2VX1A

Ephb4 kinase domain inhibitor complex
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
281
structure length
274
Chain Sequence
KEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDGGKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords EPHRIN TYPE-B RECEPTOR 4
publication title Inhibitors of the Tyrosine Kinase Ephb4. Part 2: Structure-Based Discovery and Optimisation of 3,5-Bis Substituted Anilinopyrimidines.
pubmed doi rcsb
source organism Homo sapiens
total genus 86
structure length 274
sequence length 281
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vx1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vx1A01
1LPUA 2E9OA 3TEIA 5GIPE 1Q3DA 3L8SA 2YJRA 3RAKA 3AC2A 3UE4A 3FWQA 4A4LA 4CT1A 2YAAA 3V3VA 3OBJA 4KABA 4GT4A 4RFMA 4XV2A 4ZS0A 1OL5A 4HCTA 2VO3A 4FT0A 2W1GA 3ZO1A 3ZOSA 5A46A 2GS7A 1QL6A 2HAKA 2WTKC 3QTRA 1WBVA 1PJKA 2C6KA 2Q0BA 4NUSA 3RPVA 4LGHA 4GKHA 4G6LA 4F0FA 2XKEA 3ZFXA 3Q9ZA 4MH7A 4DFLA 4OTPA 3PWYA 2ZMCA 5DGZA 2PZRA 4JX3A 4OAVB 4Y95A 3RGFA 2HCKA 3BU6A 3M2WA 3UOHA 4DT8A 5AM7A 2VWIA 5IDPA 2C6OA 1FMKA 1JSUA 3WF9A 3AC8A 5J95A 2R3GA 2XA4A 3EFJA 2PVRA 3E87A 3GB2A 3LVPA 3QKKA 3MH2A 1OI9A 4EJNA 4K77A 3PY3A 1UNGA 5ACKA 4DLJA 3BWFA 2FSLX 3O50A 3H9OA 3TNQB 3GC0A 3OT8A 1RQQA 4OTWA 4QTDA 2WU6A 5AR3A 5IQFA 4PMMA 3IONA 2BFXA 4AGCA 4EQMA 1M7QA 3CIKA 4QP2A 2BTSA 3EMGA 2QOFA 2VX3A 3NLBA 3ZLWA 4H1MA 4CV9A 3HRBA 4YLLA 5LCKA 3F7WA 2R3KA 5CQWA 1IASA 5AV0A 3E7VA 3MSSA 4FEWA 3EQCA 3CPCA 5IH4A 3WZKA 1Z9XA 4ZS4A 5CY3A 4RFYA 5ETAA 3VF8A 2W1HA 2VN9A 3DK7A 3QQHA 4GL9A 5CSWA 4EORA 4WSYA 4ANMA 3TUBA 3MY1A 4RJ7A 3U4UA 4RC3A 2I0HA 3BZ3A 2QD9A 3O71A 5D1JA 3OWPA 5D7VA 5CAOA 5F9EA 3DA6A 5A4LA 3OCGA 5M09A 5L6OA 2PE0A 4A9UA 1PHKA 3AQVA 5L8LA 2NNWB 4AQCA 1JKKA 2J0JA 2PMOX 3LFBA 3P1AA 3LJ0A 4C58A 1OIRA 5LVPA 4MXXA 4OAUC 4DE4A 4U42A 3I0QA 1M2PA 2ZV7A 1K2PA 2UZBA 3K3JA 5HE2A 4HYSA 5DEWA 3FLQA 2R3JA 1IAHA 2EXCX 4ZSJA 4WSQA 4WD5A 3I5ZA 5M55A 5EG3A 5CF4A 3QRTA 5IEVA 5HO6A 2PTKA 5CEKA 3IG7A 3O23A 3WZEA 4PMSA 4WNPA 4NTTA 3U4WA 3KREA 4XG9A 5C27A 4J97A 4MVFA 2Y0AA 3R7GA 4W4WA 2OJJA 4AN3A 4O7NA 4ORKA 2ETMA 3UOKA 3QCSA 4B0GA 4CT2A 4DA5A 2J5EA 5I4NA 2PVYA 3NNUA 4FGRA 4FK3A 4XV9A 1J1BA 3LJ1A 4BDAA 1OMWA 4D4VA 4WG5A 5HG7A 3RK7A 2G9XA 1WFCA 2I0VA 3FMLA 5J79A 3LJ2A 2JDSA 3D7TA 5AR8A 3FHRA 4G5JA 4IWDA 4CTBA 4TYHB 3DK3A 3OZ6A 1XBBA 4R3RA 4HW7A 4O82A 3EYHA 4NCTC 3QQKA 3BRBA 3FI3A 4EHGA 2XEZA 3Q4UA 3P08A 4KUJA 4Y73A 3VS4A 4CRLA 4GJ2A 4AW5A 2YFXA 4N6YA 1J3HA 3S1HA 4NKAA 3F2RA 4PDYA 3VUHA 5B7VA 4FTAA 4GK4A 2XNBA 3NSZA 4ZOGA 4YC3A 4DH8A 3U6HA 1WVXA 2VTHA 3NGAA 4NM0A 4D5HA 1E9HA 2FO0A 3KC3A 2W5BA 3C0GA 3MPTA 3JY9A 3QD2B 2XP2A 5KZ0A 4AAAA 4CLJA 1ND4A 3ERKA 3PPJA 3PDTA 2O2UA 3A7GA 4C4IA 3ALNA 3K5VA 3VQHA 4EONA 2WU7A 3TKUA 4FV8A 5K0KA 4C37A 3KXHA 5JZNA 4UWYA 4XOYA 4PL3A 3ZM9A 3FZ1A 3IECA 3R1SA 4WUNA 4D5KA 4A9TA 1M7NA 2B9FA 4F7SA 4K9YA 4APPA 2GQSA 4WNMA 4RJ6A 2BALA 2HYYA 2HK5A 2V7AA 2VAGA 2A1AB 2G2HA 4QP6A 5EDPA 1URCA 3C50A 1JKTA 3A2CA 3MW1A 2RFEA 2ITUA 3NAYA 4LV8A 3VS0A 2YLFA 4W9WA 3LFAA 5CF5A 4CZTA 2J5FA 3ELJA 4IHPA 2BAKA 2UZNA 3O0GA 4OT6A 5B0XA 5A14A 3DS6A 2WQEA 3SG8A 3M42A 3P7AA 4AG8A 2R64A 3QCXA 4WBOA 4D55A 2AYPA 2HZ0A 4FUYA 3REPA 4BBFA 2QU5A 5AUWA 5AR2A 2VWWA 2PZIA 2J0KA 4M69B 5L4QA 2V0DA 3DK6A 2RF9A 4I6QA 1OPLA 4ACHA 3FYJX 5H8EA 4CXAA 4FV9A 4MXCA 4E73A 5JQ8A 5HG8A 4QMYA 5LXMA 2B7AA 5AMNA 3R8LA 5A6NA 3R83A 3I60A 2V7OA 3MTLA 3R71A 4FBXA 3COMA 4P5ZA 3AD6A 3TM0A 2YM5A 3V6SA 1ZYLA 4NTSA 4F99A 4C33A 3R7VA 4Z3VA 3E88A 4R8QA 4XRLA 1GZOA 3HL7A 3R0TA 3L1SA 1G8SA 2QO7A 2XIYA 3ACJA 2GU8A 2OFUA 1UU7A 3QC4A 4D4SA 3HUCA 2F7XE 1GIIA 4DFZE 4HVSA 3A7HA 4PRJA 1KE8A 2QOCA 1V0BA 3BCEA 3UIBA 1PKDA 4K18A 4RWJA 4TNDA 2JKMA 5G1XA 4CKRA 1G8AA 3QCYA 4IDTA 3QWKA 2BDJA 4V0GB 4QMOA 4AX8A 4QTAA 2OJIA 4PF4A 3VHKA 4IVAA 5HNGA 1W83A 3OEFX 2YM7A 5IKWA 4BI2A 4DEIA 3PA5A 3UVRA 2WMAA 5A4QA 4W4YA 3PLAE 4TWPA 5J9ZA 4RIWA 1Q3WA 3DJ6A 2OIBA 3EB0A 4DITA 4L3LA 1KE5A 4WRSA 2FSTX 5EM5A 2C30A 2YDJA 1Q8YA 5D11A 3R9RA 2HXLA 4CFUA 2O65A 3VF9A 4M15A 4GG7A 3V8TA 5EQYA 5EQPA 3CS9A 5AP0A 5FTGA 4G3CA 5FEEA 4U8ZA 3SVVA 3FY0A 5J7BA 5JK3A 1FVRA 1CTPE 4NSTA 5DR6A 3ZO4A 1ZYDA 3EN6A 4IM2A 1F5QA 3U8WA 2J0LA 2JDOA 3HMMA 2PE2A 3G90X 4O0UA 4I92A 3MIAA 3DNDA 1OITA 3R00A 2IW6A 1NVRA 3RALA 3CTQA 3CTJA 2CGWA 2OG8A 3LFCA 5IH5A 4O38A 3FPMA 2JITA 5L6PA 3UG2A 3SAYA 4UWBA 2PY3A 5CEIA 4EKLA 4TWNA 5LVOA 3MS9A 4E6QA 4E4MA 2GS2A 3IQ7A 2XK7A 4G16A 3ZFMA 2XIRA 3VUMA 2FYSA 3KFAA 1PXMA 1U54B 1UV5A 3EFKA 3LFEA 1OL7A 2FB8A 2G01A 2G2IA 2W1EA 3MFSA 4G9RA 4RSSA 3GFWA 4BVUA 3I4BA 4O1PA 5C9CA 3D7ZA 4UY9A 4U43A 5KMIA 4X2JA 1YQJA 2W5AA 4YSJA 2OU7A 2R3RA 4FI1A 4JDHA 3UP7A 5CSXA 3W8LA 5DR9A 1ZXEA 4L8MA 3DDQA 4G31A 4L44A 3ZEPA 2PUPA 4KS7A 1H07A 1H27A 1ZZLA 3KCFA 4GUEA 4TYGA 3ULIA 4DGOA 1VYZA 3OWKA 4RMZA 1ZYSA 3UZRA 4U3YA 4D0XA 4RLLA 3TNPC 1XH8A 3R6XA 1PMEA 4G34A 4JI9A 3KCKA 4CFVA 1ZYJA 2Y6OA 2WTWA 4LL5A 1YHSA 4IW0A 2E9PA 4U0IA 4V05A 2BIYA 3QQGA 4QQ5A 5L2QA 5HTCA 2CPKE 4IMYA 2OF2A 1ZOHA 4D2PA 4CFWA 2YLEA 4KS8A 4UYNA 4YJSA 4DN5A 4X0MA 3Q2MA 2QNJA 3HGKA 2XF0A 