NRMA 4ANNA 4UBAA 3MB6A 5A14A 2C6IA 4NCTA 3QRJA 3FPQA 5C8MA 4LRMA 5FP6A 1M2RA 4FV1A 2H96A 3L8SA 2XCKA 4I1ZA 3O8PA 2PVFA 5JT2A 2QKWB 2YITA 3F66A 1YHWA 2CHLA 3FLQA 4BCFA 3IW6A 5IZFA 4EJNA 4LI5A 3TZ9A 3KCFA 2VWWA 2R3KA 4RG0A 3W2RA 3FC1X 4G2FA 2R2PA 3H9OA 3C4CA 3Q9YA 3R9HA 4U44A 1ZYSA 4XP3A 5AAFA 3DTCA 5A54A 3FYKX 3CY2A 1Z5MA 5A6OA 1XO2B 1YXVA 1JQHA 3HRCA 4GG5A 4XG4A 3VULA 3ZFMA 2QO7A 3T8OA 3LXLA 3PY1A 4RJ6A 4U6RA 4B8MA 4C0TA 4DEAA 2YCFA 4O7VA 1YHVA 2IVSA 4FV7A 3PZHA 5K5NA 3LVPA 3OWKA 3GVUA 3FI4A 4NM7A 4ZJVA 3DXNA 5CSVA 2WTKB 3VBTA 2X4FA 3RHXA 3QCQA 1J91A 2BAKA 2XK6A 3SG9A 1PMEA 3QRTA 4R5YA 3ZSIA 2C6MA 4KSQA 4IW0A 1G8AA 1QPDA 1U59A 2BHHA 1Q8UA 3PRFA 4HJOA 3G33A 2WMWA 3Q9ZA 4IAYA 3ZRLA 2BDFA 5FXQA 2Y4IC 5HESA 2R7IA 2HAKA 4PV0A 4FT5A 2HCKA 3SGCA 4G5PA 3TNQB 3ZONA 4XUFA 3DLSA 3BGPA 3D5VA 3V51A 5K0XA 4F0IA 5A6NA 3OXTA 4V04A 3KXNA 1ZYCA 4WNKA 4ZSLA 1XH7A 3GGFA 4C2VA 4D2VA 4NJDA 4F0FA 2JKKA 4FIEA 3JVRA 5EQYA 4HGLA 2C5NA 1RJBA 3CQUA 2XIYA 4O83A 4M12A 3FLWA 3HV4A 2GS6A 3OTVA 5M09A 3IW7A 4DEIA 3G51A 2GNGA 3EQIA 4DEGA 5CEOA 1GZ8A 1BI7A 3D7TA 4YZNA 3W55A 4HGSA 4CD0A 3P7BA 4D1XA 4Y83A 1H0WA 1SVGA 3QTRA 4TNBA 4Y95A 4X2FA 2B9IA 4OTWA 1HOWA 5JKGA 3BYSA 1FPUA 1FVVA 3QD4A 5C01A 3ZC5A 5CSXA 4XV9A 2WU6A 4UWCA 3PVBA 2PZYA 4LGGA 3RWPA 2X8EA 3ZZEA 1E1XA 2ETRA 1U5RA 4LV8A 4DH1A 3DXQA 2YZAA 4HZRA 2WEIA 2WMQA 4F9AA 2W1HA 5EDQA 3AC5A 4O1OA 2GCDA 4ZSGA 1Q8WA 4F7NA 5CF8A 3GI3A 4AE6A 2QOHA 5IEVA 2UW5A 3MBLA 2JDSA 2Y8OA 3KF4A 3KXHA 3UG2A 2C1BA 3EB0A 2VAGA 3QLGA 3OD6X 4O38A 4QYHA 3L8VA 3LJ0A 1JNKA 3QTUA 4QQJA 5CXHA 3LMGA 5ITAA 3V5WA 1XQZA 4GUEA 2OGVA 4PQNA 4FVPA 5BVOA 3C4EA 1CDKA 2FSLX 3COHA 3QCSA 4OBPA 1GIHA 2W5HA 4JG8A 3TTIA 5HO6A 2EWAA 3MPAA 4XH6A 3KREA 1ERKA 3UMWA 5IA4A 3NZ0A 2VWXA 4NYEA 3HA6A 5BVDA 4FV5A 4F64A 4E1ZA 4BRXA 4CRSA 4RIYB 3TG1A 5IH5A 4DT9A 2J2IB 4GJ3A 3HAMA 2KTYA 1YHSA 2CN5A 4RFYA 4FKRA 5AUXA 5HD7A 4KKGA 4BCNA 2C6OA 5KZIA 2VTQA 4FTRA 5L6OA 5DPVA 3QRIA 3PPJA 3F82A 5IG1A 4JDIA 5BX0A 3PRIA 1YXUA 4FNZA 5DVRA 3CS9A 1H1PA 4TYHA 4CMUA 5AP5A 1H08A 3KN5A 4UMPA 1ZYDA 3KMWA 4IWDA 3AC1A 4FTOA 5IPJA 3HA8A 3Q5IA 4YBJA 3S00A 4CNHA 4FSZA 5FRIA 4QPSA 3HX4A 5KBQA 3N51A 4LOOA 2UW0A 4S32A 3VS4A 4N70A 5KHXA 4G9RA 1Q8ZA 1F0QA 2QVSE 5J5TA 3BRBA 1YWVA 3AC8A 2CNVA 5GZ9A 4EQUA 3F2NA 1AQ1A 4M15A 4AE9A 2Z8CA 3MA3A 3OCTA 4FL3A 3MW1A 1YI4A 4GS6A 2JIIA 1I44A 2QLQA 4MHAA 4FEVA 2XIXA 3SXFA 3PJCA 3LXKA 4JQ8A 4MF0A 1CKIA 4JIAA 4M14A 3R21A 4BTMA 2NNWB 4LL5A 2R9SA 4E26A 3Q6UA 1MQ4A 4K18A 4FT3A 4RFMA 2W4OA 4MXXA 1KUTA 4C61A 4WO5A 4H3BA 4MXZA 5HOAA 4AFJA 2VX0A 5CEIA 4BDAA 4USFA 1R3CA 3LM5A 5LCKA 4C3RA 4EC8A 4MEDA 4PP7A 2CKQA 2A4LA 3BYUA 4OLIA 4ENXA 2YN8A 4ZTMA 3OW3A 4FOBA 