4FOBA

Crystal structure of human anaplastic lymphoma kinase in complex with acyliminobenzimidazole inhibitor 1
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
310
structure length
295
Chain Sequence
NPNYSFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/inhibitor
molecule keywords ALK tyrosine kinase receptor
publication title The Discovery and Optimization of a Novel Class of Potent, Selective, and Orally Bioavailable Anaplastic Lymphoma Kinase (ALK) Inhibitors with Potential Utility for the Treatment of Cancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 295
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fobA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fobA01
4YJRA 4EOQA 4EWQA 2WMAA 3JY9A 3WZJA 3HZTA 3F5PA 4NK9A 5BYZA 3L9PA 4U0IA 5K3YA 3OCGA 4LV5A 1ZYCA 4XNEA 2JLDA 4FV6A 4OTPA 4D5HA 4L53A 4S33A 3UIMA 3FE3A 4KIPA 4NFMA 4YJQA 5HVYA 4TNBA 1Y8YA 3P08A 3UVPA 3QQGA 4FK3A 3LCSA 3MVLA 2A4LA 5IMEA 4IHPA 1XBBA 5AUTA 1GIJA 3LM0A 3V8TA 4AE6A 4RA4A 5HE0A 3MY1A 2HYYA 4U9AA 4CEGA 2O64A 4CZYB 5AAEA 4K8AA 3TKUA 4LOPA 3PDTA 3RJCA 4GV1A 2UW8A 4J1RA 3LIJA 3OCTA 4HGSA 3P1AA 5DT0A 5HCXA 3LQ5A 3WE4A 4EOMA 5M56A 5FEQA 3OUNB 2ACXA 3S0OA 2ITXA 5D11A 4CD0A 3ZEWA 2OBJA 4ZZOA 2YDKA 4PWNA 4QMUA 2HAKA 4QMXA 2WKMA 5HE2A 2CGXA 4KIKA 4Y85A 4ZSGA 4E4NA 1WVYA 4MF0A 4V0GA 4D1XA 4UYNA 3C0GA 3FLWA 3FLQA 5EI8A 4E3CA 3ZO3A 2XM8A 1BLXA 1P5EA 4AQCA 3LFSA 3PVGA 4MXYA 5EYDA 1XO2B 3EFLA 1O6LA 2R4BA 4QP4A 3CEKA 3HAMA 3HEGA 5AV2A 1XH5A 3DZOA 2C5XA 4H36A 2WNTA 3AD6A 3PE1A 4WT6A 3G6HA 4C2VA 3BGZA 4GIHA 3PXQA 5LMKA 2W17A 5FD2A 3HA6A 4BCPA 4Z55A 3GXLA 3ORNA 3BX5A 3BV3A 4IAFA 1Q8UA 2R2PA 3NDMA 2OG8A 4ORKA 3MSSA 2ZM4A 3HRFA 2WQBA 4G5PA 4PX6A 5B0XA 3A8WA 4DH3A 5I9YA 4Y46A 2A0CX 2R3JA 4ONAA 4DFLA 2WAJA 3O51A 4HNFA 3PUPA 4L7FA 2WO6A 3PYYA 2ITQA 4M13A 4D0WA 2GQRA 3LHJA 2X6EA 4UYAA 2OIQA 3QX4A 4IMYA 4JOAA 1YVJA 4QMWA 2J7TA 2WMUA 2GDOA 2WU7A 3S2PA 4MYGA 2YJRA 2X8IA 4QMYA 4B8LA 4O21A 3C0HA 3I79A 1UNLA 4GUBA 3ALNA 3PXRA 4G3FA 4YJSA 1OL1A 3TZ7A 4L44A 3ACKA 4RIWA 4FSWA 3TIZA 3MI9A 1VR2A 5J9LA 2XKDA 4MK0A 4TWCA 3LXLA 3C5UA 1NY3A 4FEQA 3BQCA 2VTIA 3EFWA 3PZHA 3FXWA 1SVHA 1RE8A 1OPJA 3QTIA 3R9DA 3ORPA 5HX8A 1Q24A 5IG1A 4IX4A 3PA3A 4XP0A 4YZBA 5EM7A 3OOGA 2X6DA 4KAOA 4L3LA 4RRVA 1VYWA 3ANRA 3F5XA 3ZRLA 4KB8A 4DLJA 4Y83A 4FKTA 3BWJA 5E8VA 1Q8ZA 2WTWA 4AOTA 3PA4A 2OJGA 5DA3A 2X1NA 5CAQA 1APME 5AP4A 3VHEA 3NYXA 4EHGA 4ERKA 1PMVA 1HCKA 4PPBA 3OS3A 3FKLA 1JPAA 2WMVA 1WBVA 2IW6A 5AR3A 3BYMA 3NGAA 4EH9A 4UWYA 5M44A 4AZFA 1JSVA 2VWIA 2WIHA 4QMPA 4AGWA 4Z7HA 3Q52A 4PRJA 3BYSA 3FY0A 5BVFA 4RGJA 1L3RE 4D2VA 2B4SB 4YTHA 5EHLA 3PG1A 3EMGA 3WIKA 5BNJA 1VYZA 2CDZA 2X0GA 2VWVA 2W9ZB 4BI2A 3DBEA 3PPJA 2VD5A 2PL0A 2XYUA 4AE9A 5IQDA 5BUEA 5DNRA 4BCGA 2CSNA 3SXFA 4EOJA 5CVFA 2HK5A 4MHAA 4YBJA 3BU6A 4EOPA 4F1MA 4FTRA 5EYCA 1V0OA 2VO7A 5AIKA 2YM5A 2H8HA 2DQ7X 2PVHA 4RIYB 3UZPA 1Q99A 1YW2A 3Q9ZA 4EBVA 4P2KA 2QD9A 5I5ZA 4F63A 2CLQA 4RJ4A 1FOTA 4XBUA 3T9TA 5CU2A 2R3PA 5M4FA 4BKZA 2CN5A 2WMRA 4AA4A 2QOBA 2QURA 2YM7A 3O8PA 4OTRA 3VIDA 1YXXA 3HP5A 4G9CA 3ZBXA 5AM6A 3ZO4A 1OUKA 4ID7A 4AXAA 4DEHA 4G6LA 2W5HA 1BX6A 3PIZA 2PYWA 3R2BA 3KXNA 3T9IA 5A4QA 4HVSA 3OFMA 4QO9A 4E20A 5C01A 3LXKA 3FSKA 3LZBA 5L8LA 4KBKA 4CZTA 4JBOA 5FTOA 4YJVA 2QLUA 4JI9A 2BAJA 3HECA 4MNEB 5E8UA 3ENMA 1ZMVA 4IFCA 3GCUA 3AMAA 4O0SA 4XG6A 5D10A 4PDPA 4LGDA 3MVMA 4CFFA 4EEVA 4FSNA 1ZYLA 4FZ6A 2QCSA 3O50A 3PIYA 4QP2A 4CKRA 4L3PA 4XLIA 3MWUA 4GT4A 5H9BA 2W5BA 3R8LA 3QCYA 2CKOA 1F5QA 4MKCA 3BGQA 2ZAZA 1YQJA 3PRIA 2OO8X 2PE0A 4D4RA 4BC6A 3E7VA 3FDNA 4YMJA 3SHEA 2C3JA 3IDPA 4O7LA 4DYMA 2P33A 3KN5A 1OVEA 2XNNA 5AV0A 4YSJA 1IA8A 2ITPA 2BDFA 3CS9A 4RX7A 5AR4A 5F94A 3R7IA 4QPSA 5L8KA 3IW4A 4BDIA 4EK5A 2JAVA 4G3CA 2J6MA 2C6OA 5LXMA 3MJ1A 4CRSA 3Q9YA 4PMTA 3R8PA 2E9PA 2FSOX 4KIQA 3NX8A 1SNXA 4FICA 5FUTA 4FVRA 3RVGA 2B9HA 2YLEA 3GI3A 3PXZA 3UVRA 1H1QA 4GL9A 3NMUF 2QKWB 3JVRA 4UZHA 