3OHTA

Crystal structure of salmo salar p38alpha
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
348
structure length
331
Chain Sequence
ERPTFYRQELNKTIWEVPERYQTLSPVGSGAYGSVCSSYDVKSGLKIAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPATSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGYRAPEIMLNWMHYNMTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTGTPPASVISRMPSHEARNYINSLPQMPKRNFADVFIGANPLAVDLLEKMLVLDTDKRITASEALAHPYFSQYHDPDDEPESEPYDQSFESRQLEIEEWKRLTYEEVCSFETP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords p38a
publication title p38alpha MAP kinase dimers with swapped activation segments and a novel catalytic loop conformation
pubmed doi rcsb
source organism Salmo salar
total genus 95
structure length 331
sequence length 348
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ohtA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ohtA01
5HO8A 4L42A 4PPAA 3C5UA 2W1ZA 1H08A 2SRCA 3A4OX 2OXDA 3KGAA 2VWBA 4FIHA 4FV2A 2ZM4A 4IB1A 4L46A 4O6LA 4RLKA 5ANDA 4EOOA 4A9TA 2YHVA 3KRXA 4OW8A 5EYMA 4ZSLA 3RK9A 4WRSA 3O17A 5AUUA 5IQIA 2WXVA 4CLJA 5M4FA 3BYVA 3PSBA 4P4CA 3BBWA 1Q3WA 2XIRA 2JFMA 4LUEA 4TYHB 3TG1A 5HNIX 3I81A 2CLXA 4G6NA 5CAOA 3JS2A 4IM2A 4W8EA 5A4QA 3QGWA 5BVWA 2XMYA 4MF1A 1WZYA 4ID7A 4ASDA 5J9LA 2YWVA 3UVPA 3ZONA 2UW5A 2QKRA 3GU4A 3OWKA 3WZKA 1JKTA 1T46A 2QQ7A 2BPMA 2UW3A 1PYEA 3PE2A 3B2WA 3MTLA 3BHVA 3NYOA 3R1YA 4EH4A 2UW7A 5CAUA 2OJFE 3PE1A 5J1VA 3JY9A 3PUPA 5HTCA 3POZA 1IA9A 5AP3A 4QYGA 4AGWA 4I4EA 2UZUE 1TVOA 2J5FA 3KK9A 3FPQA 1OBDA 2OXXA 3ATTA 4UWYA 1GAGA 4R1YA 3KF4A 4G34A 1NY3A 3ZC6A 4F7LA 3TUCA 3SDJA 5I9WA 4C3RA 4BWXA 3HLLA 3R04A 5C4KA 5KHXA 4K8AA 1W8CA 2OH0E 3RKBA 2UUEA 2QO7A 2GNHA 3ZDUA 4D9UA 1OL5A 3NDMA 3AD6A 5J1WA 1UNHA 4ANMA 4NYEA 3OC1A 2C30A 3G6GA 3QKMA 3R21A 4FKPA 5I4NA 4R78A 3Q4TA 4FNZA 3PSDA 3U87A 5EM5A 4WBOA 5JFVA 2YCSA 3RAWA 3LJ0A 4FSZA 4EBVA 3NUXA 4EQMA 2YM3A 2OGVA 5F20A 1OITA 2VTHA 3PPJA 5K0KA 3TZMA 2FVDA 2WTKB 3A7HA 3AMAA 1M7QA 1XH5A 5HIEA 2BAJA 2WFYA 4K11A 2YAKA 3DS6A 4GK4A 3SRVB 2CGXA 4FKIA 2PZIA 4MNEB 2CNVA 1WBPA 3D9VA 1M14A 4CRLA 4YURA 4JG6A 5CEIA 2PTKA 5J7HA 4ZY5A 1Q61A 3FMMA 4XG7A 2PVJA 4R7BA 3HMOA 3WF7A 3C9WA 5L2SA 4AZSA 1YQJA 4LV5A 4HVSA 3VUKA 4FSRA 3ZUVA 2VTQA 2C6MA 5JK3A 2R3HA 3WYYA 4L01A 4RMZA 4UZHA 1URCA 4JIAA 1BYGA 3VBQA 4O38A 5HICA 1GZOA 1FGIA 2W96B 3P86A 4ANNA 2PVLA 5HNBA 4O0RA 4GL9A 5BVKA 4D4VA 4E6DA 3OT8A 3OT3A 4IDTA 3UJGA 3VS7A 3MH0A 3CLYA 5KE0A 4C58A 4D5HA 3P79A 4LMUA 2QD9A 3E92A 3Q2MA 3QUPA 4QMOA 4AQCA 3E8NA 4G1WA 3WZUA 2VAGA 4X3JA 1NT2A 3O2MA 3ZSGA 5CAVA 2V0DA 3AC4A 4NK9A 4KIKB 4WNOA 4EC9A 3FLWA 4F1MA 5F95A 2OK1A 4I6QA 4APCA 2XK4A 3LFCA 1XH4A 3GT8A 3OHTA 4YBJA 5HIBA 4AE9A 5DHJA 3VRYA 4AFJA 2Z8CA 3ZRMA 4DGNA 2YM6A 5CSXA 2YERA 2PUUA 3LHJA 4HVDA 1ZYDA 3ZO1A 3H9FA 3O96A 2CNUA 4E5BA 2X8EA 3IDBA 2WU6A 3ALNA 4BVUA 1IG1A 2ETKA 2G9XA 3E88A 4AP7A 3BYMA 4C3FA 4FVPA 3GP0A 5D7AA 3OCGA 5HTBA 2HWPA 3R9HA 3Q4UA 1B39A 4D0XA 1JSUA 3QF9A 5H8EA 3PXQA 4FZDB 2YACA 4IB5A 5LVPA 2CCHA 4EH6A 3QZFA 3MI9A 3E7VA 4WO5A 4DEGA 5L2WA 4WD5A 2VO6A 3F6XA 5IA3A 4O7WA 4BCOA 4FTOA 4QTEA 4NM7A 4QMMA 2XEYA 4BI0A 2A19B 4JQ7A 3NMUF 2ITZA 4KABA 3Q60A 2I0YA 4AZFA 4CG9A 1XQZA 3UIMA 3TZ7A 3NUSA 5AP0A 5CANA 3Q32A 1YWNA 4IX6A 3W10A 3M11A 4PWNA 3OXZA 1KSWA 3FZTA 3SXSA 3KMMA 3RVGA 2O0UA 3AG9A 4PTCA 5CI6A 3HKOA 4A4LA 4DH8A 4HGEA 4IH8A 2QR7A 5I9ZA 2A0CX 5ETFA 3ET7A 4UMQA 1S9IA 2BRGA 5FM3A 2CMWA 5CQUA 4EOKA 5A4CA 1PXNA 3OBGA 3WYXA 3D7TB 3HVCA 5AADA 3SAYA 2XA4A 5EW8A 5IQGA 4OTRA 3EQRA 5HCXA 5DFPA 5AP6A 4CMUA 2IW9A 4GW8A 4BCFA 2PPQA 4KRCA 3ZOSA 2IZSA 4RJ4A 4EWQA 3Q9XA 3MJ2A 1R1WA 5LVLA 2WIHA 3CIKA 3H3CA 4FZ6A 4IAFA 4B99A 2XIZA 3KVXA 5CVFA 2DS1A 4MXYA 1H1SA 4J97A 4CD0A 1BI8A 2WHBA 3R7EA 4AA0A 4UMUA 5CF6A 1REKA 3QZIA 1J91A 4CMOA 4FNWA 3EQHA 1UA2A 3DU8A 2CCIA 1VEBA 3GXLA 5KUPA 3GFWA 4ZJIA 4NFMA 4HOKA 2ITWA 3FDNA 2Y4PA 2VO0A 3EN5A 3FQSA 3NAYA 2HAKA 2F7EE 3PRIA 3GCSA 4OTFA 5CVGA 2R3QA 4EH8A 5L6PA 3GQLA 1CTPE 4USDA 5JT2A 3V8WA 4U80A 4L7SA 4MYGA 4GS6A 3T3UA 4RC4A 4AW5A 4EJ7A 4E7WA 4EHGA 4YNOA 1KE9A 4QMWA 3CXWA 4C33A 3TIYA 3BIZA 4IDVA 5J87A 3T8OA 2E2BA 4AGUA 4UB7A 3UODA 3VWAA 4P7EA 1TQIA 4GV1A 4NTSA 4ALWA 1PXMA 1PY5A 3AQVA 4I92A 2Y8OA 1OIQA 3ORXA 2UZWE 4IZ5A 4I1ZA 2RG6A 3BEAA 2VUWA 4EK3A 4QQCA 3FZSA 1XBAA 2F2CB 4JRNA 3S2PA 2R0UA 4XCUA 1UWJA 3DFCB 5D41A 3VW6A 1LEZA 4FV6A 1A06A 2ITUA 3I5NA 3H4JA 3RHKA 5L6OA 5I5ZA 4YTHA 2W1HA 3F5UA 4HGTA 3D0EA 5HD4A 5DPVA 5IEXA 4JRVA 4LV8A 5IU2A 3PPZA 2OJIA 4GVJA 4AXAA 4C34A 1SYKA 3RINA 2X6EA 3ZC5A 4WHZA 2GHMA 3GU5A 4PMSA 5DT4A 2HW6A 3G9LX 5IA5A 3UOLA 5HLWA 2IVSA 4U3YA 4CFXA 4IX5A 3COIA 3WILA 3FY2A 3LMGA 4DEBA 3G51A 4JDKA 4C4JA 4BF2A 4N0SA 2X7FA 4GH2A 4GJ3A 5EDQA 4JR7A 1IRKA 1PJKA 4FZAB 3IQ7A 1ZMWA 4L7FA 4DGOA 2C4GA 4BFMA 4NIFB 1YWRA 2DUVA 3G0FA 4M13A 4EL9A 4PTGA 5E8YA 4RJ7A 5HHWA 4BHZA 4F08A 4IX4A 1XH7A 1IAHA 4OTIA 4AN9A 4ANLA 4M69B 5A14A 4FIJA 3MSSA 4XOYA 4OT5A 4TYHA 4UMTA 1JSTA 1WFCA 4RIYB 4EI4A 3SHEA 3Q4ZA 3A4PA 3R83A 4YZMA 4KS7A 3NPCA 4FTUA 1CSNA 4DG3E 5ITAA 1BX6A 4XRJA 2C3KA 3MS9A 3VBWA 1K9AA 4O2PA 3VHEA 5IQBA 3QAME 3RK5A 