3OHTA

Crystal structure of salmo salar p38alpha
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
348
structure length
331
Chain Sequence
b'ERPTFYRQELNKTIWEVPERYQTLSPVGSGAYGSVCSSYDVKSGLKIAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPASVISRMPSHEARNYINSLPQMPKRNFADVFIGANPLAVDLLEKMLVLDTDKRITASEALAHPYFSQYHDPDDEPESEPYDQSFESRQLEIEEWKRLTYEEVCSFETP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords p38a
publication title p38alpha MAP kinase dimers with swapped activation segments and a novel catalytic loop conformation
pubmed doi rcsb
source organism Salmo salar
molecule tags Transferase/transferase inhibitor
total genus 95
structure length 331
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ohtA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ohtA01
2H9VA 4QP1A 4OAUC 3NVMB 3Q04A 2XEZA 4J98A 4KNBA 3R83A 2YEXA 4D2RA 3QQKA 2PMLX 3TNIA 3IOKA 4QP4A 4X2FA 3TL8A 3TEIA 5IQBA 3KY2A 4FEUA 3OFMA 2XNGA 2ZV9A 4PL5A 5CXZA 1K9AA 3Q53A 3LFFA 4F9CA 2IZSA 4DITA 1Q8YA 3ZSHA 4JG8A 3FMNA 4L8MA 3C4ZA 3VF9A 4EQMA 3R1SA 5AJQA 5ETIA 3C7QA 3CBLA 2YN8A 5EYDA 5DH3A 4HVIA 2CGUA 4UEUA 4DCAA 3Q6WA 5HU9A 4I0SA 4MTAA 4AZVA 2QKRA 2XRUA 4I5PA 4JR3A 4ASXA 4DFXE 2WMBA 5CAVA 4NKAA 3DY7A 3BYVA 1FBNA 3U8WA 3GCQA 2OGVA 4B4LA 5IA1A 1XH6A 5IEVA 4CG9A 3LQ5A 5CAQA 1JQHA 4WKQA 4HCVA 5L3AA 2PUIA 3NYOA 4MCVA 3VAPA 4OLIA 4IZYA 1B6CB 4F7SA 4DA5A 4NM7A 2WO6A 4FTTA 3EN7A 4IZ7A 2YLFA 4LI5A 2BR1A 4RQVA 1J7LA 5ETAA 5IISA 4IM2A 4MXXA 3M1SA 1EH4A 4LOPA 4AXAA 5HLWA 3EQRA 4IVAA 2X9EA 5EQEA 4RWKA 2JKMA 4WG4A 3KXZA 3DLZA 4GJ2A 4AE9A 4IB5A 4J99A 1SNXA 2C6OA 2R2PA 5DT0A 3ZC6A 4C34A 4DBNA 4DG0E 4Y46A 5FRIA 5K4IA 4ZS0A 1YWRA 3IGGA 4R77A 2GNGA 4LGHA 3SDJA 3MB7A 5ANIA 1CM8A 2G9XA 2VRXA 3AD6A 3JPVA 5HVYA 1M17A 4D5HA 3UDBA 3HL7A 2VO6A 4BICA 4DG3E 1PYEA 2UW8A 5F4NA 4MHAA 2I7QA 4A9UA 1ZZ2A 5AV2A 5IQGA 3LFSA 4H1MA 5AAFA 3RKBA 3MFRA 3NIEA 1M52A 3LCOA 5E1SA 3ZLWA 1R0PA 3ZZWA 4LMUA 4KS7A 3MVJA 2FVDA 2P0CA 3OUKA 3Q9YA 1U4DA 3E93A 4FV7A 4AA0A 5JZJA 1GAGA 3ZOSA 1NVRA 2YERA 2WTDA 2Y4IC 4OBOA 3HRFA 3DAJA 4CYIA 4J8NA 2QKWB 4KSQA 3R8UA 4A9RA 2NP8A 5IQFA 4DHFA 2CN8A 4IFGA 3LFCA 4ITJA 1OMWA 4I20A 4QTAA 5CNNA 4YSJA 3COMA 4GK4A 4NSTA 2C3IB 3PG1A 3R1YA 4O0WA 3BRBA 4WG3A 5KMOA 4BDCA 4XLVA 5HQ0A 4AOJA 3PXKA 3SOCA 3Q5ZA 5CENA 3FY0A 5IUIA 3S95A 2ZYBA 3MPMA 4I24A 5HE2A 5DRDA 2QOFA 2G2IA 4F1OA 3PFQA 1MUOA 3UVQA 4A9TA 4KS8A 3ALOA 3DBDA 2UZUE 2JDTA 2XK9A 4F0GA 3IECA 4TNDA 2WQMA 3K3JA 3FQSA 2WU6A 3GI3A 4PPCA 5FUTA 4QRCA 3U9CA 4EOLA 1ZY4A 4N0SA 2BCJA 3R7UA 1QPDA 5BPYA 3UQCA 4FKIA 4XHKB 5HLPA 3PXRA 5HG9A 5HBHA 5EDQA 2WMUA 4MD8E 1JPAA 4FTOA 4PTCA 4Q9SA 3D14A 3FXXA 3QCSA 4X3FC 4BGHA 3W2RA 4C4EA 2WOTA 5C8MA 3QGWA 3PLAE 4QP3A 4FG7A 3EQHA 3HDMA 3VBYA 4E4NA 2CGXA 2YACA 2J51A 4TYHA 1P2AA 1WBOA 3RJCA 3LOKA 1K3AA 3OBGA 4BDJA 3B8RA 2B9HA 2G2FA 3II5A 3VUHA 4F6WA 2XKDA 3MFTA 3LHJA 2PZRA 4LMNA 5HTCA 4DEIA 3NNWA 5ANDA 1E1XA 4AN9A 1WFCA 3IS5A 4YJNA 1IEPA 4Q2AA 5KKRB 1LEZA 3BE2A 3SV0A 1XBAA 4EH8A 2PVFA 4WBBB 4AA5A 2BVAA 2OO8X 4FV1A 3SXSA 2X1NA 3V3VA 1NA7A 3FLYA 4KIQA 2BZHB 3DK7A 3VUMA 4FR4A 3D94A 4BCKA 4CLIA 3P7CA 3R7VA 4H1JA 3FZSA 4XX9A 5JMSA 4BYJA 3ZUTA 3O2MA 4YZ9A 5HLNA 4FK6A 4L53A 2YM7A 1BI8A 4L67A 4EWQA 3GBZA 4FOCA 5C26A 4TL0A 1WBTA 4IX3A 1MP8A 3PG3A 5KNJA 5KE0A 4ACGA 3R0TA 4X7QA 4ACDA 3FQEA 3MH3A 4YSMA 1XHAA 2BPMA 3C4FA 4PRJA 4U5JA 4A06A 2XM9A 3H10A 2E9VA 3FE3A 3LXKA 3S4QA 1BUHA 4BTJA 3D2IA 5DR2A 4DH3A 2VTSA 3U55A 5IDPA 2UW0A 4AWIA 3VS4A 1H1RA 3E7OA 1PMEA 4RWJA 3IQ7A 3U6JA 5ANKA 3QC4A 4EK6A 4QD6A 3IW7A 4HNIA 4OBQA 4ZZOA 4X3JA 1RDQE 4L3LA 5CAOA 3EN9A 3N4UA 2J9MA 3DJ7A 3ZBXA 3MVMA 4U41A 3RP9A 3LJ1A 3NYXA 5AUTA 4C57A 1XBCA 3WZDA 3H0YA 3U87A 3UG2A 5JN2A 1T46A 4CZTA 3Q9WA 2RIOA 4FTNA 3RZFA 3VC4A 2CPKE 3FDNA 3JVRA 5AFVA 4OTHA 4ANLA 4P7EA 4LV5A 1YDRE 3UOJA 1TQIA 5BMMA 3PPJA 4CCUA 5LVOA 4EK5A 4FTAA 1UU7A 2CN5A 1GZ8A 3QU0A 2Z2WA 4IHPA 4RMZA 3VBQA 3DXNA 3FXWA 5AP5A 2WQBA 2W9FB 3P0MA 4V04A 4YP8A 5I5ZA 2R3IA 4LOOA 5CU2A 4DN5A 4LL5A 4EH3A 2EWAA 4NU1A 4IB1A 2CCHA 3FI3A 3BEAA 4M84A 4MXAA 5HBEA 3FKOA 5CEKA 5K0XA 1YRPA 1ZZLA 4JDKA 4C8BA 5FXRA 4QQCA 2WTKC 2X81A 3AQVA 4FBXA 2GPHA 5E8SA 3SG9A 4L3PA 1MQBA 5M4CA 4J95A 3Q5IA 3QD4A 4U7ZA 2UVYA 4JBQA 3FSKA 4WUAA 3T8OA 5T3QA 3ZSGA 2X7OA 4C4HA 3M42A 5H8BA 3KMWA 3ZZEA 4FKGA 2E9OA 4Y5HA 4MXZA 3SGCA 1ZOEA 3F2NA 2UZLA 3R28A 5EYMA 2JDRA 2YM8A 3DZOA 3VIDA 2VWZA 1JNKA 3OVVA 3QL8A 5EK7A 4J96A 3HA6A 4CKJA 4EUTA 4H58A 1PXPA 3AT4A 3RM7A 2BKKA 3F61A 4IMYA 3EZRA 3UMWA 3VS0A 3W2OA 2IN6A 4HPTE 3ZUVA 1BL6A 1PKGA 4IX5A 4QNAA 4X2KA 4XJ0A 5HX8A 3I0OA 3DA6A 3D7ZA 4HYHA 5BVEA 4WNMA 4AS0A 5CSPA 4I4FA 5EDPA 4P4CA 3OROA 4EHZA 5CASA 5L2WA 4ALUA 3CGFA 5BQ0A 5IU2A 1YXUA 3GU5A 3TM0A 4O7RA 2PVNA 3RPOA 1H1QA 3B8QA 3PUPA 4J7BA 4KBAA 4TW9A 5HE1A 3TI1A 5K4JA 3P78A 3CE3A 4XRLA 3TNHA 4M15A 3WF8A 4E4MA 3OTUA 1GIHA 4O7NA 5FGKA 1UWHA 2VGOA 4EK8A 4EOJA 3BI6A 2V0DA 3QQLA 1MQ4A 5ACKA 4CTBA 4EOKA 2CCIA 2IVTA 3KXXA 4IM0A 2C69A 1R0EA 3JYAA 3FMEA 3LFAA 4M69A 4RC3A 4DEAA 4EH6A 4JDJA 4RIXA 4DGLC 3A61A 3PZEA 4Z7HA 1CKPA 3NUPA 4DTBA 3PPKA 4R8QA 4NW6A 1MRVA 4OUCA 