1R0PA 2W06A 5FG8A 2XB7A 4YNOA 3ZEWA 5BVDA 1LEZA 2GS6A 3FEGA 3QBNA 3D9VA 1ZMUA 1E1XA 4BCJA 5AP7A 3U6IA 5I5ZA 2BKZA 2XNPA 3KVXA 5DHJA 4C7TA 3RWPA 1FVVA 5EKNA 2DQ7X 3RVGA 4FSZA 1KV1A 1TQMA 5FTQA 3JS2A 5HCZA 3P7BA 4FV5A 4KBKA 4X21A 3PXRA 1HCKA 4WA9A 4L00A 4UX9A 4EJ7A 4QNYA 5CX9A 5HIBA 5HE3A 5HVYA 2XM9A 3R8VA 5KMKA 4EZ3A 3T9TA 2OJFE 1IAJA 5HLWA 2QODA 3D5UA 4BN1A 3VUTA 4FKWA 3LXKA 3NUYA 4BDHA 1A9UA 3HYHA 4ITHA 3VS7A 4RIXA 5JQ5A 5ETCA 3CJFA 4YJRA 2YHVA 2XRUA 3M1SA 5LMKC 5D9HA 1ZWSA 4I4FA 4ZTSA 1JNKA 1BX6A 3F9NA 3W2OA 4A4OA 4UXQA 4YGAA 3DGKA 3R7EA 2Z7LA 3HP5A 3HKOA 1NVQA 3A60A 4QOXA 4ZSEA 3LXPA 2JKKA 4CFMA 4BCGA 1BMKA 3KGAA 4FSRA 4RJ3A 5ANJA 5I0BA 2Z2WA 2ITOA 4HNIA 3TCPA 2W96B 5J9LA 5H2UA 4UXLA 2G15A 1BI8A 3OF0A 2J50A 5E90A 1HCLA 4G3GA 4RT7A 2WIHA 2HENA 1VJYA 3EFLA 3MA3A 4IACA 4K33A 1J7LA 2E9NA 3PLSA 1PXPA 2GCDA 2R2PA 4PTEA 2IVVA 3Q5ZA 3NWWA 2Y4IC 3FXWA 4FV2A 2X8IA 4B9DA 4BIBA 2JD5A 1UA2A 5EI8A 4F6SA 5JFXA 4KKGA 4DH5A 2ITZA 5AAEA 5AP6A 2ITPA 4FIHA 4PDOA 5CZIA 1OUKA 5IA2A 4BDGA 5AJQA 1U46A 2VD5A 3KRWA 3Q6UA 3GGFA 3LCDA 3MI9A 4FGBA 4HVDA 2B55A 4QO9A 5DRBA 3VULA 1DAWA 3KXNA 4I0TA 4E6CA 4X3FA 3ZXZA 4Z9LA 3BE2A 1H28A 5AX3A 3UVPA 2PL0A 5L2TA 4X7QA 3GCSA 1Z57A 3GU8A 3DT1A 4PWNA 1BL6A 5EM8A 4HJOA 4LUEA 3EL8A 3POOA 2QG5A 1W8CA 2Y8OA 2P0CA 4FODA 1K9AA 1DI8A 3I5NA 4AT4A 3ULZA 4XYFA 4FTMA 3LXLA 5IA4A 4A06A 3IGOA 3PPKA 2WQBA 1KE6A 5HIEA 4MNEA 3ZBFA 3TL8A 4BCQA 4IDVA 3C4FA 5KNJA 3D94A 2CKEA 3BWJA 4EH8A 5DE2A 2C5OA 1PW2A 4DEGA 5J9YA 3F7ZA 4ID7A 3RPOA 1BLXA 2XCHA 3ORIA 4HGEA 4YSMA 4BC6A 4U6RA 4ZZMA 3W2RA 2PZYA 3VS5A 1NY3A 2UW8A 2GQRA 1F0QA 1H25A 4OW8A 1YI6A 5LVNA 3DXPA 4X2FA 3MJ2A 4WNKA 4BICA 3RMFA 3WI6A 4ANSA 2YERA 5DWRA 2WAJA 3LFFA 4ASZA 1P5EA 4I41A 4RWKA 4K2RA 4FSWA 1WVYA 4JVGA 4AA5A 1DI9A 3WIKA 2NRUA 5CALA 4MKCA 3FHIA 1RJBA 3RNIA 2Q0NA 4RA4A 4QMLA 3RI1A 4RGJA 1WBSA 4YO4A 2VTAA 2YN8A 3FZTA 3AC5A 3HZTA 2QLQA 1UU8A 1XH6A 2C6MA 3L8VA 3QA8A 3KKVA 3N9XA 4LL0A 4RC2A 4UZDA 4YHTA 5C4KA 4BBMA 5IQDA 3FMDA 1Q8ZA 5EW9A 3K3IA 3MPAA 2R3OA 1Q99A 3LHJA 4FSUA 1TQPA 2EUFB 3NUSA 1FGKA 3DBQA 4FYNA 3HLLA 4XBUA 4DC2A 3HMIA 4DTKA 3L8PA 4DTAA 3MDYA 4NK9A 4O0VA 5IA5A 3W1FA 4R7BA 3UNZA 3RHKA 5DBXA 3FPQA 5FD2A 2W5HA 3IPHA 4X6QC 1M2QA 4TWCA 4YUQA 5CF8A 5IUGA 3EQDA 1WBTA 3SOAA 4J99A 3S0OA 2YACA 1IEPA 5CAVA 1OIYA 3OTVA 2V5QA 4I94A 4Y83A 5HBJA 3PYYA 3LQ8A 4ZLOA 3GQLA 3PZHA 3UQFA 3VN9A 4KNBA 4KBCA 3ODYX 3PJ8A 5HO7A 1OKZA 1AGWA 3TDWA 5AR5A 1J7IA 2O3PA 1CMKE 1P14A 2QOHA 3IOPA 3QRIA 4FTJA 4MD9E 3UTOA 3ZCLA 4DCEA 2EU9A 3HRFA 2AC3A 4Z7HA 4FEQA 4NW6A 3OW4A 3EWHA 5I9WA 5IA3A 3R8UA 3GQIA 3CEKA 3V8SA 2XKFA 4RJ4A 4M3QA 4LI5A 4M84A 4C4JA 3E62A 3C1XA 2XH5A 3NCGA 5CENA 5A4TA 2B0QA 1FINA 4I1ZA 2W0JA 3NCZA 2XNOA 4YZDA 3SXSA 3HRCA 2J9MA 3NNXA 1OECA 2WELA 3R9HA 2BUJA 2J90A 4KIPA 3EN4A 3DAJA 5FXSA 2CKQA 4M97A 1GOLA 2Z8CA 3DKGA 4I6FA 4G3DA 5HE0A 4NW5A 3EKNA 4F6UA 1Q41A 3F5UA 2UZWE 5CAUA 3NVMB 3NX8A 4R1VA 4DYMA 5BYLA 2YIWA 2Z7QA 2PMNX 3AC3A 5DRDA 3FC2A 3CJGA 3MWUA 2VTIA 4YJOA 3V01A 4RVMA 1Y57A 3PP1A 3GVUA 3PJ1A 3EN7A 4PDPA 4ACGA 4AU8A 2UVXA 2WQNA 4BCPA 5E8UA 5DNRA 5AA9A 2IO6A 4Y5QA 2UVZA 4HNFA 5FEQA 5EFQA 2JBOA 3PY1A 3NW7A 3ZLSA 4O0TA 1Q62A 3D14A 3QCQA 1MUOA 4LRMA 3OG7A 4O7WA 1QCFA 4UMUA 2C0OA 2ZB1A 4N4SA 4EH5A 3TV7A 1XWSA 4RIYB 3E8CA 5J1VA 3TN8A 3MFRA 3PG3A 3EFWA 3L9NA 3OOGA 3Q4CA 2W99B 3MH0A 4FSMA 4FZAB 4LOQA 5EOBA 1KOBA 4MWHA 4Q5EA 1STCE 3F61A 3G51A 5M07A 3D5VA 3HV3A 2CNQA 2F4JA 5IQIA 3MIYA 5M08A 4PDSA 3OEZA 2XBJA 4GRBA 1R39A 3BQCA 4G6OA 4CQGA 2X8EA 4L46A 1PMUA 1BL7A 1PY5A 3CC6A 3OC1A 2XK8A 2F2UA 4FTLA 1CKIA 2PUUA 4N6ZA 2YEXA 3FSFA 3DKOA 4IX3A 3QRKA 4JDJA 4JT3A 4RRVA 3AD5A 4TYEA 4W8EA 4WG4A 4WOVA 3R7YA 1QMZA 4D58A 4GIHA 1OPJA 2OFVA 3MV5A 4HYHA 4ANLA 3P23A 3KRLA 3EQPA 4D1SA 2YAKA 3BU3A 3SRVB 3FMHA 3UDBA 1A06A 4AP7A 3SLSA 3LCSA 4HOKA 4GT5A 3MH3A 4FMQA 1U59A 1Q24A 2P2HA 1JKLA 2ZJWA 5AIRA 1OL1A 3BPRA 3DAEA 3SD0A 2UUEA 4UBAA 3F3TA 4D1XA 3UOLA 5EI6A 4PPBA 3UP2A 3F5GA 2F49A 4XHKB 3RM6A 3V5WA 2BFYA 3DFCB 2O0UA 5DA3A 2XNMA 5EYCA 3NIEA 5GHVA 4FNYA 5IMXA 3LMHA 3FC1X 4MF1A 2F9GA 2XKCA 3SC1A 5LWNA 1WMKA 2A4LA 4M14A 2X2MA 3FZPA 5K5XA 5C03A 2VO0A 4E8AA 1P2AA 2JAVA 4JR3A 4C4FA 2VNWA 1UWHA 2UW9A 2VWVA 2X7GA 2YM8A 4EH7A 3ZSGA 3PJ2A 2UZEA 3GCQA 4BCOA 4EOLA 3P78A 3HDMA 5DYJA 5HI2A 4MBJA 3FL5A 2C0IA 1H1QA 5AWMA 3NAXA 1OIQA 4B4LA 4XUFA 5EM6A 2YZAA 5CU2A 2R3MA 4N0SA 3S00A 2WHBA 3TDVA 1PXJA 2A27A 5JGDA 5IUHA 1IG1A 4GS6A 4EK4A 1FQ1B 3IDBA 5JFWA 5DG5A 2WNTA 3DKCA 5CEMA 4GFOA 5K4IA 1CSNA 3PJ3A 4NFMA 3ZONA 4FICA 4IFCA 4JG8A 3ZYAA 2YIXA 4GV1A 3BYVA 3C13A 3COIA 1K3AA 2QHNA 3ODZX 3Q9XA 4RA5A 4V04A 5AP3A 3A99A 4TZRA 2BROA 1ZMVA 3W16A 3DBFA 4MYGA 3EYGA 4JBQA 1WBOA 2HWOA 3F3VA 4JLCA 5LQFA 3NUXA 2J4ZA 1ZOEA 4NJ3A 3I81A 3PVGA 4DTBA 3A8WA 2R3PA 3N4UA 5BVFA 1UWJA 4TYHA 3GNIB 4EHEA 3C4WA 4FKJA 2B52A 3E7OA 5DN3A 4CCUA 4EEVA 4U79A 2QCSA 3BEAA 1GY3A 1OL2A 1J91A 2R3FA 4JG6A 1WBPA 1R0EA 4O6LA 4IVDA 2Y4PA 3BGQA 4CYIA 5AAFA 3LAUA 4ANNA 2IZUA 2PU8A 3R04A 4BRXA 5JFSA 5BVKA 4O7ZA 4E3CA 4O7TA 3RKBA 4AOIA 5CVGA 4ZAUA 3AXWA 4ENYA 4GSBA 1IRKA 2NP8A 3V5QA 2CN5A 3BU5A 