3SX9A 2CHLA 3TUDA 3E93A 4DT8A 4KUJA 2EXMA 3ORMA 2OFVA 1BL6A 2UZNA 5FRIA 2R3RA 4EI4A 5CNOA 4GFOA 4X3JA 4USFA 5HG5A 4YLLA 4IVDA 3ORZA 4HGEA 4XV1A 4XRJA 4CMUA 2JBOA 2RFSA 3QTSA 3ODZX 4MWHA 3EN7A 5FBOA 3RM7A 5IISA 2XRUA 4FVPA 4IADA 3UC3A 3DK7A 3QGWA 2XBJA 3MY5A 4EOOA 3FI4A 3QYWA 3QTZA 3VF9A 1J91A 1KWPA 5ANEA 3UP2A 4FTIA 4I6QA 4IM2A 2BTSA 1M2QA 3GU6A 4J8MA 5KE0A 3GNIB 2J50A 3MESA 3GU7A 3HRBA 5DH3A 3HUBA 4IX6A 3O17A 5JRSA 3BYUA 3ZM9A 2C6TA 4QMTA 4RLLA 2YFXA 2QG7A 1QL6A 4IB1A 4PF4A 2BDWA 5DOSA 3R30A 3ZM4A 4V01A 4DEAA 3DLSA 5CASA 1DI9A 4I22A 3KFAA 4D4YA 4IZ7A 4EKKA 1YWRA 2OGVA 4DG3E 4BGGA 5AAFA 5JMSA 1UU8A 3HYHA 3KMMA 2XA4A 4TTHB 2HXLA 2BRBA 2FUMA 3IDBA 4RIXB 4W9WA 2RF9A 4ZTNA 4EYMA 5GZ8A 3FI8A 5KMKA 3NR9A 4ZY4A 2J9MA 3F5UA 3OWPA 4W4VA 4II5A 5I9VA 3UYSA 4YNOA 4NW5A 2YCFA 4IVBA 3GC7A 2ZMDA 2BDJA 4AF3A 4YURA 1NW1A 3ZZEA 4ACGA 5HQ0A 3O23A 4ZLYA 5B2KA 4EHEA 1UWHA 4GU9A 3SDJA 3VJOA 4CCBA 4CFVA 3ORTA 4FG9A 5CAUA 3U6HA 1WBSA 4FEUA 4QYGA 2VTAA 1H25A 2EVAA 4XG4A 5CAPA 4FIEA 4ZP5A 4ACDA 4BZNA 2Q0BA 2UZTA 3RNYA 3ZTXA 3V01A 3AMBA 3LFDA 1XWSA 4CQEA 3FMHA 3QXPA 4FV4A 4BIDA 3FSFA 4KA3A 3HLLA 4EK4A 2G2FA 3V8SA 3R1SA 3IS5A 3OXZA 1J1CA 5IA5A 3S4QA 4O7YA 5CF4A 4U44A 2VZ6A 5EW3A 4FGBA 2C68A 3IOKA 3D83A 3ODYX 3VUTA 4H05A 5CF5A 4QMLA 4FKGA 2V62A 4QNAA 3Q4ZA 2RFNA 1UKHA 4FMQA 1OPKA 4FNXA 5IA0A 4TYEA 2IVVA 1FVTA 1IEPA 3DDQA 4W9XA 4XLVA 3VUHA 3F2NA 3KULA 2GHMA 4WG5A 3TNQB 3U6IA 4I0TA 1DAWA 4JBQA 3QRJA 2REIA 1OI9A 1OL6A 3U8WA 3OW4A 5D12A 1L8TA 5CZHA 4QQJA 4N4SA 1WBNA 3IGGA 2ZYBA 3VWAA 5LVMA 4I4FA 2PZIA 4G5JA 1G3NA 4YUQA 3EJ1A 4HNIA 5AA8A 1Q4LA 5JKGA 4MBJA 5IQGA 4UALA 2CPKE 2X2KA 3JVSA 3UMWA 3VQHA 2OH0E 2QI8A 3ZRKA 3NAYA 1KUTA 4J96A 5A4LA 2R7IA 2J90A 4Y8DA 3WIGA 4AGCA 1MQBA 5J87A 5KKRB 2WTJA 3RAWA 5DR9A 5I0BA 5GJGA 2W1DA 3JXWA 4QP7A 5HOAA 3LOKA 1SYKA 1R78A 4FEVA 3QCXA 2XBAA 1QPJA 2W0JA 1PXIA 3RINA 2YISA 5A54A 3UDBA 2CJMA 1Z5MA 2QOKA 4LM5A 3UOKA 4R7BA 2XIXA 4M69A 3KXGA 3FY2A 4MAOA 5HG7A 4ANOA 3KF4A 4JRVA 1NVSA 2QQ7A 4JBVA 4WNKA 3NW6A 3LMGA 4EWHA 4IX3A 3FJQE 4PP9A 4IW0A 1IG1A 1M7QA 4FV0A 3VHKA 4I4EA 3NUUA 5F9EA 5EQEA 4IBMA 5EM5A 4BHNA 2WMQA 3AC1A 4RSSA 3V04A 3NUPA 2IZUA 2XNOA 5ANJA 4YU2A 2XK8A 1ZOHA 3KEXA 3HKOA 1YWVA 3UODA 5JFXA 5DE2A 3F3VA 3LVPA 3ZZWA 4QRCA 1XR1A 1YXVA 4GYGA 4BCIA 5CU4A 3N4UA 1XBAA 2Z2WA 4IC8A 5J7HA 2O5KA 4FZ7A 3I7BA 3MFTA 5CQWA 2JDVA 5HLWA 5CTPA 1SM2A 3Q6UA 4FIFA 4P90A 4B6LA 3C4CA 1ZOEA 2BR1A 2OZAA 4H39A 3IW5A 4GS6A 4BI1A 3F66A 4AOIA 4P4CA 3GOPA 4UB7A 4YJNA 2VTTA 3ELJA 3VBWA 4FK6A 3ZH8A 4CLIA 3TUCA 4E6AA 4O7SA 4FTKA 2BKZA 1UU3A 2UZVA 4EZ7A 4RFYA 5HU3A 4FTTA 5T6KA 4X3FA 4MVFA 3FYJX 4MQ1A 4XG7A 5J5SA 4O1PA 3QD2B 1TQPA 4JG8A 3BHYA 1R0PA 2BALA 4A07A 3EIDA 3KREA 5K4IA 2Y7JA 3COIA 4QTAA 4BZOA 5JT2A 4BBFA 4QMZA 4Q5HA 4XP2A 5CWZA 1IR3A 4I6FA 4MXXA 4A7CA 4C4HA 4RVTA 4JG6A 3BBTB 3EQFA 4U97A 3W33A 3P0MA 4UEUA 4O81A 1GZKA 5AWMA 2GU8A 4E6QA 4ZIMA 4MNFA 1T45A 4FKJA 4I92A 4TYJA 5HO7A 4RJ8A 5CI7A 3TEIA 1ZYDA 5GZAA 4IAZA 4GFMA 5CEIA 3KC3A 4A9SA 3FV8A 4S32A 2GNHA 4HVIA 4WKQA 1OKWA 2OJFE 2WQNA 2QOCA 3QZIA 4U8ZA 5JGBA 4J52A 5LOHA 5AUUA 4ZS4A 2WIPA 5AAGA 2A27A 2GS2A 3FI3A 5HESA 2XIYA 4FTQA 3R83A 3V5QA 3TZMA 4EH7A 4F4PA 4MH7A 3TNPC 1H1RA 4DA5A 3PFQA 2VTJA 4PMPA 4JLCA 2FSLX 4UZDA 4EHVA 4YTIA 1J7LA 4CTBA 3EQBA 3U9NA 4FE2A 4YHFA 4DLIA 4MXCA 3UNKA 4EJ7A 1WAKA 5IH5A 5AUWA 4RC2A 4AAAA 1H4LA 3FZRA 3KGAA 4D55A 3FC1X 4E4LA 3F82A 1UWJA 3NPCA 4ZXTA 3DXNA 3ITZA 4MF1A 4WIHA 3QYZA 3DA6A 5BVOA 4CFWA 1B6CB 2F9GA 3FZ1A 3LKMA 5HEZA 3DGKA 3TNWA 3VF8A 5BMSA 2XK6A 4GU6A 3WF9A 4FV2A 5AADA 3NYNA 3QUPA 2PZPA 4I94A 4KS8A 3ZO2A 4UMPA 2CKPA 1JVPP 1E1XA 4FSRA 3F5GA 4TW9A 4ENXA 5M4CA 3MH1A 3UOJA 4F9AA 3PJ3A 4FEXA 4FIHA 1OKVA 3GCPA 3OTUA 2WFYA 5HICA 1CSNA 2XKFA 2R7BA 5C9CA 4F65A 5AP2A 4C57A 2C6LA 4Y95A 4R5SA 1OPLA 3ERKA 4GKHA 2W1CA 5H8BA 2NRYA 2ZVAA 4RT7A 3V8WA 3R9OA 1ZXEA 2QO7A 4Z3VA 3RBWA 3Q9XA 5IZFA 3N4VA 5GNKA 4FYNA 4JRNA 4CG8A 3R8UA 4ASXA 