2NPQA

A novel lipid binding site in the p38 alpha map kinase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
348
structure length
326
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title A novel lipid binding site formed by the MAP kinase insert in p38 alpha.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 326
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2006-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2npqA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2npqA01
2J90A 3BE2A 2OXYA 4GS6A 5CU6A 1H24A 2YIYA 4GU6A 2HW6A 4XLIA 2J0KA 5D12A 2YFXA 4D0WA 2KULA 3UZPA 5GZAA 5L8KA 4IB1A 3KRXA 3NUSA 5LMAA 3DAKA 4WBOA 2CKEA 4RQVA 4K11A 5E8SA 4HVHA 3G0EA 2C68A 4DEEA 3MA3A 2BRMA 3UMXA 2GQRA 2Y8OA 4CTBA 2PVKA 2UZNA 3EYHA 3OOMA 1XWSA 5EDRA 4B8MA 3EZVA 4HGLA 2F7ZE 4JG8A 4YJNA 3LXNA 5H8EA 3BQCA 4BDCA 5CX9A 1GJOA 1Y6BA 4AA0A 3R30A 2ITXA 3BZ3A 2HZ0A 2J0LA 3DZQA 3OUNB 4UY9A 4HOKA 2WB8A 4KINA 4A9RA 4PQNA 3U9CA 4GK4A 5M44A 3FUPA 4GFGA 4DFUA 2GQGA 3W2RA 4HPTE 5C1QB 4QYEA 3UNJA 3W8LA 4C34A 3BLQA 3AMAA 2Y7JA 2PVYA 4CG9A 4F4PA 2WQMA 3SW7A 2ITYA 1Y6AA 4XRLA 4EBVA 1FGIA 3TUDA 2XEYA 1LUFA 3SAYA 3SQQA 4M69B 4MH7A 4X2JA 4FL2A 4MQ2A 3KXGA 2WTJA 5EM5A 3RZBA 5AR5A 3TJCA 4A07A 4UMRA 3PUPA 3C5IA 1OMWA 3FSKA 3LQ3A 4L45A 5M06A 4C4FA 2B9IA 3FL4A 2XUUA 3QTRA 4I3ZA 2I40A 3C51A 4AF3A 4I0SA 4MVFA 3W2CA 5LVOA 5A4EA 3V5WA 4NL0A 3U4UA 2HZ4A 3OXTA 3QTZA 4JRNA 5C4LA 2XH5A 4FTUA 5HG5A 3RI1A 2JIVA 4I22A 3LQ5A 4NJDA 1QPCA 4PV0A 3WIKA 5K4IA 2JKMA 1W7HA 4RC2A 3FSFA 3MPAA 3L9PA 3AD4A 1E9HA 4CT2A 4TTHB 3CD8A 3F69A 3ACKA 3G2FA 1Z9XA 3R21A 4I92A 1ZMWA 4FEXA 4DH5A 3UOLA 3QTIA 4C58A 2W4KA 3EFKA 2CLXA 3GOKA 3C9WA 2OG8A 3REPA 2WZJA 3UJGA 3NVKI 1OB3A 3BQRA 4YHJA 4WNOA 2HCKA 3BCEA 1UVRA 5HESA 3UDBA 3ZO1A 3D0EA 3HL7A 3MVLA 3EH9A 3R1SA 3O17A 5HD7A 4EZ3A 2E9VA 4L3PA 3U8WA 1DAYA 2W05A 3BWJA 3JVSA 2W1FA 3VS4A 2QU5A 1GIIA 3BYMA 4YHFA 3C4FA 2X4FA 3F5PA 5BNJA 4C33A 3Q96A 2JFLA 4FV5A 4LG4A 4QPAA 1ZMVA 3EN5A 3MYGA 4XV1A 2PMOX 4XG4A 2Y6OA 4YSJA 3ORZA 3LFDA 4CYJA 3RWQA 4W4WA 5DG5A 3KK8A 3MVJA 4FV4A 5CYIA 2X6DA 3NIEA 3VQUA 5HNIX 3WF6A 2ZVAA 1F3MC 3AGLA 4ZTMA 4NKAA 2JKKA 5E8ZA 4APPA 1U59A 1KOAA 1YWRA 2C6IA 4FTQA 4FV0A 4I20A 5AA8A 4I6HA 4O38A 5ANIA 3OD6X 5DOSA 4F9WA 4H58A 4TXCA 3EKKA 3I0QA 3W1FA 2A19B 2FUMA 4PDYA 4X3FB 4GK2A 4ZTNA 1J1BA 4AAAA 4JDIA 5AR7A 3NS9A 1U5RA 3FC1X 3ZTXA 3FY0A 5M4FA 3BPRA 3FI2A 4PL5A 2E9OA 4FTLA 5AV1A 1BI8A 4F64A 3FPMA 3QXOA 4L67A 4PDSA 5A46A 2HWOA 1WBSA 4TYHA 4BYIA 4CTCA 1AQ1A 5J7BA 4GEOA 5CF8A 2UW4A 3IOPA 4TPTA 4A9UA 4C8BA 4ZMFA 5KMJA 3VW8A 5GZ9A 5CSWA 4BCGA 3WIGA 2JAVA 2RF9A 4DGOA 3H9RA 1FINA 2XIXA 2JIUA 1PXOA 4ZTLA 3F7ZA 5J79A 2P4IA 3A99A 1VEBA 4E4NA 4EUTA 4AE6A 1LEWA 4RJ4A 5CAOA 4L42A 3F2RA 1GZ8A 2W1DA 3QA8A 2F49A 1CM8A 4XHKB 3ZFXA 2WTKB 2PVFA 1WCCA 3SOAA 4UALA 2BRBA 3NYVA 5DT4A 3SXFA 2YM8A 2PMIA 2YM3A 5HBHA 3WE4A 5HBJA 5LCJA 3HAMA 2VTSA 2QOOA 2RSVA 3U9NA 1RQQA 5HCZA 2IPXA 4YC8A 3DQWA 3AD5A 4BDIA 4G3FA 3BU6A 3PJ3A 5L2TA 3TUCA 4DEHA 3DXQA 4QP4A 5LMKA 1O6KA 2C0IA 4G3GA 4MF0A 4APCA 2I0YA 3IOKA 5E1EA 5LWNA 5HG9A 1WVWA 4BDFA 3D2KA 3QKKA 3BBTB 5GHVA 3V8WA 4MXCA 3B8RA 4AX8A 4WUAA 5AV0A 3PXQA 4F7JA 5HTCA 3C0IA 1PYEA 3OUKA 3KU2A 4BDBA 4CT1A 1SMHA 2R3OA 3RK9A 2Z60A 2YWVA 4KA3A 2E9PA 3D5VA 5T3QA 3COIA 2C3IB 4A4XA 4G1WA 4F6SA 2GNJA 5FUTA 4DE4A 4L43A 3GFEA 4L53A 5E8UA 2Q83A 2OK1A 4YZ9A 4D1XA 4F6UA 1HOWA 4O0XA 4WG4A 5CLPA 3RALA 2GSFA 4QQCA 4BDHA 2UW8A 1XBCA 1PMNA 3QGWA 3ZUTA 2JDSA 4EI4A 4MBIA 4NWMA 4AT4A 2QOHA 1UU7A 4HCUA 5DPVA 4EHEA 2PZYA 3O23A 3D5WA 5AP0A 2ZM4A 4ZY6A 2ZV7A 4AS0A 4K0YA 4YU2A 1AD5A 5DVRA 1OBDA 2VO0A 4AWIA 1DS5A 3MSSA 3IS5A 4I5MA 4PL3A 3RAKA 4Y5QA 3ZO3A 4W8EA 3BYVA 3R2YA 3MY5A 3FV8A 3LFFA 1OPJA 3KCFA 4X2KA 3I79A 5FTQA 5HOAA 2XBJA 4IAIA 4DH7A 3E87A 3D94A 3O51A 4FICA 1JSTA 4TWCA 3UIUA 3DB8A 4PDOA 5AR4A 3U51A 3OTUA 4ZJVA 4MNEB 3S1HA 4ACGA 4AXAA 4QMPA 3FEGA 4J99A 2Z02A 2QOKA 5IUGA 1SNXA 2B55A 2UVYA 2I7QA 4WA9A 4M3QA 4OR5A 2UW7A 3NW6A 2PE0A 3HMOA 5FXQA 2VTPA 5A14A 4M84A 3R8MA 1ZRZA 3LW0A 4IXPA 4IJPA 4BCMA 4OT6A 4QQ5A 3EYGA 3NRMA 1XH8A 5EFQA 2VO7A 3R9HA 2ITPA 4FA2A 5AIKA 4OAVB 5HI2A 5AIRA 2ZV8A 4DTBA 3A8WA 2BFYA 2WMVA 4ZTRA 4F7SA 3UOJA 5DBXA 2CKQA 4U8ZA 3EJ1A 3TV7A 2W5BA 4IH8A 4EYMA 3MIYA 3PA4A 3BGQA 3QBNA 3D14A 4FEVA 4YJUA 4Q2AA 3HMNA 2R3PA 4RIYA 4X7QA 3R6XA 3CIKA 5G1XA 4BCOA 3V6RA 4ANBA 4F65A 3HV4A 3R04A 2BUJA 4WKQA 3FDNA 3HMIA 5I9WA 4JX3A 3R7EA 3FZPA 2ZM3A 5T68A 3P23A 5AUZA 3ZBFA 2PWLA 3PA3A 1Q8WA 2QR8A 4GSBA 3IW8A 3I7CA 4ANQA 1PRYA 3EB0A 4DN5A 3IQ7A 2REIA 3VRZA 5HZNA 4IFCA 2CPKE 3MB7A 2JITA 5EHOA 2B4SB 3QKLA 1KE7A 3MIAA 4KIOA 4YC3A 1CSNA 3TN8A 3NEWA 4FE2A 5BVFA 2C3KA 4DH1A 2P3GX 3HA6A 3PY0A 4IM0A 4EH6A 4AT3A 4O81A 2C6MA 3R1NA 3AC3A 5EW3A 2RFSA 4V04A 3PPZA 4YTCA 1XH9A 4CYIA 1ZYJA 3GENA 1JBPE 1YWNA 4FKUA 4RIXA 4D5HA 3EFJA 5K3YA 3HV5A 3JS2A 4E5AX 4ID7A 4BBEA 4N57A 3GCUA 3UQCA 2IW6A 4AW5A 4G3CA 2GS2A 4I23A 5HO7A 4KIKA 2XJ0A 2BDWA 4FKIA 2WIHA 4E4LA 5J8IA 4FKJA 1ZYLA 3I6WA 2HOGA 1XQZA 2GNFA 3C1XA 4O84A 4L3JA 4PPAA 4ZS4A 3UNZA 3V3VA 4P4CA 