4V0GB 4D2VA 2CKEA 2YM8A 3PG3A 3FMHA 4H1JA 3MPMA 4XG8A 5EYKA 5IF1A 2W0JA 4TY1A 5LMKC 3RALA 3BLRA 2HXLA 4FKRA 2EU9A 2WMQA 4O96A 4PL5A 1ZXEA 2B9FA 5M55A 3SV0A 4ZTRA 5EYCA 3KL8A 2J4ZA 5A9UA 2UZVA 1YI4A 1KOAA 2FSMX 2QR8A 3FE3A 3EL7A 3R7GA 3ENMA 4C02A 1URWA 3R2YA 1OIYA 4HCVA 3WI6A 3LFAA 3AOXA 2C69A 4LG4A 5F4NA 2HY81 5L4QA 3COMA 4BN1A 3E7OA 1ZYSA 1BL6A 4AZVA 2OFVA 1GIJA 3HDNA 4YLKA 1PMNA 2O2UA 2W4OA 4HZRA 4YJVA 2XF0A 1SVHA 4PV0A 3C4WA 3MIAA 4JAIA 3A7JA 3MA6A 3REPA 4GFMA 3RZBA 3P7CA 2VX3A 1H0VA 4HYSA 4P5ZA 2AYPA 3DK6A 3ERKA 4BHNA 2GQRA 2G2IA 2H8HA 2E9NA 4JDJA 3CD3A 4RWKA 5CZHA 2CPKE 4NH1A 5DE2A 4YPSA 3R9DA 3WZDA 4M7IA 3TL8A 2JDOA 3BLHA 1JBPE 2ZM1A 5EH0A 3CPCA 2R9SA 4GSBA 5KKRB 4IAZA 3OW4A 3IGGA 3QTSA 3QCSA 4BDJA 5EM8A 1UKHA 5CENA 4ERKA 4F4PA 1JQHA 3CQEA 4TNBA 4E26A 1MQ4A 3KA0A 5LJJA 4D2RA 5AUTA 3SW4A 3R7OA 4MNEA 5FD2A 5AX3A 4RFMA 5AR3A 4HJOA 3BLQA 4EEVA 3BI6A 5DEYA 3BE2A 4F9BA 2F7XE 5E8UA 3LQ8A 4GYIA 4CKJA 1QPCA 3CS9A 2BKZA 1Q8UA 3BHYA 2YA9A 3PTGA 3FMKA 5M08A 3ZFXA 2EB2A 3GC9A 1M52A 3GC7A 4RA5A 4ACHA 1A9UA 4BCPA 5CEOA 5KX8A 2YISA 3QRKA 4IVAA 3OMVA 2JAVA 3NYVA 3TNWA 4DE4A 3AXWA 3QGYA 3QX4A 4BRXA 4R6VA 2ZJWA 5CSHA 5B2KA 3S00A 4MKCA 4D1SA 3EFJA 3QA8A 3NUUA 1DS5A 1OKVA 1Q8TA 3E8CA 3M2WA 3DBQA 5L2IA 3G90X 5AM6A 2VTSA 2XNNA 4Y8DA 4NL0A 3PP0A 4GT3A 4OTGA 4KIKA 5CEQA 4M97A 5C27A 4RA4A 1R0EA 5L6WL 4FTCA 4W4WA 5IH4A 2UW4A 3QUDA 4P5QA 3SX9A 4ASXA 2VZ6A 2UZEA 5LCJA 1JLUE 1FVTA 2B0QA 2QOOA 3Q9ZA 1MRVA 4GEOA 5EK7A 3V01A 4DT8A 1IEPA 3CQUA 3DJ5A 2R3GA 1H07A 3VUHA 3FI3A 4PPCA 4XJ0A 4U0IA 3UNZA 2I7QA 3LOKA 1JOWB 2W1CA 3VUTA 3L9NA 5DRBA 3QRJA 3QTWA 4GG5A 4O81A 5EQEA 5D11A 5DEWA 4U40A 5KNJA 3FV8A 5ICPA 2OJ9A 5JFSA 4RVKA 2VWYA 1BUHA 4PL4A 5DT0A 1OKWA 2FH9A 3IKAA 4RWIA 4O0WA 3R02A 3KN5A 4U43A 1SVGA 4I0SA 4QPMA 4DLJA 2W9ZB 4Y85A 3R7UA 1WBSA 4D4RA 3QKKA 3AD4A 4JNWA 3A7GA 3ITZA 5C8MA 4AA4A 3W2QA 2BDFA 2PMLX 3CR0A 4BIBA 4AX8A 2A4LA 5I9YA 2C6EA 5IZFA 4FT9A 4HNFA 5FG8A 1H1WA 1H0WA 5IDPA 2R2PA 4UEUA 3II5A 4Y72A 3SXFA 3KVWA 1ND4A 4UWBA 3HECA 2BUJA 3EQIA 1PMUA 4GKIA 3FZ1A 2XKDA 3CGOA 2V62A 4EUUA 3LQ3A 4WNMA 4WNKA 4EK5A 4FT5A 4D28A 4K0YA 3LFDA 1P4FA 5TE0A 3VIDA 3E3BX 3TIZA 4BCKA 2J90A 4CZYB 3MFSA 3U9NA 3NW6A 3HMIA 3P23A 4E8AA 3QQHA 3D7TA 3DBEA 4JAJA 4XLIA 3QKLA 5DGZA 5AAEA 3EN9A 4QPAA 2GNJA 3VF8A 4PP7A 2YIXA 2XNPA 4WT6A 4BCQA 1GJOA 3GOPA 3EN7A 4KUJA 5BYLA 4RWJA 3KEXA 5FXSA 1OZ1A 3W2RA 3BBTB 4RC2A 3W33A 2OJJA 2X6DA 4LOQA 4S2ZA 5ACBC 5AA8A 4DYMA 3AMYA 3CY2A 2JFLA 2F2UA 2R3MA 5K4JA 1ZY4A 4IW0A 4KIOA 4NU1A 4HW7A 2ZMCA 3R73A 1Q41A 4S34A 5HESA 3IDCA 5IMEA 3W2OA 4AUAA 3HRCA 5ETAA 4RX9A 1RE8A 2RFDA 4XNEA 1ZAOA 4AGCA 4AOJA 4IXPA 5CXZA 5H3QA 4WG3A 3PIYA 1Q8YA 2HELA 4IZYA 2F4JA 5DNRA 2IVUA 3IW5A 3R7YA 2C6KA 2YIYA 4L52A 3KXXA 5E91A 3LCKA 1Q62A 4EZ3A 4S33A 5HE1A 4OAUC 2C1BA 4IADA 2IZUA 4WA9A 3RMFA 5GIPE 2BRNA 1BL7A 2X2MA 1RW8A 2B9HA 3TNHA 5E9EA 2GNIA 3JUHA 4WNPA 3E5AA 3MPTA 3VRZA 2QNJA 4DINA 1UU3A 2PUPA 4GFOA 4NEUA 5CWZA 5CSPA 4JT3A 3DXNA 1Q97A 3QCXA 3NUYA 1ZYLA 4FG9A 5B7VA 3QXOA 5CF8A 2R3FA 5IQCA 5L2TA 3TM0A 2NO3A 1YDSE 3OD6X 2Z2WA 3HV3A 2PE1A 1YXUA 4CCBA 3PJCA 5HE2A 4C59A 1R39A 3ODZX 4KKGA 2YZLA 2VTJA 3OVVA 2XIYA 4Y83A 4F70A 3UZTA 5EM7A 4Z3VA 3V6RA 5EM6A 4AZTA 2C6TA 2ZB0A 4NJDA 4JDHA 4DA5A 3COKA 4R7IA 5L3AA 1Q24A 3ZH8A 4QOXA 2W17A 1NXKA 5ANJA 2B9IA 1U59A 3D15A 4ZTSA 1ZOGA 2WOUA 3KXNA 3PY0A 3Q52A 1YI6A 5L8LA 4H3BA 4O27B 3ZUUA 2JDVA 3AGLA 3EQDA 3D2IA 4IWPA 3FEGA 1M2QA 4Z16A 2PZYA 4FMQA 4QQ5A 1W0XC 4DTAA 1K3AA 3NW5A 5DG5A 5HQ0A 1VR2A 5FGKA 4BICA 4W9WA 4HCTA 2BDJA 2CNQA 4BYIA 5CI7A 3AD5A 3K54A 4I5CA 3DK3A 3Q04A 3F69A 5ETIA 3ANQA 5FP5A 3N51A 5EHLA 1OI9A 2VRXA 4AE6A 2VTRA 3FLZA 4EOLA 2GTNA 5KMMA 2R3KA 4M69A 2R7IA 3W2CA 2B4SB 2PZ5A 1H00A 4EOQA 2IZRA 4RIYA 3UMXA 5M07A 4G3EA 3NS9A 4YHFA 3R1SA 5B0XA 2EUFB 5AP1A 3UMWA 3TJCA 3AC3A 4MD8E 5FUTA 4ITHA 2PMIA 3F3UA 3ZS5A 1KOBA 3OF0A 3ZBFA 4A4OA 4FG7A 4M15A 4FODA 3FYJX 1OMWA 4U5JA 4QYYA 2XK9A 4U7ZA 5TR6A 4PF4A 3PIXA 2PY3A 2G01A 2X1NA 3UVRA 3FXXA 3LCSA 4NKSA 4CVAA 1OPLA 4IQ6A 5E8WA 5C9CA 2YAAA 1UWHA 3KU2A 4XRLA 3TZ9A 2WQMA 3I6WA 4HVIA 2FSOX 2Q0NA 4RRVA 3H0YA 3RAKA 4FOCA 5IUHA 1SVEA 4BBEA 4BC6A 3OY1A 4BI2A 3F66A 5BVFA 3BCEA 2XB7A 3OWPA 1YOJA 3TNPC 5CALA 4RIXB 3BGZA 3LCOA 2XM9A 3LM5A 3JYAA 3TCPA 3DJ7A 1E9HA 2CLQA 5AR4A 4FK6A 4JR3A 5JSMA 4E5WA 5JQ5A 4MH7A 4ZTQA 4DTKA 4KB8A 2ETMA 4BWPA 3WZEA 1M2RA 3VS0A 3E62A 2PVHA 3R8VA 4A9RA 3S3IA 5EQYA 4W9XA 4CV8A 3OCBA 3GNIB 1KE7A 1ZWSA 4J71A 2XH5A 2WAJA 2QOKA 4U79A 2BZHB 3FHRA 4XYFA 5AP7A 1UV5A 4OTWA 3ROCA 2I0HA 3BYOA 3F5XA 3AC2A 5GJGA 3QQUA 3WIKA 3D14A 2XS0A 4FV9A 5FDPA 2JDSA 4BGGA 3QL8A 4AF3A 5CNOA 3SA0A 3TKIA 2VTLA 2NRYA 2JDRA 3IECA 3PP1A 3UC3A 5EW3A 2VTMA 3VS4A 5CU3A 5DWRA 5A54A 3TN8A 3ORZA 1P14A 2HW7A 4X2GA 1UU7A 4X2JA 5J9ZA 2XK8A 5CXHA 4F63A 4J99A 5CASA 2QG7A 3A7IA 2WMWA 3PLSA 2YCFA 2YJSA 5FTQA 3SW7A 3NNUA 3D5VA 4BTFA 2OICA 4G9RA 4DFZE 4UMRA 5JKGA 1J7LA 4FKVA 2ONLC 4JX3A 4PMMA 4CZUA 3SVVA 4EORA 4DFUA 3EMGA 3F2NA 4CYJA 2QI8A 3MV5A 4MWIA 4R5YA 4XV3A 4FV3A 4NSTA 3LCTA 3P5KA 2WMAA 4QMNA 1ZMVA 2GU8A 2A1AB 3LFNA 1Y8YA 4BCGA 2V7AA 2XYNA 4WBBB 3DK7A 