5LMAA 5E92A 3M1SA 4TWPA 3VS1A 4JG7A 3DBDA 2VAGA 4NJDA 3Q04A 4ZY6A 2JKOA 3EQPA 4ALVA 3SOAA 3WZDA 4BFMA 4MBIA 3M42A 3NEWA 3ZCLA 5KO1A 4L00A 1M2RA 2WTDA 3OMVA 3QALE 1U5RA 3OUKA 1QPDA 5KX8A 3GFWA 1BL7A 4FZFB 3CJFA 4IVAA 2HW7A 3GCVA 5IA1A 4R8QA 3HDNA 5FTQA 3RHXA 4YZCA 3F61A 1R3CA 2PVNA 2VTNA 2XB7A 5C8MA 3AQVA 2J51A 3KQ7A 3PPZA 3QLFA 4OTHA 4CXAA 3MS9A 5KMNA 3QKMA 4XG9A 5A4CA 4BDAA 3IPHA 1S9JA 4K9YA 5KZIA 3RAHA 4FVQA 2C0TA 5LMBA 3V5PA 2B7AA 4MXAA 1SVEA 3GQLA 1ZY4A 2YZLA 5CSHA 3BEAA 4F6UA 4JR3A 4FV5A 2BIYA 4CYJA 1H27A 4YP8A 3R9NA 3C50A 4Z9LA 4M12A 1UKIA 2NPQA 2R3IA 5E7RA 3ZSIA 4IB3A 5IMXA 3GC8A 2PTKA 5FG8A 3ID6C 1OITA 5J9YA 4C33A 3QWJA 5DEWA 2BPMA 4N0SA 4BDFA 3E8CA 2ERZE 4IIRA 4M66A 2NP8A 3A4PA 4PPAA 3AD5A 3BLHA 3P5KA 4FV3A 5DRDA 2ZMCA 3KMWA 2GNFA 5I9ZA 2UW5A 2A1AB 3DKOA 3FZOA 3A4OX 4LMNA 2VTSA 4LGHA 3TKIA 3U9CA 3LCTA 4FODA 4ALUA 5BVKA 3KK8A 5AP1A 3WILA 4GSBA 2JGZA 5H8EA 5IQAA 4AOJA 4XOZA 3RNIA 3G0EA 3QBNA 4WNOA 2ERKA 4YBKA 2PE2A 5FGKA 2HWPA 2FA2A 3Q2MA 2GNGA 5TT7A 1H28A 5B2LA 2C69A 1PXJA 4RWLA 4FSUA 3LLAA 1M14A 2G2IA 2YIYA 3Q32A 2J5EA 3GQIA 3PZEA 2XNMA 4KRCA 4D2RA 3KMUA 4FTCA 4DFBA 3UGCA 1OIQA 4BDHA 2GQSA 5IDNA 5AFVA 5E9EA 3KULB 3D9VA 3P23A 4J98A 1B38A 4FTMA 1K9AA 4YJTA 5ANIA 5AUVA 4TXCA 4BB4A 2H96A 3G9LX 3BZ3A 4IZ5A 3A99A 3NNVA 3I5ZA 3UPXA 4ZOGA 1LEWA 2I0VA 3NUNA 4X7QA 4F9BA 5HTBA 5IUHA 1K2PA 2WMXA 4X21A 4FKVA 5A9UA 2GHLA 3RPSA 3FLNC 2F7EE 4Q2AA 1YXTA 2JKMA 4L42A 3QKLA 5HCZA 3RPRA 4EH2A 1YDRE 5J7BA 3U4WA 4D2WA 5J5TA 3BLQA 3ZC6A 1VJYA 3QQUA 5HE3A 5HKMA 4I6HA 3QC4A 4O0YA 2B0QA 2VWXA 1Q41A 2VTQA 4O38A 3MH2A 4RWIA 4U3ZA 3NLBA 3T3UA 5JSMA 2B55A 4BYJA 3KXHA 3E64A 3LFBA 4O2ZA 3ATTA 5EFQA 2E9OA 3T3VA 4GVJA 3SXRA 3SW7A 3K2LA 3L1SA 2I0EA 4IB0A 3UTOA 4ACMA 3VS6A 3I1AA 3ENHA 1OECA 4XX9A 3ZXTA 2PK9A 2EWAA 1FMKA 3E7OA 3FXXA 3TZ9A 3ZU7A 3DQWA 4UY9A 1OKZA 3DKFA 4J97A 1JLUE 4TZRA 2DWBA 3R1QA 3CQUA 5AR5A 3DK6A 4QP1A 2C3LA 3UPZA 2Z7QA 2WGJA 4BN1A 3CPCA 2BFYA 1XH8A 1XH6A 5HG8A 4FSZA 4OW8A 4FL3A 3V3VA 2ZM3A 3O7LD 3E8NA 3MB6A 5AP3A 1PYXA 2WTKB 3LCKA 1ZWSA 2NO3A 3KN6A 4BWPA 3VBYA 4ZSAA 4H3QA 5EDPA 3FZPA 4DHFA 4EONA 5L6OA 3H4JA 1OZ1A 3TIYA 5M07A 3KRRA 5EHOA 1STCE 4HYHA 2X7GA 5E8ZA 3RTPA 3L8PA 2WB8A 3SA0A 4DG2E 2V5QA 2IZTA 4F99A 4NU1A 3VVHA 4V04A 1IA9A 3HGKA 3M2WA 2Y9QA 3NZ0A 5ACKA 3LFCA 4L52A 1J7UA 5T3QA 3RHKA 2J4ZA 2VWWA 5HBJA 2HELA 3TNIA 2R3FA 4O0TA 4Y5HA 3D2IA 4NKAA 3UO5A 2ETKA 3IG7A 3NNXA 5DVRA 3NS9A 1GIHA 4NW6A 3TG1A 1YDTE 1NT2A 2HZ0A 3HL7A 1HOWA 3QZHA 4F9WA 5L8JA 1OBGA 4EK8A 4O7VA 3U55A 1H0VA 4TNDA 2A19B 4O6LA 5GINE 2BKKA 3TACA 4E93A 2E9UA 5E8XA 4EL9A 4IXPA 4X3FB 2XIRA 5BX0A 3HUCA 3W2CA 4C58A 1A9UA 4M3QA 4OTWA 4U3YA 2WEIA 4G3DA 1Q3WA 4FSYA 2HIWA 1OGUA 4FOCA 4CMTA 1M2PA 5LWMA 4E5AX 2E9VA 4HCVA 4ZSLA 4I5PA 5HHWA 3W16A 4RJ3A 2C6MA 4EQCA 2BUJA 2B54A 4QMOA 2YHVA 4M97A 4NIFB 4FL1A 2GS7A 2VO0A 3DV3A 4I6BA 3ZONA 3FLSA 1CKIA 3NUYA 2CCIA 2DS1A 3SRVA 2EU9A 2JFMA 3N9XA 3HNGA 2BHEA 3E62A 3HP2A 3PRFA 4TYIA 5CEKA 5DWRA 2Z7SA 3CQEA 3GU8A 4C61A 4QTBA 3RMFA 3THBA 3VAPA 5I4NA 1W83A 2BZKB 2WZJA 4IFGA 2BILB 3SC1A 3UG1A 3H3CA 5CU6A 3HMIA 4F0FA 2O0UA 1ZYSA 1URWA 3RPVA 4A4LA 4IAIA 5TOZA 5A4EA 3QRTA 3WF7A 4USDA 5HORA 2Y4PA 1FBNA 4FKUA 3HAVA 3RZBA 1HCLA 4DEEA 5A6OA 2X4FA 3EN4A 3MGYA 3P7AA 1OM1A 4JT3A 3GENA 3ULIA 5F1ZA 3JPVA 4NWMA 2X81A 4YSMA 2CGVA 3G6GA 1J3HA 4BTFA 2WQOA 4ZZNA 4FOBA 4FT5A 4TRLA 2YACA 2HOGA 5KCVA 3EZVA 1QPCA 2VTLA 5LWNA 3DJ5A 4CRLA 2WXVA 1JBPE 4FKRA 4L46A 4D4SA 3ZC5A 3KU2A 4N6ZA 4J8NA 4EKLA 1PMUA 3F88A 4AACA 2CN8A 2BAKA 2YAAA 3TV7A 5CYIA 4E5BA 2HW6A 2W4JA 3RWPA 4NL0A 3RCDA 3RP9A 1U59A 1CDKA 5HBHA 3BCEA 3KRLA 4WO5A 5AP0A 2RGPA 2P2HA 4YJPA 2C6IA 3VUIA 3R7YA 1KOAA 3EQHA 4A06A 5AM7A 3POZA 4QYEA 1LPUA 4DF3A 3SW4A 3LMHA 4QP6A 2W4KA 5DPVA 4BGHA 2IVUA 4O22A 2R9SA 4HYIA 4YJOA 5JK3A 5HBEA 2UZDA 1YOJA 2UW6A 3FAAA 3FMKA 1FVRA 3V6RA 1KE8A 1DI8A 2ITYA 2ZJWA 3ZEPA 4HVDA 2BZIB 3CGFA 4RLKA 3FKOA 5EW9A 1OMWA 5J9ZA 4W4XA 4KKGA 3RPYA 