5E1EA 5AFVA 1Q8TA 2YITA 3C51A 3QQJA 2UW7A 2W7XA 5DIAA 5LVMA 4XG2A 4DGMA 1KE7A 3QUPA 3V8WA 4ZY6A 3RTPA 1P4FA 2WMTA 4C57A 4AA0A 5E92A 2ZV8A 5CXZA 2ACXA 5LOHA 4O84A 4IXPA 3SXFA 4RX8A 4BCNA 3MBLA 4I4EA 4IZ7A 2ITYA 4FC0A 4O96A 4KIOA 4FKGA 4ZTLA 3LLAA 1BYGA 3QZGA 2HZNA 3NW5A 5C26A 3LXNA 2BPMA 3PSDA 3AT4A 5HBHA 4AW1A 3OHTA 3RINA 3ZZWA 2E9VA 4F6WA 2HY0A 4FV6A 5CT7A 1MP8A 1PXNA 5DVRA 4YLJA 2CCIA 3VWAA 4O6EA 4D28A 4L68A 2Z7RA 3GXLA 2BIKB 5E8ZA 4DG0E 5IG1A 2WD1A 4XG6A 2WMQA 3ZRKA 1YOJA 4IZAA 4RX9A 3LZBA 5ANGA 5TOZA 2X2KA 3FE3A 4IM3A 1TQIA 5HBEA 4O7SA 5M06A 3C0HA 5J7HA 3LPBA 4M69A 4FEUA 5LJJA 1H00A 2PZ5A 2WTJA 3Q3BA 3EIDA 4HPTE 4XBRA 5EYKA 3WOWA 3R1QA 3O17A 4JL9A 5K0XA 3UPXA 3F82A 4GH2A 5AP5A 3H9RA 3QTUA 4CD0A 5BUIA 3AMBA 3UQCA 5AEPA 3WF5A 3DJ5A 1GZ8A 3UODA 2XNEA 3OROA 3IW5A 3QUEA 4FIJA 5AIKA 2A2AA 2CJMA 2IJMA 4E4XA 5T3QA 4UN0C 4ONAA 4XP0A 5EQEA 5CLPA 3DXNA 4G5PA 3UG1A 2XNGA 4ZSLA 3PZEA 3R7UA 3OS3A 4ALVA 5B2MA 2WTDA 2PMLX 3P86A 2VTQA 3UIUA 4CG8A 3WBLA 5AP4A 3ORTA 2WMXA 3HUBA 4OTGA 3G2FA 2ZM1A 4GT3A 4O21A 3OWJA 2ERKA 5AR4A 4ACMA 2V55A 4XV3A 4MEDA 4E26A 4FT7A 1Q8UA 2WMUA 5AADA 2CNUA 2WZJA 3GU7A 4V0GA 2ITWA 1I09A 3GCUA 4JQ7A 4LUDA 4NH1A 5BVWA 2PYWA 3GOKA 3QL8A 4S31A 1WBWA 4Z16A 3FKNA 3TXOA 4EBWA 3MGYA 3CXWA 3E63A 1KUTA 4J96A 3U9CA 3COKA 4AS0A 2QKRA 3FZRA 3EQIA 4U7ZA 4XJ0A 4R77A 3W2SA 2GTMA 1ZZ2A 2ONLA 3AC1A 3PXYA 4QYFA 4KIKA 2CLQA 1WVWA 3TIZA 4JJRA 1B38A 2QOOA 1SVEA 3HEGA 4JRNA 4YZ9A 4IX6A 3TV6A 2YDIA 2NO3A 1CKJA 2HZIA 2VTLA 3LE6A 4OBOA 4OUCA 4AT3A 3Q2JA 3HAMA 1ZARA 2GNHA 3GI3A 4JR7A 1SM2A 5HICA 2VTNA 2XCKA 3C4XA 2B1PA 4DBXA 2C4GA 3Q04A 4JNWA 3E8NA 2J6MA 2QOKA 3BE9A 4PMTA 2GHMA 4IB3A 1B6CB 4RPVA 4F4PA 3GC7A 4Z7GA 3DLZA 3D2KA 3ZDUA 1ZY4A 4BCFA 3VUKA 2X6DA 3G9LX 3IW8A 3NPCA 3BBWA 5HOAA 3TZMA 2UW4A 4QMNA 4E6DA 2OI4X 4BIDA 4NU1A 4PP9A 5CVFA 5HNBA 4IEBA 4JRVA 3T3UA 2XYUA 1U54A 4RLKA 4B8LA 3QQUA 2C47A 3S95A 5EW3A 4HGTA 2BHEA 4BDDA 1NT2A 5J5TA 2WTIA 3GT8A 5D10A 5GJFA 5LCJA 3N4TA 2BZKB 1GZKA 4YMJA 5KMLA 2QOQA 4S32A 3C4EA 4FUXA 4QYGA 5ANKA 3R7OA 1QPEA 4RBLA 3WF6A 1YI4A 4FT3A 3C4CA 4FSNA 3KF7A 1R78A 3IGGA 4B6LA 4XG7A 3C5IA 1APME 3WARA 3RCDA 3II5A 2VTJA 4BHZA 3R30A 4YTIA 4YJUA 4BFMA 3VBVA 5E9EA 3PTGA 5IA1A 4GEOA 5M4UA 3HMPA 3E64A 3R01A 2LAVA 3IS5A 4EC9A 5KO1A 3KMWA 2P2IA 1YOMA 2YISA 4H3PA 4O0XA 4AGUA 4AZSA 1J1CA 4FIGA 1YWRA 3AT2A 3WF7A 1JLUE 1MRVA 2DUVA 4TYJA 4RQVA 5CF6A 2XIKA 2QURA 2OXDA 3KXMA 4KRDA 4OBQA 5AP1A 3G6GA 3ZTXA 1YXXA 3ORZA 3R2BA 4QQJA 3QQLA 4JIAA 3ZU7A 3OY3A 4FKPA 4KIKB 5HCXA 4N57A 4ITIA 4PL4A 4QPAA 4ANQA 1Y8GA 4G6NA 3RHXA 2H34A 1ZOGA 5M51A 3G5DA 5CEQA 3MVJA 1RW8A 3VHEA 4AF3A 3KA0A 3WE8A 5E8VA 3EQRA 4IAAA 5ETIA 4ZTNA 4O0WA 5CXHA 2JKQA 4O86A 2W4OA 3QGWA 4YLKA 3OCBA 3LKMA 4Q5HA 5AV4A 1DAYA 3PXFA 5J8IA 5GIOE 4F1OA 2G2FA 3OCTA 4UMTA 5L6WL 3UMWA 3QD4A 1V0OA 5K9IA 4AZWA 3PP0A 3HV7A 2PVJA 4O1OA 5M53A 4NYEA 2I1MA 4YC8A 5DI1A 4L01A 5EW8A 1SYKA 2XUUA 3DFAA 4BCKA 4U3ZA 5BMMA 2IW9A 5FWKK 2Y7JA 5HQ0A 5KUPA 2ETKA 4R3PA 4AGDA 4DH7A 4I3ZA 3QRUA 4QQCA 4D2SA 3E93A 2WMRA 3A62A 3KULB 4ZTRA 2QVSE 4EZ5A 3R73A 4QYHA 2C6IA 4CTCA 1XQZA 4D4RA 2C3LA 4O2PA 1ZLTA 3TT0A 4P5QA 4FYOA 4I93A 2R0UA 4M68A 4XX9A 2NRYA 4G2FA 2GNLA 4RVLA 5FBOA 3POZA 3TZ7A 2X9EA 4CSVA 3F69A 5HLPA 2FUMA 3DV3A 2BKKA 2XK3A 4QPSA 4YP8A 1OPKA 4TPTA 1H8FA 2BRGA 4JIKA 4GW8A 5I9YA 2R3QA 3DPKA 3Q60A 4M7IA 3GC8A 4ZEGA 3OXIA 4AW0A 4BDJA 3ROYA 5ITAA 2ITXA 2PK9A 4AGWA 1MRYA 4FKLA 2PZPA 4IX4A 4I24A 3SHEA 2V22A 2HELA 3E5AA 1GNGA 3RZBA 4CGAA 3QD3A 3FKLA 3LFSA 4AOTA 3QRJA 3KRRA 2VWUA 2BDWA 2UW6A 5HO8A 2OGVA 2W4JA 4ZSGA 3CE3A 3F2AA 4PQNA 4FA2A 4R5SA 5TO8A 1OIUA 4IAKA 2IN6A 2ZAZA 4IE9A 2BZHB 3ZC6A 3KK9A 1F3MC 2CDZA 2VTMA 4S30A 4DEBA 4IC8A 4BDEA 5JN2A 3Q32A 4Q9SA 3CD3A 3HP2A 4GFMA 4E5BA 5BVNA 5HZNA 2WMVA 1WAKA 4X2NA 4TY1A 2WXVA 4YJVA 2IWIA 2Z60A 5E1SA 5BNJA 2X0GA 4A9YA 2W1ZA 1O6KA 2X39A 3Q53A 3CQEA 5AM6A 5I9VA 4L67A 4QP4A 4IANA 2XNNA 2RL5A 1TKIA 4GU9A 4X3JA 2WEIA 4GYIA 4C59A 3HAVA 2KULA 5BYZA 5C4LA 4B7TA 2CGVA 4E20A 3EQGA 4EOIA 3QC9A 4FSYA 4Y8DA 4AZFA 2XK6A 4L53A 3O51A 3OUNB 3KN5A 3F3ZA 4FSQA 1FBNA 4OLIA 4CMOA 2XIXA 3NVKI 1ZYCA 5CU6A 1S9JA 2OZAB 4UYAA 3CD8A 2EB2A 2QR7A 1H01A 2VNYA 3JVRA 3SDJA 2F2CB 4IX5A 3WYXA 3ALOA 4IJPA 3L9MA 2QR8A 4F7LA 1A48A 2LGCA 4AE9A 2GNGA 4FNZA 3OW3A 4QD6A 4C8BA 4XRJA 2PUIA 1YXUA 3B2WA 4EOJA 3EN9A 4XG4A 2XJ2A 1EH4A 3QTWA 1Y8YA 4DF3A 5DT3A 4X3FC 1XBCA 3QX2A 2V62A 1YXTA 4XNEA 3WZUA 2YJSA 4BHNA 4IAZA 4LQMA 1ERKA 2PVFA 3RBWA 4D0WA 2P3GX 3FJQE 2OJ9A 5L3AA 3UYSA 4ACCA 4FZDB 4ANBA 3SXRA 4O7YA 3RPRA 5IISA 4FX3A 4JG7A 3EZRA 5DPVA 4EH3A 4M13A 3G15A 4JBOA 4XV1A 4KIQA 4TXCA 3OFMA 1CKPA 5IU2A 4D2WA 5M57A 2PVKA 2XEYA 3FY2A 4XP2A 4CZYB 2DWBA 3F3UA 1VEBA 3HECA 1YKRA 2ZDTA 3S4QA 4EQCA 3KF4A 3LOKA 1VR2A 2WFYA 2C3KA 2WPAA 2I40A 5FP6A 2BILB 3JPVA 3ZHPC 5HX6A 5L2IA 1W7HA 1Y6AA 4PUZA 3DB8A 3TTJA 4C4HA 1H08A 4ZJIA 2C69A 4D2RA 4EOMA 2IG7A 4C62A 2CGUA 3JVSA 4G3EA 4WBBB 3UO4A 2X4FA 3G0EA 4ZTHA 4D9TA 3UJGA 4CKIA 2WGJA 3E3BX 3EQBA 3MVMA 2X7FA 4FKRA 4ITJA 4RX5A 4DH1A 3Q52A 4H58A 3BYUA 4A9SA 5JEBA 4WIHA 5CEPA 3DQWA 4QPMA 3F2NA 4APCA 2J51A 4AWIA 