3TNWA 4D58A 4K77A 4RVLA 2PMIA 1YOMA 3NAYA 3QC9A 5BVKA 4NFNA 4XG7A 4F7NA 3G6GA 4IAYA 2F4JA 1ZRZA 3DGKA 4USDA 2VX1A 3ODZX 4Q5EA 4X2NA 4U40A 1OECA 2I40A 4H05A 3PSDA 2C5VA 4G6OA 3ZS5A 3ORLA 1OPJA 1Y8GA 2EXCX 2BDJA 4IACA 3VF8A 3W2QA 3AGMA 4GRBA 4HVGA 3DFCB 4A4LA 4HCTA 4AT5A 2ZM3A 4XOYA 4FTRA 4GIHA 3DTWA 2XB7A 4MAOA 4YJPA 3JY0A 5CF5A 4AZWA 3V6RA 4ZTRA 5JK3A 4WG5A 3Q9XA 4FIFA 3BGPA 3EZVA 4FODA 4YHFA 3UC4A 5EKNA 4CFVA 1TQPA 5M53A 4QMOA 1OBGA 4IAZA 3RAKA 5AUWA 3UNZA 3RI1A 4FTCA 3V04A 5TO8A 4AGWA 5M09A 5LVNA 1HOWA 3SC1A 1J1CA 2R0IA 4AU8A 3R2YA 2YDIA 4I41A 4B6LA 4Q5HA 3O8TA 4RX5A 4V0GB 4NUSA 4ANBA 3COKA 3FJQE 3ROCA 3EMGA 4FA2A 1U54B 5JGAA 3F3WA 3QXOA 5KKRC 2YDKA 4XG4A 3DDQA 4E5WA 2WIHA 1PXMA 1QL6A 3TCPA 4PNIA 3VBVA 4EKKA 4FT3A 3FPQA 1YI6A 5FP6A 3C50A 1S9JA 1KV1A 3Q2MA 4U45A 2GNIA 5IQAA 3R00A 2ITXA 4WOVA 2CKOA 1QMZA 3FLWA 5IMXA 4FMQA 4BCQA 1W7HA 2ONLC 3G0FA 5HCYA 3ANRA 5K3YA 4A07A 2W96B 3H30A 4YJVA 4IWQA 2F7EE 1B39A 2WMSA 3G51A 1VZOA 5LWMA 1H27A 4XG9A 4YJUA 4A7CA 2DYLA 2VX0A 3F7ZA 3L8PA 2OBJA 2BZJA 3FHRA 2XNNA 4IADA 4BB4A 2W1FA 3OEZA 3FMHA 4ZEGA 3FI8A 3F5UA 1R39A 4FKWA 5CSVA 3ZTXA 3BWJA 2ITOA 3OD6X 5HO6A 2YISA 3EYHA 2AC5A 4E6CA 4YNEA 4ITHA 4EBVA 3EQCA 4ZK5A 2ESMA 4G6NA 3ZLSA 2XIYA 3NW5A 2YWVA 4G6LA 4RVTA 1H07A 3OUNB 3A60A 4FKSA 2C0OA 2OJFE 2W0JA 3KN6A 3OOGA 4FVQA 4IBMA 4XP2A 3RWPA 5JFWA 2HWPA 3ORIA 4RJ6A 5ETCA 3NX8A 2CJMA 2QO9A 3TTJA 3KREA 3EQFA 4OR5A 3F3VA 1XH5A 2RFNA 3D0EA 3JR1A 4C36A 5AA8A 5EG3A 4FSQA 2J7TA 5AP4A 1W8CA 4IX4A 4FL1A 2Z8CA 4EWHA 3U6HA 1UV5A 3R21A 3RHXA 4K0YA 4AX8A 3UMXA 4YHJA 4GCJA 4ZLOA 3V5JA 4YUQA 4PNKA 2PPQA 2QNJA 1QCFA 3QQHA 1ND4A 5EQYA 3OCBA 4IM3A 5D9HA 3EFKA 2G15A 5LMKC 3BYMA 2PE1A 1J1BA 3QHWA 3E8DA 4RSSA 4PWNA 4K1BA 2VTIA 4XBUA 2WD1A 4TWNA 3OWJA 2W1EA 2QOBA 3GFWA 3P23A 4IQ6A 4R7BA 5E8VA 4BBMA 1YXTA 1ZLTA 4YLJA 3TKIA 4D2SA 2RFSA 4ZOGA 1W83A 3IW5A 5J79A 3PP0A 4IH8A 3ZFXA 4BKJA 4FV6A 4FIGA 4RG0A 4NM5A 2H6DA 2NPQA 4RT7A 1Y8YA 5L8LA 2IPXA 4KINA 3CXWA 4JQ7A 1H08A 3MFSA 2PVJA 4D1XA 4D4YA 2EUFB 3GB2A 3CY3A 4PMTA 4C37A 4CQEA 4YZNA 3ENHA 4YJRA 4XG2A 3Q4TA 1YQJA 4FNZA 2XK7A 2Y4PA 4FZFB 1KE9A 2HIWA 4J97A 2XEYA 3VUGA 3KCFA 4FUYA 1KE7A 2IG7A 1I44A 2ZV8A 4QP6A 5IQCA 3NCZA 3S2PA 4WNPA 3CJFA 3LFNA 4O84A 3VULA 3I79A 4FYNA 2GNFA 4M14A 4TN6A 5GIOE 4O86A 4PMSA 2VTNA 1WBNA 4P90A 2FH9A 4PTGA 4HVHA 2BMCA 4AUAA 2WAJA 4FSMA 4ZTHA 2UW4A 5M08A 4M0YA 4JQ8A 3UBDA 4M7IA 2LAVA 2ZOQA 4ZSGA 5AUYA 1GZKA 1OKYA 4K33A 5DNRA 2JD5A 3H9FA 4QO9A 3F6XA 1IAJA 4FKRA 3ZH8A 1ZWSA 3P79A 3QKLA 3LMIA 3VJNA 2GHGA 1RJBA 3Q4UA 2PTKA 3MBLA 5KMLA 4RWIA 4DCEA 5HKMA 4FV2A 4X6QC 1WMKA 2FB8A 5CT7A 3R9OA 4QMQA 5IA3A 3BV3A 3O7LB 5AADA 4H3PA 5HHWA 3OG7A 4LFIA 2HCKA 1URWA 2WTWA 5DRBA 4IANA 4BKZA 3DS6A 5TF9A 4D1SA 4YZBA 4E1ZA 5KBQA 5DYJA 2RFEA 3NNVA 3R7GA 3CTHA 4TTHB 4YTIA 4F1MA 4EL9A 2WTIA 3BYUA 4GYIA 2YJRA 4Z7GA 4N70A 4Q9ZA 1PRYA 2P2HA 2Y7JA 5L6OA 5FM3A 4FSNA 3DLSA 3EKKA 3V8TA 2WQOA 3U54A 3IKAA 1CKIA 2J0MB 1LP4A 2PWLA 3F5PA 2UVXA 1CMKE 4UYNA 3SKCA 4LM5A 1Q62A 4D0WA 3RPRA 3FLNC 3ORNA 2BAJA 3RMFA 2PVYA 3OMVA 3TKHA 2QO7A 3R2BA 1ATPE 3C1XA 2ITPA 4GMYA 5CEPA 3E8CA 4X2GA 4W4WA 2PU8A 4G3GA 5A4QA 2XKCA 5J7HA 2VD5A 1M7QA 3SRVA 3FLZA 4FV5A 3E64A 5TR6A 3GCSA 5CTPA 4DH1A 1JKSA 4I21A 4OTIA 4WSQA 4MD9E 5CNOA 5ANOA 3UNJA 5IUGA 3I4BA 1PMVA 2CNVA 4ENYA 2ETMA 4D9TA 2YIWA 5CXHA 5HORA 4G34A 1LEWA 3QQGA 4EK4A 3FZTA 5BNJA 2HZIA 4LYNA 4E7WA 2PK9A 1ZARA 5BVWA 3LPBA 4L68A 4FTJA 4I0TA 3PA5A 5CT0A 3VUKA 5EDRA 4ZTNA 3O7LD 1IASA 5HVJA 4O2PA 3HRBA 5BMSA 1YXSA 2ITWA 2JBOA 4C61A 4QMSA 5ICPA 3PPZA 5L6WL 2CMWA 3MY1A 4QYEA 3CS9A 3PVWA 5C9CA 2YZAA 4FGBA 5H3QA 3I5NA 3TJCA 5CAUA 1G3NA 1H00A 2O5KA 1WZYA 1O6KA 3TZ7A 2RFDA 4BGGA 3EYGA 5AM7A 2RF9A 3FYKX 3RVGA 4YC6A 1PJKA 2W4KA 2GS6A 2JAVA 4M13A 4EJNA 2BDWA 3E3PA 3F5GA 4L46A 4OTRA 2R7BA 5E4HA 4KBKA 4ZJVA 4F63A 4DH7A 3ALNA 4JG7A 4NCTC 4O7VA 5IH5A 3PIYA 2W1CA 3PXFA 3Q4CA 5HEZA 4NZWB 5IH6A 3LCDA 5FXQA 3I6WA 4RX8A 5J9ZA 4F9AA 2R0UA 3R8LA 3UIBA 5KMJA 3NVKI 2ETRA 2WXVA 2XK8A 3NW7A 1OUYA 2VTAA 2Y9QA 5JFVA 2JLDA 4FC0A 2X8DA 3GCUA 2VTMA 5DHJA 5DOSA 3BV2A 3P5KA 3ZUUA 2R3NA 2I0HA 5FM2A 3QTIA 4JQEA 3CD3A 3A8XA 4DFZE 5F1ZA 1ZOHA 4YURA 2XIZA 5M55A 3UC3A 3UO4A 4DEGA 4DGMA 2PZPA 5I4NA 1Y6AA 1Q5KA 4KBCA 2FSOX 4IZ5A 1H25A 2OJ9A 4QP8A 2Y6OA 5EM7A 5HU3A 1O6LA 2OU7A 4RBLA 1OZ1A 4CRSA 1AD5A 2OJGA 3P86A 2Z60A 4YGAA 3MESA 4TYHB 4IJPA 4GFOA 3D5VA 4JXFA 4DAWA 4BBEA 2YIRA 2XIKA 5IEXA 3FI2A 4B7TA 3SAYA 3CP9A 4TPTA 4HZSA 2VWVA 1T45A 4FSYA 4BZOA 4G31A 2QG5A 3M11A 3LFDA 3FEGA 3OW3A 4YBKA 2C6KA 1XWSA 1BYGA 1IA8A 4FKTA 4O0YA 2HELA 1B38A 3AC2A 3O71A 3OZ6A 4I6HA 5DWRA 3FXZA 3ZRLA 5C1QB 2FGIA 4KD1A 2VNYA 4GU6A 4QTBA 4O82A 1KOAA 2B9IA 3HGKA 3Q3BA 1U59A 1ZMUA 2BILB 2OF2A 5IPJA 5DI1A 1Q4LA 2PMOX 3CCNA 3P08A 3GXLA 3O0GA 5HTIA 2X6EA 2GTMA 3BIZA 3S1HA 1Y91A 4LG4A 3SD0A 1PMNA 2YDJA 3L9NA 5LMAA 1YOLA 3MGYA 4W8EA 3BKBA 3LCSA 5L6PA 3D5UA 3GQIA 4LUEA 3TUDA 3GU6A 4AQCA 4ZLYA 4CGAA 3PRIA 5K0KA 5JH6A 3G0EA 5K9IA 1G8AA 3QX2A 4FZ6A 2C1BA 4FG8A 4FNYA 4NM3A 5JQ5A 3IW6A 3TXOA 5BVNA 2H8HA 5L2QA 1BKXA 3SXFA 1U5RA 4I5MA 1VJYA 4MEDA 2C3LA 4O38A 3CQWA 2WIPA 