3VS4A 4AS0A 2PU8A 5ANDA 2QC6A 1OB3A 2J0LA 1UA2A 4XV9A 3VNTA 3TDWA 4FKPA 3PY0A 2Z60A 3AMYA 3VUGA 2WTCA 4BKYA 4JJRA 4C38A 3GT8A 4AA0A 4F7NA 4QTEA 5EQYA 2UZUE 1UVRA 2QHNA 3DBCA 3IW6A 4JAIA 3F2RA 3MH3A 3R8ZA 3FZSA 2BTRA 2JDRA 4P5QA 4C59A 5CLPA 1ZZ2A 5LCKA 5IEVA 2PHKA 4CNHA 3VUDA 1YRPA 3WZEA 5EHYA 5DRBA 5CX9A 4GT3A 2R3OA 3ZLWA 5JGDA 5IDPA 3EKNA 4IC7A 3UZTA 5M09A 2BVAA 1I44A 3VS2A 4A9YA 4RMZA 3UIXA 1W84A 3W32A 1Q3DA 2BRHA 2XEZA 2QKRA 3BE2A 4KS7A 3RPOA 3KCKA 1FGIA 3CIKA 4TKSA 5FP6A 1PYEA 3H0YA 3PVUA 2RFDA 3TCPA 4BCHA 4EH3A 3CD8A 3G51A 3O7LB 4DH7A 3R6XA 3A7FA 3FMMA 3DK3A 4NTSA 3VS0A 2XJ1A 5D41A 5FM3A 2HZNA 4FSTA 1M52A 4DTAA 1H1PA 2EXCX 1YOMA 3SAYA 1PXPA 5ETAA 3H0ZA 3OEZA 4OR5A 4UMTA 4KSQA 4WNMA 4CGAA 2R3KA 5HD7A 2VTRA 3HRCA 3W55A 5AEPA 2WMBA 5CT0A 3WE8A 3E92A 2ITOA 3OY3A 3A7HA 1Y57A 2B9IA 3R7EA 5ICPA 2OSCA 4IE9A 4UN0C 4XHKB 2IW9A 4NTTA 2C4GA 5I9UA 2C6DA 3A62A 4FV1A 3BHTA 3QGYA 4TYHA 3VO3A 3ZUUA 4FGRA 4BR3A 3WF6A 3HMOA 4KWPA 1Z9XA 4L6QA 5LVLA 3ROCA 4LMUA 5FP5A 4WRGA 5CT7A 3I4BA 4FV8A 2JFLA 3Q53A 2GSFA 3QX2A 3WF8A 4EOIA 3PSBA 3R0TA 3P7BA 2O3PA 4KABA 3G2FA 4FZDB 2BRGA 3Q5IA 4YC3A 2XKCA 4B99A 4DITA 4F9CA 3A2CA 4R3PA 2C5NA 3MIYA 4O91A 3TJCA 4C62A 3IK3A 3FQHA 3PA5A 4LRJA 5H3QA 3RK5A 5LJJA 2UW7A 4ASZA 5AP5A 5TE0A 2ZOQA 2C6EA 4M14A 3LJ1A 2ONLC 4GVAA 4QMVA 3CTHA 5EM8A 3MW1A 3RWQA 3W8QA 3JY0A 4F08A 4E4XA 3BU5A 3C51A 4MBLA 1YI4A 2VRXA 2VWUA 3HMPA 4CCUA 2Y4IB 3LJ0A 2PUIA 4E6CA 5AA9A 3A7IA 2EB2A 2E2BA 2GMXA 2PZYA 3S95A 4CLJA 4U43A 3VN9A 3OROA 1ERKA 3UC4A 4AZVA 1KE6A 3ET7A 3PTGA 4RZWA 2XM9A 3CC6A 5IUGA 3CD3A 3IOPA 5M08A 3V6SA 3BYVA 4RQVA 1YI6A 2IO6A 4JX3A 2OICA 2XEYA 3E3BX 3FI2A 3HMMA 3Q4UA 1AD5A 5CXZA 2FYSA 1TVOA 3D2KA 4F09A 4YC8A 4FYOA 3PLSA 2GFSA 1Z57A 2PVKA 3ZLYA 1A48A 2PVRA 4ASEA 4FSQA 4Q9SA 3EKKA 3V5LA 3LCOA 4GUEA 3M11A 3F3WA 4X6RA 2XNGA 1H08A 4D2SA 2XIZA 4J71A 5FWKK 5K9IA 4BDGA 2UZBA 2C47A 3NYVA 4KIKB 2G01A 3HA8A 4V0GB 3JS2A 5DT4A 3K54A 3GC9A 4LG4A 1U46A 3LM5A 5L2TA 4GIIA 2Z02A 4AFEA 3MTFA 4APCA 2RG6A 4WG4A 4C4IA 2PVMA 4L67A 4O0VA 4MX9A 4I5MA 3BBWA 5IA2A 3HVCA 4YHTA 4D2TA 3I81A 2I1MA 4IWDA 4JQEA 4D9TA 5EI2A 3PE2A 4FA2A 4AP7A 1T46A 3HV3A 3BEGA 5A4TA 4K18A 4WA9A 4UMUA 3QQJA 2NNWB 3C4ZA 4FX3A 4L01A 4O96A 3GP0A 2J0IA 2XYNA 2QOQA 4GK3A 2R0IA 3R28A 3EFKA 3IECA 3D5WA 1V1KA 4NCTC 4R7IA 5ACBC 3SKCA 1PJKA 2VTPA 4HCTA 4PY1A 4EH8A 5CF8A 2WTIA 2Z8CA 5AV3A 4C8BA 3CBLA 4UV0A 2YM4A 5BQ0A 3IKAA 3UMXA 2I40A 4F1TA 2P3GX 5L2SA 4D58A 4HOKA 2Q83A 3QZFA 4G31A 3NUXA 4YLJA 4XG3A 4DGGA 2VWBA 5IEYA 5KMLA 4O0RA 4DGMA 2W05A 2YIXA 4QPMA 3ZSHA 4RBLA 2ITUA 4CG9A 4O0WA 5CEOA 2WU6A 3BHUA 4EZ3A 4OGRA 4DGOA 3VS7A 4A4OA 4PTCA 4O82A 3U54A 3DB6A 2XRWA 2AC3A 1BMKA 2W9FB 4IWQA 4L8MA 2P4IA 4QMMA 4MD8E 2ESMA 3G33A 4O84A 4IM3A 3I7CA 4D4VA 3PIXA 4A4XA 2C0OA 3VW8A 4K33A 4LFIA 4RIWB 5AX9A 4BBMA 5M4UA 3F2AA 5T68A 4AUAA 3OG7A 1R39A 3ZBFA 4BVUA 4JQ7A 1REJA 3CPBA 3D5UA 3GEQA 4JVGA 3SG8A 5KMMA 4J99A 1CM8A 4BCJA 2W06A 4EOSA 1KSWA 2VWZA 3RGFA 3L9LA 3ZFXA 5HVKA 4PL3A 2EUFB 4XV2A 5CVGA 3W2QA 4QOXA 5L2WA 3L8XA 3EZRA 2J0MB 4MD7E 5HNBA 5C26A 5JH6A 1W98A 3GC0A 2B1PA 4QP3A 1JQHA 2Y6OA 2IG7A 5EI6A 4AX8A 1V0BA 3ZDIA 4XEYA 4C4FA 3EQGA 1P14A 2OFUA 4G3GA 1BKXA 4HGTA 2G9XA 3N51A 4FT9A 4H3BA 4OTIA 1YHWA 5C27A 3QA8A 4GW8A 2VX1A 3W2OA 4YLKA 3QC9A 3RKBA 4XRLA 2PMIA 2X2LA 5JRQA 4OTGA 4BCOA 5HE1A 3UVQA 5CSWA 4TPTA 4YO6A 3ZHPC 3VS3A 4RIOA 3NVKI 5LMKC 2Y6MA 4GG5A 4GRBA 3OW3A 3VJNA 3F7ZA 4EBWA 5E8TA 3ZMMA 4E73A 4AZWA 3CP9A 4DH8A 3AC8A 2JKKA 3QD3A 4TT7A 3TV6A 4GMYA 5KKRC 4BL1A 3CXWA 4NEUA 3LXNA 2IW8A 4C3RA 4ZAUA 3ATSA 5C03A 3ACJA 5EW8A 5I3RA 4CT2A 3R9RA 5EKOA 2RKUA 3PJCA 2CNQA 2BRNA 5IH4A 5K0KA 2PMLX 5DG5A 1UNHA 4GT5A 4X2KA 5AX3A 3PLAE 3NIZA 4DFXE 3DCVA 3SGCA 3FHIA 1PW2A 3D94A 1H07A 3MA3A 5J79A 1ATPE 2O63A 3GCQA 1ZZLA 2X8DA 1Q8TA 3RAIA 3UIBA 4BTKA 3FPMA 1UV5A 4UWBA 4J95A 4QQCA 5CU0A 5L4QA 1W7HA 3EL8A 3ANQA 4FNYA 5KHXA 5KZ0A 4D5KA 2GPHA 4U80A 4AW5A 3LQ3A 1GZOA 4K0YA 