5AV1A 3NGAA 3PE2A 3SV0A 5IA2A 4G3EA 5ICPA 4OTQA 4YR8A 2YAKA 2BZKB 4GVAA 4IVDA 3E8EA 4R7IA 4CGAA 3W18A 5K4IA 3R1YA 3D2IA 2E9UA 3ANQA 2O2UA 5CQUA 4C58A 2QOLA 2XKEA 4KIPA 4U80A 4R7BA 3DB8A 2W5BA 4UY9A 1YDTE 1ZARA 4NL0A 4AA5A 3RWQA 1NVSA 3KEXA 4J53A 1W0XC 5HD4A 2YWPA 4BKYA 3DJ7A 3RI1A 5EQEA 4RLKA 4FKOA 1WVXA 3R7VA 3ULIA 3V3VA 5CEKA 3EFKA 4FSRA 5AA9A 2I0EA 3GUBA 4BWXA 5LWNA 4DFBA 3LFEA 5HO7A 4AN3A 2WXVA 2A0CX 4QTDA 4FTIA 3E64A 1S9IA 3PXQA 4PDOA 3F69A 2WO6A 5HNIX 4H05A 5T3QA 4XNEA 4F63A 3F5PA 3LQ8A 4GJ2A 3ORKA 4QMMA 3COKA 3GQLA 3KVXA 2J0LA 3QYZA 5CU6A 1FOTA 5DIAA 5AP1A 5EH0A 1F5QA 4CMTA 3GU7A 1Q99A 3P78A 2OIQA 5F94A 4DCEA 1IEPA 5H8EA 1W83A 4I5PA 1ZOEA 4IX4A 1IASA 1MQBA 3OBGA 5ETIA 1YWRA 3G90X 1W84A 2Z7QA 4JBPA 4ALVA 5HBEA 4EL9A 4CQGA 1R0PA 1UNHA 3LKMA 4QP4A 1OIYA 5CSPA 3Q32A 3PJ1A 4G3DA 3WI6A 2W5AA 3PPZA 3V5PA 3CTHA 4ERKA 2QU6A 2WMXA 1W82A 3OY3A 4UWBA 4BBEA 5E1EA 3ETAA 1UA2A 3KXMA 5CI6A 3OTUA 4YZ9A 4DINA 3FEGA 2ETMA 4FTNA 4OTPA 5H3QA 3NNVA 4HZSA 3Q6WA 4V01A 3IDCA 4EK8A 3AG9A 5HNBA 1MUOA 1PHKA 5EI2A 2UW7A 3DKOA 3LQ3A 3E5AA 4QPMA 4C4FA 4PMPA 3UJGA 4BDHA 2G15A 3A7GA 4FKVA 2DYLA 3UMXA 2Y9QA 3MN3A 3AD5A 4AT5A 2X0GA 4XRJA 4Y85A 3VS3A 3OFMA 4N6ZA 4KKEA 5DHJA 3E63A 4GEOA 3ITZA 4FKUA 4GT5A 3MPTA 4YTIA 1SNUA 4PTCA 4TL0A 5LMKC 2J7TA 4UV0A 2G2HA 3OWJA 3GC8A 4FG9A 3UG1A 5CASA 4EYMA 3DPKA 4O96A 5E8YA 4EOIA 4R77A 4Y46A 2CNUA 4AXAA 3DBCA 4E5BA 3W8LA 1ZYLA 2HY0A 2Z02A 4ERWA 1VZOA 4KA3A 4NJ3A 3OXIA 3VBYA 3QRUA 4NIFA 4OTHA 3C4FA 3FMNA 4HVDA 4P5ZA 3BLQA 4LV5A 3DZOA 4YTHA 5AV3A 2H34A 4FKJA 3TUBA 3TWJA 2W17A 3UZRA 3Q9WA 3PPKA 4QMNA 1BL7A 3C13A 3FPMA 4GRBA 5CAUA 4MXAA 5GNKA 3EQHA 4FTLA 5BYZA 4L3LA 2VTJA 4A4LA 4HCUA 3DJ5A 3LM0A 4AP7A 2W99B 4JDJA 4DH7A 3A7FA 4KRCA 4DFZE 1B6CB 3W8QA 3QZFA 2F7ZE 5CU2A 3EL8A 3MV5A 3ZCLA 5CEPA 4QP7A 5LMKA 4RC4A 2RFNA 3HECA 2GHLA 2GFSA 3V5QA 2OF4A 2VTLA 4O7YA 3DNEA 4Y5HA 5E8VA 3FSFA 4U3ZA 3I7BA 4I94A 5I0BA 4MTAA 4IM2A 5B2KA 1SM2A 4RX9A 3R7EA 3BGZA 5A4LA 5J1VA 3MFRA 3MDYA 2HZIA 1M52A 3K2LA 5AUYA 5GJDA 2W1FA 5F1ZA 2GNIA 4HGEA 3ORMA 4CFWA 5ANKA 2ZYBA 2FUMA 4QTEA 1J3HA 4OTGA 3TKHA 3DFAA 5L8JA 5L6PA 2WGJA 5EYCA 5FBNC 4FTQA 1KV1A 2B9JA 2OI4X 4L7FA 3OUKA 4D0XA 3QKKA 4KAOA 3R02A 5J87A 4L44A 5FWKK 1YWNA 1K3AA 3R2BA 2G2IA 4WNMA 3QA8A 2WZJA 1R39A 5HCZA 4QYGA 4O27B 4RVKA 4FIHA 2AYPA 4D2WA 1OPJA 1H26A 2DUVA 3Q2JA 5IQEA 4KIKB 4EK4A 3WF5A 2EU9A 3MY5A 3QQFA 4Z7HA 3NNXA 4CFFA 2F2UA 1BX6A 1U46A 2W06A 4BF2A 1MRYA 5FTGA 4BCGA 3DS6A 3UOJA 3PP1A 3AQVA 4FKGA 3IW8A 4CV9A 4FKLA 5IDNA 3LMHA 2HXLA 4FTJA 1UWJA 3CGFA 3D9VA 3DY7A 4RWJA 5BMMA 2ZB1A 3VS0A 3BV2A 3JVSA 4C33A 1TQPA 3CBLA 3F5UA 3P79A 4TYEA 3DNDA 4U81A 3TL8A 4JQ7A 4D9TA 2OJGA 4N6YA 