5CAQA 2YLEA 5AV2A 2EWAA 3MFTA 3QRIA 3DGKA 2BALA 3K5UA 2QONA 4GU6A 4M0YA 4XV9A 2J0LA 5E8TA 3P9JA 3RPOA 4CQGA 2CHLA 3P1AA 2PL0A 4CFUA 3ZSIA 4DGGA 4UY9A 4PUZA 3OTUA 3V8TA 1Y8GA 5KMLA 3IGOA 3PA5A 4O1OA 4O22A 4EH3A 3LVPA 3EOCA 4NFNA 4O0TA 4E3CA 4FT7A 3AMBA 4C3PA 1IR3A 4BDFA 5D12A 2PE2A 2WMRA 3PY3A 4IM0A 4U42A 1QPDA 2IJMA 5IEVA 3PLAE 3A99A 4R77A 4GT5A 1SNUA 3R00A 4H58A 3R30A 4TZRA 2BRBA 3CD8A 2ETRA 4AWIA 4FV1A 3FJQE 4OLIA 3AT2A 3FSKA 4RQKA 3LFSA 3FI8A 4C37A 4J98A 2UV2A 4M84A 3DKFA 4V05A 3KN6A 1PXIA 2XP2A 3ZSHA 1P4OA 4LMNA 2C1AA 2GNLA 3DY7A 1OIRA 2A27A 4XG4A 3PVBA 3WF8A 2JIVA 3TXOA 2G2FA 5EQPA 3ZUTA 3ZFMA 4BIDA 4MHAA 4NCTA 5CEMA 4O0SA 3TJDA 2P55A 1FBNA 4DGLC 2QOQA 3O8TA 4IAIA 5E90A 5FXRA 3GOKA 1OECA 2QLQA 4EOJA 2QO2A 3UPZA 4HYUA 3TKUA 4FF8A 5G6VA 5CSWA 3E64A 5LWNA 3SC1A 1DAYA 3BHHA 5CT7A 4RIWB 2QHMA 3LXLA 4CEGA 4O82A 3MFUA 2WMTA 3OS3A 3QLFA 4YZBA 5HVYA 4DH5A 4ACDA 3WOWA 2UZTA 2JITA 3UBDA 2GQSA 3QTRA 4GVAA 4RGJA 4DH7A 3FXWA 4N70A 4AN3A 4F9CA 4UYAA 4USEA 2NNWB 4ERWA 1B6CB 4TWCA 2DWBA 3T9IA 4XG3A 4GFGA 4YP8A 4CFFA 4TWOA 4LFIA 3DZOA 3EYGA 3HP2A 4FG8A 4QMYA 2BAKA 4C7TA 3F5GA 2VTOA 3UOJA 3B8RA 3KB7A 2OKRA 4QNAA 4JX7A 4XG6A 4ACGA 4LYNA 5AUVA 3DFAA 1KV1A 2X39A 3QA0A 4GU9A 4ASZA 3JR1A 3OWLA 3VBYA 4FKUA 4IHPA 4FV5A 3A61A 3CKXA 3RCJA 4F9YA 2BTSA 5HBJA 2NRUA 4FI1A 1GZNA 1NA7A 5AMNA 3HX4A 2C3LA 3QTZA 2OF2A 4JI9A 5C01A 5KMJA 4DH1A 4EK8A 3BELA 1Y6BA 3QTQA 2CSNA 4DG0E 4EOIA 4FKSA 4JBOA 1H26A 4X3FB 4CCUA 3H9OA 5I9XA 3IG7A 2UVYA 3O7LB 4FEQA 4K1BA 3IW7A 3DOGA 3NEWA 3ZTXA 4BKYA 5TO8A 2UW8A 3ZCLA 3VQUA 4QQTA 4ZEGA 2XIKA 3VNTA 3WZJA 1AQ1A 2BDWA 4WKQA 4L45A 2GTMA 4H36A 3FMJA 5AIKA 4QP3A 4G2FA 5EDPA 2ITTA 4U97A 1S9JA 4RFZA 3PFQA 4CQEA 5LARA 5JZNA 3THBA 3C0HA 3I5ZA 3V8SA 2XRUA 4JVGA 3MIYA 2QURA 4R3CA 3MTFA 4C8BA 4FTRA 5E8VA 4UWCA 2WNTA 1W83A 4QP6A 2FSTX 4ZZMA 2CN8A 2O64A 3BU6A 2P0CA 2XCHA 2GS7A 3LXPA 3QQKA 4BBMA 3ORMA 3OCTA 4PDOA 4YO4A 4GIIA 1F5QA 4F7NA 3KF7A 5HX8A 5AUXA 3ORNA 5AJQA 5E1EA 3P78A 1V1KA 3HEGA 4QMXA 4RVLA 5M4UA 2F57A 3TACA 4KS8A 2LAVA 2OIQA 3DNDA 4QMTA 3KQ7A 1M7NA 3NGAA 5JRSA 4FV7A 4M14A 3BWFA 1MRYA 3QWKA 5JEBA 4QD6A 4LI5A 4ZTMA 3V6SA 3BQRA 3GGFA 2VTIA 2VWVA 3QYZA 3VBXA 5I9VA 3NUAA 3SQQA 2XKFA 4AT4A 3S4QA 3VUGA 4TN6A 3F88A 2OU7A 5CTPA 3KULB 5B2MA 5HGIA 5K3YA 4XG9A 5AV4A 1WBOA 5FQDC 4B0GA 3V5QA 3ATSA 5AIRA 4IBMA 3LXKA 5F1ZA 2YJRA 5GJFA 4FTKA 5CEPA 4CFWA 2OSCA 3NCZA 2JBPA 4DF3A 2JKKA 4RX5A 2HYYA 4DAWA 4LRKA 3U51A 3TUDA 1ZYJA 1U54B 4FYOA 4LGGA 3ORPA 1JNKA 4QMLA 2F9GA 4YZNA 2VX1A 1G5SA 3RPRA 4RFYA 3PXYA 4DFNA 3FQHA 2FA2A 1O9UA 1Z57A 4YHTA 1JKSA 4G5PA 4FNXA 1XJDA 4NW6A 4DCAA 1Q5KA 3RNIA 4HCUA 1GOLA 2FGIA 2C6IA 4FIGA 4FT3A 2Z60A 4XH6A 3KKVA 4L3JA 5CSVA 4EH5A 2BZJA 4CMTA 2KTYA 3JXWA 5A4LA 1TQMA 2VTAA 5ANEA 3M42A 4DEHA 1ZOHA 3FKNA 4XOZA 3GB2A 2E9VA 1CM8A 3GC0A 2Z7LA 4QMPA 3G5DA 2RFSA 3FUPA 3DT1A 1CKIA 4FVQA 4RIXA 4XEYA 2EVAA 2QOHA 1J3HA 1F3MC 3I1AA 3KXHA 2FO0A 4J52A 3VJOA 4YJOA 5AAFA 3ACKA 1WAKA 3R28A 3WE8A 4M8TA 5F9EA 4IAKA 3UVQA 1ZLTA 2RF9A 4OGRA 4BCIA 4KIPA 4FK3A 2WEIA 3IDPA 4ZMFA 4AW1A 4W8DA 4IVBA 3D5UA 5L2QA 4KWPA 1O6YA 3VBVA 4C62A 4FOBA 3ZO4A 5CF4A 5HU3A 4ORKA 3DB6A 5FLFA 2QOLA 2VWUA 5CF5A 2W05A 4J7BA 4F0GA 4ZS0A 4O91A 3QC9A 2PVKA 2O3PA 4M3QA 3MB6A 3TV6A 2J51A 3U4UA 4CT2A 4O7SA 4BDHA 2OJGA 4BDDA 3FL4A 3JPVA 5H8BA 4LM5A 5FP6A 4N57A 4FZ7A 2IVVA 2XNGA 4EK6A 5IA4A 3MH1A 2WMUA 3GFEA 5M4CA 3Q5ZA 4ITJA 2BMCA 4G3DA 4BDAA 2GDOA 3ULZA 4FBXA 3UQFA 4G17A 4QTDA 2ZV7A 5GNKA 1KE6A 4Q9SA 1W84A 4XBUA 3KY2A 4AAAA 4BZNA 2HZ0A 2ZAZA 1M2PA 5JGDA 3IOKA 3AC1A 3TI1A 4I23A 2XBJA 4D1XA 2H6DA 4AT3A 2GNGA 2VWZA 5BMSA 5EDRA 5CAPA 1Y91A 3VF9A 2Y0AA 2W99B 4C36A 3UG2A 5HCZA 4EH2A 1FGKA 3KRWA 4R1VA 1LUFA 5ANOA 3NUNA 2QU6A 3UP7A 5LMKA 4FICA 5AM7A 3I6UA 3BGQA 4DG2E 3HUCA 3BHUA 4AOIA 4EQUA 3R0TA 5ANKA 4ANBA 4APPA 1XH8A 5HEZA 3FYKX 3EZVA 4IANA 1SM2A 3QZGA 4I22A 1ZZ2A 3D5WA 4CKIA 1GNGA 4GUBA 4DFLA 3I7BA 4E93A 2PZRA 4F7JA 2GFCA 5D1JA 3L9PA 3FLYA 4KSPA 5HCYA 4EOSA 4R5SA 3UYTA 3EIDA 3LMIA 3DBCA 3PWYA 1DM2A 2BZKB 5C8NA 3EFLA 4O21A 3LLAA 1OIUA 2OO8X 1WBNA 2X8DA 2WEVA 2R3RA 5CU4A 5E8XA 5AAGA 4O0UA 3QALE 3EFKA 3DKCA 3SRVA 4FZFB 5HKMA 2XNEA 1OUKA 2XNBA 3L9MA 4DEEA 3R1NA 2LGCA 4O2ZA 4R3PA 4H05A 4KINA 3ORKA 2WTWA 2CGWA 4H1MA 4D2WA 4J95A 4YHJA 5HE3A 4EJNA 1PHKA 1YHSA 5LCKA 5KBRA 3QTXA 4DT9A 4ZLZA 2VTPA 2G1TA 4W4YA 3GCQA 4NUSA 4I94A 2AUHA 3NWWA 3V5LA 3HAVA 2ZOQA 2XKEA 3TV7A 3D7ZA 1G8SA 4YC3A 3EKKA 4WG4A 3DNEA 3Q9WA 3TWJA 4CXAA 4V01A 4C4FA 2QU5A 3FXZA 2YDIA 4WUNA 3HAMA 2DYLA 3IS5A 3W55A 3O71A 3C13A 3L1SA 3R01A 5HLNA 1W98A 1XHAA 2GMXA 3RAIA 3WBLA 4QTAA 2IO6A 4HVGA 1OM1A 2PYWA 5CEKA 2J6MA 3JY0A 3I0QA 4FIEA 4L44A 3ZZWA 4BDGA 4EZ7A 5C1QB 1STCE 5EI2A 4U81A 1WBTA 2YN8A 5M57A 4FEXA 2WMXA 4FSWA 5M53A 1YXTA 2FSLX 4HZSA 2YWPA 4Y46A 5CU6A 4KBCA 1QL6A 5E8ZA 2ITNA 3U4WA 4FE2A 4FTNA 4MD7E 2VNYA 4D2TA 4IB3A 4ONAA 3QZHA 4QYHA 5AEPA 3ZHPC 3MESA 3NVMB 2X8IA 4ANQA 2CJMA 4AW0A 4YSJA 3DB8A 3IK3A 3PVGA 3UIXA 3NCGA 1NVSA 3TZ8A 5C4LA 3I4BA 2XK6A 1KE5A 5BVNA 5TT7A 4ANSA 4Y73A 4X3FC 4PMTA 3V3VA 4CYIA 4X21A 4F65A 4BCMA 4IAAA 5KZIA 3ENHA 2YEXA 4F0IA 2YITA 2QLUA 4NJ3A 