3QZGA 2BAQA 4D1SA 1H26A 3B2WA 3QA0A 2QOFA 4O1OA 5BVDA 5HD4A 1PXKA 2AYPA 3CJGA 3QQLA 1CKPA 4C4JA 3DBFA 2OU7A 3COKA 4YPSA 4FKOA 5E8WA 3A60A 4JL9A 4IM0A 4F9YA 4HZRA 4CFUA 3NWWA 5AUXA 1IAHA 4Q5EA 1MUOA 2HZIA 3TNHA 1IRKA 4RJ6A 5BUIA 3DDPA 3FHRA 4FTLA 3IGOA 4IWPA 5EOLA 1U54A 1XHAA 4M68A 3R8MA 2XCHA 5L2QA 3FLZA 3UNJA 4BGQA 4DE4A 4D0XA 3TI1A 1PXOA 4KINA 3AC3A 4TY1A 5D9HA 5CEPA 5JFSA 3IQ7A 3NRMA 5HIDA 5FM2A 2B53A 3ORKA 4BCMA 4FTOA 1W8CA 4TYGA 3R02A 4V05A 3MFSA 4JDJA 2PPQA 3O8UA 2QNJA 5AUYA 1IASA 5KBRA 4BCKA 2XJ2A 4L45A 5BPYA 5CF6A 2O8YA 3QHRA 4ENYA 4IJ9A 3UOHA 3MVJA 4I0SA 4JNWA 3K3JA 4NJ3A 5KMIA 2PY3A 2LGCA 4RWJA 3PG3A 4BYIA 4EORA 4HJOA 2F7XE 2UZOA 1XBCA 5CI6A 4QMQA 5HNIX 4RFMA 2PE1A 4S31A 3R8VA 2W5AA 3Q9WA 2BIKB 3NUSA 4CVAA 4XV3A 4R77A 4TYHB 3E88A 4IVCA 4HGLA 3BKBA 3RM6A 1Q97A 2X7OA 4HPUE 4L9IA 4RIYA 5HIEA 2R5TA 5GIPE 4ACHA 3FEGA 3OP5A 5EDRA 2CNUA 4W8EA 4JDIA 2XVDA 3QU0A 1ZRZA 2P55A 2HZ4A 4DFZE 2UZLA 3DU8A 3FL5A 3E8DA 5DLSA 5FEEA 2PVJA 3IW8A 2WHBA 5IQEA 3IO7A 5E8YA 3R1NA 3RI1A 3VUKA 5GIOE 2YA9A 4RX9A 3T8OA 3K3IA 2JIUA 3JR1A 5HO8A 3QFVA 4LV8A 4EQUA 1UU9A 3LQ8A 2JAMA 3AC2A 4CMOA 2VNWA 2WPAA 4GCJA 4IQ6A 4MTAA 4EK6A 4EQMA 4FT3A 4AW1A 1BUHA 3FMLA 5BVEA 4E6DA 2XZSA 5J95A 3K5UA 3UE4A 4EH4A 4BTMA 4YTFA 2QOHA 4CQGA 1KE7A 5KBQA 1J7IA 2UW0A 2R3GA 4W8DA 5FEDA 2ZDUA 2WMTA 3SLSA 5B2MA 1SVGA 4WNPA 4U6RA 1UNGA 2GNJA 3MPAA 4OTQA 5M06A 5CVHA 1EH4A 3CLYA 2XH5A 1ZAOA 3S1HA 3OWLA 3E63A 3CY3A 2YIWA 1W82A 4O2PA 2UUEA 2OF4A 3PJ8A 4NM5A 1O6YA 4FC0A 5ITAA 4MQ2A 4HYUA 4CV9A 5L6PA 2R3NA 4QP8A 2VU3A 4ZTRA 3Q6WA 3WZKA 2JEDA 3AC5A 2J5FA 2RIOA 1Q8WA 3BI6A 4O0UA 5LARA 3R7UA 4DBNA 4GEOA 4ANMA 4XP3A 3IDCA 3TTIA 4ZSEA 4E5WA 1FMOE 5ANOA 3VRZA 5CQUA 4A9TA 2C3IB 2UVXA 5FXSA 2QU6A 5TF9A 4G34A 4GG7A 4YZMA 3WARA 5HG9A 4DGLC 3FBVA 5FXQA 5EH0A 2B9FA 2JC6A 3D7TA 3LPBA 4DH1A 4ZTHA 1OL5A 2QR7A 2WOUA 4AZEA 4B7TA 4BDEA 5FXRA 3CSVA 1XJDA 4K6ZA 2ITVA 2R3QA 4BF2A 2OF2A 1MP8A 4DEGA 1P2AA 4FG8A 4XS2A 4PDOA 3CE3A 4U41A 3DQXA 1FVVA 3MBLA 4L3JA 4M15A 2R64A 4CYIA 3HX4A 3NYOA 4PNKA 5IQBA 2OXDA 3ROYA 3KXMA 4GFGA 3BHVA 4M0YA 5JFWA 3H10A 3ZO1A 1XKKA 2VTHA 2UW3A 3OWKA 4AT5A 5KNJA 4U42A 5M57A 4C36A 1KOBA 4W4YA 4ZJIA 1TQIA 4NCTA 4FKIA 4M69B 3OCBA 4JQ8A 2UVZA 4AW0A 3VW6A 3ZYAA 4RX5A 5IUIA 4IDVA 2BHHA 4FIJA 3LFEA 4RX8A 2WMSA 1R1WA 1MRVA 4XG8A 4OTFA 3DPKA 4WBBB 5I9WA 4NKSA 3WZUA 3R1YA 2BCJA 5HI2A 5HLPA 2Y8OA 4U79A 1BI7A 3R7OA 1FQ1B 4I23A 4G6OA 5FQDC 3COHA 2DUVA 2GNLA 2DYLA 3W8LA 3QQFA 4GK2A 5AR2A 2CMWA 3F3UA 5F95A 4AT3A 4ZY5A 3LMIA 4RIXA 4YPDA 1JKKA 1AGWA 3F3TA 3FWQA 3QRIA 4XOYA 4AZTA 3NIEA 3R7VA 5C8NA 3DNDA 4G6NA 5F4NA 2BROA 3DY7A 5KUPA 3SQQA 2J2IB 2LAVA 2A2AA 2X9EA 3ZUTA 3QF9A 3QD4A 5BUJA 3OY1A 2WTVA 4F6SA 4RC3A 4CT1A 3BHHA 3QQKA 4QYHA 1CMKE 3TN8A 4F64A 2H34A 4IZYA 3MDYA 3ZRMA 4JXFA 2OZAB 2JITA 3FQSA 1ZARA 4R1VA 3PXKA 4JX7A 4X0MA 1GIIA 3GBZA 4AWIA 3KRXA 3HDMA 5C1QB 2Y0AA 1H1SA 2ZM1A 4F70A 4OBQA 4AZSA 5DFPA 1PF8A 3MB7A 1ZOGA 2V55A 2WQMA 3VUMA 1Y8GA 3OF0A 4FV9A 3KVWA 3MTLA 2PVYA 5LVNA 3G0FA 1JAMA 5C4KA 4OUCA 4R1YA 4AN3A 2YWPA 4CFMA 3CTQA 1Q5KA 4DEDA 3AT2A 3UOLA 5CANA 2X9FA 4CKIA 4O27B 3RCJA 3NCZA 3AXWA 4XBRA 2W1GA 4G2FA 3SOCA 3WF5A 4YHJA 2AUHA 4M7IA 5IPJA 4AN9A 1W0XC 4C7TA 3EOCA 4BDJA 5IQFA 4EOKA 3MV5A 4H58A 5AMNA 3EQRA 2QODA 2BFXA 4KKHA 3CGOA 3NCGA 4J53A 3NW5A 4NUSA 1RW8A 4TWNA 5CNNA 3DXQA 3QAME 3KL8A 2CLXA 4OAUC 3OHTA 3I5NA 1GZ8A 2OZOA 4FT0A 4OT6A 5GJFA 5A46A 3OWJA 5EQPA 1UU7A 4BIEA 2YCQA 4FNWA 5CZIA 4R5YA 3Q4CA 4FTJA 1QMZA 2OH4A 4ZLOA 1PHKA 5M51A 4PMMA 3AG9A 4LUEA 2I0YA 3LAUA 4B4LA 4PMSA 4DCEA 4QMSA 1Y91A 2F2CB 3BGPA 4AG8A 3ORXA 4XCUA 5JGAA 2XK4A 2WTKC 1YI3A 2J0JA 4FUYA 1X8BA 4QD6A 5E1EA 4O83A 3HV7A 3OBGA 3WBLA 2X39A 2YWVA 3ZFMA 3F9NA 3SVVA 3OT3A 2G1TA 4O7TA 3D7ZA 1B39A 3PVBA 3ZXZA 3VQUA 1WCCA 3HV4A 1QPEA 4BRXA 3DBQA 2OWBA 4YTCA 2ETRA 3S00A 1H01A 4R3CA 4Y73A 3EB0A 5DYJA 5L3AA 4DT9A 2BRMA 4IB5A 5LCJA 2XIKA 2R3LA 2GHGA 3C9WA 3BPRA 3DTCA 3MH0A 1U54B 