1ZY5A 3TT0A 3QCXA 4FEVA 5TT7A 4CRLA 2XA4A 4DT9A 3HZTA 3SLSA 3CIKA 5ANEA 3S3IA 3DAEA 3MB6A 4O7WA 3MDYA 1XH7A 3DV3A 3HECA 5M4UA 3DKOA 3ZONA 5CAPA 3QHRA 5JZNA 3A99A 4C59A 1FGKA 2JDOA 2ZJWA 4XP0A 4F9BA 4F9WA 1Q97A 1OL7A 4O7YA 4GT5A 4BCPA 4ZY5A 3UOLA 4EC8A 2O0UA 3ULZA 5CVHA 1TQMA 4RX7A 4DEBA 3BWFA 1GIJA 3OT8A 1XR1A 3WYYA 2OH4A 4QP9A 5J95A 2WKMA 4AW0A 4TWOA 3MH0A 4QP2A 3E63A 3QCQA 3VRYA 3EB0A 4Y73A 4PQNA 2C5OA 4Y5QA 3LFBA 3KVWA 3LE6A 2C6MA 2WPAA 4YC3A 4CFNA 3WZJA 1F3MC 1OIRA 2XRWA 3R6XA 5LWNA 5CLPA 1F5QA 4DFYA 2VO7A 4IDTA 3HYHA 5HNGA 3GUBA 3BE9A 3GU8A 1JKLA 2QURA 3BHHA 4GW8A 5L4QA 4GKIA 3FKLA 3FMMA 3HMNA 4NWMA 4WHZA 2O64A 4O96A 3C51A 3HMPA 3D7TA 2WMTA 5DVRA 2Z7RA 4YZCA 3I5ZA 3LCKA 4ZTLA 3GC9A 4FV0A 4FNXA 4ID7A 3UZPA 4Z16A 1YHVA 5F95A 1GOLA 5HE3A 3VNTA 4QMYA 3KRLA 4BCHA 1XKKA 2CGVA 3PA4A 1V0OA 4D0XA 3HA8A 4RJ7A 4LRKA 4HVDA 5ETFA 4O0VA 4B0GA 4W9XA 3TV4A 2V62A 3EWHA 4LOQA 4JOAA 3PVGA 3LKMA 4L43A 3BEGA 2W4JA 5B0XA 5JFSA 4JBOA 2GFCA 4HPUE 3F88A 4RLLA 4FVPA 4A4XA 4C4IA 3D83A 4C2WA 2BRHA 4AOTA 3PE1A 4M0ZA 5A6OA 5EYCA 3R7YA 1JKKA 3L8SA 3FL4A 3H0ZA 3R30A 3QLGA 4F6SA 4ALWA 2QODA 5CF6A 3KK9A 1OUKA 5I0BA 4X3FA 1CTPE 4UYAA 4TKSA 5LCKA 4BZNA 4C62A 3U51A 4ZSEA 2BIKB 5ACBC 2IZUA 3GEQA 4L6QA 2XK3A 3ZBFA 4R3PA 5LVLA 4M69B 2GS2A 3C9WA 4NTSA 4F0IA 3BHUA 5ANGA 4RIXB 3TDVA 3KFAA 3M2WA 4H3QA 3MPTA 4MF0A 3QUDA 5AAEA 5BYLA 3K54A 3BHYA 3MH1A 4ANQA 2WFYA 3BYSA 2A4LA 3R9DA 2XH5A 3R8PA 3AD5A 4G16A 3A4PA 4ZMEA 3DQXA 3LMHA 3ET7A 3CTQA 2VTHA 5E1EA 5EHYA 4C38A 4EH4A 5HVKA 4CMUA 4O21A 4I3ZA 1BI7A 4GG7A 4XV9A 2PVLA 1FOTA 3N4VA 4LRJA 3ZM4A 2YJSA 2QQ7A 3PDTA 4JDIA 3R04A 3V8WA 4D2WA 1UKHA 4L45A 4QMVA 3VVHA 4PMPA 3LXPA 4OTDA 2IJMA 4BFMA 2W1ZA 2R7IA 4MBJA 4XNEA 3RBWA 3W16A 2P55A 2VWYA 3NEWA 4FIHA 2H34A 4BR3A 5IKWA 5HOAA 3POZA 2QC6A 4R1YA 2Z7QA 4XV2A 3EN6A 4HGTA 1VYZA 3ZM9A 1U5QA 3NGAA 3FHIA 3LCTA 3R9NA 3VS5A 4QP7A 3VBXA 2ITTA 1UNHA 2PE2A 4I5CA 2R64A 1IR3A 2XBJA 3HV6A 1UWJA 4HNFA 4IAKA 2EU9A 5CU6A 3RAIA 3WI6A 4D4RA 1OL6A 5CSHA 2XNOA 4G3DA 5E8TA 3FPMA 4TT7A 4BDKA 4D28A 4YTFA 5LQFA 3AC8A 2R3GA 5AUXA 5CEMA 1K2PA 1P4FA 4CKIA 3PSCA 3W32A 4ZZNA 1J7UA 2BRNA 4AZTA 3EQIA 4U3YA 2R3FA 2OW3A 4MXOA 3OHTA 1S9IA 3B2TA 3PSBA 2XNEA 2REIA 2AUHA 2X39A 2B7AA 2J0KA 1P14A 5C03A 2YCRA 3GC8A 3W18A 2XIXA 4PP9A 2Y8OA 4E6DA 3V8SA 1PXJA 3H4JA 4WNOA 4GU9A 4E20A 2YITA 2HK5A 5K5NA 2UZOA 4JBPA 4MVFA 3EFLA 1YHWA 3UJGA 1OKWA 1YWNA 4QMTA 4KKEA 4M67A 5JSMA 4XP3A 4YPSA 3FSFA 1LUFA 3IPHA 2C68A 3ITZA 3KULA 4OTGA 4RJ3A 4ZSJA 4XMOA 4G1WA 1J3HA 1E1VA 2JGZA 4LUDA 3I60A 5J5SA 4L00A 2AYPA 2R4BA 5EI8A 3LAUA 2HW7A 4E4XA 2C47A 5AP0A 4BIDA 5HE0A 3HV3A 4MQ2A 1Q99A 4DBXA 3BELA 4S32A 4DC2A 5EW3A 4FG9A 4O0XA 2CDZA 4R3CA 3R7IA 3RPSA 4BDFA 4FE2A 4H39A 4AAAA 2VTJA 2CNQA 2BIYA 4BC6A 1ZYCA 3MVLA 4GK2A 4B8MA 5HZNA 2XJ0A 2FA2A 3UO6A 2G2HA 1V0PA 3P9JA 3QRJA 1DM2A 2WTJA 3DXPA 2WEVA 4AGDA 5M4IA 1FMKA 3NUAA 3QXPA 2X9FA 4CLJA 5J9YA 2QHMA 2ZB1A 4RIYA 4UMRA 2OXYA 1H26A 2P3GX 3TDWA 4QMUA 4EH5A 1R78A 3U4WA 5E9EA 3G33A 5EM6A 4ARKA 4EOPA 1O6YA 4F65A 1ZYLA 5F94A 1FGIA 4ZTQA 3QAME 2FSMX 5LOHA 4AT3A 3WOWA 4QPMA 4ASZA 2CKPA 3UZRA 5M56A 2V55A 3D2KA 3C0GA 2OFUA 4FSZA 3QZHA 1MRYA 2B55A 4AW2A 4QMNA 4JAIA 3QD2B 4BCJA 5AV1A 4CV9A 2W4OA 1W98A 4KAOA 3FI4A 4C0TA 2JIUA 3ZHPC 5BUJA 5E8XA 4EJ7A 3HP5A 4NJDA 3A62A 2F2UA 1PKDA 5HCXA 4EUUA 1SVGA 3AT3A 4IIRA 2PYWA 4Z55A 4F7LA 3QUEA 4M68A 5AP3A 2IW9A 1WBVA 2WB8A 3H9RA 4GT4A 3NIZA 3UQFA 2QR7A 4QMWA 2Z7SA 4O7SA 3NLBA 3NS9A 5FDXA 3WE4A 5A9UA 5D7AA 4I22A 4IZAA 3FUPA 2P33A 3AC4A 3WE8A 4EH2A 3QTWA 4CG8A 1XH8A 2QOIA 3CKXA 5KUPA 4NTTA 4BDBA 5IMEA 1YWVA 4KSPA 5J8IA 3QKMA 3UG1A 5F20A 3WIKA 5FEDA 5AP7A 4P5QA 3A2CA 4PP7A 2BALA 3NUYA 4P2KA 2VN9A 4QMLA 5CSWA 4V01A 3RK7A 2GU8A 2X4ZA 4S33A 3F7WA 3N9XA 3PVUA 3OS3A 1X8BA 4D55A 3UODA 3P7AA 4BDGA 5E8ZA 4EOIA 2XCHA 1TKIA 3PTGA 4KRDA 2VO3A 3POOA 4IB0A 1REJA 4L42A 4XLIA 2PVKA 5FD2A 1PYXA 1PXOA 5HGIA 4I6QA 4L01A 3TKUA 5JT2A 2W99B 2GHLA 4FV8A 3RK5A 1PXNA 3NPCA 3O8PA 4GFGA 5FQDC 4MXYA 4BVUA 2FUMA 4OTQA 4DINA 2QO2A 2Z02A 4FSUA 3W10A 5T6KA 4IB3A 4EHVA 5A4LA 3E92A 5D10A 1AGWA 1PXIA 3QALE 3QTZA 2G01A 3DNDA 3QGYA 3BGQA 5E8WA 3PVBA 3VJOA 4UXLA 3TN8A 4CFWA 3JS2A 3QWJA 3O23A 4XCUA 4FEQA 4E5AX 5JKGA 3S00A 3UVPA 3SW4A 3C0HA 3GENA 3R71A 4DYMA 2BZKB 3O50A 4BF2A 4CT1A 3ENMA 5DBXA 3P1AA 4BTFA 4IWDA 3UO5A 3ORMA 3HP2A 3MA6A 4NJ3A 4BRXA 2J0JA 3NCGA 4TYJA 4EK3A 5BUEA 3F2RA 3ATTA 3ZFMA 3IW4A 5JRSA 3AT2A 1W84A 3N51A 4XG6A 5HIEA 5J1VA 4FIEA 3R9RA 3RCJA 4DFLA 1WVWA 4YJQA 4A9YA 1OL2A 2HXQA 3BYOA 4QPAA 5H9BA 3UNKA 3IDPA 5HX6A 5D12A 2OG8A 3SRVB 2YM3A 1YDSE 2OKRA 3JY9A 5IEYA 2IVVA 2W1HA 3SW7A 5FTOA 2GDOA 4MNFA 1YHSA 2OIQA 2XS0A 5T68A 2VTRA 1GNGA 3D5WA 4K6ZA 5CX9A 2J0LA 2QI8A 3GU7A 4RIWA 4AOIA 5I9WA 3HKOA 3HMIA 4MKCA 3ZDIA 4FV3A 2H96A 4ITIA 4PL4A 5LARA 2J5FA 1Q61A 1OITA 3VS7A 2ITQA 4QTCA 1ZXEA 5J7BA 3C5IA 4O1PA 2W1DA 5EHLA 4HOKA 4BKYA 4JX7A 3D9VA 3WZEA 3K5VA 3MFUA 1FVTA 3EQBA 1XBBA 2XM8A 3FMKA 3PZHA 3R01A 4IAAA 4RA5A 5GJFA 5M06A 1XH9A 3VS2A 1XQZA 3VQHA 4QMMA 3ZXTA 5I3OA 3EFWA 4QOXA 4DE4A 4FZAB 1DAWA 2W1GA 3DCVA 4UZHA 5CZIA 3JXWA 3U4UA 3ZEWA 