4GVAA 4GFGA 3DOGA 4BCMA 1H24A 4P4CA 4F09A 4GIIA 5EKOA 3GCPA 5BMSA 4C35A 3BI6A 5ANEA 2GHLA 3MJ1A 2YIQA 3R9OA 3ZXTA 2WMBA 5I9ZA 2CHLA 4BCHA 2B9IA 4I22A 2YCRA 2GQGA 4AFJA 4FTCA 3RZFA 2PE1A 2FSMX 2OH4A 4YURA 2JDRA 4FZ7A 5M4FA 4DFNA 1PXOA 1WBNA 2R7BA 4DFBA 3W55A 2BR1A 5FM3A 3NUUA 3UGCA 3MVLA 3CGFA 3W33A 4FV3A 1FMOE 5A54A 3W2CA 4YJTA 1S9IA 2GNJA 3QAME 4RIYA 2XIZA 3A7IA 1JVPP 2B54A 3SV0A 5DMZA 3DLSA 4JXFA 2YCSA 5JFVA 1GZNA 3BHVA 3ORMA 4EQUA 3UC4A 3QZFA 3R8ZA 2UZUE 4MD7E 5CS6A 4O81A 3G0FA 4FKTA 2ZYBA 2R4BA 4HGLA 4C4GA 4DEEA 4WNOA 3BLQA 2YWPA 3WIGA 2PWLA 4IH8A 5HHWA 3TJCA 3GU6A 1Q8WA 5CYIA 1OGUA 1Q61A 3FMNA 4W8DA 3ZSIA 4AN2A 4PMPA 5CU0A 4USFA 5HTIA 4A07A 4ZMFA 2C5VA 4BBEA 1H0VA 2C5XA 3IO7A 5KMNA 4DEHA 4U45A 1AD5A 1OKVA 3C0IA 3P79A 2W1FA 5AUXA 1PXLA 4DLIA 4YTCA 1REJA 5AR7A 2WB8A 2WKMA 4FT9A 2QKWB 4EK6A 4I20A 5EHOA 4Z55A 3PVBA 4TKSA 4FF8A 3ZZEA 3VRZA 2R3NA 3ITZA 4BWKA 5AUZA 4DGNA 3SRVA 5GZ9A 3O8TA 3CCNA 3TZ9A 3FLNC 3FLWA 3N51A 4O91A 3GC9A 2B53A 2ERZE 4AFEA 2IW8A 2DYLA 2ZV9A 3ETAA 5BPYA 4P2KA 2CMWA 3H9FA 5CQUA 2C5NA 4UMPA 4QTBA 2BAQA 4FKQA 3VO3A 5CASA 5CI6A 3H30A 4L6QA 4O0YA 4QP8A 1SVGA 4JDKA 4XOZA 3TJDA 4C3PA 5FUTA 2OXYA 2WOTA 2ZMDA 2O64A 4FKUA 4I0SA 4YJQA 4ARKA 5IDNA 5IEXA 5M4CA 3NW6A 4IB0A 4O27B 3WF8A 1MQBA 2OK1A 4D1ZA 1LUFA 3A8XA 3B2TA 2JC6A 2VGOA 3ZDIA 2WO6A 1YDSE 2OIDA 4X2GA 4USDA 5KMJA 2X1NA 3ACKA 3OTUA 3IDPA 3P9JA 4IVBA 5I3OA 3HVCA 2KTYA 4L45A 4Q2AA 3VUDA 4EOPA 5E8YA 2J0MB 3D15A 3P4KA 5D41A 3V5LA 4I5CA 5D7AA 2XJ1A 3A4OX 3RK5A 4FV7A 1L3RE 5IA0A 4NT4A 1FGIA 3FUPA 2IVSA 3DNEA 4D4YA 3R22A 3BKBA 2GSFA 3DBDA 4YU2A 5A4EA 1URWA 1JBPE 3LMGA 2Q83A 1QPDA 4ZXTA 2GHGA 3D2IA 1E1VA 2A19B 5M4IA 1O6YA 1NA7A 2CKOA 4DBNA 2GFCA 4HVGA 1OBGA 1ZRZA 5EOLA 1XH5A 4M0ZA 4CNHA 5KMMA 3PA3A 4EYMA 5E8SA 2ITTA 4NWMA 4ASEA 4B99A 4R78A 1OM1A 3A61A 3O96A 3NNWA 3HMNA 4XLVA 3GFEA 5CI7A 1M52A 4MBLA 4OT5A 5FGKA 1Q4LA 3V04A 4A7CA 3PSCA 4YJPA 3T3VA 4BKZA 3KVWA 5E7RA 1XH4A 4IADA 4CMTA 4XCUA 4KA3A 2PUNA 2ZOQA 3QXOA 2CN8A 4YHFA 4EK5A 2C6LA 2ZV2A 4J95A 3KU2A 5IQEA 4YBJA 2UZVA 3BV2A 4BWPA 2OWBA 4EUTA 5LVLA 2OBJA 4XMOA 4NEUA 4HYIA 5T68A 1DM2A 3AOXA 3BBTB 3I7CA 3G9NA 3T8OA 4DHFA 3DB6A 3I0OA 2O5KA 3UMXA 5E91A 3BELA 5HKMA 4J8MA 4EH9A 3NUAA 2W9FB 5AUYA 1OUYA 1YXSA 3QKMA 3OOMA 4MXYA 5H8BA 4DG3E 1JOWB 2PSQA 1J7UA 3ORXA 3UBDA 3OBGA 3ORKA 4L42A 5B2LA 2VUWA 3E8DA 3D5WA 5KCVA 4MQ1A 3VJOA 4LYNA 2EWAA 3EQHA 3NZ0A 5HX8A 5JRQA 4A4XA 3UO5A 3E92A 2VWZA 2BZJA 3O2MA 4NIFB 3QYZA 4QYYA 4PX6A 4KKEA 3ZM4A 4E5WA 3HV5A 1QPCA 3TZ8A 4FVPA 2YCQA 3GU5A 1G5SA 1PYXA 1SVHA 2AC5A 2VGPA 4UV0A 2O63A 2PVLA 2XJ0A 4FOBA 4C38A 3B8RA 5E8WA 4IC7A 1YVJA 3D0EA 4DFYA 5FLFA 4OBPA 4QP3A 5DH3A 4USEA 5J1WA 2R3HA 3MVHA 3PFQA 1FVTA 3W32A 4IAYA 2VV9A 3WZDA 2OH0E 2W1IA 4RC4A 2PULA 3GU4A 3QHWA 3RK9A 3MPMA 4G1WA 2REIA 3TKIA 4QMWA 3OMVA 3IW6A 3NYNA 3LW0A 2BZIB 3F3WA 1GIJA 2DS1A 4FL1A 4C36A 4I23A 2O8YA 4HYUA 5AV1A 5TF9A 5JZJA 3FI2A 4YTFA 4HPUE 3JXWA 5H9BA 5E8TA 4EI4A 3K5UA 5BUEA 4KD1A 5BVOA 3AMAA 4Y5HA 2PHKA 4HZSA 3PPZA 3DZOA 3H3CA 3KEXA 3LM0A 4RJ8A 4UEUA 4CCBA 2GNIA 3BLHA 4EK3A 2SRCA 1H26A 2C6DA 3DJ7A 4BTMA 5A6OA 4MWIA 5ETFA 3GBZA 4OTIA 5T6KA 3R9NA 3CKXA 4C34A 3UOJA 3D5XA 3WYYA 5IPJA 4QNAA 4FR4A 4I21A 3TIYA 5J87A 2HW6A 3OUKA 3VIDA 3FZSA 4QQTA 5H8GA 2E9UA 3KXZA 3NIZA 3GENA 3PE1A 3R02A 5C8KA 4EOQA 5LMBA 5DFPA 4R5YA 4XH6A 3CGOA 5A9UA 3AMYA 3ORPA 5FXRA 2QOIA 3PXZA 3HA8A 3IW4A 4BKJA 3P5KA 4KRCA 4EK8A 5JSMA 4UALA 2YM3A 3HX4A 3IOKA 3BHTA 3ZRLA 4F9BA 3G33A 4YZBA 4S2ZA 4LV5A 4E4LA 4CLIA 4ZJVA 4RJ5A 3CR0A 4BIEA 4ZZOA 4G17A 5KKRB 4CQEA 3N4VA 2C5YA 5JKGA 3BEGA 4F1TA 4ZJJA 2WOUA 5KE0A 3L9PA 5GJGA 4PP7A 4EWQA 4TN6A 3LQ5A 4P90A 4YZCA 3U55A 1KOAA 3LCTA 4O83A 4QTEA 4PPCA 3L9LA 3LCKA 2RFNA 4FKOA 4DGLC 3A7JA 2XRWA 3C7QA 3NYXA 4B8MA 5TE0A 2HZ4A 4X6RA 4FV4A 4H3QA 2R7IA 4ACDA 4F7NA 2JFLA 4QMQA 2XK4A 2WTVA 4JAJA 4U40A 2H9VA 1YW2A 5EI2A 5DEYA 1PF8A 3QALE 3TKHA 1W98A 5BUJA 2YCFA 3QQFA 5HESA 4AACA 3UNKA 2W1DA 4AT5A 2RSVA 5F95A 3H0YA 4GVJA 2BMCA 3FKOA 3HV6A 4BZDA 4E5AX 3DY7A 3UQGA 1MQ4A 5A3XA 1P4OA 4FTKA 3KN6A 2UZDA 2I7QA 4M12A 3RPSA 4NM5A 3ZUTA 4O2ZA 4BTKA 4U44A 2JIIA 3G6HA 4LM5A 4HVHA 5K5NA 3PXKA 3CSVA 3EZVA 3UZPA 4EOSA 2OZOA 3QHRA 4BTFA 1OL6A 4CKJA 4UMQA 4HGSA 4M8TA 4AZTA 2C1AA 4QMPA 4PPAA 4BDIA 4WO5A 3AD4A 3ZH8A 5KX8A 1RE8A 4BR3A 5IQCA 3R2YA 4PV0A 4YJNA 2YZLA 4FTOA 4AW2A 4BL1A 3CPBA 5DT4A 3KB7A 2AUHA 3PA4A 4ZSAA 3I1AA 2WTKB 2FVDA 3EHAA 4QMVA 3MY0A 3RAWA 4II5A 4BCIA 4FKIA 4BI0A 2X4ZA 5F94A 2W4KA 3OVVA 4YBKA 5CANA 5CAPA 5GZAA 3QLGA 4CFFA 3DTCA 2IPXA 4GUBA 4NJDA 3VBQA 3OD6X 3S3IA 2JAMA 2VZ6A 1U5RA 3W10A 4EHZA 4CRSA 3PWDA 1XH7A 4F9AA 3FL4A 5HIDA 2WQMA 3ANQA 5HG9A 3RM7A 4ZIMA 2GMXA 3DZQA 4AN9A 2OF4A 4BZOA 2HIWA 3GUBA 2ONLC 2R5TA 4U9AA 4OR5A 5G6VA 4FK6A 3FZOA 4L43A 3A7FA 5K3YA 5ICPA 3VUIA 1JSTA 3QYWA 4NCTA 4BGHA 3VBXA 3WE4A 4JQEA 5FEDA 3I79A 4CYJA 2R9SA 5JGBA 4MCVA 4J98A 1JSVA 5BVEA 3VW8A 4EWHA 3M11A 3RAHA 4EOKA 4FVQA 5IF1A 2BCJA 3EL7A 4HVIA 2UW0A 4UMRA 3ZUUA 1UU9A 3S2PA 5GJDA 4LMNA 3VBWA 4QTCA 4LOPA 5L2SA 4F1MA 3QGYA 5A4CA 2OJGA 3GEQA 2ITQA 4G3FA 4QT1A 4TT7A 3R8PA 3SKCA 3V5JA 