2NPQA

A novel lipid binding site in the p38 alpha map kinase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
348
structure length
326
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title A novel lipid binding site formed by the MAP kinase insert in p38 alpha.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 108
structure length 326
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2006-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2npqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2npqA01
3H3CA 4FTIA 1GIIA 4IMYA 1UA2A 1SNXA 2QCSA 1YXVA 2GDOA 3R1NA 3COKA 4RIWA 2UW4A 4FKPA 4G3GA 3ENMA 5IKWA 4WNKA 4V0GB 3NUSA 5CXZA 3R7EA 4I22A 5DVRA 2QOKA 3EN6A 4CFNA 1KE9A 2GNHA 3S95A 3LPBA 3EQBA 3NUNA 2WTKC 3ORZA 2PL0A 5IQGA 2YAAA 4ANNA 4NJDA 4CNHA 3R7YA 3MGYA 4FTNA 3UODA 1H28A 3AGLA 3VC4A 3MH3A 1OVEA 2AC3A 4O91A 4F6WA 3DZQA 5BVWA 4ANOA 5CAUA 4NSTA 4FKSA 4GG5A 3D4QA 2OLCA 4IB3A 5EYDA 5BVDA 4PDYA 5D10A 4RLKA 3HP5A 3POOA 5HNIX 3ELJA 2XIXA 4J97A 4HGSA 5HCYA 5AAFA 2OJGA 1E9HA 5E91A 2IZRA 3PY0A 4ALUA 4M15A 1S9IA 3GUBA 4G6OA 3V5JA 3ZU7A 5CZHA 3ZSHA 3TV6A 2WEIA 4Y8DA 3GC0A 5E1SA 5EQPA 3QCYA 4MK0A 4AX8A 3ID6C 1XH9A 5IA5A 3GCUA 2OBJA 2YDJA 3HVCA 5BYZA 3UMXA 2VTOA 2HY0A 3NYVA 2QURA 4WBOA 4ANBA 4Q2AA 4LGGA 3QTIA 3EWHA 2ZM1A 3NRMA 5AR5A 5HIBA 3UNJA 3MPMA 4KB8A 5ANDA 4AN2A 4D0XA 4DAWA 1Y6AA 4RRVA 4O7LA 3WARA 4RLLA 2XIRA 3KA0A 2Y6MA 3E5AA 3ZDIA 4A4OA 4BDHA 4C38A 4BDJA 3CSVA 3L1SA 3SHEA 4G6LA 3ZDUA 4TYHA 3NUPA 4YTIA 3RHXA 1MRYA 3OW3A 1BMKA 3LZBA 4G3CA 5HI2A 2W1ZA 3C7QA 1OZ1A 1G8SA 4EH8A 5IG1A 4PL4A 1J1CA 4FR4A 3QL8A 5KZ0A 2BIYA 3QBNA 1MUOA 4BN1A 2YZLA 4ZMFA 4FV8A 4UN0C 4BY9E 3Q9WA 4QYYA 2F57A 4IM2A 5LOHA 3F2NA 1Q8ZA 4D4YA 1WBWA 3P5KA 4FTCA 4FV3A 3QUEA 3OY3A 4Y46A 4EQUA 3PTGA 4TTHB 5EW3A 3C0HA 2XNGA 4O84A 3QUPA 4I4FA 4IE9A 4RQKA 2YDIA 3KC3A 5EW9A 5HQ0A 1U54B 4DHFA 3VO3A 3FLZA 4PX6A 4O0XA 3FC1X 3BYOA 4F65A 5HX6A 4GMYA 3NAXA 3WOWA 3VBQA 2Z60A 3BI6A 4KWPA 5IA3A 4JBVA 4YHJA 5KBRA 5F20A 2FSTX 2VTSA 3CXWA 1M7NA 2O65A 5AIKA 4I5PA 4MEDA 4QP1A 4YJTA 3D83A 2VX1A 2R3PA 4O7NA 2X0GA 3A8WA 3F5XA 3FLSA 2W9ZB 3GQLA 3UGCA 4O0YA 4O83A 4X2NA 4JRNA 2CMWA 3DQXA 4HNFA 2IJMA 2XK8A 5FTQA 3FPQA 4E5BA 3RM6A 1YWRA 4XV9A 3V5PA 4FEXA 3OHTA 3BBTB 2G01A 5DT3A 3R0TA 4TY1A 4UZDA 1PF8A 1WVWA 4Q9SA 2IVUA 5M09A 1K3AA 1MRUA 2GHMA 4KKEA 5J9LA 3Q9ZA 4E93A 3PXYA 4ORKA 3GCSA 4F99A 4R3CA 4BIBA 2H9VA 2PY3A 3ODZX 2A2AA 3KGAA 4IAYA 3UOHA 3NUXA 4AFEA 2HELA 2ZAZA 3CEKA 3CR0A 2VTTA 4LL5A 4TZRA 4TYEA 4E6CA 2DWBA 4FOBA 4IZYA 3IW4A 5HLWA 2QOIA 5L2TA 5C1QB 3TXOA 4JDKA 2E2BA 5HNBA 1EH4A 3QQLA 3FXWA 2PVMA 5FP5A 1ZZ2A 4KKHA 3ANRA 4RA4A 3RAHA 3OEZA 2BMCA 5M08A 3M2WA 2XNOA 2W1HA 2OO8X 3V04A 1J3HA 1UU3A 2Y8OA 5FTGA 2ZV7A 2C3IB 4CRSA 1IEPA 5IA1A 2UVYA 4YHTA 1DS5A 5KCVA 3UIMA 3MVMA 2RFDA 4K0YA 4E4NA 2XCKA 2X7FA 2QG5A 5IDNA 3D14A 5CEQA 1YXTA 3ZUVA 1R39A 5EDQA 3PZHA 2ITQA 4D9UA 2C5NA 1GZ8A 3SD0A 4I0RA 4BZOA 3GC8A 3HMOA 5TO8A 4ACMA 5AJQA 5HE0A 1CMKE 3QD4A 5ETIA 3PJ1A 3P1AA 2WFYA 1Q61A 3DAJA 5ACKA 4YUQA 3DJ6A 3UOKA 4ZJVA 4OAUC 2ONLA 4N0SA 5CEKA 1FVTA 1W0XC 3FMDA 2V7AA 3PPKA 4HJOA 2HW6A 2PMIA 3UZRA 1JKSA 2WO6A 2Z2WA 4DGGA 5EH0A 5JH6A 1A06A 4XLVA 4CD0A 5H2UA 2QO2A 2HIWA 1JKKA 4QNYA 5DEYA 3NEWA 3TUBA 2JFMA 4Z9LA 4PTGA 3P7AA 4JAIA 3UOLA 4BIDA 4WUAA 2BRBA 3MS9A 3VHKA 3ZRKA 5D7VA 5KMNA 2WU7A 4EZ3A 4IVAA 5E8UA 3SQQA 1K9AA 4OTFA 3U4WA 5JFXA 5HVKA 4LI5A 1LP4A 2PK9A 4FEQA 2XKFA 5FBNC 3KU2A 2VO6A 3KCKA 4IIRA 4ZTQA 3WYXA 4CCUA 1H26A 3FKLA 4B0GA 4NM0A 4L45A 3LJ1A 4OT6A 5L2IA 3VJNA 3A7IA 4IWPA 4XNEA 3DTCA 4FK6A 4GK4A 2B9IA 5K4IA 4U9AA 3VBVA 4OTDA 3RZFA 1Q8TA 3R2BA 5L8JA 4R5SA 2CKQA 3ZH8A 3FZPA 4KRCA 4MXAA 3AC2A 4FTTA 2XBJA 3H0ZA 3FZ1A 1H8FA 3U54A 5AAEA 4MQ2A 3BLHA 4DG2E 3O8TA 4GYGA 5J7HA 1CSNA 3AD5A 3F3VA 5EKOA 2PTKA 4F9AA 3ROCA 2OF4A 3WF6A 2UZTA 3MN3A 1Z57A 2OK1A 5G6VA 4FVRA 4E7WA 4J53A 3BPRA 3R7OA 3RK9A 3IK3A 4CFXA 3VBXA 4O0SA 3PVBA 2VGPA 3JVSA 4UXQA 4IB0A 2JKKA 3UBDA 2BAQA 4X2KA 1ZOEA 5LMKA 3FQEA 2BRNA 5DRBA 2W5BA 4CMUA 2BKZA 4LUEA 4ZJIA 3WZEA 3ZSGA 2GS7A 2ESMA 4NKAA 1U4DA 5H3QA 4YR8A 3U55A 5GINE 1PHKA 5HG7A 3VS4A 4JG8A 3ZMMA 4ZLYA 2J0KA 4EHVA 2QHMA 3OF0A 3R71A 4QQ5A 3OBJA 5IQAA 2FA2A 2RF9A 3BHUA 3VRYA 4M7IA 1AQ1A 4GU9A 4AGUA 3PP1A 5CALA 5K5XA 4AGCA 4M97A 2UW5A 4IWQA 3UO6A 4PDSA 2ITNA 4S2ZA 5T68A 5F9EA 4CXAA 2CCIA 5IZFA 2VTJA 4L43A 1URCA 3MW1A 3VUMA 3MFTA 4GSBA 2CGXA 3HUCA 1OKYA 3NW7A 5IISA 3F9NA 4F7LA 4RJ6A 4QYGA 5J9ZA 4BKJA 3B2WA 2VWWA 1YXUA 3NNUA 3NVMB 3D2IA 4I23A 3Q6UA 5HCXA 3WZDA 4E26A 5HVYA 2OZOA 4I94A 1H1WA 2C5XA 4A9YA 3OZ6A 3LKMA 3LMGA 2J0MB 3OTUA 3O17A 4WIHA 4X3FC 5FRIA 4DH1A 3S0OA 2Y7JA 3ITZA 4XLIA 2R0UA 5CVHA 3OD6X 4PPAA 5K0XA 3C4EA 4PF4A 3KVXA 2E9OA 4HYIA 4YJNA 3O2MA 4A9UA 3ODYX 3AMAA 4EH3A 3UO4A 3O96A 2XZSA 2OKRA 3BKBA 3FY0A 3HAVA 4NYEA 4O7SA 3EYHA 1KE8A 1SYKA 2JIVA 2W99B 3KULB 4W8DA 3RAKA 4FEUA 2J4ZA 5J1VA 3QRUA 1MQBA 4EJ7A 4QYHA 2QC6A 3QRTA 5AR8A 4E1ZA 4M8TA 5FXSA 3R1YA 1IG1A 4FT7A 3UE4A 3ZO3A 3ZRLA 3JYAA 5JRQA 3QZIA 5ETCA 4USDA 4UMRA 4RQVA 1ZY5A 1PMUA 3EN4A 3FKOA 2QQ7A 5A4QA 4F7NA 5AP6A 