4I93A 1VZOA 5DHJA 5CENA 3C0IA 5BMMA 4O7ZA 4BDBA 2ITNA 5J1WA 3ORIA 2C5OA 3A8XA 4WOVA 1BI8A 4ACCA 4NYEA 2UVYA 2OJIA 2VWYA 2YCSA 3GFEA 4PNIA 4X3FC 3V51A 4JBPA 4EUUA 3GVUA 1IAJA 4E26A 3AC4A 5I3OA 3CCNA 4YO4A 4YC6A 1OBDA 2OI4X 2UW4A 3CY2A 3KK9A 4FUXA 1JKLA 3TUBA 2VGOA 2VN9A 4R3RA 2YAKA 4FT7A 5J8IA 4DEIA 1TQMA 3SG9A 2BZJA 5HX6A 4IAAA 2YN8A 5E8SA 4YGAA 2IPXA 2W1IA 5M4IA 5J1VA 1YXSA 2IVTA 3AGLA 4DCAA 4OT5A 4RZVA 4U7ZA 3LXPA 5JFVA 1YDSE 2JDOA 4K77A 5EYKA 3FUPA 3N4TA 2W1EA 5IA3A 4R7HA 1J1BA 1PXMA 4O0XA 4C2WA 5HLNA 3BYOA 2IVSA 4RC4A 3OT8A 4FEWA 3KRJA 3UBDA 1WFCA 5AUZA 3ZLSA 4E7WA 4BDKA 4M8TA 4QTCA 2CCHA 3O71A 2UV2A 1E9HA 5EYMA 3RK9A 4ZS0A 5BYYA 3MJ2A 3U51A 5KHWA 2XMYA 4F0IA 3MPTA 3E8EA 4FR4A 5KMJA 3F3ZA 5KMOA 2YLFA 3QKKA 4O6EA 5AP6A 1JSUA 3ZUVA 4DG0E 1CKJA 2YM6A 3GUBA 3BE9A 3BQRA 4UMQA 4CFNA 3DS6A 5HU9A 5TKDA 4F1OA 4ANQA 3EH9A 3Q60A 4ITHA 1GJOA 3UQGA 5FDPA 5DGZA 3EQCA 4LL0A 4ZZMA 3G9NA 2EXEA 4E4MA 4FKLA 4WUAA 3O0GA 3SD0A 3TZ8A 2ZB1A 1NA7A 4WRSA 4XG2A 4TN6A 5CXHA 2G15A 4DFNA 4PL5A 3QTWA 4WUNA 2WELA 3UO6A 3UIUA 4ZSJA 4FTUA 4LQMA 2ETMA 2OJJA 4FTAA 4HYSA 1WVWA 4XYFA 2XP2A 3EN6A 3EFJA 3A61A 4U81A 2CKEA 5CSVA 2GQGA 2VX3A 2W1FA 4G16A 4I5CA 2I6LA 3ZS5A 4QT1A 3AD4A 2OLCA 1MQ4A 4E8AA 2GS6A 3FC2A 3H9FA 4OAVB 3FMNA 5CSPA 5L6WL 2CNVA 2W4OA 4G9RA 5CSXA 4PDYA 3EYHA 4IJPA 3GCSA 1NVRA 5CEQA 4U40A 2RSVA 4H3PA 2Z7LA 3C4XA 3QD0A 3R00A 4H1JA 4AA5A 5H2UA 4P7EA 3C4FA 1AQ1A 5FDXA 4YJUA 4C4GA 4BWKA 4BHZA 1PMNA 3QWKA 4Y72A 4IAYA 1XH9A 2O65A 2G2HA 4YNEA 3U6JA 4LI5A 3S3IA 3D7TB 3PWDA 4H1MA 4TL0A 4O86A 4KD1A 2XNEA 4K2RA 4RJ5A 5K4JA 4OBPA 4WHZA 3R71A 5IQIA 3UO4A 4WSYA 5A14A 1V0PA 1PRYA 3PSDA 5ETIA 4QQ5A 4FBXA 2CGUA 3EWHA 4MCVA 4GKIA 1YHSA 4M84A 2HWOA 3W1FA 3R9HA 1Q61A 2HXQA 3MIAA 5CU3A 2FGIA 2C3KA 3GOKA 4NZWB 3PP0A 4C34A 4RFZA 2OK1A 3PJ1A 3P4KA 3FPQA 4DEBA 3CR0A 2C5YA 5HNGA 3TL8A 3WOWA 1LEZA 4A9UA 4MWIA 3MYGA 1KE9A 5DN3A 4BWXA 2YM3A 2PUUA 3C13A 4YZNA 4ZEGA 3VC4A 1S9IA 2YZAA 1LR4A 3BIZA 4DTBA 4RVLA 3PY1A 4NM7A 4QYYA 2OW3A 4BCNA 5LQFA 3E3PA 2E9NA 5EDQA 4G1WA 3P79A 1F3MC 5A3XA 1YKRA 3R63A 3FXZA 3POOA 3K5VA 3P7CA 4ZJJA 4X2NA 1LUFA 3B2TA 2YDJA 3VBXA 4ZMEA 5K0XA 3IW7A 5HIBA 1WMKA 3EN5A 3KKVA 3DKGA 4JAJA 4JR7A 5AV1A 3VRYA 4BZDA 3LJ2A 3OTVA 5A6NA 3QUEA 4LOQA 4JIKA 3TDVA 1P4OA 1DAYA 2X4ZA 2WEVA 2YDIA 5K5NA 1XQZA 2PULA 5TO8A 2F7ZE 4LUDA 3FZTA 5H8GA 2IWIA 1ZMWA 4BTJA 3LFFA 4DH5A 4NM3A 4PV0A 2PSQA 2YABA 3VULA 2H6DA 1R0EA 4OTDA 3MA6A 4D1ZA 1REKA 1LP4A 2WOTA 3DAKA 3GGFA 3W18A 3F7WA 2QOIA 3MPMA 3OCSA 3QUDA 3RAKA 5AR8A 5DT3A 2XK3A 1OUYA 3VS5A 4N6YA 2QHMA 1MRYA 1WBOA 2I7QA 3ZOSA 5K5XA 2UZWE 4S34A 5LVOA 5LVPA 1CTPE 1GOLA 3QCQA 4RVKA 2VO3A 2OXYA 3W10A 3ZLXA 3BRBA 1WVXA 4JDKA 5JEBA 4IACA 4D28A 2ITWA 3Q2JA 3H9RA 4KIOA 4GK4A 3KXXA 2C6KA 2IZRA 2UZEA 4K11A 4N70A 1U5QA 5TR6A 1ZMUA 3D5VA 3TV4A 1OIYA 3KY2A 4PQNA 2VTMA 4UWCA 4X2GA 4BBEA 4ERWA 3V5JA 2YM8A 4QMNA 4IWOA 5ETFA 3V5TA 5GHVA 5EM6A 4K1BA 2FSTX 2C1BA 3NSZA 3A7JA 3TWJA 2XK7A 4C0TA 4KRDA 2PZ5A 1O6KA 3DTWA 5D1JA 4IH8A 1O9UA 3TTJA 4BI0A 2JKQA 3TKHA 1MRUA 4PUZA 4A9RA 5EG3A 5DIAA 4YR8A 5IKWA 3BWFA 4PP7A 1H0WA 5DBXA 4FG7A 4BY9E 4IDTA 3FMDA 2FB8A 2XJ0A 4DINA 2GFCA 2Y4IC 4FKSA 4TWOA 1URCA 3EN9A 3MFRA 2XK9A 2VUWA 4R6VA 5EKNA 5IEXA 2ZDTA 3SRVB 4NM0A 3UQFA 3R22A 5AIRA 4C02A 3MVHA 4I21A 4QP9A 2XKEA 2PWLA 4NFNA 2WQEA 4IANA 5B7VA 3AGMA 4KKEA 4LRMA 2SRCA 2F49A 3FLYA 3COMA 3W2PA 5E1SA 4RJ7A 1OKYA 4I5HA 3R21A 4L68A 4R78A 3MN3A 2EB3A 3QRKA 4B0GA 2C0IA 3DZQA 5IU2A 3QCSA 2UW9A 4J7BA 4QTDA 4DTKA 3EHAA 2R3MA 3GB2A 4L7SA 2OIDA 4E1ZA 4ZTMA 2V7OA 2JIIA 5HO6A 1OIUA 2XF0A 4I1ZA 5DMZA 1OL2A 3BV2A 3OD6X 4ZK5A 4EC8A 4RVMA 2IZSA 3EQIA 5M53A 3KVXA 3JYAA 3LE6A 5JQ8A 1PKDA 1G5SA 2RL5A 4ITIA 2V7AA 3QTUA 2HCKA 4QNYA 5DEYA 3UP7A 4GYIA 3OXIA 4AGUA 3FKNA 4ZTLA 3U4UA 3DJ6A 2JDSA 4BDDA 2Q0NA 4CZUA 4G17A 1P4FA 2QOOA 4QPAA 5CY3A 3OC1A 3NVMB 2ITTA 3Q5ZA 1ZYJA 1RDQE 3LW0A 1GNGA 4G3EA 1JKTA 4X6QC 3TT0A 3FMEA 3PJ2A 2PUNA 3P78A 2B52A 