5HLWA 3IGOA 4NM5A 1PMNA 4PTEA 4UYNA 4HVIA 2BTRA 3BKBA 4FTUA 3EQFA 2Y4PA 3V6SA 3H3CA 2QG5A 4OTRA 5AP4A 3ZO3A 4AW1A 2VD5A 1WBVA 4QP9A 3CSVA 3FKNA 3QXOA 4DEHA 1IA9A 4O91A 5ANJA 3FL4A 1NA7A 4JDHA 4K6ZA 2ITUA 4LUEA 4A9UA 4I4FA 2RIOA 3OWPA 5AP6A 3RJCA 5HIBA 5L2IA 4FMQA 2Z2WA 3ZH8A 3C50A 4WRGA 4DFLA 3DBDA 1GY3A 2E9NA 5DRBA 1OITA 4YJUA 3GU5A 3UBDA 4M97A 3PA4A 4FR4A 5AADA 1VEBA 3NCZA 5E7RA 5JGAA 3FLYA 4JIKA 2R3FA 2PYWA 3PJ2A 4EH5A 4FV2A 4DGGA 4E4LA 2QOQA 2XNEA 4R78A 3K3IA 3TIZA 4D2TA 2WIHA 4FIFA 2VTMA 2YFXA 2EB3A 3R1SA 4JG6A 3EN6A 5CI7A 2JIVA 5ACKA 2Q0NA 2WMAA 3CQWA 3FY0A 3BGQA 5LVLA 4USEA 5I9XA 1H00A 4ARKA 2OZAA 4CVAA 1SMHA 2XBAA 4FGBA 2HWOA 4OTIA 2X7GA 5CYIA 2JDOA 3EQBA 4G6OA 3G6HA 3HDMA 5H8BA 5HE3A 3ZLXA 2XYUA 3ZOSA 2PE1A 5JN2A 5HGIA 1B38A 2ZDTA 3EL7A 5G1XA 3Q4UA 4EC9A 3SD0A 4BZNA 2YCSA 4FZDB 5DT3A 2JKOA 4LMUA 3ACJA 4H39A 2QHNA 1J7UA 3LQ5A 4WNOA 4L68A 4MNFA 3RPVA 5CAOA 3R8ZA 3FQHA 4EKKA 5I9YA 5ANDA 5JZJA 5H2UA 3QQGA 4DTBA 3DQXA 1OL2A 1BL6A 2W0JA 2O5KA 3KK9A 2YABA 4OBQA 3ZFXA 3LXPA 4ENYA 5EKNA 3QZHA 5CEQA 1Q3DA 4C34A 4FV8A 3TV6A 5JFXA 3NNWA 4TKSA 4ALWA 3NUPA 3R1NA 3F2RA 3ATSA 3ORIA 2CGUA 2BCJA 4RWIA 5A4QA 4J95A 2PU8A 4TYGA 3HMPA 4QMLA 3DBFA 3GENA 3HV5A 5GIOE 2I0HA 1NVQA 2IVTA 3FMHA 3HL7A 3TXOA 3ULZA 4BCOA 4IWOA 4EI4A 4ACCA 5IISA 4BKJA 5HZNA 2Z60A 2J0KA 2XKFA 4DLJA 4YLLA 3VO3A 2A19B 2W1IA 2YERA 4OGRA 3SLSA 4YC3A 2XVDA 2AC5A 4ZTQA 4F1TA 4M66A 4MQ1A 5DFPA 4F08A 5FEEA 3CD8A 3BLHA 3UPXA 5JMSA 3K5UA 4L7SA 4O0RA 3ALNA 3AD4A 3KFAA 2W7XA 4XP2A 3EN5A 5EM6A 5EM8A 5LMAA 2W96B 2QR8A 4BGHA 4RSSA 4OT6A 5FQDC 3CE3A 3OS3A 3ZUVA 2YDIA 4Y72A 4NU1A 2GDOA 5BVNA 4RFZA 3U51A 3WYXA 4WUNA 3ELJA 3EN7A 4HNFA 3V8TA 4WNPA 4D5KA 1OZ1A 4JBOA 3JYAA 1Q8YA 3NUNA 3RAKA 4A9YA 4GYIA 3SDJA 4DLIA 4EEVA 1XBBA 2ONLC 5K0KA 3LFFA 4ANQA 2OIDA 4FOCA 4BI2A 2X2MA 3JY0A 2BRNA 1H0VA 1IG1A 4FF8A 2CKEA 2W4JA 5EYMA 3TNIA 4RJ3A 5CY3A 5IQHA 2X81A 5KKRB 1RW8A 1GIJA 4K33A 4LUDA 4IVBA 4RBLA 3FMLA 4BDCA 2OSCA 4BVUA 4YMJA 4EOSA 3PG3A 3VUDA 4C2WA 4AX8A 5DT4A 3GCVA 2Q83A 3QXPA 4AS0A 2R3OA 3MA6A 4RIWB 4MQ2A 3TCPA 3Q96A 5LMBA 4QYYA 2NPQA 1U5QA 4RJ7A 1SVEA 4Z3VA 5D10A 3EZRA 4F9BA 5M56A 1XH9A 1HCKA 1V0BA 2XJ2A 3MVLA 4FTMA 4XG2A 1H27A 3OT8A 2CMWA 3R9OA 4YTFA 4IM0A 3RZBA 1RE8A 4D1ZA 2HWPA 4O7SA 3ZRMA 5IA5A 3RM6A 1OKZA 3FDNA 3F9NA 3QUDA 3KRXA 4PL5A 3VJNA 2C6KA 3BBWA 4MD9E 2ITNA 2UZUE 3E8DA 5I3OA 4CLIA 2WFYA 2GHMA
chains in the Genus database with same CATH superfamily