5K0XA 5ANIA 4RX7A 2UW9A 2J2IB 5A3XA 4EQCA 4UMPA 1BKXA 3BE9A 4BDBA 5LOHA 1G8AA 4X2NA 3RPYA 2E9PA 3PJ3A 2WMVA 2JKMA 4HVHA 3CPBA 4D2PA 1H27A 3PA4A 3HP5A 3QU0A 3RZFA 3SG8A 2W4JA 5BMMA 4H3QA 3ROYA 3C4EA 4I6FA 3NX8A 4M67A 4QMVA 4FEVA 1UU9A 2R3LA 4FTMA 2PHKA 3DDQA 3GC8A 4TRLA 1YDRE 3Q96A 5AV0A 3FHIA 4PPBA 4ACCA 3KRJA 4ALUA 4FV8A 5FEDA 4XX9A 5ETCA 4OUCA 4FUYA 4ARKA 4FT0A 2XZSA 1PW2A 4FYNA 4O0XA 2VO7A 4A4XA 3DPKA 4PQNA 3O8PA 3MYGA 3ZRLA 2J50A 4Y95A 4G3CA 5CLPA 4C4GA 4MK0A 3VJNA 4IM3A 2B53A 3LE6A 2B9JA 3MFRA 4FIFA 4ZSEA 3F3ZA 3O7LD 3KXZA 1Q3DA 3ANRA 3DKGA 1J7UA 1WVXA 4IWOA 2XJ0A 4ZLOA 3UO4A 4F99A 5HG7A 3VC4A 4F6UA 4LGHA 2NPQA 2R3NA 3R63A 1UVRA 5HI2A 3UO6A 2XRWA 2C6OA 4BCNA 3S0OA 5GINE 4YZ9A 4M66A 5JFWA 1YW2A 2C6DA 1DAWA 3CTQA 2OWBA 2C5NA 4QRCA 4Q5HA 5H2UA 2QOBA 1VJYA 4GT4A 5CU2A 3ZZEA 1BLXA 2J0MB 3I0OA 3ZFYA 2ITPA 5H8GA 2QOCA 3PJ2A 5A6NA 1H1PA 1XO2B 4EWHA 4EBWA 2ITXA 3N9XA 2BZIB 4D58A 4FSTA 3RGFA 4BWKA 2VN9A 3O8UA 3TNIA 2XJ1A 3EQGA 3LCDA 3NYXA 5T3QA 3KULA 3LXNA 2CKPA 3RBWA 2OH4A 1ZY5A 1PRYA 5AR7A 2PVRA 4IIRA 4ANOA 3R1QA 3QD4A 2BRMA 3D4QA 1ZMUA 3SLSA 4YO6A 2R64A 3P0MA 1AD5A 3CJGA 3DBDA 3R8LA 4B8LA 3PZHA 4D0WA 1U54A 4YJQA 2RIOA 3FZRA 3MVMA 2JD5A 2VWXA 4QNYA 4JXFA 4DEAA 5JGBA 2UZDA 3PWDA 4CFVA 2HCKA 5TOZA 1LP4A 3WE4A 5AP5A 1IA8A 3VVHA 4DBXA 3FMEA 4F1TA 4J8MA 4FKLA 4N6YA 4TYEA 2J0IA 4W4XA 3UZPA 4U41A 3NZ0A 5BUEA 3SD0A 4XHKB 2E9UA 4BDEA 4UALA 3QBNA 4AZEA 4IWDA 5JH6A 1FVVA 3BV2A 3NR9A 4Q2AA 4C2WA 3H10A 2E9OA 3HV6A 3M1SA 5CZIA 3T3VA 3RTPA 3TKHA 3KK8A 3RNYA 3C4FA 5CU0A 4EONA 4DGMA 4FKGA 4MQ2A 3EFWA 3OOMA 4X2KA 3RJCA 4F64A 3R8PA 1FMKA 1QMZA 4AOTA 1H1QA 3NNXA 3MY5A 4BR3A 3NNWA 5CQWA 2QHNA 3I7CA 3P4KA 3CP9A 3TEIA 1L8TA 3OCSA 5GZ8A 3DAKA 3Q4CA 3VS2A 4XUFA 3KREA 5ANGA 1U5QA 4E6AA 3OEZA 2GQGA 1W7HA 3HV7A 3K2LA 4FTTA 2J0KA 3MH3A 5DI1A 4DBNA 5DT3A 4UX9A 1CMKE 5DR6A 4O7RA 3BU5A 1NW1A 4NIFA 3EZRA 4AACA 3U9CA 3BGPA 5BQ0A 2G2HA 4FNYA 1H24A 2YABA 4ZP5A 4U44A 2PK9A 2WGJA 2QKWB 4FTIA 3MA3A 4I93A 4QO9A 5EI8A 5HVKA 1YKRA 4PP9A 4RBLA 4HPUE 5J95A 2X7OA 4XP2A 2I40A 1LPUA 2O5KA 2XNOA 5HO6A 4C35A 2GNFA 3VULA 4X7QA 2C3IB 3G0EA 2O63A 3WF5A 3EHAA 3E87A 3CJFA 5M44A 4EH9A 4QPSA 2BHEA 5J9YA 2FUMA 2WPAA 4V0GA 5KMIA 3JVSA 4U8ZA 4I3ZA 2ITYA 3SKCA 3C5IA 1Q4LA 4CG8A 3Q5IA 1YXXA 4PX6A 1H8FA 5T68A 3VS3A 3BYUA 4YNEA 4IJ9A 3QQFA 3W2PA 3R8UA 4J53A 4K18A 1XR1A 1Y6AA 4TWNA 2PULA 3N4UA 3VS5A 4E4MA 4DFYA 1FINA 4NTTA 5EG3A 5BYYA 4DEDA 2YIWA 3RWPA 3VHKA 1KV2A 4O7LA 2JEDA 3NVKI 3CY3A 2BRHA 3V5WA 1XWSA 3N4TA 3FLQA 2B52A 2XK7A 4E4XA 4X2FA 4DCEA 4RJ5A 1JSVA 3A8WA 3CTHA 1VYWA 4OTDA 3W1FA 4BCJA 4EK4A 4ITIA 3OG7A 4U45A 4I0TA 1PKGA 4ASEA 3RI1A 3DDPA 1RQQA 2ZB1A 3FZPA 3KXMA 4HYHA 4IC8A 5E8SA 4QP9A 2QODA 3Q53A 4M0ZA 4NM5A 1RDQE 1YVJA 3OWJA 4UYNA 3MW1A 2R4BA 3LIJA 3PXKA 3O0GA 3HA6A 4HNIA 2JAMA 4FX3A 5C26A 5IH5A 3PYYA 2RL5A 2QCSA 4IWQA 4TKSA 2PVFA 3ZXTA 4MCVA 2WU7A 4TWPA 3KMUA 3W2SA 4BDKA 3D5XA 4QT1A 3UGCA 5LXMA 3PXFA 4NKAA 4B9DA 2RGPA 4I24A 3F9NA 4PNKA 4PTEA 2I1MA 3ZO2A 4BTKA 3ZM9A 3PY1A 2C68A 1JWHA 4YJNA 5DOSA 4TL0A 3JVRA 4MQ1A 5EFQA 3RM7A 3EWHA 4GK3A 3ALOA 4FL2A 4QP7A 4QMUA 3RPVA 4O0VA 4A9YA 1OKYA 2ZM3A 2PU8A 3KRRA 5K9IA 2QG5A 3COHA 5HU9A 2PMNX 1PXLA 4RJ3A 4XP3A 2WTIA 3C4XA 3R9RA 4ALVA 3DA6A 2PVYA 5BVEA 3L8PA 3GBZA 3QUEA 4ZAUA 5BVOA 5IQHA 4MF0A 3C1XA 3PVWA 3BHTA 2Y6MA 4OBPA 1VZOA 4C61A 3U54A 2BCJA 2I0VA 2I6LA 2RKUA 3C4ZA 4UN0C 2O65A 3FPMA 3LQ5A 3ODYX 5A46A 2ZV2A 4I6HA 2CKOA 3QX2A 5CVHA 4O84A 2WO6A 4MBJA 5DYJA 1XH6A 4QYEA 4J1RA 4AG8A 1JKKA 3BU3A 4LQMA 4O1PA 3EQFA 4TT7A 3UE4A 4ACMA 1M17A 1L3RE 3HMPA 4YLJA 3TV4A 4BCHA 4S31A 2RFNA 4GG7A 3UOKA 5HG9A 4FKOA 2OG8A 1WVYA 2VO3A 3DV3A 2YDKA 2ZMDA 3BYSA 3NW7A 3DLZA 2ONLA 5FBOA 4F09A 3VAPA 1ZOEA 3F3VA 1H25A 3BPRA 5EYDA 2JIIA 3UQGA 3ZMMA 2VTNA 4L53A 4JIKA 4E5AX 1J1CA 4ZJJA 3QTIA 4EKLA 5BVDA 5FWKK 4IAYA 5C8KA 5HO7A 2X4FA 4DFBA 5AX9A 2XKCA 2Z02A 5AV3A 1R0PA 2XVDA 3F5PA 3ZLWA 5DLSA 5IISA 1YRPA 3R9OA 1KE8A 3MH2A 4QP8A 5FM2A 4JS8A 1NVRA 2XUUA 2P3GX 4IJPA 4ZOGA 5AUZA 3NYNA 3TDVA 2EB3A 2ZDTA 1PKDA 2IG7A 5DR9A 4BKJA 3R7IA 4MTAA 4X6RA 2EXMA 4TPTA 1E1VA 3LZBA 3CBLA 4E73A 1YHWA 1MUOA 3HA8A 4OAVB 4USFA 4L6QA 3G33A 3POOA 3C0IA 1PYXA 2HENA 3R8ZA 2PE0A 2X9FA 4HPTE 4AZWA 4E6QA 1P5EA 3EN4A 2XJ2A 3ZBXA 4G5JA 3A60A 5J8IA 1CDKA 3RAHA 3ZRKA 2UZLA 3U6IA 3SGCA 2WTCA 4CT1A 5FEEA 3DKOA 5CT0A 4DLIA 4Q9ZA 3DXQA 3IW6A 1CKPA 4IVCA 1P2AA 2C0OA 2WTDA 4TTHB 3E63A 4DC2A 5HORA 5KMKA 3SOAA 4CV9A 1LEWA 2WZJA 3HZTA 3AC5A 4GYGA 4CZTA 3AGMA 4G3GA 4LRJA 4C2VA 3NAXA 2BTRA 4YTCA 2CGUA 4QP2A 4GUEA 4NCTC 3OUNB 4BB4A 1QCFA 3IOPA 4E4LA 3QHWA 3MPAA 2NP8A 5DR2A 3UOHA 1YDTE 2HWOA 2H9VA 3I60A 4YUQA 4EOPA 2X0GA 3I79A 3Q6WA 3ORLA 2HIWA 2X2LA 2DQ7X 4KAOA 2BVAA 4ENYA 4F0FA 2RG5A 5DRDA 2VU3A 2W9FB 3FY0A 2QOIA 4B8MA 3EJ1A 3ZLYA 5BNJA 2GCDA 1Q8ZA 3AT3A 4MD9E 4NT4A 4I6BA 2QVSE 5EW9A 3PSCA 3WF9A 2VWIA 4CFNA 2OIBA 2YCQA 3FI2A 2GPHA 2UVZA 3RP9A 4BTJA 3LKMA 3RHXA 3SG9A 4HYIA 3NIEA 4ZSGA 1IAJA 2BIYA 1GIHA 4HGSA 2EXEA 3QD2B 3UPXA 1YXSA 3GUBA 3EKNA 3S95A 1VYZA 3O23A 3OZ6A 5IMXA 4NZWB 2CGVA 4RJ8A 3U55A 3GQIA 1EH4A 3V51A 1YXVA 1ERKA 4YBKA 5LVOA 5CS6A 4ZK5A 2W7XA 