4FA2A 4QMVA 2PUPA 4BYIA 3PY3A 4DTKA 4K77A 5CAPA 1LEZA 1SVGA 3FL4A 3LFFA 5EOBA 3MI9A 3TEIA 3NR9A 4TW9A 4L7FA 5GZAA 5IA0A 2R5TA 4IDVA 3F3WA 4HW7A 5E92A 3IONA 4K9YA 4WNOA 1BI8A 4DFYA 3RNIA 4KIKB 3Q2JA 4C37A 4R1VA 3WE8A 2B55A 4QP8A 4G3FA 5C4LA 4BYJA 3P9JA 5HU9A 2C5OA 2VZ6A 2UZLA 4FKGA 1V1KA 2RFSA 1YQJA 1ZY4A 4NTSA 3TG1A 3IS5A 2X81A 4O7ZA 3A60A 4B8LA 4W9XA 3KXNA 3LFDA 1QMZA 1WVXA 2Z7QA 3LM0A 2E9UA 3OVVA 1YI3A 4BDAA 2QR7A 2WTVA 5EM8A 1NVQA 4EL9A 2IPXA 3I79A 3ZUTA 4HNIA 2B4SB 3I5NA 4L6QA 4MXXA 3NS9A 2BHHA 4FTJA 3FXZA 4CTCA 1ZOHA 3QGYA 3R22A 4RFZA 4HCUA 4YTHA 4RFYA 4C4IA 2I7QA 4H3BA 2YCFA 2Z8CA 4L46A 4RC2A 4JNWA 4AOJA 5M4IA 4AZSA 3R02A 5TE0A 2YERA 1NT2A 4GRBA 3BGQA 5KMIA 1PRYA 1G3NA 1CKPA 5FEEA 5DOSA 3GXLA 5AP5A 3PA4A 3OS3A 4BI0A 2XS0A 3GU5A 4AG8A 4W4YA 3MFUA 2QOLA 4L8MA 5LMAA 3FQHA 5AUZA 1M14A 4O6EA 4AQCA 4OTWA 5CF5A 1SNUA 4MXYA 4FT0A 4FV5A 2A1AB 3V5WA 2QLQA 4RGJA 5I9XA 4EWQA 4E3CA 3GFWA 4KINA 1J7IA 2CKPA 2HY81 3DU8A 5D7AA 4UZHA 3HV5A 5A4TA 3Q4CA 5L2SA 2CKEA 3UC3A 5EG3A 4Z16A 3ORKA 5LVNA 5KZIA 3WI6A 3KRXA 5AR2A 2B1PA 2X2LA 3DA6A 3GT8A 1RDQE 2W96B 5DIAA 3LCTA 3MY5A 3VIDA 5KMJA 4USFA 5IQHA 4AXAA 3P08A 3KF4A 5CF8A 4PMPA 5CF6A 4O2ZA 2PVNA 4BDIA 2WMQA 4YTFA 4RZVA 3OWPA 3R21A 3FLNC 3UDBA 3R1SA 3EFWA 5ANOA 2QOOA 2VTRA 4MH7A 4O96A 2C68A 2X4FA 3BELA 4MF1A 4NM5A 2CLQA 2HWOA 5IEVA 4D55A 2UUEA 3Q60A 5J79A 5A46A 2YHVA 4QMSA 3V8SA 3NSZA 4C4GA 4TPTA 3VAPA 3FI8A 4FGRA 4AAAA 1XKKA 4IJPA 2YAKA 3NVKI 5D12A 4YJVA 4C4HA 4MF0A 3MVLA 2C4GA 4L52A 3EFKA 4BTFA 4O2PA 4G16A 4XV3A 3E63A 4QP9A 4B8MA 4QTDA 2VTQA 2QOHA 5FDPA 5CI6A 3NAYA 5C8KA 2NRUA 2A27A 1Y8GA 4A07A 3PIYA 5E1EA 4AW5A 3V51A 2VTHA 4U3YA 2WMVA 3PXFA 3M1SA 3OROA 5EDPA 2ZV9A 4O27B 2HW7A 3RALA 3ZLSA 3VUDA 3MY1A 4QP7A 3MH0A 1O9UA 4QPMA 1Q97A 4AT3A 5KBQA 2P0CA 3Q3BA 3QTUA 3VW6A 2W1EA 3A7JA 4ZOGA 3RPYA 5IH5A 5M44A 3TUCA 3UOJA 3QLFA 3C4ZA 3CTQA 3SG8A 4FSNA 2ZB1A 5H8GA 3G9LX 4GYIA 4J52A 4Y85A 3SKCA 4D2VA 4FSZA 4G9CA 4FNZA 5DEWA 5A9UA 2FVDA 2DQ7X 3E8NA 2W4KA 2XIYA 3ZXZA 1OL5A 3C13A 3PVWA 5D11A 5FLFA 4QMXA 5CASA 2J2IB 3G6HA 4NW6A 4NIFB 4EBWA 5AADA 3LQ3A 4IAIA 5HEZA 5GIOE 2P33A 2R3OA 3MH1A 3RTPA 4Y83A 1PXOA 3ZO1A 5IEYA 2VWIA 5K3YA 2VD5A 1GZOA 4HOKA 2I6LA 3NCGA 4QMPA 4C4EA 4M68A 2C6DA 2QD9A 2GSFA 3W18A 1PMEA 1DAYA 1TQIA 4D5KA 2IW9A 1BLXA 4WRSA 2B54A 3ZC6A 3QTSA 2F7EE 4IEBA 4BDGA 4EJNA 4XV2A 4E8AA 3CS9A 3SXFA 5DRDA 2JKQA 3NZ0A 2JEDA 1QPJA 2C6KA 3UPZA 3QTWA 4AUAA 5L6PA 3AC1A 1IRKA 4XBRA 3BLQA 3OP5A 2R3HA 4XRJA 5DMZA 4DG3E 4WBBB 3BWFA 4BCGA 3ZXTA 4DCAA 4E5WA 1M2QA 5EI8A 2C3LA 4Z3VA 4F09A 3ERKA 4WNPA 3UVQA 3QFVA 2OIDA 5FWKK 5AR3A 4YC6A 4N6ZA 2C69A 3K5VA 3R1QA 1U54A 2E9PA 4EEVA 4DC2A 4U8ZA 1GIJA 4GS6A 1XHAA 4HVHA 2ONLC 4AW2A 1SM2A 3F61A 1OKWA 4F63A 2C6TA 4HZSA 4FIHA 2CN5A 4UYAA 4F9CA 3HV4A 4Y5HA 3UG2A 2EB2A 4IW0A 3U8WA 3MWUA 4ASZA 4D2SA 3HMMA 5JK3A 5K5NA 4FKJA 3TCPA 3DKCA 5L8KA 2WTKB 1J7LA 1YHVA 3A7GA 1AGWA 3ZFXA 4JS8A 4XG7A 3KMWA 5E8SA 2P2HA 2PVYA 3OXTA 4GT4A 4IAKA 5JRSA 4RWJA 4LM5A 5C01A 3VVHA 4C58A 4TNBA 3EZVA 4ZZMA 4BTMA 5LVMA 5JKGA 4S32A 5EQYA 5B0XA 2ZDTA 4XJ0A 4ZAUA 4D1XA 4KS8A 3REPA 4C4FA 4BR3A 1FGKA 3DJ7A 2JKOA 4FZFB 3S4QA 3TNWA 4BCFA 4ID7A 2WKMA 3QCSA 3D15A 4AF3A 4AT5A 5HG8A 1JSVA 3LLTA 4YZMA 4Q9ZA 4BDKA 2XJ2A 2H8HA 4FZ6A 5H8BA 3TT0A 1OIQA 4U42A 3VF9A 5DYJA 2O3PA 2BPMA 2YM7A 1OBDA 1XBBA 2XB7A 4WD5A 4ERWA 3KMMA 2JGZA 4FIJA 3QQKA 1Q8YA 4J99A 4C0TA 5HESA 1MQ4A 3BGPA 2FGIA 4OTIA 3NX8A 4AN3A 4GJ3A 2IZTA 2YJRA 2FSMX 2QI8A 2EXEA 4MQ1A 4D28A 2IZUA 5IMXA 4L3JA 1WBTA 2G1TA 3BIZA 4IBMA 2YM6A 4YJUA 4PV0A 2YISA 1PYXA 3TIZA 4XG9A 3HA8A 4G17A 4XS2A 5HE3A 4ACGA 3OCGA 5JGDA 1PMNA 4ALWA 3BHVA 3ZZEA 1Q24A 3CLYA 5BYLA 3CGOA 4IX5A 3LXNA 2P3GX 4DLIA 3TNQB 4I6BA 3Q5IA 2G9XA 2W1GA 4QD6A 3UC4A 4BZNA 4DLJA 5LMKC 2PUNA 2AUHA 3HAMA 1KSWA 4D0WA 5C4KA 3F66A 4FL3A 3MESA 1PXIA 5ETAA 4QO9A 4DBNA 4HPTE 5LJJA 4QRCA 4CFUA 1XH4A 3LFNA 3QQGA 4E73A 4I0SA 2UV2A 4H36A 5CANA 4AGWA 3FL5A 2O2UA 4F1OA 4NU1A 3GEQA 2YCSA 3PUPA 3Q96A 3HDMA 4RC3A 3VUKA 4ZLOA 4Y5QA 4U45A 3CJGA 3W8LA 4F9YA 2H96A 3UG1A 1OPLA 2HK5A 4MD9E 1XQZA 2BRGA 4TWNA 4D5HA 3O8PA 2QG7A 2F7ZE 4P7EA 3CQEA 4MNEB 1PXKA 3WILA 3ZFMA 3FV8A 3KN5A 3IO7A 4K33A 1V0PA 2W17A 3THBA 4X2GA 3FLQA 2YLFA 1XH8A 4EOLA 4HVDA 1WZYA 5AA8A 5HD4A 1PXLA 2WQMA 3TKUA 4D4VA 3I7CA 3ZSIA 4LGDA 4RJ4A 2W1CA 3I81A 4E20A 4KUJA 1H1SA 3R8MA 5M4FA 1JOWB 1V0OA 3PY1A 3ZUUA 3FPMA 4GJ2A 3I5ZA 4WT6A 4BVUA 2C1AA 1H25A 1PMVA 2R7BA 3FMLA 3CQUA 3MV5A 1H0WA 4DH3A 2W1IA 2GQSA 4RIXB 5IA4A 3PXQA 4Z7GA 3CIKA 3VS1A 3QZGA 4FKLA 4JLCA 2J50A 3L8PA 4DBXA 2PHKA 3PVUA 2PVRA 4IZ7A 3LVPA 4IZ5A 4R8QA 1XH7A 3A4PA 3Q04A 5C26A 2XK9A 2FH9A 3EZRA 5C9CA 4FNYA 4HPUE 3QWJA 2X6DA 3LCSA 4AA4A 3QKKA 2B9FA 3GI3A 1GAGA 4GT3A 4JG7A 4ZEGA 5IMEA 5E8TA 4MAOA 4FG9A 1SVHA 3L8XA 4FYNA 4EHZA 3DKGA 4H3QA 3TJCA 3FMMA 3ACKA 4QMOA 3RK5A 4FG8A 4PDPA 5FDXA 4YJOA 3MY0A 4HYSA 4YLJA 4CFWA 5EYMA 1R3CA 3ZM9A 4IC7A 2HZIA 3PA3A 3TZ7A 4NK9A 5CSPA 5IQCA 5HX8A 4FKVA 4B9DA 2VRXA 4G6NA 4GKIA 3QKLA 5CF4A 4ERKA 4IXPA 3IGOA 3E8DA 1W98A 1FGIA 1ZXEA 3LHJA 3R04A 1V0BA 4JRVA 1TQMA 3GCQA 4DFLA 