5IA4A 5TOZA 3PJ8A 2YCSA 4X0MA 2F49A 4DTAA 3ETAA 1QPEA 3CSVA 2JFMA 4WNKA 1VEBA 4UV0A 3F9NA 1ERKA 5FBNC 1OPLA 2HXLA 2W5HA 3REPA 5AX9A 1P4OA 3VUDA 3CQEA 4RRVA 3QZIA 3ELJA 2DUVA 3EKNA 2HY81 3COIA 3OWLA 4DEEA 3G2FA 4WO5A 2JFLA 3RWQA 3GQLA 3V01A 5IF1A 1ZMWA 4PPBA 4PDSA 5M4FA 1FVRA 2ZV7A 2W06A 2A0CX 5EM8A 5HD4A 4UN0C 3F66A 3IONA 4KIKA 2HY0A 2PUNA 3VWAA 3TUCA 2WMXA 4JDHA 2J6MA 5HCZA 2W05A 4ERKA 3KN5A 4TY1A 3DBFA 3SX9A 4IC7A 1PF8A 2JBPA 5EW8A 4E6QA 3JUHA 4EONA 1M2RA 3BPRA 5IA5A 3QTQA 3UOHA 5JGBA 1SVEA 5A54A 4XYFA 4NFMA 2R5TA 2WMAA 3KL8A 5C01A 2IW8A 2KULA 4BTMA 5AV3A 3SQQA 4AG8A 5AIRA 1Q41A 1PW2A 2BTSA 3MTLA 3E62A 2EB2A 3DBQA 2IO6A 3Q96A 3D15A 2C5NA 4O0UA 3LM5A 5E90A 3AC3A 2PSQA 4L52A 5CVGA 5EHOA 5KO1A 1UA2A 4I4EA 1KOBA 2HYYA 3Q52A 2GNLA 4QT1A 4IAIA 5KMIA 4MXCA 5FG8A 5CF4A 2IZRA 4I5HA 4S34A 2C5XA 4YMJA 4TYIA 1OKVA 3HX4A 2VU3A 3CLYA 3ZYAA 5IQHA 3DQWA 3OY3A 3FV8A 4GIIA 2PUPA 5BUIA 3C0IA 3FY2A 3ZC5A 4B9DA 4LV8A 1Q8WA 4YPDA 2FO0A 2PVRA 4JNWA 1Y6BA 4YZDA 1MRUA 5TKDA 3ZDUA 4NIFA 3N4TA 3CY2A 5HTBA 2I0VA 5AR2A 2DWBA 3FLSA 2YIQA 3PY0A 4TWCA 5AP6A 3ERKA 2NRYA 3EHAA 3F3UA 3HLLA 1H1PA 4Y83A 4JIKA 3DKFA 4JT3A 2B1PA 3QZGA 4IVBA 3FC1X 2NO3A 4YLKA 3P7BA 4MF1A 2JIIA 3UTOA 2A1AB 2ZDUA 3MN3A 4IX6A 1UKIA 3R02A 4H3BA 5AA9A 2IZTA 4ALVA 3TIYA 3VS3A 1Q8ZA 4J71A 3QD3A 3C4CA 4IWOA 5HESA 4BBFA 4FVRA 3MH2A 5KHXA 3BQRA 2DQ7X 2ZDTA 4O27B 3PA3A 2CLQA 4QYGA 5LVPA 2ITNA 3PJCA 4II5A 2XK4A 2VWWA 2HZ4A 1KE8A 4KB8A 4MWHA 4RIOA 2JEDA 3CR0A 4YJSA 1YVJA 1I09A 5EM5A 3ZO4A 4AZFA 3MA3A 4ANMA 4GL9A 4GV1A 5DT3A 4CZUA 1H24A 2QOCA 4NYEA 1UU9A 3KC3A 1OGUA 4BYIA 5E8YA 3C4EA 3ORXA 4CMOA 5J1WA 4EOQA 4WUNA 3I0QA 5FWKK 3RAWA 4BCNA 1GIIA 4ERWA 4O1OA 3AC5A 5EW9A 3QTUA 5C8NA 3UVRA 3OCSA 2HOGA 3FZOA 4FKQA 4O0RA 3EOCA 5D7VA 4D2VA 1TVOA 2VTPA 4E93A 2OSCA 2BFXA 3LXNA 3DKCA 3FWQA 4ORKA 2Y4IB 4HGSA 3LQ8A 5H8GA 4E3CA 2UW5A 3MIYA 4GFMA 4B8LA 5L8JA 3NUUA 2C1AA 4BCOA 4FEXA 3UP2A 3TNQB 2W17A 2R3JA 2R3QA 3R1QA 2XBAA 3GU4A 3TV6A 2OF4A 4RFZA 3CGOA 3TACA 2WHBA 3D7TB 1SYKA 4FKVA 3QZFA 5ITAA 2ITVA 2B9JA 4ZAUA 3HVCA 1ZYSA 4IFCA 4F70A 5EI6A 2JDSA 5A4CA 4WSYA 1GZNA 5JQ8A 5GJDA 1GY3A 4GUBA 4U80A 5EOBA 2CHLA 3GP0A 3Q4ZA 4A9SA 4J8MA 2BHHA 1L3RE 2J50A 4CYJA 5A4EA 5FDPA 4O22A 4TXCA 5M51A 4UMQA 3WARA 3L9MA 1CDKA 3BLHA 3IDCA 5DEWA 4QYYA 3G9NA 2QOQA 2YM6A 2GNJA 4IJ9A 4DH5A 4U8ZA 1SZMA 3V51A 3MWUA 3CTJA 2YA9A 4EHEA 2YIXA 3AMYA 5AWMA 5AR3A 3GC7A 2OJJA 1FVVA 1SMHA 2GSFA 1Q24A 5K5XA 4BCFA 4C4JA 2A19B 2F9GA 5LJJA 5TE0A 4JLCA 4X3FB 3PY1A 2WMVA 1H1WA 4ZLZA 4ACHA 2X7GA 3KF7A 3V6SA 1U46A 2B52A 3TZ9A 2VTOA 4JVGA 2GHMA 4FKJA 5E7RA 2YM5A 1J91A 2XYNA 2QOKA 4I23A 3ZLXA 1A48A 2A2AA 2QOLA 4DLIA 2ZMDA 1R3CA 1YDTE 4YO6A 4ACCA 2R3MA 1UU3A 4MD7E 1Y57A 2UW7A 3B2WA 3F3TA 3GOPA 4JRVA 5EOLA 4FTKA 4JIAA 5CU0A 2R3LA 4FT5A 4QMXA 5A6NA 1NVQA 4IAFA 4AZSA 3UYSA 2XK6A 5CI6A 1OIYA 4F6UA 2W7XA 2VX3A 4X21A 1OBDA 1APME 1KSWA 4CFUA 5CALA 4NK9A 1CKJA 3ZRMA 3GNIB 4C2VA 3R22A 4L7SA 2AC3A 1JKTA 2Q0NA 4GVJA 4V05A 3IOPA 3ZRKA 4N4SA 4I94A 3UOKA 5B7VA 3QA8A 5B2KA 4HJOA 2I6LA 4AW1A 4C02A 3TJDA 3KU2A 4LQMA 2QVSE 4F99A 2W1IA 4AA4A 2V5QA 2OZAB 4RA4A 5HNBA 2ERZE 4RWLA 1A9UA 3MY0A 3MJ1A 5HO7A 2O2UA 2QONA 4JJRA 3OXIA 4XV3A 4C58A 5L2SA 4F1TA 3UPZA 5LXMA 5CS6A 2WEIA 3HNGA 3HDNA 1WBSA 4J53A 4BDEA 3G9LX 4GSBA 4QYFA 4U44A 5A3XA 4FX3A 2FYSA 4FTMA 3PIZA 2F7ZE 3K2LA 5AV4A 3V5QA 2V7AA 2YAKA 3BBTB 2UW3A 4AN3A 4BDHA 3ULIA 4I6FA 4R5SA 2XVDA 5CANA 3PRFA 2ZM4A 1IRKA 1QPJA 5FP5A 2EVAA 3TV7A 3FQHA 3WF6A 1JSVA 3CC6A 4AZEA 4IXPA 1KWPA 3Q60A 3WBLA 4BWPA 3AOXA 5KZIA 4CXAA 3E87A 3KRWA 3KEXA 2WQNA 4JBVA 1VR2A 4IE9A 3WZUA 4E6AA 5IA0A 3OXTA 3QTRA 4CNHA 4QQTA 1JLUE 3FMLA 5AUZA 3TG1A 4CEGA 2B0QA 1W0XC 2VTQA 3AMAA 2PE0A 5DEYA 4UMPA 5KCVA 2B53A 1Z5MA 3SVVA 3ORKA 4FT9A 3VHEA 2C0TA 4P5ZA 3Q9ZA 3HV7A 1FPUA 3MSSA 3KULB 2UZEA 2WGJA 4QTDA 5C27A 4FIIA 3HUBA 3LLTA 3I7BA 3MW1A 3DT1A 3RPVA 2HWOA 2JKQA 2WTKB 2O65A 2YFXA 4FTUA 3TNPC 3VN9A 4R6VA 5AEPA 4I0RA 4CTCA 4CV8A 5HNIX 4RZVA 4MWIA 4JAJA 3DKGA 5D41A 2UZDA 3NR9A 3PYYA 3GVUA 3C13A 1ZYJA 4E73A 3FC2A 2BFYA 3DTCA 3PJ3A 3ORZA 3W2PA 4EC9A 1H01A 4UWYA 2CKEA 1RQQA 3WZKA 2W5AA 1IA9A 4FF8A 4BWXA 3VBWA 3VW6A 2LGCA 1O9UA 2GMXA 4RZWA 4YJOA 3LFQA 4TYGA 3T3UA 3RTPA 3UIUA 4RIYB 5DFPA 2P2IA 3VRZA 4F09A 3LXLA 4R1VA 4FTQA 3Q32A 4W4XA 1M7NA 2W9ZB 3GC0A 4D1ZA 2NRUA 4CVAA 4XG3A 4CD0A 2NNWB 3MI9A 4BIBA 3CQUA 3MVHA 5DE2A 1M2QA 4QMZA 3A7IA 4EOOA 4O7TA 1V1KA 1YI3A 3RAHA 2C6TA 4FUXA 4IC8A 4JI9A 5ANJA 4UZDA 4AT4A 3AGLA 3OY1A 5AAGA 3EL7A 4IWPA 5EI2A 5AX3A 3EN5A 3QYZA 2RKUA 2E9PA 4CT2A 3UIMA 2O3PA 2GNHA 3DOGA 4FKPA 4R7IA 4N6YA 4EORA 2YM4A 4FV4A 3FKNA 1YOJA 5DIAA 3K3IA 4E26A 3H3CA 2OFVA 2ITYA 3ZO3A 4GK3A 4TYEA 4G5PA 4FYOA 2OXDA 1Z57A 1Q3DA 1SVHA 3CPBA 4Y8DA 5AR4A 5LVMA 4ZS4A 4KIOA 5I9YA 5AM6A 3OXZA 4EH7A 3F69A 4L7FA 5FEQA 4YLLA 3CD8A 2HZNA 3D5XA 4AGUA 4MH7A 5M44A 2BKZA 5L2TA 2XUUA 1NW1A 3FZ1A 3WILA 3GGFA 3BZ3A 2UZNA 3G6HA 2UZTA 2QG7A 3A4OX 4OTFA 5CI7A 3W8QA 3QD0A 4M3QA 3LJ0A 2VWUA 5JEBA 2V7OA 3NWWA 2X2LA 4JRNA 4M66A 3R7OA 3PP1A 4XH6A 4TWPA 1Z9XA 3ACKA 3D4QA 4KRCA 4RQKA 5HBJA 1WVYA 3IK3A 2OZAA 4GH2A 4M97A 4UMTA 