1YHVA 2PVHA 1VZOA 3BHUA 4EZ7A 2W17A 3ORNA 4QMTA 4FTQA 4DFUA 3T9IA 5AV2A 3GOPA 2C3JA 2VX1A 3BIZA 3CQWA 3VS3A 4RWLA 2OLCA 3UC3A 2WMWA 2H8HA 4MF0A 4MX9A 5HG5A 3TG1A 2VO7A 5HU3A 4S34A 4EOOA 5HE1A 4R7IA 5HD7A 4FV1A 2F7EE 4TL0A 2VTSA 5IH6A 2W1CA 3OWLA 3WZJA 2BAJA 3E3PA 3PRFA 4RG0A 1XHAA 4FTNA 5KZIA 3Q96A 3PG1A 1PRYA 4H39A 1DS5A 3AG9A 2J0IA 4O7LA 3DBEA 4JS8A 2OKRA 3KULA 4EKKA 4F0GA 3FQSA 4FL2A 2PVNA 1QPJA 3KL8A 5ANOA 3QTIA 2Z7SA 3BGPA 3OXTA 4H1JA 3U54A 3K54A 3ZO2A 1FPUA 3ENHA 1YDRE 2RKUA 2VO6A 2VTRA 1UU3A 4K1BA 1MRUA 4CV8A 5TKDA 4F65A 2XM8A 3QUDA 5HVKA 3PRIA 2I6LA 3BV3A 1PXKA 1GAGA 2IVTA 4FZ6A 4QMXA 2RFDA 4PNKA 3R8MA 2ZDUA 3OP5A 3D7TB 3DKFA 3F5PA 2QC6A 4AE6A 2JDTA 1JQHA 3HA6A 5FDXA 3ZO3A 3CKWA 3OY1A 2OIQA 4MAOA 4IB5A 4TTHB 3VS6A 4F9YA 5FDPA 3FYKX 2BHHA 4FG9A 4GMYA 5EHYA 2WQOA 3TWJA 3ZUVA 5AAGA 4E7WA 2X7OA 4BGQA 5TR6A 4MK0A 4Y72A 3W2QA 3I7BA 4RVKA 3ZC5A 3O7LB 3VNTA 1CDKA 3NUPA 4ASXA 3LFNA 5M56A 2EB3A 5CSHA 4FVRA 4OTHA 3TACA 4IWQA 1O9UA 2YWVA 3I6UA 4UWCA 4RWIA 3ZFYA 4WRGA 3DQXA 3QXPA 3DAKA 3DU8A 3TV4A 2XKDA 3LMIA 3BLRA 3PVWA 4FG8A 4TRLA 5CNOA 2HWPA 3O7LD 1KV2A 4GU6A 4IFGA 5LARA 4E93A 4NL0A 3SX9A 2P55A 1IA8A 3QX4A 4TNBA 3TI1A 4LFIA 4KBAA 2C68A 3VJNA 4D2VA 4DEDA 4F7JA 4GYGA 5IMEA 4L7FA 1H4LA 3WILA 2FSOX 3KY2A 5FM2A 5H3QA 3ATTA 5FP5A 3KMUA 4L3JA 4JAIA 1R1WA 2WMSA 4A9RA 3MFUA 4BY9E 4O0RA 4J52A 5LMAA 2RG6A 4OTFA 3Q5IA 4MTAA 4ANOA 5D12A 2CNVA 5JGAA 2VRXA 5KMOA 3R1NA 4AZVA 2HOGA 3F66A 1W84A 4KB8A 5KHXA 1UKHA 4ZLZA 2RFSA 2ITVA 4FKSA 3SW7A 4GG5A 3V51A 4IAFA 4FTTA 4OGRA 1CM8A 3ENMA 1AQ1A 3BYSA 4QP7A 3W8QA 1NXKA 3DCVA 3RWQA 3F88A 3FBVA 4BI1A 2OZAA 5KHWA 3HDNA 4UB7A 3LM5A 5L8JA 2HXQA 4AA4A 2HW7A 3LFDA 3ZS5A 4RFZA 4U81A 4CZUA 1Q5KA 1T46A 1PKGA 2JFMA 2W05A 3Q4TA 4LMUA 5CU3A 3QZIA 3EN5A 3RAIA 1LEWA 4D2TA 3JUHA 4XS2A 1YWNA 2XK9A 1IR3A 5FTOA 2X8DA 3CQUA 5JRSA 3R9DA 5JH6A 3DDPA 4GCJA 4MNFA 3JR1A 4ERWA 4JOAA 3VS1A 5CAQA 4CMUA 2G1TA 2OW3A 3BYOA 3FQEA 4ZTQA 3UIMA 3ZSHA 1JKSA 4BDKA 1NW1A 4L52A 3RP9A 1G3NA 4Q9ZA 2EVAA 4EL9A 2QOLA 4OTRA 5EK7A 3TNHA 4C02A 4AZEA 4FEVA 3TNWA 1H1WA 4IJ9A 4RX7A 1PMVA 4YZNA 3K2LA 5EDQA 4F63A 3OCSA 4DINA 4FNWA 1Y6BA 3NDMA 2RGPA 5CU4A 3SQQA 3F5XA 5CEOA 2B9JA 3OXZA 4P7EA 1PXIA 1M14A 2QHMA 4C0TA 4ZK5A 4F9CA 3NRMA 4FTUA 3NUNA 4NKSA 4OTDA 5KBQA 4PTGA 5L2WA 5JT2A 3PIZA 4LRKA 5IQGA 4JQ8A 2OXXA 5J5SA 4FE2A 4IVCA 1O6LA 2QU6A 4X2KA 4QP9A 4U5JA 5BQ0A 3DBCA 3UO6A 3C5UA 3ANRA 1ATPE 4RIWB 2F7ZE 4U80A 4IZYA 3V6RA 3QKLA 2IZSA 3R28A 5HVJA 2BRMA 2ESMA 1OVEA 2IZTA 3PE2A 1M2RA 2VWBA 4BB4A 2YDKA 4NFNA 3GP0A 1BI7A 3IKAA 3RCJA 4BKYA 2QLUA 5BX0A 2CCHA 3JYAA 1XO2B 3MB6A 3UZTA 1JAMA 4DCAA 4I0RA 3Q9YA 5ANIA 4OTQA 2OO8X 4DGGA 1XBAA 4J8NA 5DR2A 2JGZA 3ROCA 5HU9A 4WG3A 2Z02A 2H6DA 2QG7A 3CLYA 5FRIA 3NNVA 4CG9A 4J71A 4KSQA 2GFSA 3CP9A 4XLIA 3R7IA 4CFNA 3FI4A 4YTHA 2X9FA 2P33A 3EH9A 4H3BA 4JBVA 4TW9A 5BYYA 4MBIA 3R21A 4MD8E 4FSTA 4ZTMA 5HEZA 1W82A 2CKPA 4JBPA 1OKYA 5L8KA 4F0IA 3DTWA 2FGIA 2JBPA 5CVHA 4DH3A 2QONA 3NYOA 5F20A 3U9NA 3UVQA 5HLNA 4EYJA 2ZM4A 2ZM3A 2EXMA 4W4XA 3VBTA 3QU0A 4JDIA 5LMKA 3CBLA 1TVOA 3EKKA 3LCOA 2JEDA 4R7HA 4DT9A 2WEVA 2PPQA 4ZY4A 2YM4A 4TWOA 2C6EA 3CY2A 3UPZA 1XKKA 5EYMA 4O7VA 4M67A 3PY0A 1REKA 1KSWA 4ERKA 3FV8A 4K0YA 4WT6A 2JDVA 4FL3A 2XZSA 3U87A 2UV2A 3UNJA 1LP4A 4DAWA 4EH4A 4FIIA 3JY0A 2XBAA 3H0ZA 3HV4A 4FIEA 4RZVA 4HZRA 5CT0A 4FTIA 5EH0A 5CZHA 5JMSA 5E4HA 4F9WA 5KBRA 4QMZA 5EYDA 4LG4A 1B39A 2BRNA 5LWMA 4L7SA 2X6EA 3NYVA 3ZMMA 5TT7A 5HGIA 4BDBA 1W0XC 4H36A 3RNYA 3D4QA 5IQBA 5I9UA 3PIYA 4FNXA 3TNIA 3LQ3A 3KRXA 4FG7A 1NVSA 4EH6A 1U5QA 2JIUA 4LGGA 1H1PA 2JKOA 2OSCA 2WIPA 4YHJA 4PY1A 4BTJA 1IA9A 4IB1A 2B4SB 4FTRA 1KWPA 2HY81 3H10A 1Q97A 2XVDA 3V5PA 1UKIA 3NMUF 1VYWA 2R3IA 2GTNA 1YOLA 2J7TA 3IDCA 3R63A 4FT5A 1JPAA 4XG3A 3FLSA 3V5TA 3VAPA 3AGMA 4KINA 1Y91A 1XH9A 4WHZA 3MB7A 4F64A 2UVYA 4EUUA 5IQHA 1XR1A 2UZOA 3BGZA 5AP2A 2QO9A 4LOOA 4FV0A 4IWOA 3QTXA 4ZZNA 3AT3A 4RIXB 3R1YA 3FMMA 4AUAA 4C3RA 2VTTA 4GKIA 3VRYA 2W9ZB 2OICA 2VTOA 3BHYA 1OB3A 3QTQA 4BWXA 2VTPA 4KSPA 3KXGA 2UZLA 4F70A 4LGDA 2PVMA 1WZYA 2JIVA 3Q4ZA 5I9XA 2BRBA 5AUUA 2Y6MA 1H0WA 1BKXA 3OT3A 4MXAA 3FXZA 5CNNA 2FH9A 1ZAOA 4S33A 2QI8A 3MESA 5CSVA 1YRPA 4HCVA 5I3RA 1SNUA 2CLXA 2ITNA 4QRCA 4V01A 3I6WA 3SA0A 3Q6WA 4O22A 3SOCA 4G9CA 4DG2E 3C9WA 4GK2A 4I5HA 1YXVA 3QA0A 2RIOA 4E1ZA 1H1RA 2FA2A 3RPYA 3IW7A 5DT0A 3FI8A 2IZRA 1YWVA 3SGCA 5AX9A 2F57A 4XP3A 4BYJA 5HNIX 4FOCA 2VWYA 2Y4IB 1GJOA 1T45A 4WUAA 4AOJA 2WTCA 1BUHA 3THBA 2Y9QA 3D83A 4CVAA 2NPQA 4DFXE 2GNFA 4ASDA 4RQKA 3LIJA 4BGGA 2B9HA 2BRHA 5EHLA 4X3FB 1XJDA 3FLZA 4JX7A 2YABA 3FMKA 4WKQA 3PXQA 5EM7A 5GINE 1GIHA 2A0CX 3C4ZA 4BYIA 4I5PA 3UYTA 3BQRA 3CTHA 2VWXA 3P7CA 4DEAA 4C61A 1U4DA 3HNGA 5C01A 5M44A 3ATSA 4R3CA 3UIXA 3NS9A 3VUGA 1JWHA 2C0TA 3L8XA 5IEYA 4U97A 2UW3A 4IBMA 5B2KA 3BX5A 3MH1A 5IZFA 2BTRA 2EXEA 3FMJA 3PIXA 3QLFA 4CFXA 2CGXA 3PSBA 4I5MA 5CTPA 5CWZA 2RG5A 4L9IA 3QWJA 4IM0A 5IQAA 2P4IA 3BYMA 4FIFA 4MNEB 5ANDA 3VW6A 4C4EA 4LRJA 3MY5A 4XG8A 4C3FA 1R3CA 5CSPA 3W18A 3U6JA 3DXQA 3O8UA 3QTSA 3ID6C 4NIFA 4K11A 3COHA 5FBNC 4QP1A 3FAAA 2ZB0A 2YM6A 4NM7A 3FQHA 4K6ZA 