5EYKA 5I3OA 5BUJA 4Z7GA 1UKIA 2WU7A 4G9RA 3KRRA 4S30A 4LV5A 1H4LA 4U3ZA 4IW0A 2QURA 3PXKA 1QPEA 2GHGA 2C3JA 1Z5MA 3HV3A 4MTAA 1L3RE 4JNWA 2UZEA 1PKDA 4C59A 4IWDA 5KUPA 2HYYA 1A48A 3L9LA 2ETMA 3OCBA 1PXNA 5D7AA 4DH8A 4BI2A 2R3IA 2ONLA 4A9YA 3VQHA 2WTVA 2VGPA 4JR3A 4IAFA 4DGGA 3NUYA 4X0MA 4ZSLA 4BDAA 5M57A 5HIBA 2H96A 3FZOA 2DWBA 2IZTA 4G5JA 4I41A 2XKDA 4W4VA 4WBBB 4BKYA 2CN8A 4U3YA 3PVGA 2ZYBA 5BMSA 4FTOA 1FVTA 4FUYA 5ETIA 2XK6A 4EH2A 3RK5A 2R5TA 4CCUA 1FBNA 4H1MA 2W17A 4JQ7A 3TZ9A 3BLRA 4GKIA 2C3LA 2YAKA 3ET7A 4IZ7A 5GJFA 4RMZA 3GU5A 3ORKA 3QHRA 4UMQA 4C4JA 3HAVA 5FEEA 3TT0A 3PG3A 4B8LA 1YXTA 1OPKA 2YM4A 4N70A 5CEIA 1LEZA 2OF4A 3ORIA 1P4OA 4CKRA 2R7BA 3LXLA 2J51A 4DEDA 3BI6A 4J98A 4C37A 2YDKA 4U7ZA 3UVRA 4K33A 1H27A 3SV0A 4PTCA 4OBQA 3VBYA 5KX8A 1ZY4A 2PTKA 3CTQA 3K3JA 5JZNA 1UU3A 4EEVA 1JAMA 5AM6A 5AP5A 4BI1A 1G8SA 2B9JA 3AOXA 4BWKA 4EOIA 4K9YA 1BL7A 3R63A 5ANJA 4IM3A 4L52A 3QRUA 3DKOA 3IECA 5AV3A 3LLAA 3IDBA 3PY1A 2R9SA 4QQTA 1ZOHA 5EOBA 3GB2A 4F9YA 4ENXA 4G6LA 2BIYA 4RFZA 4HVSA 2OW3A 1R0PA 4YO6A 2ITTA 2UV2A 5M09A 2YCQA 2GHMA 4FKRA 4TW9A 3IGGA 4L68A 3ELJA 4GVAA 3UG1A 5JQ5A 2W99B 5IUIA 1OKZA 3JPVA 4BFMA 2J5EA 3PVBA 3ZLSA 4D1ZA 4Q5EA 2UUEA 5KHXA 5E1SA 3R7UA 3VUIA 2JLDA 4BI0A 2VTAA 2B53A 3ENMA 4JIKA 2HWPA 3TZMA 4TYJA 4E20A 2NRUA 4A9SA 2XNEA 4FGRA 4ACHA 1OIUA 5C9CA 3FZTA 5IH6A 4C3FA 5DA3A 1OKVA 5M55A 4EOJA 1H07A 3ZM4A 4N6ZA 5D9HA 3VS2A 4FTCA 4ANNA 5LVMA 1ERKA 3GUBA 3WILA 4OTGA 1ZYSA 2GFSA 3BYOA 4E3CA 3QQLA 4M14A 4ACDA 4IB3A 2I6LA 4FEQA 4R3PA 1YI4A 2FH9A 2JD5A 1OBGA 3ZSGA 1OVEA 2VRXA 4FKOA 4ZJIA 5TOZA 2ERKA 3T3VA 4D4RA 5K0KA 4RWKA 4YJSA 4ERKA 4IWQA 5DLSA 5FGKA 3E5AA 4WD5A 4CZTA 4HVGA 2QOLA 5L6OA 3ZUUA 4QPSA 2ZV2A 1ZY5A 2RFEA 3EHAA 4MCVA 4RLLA 3RWPA 4CLIA 4FIJA 1IA8A 1UWJA 2GTMA 3F2AA 3FZSA 3MPMA 3DLZA 4RX8A 3SW4A 3QCQA 3ZYAA 4D9UA 2I0EA 4K2RA 3EN7A 4O0VA 4F9CA 4OLIA 3FYKX 3T9IA 4DTAA 3DT1A 3DDPA 3I60A 1JSVA 1H1WA 1J1CA 3OWLA 1YDSE 3FLWA 3KY2A 5IA0A 3TTJA 4IBMA 1H01A 4F08A 5FBOA 4O82A 5J5TA 3VUTA 3E93A 3F3ZA 3H9OA 3I6UA 3ORPA 2C5OA 1W82A 4ANMA 5CF5A 4RC3A 3QQFA 5JMSA 1U54A 3BV2A 3FI4A 2IVTA 2ZDTA 3E8EA 1JLUE 3VAPA 4FC0A 4LYNA 2R3KA 2X81A 4BTFA 5FD2A 5HCXA 1YQJA 4WRSA 4UBAA 1UA2A 3W2QA 2YABA 4I4FA 3KULB 4QP8A 3FHRA 3RGFA 4LUEA 4NUSA 4RJ5A 4YNOA 2UW3A 2YIQA 4FZFB 4RX9A 2GPHA 3VW6A 3WARA 4AGWA 4EWQA 2PUNA 3F5UA 5EH0A 2EWAA 3TIZA 3EQIA 1QPDA 3D5UA 5AEPA 5CU0A 4I6QA 3A60A 4JT3A 4BIBA 5K5NA 2NP8A 4II5A 2XK8A 5AR2A 1F5QA 4O0SA 3EQPA 3R1QA 3UVQA 4PTEA 3E7OA 3GVUA 3ZZWA 4J71A 2PYWA 2A1AB 3SXRA 1H26A 3G5DA 4BCNA 1UNGA 2VTLA 3VF9A 2AUHA 3MH3A 1M52A 5LVNA 2R3NA 3QTUA 4NIFA 4JAIA 3DKFA 3W2PA 4XMOA 4L00A 1XH4A 2W4OA 1M2PA 3KRJA 5CZIA 4L01A 1BLXA 5DWRA 3EL8A 5J1WA 2OIQA 3A7FA 4AUAA 2BKKA 2QKRA 5J95A 3QRJA 4EK8A 3LLTA 4C0TA 4KKEA 4QP7A 3TNIA 1H8FA 1IAJA 3ERKA 2RG5A 5F94A 2Y9QA 5CWZA 2CGXA 2PZ5A 4O7YA 2OIDA 4FF8A 4RX7A 1S9IA 4I0TA 1WBOA 4U9AA 4ZSGA 4BDKA 5FDXA 3JR1A 2OXXA 4RJ3A 1T46A 3R1YA 3JVRA 2XNGA 4PWNA 4O6LA 3PP1A 4QMWA 4ANSA 2YJSA 3FMHA 4FV6A 3QTWA 3VUKA 5JGDA 5M4IA 2ZB1A 3O71A 3WI6A 4CFNA 2J0JA 1GAGA 1P2AA 1WBTA 2WTDA 3F6XA 3OEZA 5H2UA 4HVDA 4M69A 1WVXA 5JFWA 4AACA 2WFYA 3CD3A 3L9MA 5DGZA 2ONLC 2QLQA 4U81A 3Q6WA 4CSVA 3VBTA 2CNVA 2C6EA 5AFVA 4MXAA 2R4BA 3PJ1A 3ORLA 5DH3A 3WYXA 4D2PA 4IFGA 2BRGA 3CR0A 4KBAA 2WKMA 3LCTA 1OZ1A 4FG7A 1Q97A 2WQBA 3UZTA 3U54A 3FXZA 4MXXA 5EKOA 2QU6A 4FI1A 4ZSJA 3A7HA 3AC1A 3UQGA 1G3NA 1Q8UA 3CTJA 4RFYA 5FTOA 4BZNA 3PPKA 4QTAA 4V05A 5AP4A 3UOKA 4HZRA 5AAFA 2QO9A 3V5QA 1SM2A 3G6HA 3L8SA 3R28A 4AT5A 3ZLWA 3MB6A 2YACA 3Q2MA 4MEDA 2AYPA 3Q60A 4JDKA 3UTOA 1OL2A 4DFLA 4DT9A 1J7UA 3QUPA 3COMA 5CEMA 4EOPA 2IN6A 3B2TA 3OWJA 4EZ7A 3OF0A 3KCKA 3KXXA 4NU1A 2NRYA 4ANLA 2RFDA 4LOQA 3S2PA 5HBEA 4PMTA 5HD4A 1BL6A 1V0PA 2IVUA 5DIAA 1YXUA 3MH1A 3VWAA 3NIZA 2VWBA 2XJ2A 2JDVA 3CGOA 3O0GA 4HNIA 4WNPA 5CQUA 4QMZA 4XG2A 3PWYA 4S2ZA 2VX3A 3OBJA 4CFXA 1PXJA 2JAMA 4FGBA 4BVUA 4OTWA 2IZUA 4AFEA 2J2IB 2PZIA 3BRBA 2WOUA 2DUVA 3RINA 2Z7LA 3AC4A 5EW8A 3PRFA 4GL9A 3AGMA 4XLVA 4KBKA 3F3UA 2IVSA 3NUPA 1OIQA 4JG6A 2DQ7X 3O2MA 3G9LX 3KEXA 5IQGA 3K5VA 2H8HA 3NAYA 5B0XA 4ZEGA 3UQFA 4I21A 3H0YA 2BHHA 4ZSAA 3K3IA 2X7FA 4ZZNA 2W1CA 3DNDA 3E8NA 1BKXA 1JSUA 3KGAA 1R0EA 3R00A 3UVPA 3PA5A 3R9OA 4TN6A 4RC4A 5L2QA 1FMKA 3VRYA 4BRXA 1JKLA 2V7AA 3I4BA 4X3FA 3RKBA 1DM2A 4RWIA 2BTRA 1YXSA 5HO8A 4A7CA 3BYSA 2KTYA 3OT8A 4CZUA 2AC5A 4X21A 4WUNA 3OCTA 3PJ8A 4UMPA 2OIBA 1H1PA 3FL5A 4W4XA 5IZFA 1NVQA 4EOMA 5TT7A 5JFVA 1EH4A 1SVHA 4I24A 4W8DA 2WNTA 2YERA 3QAME 5F4NA 3OC1A 2CGUA 1XR1A 4FSTA 3KXMA 3SRVA 4YUQA 1UV5A 4FKLA 2WTWA 3SHEA 4CKIA 3QRIA 2A27A 3D7TB 4G3EA 3FJQE 3ZO4A 1I44A 2BZHB 3MY1A 4U42A 4YC6A 4DFYA 2X9EA 5A4QA 3COKA 5FEDA 4UN0C 5HX8A 3BHHA 2Z7QA 2R3HA 5KKRC 4N4SA 1WBNA 2PUPA 4TT7A 4NTSA 4AOTA 2ZMDA 5KMMA 4H1JA 3PXYA 2UW0A 2PE2A 3LFBA 5DN3A 1J7LA 3PIXA 4IWOA 2YITA 2F7XE 1SNUA 2JFMA 3TNQB 3VIDA 2BROA 3WF9A 4C7TA 4F6WA 5M56A 3QQUA 2PSQA 4YMJA 5LWMA 2XKEA 1BX6A 4KD1A 2PHKA 3O8TA 4RA5A 1ZWSA 4K8AA 1H0VA 4UXQA 4B9DA 1QCFA 2OKRA 3P7CA 4DFXE 1GOLA 2UZDA 4GCJA 4FK3A 