1YXVA 4L3JA 4U79A 3F2AA 4BN1A 4BL1A 1V0BA 4K18A 3EIDA 3MIAA 2XNBA 5KMMA 3R1NA 2XJ2A 3BLRA 1BLXA 2ZAZA 4ZJJA 2IW6A 4G3CA 1JSTA 1LPUA 5DR9A 3BHTA 5HIBA 4ZZMA 3RM6A 4ZJIA 4CSVA 4HW7A 3ORTA 4YTHA 4O81A 1NVSA 2UW9A 2WTCA 2I0YA 3CPCA 2UZVA 5AP1A 3U9NA 3E8EA 3QQUA 5J87A 3T9TA 4C3PA 3W33A 3BGZA 4GKHA 3LW0A 1WCCA 3R9HA 4G17A 1H8FA 4KIPA 5DR6A 3RZBA 4USEA 5A46A 4UXQA 4R5YA 5AV0A 4I1ZA 3ZU7A 3QRTA 2C5YA 2PVHA 4EZ3A 3QCYA 1OIQA 3EN4A 3PY3A 2J2IB 4UBAA 3ZEPA 5GIPE 5BVFA 4XV1A 2EB3A 4ZY4A 4YO4A 2XIRA 2QHNA 5AUUA 3SHEA 3LVPA 4GG5A 4PL3A 4GVAA 4HYSA 5CU3A 5AP2A 3ORPA 3AXWA 3IDBA 4GUEA 4C4FA 5AUVA 1ZAOA 5IQEA 4AF3A 5GZ9A 3RHKA 5BVOA 2PZ5A 4BCGA 2VAGA 4O0SA 4I6BA 5I9UA 4HVSA 1DI8A 1JVPP 2A27A 3EQPA 4FKOA 2EXEA 2I1MA 3QA0A 4A4OA 4OAVB 4GT3A 4BDAA 3OF0A 1RW8A 4YC8A 3G15A 4MYGA 5DG5A 2YIYA 1OM1A 3E8NA 4F64A 1NXKA 3HUCA 3NRMA 4HCUA 1FQ1B 3OBJA 3MPAA 5EFQA 3QUPA 4BHNA 4YU2A 4YBJA 4QQJA 1KE6A 3AG9A 2QOOA 5EKOA 5IA2A 1KV2A 1OL5A 3K5UA 3E3BX 3FYJX 1F0QA 3I81A 5C4KA 5IQDA 4WRSA 4O83A 1OL1A 1YXXA 3UPXA 1GJOA 2XNMA 3EQDA 4RIWB 4RJ8A 4DGNA 5GINE 2ETKA 2PZIA 2R3OA 2QU6A 2ACXA 4GS6A 3TZ8A 2UV2A 4NKSA 4XRJA 4W9WA 3UGCA 4DEDA 4FK3A 1M14A 4EBWA 4EYJA 4ZIMA 3SXRA 5CEOA 5EH0A 3T3VA 1M2PA 5IZFA 4JL9A 2OICA 2XNPA 5HICA 2BRBA 1PXKA 5IDNA 2YHVA 1PHKA 2R3PA 4Z9LA 3NYVA 4E5BA 1JAMA 3AMBA 3E7VA 4NEUA 4TNBA 5D1JA 4C7TA 4CQGA 2HW6A 4RX9A 4D2TA 2B54A 3KQ7A 4DF3A 3LM0A 1AQ1A 2GS7A 4K9YA 5CVFA 3SG8A 3QQFA 3PXZA 3BX5A 3TZMA 4FNWA 4FIJA 5G1XA 3UYTA 2C6LA 2BHEA 3BCEA 3L1SA 3NNUA 3NYNA 2R3KA 4QQ5A 4WT6A 4XUFA 4MNEB 4CZYB 5GZAA 5FTQA 3ROYA 2VWBA 4UMUA 3LIJA 2OH0E 3QFVA 2ERKA 3W8LA 1LR4A 4K8AA 2Y6MA 3A8WA 4QMPA 3KXHA 2OIBA 4B99A 4S2ZA 4WA9A 4Y85A 2Q83A 3THBA 2BZIB 3RINA 2GQRA 3MV5A 3W2SA 4BGQA 1WBPA 3KCKA 3VS6A 4U81A 1OKZA 3OW4A 1XJDA 1PXLA 4FICA 4F4PA 3DZQA 3TIZA 5CQWA 4KIKB 3F82A 4DG2E 2JKOA 3C4XA 3WYXA 4FSWA 4OT6A 1RE8A 2ZVAA 1DS5A 3LMGA 1JBPE 3NW6A 3PWDA 5BYZA 5J5TA 4ZSAA 2C4GA 2E9NA 2WQEA 3H9OA 5AMNA 4IVDA 4EKLA 2YABA 5L8KA 4PDYA 3NUNA 4LGDA 2IVUA 3PE2A 2QOHA 4BCMA 2JC6A 5FEEA 4JS8A 1W82A 3OWKA 4WRGA 4EQCA 4MBIA 4PV0A 1G5SA 2VO0A 1A06A 4XS2A 3NNXA 4RJ4A 4KWPA 4APPA 3HMMA 3COHA 3WF7A 4D9UA 2ZB0A 4X2JA 3CKWA 4CFXA 2VTTA 3DNEA 3L8VA 5B2LA 3NZ0A 5M07A 2RSVA 3S0OA 1ZMVA 1G8SA 2G1TA 4EHGA 2VUWA 2RG5A 1FMOE 5KX8A 4RFMA 5GHVA 3SOAA 4U43A 4DTKA 1SM2A 3V5LA 5GNKA 3DAKA 3L9PA 4C3FA 4PPAA 2F7XE 3UE4A 4LGGA 4DEHA 2JKKA 3WF5A 4KKHA 1Q8UA 4G2FA 4UB7A 3F3ZA 5FLFA 1YI4A 4KKGA 3P4KA 4LL0A 2WELA 1JOWB 2ITZA 3VHKA 5JGDA 2BUJA 4BDIA 1H0VA 2IVSA 4N57A 2JAMA 2JITA 5HG7A 4APCA 1OPKA 4NIFB 3KXGA 2ONLA 2WOUA 3LLAA 4EOMA 4ANSA 4BIEA 4W4VA 1Q8TA 1J7IA 5E8UA 2RL5A 5EQPA 2CNUA 2HENA 3KK8A 4RJ5A 1NT2A 2WMRA 1XH4A 3Q2JA 2OWBA 4PDOA 4PX6A 4Y95A 5KBRA 1OI9A 2EXMA 5IH4A 3HAVA 2IWIA 4NT4A 2PVMA 2VNWA 4UALA 3IO7A 3IG7A 3T9IA 4OW8A 4FL3A 4C33A 3OCGA 3FMDA 3DJ5A 3ZFYA 3QX4A 3DB6A 3F5XA 3QRKA 4YNOA 5CEIA 3DK3A 4HGEA 4JX3A 1JWHA 4JR7A 4PTEA 2SRCA 4F9YA 3EFJA 4RLKA 5FTGA 2HZ0A 4OT5A 4M8TA 5CU4A 4NM0A 3ZLYA 5L2IA 3KGAA 2R9SA 1IAHA 4ASDA 1BMKA 5BVDA 1KE5A 3NSZA 3O51A 2GTNA 4L44A 5EYKA 5GJGA 4ONAA 1UU8A 3LZBA 3RNIA 2F57A 2FSLX 5DLSA 3FLQA 3VW8A 4BZDA 2XKFA 3GFEA 2QR8A 4DT8A 2OI4X 3O8UA 2OK1A 5JFXA 4UY9A 4Y72A 3OEFX 4USFA 2VV9A 4W4YA 3ZO1A 3A7HA 1PY5A 1UNLA 3PXYA 3V5PA 2XKEA 5A14A 2E9UA 3E88A 4R3RA 4ZMFA 2X8IA 1CSNA 4XBRA 3BU3A 2X2MA 2I0EA 2OJIA 4YJTA 2ITUA 2BTRA 5DPVA 3QKKA 3QRUA 4EZ5A 5LMKA 4PMMA 3C4WA 4AP7A 4F0FA 3UZTA 4BY9E 3VBTA 4G3FA 4U3ZA 3CEKA 3ZXZA 5H2UA 4BI1A 2WTVA 3MY5A 4CFMA 2QCSA 3IGOA 2VWXA 4C35A 5CYIA 4ENXA 2OLCA 3OC1A 1KUTA 1DI9A 4O7LA 3HEGA 5DGZA 4FT0A 3PLSA 3RGFA 5AR8A 4AACA 3OOMA 5C8KA 2VWIA 4EH9A 2GQSA 3MTFA 2OIDA 2B9FA 4KABA 4MNEA 3V5WA 1NY3A 1SNUA 5LMBA 2BAKA 3KXMA 4O6EA 3DXQA 4O7ZA 2XCKA 4FL2A 4ANOA 3BLQA 4WBOA 4G3EA 1R1WA 4MX9A 3ID6C 3GCVA 3RCDA 5LCJA 4FSTA 2JIVA 5A4TA 4E4LA 2CLXA 4DLJA 4FEWA 1GZOA 4ZTMA 3HV4A 3BU5A 4IVCA 1PMUA 2WZJA 3GOKA 2C30A 3I1AA 3UP7A 1H28A 2UVZA 2OZOA 3OT3A 4MQ1A 3ZSIA 4NH1A 4FGRA 1OVEA 2J90A 2QD9A 2DS1A 3I6UA 1OIUA 3HMOA 4CKRA 3RNYA 4QNYA 3R8ZA 3JVSA 3KVXA 4WD5A 5AR5A 4DGOA 3KB7A 3ZMMA 4AE6A 2GCDA 4HGLA 4S31A 3DK6A 3QTSA 3QRIA 1H0WA 4XG8A 4PY1A 4G9RA 2PHKA 4E8AA 3FMJA 3IW8A 2X0GA 3KMMA 4W8DA 2C3KA 3DPKA 2UZWE 2YCFA 2V22A 3WF9A 3W55A 1WAKA 2VZ6A 4I92A 4PUZA 5KMKA 4R78A 4FTLA 3NAXA 3MYGA 3EQGA 3ACJA 3VUTA 2R3RA 4NL0A 5IQIA 2QLUA 3TTIA 2C6IA 4G9CA 4GYGA 2W5BA 1XO2B 2ZMCA 3A7GA 1HCLA 2GQGA 3I7CA 4UWCA 5H8EA 3PWYA 3KRRA 4IW0A 3W1FA 5KMNA 4FTIA 5I9VA 4RC4A 5F9EA 3QWKA 4ZXTA 4OTPA 2PL0A 4O2ZA 3NDMA 4FV9A 4O91A 2WNTA 2X8EA 3WIGA 2UUEA 3TWJA 1QPCA 4BTKA 4PDPA 5HI2A 3DBCA 5CWZA 5BYYA 4M12A 1JSUA 3PXQA 2JDVA 2VGPA 3GT8A 3L9LA 5HG5A 4AFEA 2PMNX 1OB3A 3QF9A 4BWKA 2ZM1A 3NMUF 4IDVA 3DBEA 4GEOA 5CQUA 4CCBA 2X7FA 1UNGA 3KA0A 3SA0A 1URCA 3NUXA 3KRXA 2BRMA 5D11A 3A7JA 2Q0BA 3TUBA 3QYWA 3AD4A 4V0GA 3PJ1A 1ZYDA 2CSNA 4EOSA 3EL8A 1U54A 2YZLA 4BCIA 5DN3A 2QU5A 4U42A 3V5TA 3Q6UA 4ASEA 5HG8A 4LRMA 3FZPA 3ZO2A 1YKRA 3R73A 4FT7A 1Q3WA 2C3JA 2C6EA 2PZYA 3ODYX 4QTEA 3LFEA 3C5UA 1YW2A 2O8YA 4RGJA 3FZRA 4UWBA 2C0IA 5AR7A 3VO3A 2YWPA 