2QVSE 3HV6A 2XCKA 2BMCA 4ZMFA 3QTQA 2W96B 1F0QA 4FKWA 4C35A 4X2FA 3UG2A 3DXPA 3FYKX 4X2JA 3L9MA 4ZTQA 5IQCA 3P86A 4LOOA 1WBWA 2HY81 4PTEA 4F7LA 1KE5A 2IJMA 3DT1A 3D4QA 4BCFA 3LFQA 3QLGA 4FNZA 4HW7A 2R0UA 3OVVA 3R01A 2QR8A 4B9DA 5HGIA 1I09A 2VV9A 4DFUA 4FV7A 2AC5A 5E90A 3L8VA 4OBOA 1ZLTA 4CTCA 3SV0A 1VEBA 3VBQA 4ALWA 4DGNA 5I9XA 3OXTA 5IQHA 4ZLZA 4GJ3A 3LLTA 4FZAB 3C4WA 1DM2A 4B8MA 5C8KA 3OEFX 3BU3A 1H24A 3R73A 4M67A 5HCYA 1PKGA 3D5XA 2XNPA 3DKCA 4S30A 4DFYA 3PXYA 4FSMA 4QYFA 2VX0A 5E4HA 3REPA 2YEXA 1PXLA 5BVNA 4C3FA 3F69A 2XS0A 4NIFA 2C30A 4HPTE 3UYTA 2JD5A 4BCQA 1RJBA 2QONA 5E91A 2JIVA 2Z7RA 1Q8YA 3NAXA 4ZTSA 2WMWA 4AU8A 4EH6A 4ANNA 2PMOX 4RQKA 4ANSA 4RA5A 2W7XA 2JBPA 3C7QA 4QQTA 1FPUA 3KA0A 5ANGA 4EZ5A 1ND4A 4AW2A 2ZV7A 4FIIA 2FVDA 3DNEA 4F7JA 4F6WA 3QHWA 3Q4TA 2VO6A 3D15A 4MXZA 4UXQA 2V0DA 4M0ZA 5GZ9A 3AOXA 4P5ZA 5AJQA 3CQWA 3H9OA 4AT4A 2NRUA 3FQEA 1GY3A 3G90X 1SNUA 3ULZA 1G8AA 4USEA 3GU4A 3EYGA 3ZFYA 3DB8A 1YOLA 3KRWA 5BYLA 1H00A 2GCDA 2ITZA 4KBAA 4RPVA 3VBTA 3HV5A 4EOLA 3FMJA 3G5DA 5EK7A 4WG3A 1BYGA 2FO0A 3DJ7A 4WD5A 3V5WA 5FTGA 4DAWA 1OIRA 1JOWB 4PPCA 3C1XA 1NVQA 1JNKA 1RQQA 3PWYA 3QQHA 4C4EA 2P2IA 5CS6A 2JDTA 2ZV8A 3D0EA 4EK3A 4Z7GA 5AV4A 2HY0A 1PXNA 4FTNA 2W1ZA 3E5AA 1M17A 5D7VA 2PVLA 3TJDA 3KCFA 4APPA 3Q3BA 1JSTA 3L8SA 1H1WA 1YXUA 1Y6BA 2X7FA 3ZSGA 4BKJA 4CFXA 1XH4A 5AR7A 3O96A 1XH7A 4KBCA 3KF7A 4LL5A 4LYNA 4EJNA 3O8TA 1YWNA 4D9UA 3DOGA 3MY0A 4U45A 4NT4A 4C37A 1GZNA 2VNYA 3NNUA 3ZDUA 3SXSA 3WYXA 2GTNA 2OJ9A 4N57A 3D14A 2QU5A 4EHZA 3A7GA 3PP1A 4JS8A 3IONA 2RFEA 1OL7A 4FL2A 4DBXA 4YZ9A 4W4WA 1E1VA 4AGDA 1A06A 2XUUA 3AT4A 4HCUA 3MFUA 3QTXA 3UZRA 2OXXA 3B8RA 5BVWA 5DR2A 3NUAA 4KNBA 3I6WA 4JIAA 4ITJA 4XUFA 3FL4A 2KULA 4NH1A 4RG0A 5F20A 1Y6AA 3QL8A 4RWKA 4BICA 1SMHA 4IEBA 4CSVA 5GJDA 3G15A 2X8EA 2HENA 4AFJA 4LRKA 4ASDA 4F7SA 4EYJA 1GAGA 3ETAA 4MEDA 2W99B 3E87A 3ALOA 3W2RA 5HTIA 5FLFA 3OOMA 3PY3A 4PL4A 1G8SA 2IN6A 4ARKA 2QG5A 4FF8A 5JQ5A 4YZDA 1ZY5A 3OZ6A 3QXOA 3RZFA 4IAKA 4MNEA 3QRUA 5DR6A 2BZHB 4MXOA 1JKSA 3I0OA 4OLIA 3I0QA 1WBPA 4Z16A 2ONLA 4UX9A 2YITA 1KV1A 2H9VA 3I6UA 4FKQA 3DFCB 5C4LA 4DN5A 2PUPA 4BIBA 3UJGA 3EL7A 4L43A 2VTOA 5G1XA 3U87A 4Q9ZA 4DC2A 3CKXA 3DFAA 5M55A 2P0CA 3F6XA 1NXKA 2W1HA 3ORLA 3OBJA 1TKIA 2QOLA 3O2MA 4UXLA 3KB7A 2QLQA 3C4EA 2C1AA 3LCDA 4HZSA 5HTCA 3PVWA 3R2YA 4GJ2A 5FBNC 3II5A 2I0HA 4EC9A 2V22A 4I3ZA 4D2PA 5HVJA 4O7RA 5D7AA 2YIRA 2FSMX 4FIGA 4CKJA 1M7NA 2PVFA 1WBTA 2B9JA 2ZV9A 3R04A 3BELA 4GH2A 5CALA 5CAVA 5IH6A 3LFAA 4F0GA 2O2UA 4I0RA 4Y5QA 3UQCA 4KSPA 3R7GA 2YJSA 4ANBA 5L2IA 1FGKA 2WD1A 4C3PA 1KV2A 5EOBA 4EH5A 5JZNA 4WBOA 1YHVA 5IF1A 2GNIA 2RG5A 2VGPA 2QO2A 4IZAA 2F57A 5HZNA 1PMEA 2OKRA 3DLZA 4FI1A 3RALA 4HVHA 3NW7A 4LGGA 1Q62A 3H30A 3EQDA 4MD9E 4UBAA 4WSQA 4HVGA 2PMNX 3LFNA 3Q96A 3I60A 4U5JA 4ANLA 4EUTA 3RK7A 3VBVA 1K3AA 4IX5A 3JUHA 2XNBA 2J0KA 4AN2A 4XH6A 3HMNA 2GTMA 5ANKA 2CKQA 4PTGA 3CTJA 4BDCA 2CGWA 3TM0A 4I41A 1QCFA 4CV8A 4O7WA 4XJ0A 1DS5A 2FH9A 2OIBA 3DAEA 3CKWA 4O7NA 3WYYA 3NNWA 5ETCA 2YERA 5DI1A 4I24A 3C5IA 5G6VA 2ZB0A 1JWHA 1PY5A 2F4JA 3L9NA 2KTYA 1WZYA 4ZJVA 5CAOA 3B8QA 2YCRA 3GU5A 3DAJA 3PPKA 1SZMA 4UMRA 5JN2A 2YIQA 4JDHA 3WI6A 1FINA 4I20A 3TXOA 4PDSA 3PSCA 3AT3A 5JZJA 2QO9A 4S2ZA 4XMOA 2F2UA 3KXZA 1H8FA 1U4DA 3PXFA 3UNZA 2PZRA 2X2MA 2C5VA 5IA4A 5CEMA 3QTRA 2R3HA 3P9JA 3W2SA 3BLRA 2ZV2A 5AP7A 4NSTA
chains in the Genus database with same CATH superfamily