3DNEA 3P0MA 1ZZLA 2QNJA 5L4QA 2HXLA 2RSVA 1YW2A 5F94A 3G0FA 2O64A 5DT4A 5BVKA 1JPAA 4GFGA 4BBFA 1K2PA 1OKVA 3HP2A 3R63A 5DH3A 1KOBA 4RVLA 2VO0A 3TZMA 4XOYA 3P79A 4QMYA 4ZMEA 3G2FA 3QA0A 4V04A 4OLIA 5T6KA 4G2FA 3CCNA 4FEVA 2F9GA 4P5ZA 2Z7LA 3NW6A 4NJ3A 2GMXA 2IZSA 4Y95A 2R3MA 3FHIA 3KULA 2PUUA 2ITPA 2VNYA 3A7HA 3FMHA 3GC7A 4YBJA 2WXVA 3NYNA 5IF1A 2YM3A 2A19B 4YO6A 4QP3A 4NT4A 5E8ZA 5FP6A 4ZTMA 4W4WA 3ZO2A 4I3ZA 4M84A 4F1MA 5BNJA 1XBAA 4ZTHA 5FTOA 3IW6A 5FEQA 2QVSE 1XJDA 4K18A 3LXPA 2GQGA 3B8RA 4FF8A 2W06A 2RGPA 4MVFA 4TYGA 2JBPA 3IECA 3K3JA 3TV4A 4FNXA 4PMMA 4I6QA 5DN3A 4FSUA 3TNHA 3EN5A 3SRVA 4X6RA 5TT7A 5EM5A 3ZEWA 1JQHA 3G15A 3HMNA 1SZMA 4RX9A 1YDSE 3KXXA 4IDTA 3QQUA 2JDRA 4MBJA 4ZTLA 5CEIA 3QUDA 3I0OA 1KV2A 4K6ZA 2V22A 3RGFA 5CU4A 5E8WA 4YZDA 3TWJA 3GCPA 4UWBA 3MBLA 1UKHA 4E6AA 3AC3A 5JT2A 3DB8A 4TT7A 5AUWA 4EOIA 4DFBA 3GGFA 3QC9A 4NH1A 3SOAA 2IG7A 4JDJA 5GZ8A 2DYLA 2UW7A 1VR2A 2YACA 3BBWA 4FKIA 5ANJA 4P4CA 3ZHPC 1ZYJA 2QR8A 4RWKA 2I0VA 4ASDA 1U5QA 5HICA 2C30A 5HTCA 4L01A 4U5JA 3IDCA 4X6QC 1FMOE 5AM6A 5E8XA 5AV2A 3PSBA 5GHVA 2H6DA 3FSKA 4BWKA 3HRCA 5DHJA 2XYUA 3OG7A 3W33A 4M69B 3D7TB 3LXKA 4RVKA 4WG3A 2I0YA 3FI3A 4O21A 4QPAA 2OJ9A 5F1ZA 4OGRA 2YWPA 5HG9A 2Q83A 1GZKA 2ZB0A 4IZAA 5IUGA 4XP2A 1FVRA 2IVTA 2RKUA 1H27A 3AD4A 3OT8A 5EDRA 2YWVA 1PJKA 5B2KA 2YM5A 3EFJA 3LCDA 3RJCA 5JFVA 1YWVA 3E92A 1PY5A 3DKFA 3CPBA 1ZMUA 3F7ZA 4C3FA 4E6QA 3R83A 4FMQA 2OG8A 4PP7A 2YABA 3BGZA 3LAUA 4I1ZA 5KKRB 4EYJA 2ITTA 4U40A 2ERZE 5DR6A 4H3PA 4EQCA 1VYZA 5BYYA 1FPUA 4FV1A 4AGDA 4PPBA 3RWQA 5KMLA 5IEXA 4Q5EA 3B2TA 1ERKA 2FUMA 3MTFA 4PL5A 3C4WA 4X3FB 3TL8A 4JDIA 3MH2A 4O0UA 2YA9A 2UZDA 3GFEA 4NTTA 3ZS5A 3E8EA 4KNBA 3G33A 1VJYA 4I4EA 5D41A 2WMRA 1DI8A 2YLEA 3D5VA 4U3ZA 4CV8A 3COHA 1QL6A 5AV3A 1YI4A 2PMOX 4WKQA 4PP9A 1BL6A 2JFLA 5ANIA 4ZSEA 3P86A 2C6LA 4I21A 4RWLA 3IGGA 5KHXA 4TL0A 5A4EA 4FZ7A 3FY2A 4GL9A 4E4LA 4EC9A 2I0HA 3ORMA 2RG5A 2B53A 2BILB 3GENA 3KXHA 4BDCA 1JNKA 3BHHA 4MCVA 2GNIA 2XA4A 4FK3A 5DNRA 5KX8A 4X2FA 3C1XA 1IA8A 4FIGA 4HCVA 3E8CA 3JS2A 2YFXA 3P23A 4HGTA 4XP0A 2OF2A 3DBFA 2ZMCA 2VO3A 2X8DA 4KBKA 2OXYA 5L8LA 5HNGA 3GOPA 3WBLA 4UX9A 5FXQA 4C3PA 2JITA 3E87A 5AUXA 2GS6A 2VTPA 4LMUA 1Y91A 4S30A 4CFMA 3R7IA 5CNNA 2EUFB 4ZTNA 2XK7A 1YWNA 2R4BA 3PPZA 1MP8A 4QTEA 2NP8A 4ZK5A 5J5SA 3PVGA 5TF9A 2PVJA 3EQGA 3FI4A 2ETRA 3QX2A 2WTWA 2V7OA 4NW5A 3A61A 1KOAA 5HE2A 1I09A 2W4JA 1Z9XA 3HMIA 4XG3A 2GHLA 4FT9A 3Q5ZA 4PWNA 1TVOA 1XH5A 3M42A 3AT2A 5JGBA 4EONA 4GIIA 3MFRA 4LQMA 3WIKA 5CAVA 1T46A 4PMTA 3R73A 1MRVA 4ZJJA 4EH9A 4C34A 2X6EA 3Q52A 4ZTRA 2Y6OA 5LMBA 1ZYLA 3PZEA 5BUEA 3UQFA 4W9WA 3Q4UA 2PVKA 4HVIA 5EFQA 3MYGA 3UYSA 2R3QA 3BE9A 3LMIA 1GJOA 5EI2A 3QRKA 3U9CA 4O38A 5KMKA 4DEDA 3U6HA 5CQWA 1FBNA 1IA9A 3ATSA 3VS5A 4F0IA 3RCDA 4OBOA 4HVGA 4DFXE 3BV2A 2O8YA 1W8CA 2V0DA 3QD3A 4NIFA 3VS2A 5HOAA 4QYFA 1ZYSA 3W2RA 1DI9A 1ATPE 4ITJA 3OTVA 4YSJA 3KN6A 3PPJA 3CP9A 5CI7A 3WF5A 4J1RA 2REIA 4LV8A 4EOKA 4FKOA 4RZWA 4KBAA 3EHAA 2UW0A 4DEAA 3JXWA 2X1NA 4EHGA 5L3AA 3VUTA 4BGHA 5EKNA 3PE1A 3UYTA 3BV3A 4CYJA 4EOOA 4IAFA 2XMYA 4QT1A 5K0KA 4F4PA 2YCRA 4YP8A 5JGAA 3S1HA 1Q8WA 3TDVA 3VNTA 1ND4A 3NCZA 4DGMA 2VWVA 2J51A 4AZWA 4AN9A 3CKWA 2QO9A 3BCEA 4F1TA 1OUYA 3RM7A 3VUHA 3F3UA 4JJRA 4X0MA 4ZSJA 3BLRA 3FUPA 3W2QA 3QTZA 3F7WA 5HD7A 3BYUA 4YBKA 5D1JA 3R9HA 3QQFA 3SC1A 3FZRA 4BHNA 3DB6A 4FIIA 4BCIA 3W1FA 4TYHB 3W16A 3CPCA 3LXLA 3PLSA 4AZTA 2PSQA 5M06A 2VN9A 4ZLZA 3Q53A 3BHYA 5GZ9A 4JT3A 4ZP5A 3G90X 3UJGA 5IQIA 3PSCA 5BX0A 5BVFA 3LM5A 1F5QA 4FL2A 2BTRA 3W10A 1ZYCA 4ZS4A 5IQFA 4ALVA 4JI9A 2XNMA 4AW1A 4ITIA 2JLDA 1PXMA 4FTMA 1U46A 3NNWA 4EZ5A 3SW4A 2BCJA 4IQ6A 2BZKB 4RG0A 5AP0A 4C8BA 4R7HA 1DM2A 3FI2A 4CZYB 2R3JA 4MXOA 4NWMA 5EM6A 2XYNA 4BTJA 4MYGA 4EC8A 5CXHA 2PULA 3KRLA 3E3BX 3OCTA 5FQDC 4QP6A 1L3RE 4E4MA 4FYOA 4D2WA 4C61A 4CMOA 2BZJA 4WHZA 5HBEA 2OJJA 5M51A 4O7TA 3GU4A 2IWIA 3H0YA 4TXCA 4XX9A 2WEVA 4G9RA 4LRMA 1R78A 5I3OA 3SW7A 4FUYA 4BCJA 4F6UA 2IW8A 4O0VA 4KBCA 3WZKA 3U6IA 3RPRA 5CYIA 4CFVA 3POZA 4OW8A 3PIZA 4LRJA 1IAJA 2X4ZA 2ZJWA 3A8XA 5A14A 1G5SA 2IVVA 3TM0A 4XOZA 3ZFYA 3JY9A 3HV7A 3P7BA 3CY3A 2GU8A 2Y0AA 4GG7A 4O0RA 2EXCX 4FTLA 4CKIA 1M2PA 1OMWA 3OUNB 3TACA 2YM4A 3HNGA 4FIFA 5EHOA 3HV3A 4JL9A 3OXZA 2UZBA 1UU8A 4EBVA 4J8MA 4AOIA 4EH6A 1QPDA 3VJOA 2HAKA 4FKRA 3DBDA 4R6VA 4X3JA 3PYYA 5KO1A 3LIJA 3R8VA 5CU6A 5LWMA 3ATTA 3LOKA 5HIEA 2WIHA 4BDEA 2PMNX 2HENA 2V55A 3N4TA 2UVXA 4Y73A 2HWPA 2F49A 4FUXA 4D1ZA 3Q32A 3UNKA 4L44A 4FTRA 2ZV8A 3CC6A 4JX7A 5FM2A 1CDKA 4BCQA 4BZDA 4J98A 2XKDA 5FUTA 1UV5A 4FTUA 4C3RA 4DGLC 3DT1A 3AT3A 5HTIA 1U59A 4FV9A 4KS7A 1RW8A 3DXNA 4A9RA 4MXZA 2UZNA 3U6JA 3KRRA 4UXLA 3ENHA 4FV7A 1CKIA 1R0EA 2PWLA 1JSUA 3SXRA 3AD6A 1UNHA 5CLPA 5E90A 5L6WL 3AXWA 4IVDA 4XG4A 3MA3A 3LFBA 2EVAA 4QOXA 1PXPA 3JY0A 3R7GA 5HZNA 3F2RA 4DTAA 2PZIA 4YMJA 1O6YA 2H34A 5LWNA 1QPEA 3AGMA 2DUVA 1FVVA 2HOGA 3OCSA 4N6YA 4AZFA 3KXZA 2P2IA 1UWJA 2O63A 2C6IA 4QTBA 4XYFA 4AWIA 1YDRE 2ZMDA 3DV3A 2QOBA 4C57A 2VAGA 2X39A 2UW9A 4OR5A 4FTAA 4ACCA 2WTJA 3H30A 4RJ5A 2BIKB 3N51A 4JX3A 3DBQA 4UMUA 