4BI2A 4GJ3A 1STCE 5B2MA 3HRCA 4S30A 3BBWA 3R8VA 4FKLA 2XZSA 3RPYA 3U6IA 4X6RA 4DH8A 2FSTX 5DMZA 1FINA 3LQ3A 4D2PA 4EQUA 2ZV2A 3QLFA 2YCQA 4YR8A 2GFSA 4ZTSA 4RFYA 5DA3A 2Y0AA 4AN2A 4H36A 3ANQA 5I3RA 2YLEA 4FZDB 2PY3A 4ACMA 2J5EA 4OBPA 1ZOGA 3OWPA 4TRLA 1E9HA 3HAMA 3VQUA 2UZBA 2UW6A 1BL7A 3UIXA 3BQCA 3DU8A 2PULA 3BU6A 2R3HA 3EJ1A 4RC2A 5CEQA 5FXSA 5KZ0A 4Z3VA 2RG6A 2HAKA 2X6DA 2YAAA 3R63A 5CZHA 4ZSLA 5HD7A 4ANNA 4D4VA 2X4FA 4OTWA 5G6VA 4HYIA 4ZP5A 4DFNA 4D5KA 3R7EA 1UVRA 3A7FA 4NCTA 3KMUA 4U6RA 3OTVA 4I93A 4O0TA 3UQGA 2X2KA 3G5DA 4EZ7A 3EH9A 4BI0A 1REKA 1HCKA 3PJ2A 4AW5A 4HYUA 4OGRA 5IG1A 4NW5A 1H1SA 4FI1A 3RK9A 3KF4A 4J1RA 2B4SB 1L8TA 4RVMA 3KXNA 4G5JA 1VYWA 3G90X 4R7HA 3ZCLA 4F7JA 2WMWA 5AIKA 5GZ8A 4U0IA 4YTCA 4F08A 3VS1A 2BROA 5CY3A 2C6DA 3OCTA 4L9IA 3QTXA 4EYMA 5I9ZA 5JRQA 2BDFA 1DAYA 3L8XA 4RPVA 2J0IA 2OXXA 3GCPA 4C4GA 4EEVA 2CKQA 4DFUA 1WBWA 4XOZA 4EI4A 2P4IA 2J4ZA 4FKUA 3W2CA 4O6LA 2CGWA 5FBOA 3KKVA 5DT4A 5E92A 2BAQA 4C3RA 3VUIA 3MJ2A 3R8MA 5KHWA 3OP5A 1BX6A 5IUHA 4BHZA 2XMYA 2XYUA 2XP2A 4DGGA 4IEBA 2E2BA 3HV5A 2WMQA 2WU7A 5HO8A 3NUSA 4HZRA 3FL5A 2Z7LA 5CF8A 3E5AA 1WVXA 3BHVA 4WIHA 3DDPA 3MS9A 4K2RA 4TZRA 5J9LA 2O63A 4FSRA 4UX9A 3FAAA 4RVKA 5BX0A 2XF0A 4FOBA 4U9AA 4CFFA 2QLQA 2F2CB 3CJGA 4FZ7A 3AC1A 5E91A 2PUUA 5I9XA 4MBLA 4AFJA 1IG1A 3DJ6A 4J52A 3FBVA 2KTYA 3ATSA 2RGPA 4KUJA 4AGCA 1P5EA 4MK0A 4XEYA 3O96A 4U97A 3KRJA 4YZMA 4PF4A 1H4LA 5HIDA 3DFAA 4DFBA 5CSXA 3O17A 3QQJA 4D4SA 3LJ2A 4K11A 5M57A 5C4LA 4BDDA 4QYHA 3PIXA 4YHTA 4ZY6A 3RALA 2VTLA 4KA3A 2XJ1A 4QPSA 4CMTA 2BRGA 3QBNA 4JG6A 3DB8A 4N6ZA
chains in the Genus database with same CATH superfamily
2H9VA 4QP1A 4OAUC 3NVMB 3Q04A 2XEZA 4J98A 4KNBA 3R83A 2YEXA 4D2RA 3QQKA 2PMLX 3TNIA 3IOKA 4QP4A 4X2FA 3TL8A 3TEIA 5IQBA 3KY2A 4FEUA 3OFMA 2XNGA 2ZV9A 4PL5A 5CXZA 1K9AA 3Q53A 3LFFA 3W0SA 4F9CA 2IZSA 4DITA 1Q8YA 3ZSHA 4JG8A 3FMNA 4L8MA 3C4ZA 3VF9A 4EQMA 3R1SA 5AJQA 5ETIA 3C7QA 3CBLA 2YN8A 5EYDA 5DH3A 4HVIA 2CGUA 4UEUA 4DCAA 3Q6WA 5HU9A 4I0SA 4MTAA 4AZVA 2QKRA 2XRUA 4I5PA 4JR3A 4ASXA 4DFXE 2WMBA 5CAVA 4NKAA 3DY7A 3BYVA 1FBNA 3U8WA 3GCQA 2OGVA 4B4LA 5IA1A 1XH6A 5IEVA 4CG9A 3LQ5A 5CAQA 1JQHA 4WKQA 4HCVA 5L3AA 2PUIA 3NYOA 4MCVA 3VAPA 4OLIA 4IZYA 1B6CB 4F7SA 4DA5A 4NM7A 2WO6A 2IEWA 4FTTA 3EN7A 2XAOA 4IZ7A 2YLFA 4AQKA 4LI5A 2BR1A 4RQVA 1J7LA 5ETAA 5IISA 4IM2A 4MXXA 3M1SA 1EH4A 4LOPA 4AXAA 5HLWA 3EQRA 4IVAA 2X9EA 5EQEA 4RWKA 2JKMA 4WG4A 3KXZA 3DLZA 4GJ2A 4AE9A 4IB5A 4J99A 1SNXA 2C6OA 2R2PA 5DT0A 3ZC6A 4C34A 4DBNA 4DG0E 4Y46A 5FRIA 5K4IA 4ZS0A 1YWRA 3IGGA 4R77A 2A98A 2GNGA 4LGHA 3SDJA 3MB7A 5ANIA 1CM8A 2G9XA 2VRXA 3AD6A 3JPVA 5HVYA 1M17A 4D5HA 3UDBA 3HL7A 2VO6A 4BICA 4DG3E 1PYEA 2UW8A 5F4NA 4MHAA 2I7QA 4A9UA 1ZZ2A 5AV2A 5IQGA 3O5AA 3LFSA 4H1MA 5AAFA 3RKBA 3MFRA 3NIEA 1M52A 3LCOA 5E1SA 3ZLWA 1R0PA 3ZZWA 4LMUA 4KS7A 4LV7A 3MVJA 2FVDA 2P0CA 3OUKA 3Q9YA 1U4DA 3E93A 4FV7A 4AA0A 5JZJA 1GAGA 3ZOSA 1NVRA 2YERA 2WTDA 2Y4IC 4OBOA 3HRFA 3DAJA 4CYIA 4J8NA 2QKWB 4KSQA 3R8UA 4A9RA 2NP8A 2AQXA 5IQFA 4DHFA 2CN8A 4IFGA 3LFCA 4ITJA 1OMWA 4I20A 4QTAA 5CNNA 4YSJA 3COMA 4GK4A 4NSTA 2C3IB 3PG1A 3R1YA 4O0WA 3BRBA 4WG3A 5KMOA 4BDCA 4XLVA 5HQ0A 4AOJA 3PXKA 3SOCA 3Q5ZA 5CENA 3FY0A 5IUIA 3S95A 2ZYBA 3MPMA 4I24A 5HE2A 5DRDA 2QOFA 2G2IA 4F1OA 3PFQA 1MUOA 3UVQA 4A9TA 4KS8A 3ALOA 3DBDA 2UZUE 2JDTA 2XK9A 4F0GA 3IECA 4TNDA 2WQMA 3K3JA 3FQSA 2WU6A 3GI3A 4PPCA 5FUTA 4QRCA 3U9CA 4EOLA 1ZY4A 4N0SA 2BCJA 3R7UA 1QPDA 5BPYA 3UQCA 4FKIA 4XHKB 5HLPA 3PXRA 5HG9A 5HBHA 5EDQA 2WMUA 4MD8E 1JPAA 4FTOA 4PTCA 4Q9SA 3D14A 3FXXA 3QCSA 4X3FC 4BGHA 3W2RA 4C4EA 2WOTA 5C8MA 3QGWA 3PLAE 4QP3A 4FG7A 3EQHA 3HDMA 3VBYA 4E4NA 2CGXA 2YACA 2J51A 4TYHA 1P2AA 1WBOA 3RJCA 3LOKA 1K3AA 3OBGA 4BDJA 3B8RA 2B9HA 2G2FA 3II5A 3VUHA 4F6WA 2XKDA 3MFTA 3LHJA 2PZRA 4LMNA 5HTCA 4DEIA 3NNWA 5ANDA 1E1XA 4AN9A 1WFCA 3IS5A 4YJNA 1IEPA 4Q2AA 5KKRB 1LEZA 3BE2A 3SV0A 1XBAA 4EH8A 2PVFA 4WBBB 4AA5A 2BVAA 2OO8X 4FV1A 3SXSA 2X1NA 3V3VA 1NA7A 3FLYA 4KIQA 2BZHB 3DK7A 3VUMA 4FR4A 3D94A 4BCKA 4CLIA 3P7CA 3R7VA 4H1JA 3FZSA 4XX9A 5JMSA 4BYJA 3ZUTA 3O2MA 4YZ9A 5HLNA 4FK6A 4L53A 2YM7A 1BI8A 4L67A 4EWQA 3GBZA 4FOCA 5C26A 4TL0A 1WBTA 4IX3A 1MP8A 3PG3A 5KNJA 5KE0A 4ACGA 3R0TA 4X7QA 4ACDA 3FQEA 3MH3A 4YSMA 1XHAA 2BPMA 3C4FA 4PRJA 4U5JA 4A06A 2XM9A 3H10A 2E9VA 3FE3A 3LXKA 3S4QA 1BUHA 4BTJA 3D2IA 5DR2A 4DH3A 2VTSA 3U55A 5IDPA 2UW0A 4AWIA 3VS4A 1H1RA 3E7OA 1PMEA 4RWJA 3IQ7A 3U6JA 5ANKA 3QC4A 4EK6A 4QD6A 3IW7A 4HNIA 4OBQA 4ZZOA 4X3JA 1RDQE 4L3LA 5CAOA 3EN9A 3N4UA 2J9MA 3DJ7A 3ZBXA 3MVMA 4U41A 3RP9A 3LJ1A 3NYXA 5AUTA 4C57A 1XBCA 3WZDA 3H0YA 3U87A 3UG2A 5JN2A 1T46A 4CZTA 3Q9WA 2RIOA 4FTNA 3RZFA 3VC4A 2CPKE 3FDNA 3JVRA 5AFVA 4OTHA 4ANLA 4P7EA 4LV5A 1YDRE 3UOJA 1TQIA 5BMMA 3PPJA 4CCUA 5LVOA 4EK5A 4FTAA 1UU7A 2CN5A 1GZ8A 3QU0A 2Z2WA 4IHPA 4RMZA 3VBQA 3DXNA 3FXWA 5AP5A 2WQBA 2W9FB 3P0MA 4V04A 4YP8A 5I5ZA 2R3IA 4LOOA 5CU2A 4DN5A 4LL5A 4EH3A 2EWAA 4NU1A 4IB1A 2CCHA 3FI3A 3BEAA 4M84A 4MXAA 5HBEA 3FKOA 5CEKA 5K0XA 1YRPA 1ZZLA 4JDKA 4C8BA 5FXRA 4QQCA 2WTKC 2X81A 3AQVA 4FBXA 2GPHA 5E8SA 3SG9A 4L3PA 1MQBA 5M4CA 4J95A 3Q5IA 3QD4A 