4ZP5A 3VVHA 1URWA 3PZHA 5ANKA 4JR7A 4O7WA 4XV2A 3O8PA 4FZ7A 4LRMA 3HUBA 4JL9A 1FVVA 4UEUA 4DTKA 2H6DA 2WMAA 2ZOQA 2Y0AA 3G6GA 4HGEA 3PPJA 4D1SA 2P2HA 4J8MA 2VUWA 2BFXA 5FXRA 4O7NA 3FZRA 4MD8E 3GC7A 3U6HA 4KIQA 2VGOA 1BI7A 3GCQA 2PMLX 4XG6A 5BVNA 4IE9A 3GP0A 3RZFA 3F5XA 3QTXA 5EK7A 4Q9ZA 2WOTA 4R7IA 1T45A 3LMGA 4IVCA 3FKNA 3V04A 5AV2A 3RNYA 4WOVA 5DFPA 5DT0A 4GUBA 3KRLA 4MD7E 4D0XA 5EHYA 1GZKA 3U4WA 4DC2A 5A54A 5AR3A 2OF2A 2QOFA 4JDJA 2YLFA 2UZOA 5GJDA 4MWHA 4RGJA 4IZYA 5IU2A 5CVFA 2OWBA 5CAPA 2JDTA 4WG5A 4YLLA 5AP1A 2YCRA 3AMYA 5J5SA 1H00A 3RCJA 4E1ZA 5EDQA 1IEPA 4NSTA 2OBJA 5E8YA 3Q52A 4PNKA 2P2IA 3RP9A 3MV5A 1KV2A 1JNKA 4MD9E 4YR8A 3OCGA 5A6NA 4GMYA 3ZUVA 3W2OA 3D5XA 3P86A 3R7OA 5LVPA 2OJGA 3LJ2A 2I1MA 3Q5ZA 4FT9A 4AN2A 4EOKA 2W1HA 3K54A 3NYOA 3GT8A 1U5QA 4MNEA 4RZVA 4XH6A 4IACA 4FKQA 3NSZA 5CVGA 5D1JA 1LP4A 3NUNA 3FPQA 4MK0A 3DB6A 2VN9A 1WVYA 4RVMA 4LI5A 5D41A 3KB7A 3AT2A 5M07A 5DE2A 3W55A 4BYJA 3A61A 4F0GA 2J6MA 3LAUA 3U6JA 4ERWA 1YXXA 4GVJA 1A06A 4Y73A 3TIYA 4FYOA 4BCHA 1R78A 4CEGA 5F95A 3Q9YA 4QP2A 4DH3A 4C4GA 1KE5A 4I5HA 2C1AA 4FTMA 1W0XC 4FVPA 4P7EA 2QNJA 3EQGA 3OW3A 4LOPA 4RJ7A 1KE9A 3QD3A 2BZIB 3WYYA 3EOCA 3RPVA 2C6TA 3LIJA 3VNTA 4F9BA 4V0GB 4C57A 5DT3A 4EJ7A 3ORNA 3TKHA 3WF7A 3DJ5A 2RFNA 2WMSA 4FKWA 4I6FA 3MVMA 3R9NA 3CGFA 2X6EA 4EK4A 3KA0A 2F9GA 3FMDA 3W16A 3BHTA 2OH0E 3N4UA 1VYZA 2J5FA 3NW5A 3GQLA 4YZDA 4GJ2A 4DINA 4F70A 2GDOA 4GK3A 1YXVA 4XCUA 2GNGA 3EWHA 2WTCA 2Z8CA 3KXZA 4OTQA 2VAGA 4BHZA 4GG5A 4QMUA 5E92A 3PSDA 2WMWA 2R3JA 4JLCA 4XP3A 4EK3A 5IEXA 3PXZA 2OO8X 4Q9SA 3QX2A 3ORXA 2Z2WA 5AWMA 2I0VA 4ZZMA 4Z7HA 3TUBA 2WD1A 3HA8A 5AP7A 4O2ZA 4FTRA 4RIWB 2Y6MA 5A9UA 1OGUA 2WQNA 2VX0A 5AAEA 1E1XA 4R3RA 2VTOA 2XP2A 3FMNA 4FX3A 4RPVA 3R7IA 5FDPA 5KMIA 3TV4A 5D7VA 4PPBA 4NCTA 3GU6A 2XNMA 2UVXA 4TRLA 5JSMA 3UIMA 3BU3A 1UU8A 3EZRA 3IO7A 3Q3BA 4BGGA 1RW8A 4EH7A 2BR1A 4AOJA 4E73A 2R7IA 3L1SA 3QL8A 4O83A 2HZIA 4DGMA 1OUYA 5HVYA 3FMEA 3MJ2A 3ZRLA 3R01A 5EQPA 4HYHA 4H3PA 4BB4A 1YI6A 1YI3A 1Q8YA 2WMTA 4CG8A 3DK7A 2C47A 3TWJA 4ITHA 2G15A 4XOYA 4ZTQA 2G01A 2C0OA 4QMNA 3I7BA 3E64A 4X3JA 3HV6A 3RNIA 4MKCA 5FM3A 3ATTA 3AQVA 4ITJA 4BIEA 3HKOA 2RGPA 3TNHA 3H3CA 3E3BX 5DRDA 3VUMA 4MYGA 1H1SA 4B7TA 1FVRA 4FKSA 3R7GA 2O8YA 4MAOA 3P7AA 1P14A 2YISA 3ALNA 4X3FC 2ZB0A 4NJ3A 4R5YA 3GEQA 1CKIA 2PVHA 5JGAA 1IA9A 4ZLZA 1Z57A 2F57A 3PVUA 1RJBA 3BYUA 3F3VA 3P4KA 4PDPA 3BKBA 4Z9LA 4KRDA 3MESA 3C0GA 2ETKA 1ZLTA 3Q32A 5HU9A 4CD0A 3PLSA 3R2BA 2PL0A 1CKJA 2WO6A 4M15A 5H8GA 2BAJA 1Q8ZA 3R8PA 2QOBA 4H36A 2O5KA 5DR9A 3B8QA 5IMXA 2C6LA 4PP7A 5D10A 3PE2A 3NW7A 1AGWA 2WTKC 4WNKA 4LL5A 2RIOA 2ITUA 3LCKA 2OZAB 4LMUA 2XIRA 1Y8GA 5DYJA 5LMBA 2JKQA 5TKDA 3SG9A 4BHNA 2VWIA 2VO3A 4BF2A 1PW2A 4IADA 3EQCA 1GNGA 5J9ZA 2EXCX 2XRUA 3P79A 4X2NA 2VZ6A 3PIZA 1O6LA 3E88A 3PTGA 5EYDA 3RPSA 3KXHA 3UGCA 4BKZA 4UMUA 2ZMCA 2YIXA 4LRJA 2F2UA 3ZDIA 5B2KA 4K1BA 4UZHA 4D2TA 2NPQA 4R8QA 5GIPE 4UYAA 2X0GA 3SLSA 2FSOX 2G1TA 4QMTA 3WZEA 1ZOEA 3ZXTA 3P7BA 5M53A 5AJQA 5G6VA 4ACCA 3NYNA 3DBFA 2OICA 3HLLA 5CSXA 2C6KA 4XP2A 5HE2A 1NW1A 3LXPA 4JQ8A 2VTIA 3A2CA 1PYXA 4E6CA 2VD5A 5FG8A 5IA3A 5L8LA 2IZSA 2YM7A 1HCKA 2OXDA 5LVLA 1Y91A 4J1RA 4R1YA 4NM3A 2C5NA 1JKTA 2GNIA 5BUIA 3TTIA 4I6BA 2UW6A 3GXLA 4AG8A 3C4ZA 3ZC5A 3HP2A 4L8MA 1OL5A 3KQ7A 3PZEA 2BMCA 1M7NA 3EQHA 4NK9A 2FVDA 3TNPC 2W1GA 4TYHB 1O9UA 4BDDA 2R3LA 5HE0A 2IZRA 4BBMA 3TM0A 2CMWA 3QYZA 2QOIA 3F66A 4GU9A 4JIAA 4WO5A 2R2PA 3VUGA 4MHAA 3VJOA 2B0QA 3CBLA 4DCAA 4MBLA 1VZOA 3ZSHA 3GCVA 1MQBA 5DHJA 3LMHA 2ITNA 3EQBA 3Q4CA 4I0RA 5I9XA 2XF0A 3R9DA 3EN9A 1PMVA 4YGAA 4EWHA 3GC9A 3NNUA 5IDPA 3U87A 1K3AA 3FLQA 4NEUA 1TQMA 3WE8A 3DOGA 4PPCA 4WIHA 3FHIA 5TF9A 2EU9A 3DBQA 2G2HA 4RG0A 4AE9A 3QYWA 3GCPA 3NWWA 2BIKB 3F7WA 4EK6A 3OFMA 5I5ZA 3UO6A 2V0DA 5IG1A 4L9IA 4ZZOA 4X6RA 3QZHA 2ACXA 2HY81 2GS6A 4PMMA 3OWPA 4FVRA 4EH9A 2A0CX 3O50A 2QHNA 1QMZA 5AADA 3TDWA 2BAKA 4FSZA 4ASDA 3HV7A 3I5NA 3FC2A 2F7EE 5HCYA 5B2LA 3DXNA 1KV1A 5IEVA 3W32A 4JAJA 4C61A 2FGIA 1KE6A 3UZRA 1OECA 3D15A 3OXZA 4U80A 4OAUC 2XM9A 4HPUE 1JVPP 5ANEA 3ZCLA 1WBWA 2JBOA 5HKMA 4CZYB 2ITZA 3UPZA 2CDZA 3DK3A 4EHVA 2XKFA 4U0IA 4X2GA 3KN5A 1V1KA 4O0UA 3EIDA 4Z16A 4AW2A 5I0BA 3MA6A 5LQFA 4AZSA 3D83A 4KIPA 5ANGA 5HIDA 5I4NA 4CNHA 2G9XA 2XK7A 4KSQA 2B54A 3WOWA 5HE3A 2UZTA 5HU3A 5KO1A 4AGUA 4EC9A 4DGLC 3EN4A 1OL7A 4QD6A 1STCE 4YP8A 4F7LA 3CE3A 4QYGA 5CENA 1R39A 3UYTA 3C4WA 3QZIA 1OPLA 3QUDA 4IQ6A 4WG3A 5ANOA 1CMKE 1TQIA 2OZOA 4NT4A 4NCTC 4QMOA 4QMQA 3MBLA 4AQCA 5IPJA 2YM6A 3G15A 4XG3A 2FSLX 3VS7A 4FKVA 4C2VA 5B7VA 4F1OA 2FO0A 3HGKA 3LFCA 5HLNA 3R22A 3CP9A 2JDOA 1YOMA 5EI8A 3UO5A 4FSWA 1JOWB 3ZEPA 2WELA 4W9WA 4Z3VA 5CF6A 4FV7A 4GRBA 1V0BA 3DKCA 3OVVA 3EKNA 3OP5A 3LFSA 1GZOA 4O0YA 3P0MA 4WRGA 4BTMA 4FNYA 4W4YA 4FIFA 2EVAA 4FV8A 3H10A 4LGDA 4OTRA 4TYGA 4O0TA 2PVMA 2VV9A 4IDVA 2A2AA 4RLKA 2YLEA 3PXRA 4YJPA 4CCBA 4BL1A 3RJCA 5KMKA 3PSBA 2E9NA 5E9EA 5J87A 2V5QA 3HVCA 5ITAA 4CXAA 2ZDUA 3QUEA 4FKPA 4UZDA 1WAKA 1UKHA 1FMOE 2J0IA 3OBGA 3ROYA 4IVAA 5JFSA 3N4VA 5C4KA 1O6YA 4PL4A 2Y4IB 5I9UA 4C02A 4JBQA 4AN3A 