2Y7JA 2YM4A 3HRFA 4ZXTA 3UO5A 4MNFA 5BYZA 2P33A 5AV1A 3AC8A 4YJRA 3R6XA 2X9EA 3W8QA 2C6LA 5BX0A 5EKNA 4J8NA 4MVFA 2IW8A 1KUTA 4D4SA 1NVQA 3KCKA 4XG2A 1A48A 5CX9A 4JL9A 4L68A 1XBBA 2OBJA 2HXQA 4XS2A 5CNNA 3F3WA 4FKJA 4G9CA 4FKQA 4ZMEA 5IA1A 2UZOA 3GENA 4FIIA 3F82A 2PSQA 3T9TA 4U3ZA 3U8WA 3LJ2A 1PMVA 4K77A 3GCUA 3UQCA 3GU6A 4R7HA 4F1OA 5HG8A 3RWQA 1UU8A 4B7TA 4PDYA 4LGDA 4WG5A 4BTMA 2PZPA 2Y6OA 3PPKA 4DEIA 1PMEA 3WARA 4KNBA 1REJA 2ERZE 2BIKB 3VBTA 4OR5A 3VO3A 2WKMA 4D5KA 3OROA 3DXPA 2IW6A 5K5XA 5LMBA 5DMZA 1WCCA 4PDSA 2PVNA 2OW3A 1KWPA 5EHYA 1Z5MA 1GY3A 3BRBA 1BI7A 4YR8A 4WUAA 3KMWA 2O8YA 3NNVA 2UVXA 3UDBA 3TDWA 3F3TA 5EHOA 5E7RA 4ZSJA 2OF4A 3UC4A 3W18A 4FR4A 1FMOE 1HOWA 1H01A 3HL7A 5I0BA 4PY1A 5H9BA 2Y4IC 4FEWA 3F7ZA 5M51A 4RPVA 4BDCA 5JZJA 4FL3A 4E1ZA 5M09A 4O83A 3FLSA 4KA3A 5M56A 4C57A 4FSUA 2R5TA 3BX5A 4BI1A 3L8VA 4A7CA 4ENXA 1XBCA 4JQ8A 2WQBA 4F7SA 4RWLA 2FB8A 3LFEA 3QRTA 4XV2A 2AC3A 3FC1X 3FZOA 2GS2A 2VNWA 5DBXA 2EXCX 2V7OA 5HX6A 4RJ6A 3TUBA 2VD5A 4X6QC 2B1PA 3CGFA 4E4NA 3HNGA 4JJRA 4RC3A 3U6HA 2JBOA 5DH3A 5E92A 4UZDA 4K9YA 3A62A 2ITVA 5EOBA 3DTWA 4I21A 1DI8A 3IW8A 1O6LA 3V5TA 4F9AA 5BUJA 4DFXE 2ZDUA 5GHVA 4YSMA 5JGAA 4RLLA 2W4KA 3UIBA 4DN5A 3TTJA 3MGYA 3ZM4A 5E1SA 3QQGA 2PUIA 4MXZA 5JMSA 3OUKA 1V0PA 5KZ0A 3G15A 4U9AA 1R78A 4MBIA 1YHVA 3MBLA 4JOAA 4XV1A 1GZKA 1Q8WA 2XBAA 2JGZA 3H9RA 4D55A 4XP0A 2XCKA 3CKWA 3RM6A 3BQCA 3LW0A 3VW8A 5EKOA 3C51A 4JBPA 1E1XA 1V0BA 3DQWA 4D2SA 4YJTA 3KC3A 2VGOA 5DIAA 3F7WA 5F94A 5BUIA 1PXJA 2WTVA 4FSQA 3ZEPA 5FRIA 3DZQA 2ERKA 3ZLXA 4JBQA 5FBNC 4K33A 3E93A 3LFFA 4CGAA 3G6HA 2QOFA 4RIOA 2P2IA 4FSNA 3C0GA 3OXIA 4I0RA 1I44A 3FSFA 3QYWA 4I5MA 2UZBA 3BZ3A 3H0ZA 3O50A 4MAOA 3BKBA 1PXKA 5AWMA 3DTCA 3R71A 3L9LA 3TNQB 4O7YA 3QHRA 3KXGA 4KRDA 3TT0A 4YMJA 4O0YA 1J1BA 4XMOA 3QLGA 3VUDA 3HV5A 4K2RA 1OUYA 4O86A 3HUBA 3F2AA 4B6LA 1Q99A 3V5JA 4O7NA 4LOOA 5I9UA 2J7TA 3NIZA 3NLBA 4RZVA 4L9IA 2IWIA 4YJUA 1XKKA 5J7BA 4I4FA 2BR1A 2C3JA 1ZRZA 3FC2A 2PMOX 3UTOA 2CKQA 3CTJA 4LUDA 2C0TA 3UNKA 4TYJA 4A06A 2YIQA 4Y5HA 3RCDA 4AGDA 1Z9XA 4AU8A 3FBVA 1IASA 1TKIA 5BPYA 2JIUA 4YGAA 4D4YA 5AR8A 1WMKA 3GEQA 1H4LA 2GFSA 4AS0A 4YTFA 5FTGA 4UXLA 4L3LA 4KIQA 5A6OA 2BROA 3C4CA 3R9NA 4C0TA 4EYMA 5AA9A 3LFBA 4RSSA 5DVRA 2W5AA 1MQBA 4ZLYA 4OTPA 3CC6A 1SZMA 4NW5A 5IUIA 4MX9A 1OB3A 1OPJA 1ZZLA 3WF6A 1JPAA 4MXOA 4MWHA 2OI4X 5LMAA 5JN2A 3A8XA 2X81A 2UW6A 4GMYA 4IE9A 5JRQA 4WOVA 4YTIA 1GZ8A 3DQXA 3PJ8A 4ZTLA 1W82A 2WELA 4L00A 4P90A 4TXCA 2OXYA 3O51A 4GRBA 4TNDA 4BKZA 4F6SA 4DH3A 5IKWA 1O6KA 3MY0A 3IONA 2G15A 5GZAA 2YIRA 5LVNA 3CSVA 4ZS4A 1OVEA 3SOCA 4QTBA 1WBVA 3OP5A 4XLVA 4YJSA 4WSYA 5HLPA 2BFYA 2WQNA 2YCRA 3CCNA 2XNMA 4GCJA 1H1RA 4L67A 4EUTA 4ZZNA 2UZNA 3SXRA 4P2KA 1ATPE 2R3IA 4M12A 3B8QA 3R7VA 3HRBA 3G9NA 5M06A 3EQBA 1OKZA 4EHEA 4TW9A 1PXOA 2OZAB 2WTKC 3DCVA 3FKOA 4ZY6A 4EH7A 2XM8A 2Z7QA 3D2KA 2JLDA 4NM3A 1R3CA 3PRFA 3R8MA 2CDZA 5CYIA 5HTIA 2KULA 2W1FA 2HY0A 2OIDA 4HGLA 4KD1A 4RQVA 3FQEA 4OBQA 4YZDA 5EI6A 2V5QA 1JKLA 3MDYA 2J9MA 2WMSA 3QCQA 3HDMA 4G3FA 4C4IA 2R3OA 3P08A 4H39A 4CTBA 4F6WA 3UZRA 4O6EA 3ULIA 2C0IA 4YU2A 5KO1A 4FC0A 4FSYA 3OTVA 3H30A 4FV0A 4S30A 2X4ZA 5AUWA 2HOGA 2F7ZE 2QC6A 3GVUA 5HE0A 4G6OA 5HBEA 5HG5A 5IA2A 2JKQA 3Q2JA 3R22A 4IC7A 4ZTHA 4RIWA 2IPXA 4E20A 4YPDA 3GCVA 1YI3A 3E3PA 3W32A 2PUNA 4ZJVA 2ZV8A 1TQPA 2C5OA 1OL2A 2VWWA 3QC4A 5L8JA 4UXQA 1APME 3ZYAA 3Q9YA 5HBHA 4JQEA 1UNLA 4CFMA 1MP8A 3OBJA 3ORIA 4L8MA 3MJ1A 4MXCA 2Q0BA 1OL6A 3LLTA 4IMYA 1J7IA 4WRGA 4XBRA 2WMBA 4AW2A 4IVDA 4Z7GA 1UKIA 3FAAA 5IG1A 4C4HA 4OTQA 2OZOA 3QWJA 1BMKA 1FPUA 2AC5A 1F0QA 2ZV9A 3R2BA 5A4EA 4Z9LA 5ACKA 2IZTA 5D9HA 4BL1A 2BFXA 2B55A 3E8EA 3IPHA 3F61A 3PG1A 4L43A 2W06A 4F9WA 4FTLA 2B7AA 3Q3BA 4FUXA 4EHVA 4PDPA 3VQHA 4Z55A 2C5XA 1UNGA 2VTTA 2R3PA 4RVTA 2I0EA 3K3JA 3U6JA 5HIDA 2W1IA 4FV4A 5K4IA 4FTJA 4N4SA 5IQEA 3L8SA 4X3FA 3DAJA 4FGBA 3N4VA 2YDJA 2J5EA 4CNHA 4FSMA 3ORTA 3ZO3A 2A2AA 5I3RA 2WQOA 4BGQA 2ZYBA 4DITA 3LFQA 3PXZA 3LM0A 3FMNA 3DLSA 4FTQA 5T6KA 4Z7HA 3QRUA 4BIEA 4M68A 5J5SA 4OTHA 2GS6A 1XH9A 1OL7A 3V5PA 4QMZA 4R3RA 1AGWA 4I5PA 5GZ9A 5JFXA 2YZAA 3UP2A 3FLNC 3WIGA 4BY9E 4H3PA 3HV4A 3GU8A 3F2RA 3OEFX 4YJPA 2W1DA 5D10A 5E4HA 5FEQA 2ZVAA 4CSVA 5HD7A 2F49A 4FA2A 3C50A 3HMMA 4QQJA 5IDNA 3VUMA 2OLCA 1Y57A 2V55A 3ACJA 2C5VA 4GJ2A 4QP4A 2WB8A 2WD1A 3HGKA 5KMOA 1PXPA 5FTOA 5KMNA 4UV0A 5AR5A 4YZCA 4N6ZA 5EOLA 5IQDA 3OW3A 4RT7A 4D9TA 3EYHA 2WIPA 4PMPA 5AP4A 2R3JA 4JDIA 4L3PA 5IQAA 4CRSA 2V22A 3LJ1A 4MEDA 3W16A 3MVJA 3MWUA 4KSQA 4CLIA 2C5YA 1G3NA 1I09A 3PA3A 1YWVA 2HZ4A 3C7QA 2WTJA 2YLFA 3S1HA 4LL0A 3DJ6A 4LRMA 3B2TA 3ZU7A 2W1EA 4FKTA 1GIIA 5CY3A 2YM5A 5M4IA 3CE3A 4CTCA 1FQ1B 5B2LA 4JLCA 2FYSA 3FKLA 2Z7RA 5IEYA 4O7TA 1LR4A 2J0JA 1CKJA 2H96A 4LL5A 5FDXA 3VN9A 5D7VA 2HZIA 3OOGA 1HCLA 2REIA 3OXTA 5L8KA 5KCVA 4FVRA 2IN6A 4MXAA 3RK7A 3GU7A 4G6LA 4RG0A 2WQEA 3QFVA 3HMNA 4ZSAA 4B4LA 4FL1A 3EQPA 4KKHA 4ZTNA 3L8XA 3ZEWA 5KBQA 3KCFA 2PVMA 2Z7SA 4EOMA 4CKRA 4O7ZA 4WIHA 2RSVA 4BDIA 2QO9A 2BAQA 1ZYCA 5C03A 4BYJA 2IVTA 3LPBA 3UYSA 3ID6C 4QMSA 4IZAA 1OBGA 4FEUA 2ITOA 2VV9A 3PIZA 4I5HA 1HCKA 4QP1A 3DAEA 4A9SA 3P7BA 