3VHKA 2ONLA 3DV3A 2UW6A 2JKQA 4WG4A 1NT2A 4DFUA 2P2HA 5M53A 1Q41A 4FSQA 3H0ZA 1KWPA 1JKSA 3IECA 4DCAA 1FQ1B 2WTCA 5FDPA 3TUDA 2BDWA 3ACKA 4PRJA 4QD6A 1W98A 4M7IA 4F65A 3L9MA 1W2DA 3WZJA 1O6YA 3BHYA 4RIXA 3VQUA 5FEQA 1M2PA 2C3IB 5B2LA 3UP7A 2XNOA 4I93A 3RAHA 4FSTA 3LCKA 4O82A 5TKDA 4D4RA 1H24A 3IGGA 4X7QA 4BICA 4ITJA 5AUVA 4RQKA 5J9LA 2XNBA 4S30A 2IWIA 5A4EA 3UC3A 1GZOA 3MIYA 1T45A 1OECA 2BDJA 3QGYA 4UYAA 3VUKA 3U6HA 3V01A 4PX6A 1M17A 1ZLTA 2OF2A 3O17A 4I6BA 4KINA 2C47A 2CGXA 4FNXA 4V0GB 5ANGA 3SW7A 1YOLA 2JKMA 2YM7A 3H0YA 4W4WA 2IZRA 1CKPA 3OWLA 2PVRA 5DE2A 4IM3A 5FG8A 5KE0A 1WAKA 3QBNA 4H3PA 4ZY5A 5EFQA 5AR5A 4IAFA 2G9XA 4O1PA 1M14A 2XNNA 4G6NA 2VUWA 3AOXA 4GK4A 3LFQA 4JAIA 4M67A 4M84A 4F0GA 5DYJA 1KOBA 5DLSA 1WBOA 2ITYA 4ZLZA 4TT7A 4BFMA 4ACGA 4NUSA 3BU3A 3TTJA 3IDPA 3V5TA 4CT1A 2ITQA 4APCA 4W4VA 3W2PA 5FM3A 3B8QA 3FHIA 2V62A 1P4OA 3FI2A 5CU4A 3FZSA 4MBLA 3MH3A 2V22A 3T9IA 2OBJA 5DWRA 2QR7A 2XK9A 5T68A 4GKHA 5GINE 4QEBA 4DFYA 2QLUA 5LXMA 2CGVA 4W4YA 4QMWA 4XHKB 3EIDA 3BWFA 2C0OA 3IQ7A 4UX9A 3VBXA 3BHVA 3AD6A 2GMXA 5FTQA 4EHEA 4AG8A 1ZOHA 2F9GA 2FYSA 3DZQA 3MB7A 3I6WA 4DF3A 3POOA 4XBUA 4L45A 2B4SB 2BAJA 5M55A 3VRYA 4F4PA 4AZWA 5GJFA 4I5MA 5FEDA 4UMUA 5AIRA 5KMKA 4LDTA 1WBTA 4A9SA 4AXFA 3UVQA 4YTCA 3CCNA 1QCFA 5M57A 4TPTA 2BHEA 2X1NA 3QKLA 1DI9A 4NFNA 2FH9A 3S1HA 2X9EA 4YBKA 4XP0A 2RG6A 4W4XA 3SHEA 2RG5A 3WZEA 4FV9A 3AC2A 4Z9LA 1JSVA 3C5IA 2J5FA 2IW8A 4IZAA 4RLLA 3LCDA 3QWJA 5J79A 4TW9A 2FGIA 3QQLA 3FV8A 3KMUA 5JFWA 4KWPA 1U4DA 3UTOA 5J9ZA 3FZRA 1J7LA 1TQIA 2WELA 4GH2A 1OPKA 2UV2A 5HICA 4CZUA 3FZTA 4X6QC 5C4LA 4FUXA 2OK1A 4RZWA 5AR4A 3HV7A 4IAAA 2H9VA 3U55A 4GFMA 1F3MC 4C8BA 5I5ZA 3UQFA 3SW4A 1WBSA 4YLKA 3W32A 4XX9A 5HTBA 4K8AA 2PUUA 4TNDA 5FM2A 5L2WA 3SA0A 2YZLA 2WMRA 2Z7SA 4ZZNA 1G8KA 3EJ1A 4F9YA 2Z7LA 1OIQA 3OVVA 4FEXA 5KZ0A 5FUTA 5BUEA 1VR2A 3UIMA 3POZA 5F20A 3TNHA 2LAVA 3KGAA 1TZDA 3G0EA 4FKQA 2IW6A 4U0IA 4L46A 3VONA 4ACMA 3DT1A 3QL8A 4KSPA 3GCPA 4ZTRA 4EYJA 2QOCA 5DBXA 3F2AA 1KE8A 3P7CA 3RZFA 2CDZA 5AMNA 3O23A 4ACDA 2XF0A 4YJOA 5CX9A 2VWBA 4IWPA 1PXOA 2WTWA 1O6LA 4S31A 4YHJA 2P2IA 5LWMA 3PP0A 3KQ7A 4AT3A 4HVHA 2ITOA 1Y6AA 4P2KA 4HCVA 4GK2A 4AAYA 2IG7A 3FLSA 3U6IA 3ZFYA 2R4BA 3C4ZA 3MVHA 3WYYA 2J50A 2PZIA 4WRSA 4U42A 3EHAA 2OU7A 4KIQA 1Q61A 4U43A 1APME 5CNNA 4DGMA 5EW8A 1MRVA 2R5TA 3PJ3A 5FTOA 5IQFA 5AM6A 4HYIA 4E4MA 2W9FB 2A1AB 1M2QA 2C5XA 2PE0A 4Q5HA 3FQEA 2C5OA 1PYEA 3GB2A 4XRLA 5CZIA 1YW2A 3IOPA 3PWDA 2FSOX 5HBHA 5CF6A 3VBQA 5BVFA 1JVPP 3DCVA 4FNWA 4X0MA 5HE0A 3I0OA 4J52A 2VTPA 3D5WA 3PA3A 4M0ZA 3GU4A 4QMXA 4BWKA 3UO5A 2WPAA 4FNYA 2IVVA 2PSQA 2BZHB 2VTRA 3TJCA 2FO0A 2JEDA 4FK3A 5L2QA 1OIUA 4C7TA 4D4YA 5D9HA 2P4IA 5AV2A 3FLNC 1NVRA 4CKJA 1URCA 2YCRA 3AC3A 5E8TA 2I1MA 3IG7A 1OBDA 4DG0E 2J90A 3IKAA 4FKPA 3VBWA 4QP2A 4P5QA 3O0GA 4BDGA 4R6VA 4PP9A 1PW2A 4W9WA 4CZTA 1GNGA 4AU8A 5IDPA 3R8UA 2PUPA 5E8SA 5EYDA 3RHKA 2QCSA 4PPCA 3UO6A 