2OLCA 2ESMA 2QO7A 3R02A 2RKUA 3AXWA 3DNEA 2PY3A 5IQDA 3CTHA 4BIDA 2WMQA 4ITIA 4X2FA 5I9YA 5IQCA 5BVKA 1LPUA 2R64A 4EH8A 3SA0A 4YPSA 1DAWA 2X9FA 1B6CB 2PK9A 4HCVA 2HAKA 4KS7A 3NNXA 4PP9A 4QP6A 2XA4A 4QP9A 4R77A 3Q9ZA 1W84A 2UZVA 4HGTA 4LM5A 3V5TA 4FBXA 4Z55A 4GJ3A 4MQ1A 3F88A 4YO4A 3QD2B 3MFUA 3VUDA 1P4FA 3MI9A 1Q24A 3P5KA 3GQIA 4D55A 4FOBA 5CF4A 4H39A 5A4CA 3O8UA 5GINE 2HIWA 4D2SA 2XIKA 5B2MA 4DT8A 3R8VA 3HYHA 3ZRKA 2OH4A 3FWQA 3Q6UA 2XYNA 4HYSA 3G9NA 2P0CA 4WHZA 3BU5A 3KF7A 4ZS0A 5AV4A 4KIKB 1OIRA 2ZV9A 1SYKA 2WEVA 3JY9A 4QYFA 5A4TA 1ZZLA 2C5XA 2VTQA 2UW9A 3FI3A 3DKGA 5AUXA 5KBQA 3CS9A 5HVKA 2UZUE 4KKGA 5HTIA 2WAJA 2F4JA 5E8VA 4AA5A 5J9YA 2YJRA 1J3HA 3Q04A 3GNIB 4I4EA 2ITVA 3L8PA 4E8AA 3NCZA 3DY7A 2HY0A 1NA7A 1W98A 4HZSA 2WMBA 2JDRA 4IM2A 5K9IA 3NLBA 5L2SA 3EL7A 3L8VA 4U97A 4KWPA 5K0XA 1CKPA 3IKAA 3TV6A 4FSMA 3FXWA 2R3FA 1XH6A 3FKLA 2PMNX 2BZKB 4CMUA 4E4MA 2PULA 4YTHA 3C0HA 3FY2A 4OBPA 2QONA 3QWKA 4KNBA 3UOHA 4FIHA 4O2PA 3FLNC 3RAWA 2X2MA 4ONAA 3ZU7A 4YNEA 4BWPA 1APME 3DXPA 3VUHA 3RBWA 3T3UA 1YKRA 3DJ6A 2XNNA 2XMYA 4I5PA 5BVWA 3UC4A 1ZARA 3WZKA 4O96A 3V01A 4H3BA 5L6WL 1PMUA 3MW1A 3HRFA 3FKOA 4FV1A 1MQ4A 2VTTA 1YDTE 2GMXA 3Q4UA 3QQHA 4MXYA 5JH6A 3KMMA 2J9MA 2QQ7A 4N0SA 3VBVA 3MTLA 4C62A 4U45A 2OJIA 3N4TA 2YHVA 3BEAA 4B0GA 2JEDA 3QQKA 3NGAA 5DR6A 5EYMA 4TNBA 4EQCA 2LGCA 3D7TA 4FIEA 3LJ0A 3WF8A 4B6LA 1Q99A 2V7OA 2W9FB 3POOA 3CJGA 3GFWA 4QMYA 5ETAA 5FLFA 2ZJWA 2GS7A 5AR8A 5IQAA 5EQEA 4IJ9A 4RVKA 1XHAA 1JKSA 4EH4A 2PUUA 4S32A 3HDNA 4WNMA 4M12A 5FP5A 3UG2A 4P2KA 3QQGA 4KSPA 4D2VA 5EM8A 1DI8A 1M14A 5H8BA 3GBZA 4P5QA 3VS1A 4R78A 2C30A 2I0HA 2W1EA 3AD6A 3AT4A 3IW4A 3KF4A 3NYXA 4FNWA 4RBLA 5KCVA 4YURA 5K5XA 3U6IA 5E8WA 4D2WA 3OXIA 1U4DA 5EG3A 2WTIA 4MNFA 2QO2A 4D2RA 5CEPA 5AP6A 2G2IA 2RG6A 4LQMA 3TXOA 3MS9A 4FK6A 5BMMA 1P5EA 3TJDA 2YEXA 3DA6A 3FMMA 2CSNA 5DEYA 3RM7A 3D4QA 5HGIA 5DMZA 3VN9A 4UYNA 4C4EA 2IVVA 3NPCA 4J53A 5KE0A 2X8EA 3BX5A 3QCYA 3TACA 4UB7A 1ZMUA 2JGZA 3RMFA 5AX9A 2A4LA 5ACBC 3QTQA 3SG8A 2QVSE 3QD4A 3E62A 2YZAA 3EFWA 2HZNA 3KVXA 3LCSA 3LM5A 3QFVA 4Y8DA 4EJNA 3LKMA 4G6OA 5AP3A 3QALE 1PXLA 3CLYA 4GYIA 4Y85A 4FKGA 4NTTA 4BCPA 1G8AA 4ZMEA 2OJFE 3JXWA 4FTTA 1PXMA 3LFQA 3Q4ZA 4FNZA 4XP0A 3OW4A 1XO2B 3THBA 4FT3A 3GCSA 2FYSA 1OL1A 3R7VA 3DQXA 5LJJA 4EOSA 4FV2A 5KMLA 5CAUA 5CAVA 4TWPA 2GNLA 4R6VA 4AGDA 5T6KA 4EORA 3VBQA 3MVHA 5L8JA 4XG9A 4FT5A 5AP2A 2PPQA 1ND4A 5M08A 4FTKA 4XEYA 3RHXA 5KBRA 5F9EA 4M68A 4QYHA 1B39A 3AMBA 1E1VA 4QMSA 3BELA 3HECA 4Y46A 5JQ8A 1CDKA 4JS8A 5LCKA 3BGPA 5D11A 4M67A 3AC5A 4FT7A 3UIXA 4EOQA 5BYZA 2HXLA 2WQOA 4ARKA 2ZM1A 3IDPA 5LARA 4KKHA 1MUOA 4DHFA 4S34A 1WBPA 2XEZA 4A4LA 5IMEA 4ZK5A 1PMEA 1NT2A 1UNHA 4F0FA 1WFCA 4XNEA 2VWYA 4RJ8A 4DGNA 5IQEA 1OKYA 4L3LA 4U43A 4L7FA 4IVDA 3GU4A 5DR2A 4V0GA 4GT4A 3CKWA 2BRHA 5JKGA 1SZMA 5AAGA 4RZWA 2B52A 3JY0A 4NFNA 4JBOA 3ANQA 3VS0A 4G16A 2C1BA 3TG1A 3WZUA 3V8TA 4E93A 3HEGA 3ROCA 3PY3A 3RAIA 5ANDA 4NFMA 4BGQA 1NVSA 3NX8A 1FGKA 2ITWA 2YIWA 2OFUA 4TZRA 3HX4A 3ORMA 4YJVA 3SKCA 3ZO2A 4FODA 3QLGA 4IX5A 4IC8A 2W0JA 2ITOA 2CKPA 3TEIA 4BZDA 4QTEA 3MN3A 1NXKA 3R7YA 4ALWA 3QKMA 4ZXTA 3DZOA 4NIFB 5LOHA 3ID6C 2OJ9A 4QNYA 1J7IA 4O7LA 3OHTA 2C4GA 3E8CA 4ZSEA 4F09A 1NVRA 1YVJA 4TKSA 3MTFA 2CHLA 4RIWA 3T9TA 3S0OA 1YRPA 2EXMA 3QTSA 5HG8A 4XV9A 1OL6A 2J4ZA 2X8DA 1U46A 3FMKA 4OGRA 4YJTA 4JXFA 5M51A 3QRTA 3ZFMA 3LXKA 5CVHA 4EHZA 4BBFA 3MFTA 3PFQA 3GI3A 1SVGA 4UV0A 4HYUA 3A7GA 1H1RA 3KKVA 4FZAB 3FI8A 2X1NA 3NAXA 3O7LB 4JX7A 4EH3A 3OEFX 4EQUA 2CNUA 1WZYA 3DAEA 4FVQA 4NM7A 3P9JA 4H3QA 5HNBA 1TQPA 1M7QA 3MDYA 3T8OA 3VS5A 3I1AA 3LCDA 4YZBA 5E7RA 3VF8A 3ZRMA 3ZXZA 4C38A 4FNXA 1BUHA 4MXZA 4YJRA 2E9UA 1UU9A 1REJA 2R3RA 3ZZEA 5FTGA 4U44A 4LRKA 5CNOA 4G9CA 5FRIA 1YW2A 4EBWA 2ERZE 3DPKA 4JOAA 2OJJA 3FQHA 3AC8A 5AA9A 5DI1A 4ZY5A 2ETRA 4F1MA 3FXXA 3LVPA 5CAQA 1Q8TA 4HJOA 1W83A 3SOCA 4FTNA 4G2FA 1IG1A 4AU8A 2PUIA 5IQHA 5L6PA 3R71A 4YLJA 5DRBA 4XG8A 3VHKA 4DBXA 2YA9A 3MWUA 4YZNA 5CSPA 4R5SA 5IH5A 3PE1A 1H28A 5CS6A 1PHKA 2NNWB 3G0FA 4N6YA 3ZBXA 4DF3A 2C5YA 4AZVA 4J52A 3R83A 4PRJA 3HUCA 4C36A 4CMOA 2VTJA 4P5ZA 4ORKA 3IW6A 1LR4A 3PVWA 5CI6A 4BCIA 3KFAA 2IW9A 4X6QC 3FQSA 5HE1A 4BZOA 1MRUA 3VBXA 4JBVA 3P78A 1KOBA 2HENA 4AZTA 2VWXA 2X2KA 4S33A 5L2WA 5IUHA 3H0ZA 3S00A 2HW7A 4FTAA 2W7XA 4B4LA 4ZAUA 4PUZA 1M2QA 4CRSA 3SD0A 4OW8A 1PXPA 2P55A 5KZ0A 4FT0A 2B1PA 2QHMA 2OSCA 2OZAA 5CTPA 2CN5A 3NCGA 4KS8A 2UZLA 2XIYA 3Q53A 3IK3A 3KMUA 5C8MA 3UO4A 4O91A 3KK9A 5I9VA 5JZJA 3GC0A 4AN9A 4U79A 3DAJA 4XOZA 5KMNA 3OG7A 5C26A 4FZ6A 2RL5A 1IASA 5TE0A 3KL8A 3NUXA 4G5PA 4RJ6A 4F1TA 3N9XA 3GU8A 5FWKK 4FTJA 3Q4TA 2Q0BA 1ZAOA 1OUKA 1Y8YA 4GUEA 3ZC6A 4FIGA 5HG7A 4D4VA 3M1SA 4M66A 3ZHPC 4I94A 5EYCA 4BCKA 3DBEA 2O2UA 4ZLYA 3W10A 4GG7A 5L3AA 4FEUA 1Q3DA 2YCFA 5GZ8A 2XZSA 3UE4A 4O0RA 1YWVA 1ZYCA 2O65A 4FYNA 1XKKA 3QCSA 1K2PA 3KXNA 5AM7A 3QZFA 5CU4A 4XJ0A 3M42A 1K9AA 3JYAA 5IDNA 4QMVA 4BDEA 1R1WA 3II5A 3FMJA 2XNOA 5FM2A 4MBJA 1YOLA 3G90X 1VJYA 4S31A 5JEBA 2CJMA 3ZH8A 4USFA 4HYIA 3OT3A 4ZLOA 5LXMA 4TY1A 3DCVA 4BICA 4XX9A 3ZS5A 4OBOA 3ZM9A 