2XK4A 2GNJA 4FTQA 4MKCA 3RNYA 4KD1A 4I92A 5F4NA 1ZARA 2BFYA 5L6OA 2BRMA 2J0LA 5AM7A 5C8NA 3R2YA 4RIXA 4PTCA 1RE8A 4OAVB 1PW2A 3MJ2A 1KE5A 4J71A 4N70A 4V0GA 4I24A 3QALE 1STCE 4DT8A 4IAAA 2CNQA 1BYGA 5HE1A 5M4UA 3TZ8A 3QX4A 2UZVA 2PZYA 3IQ7A 2PU8A 5H8EA 2PE2A 4AE9A 4RX7A 4EK3A 3PJ3A 3EQDA 3PG1A 3HLLA 4DH8A 3R8LA 4CSVA 2JDVA 3A7FA 2R3IA 4YLLA 4EZ7A 3MTLA 3ZZWA 4OTQA 4F6SA 5HU3A 4A4LA 3K5UA 3SVVA 3QU0A 4TKSA 5JFSA 5I9UA 4KSQA 3GOKA 3BX5A 2BALA 1S9JA 3P78A 4G5JA 3F3TA 1ZMWA 2UZEA 2V62A 2UZWE 5DGZA 3TKIA 1Q3DA 4BCOA 3FLWA 3KMUA 4DFNA 1PKGA 3A4OX 3Q9YA 3E7VA 3PJ2A 4WOVA 3NGAA 4HVSA 3JPVA 4YZCA 5AP7A 5KNJA 3C4CA 3T8OA 3C9WA 5AP2A 3KY2A 3LLAA 4DH5A 3W2CA 3EH9A 4K8AA 5L2WA 4FKQA 1W84A 3UTOA 1LEWA 2R64A 2WELA 4ANSA 4F0FA 5I9VA 3CY2A 3HV6A 4L68A 1YOMA 5JN2A 5M07A 3L8VA 3MFSA 4JQEA 4YNEA 2YIXA 3V8WA 4QMQA 5DE2A 3CKXA 3QRIA 4YGAA 4O0WA 3FZOA 2CNVA 5J9YA 3DDPA 4O1PA 5E7RA 4EK4A 3JUHA 2XVDA 4MD7E 4O7YA 3WF7A 1ZYDA 5DFPA 2XRWA 3H9RA 3HGKA 4XG2A 3S3IA 3HECA 2VO7A 5J8IA 4O0TA 4OTRA 4FV0A 1W7HA 2XP2A 4ZSLA 5HO7A 4U80A 4J7BA 3V6SA 2WMUA 4KIOA 4FSWA 2OXXA 3ZONA 3CJFA 4K2RA 2J6MA 3IW8A 4GU6A 5KUPA 2XKCA 4DEEA 3MB7A 3R00A 4KIPA 3KB7A 2B52A 3WF8A 4B4LA 5TR6A 5AA9A 2W1DA 1DAWA 4CT2A 5HCZA 4XHKB 2IN6A 4BDFA 4L9IA 3O8UA 3JR1A 3R9OA 3RK7A 4OUCA 4QQCA 3NLBA 2PVLA 3FDNA 4AE6A 1M52A 3GC9A 5CSVA 4AW0A 3C51A 3FMEA 4QQTA 3AOXA 4ARKA 3EQRA 4G31A 3V3VA 4M3QA 3DXQA 4BGGA 4JAJA 3OY1A 3MVHA 5E8VA 4YPSA 4BCMA 2BDFA 4RPVA 3ALNA 3GBZA 5LCJA 3QGWA 2C1BA 1CKJA 3EN9A 4EOQA 2W4OA 4CKRA 5AAGA 4ZXTA 4N57A 3R9RA 2CGVA 3NIEA 4I6HA 2OIBA 4K1BA 2C5YA 3R7UA 3ROYA 4QMUA 3IDBA 4PNIA 5I4NA 4R5YA 3D7ZA 4PDOA 4M69A 3D7TA 5ITAA 4K11A 4EK8A 4BCKA 2W5HA 4IADA 1OIUA 3LCOA 3PDTA 3I0QA 3MVJA 4LOOA 5C8MA 5JZJA 4R78A 1P4FA 4BI2A 3AC4A 3R28A 5HGIA 4D4SA 4UWYA 2BZHB 3Q2MA 4F7JA 3OXIA 1ZRZA 2OFUA 1H1PA 4IWOA 5JQ8A 4P2KA 5IH4A 3COMA 3S2PA 3VUIA 4EOMA 2V5QA 3PFQA 4TWCA 2CKOA 4N4SA 3GU6A 2F4JA 3QTQA 4CCBA 2OH4A 3QYWA 3RAIA 3VS3A 3U9NA 3BQRA 4U44A 4XH6A 4QTCA 2OSCA 3U4UA 2FYSA 4WUNA 4XV1A 4FIEA 3GQIA 1OPJA 2FO0A 5DPVA 4GFOA 3RMFA 3ULIA 3VUGA 4DGOA 4P5QA 3VW8A 4YJSA 2J5EA 4IX4A 3BEAA 3D5XA 3E3PA 2YN8A 2XM9A 4FKUA 3FXXA 4EK5A 2RFNA 1JLUE 5EI6A 2YIRA 3QCQA 3EKNA 3O7LB 1VYWA 4IWDA 4DG0E 3VS0A 2KULA 4IM0A 3EQCA 5EHLA 3BU6A 5DBXA 3EJ1A 3HYHA 4LGHA 5CTPA 4BRXA 2W5AA 4FSQA 4JVGA 2VTMA 1YDTE 4J96A 2QLUA 3DK3A 4F7SA 4EH2A 2X8EA 3QQHA 4NEUA 4C4JA 2WTDA 4O22A 2UW6A 4EUTA 2R3FA 4WSQA 4F08A 3WZUA 5A6NA 4EUUA 3H10A 2WU6A 2YCQA 3Q4ZA 4TWOA 3R8PA 3RI1A 1X8BA 4O7RA 1OL6A 4DFUA 3AQVA 2PYWA 4EORA 4ANLA 1W83A 4BCHA 4FGBA 3AT4A 1Q8UA 3W2SA 4GKHA 4RFMA 4BI1A 4C7TA 1XO2B 3HKOA 4UY9A 2ZM4A 3DDQA 4XP3A 2Y4IC 4U6RA 3FE3A 3PWYA 3ZYAA 4UMQA 1YVJA 1LPUA 2P55A 3ET7A 4MNFA 5A6OA 2RL5A 2R3LA 4C2WA 4JR7A 4C35A 4P90A 3UZPA 2NO3A 4RWIA 3KKVA 2IW6A 3FAAA 3PLAE 1H24A 1HCLA 2JKMA 1UNLA 2R3KA 2WGJA 4H1MA 1OIYA 2HXQA 4O86A 2EB3A 3TJDA 3C0IA 5I9WA 5M57A 5JFWA 4IB1A 3OFMA 2RIOA 3OCBA 3F3ZA 3DBEA 4GH2A 2VWYA 4EQMA 3QCXA 4KIQA 3WF9A 2OJIA 3MIYA 4M0YA 4I93A 3BEGA 4PL3A 1JKTA 3ORLA 2J5FA 5IH6A 3E64A 3A2CA 3GVUA 1P5EA 4M13A 4A7CA 3B8QA 4YZNA 4O1OA 4WSYA 4DINA 4QPSA 4FT3A 2VX3A 4EK6A 1WBVA 2VGOA 3OT3A 3QKMA 4ZS0A 5HKMA 5C27A 2Y9QA 5FEDA 3FSFA 2ITYA 5CQUA 3T3VA 4CMTA 2OU7A 2NNWB 3FEGA 5GIPE 3DBCA 2PVHA 4R3RA 5AP4A 3ZBFA 2QHNA 5DR9A 4YZ9A 4MHAA 4V01A 2JDOA 4LOPA 3RPVA 5E9EA 3MB6A 3V8TA 5IQEA 3KK8A 2ZVAA 2PE1A 4OT5A 2SRCA 4WG4A 4BDBA 5HBHA 2XJ0A 5T3QA 4DTBA 3EQPA 4GT5A 5EOLA 5L2QA 2J0JA 2FSLX 4RVTA 4JOAA 4W4XA 2WB8A 2XIKA 4IACA 3G9NA 3E7OA 5HVJA 1Q5KA 4EI4A 3UQCA 4BCNA 4U79A 5GNKA 1JWHA 4BBEA 3LFEA 4RA5A 5IPJA 2C0OA 4EH4A 4A9TA 2C6OA 2PVFA 4FBXA 1YKRA 2W05A 3FC2A 5ICPA 1AD5A 1REKA 2QKRA 2FB8A 5DA3A 3K3IA 3SAYA 3LFCA 3O71A 5CAQA 3QZFA 2WMSA 5EM7A 2BUJA 2UZUE 4GEOA 3RVGA 4KKGA 1J91A 4HZRA 5FD2A 1XWSA 1CM8A 4HYHA 2QO7A 3EQIA 3ORIA 4O7WA 3Q6WA 4ONAA 4E5AX 3VS6A 5EK7A 3FZSA 2XK3A 1B6CB 3HRBA 4U81A 4Z7HA 1BX6A 4D4RA 1KE7A 4L67A 2XM8A 4C62A 2QODA 4FKWA 5LARA 4DEGA 2VTAA 3TIYA 1BL7A 1U5RA 2GS2A 4FTOA 5JZNA 4TNDA 4FICA 2WQOA 5IQBA 1FINA 4XUFA 3O51A 2VTNA 2YZAA 3HX4A 3G51A 2CJMA 5ETFA 3R6XA 2OZAB 4L7SA 2WMAA 2OFVA 3KEXA 1XR1A 4MXCA 3TTJA 4NM3A 3R8ZA 5CX9A 4DEHA 4LMNA 3QZHA 3L9MA 2R9SA 2WMXA 2OIQA 2BDWA 2VWUA 3RINA 4IHPA 2BFXA 3P7CA 4KIKA 4XG6A 5AX3A 2A0CX 2B7AA 4UWCA 3UQGA 3V01A 1Q41A 4QTAA 4TWPA 4CYIA 1NVRA 1WBOA 3FBVA 4YC8A 4ASEA 2XEYA 4UMPA 3RZBA 2CGUA 3D5UA 1L8TA 3DTWA 5J95A 2LGCA 4IJ9A 3VS7A 5E8YA 2XBAA 3LW0A 1YHSA 2OICA 4ZY4A 2AC5A 4GUEA 4RX8A 1W82A 2VWZA 3GP0A 3H4JA 4S33A 4M67A 2R7IA 5CSWA 2HZNA 4RIOA 2G2FA 4JQ8A 4I5MA 3KRJA 1UU7A 2XK6A 4S34A 2E9VA 4EWHA 5I5ZA 4G34A 5CZIA 2ITZA 3OOMA 4FSTA 3TUDA 5DWRA 2WTIA 4BDDA 2C0TA 5HG5A 3CQWA 2OI4X 3F5PA 4CT1A 4X2JA 3DPKA 3AMYA 4LUDA 4LOQA 4D1SA 5KHWA 4PRJA 4FV2A 4AA5A 4FV4A 2ITVA 5CT0A 2PZPA 3DS6A 3CD8A 4FODA 3DK7A 2GHGA 2B0QA 2ITXA 4DEBA 3V5LA 2XKEA 2Q0BA 3E62A 4GW8A 4DGNA 3NYXA 3PE2A 2GNGA 4H1JA 3QTRA 4NL0A 2XUUA 3VBWA 1Y6BA 2GTNA 2ZM3A 4GUBA 3TV7A 1OPKA 4EHEA 4AA0A 3L8SA 4PMSA 4RJ7A 2GTMA 3DAKA 4FT5A 4BIEA 