4U7ZA 2UVYA 4JBQA 3FSKA 4WUAA 3T8OA 5T3QA 3ZSGA 2X7OA 4C4HA 3M42A 5H8BA 3KMWA 3ZZEA 4FKGA 2E9OA 4Y5HA 4MXZA 3SGCA 1ZOEA 3F2NA 2UZLA 3R28A 5EYMA 2JDRA 2YM8A 3DZOA 3VIDA 2VWZA 1JNKA 3OVVA 3QL8A 5EK7A 4J96A 3HA6A 4CKJA 4EUTA 4H58A 1PXPA 1TZDA 3AT4A 3RM7A 2BKKA 3F61A 4IMYA 3EZRA 3UMWA 3VS0A 3W2OA 2IN6A 4HPTE 3ZUVA 1BL6A 1PKGA 4IX5A 4QNAA 4X2KA 4XJ0A 5HX8A 3I0OA 3DA6A 3D7ZA 4HYHA 5BVEA 4WNMA 4AS0A 5CSPA 4I4FA 5EDPA 4P4CA 3OROA 4EHZA 5CASA 5L2WA 4ALUA 3CGFA 5BQ0A 5IU2A 1YXUA 3GU5A 3TM0A 4O7RA 2PVNA 3RPOA 1H1QA 3B8QA 3PUPA 4J7BA 4KBAA 4TW9A 5HE1A 3TI1A 5K4JA 3P78A 3CE3A 4XRLA 3TNHA 4M15A 3WF8A 4E4MA 3OTUA 1GIHA 4O7NA 5FGKA 1UWHA 2VGOA 4EK8A 4EOJA 3BI6A 2V0DA 3QQLA 1MQ4A 5ACKA 4CTBA 4EOKA 2CCIA 2IVTA 3KXXA 1XMMA 4IM0A 2C69A 1R0EA 3JYAA 3FMEA 3LFAA 4M69A 4RC3A 4DEAA 4EH6A 4JDJA 4RIXA 4DGLC 3A61A 3PZEA 4Z7HA 1CKPA 3NUPA 4DTBA 3PPKA 4R8QA 4NW6A 1MRVA 4OUCA 3TNWA 4D58A 4K77A 4RVLA 2PMIA 1YOMA 3NAYA 3QC9A 5BVKA 4NFNA 4XG7A 4F7NA 3G6GA 4IAYA 2F4JA 1ZRZA 3DGKA 4USDA 2VX1A 3ODZX 4Q5EA 4X2NA 4U40A 1OECA 2I40A 4H05A 3PSDA 2C5VA 4G6OA 3ZS5A 3ORLA 1OPJA 1Y8GA 2EXCX 2BDJA 4IACA 3VF8A 3W2QA 3AGMA 4GRBA 4HVGA 3DFCB 4A4LA 4HCTA 4AT5A 2ZM3A 4XOYA 4FTRA 4GIHA 3DTWA 2XB7A 4MAOA 4YJPA 3JY0A 5CF5A 4AZWA 3V6RA 4ZTRA 5JK3A 4WG5A 3Q9XA 4FIFA 3BGPA 3EZVA 4FODA 4YHFA 3UC4A 5EKNA 4CFVA 1TQPA 5M53A 4QMOA 1OBGA 4IAZA 3RAKA 5AUWA 3UNZA 3RI1A 4FTCA 3V04A 5TO8A 4AGWA 5M09A 5LVNA 1HOWA 3SC1A 1J1CA 2R0IA 4AU8A 3R2YA 3KIOC 2YDIA 4I41A 4B6LA 4Q5HA 3O8TA 4RX5A 4V0GB 4NUSA 4ANBA 3COKA 3FJQE 3ROCA 3EMGA 4FA2A 1U54B 5JGAA 3F3WA 3QXOA 5KKRC 2YDKA 4XG4A 3DDQA 4E5WA 2WIHA 1PXMA 1QL6A 3TCPA 4PNIA 3VBVA 4EKKA 4FT3A 3FPQA 1YI6A 5FP6A 3C50A 1S9JA 1KV1A 3Q2MA 4U45A 2GNIA 5IQAA 3R00A 2ITXA 4WOVA 2CKOA 1QMZA 3FLWA 3UDZA 5IMXA 4FMQA 4BCQA 1W7HA 2ONLC 3G0FA 5HCYA 5BV3A 3ANRA 5K3YA 4A07A 2W96B 3H30A 4YJVA 1XMLA 4IWQA 2F7EE 1B39A 2WMSA 3G51A 1VZOA 5LWMA 1H27A 4XG9A 4YJUA 4A7CA 2DYLA 2VX0A 3F7ZA 3L8PA 1ST4A 2OBJA 2BZJA 3FHRA 2XNNA 4IADA 4BB4A 2W1FA 3OEZA 3FMHA 4ZEGA 3FI8A 3F5UA 1R39A 4FKWA 5CSVA 3ZTXA 3BWJA 2ITOA 3OD6X 5HO6A 2YISA 3EYHA 2AC5A 4E6CA 4YNEA 4ITHA 4EBVA 3EQCA 4ZK5A 2ESMA 4G6NA 3ZLSA 2XIYA 3NW5A 2YWVA 4G6LA 4RVTA 1H07A 3OUNB 3A60A 4BJJB 4FKSA 2C0OA 2OJFE 2W0JA 3KN6A 3OOGA 4FVQA 4IBMA 4XP2A 3RWPA 5JFWA 2HWPA 3ORIA 4RJ6A 5ETCA 3NX8A 2CJMA 2QO9A 3TTJA 3KREA 3EQFA 4OR5A 3F3VA 1XH5A 2RFNA 3D0EA 3JR1A 4C36A 5AA8A 5EG3A 4FSQA 2J7TA 5AP4A 1W8CA 4IX4A 4FL1A 2Z8CA 4EWHA 3U6HA 1UV5A 3R21A 3RHXA 2X0QA 4K0YA 4AX8A 3UMXA 4YHJA 4GCJA 4ZLOA 3V5JA 4YUQA 4PNKA 2PPQA 2QNJA 1QCFA 3QQHA 1ND4A 5EQYA 3OCBA 4IM3A 5D9HA 3EFKA 2G15A 5LMKC 3BYMA 2PE1A 1J1BA 3QHWA 3E8DA 4RSSA 4PWNA 4K1BA 2VTIA 4XBUA 2WD1A 4TWNA 3OWJA 2W1EA 2QOBA 3GFWA 3P23A 4IQ6A 4R7BA 5E8VA 4BBMA 1YXTA 1ZLTA 4YLJA 3TKIA 4D2SA 2RFSA 4ZOGA 1W83A 3IW5A 5J79A 3PP0A 4IH8A 3ZFXA 4BKJA 4FV6A 4FIGA 4RG0A 4NM5A 2H6DA 2NPQA 4RT7A 1Y8YA 5L8LA 2IPXA 4KINA 3CXWA 4JQ7A 1H08A 3MFSA 2PVJA 4D1XA 4D4YA 2EUFB 3GB2A 3CY3A 4PMTA 4C37A 4CQEA 4YZNA 3ENHA 4YJRA 4XG2A 3Q4TA 1YQJA 4FNZA 2XK7A 2Y4PA 4FZFB 1KE9A 2HIWA 4J97A 2XEYA 3VUGA 3KCFA 4FUYA 1KE7A 2IG7A 1I44A 2ZV8A 4QP6A 5IQCA 3NCZA 3S2PA 4WNPA 3CJFA 3LFNA 4O84A 3VULA 3I79A 4FYNA 2GNFA 4M14A 4TN6A 5GIOE 4O86A 4PMSA 2VTNA 1WBNA 4P90A 2FH9A 4PTGA 4HVHA 2BMCA 4AUAA 2WAJA 4FSMA 4ZTHA 2UW4A 5M08A 4M0YA 4JQ8A 3UBDA 4M7IA 2LAVA 2ZOQA 4ZSGA 5AUYA 1GZKA 1OKYA 4K33A 5DNRA 2JD5A 3H9FA 4QO9A 3F6XA 1IAJA 4FKRA 3ZH8A 1ZWSA 3P79A 3QKLA 3LMIA 3VJNA 2GHGA 1RJBA 3Q4UA 2PTKA 3MBLA 5KMLA 4RWIA 4DCEA 5HKMA 4FV2A 4X6QC 1WMKA 2FB8A 5CT7A 3R9OA 4QMQA 5IA3A 3BV3A 3O7LB 5AADA 4H3PA 5HHWA 3OG7A 4LFIA 2HCKA 1URWA 2WTWA 5DRBA 4IANA 4BKZA 3DS6A 5TF9A 4D1SA 4YZBA 4E1ZA 5KBQA 5DYJA 2RFEA 3NNVA 3R7GA 3CTHA 4TTHB 4YTIA 4F1MA 4EL9A 2WTIA 3BYUA 4GYIA 2YJRA 4Z7GA 4N70A 4Q9ZA 1PRYA 2P2HA 2Y7JA 5L6OA 5FM3A 4FSNA 3DLSA 3EKKA 3V8TA 2WQOA 3U54A 3IKAA 1CKIA 2J0MB 1LP4A 2PWLA 3F5PA 2UVXA 1CMKE 4UYNA 3SKCA 4LM5A 1Q62A 4D0WA 3RPRA 3FLNC 3ORNA 2BAJA 3RMFA 2PVYA 3OMVA 3TKHA 2QO7A 3W0QA 3R2BA 1ATPE 3C1XA 1ST0A 2ITPA 4GMYA 5CEPA 3E8CA 4X2GA 4W4WA 2PU8A 4G3GA 5A4QA 2XKCA 5J7HA 2VD5A 1M7QA 3SRVA 3FLZA 4FV5A 3E64A 5TR6A 3GCSA 5CTPA 4DH1A 1JKSA 4I21A 4OTIA 4WSQA 4MD9E 5CNOA 5ANOA 3UNJA 5IUGA 3I4BA 1PMVA 2CNVA 4ENYA 2ETMA 4D9TA 2YIWA 5CXHA 5HORA 4G34A 1LEWA 3QQGA 4EK4A 3FZTA 5BNJA 2HZIA 4LYNA 4E7WA 2PK9A 1ZARA 5BVWA 3LPBA 4L68A 4FTJA 4I0TA 3PA5A 5CT0A 3VUKA 5EDRA 4ZTNA 3O7LD 1IASA 5HVJA 4O2PA 3HRBA 5BMSA 3VONA 1YXSA 2ITWA 2JBOA 4C61A 4QMSA 5ICPA 3PPZA 5L6WL 2CMWA 3MY1A 4QYEA 3CS9A 3PVWA 5C9CA 2YZAA 4FGBA 5H3QA 3I5NA 3TJCA 5CAUA 1G3NA 1H00A 2O5KA 1WZYA 1O6KA 3TZ7A 2RFDA 4BGGA 3EYGA 5AM7A 2RF9A 3FYKX 3RVGA 4YC6A 1PJKA 2W4KA 2GS6A 2JAVA 4M13A 4EJNA 2BDWA 3E3PA 3F5GA 4L46A 4OTRA 2R7BA 5E4HA 4KBKA 4ZJVA 4F63A 4DH7A 3ALNA 4JG7A 4NCTC 4O7VA 5IH5A 3PIYA 2W1CA 3PXFA 3Q4CA 5HEZA 4NZWB 5IH6A 3LCDA 5FXQA 3I6WA 4RX8A 5J9ZA 4F9AA 2R0UA 3R8LA 3UIBA 5KMJA 3NVKI 2ETRA 2WXVA 2XK8A 3NW7A 3UDSA 1OUYA 2VTAA 2Y9QA 5JFVA 2JLDA 4FC0A 2X8DA 3GCUA 2VTMA 5DHJA 5DOSA 3BV2A 3P5KA 3ZUUA 2R3NA 2I0HA 5FM2A 3QTIA 4JQEA 