1OI9A 4ASZA 3PJ2A 4OTHA 2QOCA 2PVNA 5CY3A 3RVGA 4ALUA 2VNYA 4FSYA 4QYYA 3SRVB 3HRBA 2WMUA 5BQ0A 3NDMA 3IW5A 3K5UA 4HW7A 2BAQA 4USDA 4IAKA 3MPTA 3IONA 4CV9A 4GW8A 4U5JA 4G6NA 2VTMA 1PXIA 3R8UA 2EB3A 3KVWA 3QD0A 2HELA 4CMTA 4O7RA 4AP7A 4FR4A 2C6DA 4JVGA 5GNKA 5HEZA 4PTGA 3VHEA 3DTWA 1XBAA 5F20A 1R3CA 2NO3A 4FV9A 4O7ZA 3H4JA 5A3XA 2P33A 3NNWA 3PIYA 4FSNA 3TKUA 3OS3A 5F1ZA 4F9AA 5IKWA 2Q0NA 3LPBA 4F63A 1Q4LA 4CKJA 1FOTA 2BALA 4DG3E 3C4EA 2XJ1A 5IA5A 2XKCA 3PDTA 3RTPA 4TWOA 1KE8A 2G2FA 2O3PA 3U55A 5AUUA 4FL1A 3V6SA 4DEBA 5CSVA 3UIBA 2BDFA 1WMKA 3UODA 1JPAA 4ZY4A 2EXEA 4PF4A 5TO8A 3FLZA 3MY0A 3PRIA 4RT7A 3R8LA 4HVIA 3WZDA 5BVDA 4IVBA 5ACKA 3TNWA 3LFEA 3QA0A 4LGHA 4PX6A 4E6DA 5I9ZA 3FE3A 5E8XA 4NW5A 3W2SA 4QPMA 4C3PA 5EM6A 3OY3A 4IEBA 2LAVA 3VBWA 1ATPE 5JN2A 4WT6A 2GQSA 1V0OA 3A62A 4KAOA 4CFMA 2YN8A 3OWKA 4QNAA 3CSVA 3DBCA 3N51A 5BYLA 4KABA 4YPDA 3BWFA 4LGGA 4O7TA 3PG1A 3FZ1A 2VO6A 3AT3A 3A4PA 4M0YA 5CQWA 2SRCA 3V5PA 1IAHA 3A7IA 3VULA 4AGCA 1Y57A 3W18A 3I5ZA 3A7JA 4Q5HA 4C4IA 2W1ZA 4XS2A 2QLUA 3BLHA 4WSYA 2X39A 3CPCA 4IX3A 4JJRA 3QHWA 2XBAA 3Q9WA 2BPMA 3EMGA 5KZIA 3V51A 4DLIA 3QRKA 2XRWA 1YHWA 3O96A 3HRCA 1SVEA 2CNQA 1ZYDA 1H08A 4D4SA 5GJGA 2W5AA 1W8CA 2O64A 4EQMA 4RA4A 3H30A 4IIRA 5CASA 3DFCB 2QG5A 3HDMA 2WHBA 4BTJA 4EOLA 3POZA 3V5JA 5CZHA 5EM7A 1FPUA 4U40A 3VJNA 5C8NA 3UP7A 3WZJA 3LZBA 4OTPA 5CSHA 3Q5IA 4UWBA 4CVAA 5AMNA 3P1AA 2YDIA 2E2BA 2YAAA 2IG7A 3F3WA 3TZ8A 1Q62A 3RPOA 2XM8A 4EONA 3K2LA 3TDVA 2X4ZA 3OOGA 3P08A 4TWNA 4EZ5A 5HQ0A 2VTRA 4EYJA 3BGZA 4O7VA 2CGVA 4GH2A 2C69A 4J95A 2R3MA 4A4OA 3CXWA 3DTCA 4BC6A 3BHVA 5CI7A 5BVOA 4AZWA 4BCFA 2FB8A 2QR7A 4USEA 1RDQE 4XBUA 5HHWA 2XB7A 4EH5A 2PVJA 5CXHA 4NH1A 4W9XA 1J91A 2Y4PA 1YDRE 2CCIA 5EOLA 5ETCA 4YLKA 3OTVA 5JRSA 5CANA 4LL0A 3QCXA 5J9LA 3D7ZA 5E8TA 4DA5A 2Z7SA 4ASEA 3DK6A 1OM1A 4FV3A 2IO6A 2BILB 4FG9A 4P90A 2IW8A 3RK7A 3RM6A 3RPRA 5C8KA 3MH0A 5AUTA 2XK3A 4O0WA 3FLSA 4IAZA 4QMXA 5H9BA 4AOIA 4BDJA 3I0OA 2DYLA 2GCDA 2VWVA 4KRCA 3LOKA 3BV3A 2HK5A 1RE8A 4IX6A 4TYIA 4D5KA 3I81A 4JRVA 3LMIA 5EDPA 2BRNA 3TCPA 5IA4A 4AW0A 3LHJA 4ZTHA 1PY5A 2YWPA 5IEYA 1QPJA 4FUXA 4GFOA 4I93A 2AC3A 4UXLA 2JIIA 4XV3A 4DYMA 4EUUA 2BVAA 5L4QA 2XNBA 3V5LA 5CEQA 4IB5A 1IR3A 3OCSA 3A4OX 3QZGA 5BX0A 4IAYA 2B9FA 3MFSA 4ASXA 5CALA 4O86A 2GFCA 4DBNA 2YCSA 2Z7RA 3M11A 2XK4A 3CC6A 2YDJA 3CEKA 5HTBA 3GOPA 5E91A 3LQ8A 4NW6A 5KNJA 4IANA 3QF9A 3SVVA 4MX9A 4BKJA 4EKKA 5J7HA 4YJOA 2WIPA 4NZWB 1OITA 4YTFA 3MH2A 3V8SA 3QU0A 1DI9A 1NY3A 2DS1A 4K18A 5A4LA 4AZFA 4FZDB 4XYFA 3DS6A 4QMLA 1X8BA 2R0UA 3ALOA 3COHA 4CQEA 3BIZA 3NMUF 3LJ1A 4QTDA 3SX9A 3FBVA 4GIIA 5CEOA 4L7SA 4O22A 3AG9A 4UWYA 2JKOA 3QLFA 4CFFA 2CGWA 3EQDA 3PLAE 1BMKA 4C3RA 2B9HA 3BHYA 3KC3A 4ANOA 3CCNA 2V22A 4EKLA 3KULA 5JGBA 3IG7A 4HCTA 4J96A 1XJDA 3CQEA 1GY3A 3ZLYA 4BN1A 3NR9A 4E5BA 4H05A 3SGCA 2VNWA 4IB0A 4FKTA 4C35A 4EL9A 5BYYA 4C2WA 3TI1A 4CV8A 2XNPA 4EK5A 4RRVA 5FQDC 1TVOA 4L44A 5AUYA 3KN6A 3EN6A 1OIYA 3ODYX 3BBWA 1OKWA 2BTSA 2QG7A 2GU8A 1REKA 4U6RA 2UW5A 5DEWA 3W8QA 3C4CA 3HMPA 3QXPA 4IAAA 3NUAA 3SXSA 3R9RA 3ETAA 3DLSA 3EQRA 1GZNA 3L9NA 4BTKA 4DEIA 4F7NA 3E8DA 5EKNA 4WSQA 4Y83A 3ENHA 1XH7A 4UWCA 5HX6A 5EI6A 3KREA 3BE9A 4E7WA 1ZOGA 2PVLA 4RWJA 3VS6A 3W33A 2BHEA 2XVDA 3CKXA 3ACJA 3F61A 2FSMX 3F9NA 5HIEA 4FMQA 2H9VA 4QTCA 2PE1A 5CU2A 2QOQA 1HCLA 3GGFA 4GT3A 5C01A 5TR6A 5LMKC 4JQEA 4I1ZA 2QC6A 2WPAA 2ZAZA 4QMMA 3UP2A 4U41A 2WGJA 1S9JA 1XH5A 4XG7A 3RHKA 4FL3A 4O6EA 5C03A 4AA4A 2IJMA 4RIYB 1JWHA 2J0MB 4QP1A 1WBVA 2XK9A 3ZEWA 3CPBA 2C5VA 4DG2E 1ZZ2A 3NZ0A 4JG7A 4QQJA 3C50A 3DV3A 3NNVA 2BDJA 1A9UA 3HP5A 4YSMA 2YM5A 2XS0A 3BEGA 4J97A 4BWXA 2B7AA 3F82A 2H34A 4BCJA 3SDJA 3DDQA 4GYGA 4QTBA 3VC4A 4A9TA 3LFNA 1PJKA 5FXSA 5DNRA 2QCSA 3DU8A 1CTPE 3ZSIA 4RQKA 4MWIA 4DG0E 5KMOA 1L8TA 5ICPA 1PF8A 3TL8A 4MXOA 2BKZA 4JDHA 3DJ7A 5IQBA 4J7BA 4BGHA 4GIHA 1Q41A 4IX4A 2PU8A 1G5SA 5IQIA 4LMNA 3LFAA 4O27B 3EFLA 3TZ7A 1MRYA 1VYWA 4E5WA 4IMYA 1YOJA 2ITQA 3ATSA 4TL0A 4QP3A 4DAWA 5FBNC 3C4XA 4OTDA 4PNIA 4RIXB 3S4QA 4O21A 2X8IA 3OROA 5E90A 3H9FA 4I5CA 4QO9A 4YBJA 5IA2A 5CT0A 3G33A 4RWLA 3WF5A 5BVEA 4CFWA 3Q2JA 4ZJJA 5I3RA 5CT7A 4ZTSA 3VO3A 3UC3A 5JRQA 2V55A 4JI9A 3PWDA 5M4UA 1QL6A 2OI4X 3IPHA 4F0IA 4LV8A 3JUHA 3OZ6A 4YZMA 5AUWA 3DBDA 4EOOA 2QI8A 4FIIA 5JK3A 2X7GA 2QODA 3S95A 5KHWA 4ZIMA 4K77A 4DFZE 4CLJA 4FEWA 2WMRA 2FSTX 2CLQA 2W5HA 3TKIA 3ODZX 1H1QA 2C0TA 4D9TA 3CQUA 3R8ZA 4JBPA 2VU3A 4GFMA 3IDCA 4YZCA 3ZONA 4M97A 5BUEA 3C7QA 2UVZA 3AC2A 4DITA 4XBRA 3KMWA 5IISA 4HNFA 4ZOGA 4R3CA 3MJ1A 5HVJA 5IF1A 4R1VA 2W9ZB 4M8TA 3FMLA 2VTNA 4Y95A 1BYGA 2WU6A 4V01A 1ZXEA 5ETFA 4IC7A 4XUFA 3ZMMA 1F0QA 2Y4IC 3UBDA 2GTNA 2PZRA 2PZPA 3E7VA 4AFJA 1MP8A 4ALVA 2X2LA 3DGKA 3OY1A 3QC4A 2YIRA 4A06A 4OUCA 4PMSA 2UZBA 4ACMA 4YJQA 3MGYA 2XYUA 5FEQA 3QGYA 4PMPA 1FQ1B 3FAAA 3ITZA 1Q5KA 4M0ZA 3C5UA 1XBBA 2PVRA 3DFAA 2OGVA 4RX5A 1KUTA 2BZJA 2WMXA 2R0IA 1VR2A 2W1IA 5L2IA 3EQFA 4FSQA 3OMVA 4K6ZA 5HORA 3GU7A 2WQEA 4J8NA 5CXZA 5HICA 3SC1A 4NM0A 5EQYA 4D4YA 3D2IA 2GHLA 4O1OA 4E4XA 4AZEA 2VWUA 4O1PA 5IH4A 3F2NA 3CY2A 3LE6A 4NM5A 