4MQ2A 3MTFA 2X2LA 4EBVA 2I0YA 3CY3A 3VVHA 2E2BA 2YA9A 1FOTA 3VQUA 2C3IB 2QO2A 4XEYA 3PJCA 4E4NA 4EH2A 5F4NA 2JLDA 5HTBA 4MXZA 5C8MA 4ENXA 1YHWA 1ZMWA 4IZ5A 1HOWA 3MYGA 3QZHA 4IWPA 2UW5A 2R0IA 3FSKA 4W9XA 3VS2A 3KXXA 5K4JA 3FXXA 3ZBXA 4PNIA 3NEWA 2I0EA 4YO6A 4EC8A 3KRJA 1H1SA 1KE9A 1UNHA 2VX0A 2CSNA 5HD4A 4IQ6A 4RVTA 2UZTA 4Y46A 5AA8A 4I6HA 3FDNA 3Q9WA 2H96A 3EJ1A 3LLTA 3ORLA 3NR9A 4YPSA 3B8QA 3HMOA 1I44A 2X81A 2XYNA 3KK8A 3QFVA 4R6VA 5F1ZA 2PMIA 5IUIA 4AXAA 3TTIA 4CEGA 4ZLYA 1L8TA 3AGLA 4L3PA 3PUPA 4N70A 4M0YA 4QMMA 4YZMA 4K8AA 5AV3A 2J2IB 3VC4A 4E6AA 3E8EA 4BF2A 4BZNA 4EHVA 3F6XA 3ZLXA 4I6BA 4YNEA 5EDRA 3QTZA 2VU3A 1ZY5A 4R1YA 4Y85A 2R3LA 4FEXA 5AUVA 5HCYA 3FMEA 5FXQA 4TYIA 1M17A 3KMMA 4RIOA 4PTCA 4ZMEA 3FLYA 4ZP5A 2QOBA 5KKRC 5E8XA 5FQDC 4BDCA 4KKHA 4O0SA 1WCCA 3VBYA 3MA6A 3QD0A 3RJCA 3IK3A 1UNLA 4ALUA 4IAIA 4NZWB 1LR4A 4J1RA 4PL5A 4W4VA 3ET7A 5GNKA 3ZLYA 1V1KA 4QMUA 1RDQE 4YR8A 2XMYA 4ZY5A 3BHHA 4YC6A 4J7BA 4QYEA 5C8NA 4HCUA 3QF9A 1OKWA 1V0PA 2XS0A 4IIRA 4KAOA 4KWPA 3W2PA 2C1BA 3TUCA 4H05A 2ETRA 5AUTA 3MFTA 1X8BA 4MXOA 1Z5MA 4RZWA 3MN3A 5ACBC 3PVUA 4M66A 5GZ8A 4YPDA 2QQ7A 3O8PA 3SG9A 1SMHA 1SNXA 1PMNA 4NM3A 4F08A 2IVUA 4MHAA 3KQ7A 4UZHA 1YI3A 4FKVA 1SZMA 4FZFB 3H4JA 3U51A 2C6TA 4O7RA 4C2WA 1YDTE 2YIRA 3GCVA 5C1QB 4GJ3A 3ZRMA 2ZVAA 2BVAA 3SW4A 4D9UA 3A4PA 4J53A 5HORA 3TUDA 4ALWA 1PYEA 3EQFA 2YIYA 4U41A 3P0MA 3LFQA 5DLSA 2BDFA 1OZ1A 3EOCA 5DOSA 3AC4A 4GK3A 1OBDA 1UVRA 2GDOA 2GPHA 4C2VA 4BDFA 4QMSA
chains in the Genus database with same CATH superfamily
1LPUA 2E9OA 3TEIA 3AKKA 5GIPE 1Q3DA 3L8SA 2YJRA 1ST0A 3RAKA 3AC2A 3UE4A 3FWQA 4A4LA 4CT1A 2YAAA 3V3VA 3OBJA 4KABA 4GT4A 4RFMA 4XV2A 4ZS0A 1OL5A 4HCTA 2VO3A 4FT0A 2W1GA 3ZO1A 3ZOSA 5A46A 2GS7A 1QL6A 2HAKA 2WTKC 3QTRA 1WBVA 1PJKA 2C6KA 2Q0BA 4NUSA 3RPVA 4LGHA 4GKHA 4G6LA 4F0FA 2XKEA 3ZFXA 3Q9ZA 4MH7A 4DFLA 4OTPA 3PWYA 2ZMCA 5DGZA 2PZRA 4JX3A 4OAVB 4Y95A 3RGFA 2HCKA 3BU6A 3M2WA 3UOHA 3NFFB 4DT8A 5AM7A 2VWIA 5IDPA 2C6OA 1FMKA 1JSUA 3WF9A 3AC8A 5J95A 2R3GA 2XA4A 3EFJA 2PVRA 3E87A 3GB2A 3LVPA 3QKKA 3MH2A 1OI9A 4EJNA 4K77A 3PY3A 1UNGA 5ACKA 4DLJA 3BWFA 2FSLX 3O50A 3H9OA 3TNQB 3GC0A 3OT8A 1RQQA 4OTWA 4QTDA 2WU6A 5AR3A 5IQFA 4PMMA 3IONA 2BFXA 4AGCA 4EQMA 1M7QA 3CIKA 4QP2A 2BTSA 3EMGA 2QOFA 2VX3A 3NLBA 3ZLWA 4H1MA 4CV9A 3HRBA 4YLLA 5LCKA 3F7WA 2R3KA 5CQWA 1IASA 5AV0A 3E7VA 3MSSA 4FEWA 3EQCA 3CPCA 5IH4A 3WZKA 1Z9XA 4ZS4A 5CY3A 4RFYA 5ETAA 3VF8A 2W1HA 2VN9A 3DK7A 3QQHA 4GL9A 5CSWA 4EORA 4WSYA 4ANMA 3TUBA 3MY1A 4RJ7A 3U4UA 4RC3A 2I0HA 3BZ3A 2QD9A 3O71A 5D1JA 3OWPA 5D7VA 5CAOA 5F9EA 3DA6A 5A4LA 3OCGA 4BJJB 5L6OA 2PE0A 4A9UA 1PHKA 3AQVA 5L8LA 2NNWB 5M09A 4AQCA 1JKKA 2J0JA 2PMOX 3LFBA 3P1AA 3LJ0A 4C58A 1OIRA 5LVPA 4MXXA 4OAUC 4DE4A 4U42A 3I0QA 1M2PA 2ZV7A 1K2PA 2UZBA 3K3JA 5HE2A 4HYSA 5DEWA 3FLQA 2R3JA 1IAHA 2EXCX 4ZSJA 4WSQA 4WD5A 3I5ZA 5M55A 5EG3A 5CF4A 3QRTA 5IEVA 5HO6A 2PTKA 5CEKA 3IG7A 3O23A 3WZEA 4PMSA 4WNPA 4NTTA 3U4WA 3KREA 4XG9A 5C27A 4J97A 4MVFA 2Y0AA 3R7GA 4W4WA 2OJJA 4AN3A 4O7NA 4ORKA 2ETMA 3UOKA 3QCSA 4B0GA 4CT2A 4DA5A 2J5EA 5I4NA 2PVYA 3NNUA 4FGRA 4FK3A 4XV9A 1J1BA 3LJ1A 4BDAA 1OMWA 4D4VA 4WG5A 5HG7A 3RK7A 2G9XA 1WFCA 2I0VA 3FMLA 5J79A 3LJ2A 2JDSA 3D7TA 5AR8A 3FHRA 4G5JA 4IWDA 4CTBA 4TYHB 3DK3A 3OZ6A 1XBBA 4R3RA 4HW7A 4O82A 3EYHA 4NCTC 3QQKA 3BRBA 3FI3A 4EHGA 2XEZA 3Q4UA 3P08A 4KUJA 4Y73A 3VS4A 4CRLA 4GJ2A 4AW5A 2YFXA 4N6YA 1J3HA 3S1HA 4NKAA 3F2RA 4PDYA 3VUHA 5B7VA 4FTAA 4GK4A 2XNBA 3NSZA 4ZOGA 4YC3A 4DH8A 3U6HA 1WVXA 2VTHA 3NGAA 4NM0A 4D5HA 1E9HA 2FO0A 3KC3A 2W5BA 3C0GA 3MPTA 3JY9A 3QD2B 2XP2A 5KZ0A 4AAAA 4CLJA 1ND4A 3ERKA 3PPJA 3PDTA 2O2UA 3A7GA 4C4IA 3ALNA 3K5VA 3VQHA 4EONA 2WU7A 3TKUA 4FV8A 5K0KA 4C37A 3KXHA 5JZNA 4UWYA 4XOYA 4PL3A 3ZM9A 3FZ1A 3IECA 3R1SA 4WUNA 4D5KA 4A9TA 2IEWA 1M7NA 2B9FA 4F7SA 4K9YA 4APPA 2GQSA 4WNMA 4RJ6A 2BALA 2HYYA 2HK5A 2V7AA 2VAGA 2A1AB 2G2HA 4QP6A 5EDPA 1URCA 3C50A 1JKTA 3A2CA 3MW1A 2RFEA 2ITUA 3NAYA 4LV8A 3VS0A 2YLFA 4W9WA 3LFAA 5CF5A 4CZTA 2J5FA 3ELJA 4IHPA 2BAKA 2UZNA 3O0GA 4OT6A 5B0XA 5A14A 3DS6A 2WQEA 2XANA 4QDVA 3ML1A 3M42A 3P7AA 4AG8A 2R64A 3QCXA 4WBOA 4D55A 2AYPA 2HZ0A 4FUYA 3REPA 4BBFA 2QU5A 5AUWA 5AR2A 2VWWA 2PZIA 2J0KA 4M69B 5L4QA 2V0DA 3DK6A 2RF9A 4I6QA 1OPLA 4ACHA 3FYJX 5H8EA 4CXAA 4FV9A 4MXCA 4E73A 5JQ8A 5HG8A 4QMYA 5LXMA 2B7AA 5AMNA 3R8LA 5A6NA 3R83A 3I60A 2V7OA 3MTLA 3R71A 4FBXA 3COMA 4P5ZA 3AD6A 3TM0A 3AKLA 2YM5A 3V6SA 1ZYLA 4NTSA 4F99A 4C33A 3R7VA 4Z3VA 3E88A 4R8QA 4XRLA 1GZOA 3HL7A 3R0TA 3L1SA 1G8SA 2QO7A 2XIYA 3ACJA 2GU8A 2OFUA 1UU7A 3QC4A 4D4SA 3HUCA 2F7XE 1GIIA 4DFZE 4HVSA 3A7HA 4PRJA 1KE8A 2QOCA 1V0BA 3BCEA 3UIBA 1PKDA 4K18A 4RWJA 4TNDA 2JKMA 5G1XA 4CKRA 1G8AA 3QCYA 4IDTA 3QWKA 2BDJA 4V0GB 4QMOA 4AX8A 4QTAA 2OJIA 4PF4A 3VHKA 4IVAA 5HNGA 1W83A 3OEFX 2YM7A 5IKWA 4BI2A 4DEIA 3PA5A 3UVRA 2WMAA 5A4QA 4W4YA 3PLAE 4TWPA 5J9ZA 4RIWA 1Q3WA 3DJ6A 2OIBA 3EB0A 4DITA 4L3LA 1KE5A 4WRSA 2FSTX 5EM5A 2C30A 2YDJA 1Q8YA 5D11A 3R9RA 2HXLA 4CFUA 2O65A 3VF9A 4M15A 4GG7A 3V8TA 3LMIA 5EQPA 3CS9A 5AP0A 5EQYA 5FTGA 4G3CA 5FEEA 4U8ZA 3SVVA 3FY0A 5J7BA 5JK3A 1FVRA 2X0PA 1CTPE 