3DKCA 3F3TA 4F7JA 2UZWE 3NAXA 3VF8A 1PJKA 2I6LA 3KRRA 5E91A 4IB0A 3FMDA 5CAPA 1PRYA 4GT3A 5C03A 3NEWA 2ZOQA 3MWUA 1PYXA 4FYOA 4IX5A 2UZBA 2CGWA 4I41A 4OW8A 4XV2A 3WZUA 4C4IA 5C4KA 4ZS0A 3RINA 4HOKA 2IZUA 4DHIB 2B54A 1ZMWA 4BCKA 4JT3A 4D5HA 3A8WA 3D7ZA 3M11A 3NUXA 4WSQA 4BTFA 2BKKA 4UXLA 2WTVA 3VW8A 2J6MA 1XJDA 3UNJA 3QTXA 4Y5QA 4BWPA 3MH0A 3TEIA 1SVHA 2VWIA 2ITXA 3BE2A 1P5EA 4GCJA 4I0TA 3W33A 1STCE 2QHMA 3WF6A 1BYGA 4D2PA 2WQMA 4K0YA 4BC6A 5J1WA 5JK3A 2B9HA 4ID7A 4O6LA 4UMTA 1MRUA 3CTJA 1XH8A 4YC6A 2IZSA 3LXNA 5IQGA 3NMUF 3ERKA 4DA5A 2YAAA 2PVLA 1UNLA 3V04A 4EH4A 5KO1A 2QONA 1XBAA 2X7FA 5AV4A 2W1EA 4ZJJA 3NUYA 2SRCA 3HMOA 4EH8A 5HI2A 3TKUA 4IX3A 2WD1A 3ZMMA 2CLXA 3R7OA 3QHRA 3RMFA 4FTCA 2C4GA 2VTIA 3JY9A 3PTGA 3KXXA 4QMUA 4BN1A 3K54A 4O0TA 3UVPA 2CKPA 3HP2A 4IFGA 4USDA 4E5WA 2VNYA 2VO0A 4UN0C 2QG7A 4WBBB 1JWHA 3QQHA 5M07A 4YJQA 4BIBA 4QP8A 4F1MA 5K4JA 1FGKA 4O7LA 2C6EA 2XNPA 4HCTA 4RT7A 4YNOA 2XK7A 4P7EA 4MKCA 5AIKA 1Z57A 4EK6A 3LCTA 5KMMA 3MI9A 4ZS4A 1FMOE 2C5VA 4TWPA 2QURA 2Z7RA 3QQJA 5CT7A 4EH9A 3N9XA 4YO6A 1IRKA 3L9PA 4BL1A 3PDTA 4CRLA 4RX8A 3FL5A 4PMSA 4GFGA 3I5NA 1TVOA 2BRGA 3ZXZA 2YEXA 2OH0E 2QO9A 3DQWA 2V7AA 4V0GA 3Q53A 5EM7A 3VS6A 4PY1A 4UEUA 3BPRA 4J7BA 5AA8A 3HUCA 1PKDA 5DOSA 4DH3A 3R9RA 3QQKA 5AP3A 2VV9A 3CD3A 2PMIA 5ETCA 5AP2A 4LG4A 3UOLA 2YIRA 4U41A 2NP8A 1KE7A 2IJMA 4O0WA 5EKOA 5HKMA 5IA3A 3VWAA 2PE2A 4AWIA 3U8WA 1YKRA 3CR0A 3MFSA 4MH7A 1LP4A 1BKXA 2RKUA 3GEQA 2WTJA 5HU3A 1OKYA 1XH4A 5CF5A 4Q9SA 2XJ1A 3Q3BA 4NTSA 5CT0A 1XKKA 2LGCA 3O7LD 1Q8TA 3VW6A 2WTKC 4V05A 5EQPA 2W1CA 3U6JA 3BLAA 4F78A 4GT4A 5KMIA 5FP5A 4JLCA 2JC6A 2YDKA 3QX4A 4KBAA 4MX9A 4EZ7A 2HELA 4E4XA 3MH1A 3UC4A 1U54B 1OKVA 3HLLA 1ZRZA 1JOWB 3FWQA 3ORTA 4CQEA 2C3JA 4ZIMA 3RTPA 1QPJA 5EI6A 5DGZA 3UOHA 3EYHA 1W7HA 3DDPA 3N4VA 4II5A 4DHFA 4G34A 3N4UA 5KUPA 2X8DA 3G2FA 2WHBA 3I79A 4C38A 3LAUA 2UUEA 5D12A 3F7WA 5KCVA 4GYGA 3KY2A 1JLUE 5AX9A 2ITPA 4O22A 3UZTA 2VZ6A 4MCVA 4YPDA 3HMMA 3KMMA 3ZUTA 4A9RA 2OJIA 1W8CA 4JNWA 2YM5A 4BKZA 3TZ7A 3BWJA 4K77A 3MS9A 3ZBFA 2BZIB 4S34A 1LEZA 3AMBA 3FXXA 2XKDA 4G31A 1DAYA 2YJSA 3BBTB 3V5JA 4R1VA 2BALA 2EB2A 2PPQA 3ORZA 2XZSA 3GU6A 3KKVA 3VAPA 5LVNA 1ZZ2A 4FK6A 4J96A 2CPKE 4JL9A 4E7WA 4AOTA 4AW0A 4DGLC 3P0MA 5CU3A 2W05A 3NYNA 3OCBA 4L6QA 4BGQA 3NUUA 1OUKA 2H8HA 4FT0A 4I0SA 1P4FA 4LRJA 5HG7A 3MY0A 4O0YA 5IUGA 4JX3A 5HVKA 5IU2A 1YDRE 4K11A 4KNBA 5ANIA 4EOMA 4IANA 4ZMEA 5CANA 2X0OA 1ZMVA 4I21A 4L3JA 4AF3A 4IAKA 4IZ5A 5ETFA 3EZVA 3COMA 5GJGA 3L9LA 4X2NA 4PF4A 2XS0A 3RGFA 4AGWA 4E6AA 2J0IA 2BRBA 2PK9A 3HYHA 4PWNA 2BROA 3GCUA 2FSMX 2F57A 3ZXTA 4BDBA 4L67A 1UU7A 2ITTA 3DAJA 4BCPA 4L8MA 1QMZA 4S2ZA 4F7SA 2PHKA 1YOMA 