3NYOA 3DFAA 3GU7A 4FTKA 4IX6A 3VULA 4CFFA 5JQ5A 1WAKA 3EKKA 4ZZOA 4J8NA 3DKOA 1H07A 5IUIA 4DITA 5KE0A 2X7OA 4CZUA 2J90A 3VHEA 3RP9A 2C47A 3DFCB 3IW7A 3KVWA 4QMLA 4CQEA 1OL7A 1Y8YA 3F2AA 3C4FA 3DY7A 3DZOA 2E9NA 2WOUA 4JBOA 3IDPA 1KE6A 3R9DA 1JAMA 2GPHA 2WZJA 1JVPP 3IKAA 1R0PA 2G2HA 4IB5A 4FV6A 2VNWA 5CVFA 3OWJA 3MA6A 1APME 3T9TA 3VN9A 4II5A 5DR2A 5BPYA 4ZZNA 2YIWA 1H08A 2C0IA 2YDKA 3OEFX 3QTXA 3RKBA 2EWAA 4W8EA 5LQFA 2QOCA 3HL7A 3O23A 4I20A 5DI1A 4BHZA 4QMNA 3NWWA 3RHKA 1KWPA 3VQHA 4CLIA 3SG9A 3KREA 4FL1A 2EXMA 2XJ1A 4DCEA 2OWBA 5CS6A 1Y57A 3PWDA 2PE0A 3HMPA 3IOPA 3WYYA 3UO5A 2CPKE 1F0QA 1NY3A 1TKIA 3EIDA 3OWKA 1H4LA 4GV1A 2XNEA 5GJFA 2ZOQA 4LV5A 1Z5MA 5AX9A 4NFNA 2PZ5A 4JIAA 4L3PA 5EHYA 4YNOA 3ULZA 2XRUA 4OTHA 4FVPA 4PQNA 5HBJA 2Z02A 4RIYB 3I60A 1GY3A 2ZYBA 4QP4A 1KV1A 3TNIA 4ANMA 3KCFA 5CNOA 4ACDA 2X8IA 3ORTA 4IX3A 3DK6A 2A4LA 4CEGA 2VTLA 1GZNA 3NUUA 5J87A 2DS1A 3I1AA 3E88A 3LQ8A 4UYNA 4BWXA 4BF2A 4RIWB 3AC8A 4XBUA 5C03A 4CKJA 5TKDA 4H05A 4DA5A 2YIYA 5CEMA 4D2RA 3WE4A 3PJ8A 3QF9A 2QKWB 3R30A 1M17A 4O82A 5EQEA 2UZOA 4NCTA 1WBSA 3DAEA 5HO6A 4AT4A 2C6EA 5B2LA 4QMTA 3NIZA 1YHWA 4U0IA 3IW5A 3UZTA 4CVAA 3LQ5A 3GB2A 2X9FA 3ZO4A 4IFCA 5IA2A 2HYYA 2O0UA 4EKLA 1GNGA 3FMNA 4I5CA 3NMUF 2ACXA 3I6WA 4GK3A 3SGCA 1QPCA 2QU6A 3LFSA 3VF8A 5CEPA 4L42A 3NUAA 1TQPA 5BVOA 2Z7SA 4F70A 4ZTSA 1YOLA 3ZLXA 2X9EA 4IVBA 3CTJA 5TOZA 4BB4A 4MTAA 2W0JA 1F3MC 2X7GA 4R7BA 4BKZA 1B39A 1NA7A 3EFLA 2FSOX 2JAVA 2BAKA 3QLGA 3TNPC 4USEA 3PXKA 5KKRC 4GCJA 3D5WA 4QMZA 4KAOA 4BKYA 1BI7A 2G15A 4BGQA 2RG6A 2VWBA 3Q9XA 3BZ3A 4UALA 2JBOA 5I9ZA 1P4OA 3BYMA 1UVRA 1H0VA 2PUIA 2CDZA 4HCTA 4YHFA 3R8UA 2F2UA 1P14A 5CT7A 4IH8A 2Q0NA 1SVEA 1OB3A 3QQJA 4MX9A 1OUKA 1XH6A 3PG3A 4EH5A 4F0GA 3DCVA 4PPCA 1ZAOA 1WCCA 4YJRA 1OBGA 3FKNA 5AP1A 4A06A 3BYSA 3C50A 4DT9A 3ORNA 3IG7A 3FJQE 4BCPA 4JXFA 4QMMA 3EOCA 1IAHA 2ETMA 1PXNA 2J7TA 3HDNA 3SLSA 1PYEA 2BRHA 5LVLA 4C33A 4KRDA 3ZCLA 2UW3A 4IVCA 1FOTA 4NUSA 4RT7A 3ANQA 4NZWB 3CD3A 3W2OA 4O7VA 4OBQA 3OMVA 4V05A 4XG8A 4B7TA 3EQHA 5ANGA 3WIGA 2XH5A 3GNIB 4E4XA 5JSMA 4ZSAA 3R9NA 2XNNA 4LG4A 2CN8A 1WFCA 3SRVB 5AR7A 1SMHA 5B7VA 4Q5HA 3O0GA 4JR3A 2YIQA 5EYKA 3VWAA 3KXGA 2R3GA 5J1WA 2JIIA 3HA6A 3TKHA 5M55A 5M56A 2KTYA 3MPAA 5AIRA 3FWQA 3I4BA 2BROA 1ZMVA 3G6GA 2W7XA 4KA3A 3R7VA 4CTBA 2R0IA 1RJBA 3W55A 1UWHA 5CSHA 4M0ZA 2ZDUA 4L00A 3KQ7A 4C59A 5AUTA 3G5DA 3SX9A 3QXPA 4IFGA 4ZY5A 3TI1A 1YXSA 4QMWA 3EYGA 3SDJA 2GFCA 3K54A 1FMKA 4UB7A 5CVGA 4FSMA 5I9YA 5DT0A 3VQUA 3ALOA 5LXMA 5HIDA 5ACBC 1UKIA 3KXMA 4I6FA 3QXOA 1NVSA 3TTIA 3C5IA 3QD0A 1M2RA 3Q4TA 2WTCA 3CTHA 5M4CA 2F7XE 3PIXA 4MWHA 4NKSA 4DH7A 4O81A 3PRFA 3V5TA 3KRWA 2HZ4A 5BUJA 3FYKX 4JDHA 4RSSA 4FKTA 3HZTA 4RJ3A 3UNZA 3MSSA 4FZAB 4ZSGA 4G1WA 4RVMA 1WVYA 3NNVA 3ZTXA 4RMZA 2I40A 5F95A 3LCKA 2VUWA 5AV0A 1Q3WA 4AS0A 1BKXA 4EYMA 2WMWA 2IO6A 1OITA 4KSPA 4ACHA 4DN5A 3U51A 3UIBA 5G1XA 3ACJA 3ETAA 5AV4A 5DLSA 3PJCA 4DF3A 2YM8A 3OUKA 1OIRA 5HO8A 4D58A 4OBPA 4CZTA 4G3DA 3W2PA 5J7BA 3COIA 3EMGA 3QHWA 5KMOA 3AMBA 4GFMA 1NW1A 4MD8E 4FC0A 5FG8A 2B9JA 2QU5A 3II5A 4A4XA 4MNEA 4E6DA 5D9HA 4M66A 5A54A 3EB0A 4L3LA 5IUHA 1E1VA 1PKDA 2JIUA 4R1YA 2JD5A 1REJA 4LYNA 4R77A 2BTSA 3C0GA 4F9WA 2XCHA 3PA5A 3HUBA 5BMMA 3SOCA 1KUTA 3KFAA 2GNLA 4FZDB 4U41A 1URWA 1UU9A 1H01A 5IU2A 4XEYA 2Z7RA 4FVQA 2VTIA 4LL0A 2BAJA 4AOTA 1G8AA 2PZRA 4OTPA 3IOKA 1CTPE 2VV9A 1H00A 4EOPA 3OOGA 5LVOA 3RWPA 3ZOSA 1YOJA 2R3RA 3UP7A 1A9UA 3DOGA 5CENA 3I7BA 2YITA 3ZM4A 3H9OA 3S00A 3E93A 1Q99A 3BU3A 2P4IA 3I6UA 4H58A 2ETKA 4DE4A 3QWKA 3FMKA 3QD2B 3DLZA 3T3UA 1E1XA 3BQCA 4L53A 2C3KA 4TYJA 3F88A 5EYCA 4HYUA 4R7IA 3DGKA 2ITWA 5CY3A 4BFMA 4M12A 2C5VA 2ITOA 1P2AA 4A9SA 3W8QA 3N4VA 2XEZA 3OWLA 2WQNA 4D2PA 1H1RA 3SV0A 3ZBXA 4YJQA 4D9TA 4F9BA 4FI1A 2ZV2A 1J7UA 4FNWA 4RC4A 4AP7A 3TZ9A 4RJ8A 3V5QA 3WZJA 4I41A 4DYMA 3L9NA 2WHBA 3NNXA 3HEGA 1Q62A 3DNDA 3KL8A 2OH0E 3OW4A 1WMKA 4C36A 3LMHA 5A3XA 1OECA 3M11A 5I3RA 4QYEA 4YO4A 2YEXA 5HTBA 4G5PA 1T45A 3RAWA 3EL8A 1JBPE 4ENXA 1OGUA 1RQQA 4KABA 4FX3A 3ZLYA 2PPQA 3D9VA 2I1MA 2PMLX 3MJ1A 1YXXA 5KMMA 4JQ7A 2R2PA 4MBLA 1B38A 2VWXA 1HCKA 1OL1A 4NM7A 4PUZA 2ERKA 3ZRMA 4D2TA 2OXDA 5ANKA 2QONA 4ENYA 2WAJA 3NDMA 5HLNA 3QYZA 1FQ1B 3MPTA 2IVSA 2QOFA 3FHRA 4DFZE 5AUYA 4FE2A 1YI6A 3C4XA 2Y4PA 3AC5A 3PRIA 3BWJA 3F6XA 3ZEPA 4ZIMA 5AWMA 4GIHA 2GFSA 2C6MA 1ZOGA 2CNUA 3F69A 3FLYA 4RX5A 5IQDA 4WRGA 4AZEA 5K9IA 5K4JA 2NRYA 2CGWA 4HGEA 1OL2A 1I44A 3H9FA 3D2KA 5LCKA 4B99A 2VX0A 2BR1A 3BYVA 1UNGA 3PP0A 5I0BA 2BVAA 2Y4IB 3UIUA 3V6RA 3QA8A 1A48A 4IAZA 3F82A 4YLKA 3UP2A 3UIXA 3ORPA 4BL1A 3QAME 4PTEA 5JEBA 2XF0A 3G0EA 4BTKA 5HLPA 5HHWA 4O6LA 4QQJA 4U43A 4UMTA 4CQGA 5B2MA 4Y72A 3U87A 4CG8A 3L9PA 1GOLA 4TYIA 4WG5A 3QC4A 4S31A 3ZC5A 5AV1A 1R1WA 5LVPA 2HZ0A 5AR4A 3RPOA 2WNTA 3GCVA 5E4HA 4H39A 2OZAA 2WIPA 4Z55A 5IDPA 1HOWA 4JIKA 5A4LA 4PNKA 3KF7A 5FXRA 4JG6A 2EU9A 3RCJA 4ZY6A 3GU8A 1WBPA 4YPDA 1O6LA 3EQFA 3FMJA 5CAOA 4XRLA 2X2MA 4CRLA 4BC6A 4CLJA 3A62A 5FBOA 1YRPA 3CGFA 2VU3A 2J0IA 2ITUA 2O5KA 3KK9A 5FGKA 2RFEA 5CU2A 3PXZA 2JDTA 2LAVA 4AACA 3K2LA 5A4CA 3LFAA 