3NRMA 2UW0A 1PF8A 3K3IA 5TF9A 3ETAA 2PWLA 3AT4A 4K6ZA 1SNXA 3RPSA 3UIUA 4BZDA 4Y5QA 4PRJA 4UBAA 3QQLA 4YC6A 4KBKA 4C38A 3PXRA 4RVMA 3K5VA 4RZWA 4X0MA 2HK5A 2HZNA 4EKKA 3ELJA 4GKHA 5AFVA 3VUIA 4I41A 5HOAA 2R7BA 4V04A 2H34A 4FGRA 4Q5EA 1U5RA 1B38A 5IQFA 1OPKA 3DBFA 1JVPP 5IPJA 4YC8A 3W8LA 2Q83A 2YM7A 3HYHA 2P4IA 1WBWA 3QCYA 4FTAA 3Q6UA 5I3OA 2W1GA 2JDTA 3PDTA 2ITQA 3CEKA 3QXPA 4BZOA 3NSZA 5LVMA 3TTIA 1WVWA 3VS1A 4PNIA 3MY1A 5GIOE 2CN5A 1K2PA 5IUGA 4II5A 2X7GA 3LMHA 1H28A 2GHGA 4IEBA 2C47A 1ZARA 1U4DA 2BHHA 3KFAA 2B54A 3FMDA 1SMHA 3EL8A 5FXQA 4E6CA 1V0OA 4TYIA 4S32A 3BV3A 5GJDA 2VX0A 4BGHA 4EYJA 2VGPA 2WOTA 4IX3A 2JC6A 3MN3A 3ZXZA 3EN6A 4GIHA 5IA0A 2XYUA 2BKKA 3GI3A 2Y4IB 4ZZOA 3G2FA 4MXXA 3P7AA 4OBOA 4AA5A 2XEZA 1T45A 2P2HA 3NUPA 3PVUA 4NM0A 5K5NA 3PZEA 1MRUA 2RFEA 3FI4A 4AFEA 4LOPA 5HZNA 2JKOA 1QPEA 5A4TA 4KKEA 3QTUA 2Y9QA 3ZDIA 4I20A 4J96A 4BBFA 4ZIMA 5TKDA 4NWMA 1QPJA 4JBVA 4G16A 4ZY4A 4U6RA 4PL3A 3V04A 2OFUA 4IFGA 4DHFA 2ACXA 5IH6A 4A9UA 2W5HA 2GSFA 3LAUA 4YLLA 2W5BA 3MVHA 3A2CA 3UG1A 5JQ8A 4O7VA 1FVRA 4JG8A 4C4EA 3IO7A 3KRLA 1X8BA 3A7FA 2XK3A 3MB7A 1FOTA 5AP2A 4W4VA 1OL1A 1YOLA 4FKWA 4EHZA 3BEGA 3OFMA 4IFCA 2GHLA 4RX8A 3EQCA 1OGUA 3BWJA 3EB0A 3ZLSA 3E8DA 1YOMA 5AR2A 5LQFA 3FL5A 4KBAA 1JAMA 4R8QA 4A07A 5J79A 3OY3A 4JG7A 4G31A 5HNGA 2XIXA 3D94A 4QMQA 5LWMA 4QYFA 5DN3A 3FMLA 4IB0A 5HVJA 1U46A 4TYGA 5J5TA 3QQJA 5AUYA 3EH9A 4AT5A 5KHWA 2X2KA 4IZ7A 3UNJA 2BILB 2ESMA 2R0IA 3MVLA 4MBLA 4OT6A 4IACA 4WSQA 3CQWA 3GCPA 4GK2A 5DA3A 3D83A 4DTBA 3VS6A 2YFXA 4D1ZA 3FWQA 3QD0A 4AN2A 4QTCA 5KKRC 3IW4A 3PJ1A 1RJBA 3QD3A 1DI9A 5G1XA 2OZAA 4EC8A 4EZ5A
chains in the Genus database with same CATH superfamily
5HO8A 4L42A 4PPAA 3C5UA 2W1ZA 1H08A 2SRCA 3A4OX 2OXDA 3KGAA 2VWBA 4FIHA 4FV2A 2ZM4A 4IB1A 4L46A 4O6LA 4RLKA 5ANDA 4EOOA 4A9TA 2YHVA 3KRXA 4OW8A 5EYMA 4ZSLA 3RK9A 4WRSA 3O17A 5AUUA 5IQIA 2WXVA 4CLJA 5M4FA 3BYVA 3PSBA 4P4CA 3BBWA 1Q3WA 2XIRA 2JFMA 4LUEA 4TYHB 3TG1A 5HNIX 3I81A 2CLXA 4G6NA 5CAOA 3JS2A 4IM2A 4W8EA 5A4QA 3QGWA 5BVWA 2XMYA 4MF1A 1WZYA 4ID7A 4ASDA 5J9LA 2YWVA 3UVPA 1VLRA 3ZONA 2UW5A 2QKRA 3GU4A 3OWKA 3WZKA 1JKTA 1T46A 2QQ7A 2BPMA 2UW3A 1PYEA 3PE2A 3B2WA 3MTLA 3BHVA 3NYOA 3R1YA 4EH4A 2UW7A 5CAUA 2OJFE 3PE1A 1ST0A 5J1VA 3JY9A 3PUPA 5HTCA 3POZA 1IA9A 5AP3A 4QYGA 4AGWA 4I4EA 2UZUE 1TVOA 2J5FA 3KK9A 3FPQA 1OBDA 2OXXA 3ATTA 4UWYA 1GAGA 4R1YA 3KF4A 4G34A 1NY3A 3ZC6A 4F7LA 3TUCA 3SDJA 5I9WA 4C3RA 4BWXA 3HLLA 3R04A 5C4KA 5KHXA 4K8AA 1W8CA 2OH0E 3RKBA 2UUEA 2QO7A 2GNHA 3ZDUA 4D9UA 1OL5A 3NDMA 3AD6A 5J1WA 1UNHA 4ANMA 4NYEA 3OC1A 2C30A 3G6GA 3QKMA 3R21A 4FKPA 5I4NA 4R78A 3Q4TA 4FNZA 3PSDA 3U87A 5EM5A 4WBOA 5JFVA 2YCSA 3RAWA 3LJ0A 4FSZA 3KIOC 4EBVA 3NUXA 4EQMA 2YM3A 2OGVA 5F20A 1OITA 2VTHA 3PPJA 5K0KA 3TZMA 2FVDA 2WTKB 3A7HA 3AMAA 1M7QA 1XH5A 5HIEA 2BAJA 2WFYA 4K11A 2YAKA 3DS6A 4GK4A 3SRVB 2CGXA 4FKIA 2PZIA 4MNEB 2CNVA 1WBPA 3D9VA 1M14A 4CRLA 4YURA 4JG6A 5CEIA 2PTKA 5J7HA 4ZY5A 1Q61A 3FMMA 4XG7A 2PVJA 4R7BA 3HMOA 3WF7A 3C9WA 5L2SA 4AZSA 1YQJA 4LV5A 4HVSA 3VUKA 4FSRA 3ZUVA 2VTQA 2C6MA 5JK3A 2R3HA 3WYYA 4L01A 4RMZA 4UZHA 1URCA 4JIAA 1BYGA 3VBQA 4O38A 5HICA 1GZOA 1FGIA 2W96B 3P86A 4ANNA 2PVLA 5HNBA 4O0RA 4GL9A 5BVKA 4D4VA 4E6DA 3OT8A 3OT3A 4IDTA 3UJGA 3VS7A 3MH0A 3CLYA 5KE0A 4C58A 4D5HA 3P79A 4LMUA 2QD9A 3E92A 3Q2MA 3QUPA 4QMOA 4AQCA 3E8NA 4G1WA 3WZUA 2VAGA 4X3JA 1NT2A 3O2MA 3ZSGA 5CAVA 2V0DA 3AC4A 4NK9A 4KIKB 4WNOA 4LV7A 4EC9A 3FLWA 4F1MA 5F95A 2OK1A 4I6QA 4APCA 2XK4A 3LFCA 1XH4A 3GT8A 3OHTA 4YBJA 5HIBA 4AE9A 5DHJA 3VRYA 4AFJA 2Z8CA 3ZRMA 4DGNA 2YM6A 5CSXA 2YERA 2PUUA 3LHJA 4HVDA 1ZYDA 3ZO1A 3H9FA 3O96A 2CNUA 4E5BA 2X8EA 3IDBA 2WU6A 3ALNA 4BVUA 1IG1A 2ETKA 2G9XA 3E88A 4AP7A 3BYMA 4C3FA 4FVPA 3GP0A 5D7AA 3OCGA 5HTBA 2HWPA 3R9HA 3Q4UA 1B39A 4D0XA 1JSUA 3QF9A 5H8EA 3PXQA 4FZDB 2YACA 4IB5A 5LVPA 2CCHA 4EH6A 3QZFA 3MI9A 3E7VA 4WO5A 4DEGA 5L2WA 4WD5A 2VO6A 3F6XA 5IA3A 4O7WA 4BCOA 4FTOA 4QTEA 4NM7A 4QMMA 2XEYA 4BI0A 2A19B 4JQ7A 3NMUF 2ITZA 4KABA 3Q60A 2I0YA 4AZFA 4CG9A 1XQZA 3UIMA 3TZ7A 3NUSA 5AP0A 5CANA 3Q32A 1YWNA 4IX6A 3W10A 3M11A 4PWNA 3OXZA 1KSWA 3FZTA 3SXSA 3KMMA 3RVGA 1W2FA 2O0UA 3AG9A 4PTCA 5CI6A 3HKOA 4A4LA 4DH8A 4HGEA 4IH8A 2QR7A 5I9ZA 2A0CX 5ETFA 3ET7A 4UMQA 1S9IA 2BRGA 5FM3A 2CMWA 5CQUA 4EOKA 5A4CA 1PXNA 3OBGA 3WYXA 3D7TB 3HVCA 5AADA 3SAYA 2XA4A 5EW8A 5IQGA 4OTRA 3EQRA 5HCXA 5DFPA 5AP6A 4CMUA 2IW9A 4GW8A 4BCFA 2PPQA 4KRCA 3ZOSA 2IZSA 4RJ4A 4EWQA 3Q9XA 3MJ2A 1R1WA 5LVLA 2WIHA 3CIKA 3H3CA 4FZ6A 4IAFA 4B99A 3UDTA 2XIZA 3KVXA 5CVFA 2XAMA 1W2DA 2DS1A 4MXYA 1H1SA 4J97A 4CD0A 1BI8A 2WHBA 3R7EA 4AA0A 4UMUA 5CF6A 1REKA 3QZIA 4AQKA 1J91A 4CMOA 4FNWA 3EQHA 1UA2A 3DU8A 2CCIA 1VEBA 3GXLA 5KUPA 3GFWA 4ZJIA 4NFMA 4HOKA 2ITWA 3FDNA 2Y4PA 2VO0A 3EN5A 3FQSA 3NAYA 2HAKA 2F7EE 3PRIA 3GCSA 4OTFA 5CVGA 2R3QA 4EH8A 5L6PA 3GQLA 1CTPE 4USDA 5JT2A 3V8WA 4U80A 4L7SA 4MYGA 4GS6A 3T3UA 4RC4A 4AW5A 3BL9A 4EJ7A 4E7WA 4EHGA 4YNOA 1KE9A 4QMWA 3CXWA 4C33A 3TIYA 3BIZA 4IDVA 3NFFB 5J87A 3T8OA 2E2BA 4AGUA 4UB7A 3UODA 3VWAA 4BJJB 4P7EA 1TQIA 4GV1A 4NTSA 4ALWA 1PXMA 1PY5A 3AQVA 4I92A 2Y8OA 1OIQA 3ORXA 2UZWE 4IZ5A 4I1ZA 