4IZ7A 2YACA 4YZDA 4TTHB 3VUTA 3K5VA 1BMKA 4JBVA 3MPMA 1FMKA 2R64A 2C6LA 3P23A 3WBLA 1L3RE 2UW9A 1PXJA 2OG8A 3TDVA 4WBOA 3A2CA 3AGMA 5EOBA 4CZYB 2GQGA 4EQMA 4FA2A 3OXZA 3OG7A 3RK5A 4IZYA 1GJOA 1PXMA 4W8DA 4H1MA 1K9AA 2OJFE 2WAJA 3Q04A 4P90A 4X3FB 5AUUA 3BIZA 5EYKA 2XRUA 3W2OA 3EQPA 1UKHA 2QOKA 3F3WA 3NYOA 5JSMA 2OW3A 3MSSA 1T46A 2Y7JA 4RC2A 1E9HA 2ZM4A 4DGOA 4QYEA 1WVWA 3GNIB 4G3CA 4Z55A 3EFLA 2HZNA 3MYGA 3KC3A 4E5AX 5E92A 3S4QA 1YI6A 2C0TA 1ZWSA 3CLYA 3R73A 2PMLX 5AR3A 4C4EA 1CTPE 1M7NA 2P3GX 4I5HA 3R83A 3D14A 4M8TA 4O2PA 4XG8A 5FD2A 3FQSA 5FDXA 1UVRA 1PY5A 2ZM1A 5EHLA 3REPA 3U54A 5JFVA 5DEYA 4AZVA 4D58A 4CCBA 4B7TA 4U40A 4YUQA 4RIYA 3KULB 3R7IA 1BUHA 2HZ4A 3QYWA 2ZM3A 4J98A 1KSWA 4WKQA 3ZM9A 3LFDA 2F49A 2PVNA 3HMIA 4D55A 4KBCA 2WKMA 3SC1A 4BY9E 4LL0A 2ERKA 2BAQA 2VTAA 2E2BA 4ZLYA 4MBJA 3EKKA 1Q3WA 2GS7A 2I40A 3QKMA 4EH7A 3WF8A 2F7XE 3GBZA 2CNQA 4M69B 5HLPA 2ETKA 5GIPE 3EQDA 3BV3A 4ZSAA 5JGBA 1OVEA 3P86A 4ZEGA 4TYIA 3KN6A 3SAYA 4HGTA 3AKLA 4TZRA 1PXKA 4XYFA 3UQCA 3UOKA 3FMJA 5AAEA 2IW9A 2KULA 1OI9A 5E8WA 5BVEA 2UW8A 2QOBA 1YOJA 4ACHA 2PWLA 3WF9A 4ZXTA 4C57A 2O63A 4E6CA 4LOPA 1UKIA 4RX5A 4CYIA 4EWHA 4EH3A 2CSNA 5HVJA 3DK3A 3CY3A 3RPYA 4D0WA 4EHGA 4FX3A 4L00A 4YJVA 3W2SA 3OP5A 2ZV2A 4BZDA 3R7UA 4ZTHA 3IONA 3FI8A 2C0IA 4J97A 2Y6MA 1YXSA 3DJ6A 4HNIA 1OKWA 1OB3A 1PF8A 3NYXA 3ZBXA 3CQEA 3G9LX 4OTDA 3QZIA 3ZUUA 1SYKA 4TYJA 2W9ZB 5AEPA 3A7IA 3LFNA 4ZTSA 4CT2A 5HBJA 1FGIA 3E7OA 1H4LA 5E8XA 1OIRA 4QMZA 5IQIA 2B9FA 3QWKA 4I92A 3QALE 3R22A 3CXWA 3LJ2A 2RSVA 4R1YA 4WIHA 3FXZA 3VRZA 4AXEA 5EHYA 3KL8A 2XMYA 3EMGA 3HZTA 3BELA 4GL9A 4AA4A 2GU8A 3Q5ZA 5IA1A 3FZOA 3NVMB 3A4OX 3NDMA 4QT1A 4DEEA 4E3CA 4EUTA 2BUJA 2R3IA 5CEMA 5J7HA 3KB7A 1REKA 3UO4A 4QRCA 2VGOA 3AMAA 4NTTA 5LARA 3W10A 4O0XA 5L3AA 4EH6A 4GV1A 2R3GA 3FUPA 4FUYA 4RJ4A 5CVHA 2W1DA 3JUHA 4Q9ZA 4D2SA 1OBGA 1UU3A 3NNUA 4ZP5A 4DN5A 4FZFB 5EG3A 5IQBA 3R2YA 3RNYA 4JI9A 2WOUA 2X8IA 4F6WA 3F88A 2IN6A 3NW5A 4CFNA 3SXSA 3HNGA 2GQSA 3EFJA 2YDJA 1VYZA 3LIJA 4BDFA 3PUFC 3CPCA 3A7JA 4YO4A 3FYJX 3R30A 3D7TB 3RVGA 3NPCA 4UMQA 4YU2A 4R3RA 2BR1A 5I9ZA 5EHOA 2WNTA 4TWNA 2HYYA 4QDEA 3F3UA 3MFTA 4IBMA 4E93A 3FXWA 1LPUA 4AZFA 4EOQA 5BUJA 2GSFA 3OCSA 1BI8A 1PXLA 4O7TA 4IADA 3DKGA 1ZYJA 1W2CA 1A48A 2XH5A 4GKIA 4YGAA 2Y4IB 4MF1A 4IDTA 3VIDA 3E3BX 4FSMA 3NWWA 4G5JA 4WOVA 4QMYA 2VO3A 1G3NA 2FVDA 4DAWA 4U7ZA 5E90A 5GZAA 2YIQA 3QZGA 4LYNA 2X0PA 3FZ1A 4L42A 2WIPA 4R3PA 2XEZA 3ZLSA 4AXCA 3CKWA 1WFCA 2H6DA 3DBQA 4XCUA 4ZZOA 4FGRA 1Y8GA 4IAIA 5BVKA 4OBOA 1OL1A 2XA4A 1J1BA 4KB8A 5DMZA 4DBXA 2R3PA 2BIYA 2R3QA 4MXOA 3THBA 2OFUA 1LUFA 1YVJA 2ITVA 3QD3A 4D2RA 5K9IA 2XANA 3VBVA 3S3IA 2QD9A 4L43A 3WZDA 2ITWA 2OWBA 