3NUYA 2B9HA 3FQSA 3MIAA 1JKLA 2R3NA 4PY1A 4ANQA 4TN6A 1Q4LA 2BDJA 3LJ2A 2WMTA 3LJ0A 2XIZA 4UEUA 3BRBA 4FSRA 1IR3A 4YSMA 2BHEA 2XNPA 3UPXA 3HRFA 2GNFA 3AG9A 3P4KA 1NXKA 4IANA 4YURA 5BVEA 2UVZA 3NW5A 4WNMA 4JBPA 3SA0A 2WQBA 2I0EA 4AFJA 2BZIB 3LFQA 2CSNA 2WQEA 1ZLTA 4UV0A 4EKKA 3N9XA 3UVPA 5BMSA 1VEBA 4LFIA 4ITHA 3PSDA 3RBWA 1XBCA 3C5UA 4XMOA 1H1QA 2CLXA 4FOCA 3W32A 3OBGA 5CSXA 1OKZA 4CV9A 1ZWSA 4U7ZA 3D94A 2GQRA 2OW3A 5AP3A 4JBQA 3O50A 4GK2A 2F2CB 3QHRA 4YJPA 3EN7A 4AU8A 4X3FA 5FM3A 5AEPA 2CCHA 4YC3A 5CU3A 3FZTA 3OC1A 3PXRA 4B6LA 5J5TA 4QNAA 3A99A 2J9MA 3UMWA 2OJFE 3BU5A 3T9IA 5GJGA 4APCA 3CE3A 5HORA 5BUIA 4EOJA 1PXJA 3TN8A 1BUHA 3ZLWA 4C02A 4F64A 2YJSA 1OM1A 4R3PA 4WO5A 4FSYA 3UVRA 4FG7A 4EH7A 4I5HA 1JSTA 2JC6A 3FYJX 4TRLA 3F5UA 3MDYA 4BBMA 5CU0A 4UBAA 3R01A 5GJDA 2W1FA 4NCTC 2G2IA 4MWIA 1VZOA 3VBYA 5AUUA 5EW8A 2CHLA 1OI9A 2XNBA 4CGAA 3VRZA 3DLSA 1WBNA 3RPSA 2HCKA 3QRJA 4W4VA 4YTCA 5M53A 3N4UA 3DQWA 2JAMA 3TDWA 1J1BA 4M14A 4GVAA 3EL7A 3DJ5A 4AZVA 4YU2A 4NFMA 1LR4A 4EOSA 2C3JA 2JDSA 4BWPA 4DEIA 3BE2A 5AMNA 2BKKA 4CG9A 5BVNA 1LUFA 1GIHA 1QCFA 4G3EA 1M7QA 4GVJA 4YZBA 4J95A 3SXSA 5JMSA 4X7QA 5ANEA 4IC8A 4WA9A 1O6KA 3IPHA 5CWZA 4APPA 3VBTA 5BQ0A 2AYPA 2GCDA 3BHTA 4BICA 3DXPA 3CBLA 4MBIA 5AUVA 5H9BA 2WMBA 2NPQA 2WD1A 3JVRA 3LE6A 4ASXA 3NPCA 4U97A 2WPAA 4X21A 4FEWA 5DG5A 3ORXA 5CEOA 1IASA 3O7LD 4IM3A 3F5GA 4RIYA 2QOQA 3D0EA 5AFVA 4QP2A 2WOTA 4LRKA 4OTGA 4XCUA 4I0TA 3L9LA 2UW8A 2W9FB 2X2KA 4C2VA 4HGLA 2OGVA 4RBLA
chains in the Genus database with same CATH superfamily
3H3CA 4FTIA 1GIIA 3ML1A 1XMLA 4IMYA 1UA2A 1SNXA 2QCSA 1YXVA 2GDOA 3R1NA 3COKA 4RIWA 2UW4A 4FKPA 4G3GA 3ENMA 5IKWA 4WNKA 4V0GB 3NUSA 5CXZA 3R7EA 4I22A 5DVRA 2QOKA 3EN6A 4CFNA 1KE9A 2GNHA 3S95A 3LPBA 3EQBA 3NUNA 2WTKC 3ORZA 2PL0A 5IQGA 2YAAA 4ANNA 4NJDA 4CNHA 1ST4A 3R7YA 3MGYA 4FTNA 3UODA 1H28A 3AGLA 3VC4A 3MH3A 1OVEA 2AC3A 4O91A 4F6WA 3DZQA 5BVWA 4ANOA 5CAUA 4NSTA 4FKSA 4GG5A 3D4QA 2OLCA 4IB3A 5EYDA 5BVDA 4PDYA 5D10A 4RLKA 3HP5A 3POOA 5HNIX 3ELJA 2XIXA 4J97A 4HGSA 5HCYA 5AAFA 2OJGA 1E9HA 5E91A 2IZRA 3PY0A 4ALUA 4M15A 1S9IA 3GUBA 4G6OA 4O4CA 3V5JA 3ZU7A 5CZHA 3ZSHA 3TV6A 2WEIA 4Y8DA 4LDTA 3GC0A 5E1SA 5EQPA 3QCYA 4MK0A 4AX8A 3ID6C 1XH9A 5IA5A 3GCUA 2OBJA 2YDJA 3HVCA 5BYZA 3UMXA 2VTOA 2HY0A 3NYVA 2QURA 4WBOA 4ANBA 4Q2AA 4LGGA 3QTIA 3EWHA 2ZM1A 3NRMA 5AR5A 5HIBA 3UNJA 3MPMA 4KB8A 5ANDA 4AN2A 4D0XA 4DAWA 1Y6AA 4RRVA 4O7LA 3WARA 4RLLA 2XIRA 3KA0A 2Y6MA 3E5AA 3ZDIA 4A4OA 4BDHA 4C38A 4BDJA 3CSVA 3L1SA 3SHEA 4G6LA 3ZDUA 4TYHA 3NUPA 4YTIA 3RHXA 1MRYA 3OW3A 1BMKA 3LZBA 4G3CA 5HI2A 2W1ZA 3C7QA 1OZ1A 1G8SA 4EH8A 5IG1A 4PL4A 1J1CA 4FR4A 3QL8A 5KZ0A 2BIYA 3QBNA 1MUOA 4BN1A 2YZLA 4ZMFA 4FV8A 4UN0C 5BV3A 4BY9E 3Q9WA 4QYYA 2F57A 4IM2A 5LOHA 3F2NA 1Q8ZA 4D4YA 1WBWA 3P5KA 4FTCA 4FV3A 3QUEA 4I6LA 3OY3A 4Y46A 4EQUA 3PTGA 4TTHB 5EW3A 3C0HA 2XNGA 4O84A 3QUPA 4I4FA 4IE9A 4RQKA 2YDIA 3KC3A 5EW9A 5HQ0A 1U54B 4DHFA 3VO3A 3FLZA 4PX6A 4O0XA 3FC1X 3BYOA 4F65A 5HX6A 4GMYA 3NAXA 3WOWA 3VBQA 2Z60A 3BI6A 4KWPA 5IA3A 4JBVA 4YHJA 5KBRA 5F20A 2FSTX 2VTSA 3CXWA 1M7NA 2O65A 5AIKA 4I5PA 4MEDA 4QP1A 4YJTA 3D83A 2VX1A 2R3PA 4O7NA 2X0GA 3A8WA 3F5XA 3FLSA 2W9ZB 3GQLA 3UGCA 4O0YA 4O83A 4X2NA 4JRNA 2CMWA 3DQXA 4HNFA 2IJMA 2XK8A 5FTQA 3FPQA 4E5BA 3RM6A 1YWRA 4XV9A 3V5PA 4FEXA 3OHTA 1G8KA 3BBTB 2G01A 5DT3A 3R0TA 4TY1A 4UZDA 1PF8A 1WVWA 4Q9SA 2IVUA 5M09A 1K3AA 1MRUA 2GHMA 4KKEA 5J9LA 3Q9ZA 4E93A 3PXYA 4ORKA 3GCSA 4F99A 4R3CA 4BIBA 2H9VA 2PY3A 3ODZX 2A2AA 3KGAA 4IAYA 3UOHA 3NUXA 4AFEA 2HELA 2ZAZA 3CEKA 3CR0A 2VTTA 4LL5A 4TZRA 4TYEA 4E6CA 2DWBA 4FOBA 4IZYA 3IW4A 5HLWA 2QOIA 5L2TA 5C1QB 3TXOA 4JDKA 2E2BA 5HNBA 1EH4A 3QQLA 3FXWA 2PVMA 5FP5A 1ZZ2A 4KKHA 3ANRA 4RA4A 3RAHA 3OEZA 2BMCA 5M08A 3M2WA 2XNOA 2W1HA 2OO8X 3V04A 1J3HA 1UU3A 2Y8OA 5FTGA 2ZV7A 2C3IB 4CRSA 1IEPA 5IA1A 2UVYA 4YHTA 1DS5A 5KCVA 3UIMA 3MVMA 2RFDA 4K0YA 4E4NA 2XCKA 2X7FA 2QG5A 5IDNA 3D14A 5CEQA 1YXTA 3ZUVA 1R39A 5EDQA 3PZHA 2ITQA 4D9UA 2C5NA 1GZ8A 3SD0A 4I0RA 4BZOA 3GC8A 2XAOA 3HMOA 5TO8A 4ACMA 5AJQA 5HE0A 1CMKE 3QD4A 5ETIA 3PJ1A 3P1AA 2WFYA 1Q61A 3DAJA 5ACKA 4YUQA 3DJ6A 3UOKA 4ZJVA 4OAUC 2ONLA 4N0SA 5CEKA 1FVTA 1W0XC 3FMDA 2V7AA 3PPKA 4HJOA 2HW6A 2PMIA 3UZRA 1JKSA 2WO6A 2Z2WA 4DGGA 5EH0A 5JH6A 1A06A 4XLVA 4CD0A 5H2UA 2QO2A 2HIWA 4F78A 1JKKA 4QNYA 5DEYA 3NEWA 3TUBA 2JFMA 4Z9LA 4PTGA 3P7AA 4JAIA 3UOLA 4BIDA 3W0MA 4WUAA 2BRBA 3MS9A 3VHKA 3ZRKA 5D7VA 5KMNA 2WU7A 4EZ3A 4IVAA 5E8UA 3SQQA 1K9AA 4OTFA 3U4WA 5JFXA 5HVKA 4LI5A 1LP4A 2PK9A 4FEQA 2XKFA 5FBNC 3KU2A 2VO6A 3KCKA 4IIRA 4ZTQA 3WYXA 4CCUA 1H26A 3FKLA 4B0GA 4NM0A 4L45A 3LJ1A 4OT6A 5L2IA 3VJNA 3A7IA 4IWPA 4XNEA 3AKKA 3DTCA 4FK6A 4GK4A 2B9IA 5K4IA 4U9AA 3VBVA 4OTDA 3RZFA 1Q8TA 3R2BA 5L8JA 4R5SA 2CKQA 3ZH8A 3FZPA 4KRCA 4MXAA 3AC2A 4FTTA 2XBJA 3H0ZA 3FZ1A 1H8FA 3U54A 5AAEA 4MQ2A 3BLHA 4DG2E 3O8TA 4GYGA 5J7HA 1CSNA 3AD5A 3F3VA 5EKOA 2PTKA 4F9AA 3ROCA 2OF4A 3WF6A 2UZTA 3MN3A 1Z57A 2OK1A 5G6VA 4FVRA 4E7WA 4J53A 3BPRA 3R7OA 3RK9A 3IK3A 4CFXA 3VBXA 4O0SA 3PVBA 2VGPA 3JVSA 4UXQA 4IB0A 2JKKA 3UBDA 2BAQA 3P5JC 4X2KA 1ZOEA 