3CD3A 3A8XA 4DFZE 5F1ZA 1ZOHA 4YURA 2XIZA 5M55A 3UC3A 3UO4A 4DEGA 4DGMA 2PZPA 5I4NA 1Y6AA 1Q5KA 4KBCA 2FSOX 4IZ5A 1H25A 2OJ9A 4QP8A 2Y6OA 5EM7A 5HU3A 1O6LA 2OU7A 4RBLA 1OZ1A 4CRSA 1AD5A 2OJGA 3P86A 2Z60A 4YGAA 3MESA 4TYHB 4IJPA 4GFOA 3D5VA 4JXFA 4DAWA 4BBEA 2YIRA 2XIKA 5IEXA 3FI2A 4B7TA 3SAYA 3CP9A 4TPTA 4HZSA 2VWVA 1T45A 4FSYA 4BZOA 4G31A 2QG5A 3M11A 3LFDA 3FEGA 3OW3A 4YBKA 2C6KA 1XWSA 1BYGA 1IA8A 4FKTA 4O0YA 2HELA 1B38A 3AC2A 3O71A 3OZ6A 4I6HA 5DWRA 3FXZA 3ZRLA 5C1QB 2FGIA 4KD1A 2VNYA 3PUFC 4GU6A 4QTBA 4O82A 1KOAA 2B9IA 3HGKA 3Q3BA 1U59A 1ZMUA 2BILB 2OF2A 5IPJA 5DI1A 1Q4LA 2PMOX 3CCNA 3P08A 3GXLA 3O0GA 5HTIA 2X6EA 2GTMA 3BIZA 3S1HA 1Y91A 4LG4A 3SD0A 1PMNA 2YDJA 3L9NA 5LMAA 1G8JA 1YOLA 3MGYA 4W8EA 3BKBA 3LCSA 5L6PA 3D5UA 3GQIA 4LUEA 3TUDA 3GU6A 4AQCA 4O4FA 4ZLYA 4CGAA 3PRIA 5K0KA 5JH6A 3G0EA 5K9IA 1G8AA 3QX2A 4FZ6A 2C1BA 4FG8A 4FNYA 4NM3A 5JQ5A 3IW6A 3TXOA 5BVNA 2H8HA 5L2QA 1BKXA 3SXFA 1U5RA 4I5MA 1VJYA 4MEDA 2C3LA 4O38A 3CQWA 2WIPA 1ZY5A 3TT0A 3QCXA 4FEVA 5TT7A 4CRLA 2XA4A 4DT9A 3HZTA 3SLSA 3CIKA 5ANEA 3S3IA 3DAEA 3MB6A 4O7WA 3MDYA 1XH7A 3DV3A 3HECA 5M4UA 3DKOA 3ZONA 5CAPA 3QHRA 5JZNA 4O4BB 3A99A 4C59A 1FGKA 2JDOA 2ZJWA 4XP0A 4F9BA 4F9WA 1Q97A 1OL7A 4O7YA 4GT5A 4BCPA 4ZY5A 3UOLA 4EC8A 2O0UA 3ULZA 5CVHA 1TQMA 4RX7A 4DEBA 3BWFA 1GIJA 3OT8A 1XR1A 3WYYA 2OH4A 4QP9A 5J95A 2WKMA 4AW0A 4TWOA 3MH0A 4QP2A 3E63A 3QCQA 3VRYA 3EB0A 4Y73A 4PQNA 2C5OA 4Y5QA 3LFBA 3KVWA 3LE6A 2C6MA 2WPAA 4YC3A 4CFNA 3WZJA 1F3MC 1OIRA 2XRWA 3R6XA 5LWNA 5CLPA 1F5QA 4DFYA 2VO7A 4IDTA 3HYHA 5HNGA 3GUBA 3BE9A 3GU8A 1JKLA 2QURA 3BHHA 4GW8A 5L4QA 3NFGB 3FKLA 4GKIA 3FMMA 3HMNA 4NWMA 4WHZA 2O64A 4O96A 3C51A 3HMPA 3D7TA 2WMTA 5DVRA 2Z7RA 4YZCA 3I5ZA 3LCKA 4ZTLA 3GC9A 4FV0A 4FNXA 4ID7A 3UZPA 4Z16A 1YHVA 5F95A 1GOLA 5HE3A 3VNTA 4QMYA 3KRLA 4BCHA 1XKKA 2CGVA 3PA4A 1V0OA 4D0XA 3W0RA 3HA8A 4RJ7A 4LRKA 4HVDA 5ETFA 4O0VA 4B0GA 4W9XA 3TV4A 2V62A 3EWHA 3BLAA 4LOQA 4JOAA 3PVGA 3LKMA 4L43A 3BEGA 2W4JA 5B0XA 5JFSA 4JBOA 2GFCA 4HPUE 3F88A 4RLLA 4FVPA 4A4XA 4C4IA 3D83A 4C2WA 2BRHA 4AOTA 3PE1A 4M0ZA 5A6OA 5EYCA 3R7YA 1JKKA 3L8SA 3FL4A 3H0ZA 3R30A 4LDTA 3QLGA 4F6SA 4ALWA 3PFYA 2QODA 5CF6A 3KK9A 1OUKA 5I0BA 4X3FA 1CTPE 4UYAA 4TKSA 5LCKA 4BZNA 4C62A 3U51A 4ZSEA 2BIKB 5ACBC 2IZUA 3GEQA 4L6QA 2XK3A 3ZBFA 4R3PA 5LVLA 4M69B 2GS2A 3C9WA 4NTSA 4F0IA 3BHUA 5ANGA 4RIXB 3TDVA 3KFAA 3M2WA 4H3QA 3MPTA 4MF0A 3QUDA 5AAEA 5BYLA 3K54A 3BHYA 3MH1A 4ANQA 2WFYA 3BYSA 2A4LA 3R9DA 2XH5A 3R8PA 3AD5A 4G16A 3A4PA 4ZMEA 3DQXA 3LMHA 3ET7A 3CTQA 2VTHA 5E1EA 5EHYA 4C38A 4EH4A 5HVKA 4CMUA 4O21A 4I3ZA 1BI7A 4GG7A 4XV9A 2PVLA 1FOTA 3N4VA 4LRJA 3ZM4A 2YJSA 2QQ7A 3PDTA 4JDIA 3R04A 3V8WA 4D2WA 1UKHA 4L45A 4QMVA 3VVHA 4PMPA 3LXPA 4OTDA 2IJMA 4BFMA 2W1ZA 2R7IA 4MBJA 4XNEA 3RBWA 3W16A 2P55A 2VWYA 3NEWA 4FIHA 2H34A 4BR3A 5IKWA 5HOAA 3POZA 2QC6A 4R1YA 2Z7QA 4XV2A 3EN6A 4HGTA 1VYZA 3ZM9A 4AXCA 1U5QA 3NGAA 3FHIA 3LCTA 3R9NA 3VS5A 2XAMA 4QP7A 3VBXA 2ITTA 1UNHA 2PE2A 4I5CA 2R64A 1IR3A 2XBJA 3HV6A 1UWJA 4HNFA 4IAKA 2EU9A 5CU6A 3RAIA 3WI6A 4D4RA 1OL6A 5CSHA 2XNOA 4G3DA 5E8TA 3FPMA 4TT7A 4BDKA 4D28A 4YTFA 5LQFA 3AC8A 2R3GA 5AUXA 5CEMA 1K2PA 1P4FA 4AXDA 4CKIA 3PSCA 3W32A 4ZZNA 1J7UA 2BRNA 4AZTA 3EQIA 4U3YA 2R3FA 2OW3A 4MXOA 3OHTA 1S9IA 3B2TA 3PSBA 2XNEA 2XARA 2REIA 2AUHA 2X39A 2B7AA 2J0KA 1P14A 5C03A 2YCRA 3GC8A 3W18A 2XIXA 4PP9A 2Y8OA 4E6DA 3V8SA 1PXJA 3H4JA 4WNOA 4GU9A 4E20A 2YITA 2HK5A 5K5NA 2UZOA 4JBPA 4MVFA 3EFLA 1YHWA 3UJGA 1OKWA 1YWNA 4QMTA 4KKEA 4M67A 5JSMA 4XP3A 4YPSA 3FSFA 1LUFA 3IPHA 2C68A 3ITZA 3KULA 4OTGA 4RJ3A 4ZSJA 4XMOA 4G1WA 1J3HA 1E1VA 2JGZA 4LUDA 3I60A 5J5SA 4L00A 2AYPA 2R4BA 5EI8A 3LAUA 2HW7A 4E4XA 2C47A 5AP0A 4BIDA 5HE0A 3HV3A 4MQ2A 1Q99A 4DBXA 3BELA 4S32A 4DC2A 5EW3A 4FG9A 4O0XA 2CDZA 4R3CA 3R7IA 3RPSA 4BDFA 4FE2A 4H39A 4AAAA 2VTJA 2CNQA 2BIYA 4BC6A 1ZYCA 3MVLA 4GK2A 4B8MA 5HZNA 2XJ0A 2FA2A 3UO6A 2G2HA 1V0PA 3P9JA 3QRJA 1DM2A 2WTJA 3DXPA 2WEVA 4AGDA 5M4IA 4DHZA 1FMKA 3NUAA 3QXPA 2X9FA 4CLJA 5J9YA 2QHMA 2ZB1A 4RIYA 4UMRA 2OXYA 1H26A 2P3GX 3TDWA 4QMUA 4EH5A 1R78A 3U4WA 5E9EA 4I6LA 3G33A 5EM6A 4ARKA 4EOPA 1O6YA 4F65A 1ZYLA 5F94A 1FGIA 4ZTQA 4JMQA 3QAME 2FSMX 5LOHA 4AT3A 3WOWA 4QPMA 4ASZA 2CKPA 3UZRA 5M56A 3NFFB 2V55A 3D2KA 3C0GA 2OFUA 4FSZA 3QZHA 1MRYA 2B55A 4AW2A 4QMNA 3TMOA 4JAIA 3QD2B 4BCJA 5AV1A 4CV9A 2W4OA 1W98A 4KAOA 3FI4A 4C0TA 2JIUA 3ZHPC 5BUJA 5E8XA 4EJ7A 3HP5A 4NJDA 3A62A 2F2UA 1PKDA 5HCXA 4EUUA 1SVGA 3AT3A 4IIRA 2PYWA 4Z55A 4F7LA 3QUEA 4M68A 5AP3A 2IW9A 1WBVA 2WB8A 3H9RA 4GT4A 3NIZA 3UQFA 2QR7A 4QMWA 2Z7SA 4O7SA 3NLBA 3NS9A 5FDXA 3WE4A 5A9UA 5D7AA 4I22A 4IZAA 3FUPA 2P33A 3AC4A 3WE8A 4EH2A 3QTWA 4CG8A 1XH8A 2QOIA 3CKXA 5KUPA 4NTTA 4BDBA 5IMEA 1YWVA 4KSPA 5J8IA 3QKMA 3UG1A 5F20A 3WIKA 5FEDA 5AP7A 4P5QA 3A2CA 4PP7A 2BALA 3NUYA 4P2KA 2VN9A 4QMLA 5CSWA 4V01A 3RK7A 2GU8A 2X4ZA 4S33A 3F7WA 3N9XA 3PVUA 3OS3A 1X8BA 4D55A 3UODA 3P7AA 4BDGA 5E8ZA 4EOIA 2XCHA 1TKIA 3PTGA 4KRDA 2VO3A 3POOA 4IB0A 1REJA 4L42A 4XLIA 2PVKA 5FD2A 1PYXA 1PXOA 5HGIA 4I6QA 4L01A 3TKUA 5JT2A 2W99B 2X0OA 2GHLA 4FV8A 3RK5A 4DDIA 1PXNA 3NPCA 3O8PA 4GFGA 5FQDC 4MXYA 4BVUA