2RG6A 3BEAA 2VUWA 4EK3A 4QQCA 3FZSA 1XBAA 2F2CB 4JRNA 3S2PA 2R0UA 4XCUA 1UWJA 3DFCB 5D41A 3VW6A 1LEZA 4FV6A 1A06A 2ITUA 3I5NA 3H4JA 3RHKA 5L6OA 5I5ZA 4YTHA 2W1HA 3F5UA 2AEGA 4HGTA 3D0EA 5HD4A 5DPVA 5IEXA 4JRVA 4LV8A 5IU2A 3PPZA 2OJIA 4GVJA 4AXAA 4C34A 1SYKA 3RINA 2X6EA 4MUQA 3ZC5A 4WHZA 2GHMA 3GU5A 4PMSA 5DT4A 2HW6A 3G9LX 5IA5A 3UOLA 5HLWA 2IVSA 4U3YA 4CFXA 4IX5A 3COIA 3WILA 3FY2A 3LMGA 4DEBA 3G51A 4JDKA 4C4JA 4BF2A 4N0SA 2X7FA 4GH2A 4GJ3A 2IF8A 5EDQA 4JR7A 1IRKA 1PJKA 4FZAB 3IQ7A 1ZMWA 4L7FA 4DGOA 2C4GA 4BFMA 4NIFB 1YWRA 2DUVA 3G0FA 4M13A 4EL9A 4PTGA 5E8YA 4RJ7A 5HHWA 4BHZA 4F08A 4IX4A 1XH7A 1IAHA 4OTIA 4AN9A 4ANLA 4M69B 5A14A 4FIJA 3MSSA 4XOYA 4OT5A 4TYHA 4UMTA 1JSTA 1WFCA 4RIYB 4EI4A 3SHEA 3Q4ZA 3A4PA 3R83A 4YZMA 4KS7A 3NPCA 4FTUA 1CSNA 4DG3E 5ITAA 1BX6A 4XRJA 2C3KA 3MS9A 3VBWA 1K9AA 4O2PA 3VHEA 5IQBA 3QAME 3RK5A 4V0GB 4D2VA 2CKEA 2YM8A 3PG3A 3FMHA 4H1JA 3MPMA 4XG8A 5EYKA 5IF1A 2W0JA 4TY1A 5LMKC 3RALA 3BLRA 2HXLA 4FKRA 2EU9A 2WMQA 4O96A 4PL5A 1ZXEA 2B9FA 5M55A 3SV0A 4ZTRA 5EYCA 3KL8A 3TMOA 2J4ZA 5A9UA 2UZVA 1YI4A 1KOAA 2FSMX 2QR8A 3FE3A 3EL7A 3R7GA 3ENMA 4C02A 1URWA 3R2YA 1OIYA 4HCVA 3WI6A 3LFAA 3AOXA 2C69A 4LG4A 5F4NA 2HY81 5L4QA 3COMA 4BN1A 3E7OA 1ZYSA 1BL6A 4AZVA 2OFVA 1GIJA 3HDNA 4YLKA 1PMNA 2O2UA 2W4OA 4HZRA 4YJVA 2XF0A 1SVHA 4PV0A 3C4WA 3MIAA 4JAIA 3A7JA 3MA6A 3REPA 4GFMA 3RZBA 3P7CA 2VX3A 1H0VA 4HYSA 2ZFYA 4P5ZA 2AYPA 3DK6A 3ERKA 4BHNA 2GQRA 2G2IA 2H8HA 2E9NA 4JDJA 3CD3A 4RWKA 5CZHA 2CPKE 4NH1A 5DE2A 4YPSA 3R9DA 3WZDA 4M7IA 3TL8A 2JDOA 3BLHA 1JBPE 2ZM1A 5EH0A 3CPCA 2R9SA 4GSBA 5KKRB 4IAZA 3OW4A 3IGGA 3QTSA 3QCSA 4BDJA 5EM8A 1UKHA 5CENA 4ERKA 4F4PA 1JQHA 3CQEA 4FRFA 4TNBA 4E26A 1MQ4A 3KA0A 5LJJA 4D2RA 5AUTA 3SW4A 3R7OA 4MNEA 5FD2A 5AX3A 4RFMA 5AR3A 4HJOA 3BLQA 4EEVA 3BI6A 5DEYA 3BE2A 4F9BA 2F7XE 5E8UA 3LQ8A 4GYIA 4CKJA 1QPCA 3CS9A 2BKZA 1Q8UA 3BHYA 2YA9A 3PTGA 3FMKA 5M08A 3ZFXA 2EB2A 3GC9A 1M52A 3GC7A 4RA5A 4ACHA 1A9UA 4BCPA 5CEOA 5KX8A 2YISA 3QRKA 4IVAA 3OMVA 2JAVA 3NYVA 3TNWA 4AXDA 4DE4A 3AXWA 3QGYA 3QX4A 4BRXA 4R6VA 4AXEA 2ZJWA 5CSHA 5B2KA 3S00A 4MKCA 4D1SA 3EFJA 3QA8A 3NUUA 1DS5A 1OKVA 1Q8TA 3E8CA 3M2WA 3DBQA 5L2IA 3G90X 5AM6A 2VTSA 2XNNA 4Y8DA 4NL0A 3PP0A 4GT3A 4OTGA 4KIKA 5CEQA 4M97A 5C27A 4RA4A 1R0EA 4DDGA 5L6WL 4FTCA 4W4WA 5IH4A 2UW4A 3QUDA 4P5QA 3SX9A 4ASXA 2VZ6A 2UZEA 5LCJA 1JLUE 1FVTA 2B0QA 2QOOA 3Q9ZA 1MRVA 4GEOA 5EK7A 3V01A 4DT8A 1IEPA 3CQUA 3DJ5A 2R3GA 1H07A 3VUHA 3FI3A 4PPCA 4XJ0A 4U0IA 3UNZA 2I7QA 3LOKA 1JOWB 2W1CA 3VUTA 3L9NA 5DRBA 3QRJA 3QTWA 4GG5A 4O81A 5EQEA 5D11A 5DEWA 4U40A 5KNJA 3FV8A 5ICPA 2OJ9A 5JFSA 4RVKA 2VWYA 1BUHA 4PL4A 5DT0A 3BL7A 1OKWA 2FH9A 3IKAA 4RWIA 4O0WA 3R02A 3KN5A 4U43A 1SVGA 4I0SA 4QPMA 4DLJA 2W9ZB 4Y85A 3R7UA 1WBSA 4D4RA 3QKKA 3BLAA 3AD4A 4JNWA 3A7GA 3ITZA 5C8MA 4AA4A 3W2QA 2BDFA 2PMLX 3CR0A 4BIBA 4AX8A 2A4LA 5I9YA 2C6EA 5IZFA 4FT9A 4HNFA 5FG8A 1H1WA 1H0WA 5IDPA 2R2PA 4UEUA 3II5A 4Y72A 3SXFA 3KVWA 1ND4A 4UWBA 3HECA 2BUJA 3EQIA 1PMUA 4GKIA 3FZ1A 2XKDA 3CGOA 2V62A 4EUUA 3LQ3A 4WNMA 4WNKA 4EK5A 4FT5A 4D28A 4K0YA 3LFDA 1P4FA 5TE0A 3VIDA 3E3BX 3TIZA 4BCKA 2J90A 4CZYB 3MFSA 3U9NA 3NW6A 3HMIA 3P23A 4E8AA 4O4FA 3QQHA 3D7TA 3DBEA 4JAJA 4XLIA 3QKLA 5DGZA 5AAEA 3EN9A 4QPAA 2GNJA 3VF8A 4PP7A 2YIXA 2XNPA 4WT6A 4BCQA 1GJOA 3GOPA 3EN7A 4KUJA 5BYLA 4RWJA 3KEXA 5FXSA 3ML1A 1OZ1A 3W2RA 3BBTB 4RC2A 3W33A 2OJJA 2X6DA 4LOQA 4S2ZA 5ACBC 5AA8A 4DYMA 3AMYA 3CY2A 2JFLA 2F2UA 2R3MA 5K4JA 1ZY4A 4IW0A 4KIOA 4NU1A 4HW7A 2ZMCA 3R73A 1Q41A 4S34A 5HESA 3IDCA 5IMEA 3W2OA 4AUAA 3HRCA 5ETAA 4RX9A 1RE8A 2RFDA 4XNEA 1ZAOA 4AGCA 4AOJA 4IXPA 5CXZA 3UDZA 5H3QA 4WG3A 3PIYA 1Q8YA 2HELA 4IZYA 2F4JA 5DNRA 2IVUA 3IW5A 3R7YA 4O4CA 2C6KA 2YIYA 4L52A 3KXXA 5E91A 3LCKA 1Q62A 4EZ3A 4S33A 5HE1A 4OAUC 2C1BA 4IADA 2IZUA 4WA9A 3RMFA 5GIPE 2BRNA 1BL7A 2X2MA 1RW8A 2B9HA 3TNHA 5E9EA 2GNIA 3JUHA 4WNPA 3E5AA 3MPTA 3VRZA 2QNJA 4DINA 1UU3A 2PUPA 4GFOA 4NEUA 5CWZA 5CSPA 4JT3A 3DXNA 1Q97A 3QCXA 4DHJA 3NUYA 1ZYLA 4FG9A 5B7VA 3QXOA 3W0NA 5CF8A 2R3FA 5IQCA 5L2TA 3TM0A 2NO3A 1YDSE 3OD6X 2Z2WA 3HV3A 2PE1A 1YXUA 4CCBA 3PJCA 5HE2A 4C59A 1R39A 3ODZX 4KKGA 2YZLA 2VTJA 3OVVA 2XIYA 4Y83A 4F70A 3UZTA 2XALA 5EM7A 4Z3VA 3V6RA 5EM6A 4AZTA 2C6TA 2ZB0A 4NJDA 4JDHA 4DA5A 3COKA 4R7IA 5L3AA 1Q24A 3ZH8A 4QOXA 2W17A 1NXKA 5ANJA 2B9IA 1U59A 3PUFC 3D15A 4ZTSA 1ZOGA 4FJVA 2WOUA 3KXNA 3PY0A 3Q52A 1YI6A 5L8LA 4H3BA 4O27B 3VONA 3ZUUA 2JDVA 3AGLA 3EQDA 3D2IA 4IWPA 3FEGA 1M2QA 4Z16A 2PZYA 4FMQA 4QQ5A 1W0XC 4DTAA 1K3AA 3NW5A 5DG5A 5HQ0A 1VR2A 5FGKA 4BICA 4W9WA 4HCTA 2BDJA 2CNQA 4BYIA 5CI7A 3AD5A 3K54A 3W0MA 4I5CA 3DK3A 3Q04A 3F69A 5ETIA 3ANQA 5FP5A 3N51A 5EHLA 1OI9A 2VRXA 4AE6A 2VTRA 3FLZA 4EOLA 2GTNA 5KMMA 2R3KA 4M69A 2R7IA 3W2CA 2B4SB 2PZ5A 1H00A 4EOQA 2IZRA 4RIYA 3UMXA 5M07A 4G3EA 3NS9A 4YHFA 3R1SA 5B0XA 2EUFB 5AP1A 3UMWA 3TJCA 3AC3A 4MD8E 5FUTA 4ITHA 2PMIA 3F3UA 3ZS5A 1KOBA 3OF0A 3ZBFA 4A4OA 4FG7A 4M15A 4FODA 3FYJX 1OMWA 4U5JA 4QYYA 2XK9A 4U7ZA 5TR6A 4PF4A 3PIXA 2PY3A 2G01A 2X1NA 3UVRA 3FXXA 3LCSA 4NKSA 4CVAA 1OPLA 4IQ6A 5E8WA 5C9CA 2YAAA 1UWHA 3KU2A 4XRLA 3TZ9A 2WQMA 3I6WA 4HVIA 2FSOX 2Q0NA 4RRVA 3H0YA 