4NSTA 5DR6A 3ZO4A 1ZYDA 3EN6A 4IM2A 1F5QA 3U8WA 2J0LA 2JDOA 3HMMA 2PE2A 3G90X 4O0UA 4I92A 3MIAA 3DNDA 1OITA 3R00A 2IW6A 1NVRA 3RALA 3CTQA 3CTJA 2CGWA 2OG8A 3LFCA 5IH5A 4O38A 3FPMA 2JITA 5L6PA 3UG2A 3SAYA 4UWBA 2PY3A 5CEIA 4EKLA 4TWNA 5LVOA 3MS9A 4E6QA 4E4MA 2GS2A 3IQ7A 2XK7A 4G16A 3ZFMA 2XIRA 3VUMA 2FYSA 3KFAA 1PXMA 1U54B 1UV5A 3EFKA 3LFEA 1OL7A 2FB8A 2G01A 2G2IA 2W1EA 3MFSA 4G9RA 4RSSA 3GFWA 4BVUA 3I4BA 4O1PA 5C9CA 3D7ZA 4UY9A 4U43A 5KMIA 4X2JA 1YQJA 2W5AA 4YSJA 2OU7A 2R3RA 4FI1A 4JDHA 3UP7A 5CSXA 3W8LA 5DR9A 1ZXEA 4L8MA 3DDQA 4G31A 4L44A 3ZEPA 2PUPA 4KS7A 1H07A 1H27A 1ZZLA 3KCFA 4GUEA 4TYGA 3ULIA 4DGOA 1VYZA 3OWKA 4RMZA 1ZYSA 3UZRA 4U3YA 4D0XA 4RLLA 3TNPC 1XH8A 3R6XA 1PMEA 4G34A 4JI9A 3KCKA 4CFVA 1ZYJA 2Y6OA 2WTWA 4LL5A 1YHSA 4IW0A 2E9PA 4U0IA 4V05A 2BIYA 3QQGA 4QQ5A 5L2QA 5HTCA 2CPKE 4IMYA 2OF2A 1ZOHA 4D2PA 4CFWA 2YLEA 4KS8A 4UYNA 4YJSA 4DN5A 4X0MA 3Q2MA 2QNJA 3HGKA 2XF0A 1R0PA 2W06A 5FG8A 2XB7A 4YNOA 3ZEWA 5BVDA 1LEZA 2GS6A 3FEGA 3QBNA 3D9VA 1ZMUA 1E1XA 4BCJA 5AP7A 3U6IA 5I5ZA 2BKZA 2XNPA 3KVXA 5DHJA 4C7TA 3RWPA 1FVVA 5EKNA 2DQ7X 3RVGA 4FSZA 1KV1A 1TQMA 5FTQA 3JS2A 5HCZA 3P7BA 4FV5A 4KBKA 3W0NA 4X21A 3PXRA 1HCKA 4WA9A 4L00A 4UX9A 4EJ7A 4QNYA 5CX9A 5HIBA 5HE3A 5HVYA 2XM9A 3R8VA 5KMKA 4EZ3A 3T9TA 2OJFE 1IAJA 5HLWA 2QODA 3D5UA 4BN1A 1VLRA 3VUTA 4FKWA 3LXKA 3NUYA 4BDHA 1A9UA 3HYHA 4ITHA 4O4FA 3VS7A 4RIXA 5JQ5A 5ETCA 1OGYA 3CJFA 4YJRA 2YHVA 2XRUA 3M1SA 5LMKC 5D9HA 1ZWSA 4I4FA 4ZTSA 1JNKA 1BX6A 3F9NA 3W2OA 4A4OA 4UXQA 4YGAA 3DGKA 3R7EA 2Z7LA 3HP5A 3HKOA 1NVQA 3A60A 4QOXA 4ZSEA 3LXPA 2JKKA 4CFMA 4BCGA 1BMKA 3KGAA 4FSRA 4RJ3A 5ANJA 5I0BA 2Z2WA 2ITOA 4HNIA 3TCPA 2W96B 5J9LA 5H2UA 4UXLA 2G15A 1BI8A 3OF0A 2J50A 5E90A 1HCLA 4G3GA 4RT7A 2WIHA 2HENA 1VJYA 3EFLA 3MA3A 4IACA 4K33A 1J7LA 2E9NA 3PLSA 1PXPA 2GCDA 2R2PA 4PTEA 2IVVA 3Q5ZA 3NWWA 2Y4IC 3FXWA 4FV2A 2X8IA 4B9DA 4BIBA 2JD5A 1UA2A 5EI8A 4F6SA 5JFXA 4KKGA 4DH5A 2ITZA 5AAEA 5AP6A 2ITPA 4FIHA 4PDOA 5CZIA 1OUKA 5IA2A 4BDGA 5AJQA 1U46A 2VD5A 3KRWA 3Q6UA 3GGFA 3LCDA 2AQXA 3MI9A 4FGBA 4HVDA 2B55A 4QO9A 5DRBA 3VULA 1DAWA 3KXNA 4I0TA 4DDIA 4E6CA 4X3FA 3ZXZA 4Z9LA 3BE2A 1H28A 5AX3A 3UVPA 2PL0A 5L2TA 4X7QA 3GCSA 1Z57A 3GU8A 3DT1A 4PWNA 1BL6A 5EM8A 4HJOA 4LUEA 3EL8A 3POOA 2QG5A 1W8CA 2Y8OA 2P0CA 4FODA 1K9AA 1DI8A 3I5NA 4AT4A 2ZFYA 3ULZA 4XYFA 4FTMA 3LXLA 5IA4A 4A06A 3IGOA 3PPKA 2WQBA 1KE6A 5HIEA 4MNEA 3ZBFA 3TL8A 4BCQA 4IDVA 3C4FA 5KNJA 3D94A 2CKEA 3BWJA 4EH8A 5DE2A 2C5OA 1PW2A 3W0PA 4DEGA 5J9YA 3F7ZA 4ID7A 3RPOA 1BLXA 2XCHA 3ORIA 4HGEA 4YSMA 4BC6A 4U6RA 4ZZMA 3W2RA 2PZYA 3VS5A 1NY3A 2UW8A 2GQRA 1F0QA 1H25A 4OW8A 1YI6A 5LVNA 3DXPA 4X2FA 3MJ2A 4WNKA 4BICA 3RMFA 3WI6A 4ANSA 2YERA 5DWRA 2WAJA 3LFFA 4ASZA 1P5EA 4I41A 4RWKA 4K2RA 4FSWA 1WVYA 4JVGA 4AA5A 1DI9A 3WIKA 2NRUA 5CALA 4MKCA 3FHIA 1RJBA 3RNIA 2Q0NA 4RA4A 4QMLA 1W2FA 4RGJA 1WBSA 3RI1A 2VTAA 2YN8A 3FZTA 3AC5A 3HZTA 2QLQA 1UU8A 1XH6A 2C6MA 3L8VA 3QA8A 3KKVA 3N9XA 4LL0A 4RC2A 4UZDA 4YHTA 5C4KA 4BBMA 5IQDA 3FMDA 1Q8ZA 5EW9A 3K3IA 3MPAA 2R3OA 4AXEA 1Q99A 3LHJA 4FSUA 1TQPA 2EUFB 3NUSA 1FGKA 3DBQA 4FYNA 3HLLA 4XBUA 4DC2A 3HMIA 4DTKA 3L8PA 4DTAA 3MDYA 4NK9A 4O0VA 5IA5A 3W1FA 4R7BA 3UNZA 3RHKA 5DBXA 3FPQA 5FD2A 2W5HA 3IPHA 4X6QC 1M2QA 4TWCA 4YUQA 5CF8A 5IUGA 3EQDA 1WBTA 3SOAA 4J99A 3S0OA 2YACA 1IEPA 5CAVA 1OIYA 3OTVA 2V5QA 4I94A 4Y83A 5HBJA 1G8KA 3PYYA 3LQ8A 4ZLOA 3GQLA 3PZHA 3UQFA 3VN9A 4KNBA 4KBCA 3ODYX 3PJ8A 5HO7A 1OKZA 1AGWA 3TDWA 5AR5A 1J7IA 2O3PA 1CMKE 1P14A 2QOHA 3IOPA 3QRIA 4FTJA 4MD9E 3UTOA 3ZCLA 4DCEA 2EU9A 3HRFA 2AC3A 4Z7HA 4FEQA 4NW6A 3OW4A 3EWHA 5I9WA 5IA3A 3R8UA 3GQIA 3CEKA 3V8SA 2XKFA 4RJ4A 4M3QA 4LI5A 4M84A 4C4JA 3E62A 3C1XA 2XH5A 3NCGA 5CENA 5A4TA 2B0QA 1FINA 1TZDA 2W0JA 4I1ZA 2X0QA 3NCZA 2XNOA 2XAOA 4YZDA 3SXSA 3HRCA 2J9MA 3NNXA 1OECA 2WELA 3R9HA 2BUJA 2J90A 4KIPA 3EN4A 3DAJA 5FXSA 2CKQA 4M97A 1GOLA 2Z8CA 3DKGA 4I6FA 4G3DA 5HE0A 2NYAA 4NW5A 3EKNA 4F6UA 1Q41A 3F5UA 2UZWE 5CAUA 3NVMB 3W0RA 3NX8A 4R1VA 4DYMA 5BYLA 2YIWA 2Z7QA 2PMNX 3AC3A 5DRDA 3FC2A 3CJGA 3MWUA 2VTIA 4YJOA 3V01A 4RVMA 1Y57A 3PP1A 3GVUA 3PJ1A 3EN7A 4PDPA 4ACGA 4AU8A 2UVXA 2WQNA 4BCPA 5E8UA 5DNRA 5AA9A 2IO6A 4Y5QA 2UVZA 4QDEA 4HNFA 5FEQA 5EFQA 2JBOA 3PY1A 3NW7A 3ZLSA 4O0TA 1Q62A 3D14A 3QCQA 1MUOA 4LRMA 3OG7A 4O7WA 1QCFA 4UMUA 2C0OA 2ZB1A 4N4SA 4EH5A 3TV7A 1XWSA 4RIYB 3E8CA 5J1VA 3TN8A 3MFRA 3PG3A 3EFWA 3L9NA 3OOGA 3Q4CA 2W99B 3MH0A 4FSMA 4FZAB 4LOQA 5EOBA 1KOBA 4MWHA 4Q5EA 1STCE 3F61A 3G51A 5M07A 3D5VA 3HV3A 2CNQA 2F4JA 5IQIA 3MIYA 5M08A 4PDSA 4AXDA 3OEZA 2XBJA 4GRBA 1R39A 3BQCA 4G6OA 4CQGA 2X8EA 4L46A 1PMUA 1BL7A 1PY5A 3CC6A 3OC1A 2XK8A 2F2UA 4FTLA 1CKIA 2PUUA 4N6ZA 2YEXA 3FSFA 3DKOA 4IX3A 3QRKA 4JDJA 4JT3A 4RRVA 3AD5A 4TYEA 4W8EA 4WG4A 4WOVA 3R7YA 1QMZA 4D58A 4GIHA 1OPJA 2OFVA 3MV5A 4HYHA 3NFGB 4ANLA 3P23A 3KRLA 3EQPA 4D1SA 2YAKA 3BU3A 3SRVB 3FMHA 3UDBA 1A06A 4AP7A 3SLSA 3LCSA 4HOKA 4GT5A 3MH3A 4FMQA 1U59A 1Q24A 2P2HA 1JKLA 2ZJWA 5AIRA 1OL1A 3BPRA 3DAEA 3SD0A 2UUEA 4UBAA 3F3TA 4D1XA 3UOLA 5EI6A 4PPBA 3AKJA 3UP2A 3F5GA 2F49A 4XHKB 3RM6A 3V5WA 2BFYA 3DFCB 2O0UA 5DA3A 2XNMA 5EYCA 3NIEA 5GHVA 