5LMKA 3FQEA 2BRNA 5DRBA 2W5BA 4CMUA 2BKZA 4LUEA 4ZJIA 3WZEA 3ZSGA 2GS7A 2ESMA 4NKAA 1U4DA 5H3QA 4YR8A 3U55A 5GINE 1PHKA 5HG7A 3VS4A 4JG8A 3ZMMA 4ZLYA 2J0KA 4EHVA 2QHMA 3OF0A 3R71A 4QQ5A 3OBJA 5IQAA 2FA2A 2RF9A 3BHUA 3VRYA 4M7IA 1AQ1A 4GU9A 4AGUA 3PP1A 5CALA 5K5XA 4AGCA 4M97A 2UW5A 4IWQA 4DHIB 3UO6A 4PDSA 2ITNA 4S2ZA 5T68A 5F9EA 4CXAA 2CCIA 5IZFA 2VTJA 4L43A 1URCA 3MW1A 3VUMA 3MFTA 4GSBA 2CGXA 3HUCA 1OKYA 3NW7A 5IISA 3F9NA 4F7LA 4RJ6A 4QYGA 5J9ZA 4BKJA 3B2WA 2VWWA 1YXUA 3NNUA 3NVMB 3D2IA 4I23A 3Q6UA 5HCXA 3WZDA 4E26A 5HVYA 2OZOA 4I94A 3PFYA 1H1WA 2C5XA 4A9YA 3OZ6A 3LKMA 3LMGA 2J0MB 3OTUA 3O17A 4WIHA 4X3FC 5FRIA 4DH1A 3S0OA 2Y7JA 3ITZA 4XLIA 2R0UA 5CVHA 3OD6X 4PPAA 5K0XA 3C4EA 4PF4A 3KVXA 2E9OA 4HYIA 4YJNA 3O2MA 4A9UA 3ODYX 3AMAA 4EH3A 3UO4A 3O96A 2XZSA 2OKRA 3BKBA 3FY0A 3HAVA 4NYEA 4O7SA 3EYHA 1KE8A 1SYKA 2JIVA 2W99B 3KULB 4W8DA 3RAKA 4FEUA 2J4ZA 5J1VA 3QRUA 1MQBA 4EJ7A 4QYHA 2QC6A 3QRTA 5AR8A 4E1ZA 4M8TA 5FXSA 3R1YA 1IG1A 4BJJB 4FT7A 3UE4A 3ZO3A 3ZRLA 3JYAA 5JRQA 3QZIA 5ETCA 4USDA 4UMRA 4RQVA 1ZY5A 1PMUA 3EN4A 3FKOA 2QQ7A 5A4QA 4F7NA 5AP6A 4FA2A 4QMVA 2PUPA 4BYIA 3PY3A 4DTKA 4K77A 5CAPA 1LEZA 1SVGA 3FL4A 3LFFA 5EOBA 3MI9A 3TEIA 3NR9A 4TW9A 4L7FA 5GZAA 5IA0A 2R5TA 4IDVA 3F3WA 4HW7A 5E92A 3IONA 4K9YA 4WNOA 1BI8A 4DFYA 3RNIA 4KIKB 3Q2JA 4C37A 4R1VA 3WE8A 2B55A 4QP8A 4G3FA 5C4LA 4BYJA 3P9JA 5HU9A 2C5OA 2VZ6A 2UZLA 4FKGA 1V1KA 2RFSA 1YQJA 1ZY4A 4NTSA 3TG1A 3IS5A 2X81A 4O7ZA 3A60A 4B8LA 4W9XA 3KXNA 3LFDA 1QMZA 1WVXA 2Z7QA 3LM0A 2E9UA 3OVVA 1YI3A 4BDAA 2QR7A 2WTVA 5EM8A 1NVQA 4EL9A 2IPXA 2XARA 3I79A 3ZUTA 4HNIA 2B4SB 3I5NA 4L6QA 4MXXA 3NS9A 2BHHA 4FTJA 3FXZA 4CTCA 1ZOHA 3QGYA 3R22A 4RFZA 4HCUA 4YTHA 4RFYA 4C4IA 2I7QA 4H3BA 2YCFA 2Z8CA 4L46A 4RC2A 4JNWA 4AOJA 5M4IA 4AZSA 3R02A 5TE0A 2YERA 1NT2A 4GRBA 3BGQA 5KMIA 1PRYA 1G3NA 1CKPA 5FEEA 5DOSA 3GXLA 5AP5A 3PA4A 3OS3A 4BI0A 2XS0A 3GU5A 4AG8A 4W4YA 3MFUA 2QOLA 4L8MA 5LMAA 3W0OA 3FQHA 5AUZA 1M14A 4O6EA 4AQCA 4OTWA 5CF5A 1SNUA 4MXYA 4FT0A 4FV5A 2A1AB 3V5WA 2QLQA 4RGJA 5I9XA 4EWQA 4E3CA 3GFWA 4KINA 1J7IA 2CKPA 2HY81 3DU8A 5D7AA 4UZHA 3HV5A 5A4TA 3Q4CA 5L2SA 2CKEA 3UC3A 5EG3A 4Z16A 3ORKA 5LVNA 5KZIA 3WI6A 3KRXA 5AR2A 2B1PA 2X2LA 3DA6A 3GT8A 1RDQE 2W96B 5DIAA 3LCTA 3MY5A 3VIDA 5KMJA 4USFA 5IQHA 4AXAA 3P08A 3KF4A 5CF8A 4PMPA 5CF6A 4O2ZA 2PVNA 4BDIA 2WMQA 4YTFA 4RZVA 3OWPA 3R21A 3FLNC 3UDBA 3R1SA 3EFWA 5ANOA 2QOOA 2VTRA 4MH7A 4O96A 2C68A 2X4FA 3BELA 4MF1A 4NM5A 2CLQA 2HWOA 5IEVA 4D55A 2UUEA 3Q60A 5J79A 5A46A 2YHVA 4QMSA 3V8SA 3NSZA 4C4GA 4TPTA 3VAPA 3FI8A 4FGRA 4AAAA 1XKKA 4IJPA 2YAKA 3NVKI 5D12A 4YJVA 4C4HA 4MF0A 3MVLA 2C4GA 4L52A 3EFKA 4BTFA 4O2PA 4G16A 4XV3A 3E63A 4QP9A 4B8MA 4QTDA 2VTQA 2QOHA 5FDPA 5CI6A 3NAYA 5C8KA 2NRUA 2A27A 1Y8GA 4A07A 3PIYA 5E1EA 4AW5A 3V51A 2VTHA 4U3YA 2WMVA 3PXFA 3M1SA 3OROA 5EDPA 2ZV9A 4O27B 2HW7A 3RALA 3ZLSA 3VUDA 3MY1A 4QP7A 3MH0A 1O9UA 4QPMA 1Q97A 4AT3A 5KBQA 2P0CA 3Q3BA 3QTUA 3VW6A 2W1EA 3A7JA 4ZOGA 3RPYA 5IH5A 5M44A 2NYAA 3TUCA 3UOJA 3QLFA 3C4ZA 3CTQA 3SG8A 4FSNA 2ZB1A 5H8GA 3G9LX 4GYIA 4J52A 4Y85A 3SKCA 4D2VA 4FSZA 4G9CA 4FNZA 5DEWA 5A9UA 2FVDA 2DQ7X 3E8NA 2W4KA 2XIYA 3ZXZA 1OL5A 3C13A 3PVWA 5D11A 5FLFA 4QMXA 5CASA 2J2IB 3G6HA 4NW6A 4NIFB 4EBWA 5AADA 3LQ3A 4IAIA 5HEZA 5GIOE 2P33A 2R3OA 3MH1A 3RTPA 4Y83A 1PXOA 3ZO1A 5IEYA 2VWIA 5K3YA 2VD5A 1GZOA 4HOKA 2I6LA 3NCGA 4QMPA 4C4EA 4M68A 2C6DA 2QD9A 2GSFA 3W18A 1PMEA 1DAYA 1TQIA 4D5KA 2IW9A 1BLXA 4WRSA 2B54A 3ZC6A 3QTSA 2F7EE 4IEBA 4BDGA 4EJNA 4XV2A 4E8AA 3CS9A 3SXFA 5DRDA 2JKQA 3NZ0A 2JEDA 1QPJA 2C6KA 3UPZA 3QTWA 4QEBA 4AUAA 5L6PA 3AC1A 1IRKA 4XBRA 3BLQA 3OP5A 2R3HA 4XRJA 5DMZA 4DG3E 4WBBB 3BWFA 4BCGA 3ZXTA 4DCAA 4E5WA 1M2QA 5EI8A 2C3LA 4Z3VA 4F09A 3ERKA 4WNPA 3UVQA 3QFVA 2OIDA 5FWKK 5AR3A 4YC6A 4N6ZA 2C69A 3K5VA 3R1QA 1U54A 2E9PA 4EEVA 4DC2A 4U8ZA 1GIJA 4GS6A 1XHAA 4HVHA 2ONLC 4AW2A 1SM2A 3F61A 1OKWA 4F63A 2C6TA 4HZSA 4FIHA 2CN5A 4UYAA 4F9CA 3HV4A 4Y5HA 3UG2A 2EB2A 4IW0A 3U8WA 3MWUA 4ASZA 4D2SA 3HMMA 5JK3A 5K5NA 4FKJA 3TCPA 3DKCA 5L8KA 2WTKB 1J7LA 1YHVA 3A7GA 1AGWA 3ZFXA 4JS8A 4XG7A 3KMWA 5E8SA 2P2HA 2PVYA 3OXTA 4GT4A 4IAKA 5JRSA 4RWJA 4LM5A 5C01A 3VVHA 4C58A 4TNBA 3EZVA 4ZZMA 4BTMA 5LVMA 5JKGA 4S32A 5EQYA 5B0XA 2ZDTA 4XJ0A 3KIOC 4ZAUA 4D1XA 4KS8A 3REPA 4C4FA 4BR3A 1FGKA 3DJ7A 2JKOA 4FZFB 3S4QA 3TNWA 4BCFA 4ID7A 2WKMA 3QCSA 3D15A 4AF3A 4AT5A 5HG8A 1JSVA 3LLTA 4YZMA 4Q9ZA 4BDKA 2XJ2A 2H8HA 4FZ6A 5H8BA 3TT0A 1OIQA 4U42A 3VF9A 5DYJA 2O3PA 2BPMA 2YM7A 1OBDA 1XBBA 2XB7A 4WD5A 4ERWA 3KMMA 2JGZA 4FIJA 3QQKA 1Q8YA 4J99A 4C0TA 5HESA 1MQ4A 3BGPA 2FGIA 4OTIA 3NX8A 4AN3A 4GJ3A 2IZTA 2YJRA 2FSMX 2QI8A 2EXEA 4MQ1A 4D28A 2IZUA 5IMXA 4L3JA 1WBTA 2G1TA 3BIZA 4IBMA 2YM6A 4YJUA 4PV0A 2YISA 1PYXA 3TIZA 4XG9A 3HA8A 4G17A 4XS2A 5HE3A 4ACGA 2XAMA 3OCGA 5JGDA 1PMNA 4FRFA 4ALWA 3BHVA 3ZZEA 1Q24A 3CLYA 5BYLA 3CGOA 4IX5A 3LXNA 2P3GX 4DLIA 3TNQB 4I6BA 3Q5IA 2G9XA 2W1GA 4QD6A 3UC4A 4BZNA 4AXCA 4DLJA 5LMKC 2PUNA 2AUHA 3HAMA 1KSWA 4D0WA 5C4KA 3F66A 4FL3A 3MESA 1PXIA 5ETAA 4QO9A 4DBNA 4HPTE 5LJJA 4QRCA 4CFUA 1XH4A 3LFNA 3QQGA 4E73A 4I0SA 2UV2A 4H36A 