3WIKA 3IW4A 4GSBA 4X21A 5D41A 3I60A 4E4NA 3R00A 4J8MA 5LVPA 2PVHA 4QMSA 1Y91A 4RJ5A 3IDBA 5DR2A 2WMVA 4UMRA 3H9RA 2PZPA 3EQRA 4BTKA 2FA2A 3MY1A 4G3FA 3ANRA 5HCXA 1JKKA 3EWHA 4U5JA 3D0EA 1AGWA 3R8MA 2REIA 2OIBA 1ZOGA 2YIYA 4HYSA 4O6EA 4AGCA 5B2MA 4C4GA 3Q4TA 4FIJA 4WD5A 5HORA 1Q62A 4ITHA 3MJ2A 2AC3A 4IVAA 3HVCA 4WHZA 4X3FC 3BX5A 3D5XA 2JDTA 3E8NA 2RFSA 4B4LA 1L8TA 2XUUA 2QODA 4MD7E 4NT4A 3C51A 2GNJA 3H4JA 3BQRA 3HKOA 1UU9A 4QOXA 3P4KA 3T9TA 2B0QA 3LLTA 4KD1A 3UZPA 3QD0A 4JG7A 4Z7GA 4ZJIA 2PZRA 4BCJA 2ERZE 4K9YA 4TYHB 4CFMA 2OJ9A 2O3PA 2XK4A 3QU0A 4RA4A 3R8PA 2XRWA 2UVZA 5HLNA 2I0VA 3O71A 3PFQA 1UWHA 3P5KA 4OTFA 3FKLA 4MWIA 2R3LA 4C59A 3LW0A 2GS2A 1UV5A 3ORNA 3UP2A 1Y8YA 2RF9A 2XM8A 3HV3A 1CM8A 5L8KA 5CALA 3PXFA 2IO6A 3S0OA 4GUBA 3PVUA 4M0YA 5AR7A 3VJNA 5JGDA 2UW4A 2B53A 3DLZA 4BIEA 3MTFA 3GQIA 1J7IA 1KE9A 5ANEA 4ALUA 3LHJA 4FZAB 3V8WA 2JDRA 3PE1A 3Q2MA 2JBOA 1ZAOA 4EBVA 4AQCA 3V8SA 3ZO1A 4X3FA 2GNFA 1QPEA 3BU6A 1XH5A 2CN8A 2X39A 3Q4ZA 3SQQA 3TKIA 3E87A 5A3XA 4JXFA 4YSJA 4DTAA 3PSBA 5T6KA 1JSTA 3IPHA 4NW6A 4OT5A 4F9WA 2YM3A 5JQ5A 5E9EA 1JKTA 4YZCA 4D4VA 2Y0AA 4N57A 4QDVA 5ANOA 4XEYA 3RPOA 4BHZA 4YSMA 3LMIA 3R6XA 4I20A 4H36A 5AX3A 4EORA 1Q97A 4WSYA 4B9DA 1J1CA 4FL1A 1YDSE 4DGNA 4GMYA 2XIRA 2XB7A 3OROA 2QC6A 4KIKA 4JMQA 3PLAE 2E9OA 2XIKA 4NCTC 3KRLA 3TNWA 4BDDA 4BYJA 2X9FA 4FKTA 1FVTA 4LM5A 4IH8A 3TV4A 5L4QA 3NVKI 4XLIA 5LCJA 3VC4A 4G16A 2JLDA 3NFGB 4TWOA 1OL6A 5AM7A 2JFMA 3KA0A 4YJSA 5L6WL 3BQCA 4X2JA 2QOOA 2DS1A 2YWVA 3I4BA 5KMOA 4KRDA 4NFMA 4XG9A 4D1SA 3QA0A 4JRVA 3NR9A 3IS5A 3R9DA 4JRNA 5BYYA 3SX9A 2BRMA 2PZ5A 1GZNA 3R9NA 5E4HA 4PUZA 5CSWA 4KBKA 3O96A 5KX8A 3OBJA 4RPVA 3EH9A 5I4NA 1I09A 2XIZA 1K2PA 4GVJA 3WE8A 3RBWA 3UVRA 4EOPA 2OO8X 3P9JA 4Z16A 3UDTA 4CFVA 2X2LA 3UIXA 2OFVA 3EOCA 3I1AA 3R8VA 2V55A 2B52A 5EOLA 4O4BB 4EOOA 5LJJA 4QNYA 4DEDA 4DT8A 4KUJA 5TE0A 3C4WA 3PLSA 5GHVA 4O86A 4DDGA 3IW5A 5CLPA 4BBMA 2G2FA 4QP3A 2OJJA 4AA0A 5BUIA 5BQ0A 1JSUA 1WZYA 2R0IA 4FSYA 4QTBA 3OEZA 4FT7A 4EWQA 3VS1A 4EONA 2CKOA 3ORLA 3TM0A 3OCGA 5CAQA 3F5XA 4Y8DA 3RALA 3NSZA 3A7HA 4R7HA 4FIIA 4GFOA 4YP8A 2BTSA 4CTCA 3DK6A 4C02A 4EUUA 4XJ0A 3E3PA 3RPRA 2E9VA 2ZVAA 3GXLA 4F6SA 2HXQA 2UZEA 3AKJA 3QCXA 4FL2A 3MGYA 4BTJA 5JZNA 5IMXA 3R8LA 3M42A 5DNRA 4UWYA 4Q2AA 3NW7A 1MP8A 5BYLA 2UW3A 1H1RA 4JQEA 3HV6A 4JVGA 4EHVA 3JS2A 5K5XA 3RCDA 5CENA 2GHGA 3QCYA 4CG8A 1DAWA 4PL3A 4CSVA 4LGDA 5G6VA 4J8NA 4LOQA 3KK8A 3SVVA 4KS8A 4EOKA 3E62A 3VS2A 4OR5A 5HX6A 3RP9A 3A99A 1QPCA 2VTSA 3FJQE 4MD8E 1YQJA 5DG5A 4MK0A 4FZ6A 3KRWA 2UZOA 5M4FA 4YZMA 3I5ZA 1OGYA 4QTAA 4U97A 3CKXA 1HCLA 5HQ0A 3G15A 3Q52A 3BHTA 3R7GA 2EXEA 3EYGA 4FV0A 3NFFB 5IUHA 5CF4A 5EW9A 2BRHA 