1PXKA 4YBKA 4KBCA 4XRJA 2O0UA 2XCHA 4CFUA 4CQGA 2HXQA 3QQJA 3UYSA 3NVMB 3ULZA 4NKSA 4FTIA 4PY1A 5M4CA 3LM0A 3D9VA 3HZTA 2JC6A 1GIHA 4QOXA 3S3IA 5JT2A 3F3TA 3ORTA 4RVTA 4OTFA 4G31A 2X7OA 2V62A 4G34A 4O7SA 4RVLA 2R3QA 3PSCA 1GIJA 2OU7A 2EUFB 4NYEA 4IWPA 4L6QA 4FG8A 5GIOE 4IHPA 4M7IA 1TKIA 3E63A 4RFMA 2VX1A 1URCA 5J1VA 2CCHA 4LUDA 4YTIA 4DEAA 3F5GA 4KB8A 2OFVA 4UMTA 3PJCA 3QC9A 4LFIA 1KWPA 3RPYA 3PXFA 4BCQA 2J7TA 5K4JA 5E4HA 4RIOA 4BY9E 4L46A 5CNNA 3G51A 5HLPA 3ZLXA 1I09A 5BPYA 5AUVA 3ULIA 3GC8A 3PYYA 3PP0A 4FSRA 1MRVA 4D28A 2WEIA 4E26A 3A8XA 3IW7A 5CU3A 3HMMA 4CGAA 1M2RA 1KSWA 3LCOA 2J50A 2CKOA 4IZ5A 3FYJX 5EHLA 4IDTA 3C13A 4LOOA 3NUUA 2YZLA 5C27A 2IWIA 3FQEA 3Q9XA 3RCDA 4QRCA 3BHUA 3R73A 4DFNA 3L8XA 3CQWA 2W06A 3QX4A 3B2WA 5KKRB 4UX9A 3ANRA 4CRLA 4GV1A 5EI2A 3VS3A 4YHTA 4KUJA 2VWZA 4OT5A 5HLWA 1UWHA 4DFBA 3UNKA 3R0TA 4FOCA 4TYEA 1Q61A 1PKGA 2VWWA 3HNGA 2W4JA 2VTHA 2W96B 4RSSA 5H3QA 3UMWA 4DCEA 2F2CB 3CJFA 5A6OA 4G17A 4TNDA 3CY3A 4AW1A 4EHGA 4R7HA 4R7BA 1H0WA 1M17A 2QD9A 4BR3A 3WBLA 1JKKA 5IA1A 3IGOA 2QKWB 4Y5HA 3ZOSA 3UPXA 4GKHA 2XIZA 5AX3A 1B38A 2FA2A 3QWJA 4F99A 4Y72A 4E6QA 2JBPA 3KRWA 4DLJA 1U54B 3MFRA 4MF1A 5FP6A 5HNGA 3ZFYA 1UNLA 5HO6A 2UZWE 4E6AA 4IZAA 1H25A 4M13A 3M2WA 1JQHA 4FSUA 2GNHA 4DEGA 3O7LD 2BCJA 1IRKA 3E3PA 4EC8A 5CEKA 2O63A 1YHVA 3ZDUA 4CFVA 4QT1A 4HGSA 4C4HA 4ENYA 4OTIA 5IQFA 3FLYA 4B99A 4D58A 2WXVA 4G3DA 3RAHA 4BDGA 4GT5A 1YHSA 5JFXA 3E92A 2EB2A 2R3GA 2XCKA 1Q3WA 5EW9A 2C6OA
chains in the Genus database with same CATH superfamily
2J90A 3BE2A 2OXYA 4GS6A 5CU6A 1H24A 2YIYA 4GU6A 2HW6A 4XLIA 2J0KA 5D12A 2YFXA 4D0WA 2KULA 3UZPA 5GZAA 5L8KA 4IB1A 3KRXA 3NUSA 5LMAA 3DAKA 4WBOA 2CKEA 4RQVA 4K11A 5E8SA 4HVHA 3G0EA 4DHIB 2C68A 4DEEA 3MA3A 2BRMA 3UMXA 2GQRA 2Y8OA 4CTBA 2PVKA 2UZNA 3EYHA 3OOMA 1XWSA 5EDRA 4B8MA 3EZVA 4HGLA 2F7ZE 4JG8A 4YJNA 3LXNA 5H8EA 3BQCA 4BDCA 5CX9A 1GJOA 1Y6BA 4AA0A 3R30A 2ITXA 3BZ3A 2HZ0A 2J0LA 3DZQA 3OUNB 4UY9A 4HOKA 2WB8A 4KINA 4A9RA 4PQNA 3U9CA 4GK4A 5M44A 3FUPA 4GFGA 4DFUA 2GQGA 3W2RA 4HPTE 5C1QB 4QYEA 3UNJA 3W8LA 4C34A 3BLQA 3AMAA 2Y7JA 2PVYA 4CG9A 4F4PA 2WQMA 3SW7A 2ITYA 1Y6AA 4XRLA 4EBVA 1FGIA 3TUDA 2XEYA 1LUFA 3SAYA 3SQQA 4M69B 4MH7A 4X2JA 4FL2A 4MQ2A 3KXGA 2WTJA 5EM5A 3RZBA 5AR5A 3TJCA 4A07A 4UMRA 3PUPA 3C5IA 1OMWA 3FSKA 3LQ3A 4L45A 5M06A 4C4FA 2B9IA 3FL4A 2XUUA 3QTRA 4I3ZA 2I40A 3C51A 4AF3A 4I0SA 4MVFA 3W2CA 5LVOA 5A4EA 3V5WA 4NL0A 3U4UA 2HZ4A 3OXTA 3QTZA 4JRNA 5C4LA 2XH5A 4FTUA 5HG5A 3RI1A 2JIVA 4I22A 3LQ5A 4NJDA 1QPCA 4PV0A 3WIKA 5K4IA 2JKMA 1W7HA 4RC2A 3FSFA 3MPAA 1ST4A 3L9PA 3AD4A 1E9HA 4CT2A 4TTHB 3CD8A 3F69A 3ACKA 3G2FA 1Z9XA 3R21A 3W0MA 4I92A 1ZMWA 4FEXA 4DH5A 3UOLA 3QTIA 4DDGA 4C58A 2W4KA 3EFKA 2CLXA 4MUQA 3GOKA 3C9WA 2OG8A 3REPA 2WZJA 3UJGA 3NVKI 1OB3A 3BQRA 4YHJA 4WNOA 2HCKA 3BCEA 1UVRA 5HESA 3UDBA 3ZO1A 3D0EA 3HL7A 3MVLA 3EH9A 3R1SA 3O17A 5HD7A 4EZ3A 2E9VA 4L3PA 3U8WA 1DAYA 2W05A 3BWJA 3JVSA 2W1FA 3VS4A 2QU5A 1GIIA 3BYMA 4YHFA 3C4FA 2X4FA 3F5PA 5BNJA 4C33A 3Q96A 2JFLA 4FV5A 4LG4A 4QPAA 1ZMVA 3EN5A 3MYGA 4XV1A 2PMOX 4XG4A 2Y6OA 4YSJA 3ORZA 3LFDA 4CYJA 3RWQA 4W4WA 5DG5A 3KK8A 3MVJA 4FV4A 5CYIA 2X6DA 3NIEA 3VQUA 5HNIX 3WF6A 2ZVAA 1F3MC 3AGLA 4ZTMA 4NKAA 2JKKA 5E8ZA 4APPA 1U59A 1KOAA 1YWRA 2C6IA 4FTQA 4FV0A 4I20A 5AA8A 4I6HA 4O38A 5ANIA 3OD6X 5DOSA 4F9WA 4H58A 4TXCA 3EKKA 3I0QA 3W1FA 2A19B 2FUMA 4PDYA 4X3FB 4GK2A 4ZTNA 1J1BA 4AAAA 4JDIA 5AR7A 3NS9A 1U5RA 3FC1X 3ZTXA 3FY0A 5M4FA 3BPRA 3FI2A 4PL5A 2E9OA 4FTLA 5AV1A 1BI8A 4F64A 3FPMA 3QXOA 4L67A 4PDSA 5A46A 2HWOA 1WBSA 4TYHA 4BYIA 4CTCA 1AQ1A 5J7BA 4GEOA 5CF8A 2UW4A 3IOPA 4TPTA 4A9UA 4C8BA 4ZMFA 5KMJA 3VW8A 5GZ9A 5CSWA 4BCGA 3WIGA 2JAVA 2RF9A 4DGOA 3H9RA 1FINA 2XIXA 2JIUA 1PXOA 4ZTLA 3F7ZA 5J79A 2P4IA 3A99A 1VEBA 4E4NA 4EUTA 4AE6A 1LEWA 4RJ4A 5CAOA 4L42A 3F2RA 1GZ8A 2W1DA 3QA8A 2F49A 1CM8A 4XHKB 3ZFXA 2WTKB 2PVFA 1WCCA 3SOAA 4UALA 2BRBA 3NYVA 5DT4A 3SXFA 2YM8A 2PMIA 2YM3A 5HBHA 3WE4A 5HBJA 5LCJA 3HAMA 2VTSA 2QOOA 2RSVA 3U9NA 1RQQA 5HCZA 2IPXA 2AEGA 4YC8A 3DQWA 3AD5A 4BDIA 4G3FA 3BU6A 3PJ3A 5L2TA 3TUCA 4DEHA 3DXQA 4QP4A 5LMKA 1O6KA 2C0IA 4G3GA 4MF0A 4APCA 2I0YA 3IOKA 5E1EA 5LWNA 5HG9A 1WVWA 4BDFA 3D2KA 3QKKA 3BBTB 5GHVA 3V8WA 4MXCA 3B8RA 4AX8A 4WUAA 5AV0A 3PXQA 4F7JA 5HTCA 3C0IA 1PYEA 3OUKA 3KU2A 4BDBA 4CT1A 1SMHA 2R3OA 3RK9A 2Z60A 2YWVA 4KA3A 2E9PA 3D5VA 2ZFYA 5T3QA 3COIA 2C3IB 4A4XA 4G1WA 4F6SA 2GNJA 5FUTA 4DE4A 4L43A 3GFEA 4L53A 5E8UA 2Q83A 2OK1A 4YZ9A 4D1XA 4F6UA 1HOWA 4O0XA 4WG4A 5CLPA 3RALA 2GSFA 4QQCA 4BDHA 2UW8A 1TFFA 1XBCA 1PMNA 3QGWA 3ZUTA 2JDSA 4EI4A 4MBIA 4NWMA 4AT4A 2QOHA 1UU7A 4HCUA 5DPVA 4EHEA 2PZYA 3O23A 3D5WA 5AP0A 2ZM4A 4ZY6A 3W0QA 2ZV7A 4AS0A 4K0YA 4YU2A 1AD5A 5DVRA 1OBDA 2VO0A 4AWIA 1DS5A 3MSSA 3IS5A 4I5MA 4PL3A 3RAKA 4Y5QA 3ZO3A 4W8EA 3BYVA 3R2YA 3MY5A 3FV8A 3LFFA 1OPJA 3KCFA 4X2KA 3I79A 5FTQA 5HOAA 2XBJA 4IAIA 4DH7A 3E87A 3D94A 3O51A 4FICA 1JSTA 4TWCA 3UIUA 3DB8A 4PDOA 5AR4A 3U51A 3OTUA 4ZJVA 4MNEB 3S1HA 4ACGA 4AXAA 4QMPA 3FEGA 4J99A 2Z02A 2QOKA 5IUGA 1SNXA 2B55A 2UVYA 2I7QA 4WA9A 4M3QA 4OR5A 2UW7A 3NW6A 