5CANA 4AGWA 3FL5A 2O2UA 4F1OA 4NU1A 3GEQA 2YCSA 3PUPA 3Q96A 3HDMA 4RC3A 3VUKA 4ZLOA 4Y5QA 4U45A 3CJGA 3W8LA 4F9YA 2H96A 3UG1A 1OPLA 2HK5A 4MD9E 1XQZA 2BRGA 4TWNA 4D5HA 3O8PA 2QG7A 2F7ZE 4P7EA 3CQEA 4MNEB 1PXKA 3WILA 3ZFMA 3FV8A 4O4EA 3KN5A 3IO7A 4K33A 1V0PA 2W17A 3THBA 4X2GA 3FLQA 2YLFA 3UDTA 1XH8A 4EOLA 4HVDA 1WZYA 5AA8A 5HD4A 1PXLA 2WQMA 3TKUA 4D4VA 3I7CA 3ZSIA 4LGDA 4RJ4A 2W1CA 3I81A 4E20A 4KUJA 1H1SA 3R8MA 5M4FA 2ZFYA 1JOWB 1V0OA 3PY1A 3ZUUA 3FPMA 4QDVA 4GJ2A 3I5ZA 4WT6A 4BVUA 2C1AA 1H25A 1PMVA 2R7BA 3FMLA 3CQUA 3MV5A 1H0WA 4DH3A 2W1IA 2GQSA 4RIXB 5IA4A 3PXQA 4Z7GA 3CIKA 3VS1A 3QZGA 4FKLA 4JLCA 2J50A 3L8PA 4DBXA 2PHKA 3PVUA 2PVRA 4IZ7A 3LVPA 4IZ5A 4R8QA 1XH7A 3A4PA 3Q04A 5C26A 2XK9A 2FH9A 3EZRA 5C9CA 3UDZA 4FNYA 4HPUE 3QWJA 2X6DA 3LCSA 4AA4A 2X0OA 3QKKA 2B9FA 3GI3A 1GAGA 4GT3A 4JG7A 4ZEGA 5IMEA 5E8TA 4MAOA 4FG9A 1SVHA 3L8XA 4FYNA 4EHZA 3DKGA 4H3QA 3TJCA 3FMMA 3ACKA 4QMOA 3RK5A 4FG8A 4PDPA 5FDXA 4YJOA 3MY0A 4HYSA 4YLJA 4CFWA 5EYMA 1R3CA 3ZM9A 4IC7A 2HZIA 3PA3A 3TZ7A 4NK9A 5CSPA 5IQCA 5HX8A 4FKVA 4B9DA 2VRXA 4G6NA 4GKIA 3QKLA 5CF4A 4ERKA 4IXPA 3IGOA 3E8DA 1W98A 1FGIA 1ZXEA 3LHJA 3R04A 1V0BA 4JRVA 1TQMA 4AQKA 3GCQA 4DFLA 3DNEA 3P0MA 1ZZLA 2QNJA 5L4QA 2HXLA 2RSVA 1YW2A 5F94A 3G0FA 2O64A 5DT4A 5BVKA 1JPAA 4GFGA 3BL9A 4DHJA 4BBFA 1K2PA 1OKVA 3HP2A 3R63A 5DH3A 1KOBA 4RVLA 2VO0A 3TZMA 4XOYA 3P79A 4QMYA 4ZMEA 3G2FA 3QA0A 4V04A 4OLIA 5T6KA 4G2FA 3CCNA 4FEVA 2F9GA 4P5ZA 2Z7LA 3NW6A 4NJ3A 4O4BB 2GMXA 2IZSA 4Y95A 2R3MA 3FHIA 3KULA 2PUUA 2ITPA 2VNYA 3A7HA 3FMHA 3GC7A 4YBJA 2WXVA 3NYNA 5IF1A 2YM3A 2A19B 4YO6A 4QP3A 4NT4A 5E8ZA 5FP6A 4ZTMA 4W4WA 3ZO2A 4BJJA 4I3ZA 4M84A 4O4DA 4F1MA 5BNJA 1XBAA 4ZTHA 5FTOA 3IW6A 5FEQA 2QVSE 1XJDA 4K18A 3LXPA 2GQGA 3B8RA 4FF8A 2W06A 2RGPA 4MVFA 4TYGA 2JBPA 3IECA 3K3JA 3TYKA 3TV4A 4FNXA 4PMMA 4I6QA 5DN3A 4FSUA 3TNHA 3EN5A 3SRVA 4X6RA 5TT7A 5EM5A 3ZEWA 1JQHA 3G15A 3W0SA 3HMNA 1SZMA 4RX9A 1YDSE 3KXXA 4IDTA 3QQUA 2JDRA 4MBJA 4ZTLA 5CEIA 3QUDA 3I0OA 1KV2A 4K6ZA 2V22A 3RGFA 5CU4A 5E8WA 4YZDA 3TWJA 3GCPA 4UWBA 3MBLA 1UKHA 4E6AA 3AC3A 5JT2A 1TZDA 3DB8A 4TT7A 5AUWA 4EOIA 3GGFA 3QC9A 4NH1A 3SOAA 2IG7A 4JDJA 5GZ8A 2DYLA 2UW7A 1VR2A 2YACA 3BBWA 4FKIA 5ANJA 4P4CA 3ZHPC 1ZYJA 2QR8A 4RWKA 2I0VA 4ASDA 1U5QA 5HICA 2C30A 5HTCA 4L01A 4U5JA 3IDCA 4X6QC 1FMOE 5AM6A 5E8XA 5AV2A 3PSBA 5GHVA 2H6DA 3FSKA 4BWKA 3HRCA 5DHJA 2XYUA 3OG7A 3W33A 4M69B 3D7TB 3LXKA 4RVKA 4WG3A 2I0YA 3FI3A 4O21A 4QPAA 2OJ9A 5F1ZA 4OGRA 2YWPA 5HG9A 2Q83A 1GZKA 2ZB0A 4IZAA 5IUGA 4XP2A 1FVRA 2IVTA 2RKUA 1H27A 3AD4A 3OT8A 5EDRA 2YWVA 1PJKA 5B2KA 2YM5A 3EFJA 3LCDA 3RJCA 5JFVA 1YWVA 3E92A 1PY5A 3DKFA 3CPBA 1ZMUA 3F7ZA 4C3FA 4E6QA 3R83A 4FMQA 2OG8A 4PP7A 2YABA 3BGZA 3LAUA 4I1ZA 5KKRB 4EYJA 2ITTA 4U40A 2ERZE 5DR6A 4H3PA 4EQCA 1VYZA 5BYYA 1FPUA 4FV1A 4AGDA 4PPBA 3RWQA 5KMLA 5IEXA 4Q5EA 3B2TA 1ERKA 2FUMA 3MTFA 4PL5A 3C4WA 4X3FB 3TL8A 4JDIA 3MH2A 4O0UA 2YA9A 2UZDA 3GFEA 4NTTA 3ZS5A 3E8EA 4KNBA 3G33A 1VJYA 4I4EA 5D41A 2WMRA 1DI8A 2YLEA 3D5VA 4U3ZA 4CV8A 3COHA 1QL6A 5AV3A 1YI4A 2PMOX 4WKQA 4PP9A 1BL6A 2JFLA 5ANIA 4ZSEA 3P86A 2C6LA 4I21A 4RWLA 3IGGA 5KHXA 4TL0A 5A4EA 4FZ7A 3FY2A 4GL9A 4E4LA 4EC9A 2I0HA 3ORMA 2RG5A 2B53A 2BILB 3GENA 3KXHA 4BDCA 1JNKA 3BHHA 4MCVA 2GNIA 2XA4A 4FK3A 5DNRA 5KX8A 4X2FA 3C1XA 1IA8A 4FIGA 4HCVA 3E8CA 3JS2A 2YFXA 3P23A 4HGTA 4XP0A 2OF2A 3DBFA 2ZMCA 2VO3A 2X8DA 4KBKA 2OXYA 5L8LA 3AKJA 5HNGA 3GOPA 3WBLA 4UX9A 5FXQA 4C3PA 2JITA 3E87A 5AUXA 2GS6A 2VTPA 4LMUA 1Y91A 4S30A 4CFMA 3R7IA 5CNNA 2EUFB 4ZTNA 2XK7A 1YWNA 2R4BA 3PPZA 1MP8A 4QTEA 2NP8A 4ZK5A 5J5SA 3PVGA 5TF9A 2PVJA 3EQGA 3FI4A 2ETRA 3QX2A 4MUQA 2WTWA 2V7OA 4NW5A 3A61A 1KOAA 5HE2A 1I09A 2W4JA 1Z9XA 3HMIA 4XG3A 2GHLA 4FT9A 3Q5ZA 4PWNA 1TVOA 1XH5A 3M42A 3AT2A 5JGBA 4EONA 4GIIA 3MFRA 4LQMA 3WIKA 5CAVA 1T46A 4PMTA 3R73A 1MRVA 4ZJJA 4EH9A 4C34A 2X6EA 3Q52A 4ZTRA 2Y6OA 5LMBA 1ZYLA 3PZEA 5BUEA 3UQFA 4W9WA 3Q4UA 2PVKA 4HVIA 5EFQA 3MYGA 3UYSA 2R3QA 3BE9A 3LMIA 1GJOA 5EI2A 3QRKA 3U9CA 4O38A 5KMKA 4DEDA 3U6HA 5CQWA 1FBNA 1IA9A 3ATSA 3VS5A 4F0IA 3RCDA 4OBOA 4HVGA 4DFXE 3BV2A 2O8YA 1W8CA 2V0DA 3QD3A 4NIFA 3VS2A 5HOAA 4QYFA 1ZYSA 3W2RA 1DI9A 1ATPE 4ITJA 3OTVA 4YSJA 3KN6A 3PPJA 3CP9A 5CI7A 3WF5A 4J1RA 2REIA 4LV8A 4EOKA 4FKOA 4RZWA 4KBAA 3EHAA 2UW0A 4DEAA 3JXWA 2X1NA 4EHGA 5L3AA 3VUTA 4BGHA 5EKNA 3PE1A 3UYTA 3BV3A 4CYJA 4EOOA 4IAFA 2XMYA 4QT1A 5K0KA 4F4PA 2YCRA 4YP8A 5JGAA 3S1HA 1Q8WA 3TDVA 3VNTA 1ND4A 3NCZA 4DGMA 2VWVA 2J51A 4AZWA 4AN9A 3CKWA 2QO9A 3BCEA 4F1TA 4DDIA 1OUYA 3RM7A 3VUHA 3F3UA 4JJRA 4X0MA 4ZSJA 3BLRA 3FUPA 3W2QA 3QTZA 3F7WA 5HD7A 3BYUA 4YBKA 5D1JA 3R9HA 3QQFA 3SC1A 3FZRA 4BHNA 3DB6A 4FIIA 4BCIA 3W1FA 4TYHB 3W16A 3CPCA 3LXLA 3PLSA 4AZTA 2PSQA 5M06A 2VN9A 4ZLZA 3Q53A 3BHYA 3UDSA 5GZ9A 4JT3A 4ZP5A 3G90X 3UJGA 5IQIA 3PSCA 5BX0A 5BVFA 3LM5A 1F5QA 4FL2A 2BTRA 3W10A 1ZYCA 4ZS4A 5IQFA 4ALVA 1OGYA 4JI9A 2XNMA 4AW1A 4ITIA 2JLDA 1PXMA 4FTMA 3W0QA 1U46A 3NNWA 4EZ5A 3SW4A 2BCJA 4IQ6A 2BZKB 4RG0A 5AP0A 4C8BA 4R7HA 1DM2A 3FI2A 4CZYB 2R3JA 4MXOA 4NWMA 5EM6A 2XYNA 4BTJA 4MYGA 4EC8A 5CXHA 2PULA 3KRLA 3E3BX 3OCTA