3TACA 2IZTA 4DDIA 2VX3A 2ZV8A 3AGLA 4AZSA 4AN2A 1VJYA 4NIFB 1A9UA 1X8BA 2RFDA 3DAKA 3SOAA 3KXZA 4RMZA 4L3PA 2WMBA 3W1FA 4C62A 4PPBA 4XMOA 5M4CA 3VUIA 3WILA 1ZXEA 2YM6A 3BE9A 1VYWA 3F3VA 4ITIA 3VS7A 2UZDA 1XHAA 3BYOA 3O8TA 4U79A 4DBNA 3CIKA 4PMMA 1H1SA 3BCEA 3WIGA 2OH4A 4JBQA 2O65A 4B0GA 3A8XA 3LFCA 3VS5A 4BCMA 3UDZA 3OOGA 4MAOA 4EOLA 5IEYA 3VQHA 2WQNA 4F99A 3W2CA 1Q4LA 3ENHA 5HCYA 4BI1A 2OLCA 4AGDA 4ASZA 3UQGA 2WOTA 1CSNA 4XS2A 3PFYA 5HEZA 2O8YA 4ZY4A 3PG1A 5AV0A 5JH6A 2PMNX 4KS7A 2P33A 3ROYA 4BB4A 5F95A 2ZV9A 1WBNA 2PUIA 3VJOA 2XK8A 3B2WA 3HMNA 4F1OA 4LRKA 5ACBC 4ANMA 4W9XA 5KKRC 1GIIA 5C27A 2DWBA 3GOKA 3SXRA 3RCJA 2W1GA 1JBPE 3A4PA 2R7BA 3ZC6A 3CTQA 4O0VA 4A9TA 3SOCA 4IFCA 1UNGA 1Q5KA 4JX7A 3PVGA 4OUCA 4YURA 3BL7A 3DTWA 3EN4A 3UGCA 3CPBA 4YNEA 5HE2A 3PY3A 4JR7A 2JFLA 3LFBA 4J1RA 3SG8A 1KE6A 4GK3A 3QUPA 1ZZLA 3K3JA 2C5YA 3C0HA 3MVJA 4WG3A 2XKCA 3ZS5A 1PXPA 4FTAA 3WARA 4DITA 4DG2E 5M08A 4Y73A 3UYSA 5LOHA 3AKKA 4I22A 5EK7A 4GIIA 4M13A 4BDJA 5E1SA 4D28A 3JPVA 3QC4A 2PMOX 3CJFA 3OUNB 5IA0A 1EH4A 4FVRA 2VRXA 2X0QA 3EQGA 3TV7A 4DH5A 3COIA 3ZHPC 4D4SA 3PSCA 5A46A 3AT4A 4IX6A 1NXKA 1FINA 3UPZA 4TXCA 3V6RA 4IVCA 4ASDA 3UIUA 2BFXA 4CKIA 2ESMA 5IUIA 3II5A 4I24A 3ZO2A 3C9WA 5E8ZA 4BDIA 4RIWA 4BCIA 4J71A 5DT0A 4QQTA 4RX7A 4XG6A 5KMNA 1UU8A 3GC0A 4QYFA 3PWYA 3QHWA 4LQMA 5D7VA 3ZSHA 5IMEA 3R71A 4PDSA 2GNHA 3RAWA 4OAVB 4BJJB 4CV8A 3NUAA 3DBEA 3R01A 4EK5A 2X4ZA 1CKJA 2GFCA 3LOKA 3BYVA 4UZDA 4AZEA 4HPUE 5TF9A 1OL7A 2PVKA 3HEGA 2UZTA 3F61A 3ZM4A 3VUGA 5FBOA 4FTKA 3W2QA 2GQRA 2XNGA 4PNKA 3ZEWA 4O7WA 3IOKA 3TUCA 4MBIA 3AT3A 4U9AA 5HO8A 4FODA 4EZ3A 4FG8A 4RGJA 2ZV7A 2GPHA 4XLVA 3A62A 1ZY5A 4NK9A 1GOLA 3L8PA 4IMYA 2XALA 2QO2A 4BCHA 5CTPA 3NUSA 3KCKA 4UZHA 3WF7A 5HIDA 1Y6BA 2R0UA 3TN8A 5J95A 3ZLWA 4O0UA 3H10A 5CZHA 3ID6C 2VTHA 4KKHA 3CGOA 4ANLA 5A4CA 4HVGA 3PJ8A 5EI8A 2YCQA 2YLFA 2BPMA 4TY1A 3OW4A 4AACA 4HVSA 1IR3A 2WB8A 4BHNA 2WMTA 4QQ5A 5M51A 4I4EA 2YJRA 5HG8A 4CEGA 5KHWA 2AQXA 3LLAA 2VNWA 4PL4A 4FEUA 2HOGA 2J9MA 2NRUA 3ORPA 1FVRA 2XP2A 4FC0A 4F09A 2OZAB 1WMKA 2X7OA 3ZSGA 4K1BA 4PDYA 2YHVA 2W1ZA 2HY81 3DOGA 4EHZA 3LFAA 4C4JA 4QMQA 2RFEA 4GU9A 5AR8A 1TKIA 2X6EA 4Q5EA 5CNOA 4DFNA 4I0RA 5C9CA 4ZY6A 4DC2A 4M3QA 4JAJA 3W16A 3RKBA 2GTNA 1PXNA 4FKIA 2CLQA 4ONAA 4A4OA 2ZAZA 3GC7A 3KVWA 3NX8A 2FB8A 3QC9A 4FZ7A 4YPSA 3E93A 5F4NA 3FSKA 3ZEPA 3E7VA 2EXMA 2AUHA 4QMTA 3MTLA 2C68A 3M2WA 3P1AA 4AFEA 3I6UA 3OOMA 3O8UA 1CMKE 4PPAA 4YJPA 3SRVB 4E6DA 3P5JC 1ZY4A 3O50A 4EBWA 2ZDUA 3FMKA 2J4ZA 3D4QA 4DEBA 4I5CA 5CU0A 2ACXA 3LFSA 5C26A 1JKLA 2B55A 3FMMA 4E73A 5H8GA 4RJ8A 4NSTA 4C35A 4CTBA 5A9UA 4XG7A 3PXKA 3NCGA 4O4EA 4ZSEA 2VGPA 2VTNA 2XYNA 3ORXA 4CYJA 3QTQA