2PE0A 3HMOA 5FXQA 2VTPA 5A14A 2A98A 4M84A 3R8MA 1ZRZA 3LW0A 4IXPA 4IJPA 4BCMA 4OT6A 4QQ5A 3EYGA 3NRMA 1XH8A 5EFQA 2VO7A 3R9HA 2ITPA 4FA2A 5AIKA 4OAVB 4LDTA 5HI2A 5AIRA 2ZV8A 4DTBA 3A8WA 2BFYA 2WMVA 4ZTRA 4F7SA 3UOJA 5DBXA 2CKQA 4U8ZA 3EJ1A 3TV7A 2W5BA 4IH8A 4EYMA 4FRFA 3MIYA 3PA4A 3BGQA 3QBNA 3D14A 4FEVA 4YJUA 4Q2AA 3HMNA 2R3PA 4RIYA 4X7QA 3R6XA 3CIKA 5G1XA 4BCOA 3V6RA 4ANBA 4F65A 3HV4A 3R04A 2BUJA 3TYKA 4WKQA 3FDNA 3HMIA 5I9WA 4JX3A 3R7EA 3FZPA 2ZM3A 5T68A 3P23A 5AUZA 3ZBFA 2PWLA 3PA3A 1Q8WA 2QR8A 4GSBA 3IW8A 3I7CA 4ANQA 1PRYA 3EB0A 4DN5A 3IQ7A 2REIA 3VRZA 5HZNA 4IFCA 2CPKE 3MB7A 2JITA 5EHOA 2B4SB 3QKLA 1KE7A 3MIAA 4KIOA 4YC3A 1CSNA 3TN8A 3NEWA 4FE2A 4DHZA 5BVFA 2C3KA 4DH1A 2P3GX 3HA6A 3PY0A 4IM0A 4EH6A 4AT3A 4O81A 2C6MA 3R1NA 3AC3A 5EW3A 2RFSA 4V04A 3PPZA 4YTCA 1XH9A 4CYIA 1ZYJA 3GENA 1JBPE 1YWNA 4FKUA 4RIXA 4D5HA 3EFJA 5K3YA 3HV5A 3JS2A 4E5AX 3UDZA 4ID7A 4BBEA 4N57A 3BL9A 3GCUA 3UQCA 2IW6A 4AW5A 4G3CA 2GS2A 4I23A 5HO7A 4KIKA 2XJ0A 4AXCA 2BDWA 4FKIA 2WIHA 4E4LA 5J8IA 4FKJA 1ZYLA 3I6WA 2HOGA 1XQZA 2GNFA 3C1XA 4O84A 4L3JA 4PPAA 4ZS4A 3UNZA 3V3VA 4P4CA 5EYKA 5I3OA 5BUJA 4Z7GA 1UKIA 2WU7A 4G9RA 3KRRA 4S30A 4LV5A 1H4LA 4U3ZA 4IW0A 2QURA 3PXKA 1QPEA 4BJJA 2GHGA 2C3JA 1Z5MA 3HV3A 4MTAA 1L3RE 4JNWA 2UZEA 1PKDA 4C59A 4IWDA 5KUPA 2HYYA 1A48A 3L9LA 2ETMA 3OCBA 1PXNA 5D7AA 4DH8A 4BI2A 2R3IA 2ONLA 4A9YA 3VQHA 2WTVA 2VGPA 4JR3A 4IAFA 4DGGA 3NUYA 4X0MA 4ZSLA 4BDAA 5M57A 5HIBA 2H96A 3FZOA 2DWBA 2IZTA 4G5JA 4I41A 2XKDA 4W4VA 4WBBB 4BKYA 2CN8A 4U3YA 3PVGA 2ZYBA 5BMSA 4FTOA 1FVTA 4FUYA 5ETIA 2XK6A 4EH2A 3RK5A 2R5TA 4CCUA 1FBNA 4H1MA 2W17A 4JQ7A 3TZ9A 3BLRA 3AKLA 4GKIA 2C3LA 2YAKA 3ET7A 4IZ7A 5GJFA 4RMZA 3GU5A 3ORKA 3QHRA 4UMQA 4C4JA 3HAVA 5FEEA 3TT0A 3PG3A 4B8LA 1YXTA 1OPKA 2YM4A 4N70A 5CEIA 1LEZA 2OF4A 3ORIA 1P4OA 4CKRA 2R7BA 3LXLA 2J51A 4DEDA 3BI6A 4J98A 4C37A 2YDKA 4U7ZA 3UVRA 4K33A 3P5JC 1H27A 3SV0A 4PTCA 4OBQA 3VBYA 5KX8A 1ZY4A 2PTKA 3CTQA 3K3JA 5JZNA 1UU3A 4EEVA 1JAMA 5AM6A 5AP5A 4BI1A 1G8SA 2B9JA 3AOXA 4BWKA 4EOIA 4K9YA 1BL7A 3R63A 5ANJA 4IM3A 4L52A 3QRUA 3DKOA 3IECA 5AV3A 3LLAA 3IDBA 3PY1A 2R9SA 4QQTA 1ZOHA 5EOBA 3GB2A 4F9YA 4ENXA 4G6LA 2BIYA 4RFZA 4HVSA 2OW3A 1R0PA 4YO6A 2ITTA 2UV2A 5M09A 2YCQA 2GHMA 4FKRA 4TW9A 3IGGA 4L68A 3ELJA 4GVAA 3UG1A 5JQ5A 2W99B 5IUIA 1OKZA 3JPVA 4BFMA 2J5EA 3PVBA 3ZLSA 3NFGB 4D1ZA 4Q5EA 2UUEA 5KHXA 5E1SA 3R7UA 3VUIA 2JLDA 4BI0A 2VTAA 2B53A 3ENMA 4JIKA 2HWPA 3TZMA 4TYJA 4E20A 2NRUA 4A9SA 2XNEA 4FGRA 4ACHA 1OIUA 5C9CA 3FZTA 5IH6A 4C3FA 5DA3A 1OKVA 5M55A 4EOJA 1H07A 3ZM4A 4N6ZA 5D9HA 3VS2A 4FTCA 4ANNA 5LVMA 1ERKA 3GUBA 3WILA 4OTGA 1ZYSA 2GFSA 3BYOA 4E3CA 3QQLA 4M14A 4ACDA 4IB3A 2I6LA 4FEQA 4R3PA 1YI4A 3O5AA 2FH9A 2JD5A 1OBGA 3ZSGA 1OVEA 2VRXA 4FKOA 4ZJIA 5TOZA 2ERKA 3T3VA 4D4RA 2XANA 5K0KA 4RWKA 4YJSA 4ERKA 4IWQA 5DLSA 5FGKA 3E5AA 4WD5A 4CZTA 4HVGA 2QOLA 5L6OA 3ZUUA 4QPSA 2ZV2A 1ZY5A 2RFEA 3EHAA 4MCVA 4RLLA 3RWPA 4CLIA 4FIJA 1IA8A 1UWJA 2GTMA 3F2AA 3FZSA 3MPMA 3DLZA 4RX8A 3SW4A 3QCQA 3ZYAA 4D9UA 2I0EA 4K2RA 3EN7A 4O0VA 4F9CA 4OLIA 3FYKX 3T9IA 4DTAA 3DT1A 3DDPA 3I60A 1JSVA 1H1WA 1J1CA 3OWLA 1YDSE 3FLWA 3KY2A 5IA0A 3TTJA 4IBMA 1H01A 4F08A 5FBOA 3BLAA 4O82A 5J5TA 3VUTA 3E93A 3F3ZA 3H9OA 3I6UA 3ORPA 2C5OA 1W82A 4ANMA 5CF5A 4RC3A 3QQFA 5JMSA 1U54A 3BV2A 3FI4A 2IVTA 2ZDTA 3E8EA 1JLUE 3VAPA 4FC0A 4LYNA 2R3KA 2X81A 4BTFA 5FD2A 5HCXA 1ST0A 1YQJA 4WRSA 4UBAA 1UA2A 3W2QA 2YABA 4I4FA 3KULB 4QP8A 3FHRA 3RGFA 4LUEA 4NUSA 4RJ5A 4YNOA 2UW3A 2YIQA 4FZFB 4RX9A 2GPHA 3VW6A 3WARA 4AGWA 4EWQA 2PUNA 3F5UA 5EH0A 2EWAA 3TIZA 3EQIA 1QPDA 3D5UA 5AEPA 5CU0A 4I6QA 3A60A 4JT3A 4BIBA 5K5NA 2NP8A 4II5A 5BV3A 4QDEA 2XK8A 5AR2A 1F5QA 3TMOA 4O0SA 3EQPA 3R1QA 3UVQA 4PTEA 3E7OA 3GVUA 3ZZWA 4J71A 2PYWA 2A1AB 3SXRA 1H26A 3G5DA 4BCNA 1UNGA 2VTLA 3VF9A 2AUHA 3MH3A 1M52A 5LVNA 2R3NA 3QTUA 4NIFA 4JAIA 3DKFA 3W2PA 4XMOA 4L00A 1XH4A 2W4OA 1M2PA 3KRJA 5CZIA 4L01A 1BLXA 5DWRA 3EL8A 5J1WA 2NYAA 2OIQA 3A7FA 4AUAA 2BKKA 2QKRA 5J95A 3QRJA 4EK8A 3LLTA 4C0TA 4KKEA 4QP7A 3TNIA 1H8FA 1IAJA 3ERKA 2RG5A 5F94A 2Y9QA 5CWZA 2CGXA 2PZ5A 4O7YA 2OIDA 4FF8A 4RX7A 1S9IA 4I0TA 1WBOA 4U9AA 4ZSGA 4BDKA 5FDXA 3JR1A 2OXXA 4RJ3A 1T46A 3R1YA 3JVRA 2XNGA 4PWNA 4O6LA 3PP1A 4QMWA 4ANSA 2YJSA 3FMHA 4FV6A 3QTWA 3VUKA 4O4DA 5JGDA 5M4IA 2ZB1A 3O71A 3WI6A 4CFNA 2J0JA 1GAGA 1P2AA 1WBTA 2WTDA 3F6XA 3OEZA 5H2UA 4HVDA 4M69A 1WVXA 5JFWA 4AACA 2IF8A 2WFYA 3CD3A 3L9MA 5DGZA 2ONLC 2QLQA 4U81A 4JMQA 3Q6WA 4CSVA 3VBTA 2CNVA 2C6EA 5AFVA 4MXAA 2R4BA 3PJ1A 3ORLA 5DH3A 3WYXA 4D2PA 4IFGA 2BRGA 3CR0A 4KBAA 2WKMA 3LCTA 1OZ1A 4FG7A 1Q97A 2WQBA 3UZTA 3U54A 3FXZA 4MXXA 5EKOA 2QU6A 4FI1A 4ZSJA 3A7HA 3AC1A 3UQGA 1G3NA 1Q8UA 3CTJA 4RFYA 5FTOA 4BZNA 3PPKA 4QTAA 4V05A 5AP4A 3UOKA 4HZRA 5AAFA 2QO9A 3V5QA 3BL7A 1SM2A 3G6HA 3L8SA 3R28A 4AT5A 3ZLWA 3MB6A 2YACA 3Q2MA 4MEDA 2AYPA 3Q60A 4JDKA 3UTOA 1OL2A 4DFLA 4DT9A 1J7UA 3QUPA 3COMA 5CEMA 4EOPA 2IN6A 3B2TA 3OWJA 4EZ7A 3OF0A 3KCKA 3KXXA 4NU1A 2NRYA 4ANLA 2RFDA 4LOQA 3S2PA 5HBEA 4PMTA 5HD4A 1BL6A 1V0PA 2IVUA 5DIAA 1YXUA 3MH1A 3VWAA 3NIZA 2VWBA 2XJ2A 2JDVA 3CGOA 3O0GA 