4FNYA 5IMXA 3LMHA 3FC1X 4MF1A 3UDSA 2F9GA 2XKCA 3SC1A 5LWNA 1WMKA 2A4LA 4M14A 2X2MA 3FZPA 5K5XA 5C03A 2VO0A 4E8AA 1P2AA 2JAVA 4JR3A 4C4FA 2VNWA 1UWHA 2UW9A 2VWVA 2X7GA 2YM8A 4EH7A 4BJJA 3ZSGA 3PJ2A 2UZEA 3GCQA 4BCOA 4EOLA 3P78A 3HDMA 5DYJA 5HI2A 4MBJA 3FL5A 2C0IA 1H1QA 5AWMA 3NAXA 1OIQA 4B4LA 4XUFA 5EM6A 2YZAA 5CU2A 2R3MA 4N0SA 3S00A 2WHBA 3TDVA 1PXJA 2A27A 4MUQA 5JGDA 5IUHA 1IG1A 4GS6A 4EK4A 1FQ1B 3IDBA 5JFWA 5DG5A 2WNTA 3DKCA 5CEMA 4GFOA 5K4IA 1CSNA 3PJ3A 4NFMA 3ZONA 4FICA 4IFCA 4JG8A 3ZYAA 2YIXA 4GV1A 3BYVA 3C13A 3COIA 1K3AA 2QHNA 3ODZX 3Q9XA 4RA5A 4V04A 5AP3A 3A99A 4TZRA 2BROA 1ZMVA 3W16A 3DBFA 4MYGA 3EYGA 4JBQA 1WBOA 2HWOA 3F3VA 4JLCA 5LQFA 3NUXA 2J4ZA 1ZOEA 4NJ3A 3I81A 3PVGA 4DTBA 3A8WA 2R3PA 3N4UA 5BVFA 1UWJA 4TYHA 3GNIB 4EHEA 3C4WA 4FKJA 2B52A 3E7OA 5DN3A 4CCUA 4EEVA 4U79A 2QCSA 3BEAA 1GY3A 1OL2A 1J91A 2R3FA 4JG6A 1WBPA 1R0EA 4O6LA 4IVDA 2Y4PA 3BGQA 4CYIA 5AAFA 3LAUA 4ANNA 4DHJA 2IZUA 2PU8A 3R04A 4BRXA 5JFSA 5BVKA 4O7ZA 4E3CA 4O7TA 3RKBA 4AOIA 5CVGA 4ZAUA 3AXWA 4ENYA 4FRFA 4GSBA 1IRKA 2NP8A 3V5QA 2CN5A 3BU5A 5E1EA 5AFVA 1Q8TA 2YITA 3C51A 3QQJA 2UW7A 2W7XA 5DIAA 5LVMA 4XG2A 4DGMA 1KE7A 3QUPA 3V8WA 4ZY6A 3RTPA 1P4FA 2WMTA 4C57A 4AA0A 2IF8A 5E92A 2ZV8A 5CXZA 2ACXA 5LOHA 4O84A 4IXPA 3SXFA 4RX8A 4BCNA 3MBLA 4I4EA 4IZ7A 2ITYA 4FC0A 4O96A 4KIOA 4FKGA 4ZTLA 3LLAA 1BYGA 3QZGA 2HZNA 3NW5A 5C26A 3LXNA 2BPMA 3PSDA 3AT4A 5HBHA 4AW1A 3OHTA 3RINA 3ZZWA 2E9VA 4F6WA 2HY0A 4FV6A 5CT7A 1MP8A 1PXNA 5DVRA 4YLJA 3BL9A 2CCIA 3VWAA 4O6EA 4D28A 4L68A 2Z7RA 3GXLA 2BIKB 5E8ZA 4DG0E 5IG1A 2WD1A 4XG6A 2WMQA 3ZRKA 1YOJA 4IZAA 4RX9A 3LZBA 5ANGA 5TOZA 2X2KA 3FE3A 4IM3A 1TQIA 5HBEA 4O7SA 5M06A 3C0HA 5J7HA 3LPBA 4M69A 4FEUA 5LJJA 1H00A 2PZ5A 2WTJA 3Q3BA 3EIDA 4HPTE 4XBRA 5EYKA 3WOWA 3R1QA 3O17A 4JL9A 5K0XA 3UPXA 3F82A 4GH2A 5AP5A 3H9RA 3QTUA 4CD0A 5BUIA 3AMBA 3UQCA 5AEPA 3WF5A 3DJ5A 1GZ8A 3UODA 2XNEA 3OROA 3IW5A 3QUEA 4FIJA 5AIKA 2A2AA 2CJMA 2IJMA 4E4XA 5T3QA 4UN0C 4ONAA 4XP0A 5EQEA 5CLPA 3DXNA 4G5PA 1XMMA 3UG1A 2XNGA 4ZSLA 3PZEA 3R7UA 3OS3A 4ALVA 5B2MA 2WTDA 2PMLX 3P86A 2VTQA 3UIUA 4CG8A 3WBLA 5AP4A 3ORTA 2WMXA 3HUBA 4OTGA 3G2FA 2ZM1A 4GT3A 4O21A 3OWJA 2ERKA 5AR4A 4ACMA 4AXFA 2V55A 4XV3A 4MEDA 4E26A 4FT7A 1Q8UA 2WMUA 5AADA 2CNUA 2WZJA 3GU7A 4V0GA 2ITWA 1I09A 3GCUA 4JQ7A 4LUDA 4NH1A 5BVWA 2PYWA 3GOKA 3QL8A 4S31A 1WBWA 4Z16A 3FKNA 3TXOA 4EBWA 3MGYA 3CXWA 3E63A 1KUTA 4J96A 3U9CA 3COKA 4AS0A 2QKRA 3FZRA 3EQIA 4U7ZA 4XJ0A 4R77A 3W2SA 2GTMA 1ZZ2A 2ONLA 3AC1A 3PXYA 4QYFA 4KIKA 2CLQA 1WVWA 3TIZA 4JJRA 1B38A 2QOOA 1SVEA 3HEGA 4JRNA 4YZ9A 4IX6A 3TV6A 2YDIA 2NO3A 1CKJA 2HZIA 3PUFC 2VTLA 3LE6A 4OBOA 4OUCA 4AT3A 3Q2JA 3HAMA 1ZARA 2GNHA 3GI3A 4JR7A 1SM2A 5HICA 2VTNA 2XCKA 3C4XA 2B1PA 4DBXA 2C4GA 3Q04A 4JNWA 3E8NA 2J6MA 2QOKA 3BE9A 4PMTA 2GHMA 4IB3A 1B6CB 4RPVA 4F4PA 3GC7A 4Z7GA 3DLZA 3D2KA 3ZDUA 1ZY4A 4BCFA 3VUKA 2X6DA 3G9LX 3IW8A 3NPCA 3BBWA 5HOAA 3TZMA 2UW4A 4QMNA 4E6DA 2OI4X 4BIDA 4NU1A 4PP9A 5CVFA 5HNBA 4IEBA 4JRVA 3T3UA 2XYUA 1U54A 4RLKA 4B8LA 3QQUA 2C47A 3S95A 5EW3A 4HGTA 2BHEA 4BDDA 1NT2A 5J5TA 2WTIA 3GT8A 5D10A 5GJFA 5LCJA 3N4TA 2BZKB 1GZKA 4YMJA 3O5AA 5KMLA 2QOQA 4S32A 3C4EA 4FUXA 4QYGA 5ANKA 3R7OA 1QPEA 4RBLA 3WF6A 1YI4A 4FT3A 3C4CA 4FSNA 3KF7A 1R78A 3IGGA 4B6LA 4XG7A 3C5IA 1APME 3WARA 3RCDA 3II5A 2VTJA 4BHZA 3R30A 4YTIA 4YJUA 4BFMA 3VBVA 5E9EA 3PTGA 5IA1A 4GEOA 5M4UA 3HMPA 3E64A 3R01A 4F78A 2LAVA 3IS5A 4EC9A 5KO1A 3KMWA 2P2IA 1YOMA 2YISA 4H3PA 4O0XA 4AGUA 4AZSA 1J1CA 4FIGA 3VONA 1YWRA 3AT2A 3WF7A 1JLUE 1MRVA 2DUVA 4TYJA 4RQVA 5CF6A 2XIKA 2QURA 2OXDA 3KXMA 4KRDA 4OBQA 5AP1A 3G6GA 3ZTXA 1YXXA 3ORZA 3R2BA 4QQJA 3QQLA 4JIAA 3ZU7A 3OY3A 4FKPA 4KIKB 5HCXA 4N57A 4ITIA 4PL4A 4QPAA 4ANQA 1Y8GA 4G6NA 3RHXA 2H34A 1ZOGA 5M51A 3G5DA 5CEQA 3MVJA 1RW8A 3VHEA 4AF3A 3KA0A 3WE8A 5E8VA 3EQRA 4IAAA 5ETIA 4ZTNA 4O0WA 5CXHA 2JKQA 4O86A 2W4OA 3QGWA 4YLKA 3OCBA 3LKMA 4Q5HA 5AV4A 1DAYA 3PXFA 5J8IA 5GIOE 4F1OA 2G2FA 3OCTA 4UMTA 5L6WL 3UMWA 3QD4A 1V0OA 5K9IA 4AZWA 3PP0A 3HV7A 2PVJA 4O1OA 5M53A 4NYEA 2I1MA 4YC8A 5DI1A 4L01A 5EW8A 1SYKA 2XUUA 3DFAA 4BCKA 4U3ZA 5BMMA 2IW9A 5FWKK 2Y7JA 5HQ0A 5KUPA 2ETKA 4R3PA 4AGDA 4DH7A 4I3ZA 3QRUA 4QQCA 4D2SA 3E93A 2WMRA 3A62A 3KULB 4ZTRA 2QVSE 4EZ5A 3R73A 4QYHA 2C6IA 4CTCA 1XQZA 4D4RA 2C3LA 4O2PA 1ZLTA 3TT0A 4AAYA 4P5QA 4FYOA 4I93A 2R0UA 4M68A 4XX9A 2NRYA 4G2FA 2GNLA 4RVLA 5FBOA 3POZA 3TZ7A 2XAMA 2X9EA 4CSVA 3F69A 5HLPA 2FUMA 3DV3A 2BKKA 2XK3A 4QPSA 4YP8A 1OPKA 4TPTA 3TMOA 1H8FA 2BRGA 4JIKA 4GW8A 5I9YA 2R3QA 3DPKA 3Q60A 4M7IA 3GC8A 4ZEGA 3OXIA 4AW0A 4BDJA 3ROYA 5ITAA 2ITXA 2PK9A 4AGWA 1MRYA 4FKLA 2PZPA 4IX4A 4I24A 3SHEA 2V22A 2HELA 3E5AA 1GNGA 3RZBA 4CGAA 3QD3A 3FKLA 3LFSA 4AOTA 3QRJA 3KRRA 2VWUA 2BDWA 2UW6A 5HO8A 2OGVA 2W4JA 4ZSGA 3CE3A 3F2AA 4PQNA 4FA2A 4R5SA 5TO8A 1OIUA 4IAKA 2IN6A 2ZAZA 4IE9A 2BZHB 3ZC6A 3KK9A 1F3MC 2CDZA 2VTMA 4S30A 4DEBA 4IC8A 4BDEA 5JN2A 3Q32A 4Q9SA 3CD3A 3HP2A 4GFMA 4E5BA 5BVNA 5HZNA 2WMVA 4JMQA 1WAKA 4X2NA 4TY1A 2WXVA 4YJVA 2IWIA 2Z60A 5E1SA 5BNJA 2X0GA 4A9YA 2W1ZA 1O6KA 2X39A 3Q53A 3CQEA 5AM6A 5I9VA 4L67A 4QP4A 4IANA 2XNNA 2RL5A 1TKIA 4GU9A 4X3JA