3RAKA 4FOCA 5IUHA 1SVEA 4BBEA 4BC6A 3OY1A 4BI2A 3F66A 5BVFA 3BCEA 2XB7A 3OWPA 1YOJA 3TNPC 5CALA 4RIXB 3BGZA 3LCOA 3TYKA 2XM9A 3LM5A 3JYAA 3AKKA 3TCPA 3DJ7A 1E9HA 2CLQA 5AR4A 4FK6A 4JR3A 5JSMA 4E5WA 5JQ5A 4MH7A 4ZTQA 4DTKA 4KB8A 2ETMA 4BWPA 3WZEA 1M2RA 3VS0A 3E62A 2PVHA 3R8VA 4A9RA 3S3IA 5EQYA 4W9XA 4CV8A 3OCBA 3GNIB 1KE7A 1ZWSA 4J71A 2XH5A 2WAJA 2QOKA 4U79A 2BZHB 3FHRA 4XYFA 5AP7A 1UV5A 4OTWA 3ROCA 2I0HA 3BYOA 3F5XA 3AC2A 5GJGA 3QQUA 3WIKA 3D14A 2XS0A 4FV9A 5FDPA 2JDSA 4BGGA 3QL8A 4AF3A 5CNOA 3SA0A 3TKIA 2VTLA 2NRYA 2JDRA 3IECA 3PP1A 3UC3A 3W0QA 5EW3A 2VTMA 3VS4A 5CU3A 5DWRA 5A54A 3TN8A 3ORZA 1P14A 2HW7A 4X2GA 1UU7A 4X2JA 2X0PA 5J9ZA 2XK8A 5CXHA 4F63A 4J99A 5CASA 2QG7A 3A7IA 2WMWA 3PLSA 2YCFA 2YJSA 5FTQA 3SW7A 3NNUA 3D5VA 4BTFA 2OICA 4G9RA 4DFZE 4UMRA 5JKGA 1J7LA 4FKVA 2ONLC 4JX3A 4PMMA 4CZUA 3SVVA 4EORA 4DFUA 3EMGA 3F2NA 4CYJA 2QI8A 3MV5A 4MWIA 4R5YA 4XV3A 4FV3A 4NSTA 3LCTA 3P5KA 2WMAA 4QMNA 1ZMVA 2GU8A 2A1AB 3LFNA 1Y8YA 4BCGA 2V7AA 2XYNA 4WBBB 3DK7A 5CAQA 2YLEA 4QDVA 5AV2A 2EWAA 3MFTA 3QRIA 3DGKA 2BALA 3K5UA 2QONA 4GU6A 4M0YA 4XV9A 2J0LA 5E8TA 3P9JA 3RPOA 4CQGA 2CHLA 3P1AA 2PL0A 4CFUA 3ZSIA 4DGGA 4UY9A 4PUZA 3OTUA 3V8TA 1Y8GA 5KMLA 3IGOA 3PA5A 4O1OA 4O22A 4EH3A 3LVPA 3EOCA 4NFNA 4O0TA 4E3CA 4FT7A 3AMBA 4C3PA 1IR3A 4BDFA 5D12A 2PE2A 2WMRA 3PY3A 4IM0A 4U42A 1QPDA 2IJMA 5IEVA 3PLAE 3A99A 4R77A 4GT5A 1SNUA 3R00A 4H58A 3R30A 4TZRA 2BRBA 3CD8A 2ETRA 4AWIA 4FV1A 3FJQE 4OLIA 3AT2A 3FSKA 4RQKA 3LFSA 3FI8A 4C37A 4J98A 2UV2A 4M84A 3DKFA 4V05A 2XAOA 3KN6A 1PXIA 2XP2A 3ZSHA 1P4OA 4LMNA 2C1AA 2GNLA 3DY7A 1OIRA 2A27A 4XG4A 3PVBA 3WF8A 2JIVA 3TXOA 2G2FA 5EQPA 3ZUTA 3ZFMA 4BIDA 4MHAA 4NCTA 5CEMA 4O0SA 3TJDA 2P55A 1FBNA 4DGLC 2QOQA 3O8TA 4IAIA 5E90A 5FXRA 3GOKA 1OECA 3W0PA 2QLQA 4EOJA 2QO2A 3UPZA 4HYUA 3TKUA 4FF8A 5G6VA 5CSWA 3E64A 5LWNA 3SC1A 1DAYA 3BHHA 5CT7A 4RIWB 2QHMA 3LXLA 4CEGA 4O82A 3MFUA 2WMTA 3OS3A 3QLFA 4YZBA 5HVYA 4DH5A 4ACDA 3WOWA 2UZTA 2JITA 3UBDA 2GQSA 3QTRA 4GVAA 4RGJA 4DH7A 3FXWA 4N70A 4AN3A 4F9CA 4UYAA 4USEA 2NNWB 4ERWA 1B6CB 4TWCA 2DWBA 3T9IA 4XG3A 4GFGA 1ST4A 4YP8A 4CFFA 4TWOA 4LFIA 3DZOA 3EYGA 3HP2A 4FG8A 4QMYA 2BAKA 4C7TA 3F5GA 2VTOA 3UOJA 3B8RA 3KB7A 2OKRA 4QNAA 4JX7A 4XG6A 4ACGA 4LYNA 5AUVA 3DFAA 1KV1A 2X39A 3QA0A 4GU9A 4ASZA 3JR1A 3OWLA 3VBYA 4FKUA 4IHPA 4FV5A 3A61A 3CKXA 3RCJA 4F9YA 2BTSA 5HBJA 2NRUA 4FI1A 1GZNA 1NA7A 5AMNA 3HX4A 2C3LA 3QTZA 2OF2A 4JI9A 5C01A 5KMJA 4DH1A 4EK8A 3BELA 1Y6BA 3QTQA 2CSNA 4DG0E 4EOIA 4FKSA 4JBOA 1H26A 4X3FB 4CCUA 3H9OA 5I9XA 3IG7A 2UVYA 3O7LB 4FEQA 4K1BA 3IW7A 3DOGA 3NEWA 3ZTXA 4BKYA 5TO8A 2UW8A 3ZCLA 3VQUA 4QQTA 4ZEGA 2XIKA 3VNTA 3PFYA 3WZJA 1AQ1A 2BDWA 4WKQA 4L45A 2GTMA 4H36A 3FMJA 5AIKA 4QP3A 4G2FA 5EDPA 2ITTA 4U97A 1S9JA 4RFZA 3PFQA 4CQEA 5LARA 5JZNA 3THBA 3C0HA 3I5ZA 3V8SA 2XRUA 4JVGA 3MIYA 2QURA 4R3CA 3MTFA 4C8BA 4FTRA 5E8VA 4UWCA 2WNTA 1W83A 4QP6A 2FSTX 4ZZMA 2CN8A 2O64A 3BU6A 2P0CA 2XCHA 2GS7A 3LXPA 3QQKA 4BBMA 3ORMA 4AXFA 3OCTA 4PDOA 4YO4A 4GIIA 1F5QA 4F7NA 3KF7A 5HX8A 5AUXA 3ORNA 5AJQA 5E1EA 3P78A 1V1KA 3HEGA 4QMXA 4RVLA 5M4UA 2F57A 3TACA 4KS8A 2LAVA 2OIQA 3DNDA 4QMTA 3KQ7A 1M7NA 3NGAA 5JRSA 4FV7A 4M14A 3BWFA 1MRYA 3QWKA 5JEBA 4QD6A 4LI5A 4ZTMA 3V6SA 3BQRA 3GGFA 2VTIA 2VWVA 3QYZA 3VBXA 5I9VA 3NUAA 3SQQA 2XKFA 4AT4A 3S4QA 3VUGA 4TN6A 3F88A 2OU7A 5CTPA 3KULB 5B2MA 5HGIA 5K3YA 4XG9A 5AV4A 1WBOA 5FQDC 4B0GA 3V5QA 3ATSA 5AIRA 4IBMA 3LXKA 5F1ZA 2YJRA 5GJFA 4FTKA 5CEPA 4CFWA 2OSCA 3NCZA 2JBPA 4DF3A 2JKKA 4RX5A 2HYYA 4DAWA 4LRKA 3U51A 3TUDA 1ZYJA 1U54B 4FYOA 4LGGA 3ORPA 1JNKA 4QMLA 2F9GA 4YZNA 2VX1A 1G5SA 3RPRA 4RFYA 3PXYA 4DFNA 3FQHA 2FA2A 1O9UA 1Z57A 4YHTA 1JKSA 4G5PA 4FNXA 1XJDA 4NW6A 4DCAA 1Q5KA 3RNIA 4HCUA 1GOLA 2FGIA 2C6IA 4FIGA 4FT3A 2Z60A 4XH6A 3KKVA 4L3JA 5CSVA 4EH5A 2BZJA 4CMTA 2KTYA 3JXWA 5A4LA 1TQMA 2VTAA 5ANEA 3M42A 4DEHA 1ZOHA 3FKNA 4XOZA 3GB2A 2E9VA 1CM8A 3GC0A 2Z7LA 4QMPA 3G5DA 2RFSA 3FUPA 3DT1A 1CKIA 4FVQA 4RIXA 4XEYA 2EVAA 2QOHA 1J3HA 1F3MC 3I1AA 3KXHA 2FO0A 4J52A 3VJOA 4YJOA 5AAFA 3ACKA 1WAKA 3R28A 3WE8A 4M8TA 5F9EA 4IAKA 3UVQA 1ZLTA 2RF9A 4OGRA 4BCIA 4KIPA 4FK3A 2WEIA 3IDPA 4ZMFA 4AW1A 4W8DA 4IVBA 3D5UA 5L2QA 4KWPA 1O6YA 3VBVA 4C62A 4FOBA 3ZO4A 5CF4A 5HU3A 4ORKA 3DB6A 5FLFA 2QOLA 2VWUA 5CF5A 2W05A 4J7BA 4F0GA 4ZS0A 4O91A 3QC9A 2PVKA 2O3PA 4M3QA 3MB6A 3TV6A 2J51A 3U4UA 4CT2A 4O7SA 4BDHA 2OJGA 4BDDA 3FL4A 3JPVA 5H8BA 4LM5A 5FP6A 4N57A 4FZ7A 2IVVA 2XNGA 4EK6A 5IA4A 3MH1A 2WMUA 3GFEA 5M4CA 3Q5ZA 4ITJA 2BMCA 4G3DA 4BDAA 2GDOA 3ULZA 4FBXA 3UQFA 4G17A 4QTDA 4I6LA 2ZV7A 5GNKA 1KE6A 4Q9SA 1W84A 4XBUA 3KY2A 4AAAA 4BZNA 2HZ0A 2ZAZA 1M2PA 5JGDA 3IOKA 3AC1A 3TI1A 4I23A 4DDIA 2XBJA 4D1XA 2H6DA 4AT3A 2GNGA 2VWZA 5BMSA 5EDRA 5CAPA 1Y91A 3VF9A 2Y0AA 2W99B 4C36A 3UG2A 5HCZA 4EH2A 1FGKA 3KRWA 4LDTA 4R1VA 1LUFA 5ANOA 3NUNA 2QU6A 3UP7A 5LMKA 4FICA 5AM7A 3I6UA 3BGQA 4DG2E 3HUCA 3BHUA 4AOIA 4EQUA 3R0TA 5ANKA 4ANBA 4APPA 1XH8A 5HEZA 3FYKX 3EZVA 4IANA 1SM2A 3QZGA 4I22A 1ZZ2A 3D5WA 4CKIA 1GNGA 4GUBA 4DFLA 3I7BA 4E93A 2PZRA 4F7JA 2GFCA 5D1JA 3L9PA 3FLYA 4KSPA 5HCYA 4EOSA 4R5SA 3UYTA 3EIDA 3LMIA 3DBCA 3PWYA 1DM2A 2BZKB 5C8NA 3EFLA 4O21A