4HNIA 4WNPA 5CQUA 4QMZA 4XG2A 3PWYA 4S2ZA 2VX3A 3OBJA 4CFXA 1PXJA 2JAMA 4FGBA 4BVUA 4OTWA 2IZUA 4AFEA 2J2IB 2PZIA 3BRBA 2WOUA 2DUVA 3RINA 2Z7LA 3AC4A 5EW8A 3PRFA 4GL9A 3AGMA 4XLVA 4KBKA 3F3UA 2IVSA 3NUPA 1OIQA 4JG6A 2DQ7X 3O2MA 3G9LX 3KEXA 5IQGA 3K5VA 2H8HA 3NAYA 5B0XA 4ZEGA 3UQFA 4I21A 3H0YA 2BHHA 4ZSAA 3K3IA 2X7FA 4ZZNA 2W1CA 4AAYA 3DNDA 3E8NA 1BKXA 1JSUA 3KGAA 1R0EA 3R00A 3UVPA 3PA5A 3R9OA 4TN6A 4RC4A 5L2QA 1FMKA 3VRYA 4BRXA 1JKLA 2V7AA 3I4BA 4X3FA 3RKBA 1DM2A 4RWIA 2BTRA 1YXSA 5HO8A 4A7CA 3BYSA 2KTYA 3OT8A 4CZUA 2AC5A 4X21A 4WUNA 3OCTA 3PJ8A 4UMPA 2OIBA 1H1PA 3FL5A 4W4XA 5IZFA 1NVQA 4EOMA 2X0PA 5TT7A 5JFVA 1EH4A 1SVHA 4I24A 4W8DA 2WNTA 2YERA 3QAME 5F4NA 3OC1A 2CGUA 1XR1A 4FSTA 3KXMA 3SRVA 4YUQA 1UV5A 4FKLA 2WTWA 3SHEA 4CKIA 3QRIA 2A27A 3D7TB 4G3EA 3FJQE 3ZO4A 1I44A 2BZHB 3MY1A 4U42A 4YC6A 4DFYA 2X9EA 5A4QA 3COKA 5FEDA 3NFFB 4UN0C 5HX8A 3BHHA 2Z7QA 2R3HA 5KKRC 4N4SA 1WBNA 2PUPA 4TT7A 4NTSA 4AOTA 2ZMDA 5KMMA 4H1JA 3PXYA 2UW0A 2PE2A 3LFBA 5DN3A 1J7LA 3PIXA 4IWOA 2YITA 2F7XE 1SNUA 2JFMA 3TNQB 3VIDA 2BROA 3WF9A 4C7TA 4F6WA 5M56A 3QQUA 2PSQA 4YMJA 5LWMA 2XKEA 1BX6A 4KD1A 2PHKA 3O8TA 4RA5A 1ZWSA 4K8AA 1H0VA 4UXQA 4B9DA 1QCFA 2OKRA 3P7CA 4DFXE 1GOLA 2UZDA 4GCJA 4FK3A 4ZP5A 3VVHA 1URWA 3PZHA 5ANKA 4JR7A 4O7WA 4XV2A 3O8PA 4FZ7A 4LRMA 3HUBA 4JL9A 1FVVA 4UEUA 4DTKA 2H6DA 2WMAA 2ZOQA 2Y0AA 3G6GA 4HGEA 3PPJA 4D1SA 2P2HA 4J8MA 2VUWA 2BFXA 5FXRA 4O7NA 3FZRA 4MD8E 3GC7A 3U6HA 4KIQA 2VGOA 1BI7A 3GCQA 2PMLX 4XG6A 5BVNA 4IE9A 3GP0A 3RZFA 3F5XA 3QTXA 5EK7A 4Q9ZA 2WOTA 4R7IA 1T45A 3LMGA 4IVCA 3FKNA 3V04A 5AV2A 3RNYA 4WOVA 5DFPA 5DT0A 4GUBA 3KRLA 4MD7E 4D0XA 5EHYA 1GZKA 3U4WA 4DC2A 5A54A 5AR3A 2OF2A 2QOFA 4JDJA 2YLFA 2UZOA 5GJDA 4MWHA 4RGJA 4IZYA 5IU2A 5CVFA 2OWBA 5CAPA 2JDTA 4WG5A 4YLLA 5AP1A 2YCRA 3AMYA 5J5SA 1H00A 3RCJA 4E1ZA 5EDQA 1IEPA 4NSTA 2OBJA 5E8YA 3Q52A 4PNKA 2P2IA 3RP9A 3MV5A 1KV2A 1JNKA 4MD9E 4YR8A 3OCGA 5A6NA 4GMYA 3ZUVA 3W2OA 3D5XA 3P86A 3R7OA 5LVPA 2OJGA 3LJ2A 2I1MA 3Q5ZA 4FT9A 4AN2A 4EOKA 2W1HA 3K54A 3NYOA 3GT8A 1U5QA 4MNEA 4RZVA 4XH6A 4IACA 4FKQA 3NSZA 5CVGA 5D1JA 1LP4A 3NUNA 3FPQA 4MK0A 3DB6A 2VN9A 1WVYA 4RVMA 4LI5A 5D41A 3KB7A 3AT2A 5M07A 5DE2A 3W55A 4BYJA 3A61A 4F0GA 2J6MA 3LAUA 3U6JA 4ERWA 1YXXA 4GVJA 1A06A 4Y73A 3TIYA 4FYOA 4BCHA 1R78A 4CEGA 5F95A 3Q9YA 4QP2A 4DH3A 4C4GA 1KE5A 4I5HA 2C1AA 4FTMA 1W0XC 4FVPA 4P7EA 2QNJA 3EQGA 3OW3A 4LOPA 4RJ7A 1KE9A 3QD3A 2BZIB 3WYYA 3EOCA 3RPVA 2C6TA 3LIJA 3VNTA 4F9BA 4V0GB 4C57A 5DT3A 4EJ7A 3ORNA 3TKHA 4O4EA 3WF7A 3DJ5A 2RFNA 2WMSA 4FKWA 4I6FA 3MVMA 3R9NA 3CGFA 2X6EA 4EK4A 3KA0A 2F9GA 3FMDA 3W16A 3BHTA 2OH0E 3N4UA 3ML1A 1VYZA 2J5FA 3NW5A 3GQLA 4YZDA 4GJ2A 4DINA 4F70A 2GDOA 4GK3A 1YXVA 4XCUA 2GNGA 3EWHA 2WTCA 2Z8CA 3KXZA 4OTQA 2VAGA 4BHZA 4GG5A 4QMUA 5E92A 3PSDA 2WMWA 2R3JA 4JLCA 4XP3A 4EK3A 5IEXA 3PXZA 2OO8X 4Q9SA 3QX2A 3ORXA 2Z2WA 5AWMA 2I0VA 4ZZMA 4Z7HA 3TUBA 2WD1A 3HA8A 5AP7A 4O2ZA 4FTRA 4RIWB 2Y6MA 5A9UA 1OGUA 2WQNA 2VX0A 5AAEA 1E1XA 4R3RA 2VTOA 2XP2A 3FMNA 4FX3A 4RPVA 3R7IA 5FDPA 5KMIA 3TV4A 5D7VA 4PPBA 4NCTA 3GU6A 2XNMA 2UVXA 4TRLA 5JSMA 3UIMA 3BU3A 1UU8A 3EZRA 3IO7A 3Q3BA 4BGGA 1RW8A 2AQXA 4EH7A 2BR1A 4AOJA 4E73A 2R7IA 3L1SA 3QL8A 4O83A 2HZIA 4DGMA 1OUYA 5HVYA 3FMEA 3MJ2A 3ZRLA 1W2DA 3R01A 5EQPA 4HYHA 4H3PA 4BB4A 1YI6A 1YI3A 1Q8YA 2XARA 2WMTA 4CG8A 3DK7A 2C47A 3TWJA 4ITHA 2G15A 4XOYA 4ZTQA 2G01A 2C0OA 4QMNA 3I7BA 3E64A 4X3JA 3HV6A 3RNIA 4MKCA 5FM3A 3ATTA 3AQVA 4ITJA 4BIEA 3HKOA 2RGPA 3TNHA 3H3CA 3E3BX 5DRDA 3VUMA 4MYGA 1H1SA 4B7TA 1FVRA 4FKSA 3R7GA 2O8YA 1XMMA 4MAOA 3P7AA 1P14A 2YISA 3ALNA 4X3FC 2ZB0A 4NJ3A 4R5YA 3GEQA 1CKIA 2PVHA 5JGAA 1IA9A 4ZLZA 1Z57A 2F57A 4FJVA 3PVUA 1RJBA 3BYUA 3F3VA 3P4KA 4PDPA 3BKBA 4Z9LA 4KRDA 3MESA 3C0GA 2ETKA 1ZLTA 3Q32A 5HU9A 4CD0A 3PLSA 3R2BA 2PL0A 1CKJA 2WO6A 4M15A 5H8GA 2BAJA 1Q8ZA 3R8PA 2QOBA 4H36A 2O5KA 5DR9A 3B8QA 5IMXA 2C6LA 4PP7A 5D10A 3PE2A 3NW7A 1AGWA 2WTKC 4WNKA 4LL5A 2RIOA 2ITUA 3LCKA 2OZAB 4LMUA 2XIRA 1Y8GA 5DYJA 5LMBA 2JKQA 5TKDA 3SG9A 4BHNA 2VWIA 2VO3A 4BF2A 1PW2A 4IADA 3EQCA 1GNGA 5J9ZA 2EXCX 2XRUA 3P79A 4X2NA 2VZ6A 3PIZA 1O6LA 3E88A 3PTGA 5EYDA 3RPSA 3KXHA 3UGCA 4BKZA 4UMUA 2ZMCA 2YIXA 4LRJA 2F2UA 3ZDIA 5B2KA 4K1BA 4UZHA 4D2TA 2NPQA 4R8QA 5GIPE 4UYAA 2X0GA 3SLSA 2FSOX 2G1TA 4QMTA 3WZEA 1ZOEA 3ZXTA 3P7BA 5M53A 5AJQA 5G6VA 4ACCA 3NYNA 3DBFA 2OICA 3HLLA 5CSXA 2C6KA 4XP2A 5HE2A 1NW1A 3LXPA 4JQ8A 2VTIA 3A2CA 1PYXA 4E6CA 2VD5A 5FG8A 5IA3A 5L8LA 2IZSA 2YM7A 1HCKA 2OXDA 5LVLA 1Y91A 4J1RA 4R1YA 4NM3A 2C5NA 1JKTA 2GNIA 5BUIA 3TTIA 4I6BA 2UW6A 3GXLA 4AG8A 3C4ZA 3ZC5A 3HP2A 4L8MA 1OL5A 3KQ7A 3PZEA 2BMCA 1M7NA 3EQHA 4NK9A 2FVDA 3TNPC 2W1GA 4TYHB 1O9UA 4BDDA 2R3LA 5HE0A 2IZRA 4BBMA 3TM0A 2CMWA 3QYZA 2QOIA 3F66A 4GU9A 4JIAA 4WO5A 2R2PA 3VUGA 4MHAA 3VJOA 2B0QA 4I6LA 3CBLA 4AXFA 4DCAA 4MBLA 1VZOA 3ZSHA 3GCVA 1MQBA 5DHJA 3LMHA 2ITNA 3EQBA 3Q4CA 4I0RA 5I9XA 2XF0A 3R9DA 3EN9A 1PMVA 4YGAA 4EWHA 3GC9A 3NNUA 5IDPA 3U87A 1K3AA 3FLQA 4NEUA 1TQMA 3WE8A 3DOGA 4PPCA 4WIHA 3FHIA 5TF9A 2EU9A 3DBQA 2G2HA 4RG0A 4AE9A 4QEBA 3QYWA 3GCPA 3NWWA 2BIKB 3F7WA 4EK6A 3OFM