4YJRA 4EOQA 4EWQA 2WMAA 3JY9A 3WZJA 3HZTA 3F5PA 4NK9A 5BYZA 3L9PA 4U0IA 5K3YA 3OCGA 4LV5A 1ZYCA 4XNEA 2JLDA 4FV6A 4OTPA 4D5HA 4L53A 4S33A 3UIMA 3FE3A 4KIPA 4NFMA 4YJQA 5HVYA 4TNBA 1Y8YA 3P08A 3UVPA 3QQGA 4FK3A 3LCSA 3MVLA 2A4LA 5IMEA 4IHPA 1XBBA 5AUTA 1GIJA 3LM0A 3V8TA 4AE6A 4RA4A 5HE0A 3MY1A 2HYYA 4U9AA 4CEGA 2O64A 4CZYB 5AAEA 4K8AA 3TKUA 4LOPA 3PDTA 3RJCA 4GV1A 2UW8A 4J1RA 3LIJA 3OCTA 4HGSA 3P1AA 5DT0A 5HCXA 3LQ5A 3WE4A 4EOMA 5M56A 5FEQA 3OUNB 2ACXA 3S0OA 2ITXA 5D11A 4CD0A 3ZEWA 2OBJA 4ZZOA 2YDKA 4PWNA 4QMUA 2HAKA 4O4DA 4QMXA 2WKMA 5HE2A 2CGXA 4KIKA 4Y85A 4ZSGA 4E4NA 1WVYA 4MF0A 4V0GA 4D1XA 4UYNA 3C0GA 3FLWA 3FLQA 5EI8A 4E3CA 3ZO3A 2XM8A 1BLXA 1P5EA 4AQCA 3LFSA 3PVGA 4MXYA 5EYDA 1XO2B 3EFLA 1O6LA 2R4BA 4QP4A 3CEKA 3HAMA 3HEGA 5AV2A 1XH5A 3DZOA 2C5XA 4H36A 3W0SA 2WNTA 3AD6A 3PE1A 4WT6A 3G6HA 4C2VA 3BGZA 4GIHA 3PXQA 5LMKA 2W17A 5FD2A 3HA6A 3ML1A 4BCPA 4Z55A 3GXLA 3ORNA 3BX5A 3BV3A 4IAFA 1Q8UA 2R2PA 3NDMA 2OG8A 4ORKA 3MSSA 2ZM4A 3HRFA 2WQBA 4G5PA 4PX6A 5B0XA 3A8WA 4DH3A 5I9YA 4Y46A 2A0CX 2R3JA 4ONAA 2XARA 4DFLA 2WAJA 3O51A 4HNFA 3PUPA 4MUQA 4L7FA 3PUFC 2WO6A 3PYYA 2ITQA 4M13A 4D0WA 2GQRA 3LHJA 2X6EA 4UYAA 2OIQA 3QX4A 4IMYA 4JOAA 1YVJA 4QMWA 2J7TA 2WMUA 2GDOA 2WU7A 3S2PA 4MYGA 2YJRA 2X8IA 4QMYA 4B8LA 4O21A 3C0HA 3I79A 1UNLA 4GUBA 3ALNA 3PXRA 4G3FA 4YJSA 1OL1A 3TZ7A 4L44A 3ACKA 4RIWA 4FSWA 3TIZA 3MI9A 1VR2A 5J9LA 2XKDA 4MK0A 4TWCA 3LXLA 3C5UA 1NY3A 4FEQA 3BQCA 2VTIA 3EFWA 3PZHA 3FXWA 1SVHA 1RE8A 1OPJA 3QTIA 3R9DA 3ORPA 5HX8A 1Q24A 5IG1A 4IX4A 3PA3A 4XP0A 4YZBA 5EM7A 3OOGA 2X6DA 4KAOA 4L3LA 4RRVA 1VYWA 3ANRA 3F5XA 3ZRLA 4KB8A 4DLJA 4Y83A 4FKTA 3BWJA 5E8VA 1Q8ZA 2WTWA 4AOTA 3PA4A 2OJGA 5DA3A 2X1NA 5CAQA 1APME 5AP4A 3VHEA 3NYXA 4EHGA 4ERKA 1PMVA 1HCKA 4PPBA 3OS3A 3FKLA 1JPAA 2WMVA 1WBVA 2IW6A 5AR3A 3BYMA 3NGAA 4EH9A 4UWYA 5M44A 4AZFA 1JSVA 2VWIA 2WIHA 4QMPA 4AGWA 4Z7HA 3Q52A 4PRJA 3BYSA 3FY0A 5BVFA 4RGJA 1L3RE 4D2VA 2B4SB 4YTHA 5EHLA 3PG1A 3EMGA 3WIKA 5BNJA 1VYZA 2CDZA 2X0GA 2VWVA 2W9ZB 4BI2A 3W0NA 3DBEA 3PPJA 3UDTA 2VD5A 2PL0A 2XYUA 4AE9A 4BJJA 5BUEA 5IQDA 5DNRA 4BCGA 2CSNA 3SXFA 4EOJA 5CVFA 2HK5A 4MHAA 4YBJA 3BU6A 4EOPA 4F1MA 4FTRA 5EYCA 1V0OA 2VO7A 5AIKA 2YM5A 2H8HA 2DQ7X 2PVHA 4RIYB 3UZPA 1Q99A 1YW2A 3Q9ZA 4EBVA 4P2KA 2QD9A 5I5ZA 4F63A 2CLQA 4RJ4A 1FOTA 4XBUA 3T9TA 5CU2A 2R3PA 5M4FA 4BKZA 2CN5A 2WMRA 4AA4A 2QOBA 2QURA 2YM7A 3O8PA 4OTRA 3VIDA 1YXXA 3HP5A 4G9CA 3ZBXA 5AM6A 3ZO4A 1OUKA 4ID7A 4AXAA 4DEHA 4G6LA 2W5HA 1BX6A 3PIZA 2PYWA 3R2BA 3KXNA 3T9IA 5A4QA 4HVSA 3OFMA 4QO9A 4E20A 5C01A 3LXKA 3FSKA 3LZBA 5L8LA 4KBKA 4CZTA 4JBOA 5FTOA 4YJVA 2QLUA 4JI9A 2BAJA 3HECA 4MNEB 5E8UA 3ENMA 1ZMVA 4IFCA 3GCUA 3AMAA 4O0SA 4XG6A 5D10A 4PDPA 4LGDA 3MVMA 4CFFA 4EEVA 4FSNA 1ZYLA 4FZ6A 2QCSA 3O50A 3PIYA 4QP2A 4CKRA 4L3PA 4XLIA 3MWUA 4GT4A 5H9BA 2W5BA 3R8LA 3QCYA 2CKOA 1F5QA 4MKCA 3BGQA 2ZAZA 1YQJA 3PRIA 4FJVA 2OO8X 2PE0A 4D4RA 4BC6A 3E7VA 3FDNA 4YMJA 3SHEA 2C3JA 3IDPA 4O7LA 4DYMA 2P33A 3KN5A 1OVEA 2XNNA 5AV0A 4YSJA 1IA8A 2ITPA 2BDFA 3CS9A 4RX7A 5AR4A 5F94A 3R7IA 4QPSA 5L8KA 3IW4A 4BDIA 4EK5A 2JAVA 4G3CA 2J6MA 2C6OA 5LXMA 4AXEA 3MJ1A 4CRSA 3Q9YA 4PMTA 3R8PA 2E9PA 2FSOX 4KIQA 3NX8A 1SNXA 4FICA 5FUTA 4FVRA 3RVGA 2B9HA 2YLEA 3GI3A 3PXZA 3UVRA 1H1QA 4GL9A 3NMUF 2QKWB 3JVRA 4UZHA 3SX9A 2CHLA 3TUDA 3E93A 4DT8A 4KUJA 2EXMA 3ORMA 2OFVA 1BL6A 2UZNA 5FRIA 2R3RA 4EI4A 5CNOA 4GFOA 4X3JA 4USFA 5HG5A 4YLLA 4IVDA 3ORZA 4HGEA 4XV1A 4XRJA 4CMUA 2JBOA 2RFSA 3QTSA 3ODZX 4MWHA 3EN7A 5FBOA 3RM7A 5IISA 2XRUA 4FVPA 4IADA 3UC3A 3DK7A 3QGWA 2XBJA 3MY5A 4EOOA 3UDSA 3FI4A 3QYWA 3QTZA 3VF9A 1J91A 4O4BB 1KWPA 5ANEA 3UP2A 4FTIA 4I6QA 4IM2A 2BTSA 1M2QA 3GU6A 4J8MA 5KE0A 3GNIB 2J50A 3MESA 3GU7A 3HRBA 5DH3A 3HUBA 4IX6A 3O17A 5JRSA 3BYUA 3ZM9A 2C6TA 4QMTA 4RLLA 2YFXA 2QG7A 1QL6A 2X0QA 4IB1A 2BDWA 4PF4A 3R30A 5DOSA 4V01A 3ZM4A 4DEAA 3NFGB 3DLSA 5CASA 1DI9A 4I22A 3KFAA 4D4YA 4IZ7A 4EKKA 1YWRA 2OGVA 4DG3E 4BGGA 5AAFA 5JMSA 1UU8A 3HYHA 3KMMA 2XA4A 4TTHB 2HXLA 2BRBA 2FUMA 3IDBA 4RIXB 4W9WA 2RF9A 4ZTNA 4EYMA 5GZ8A 3FI8A 5KMKA 3NR9A 4ZY4A 2J9MA 3F5UA 3OWPA 4W4VA 4II5A 5I9VA 3UYSA 4YNOA 4NW5A 2YCFA 4IVBA 3GC7A 2ZMDA 2BDJA 4AF3A 4YURA 1NW1A 3ZZEA 4ACGA 5HQ0A 3O23A 4ZLYA 5B2KA 4EHEA 1UWHA 4GU9A 3SDJA 3VJOA 4CCBA 4CFVA 3ORTA 4FG9A 5CAUA 3U6HA 1WBSA 4FEUA 4QYGA 2VTAA 1H25A 2EVAA 4XG4A 5CAPA 4FIEA 4ZP5A 4ACDA 4BZNA 2Q0BA 2UZTA 3RNYA 3ZTXA 3V01A 2AEGA 3AMBA 3LFDA 1XWSA 4CQEA 3FMHA 3QXPA 4FV4A 4BIDA 3FSFA 4KA3A 3HLLA 4EK4A 2G2FA 3V8SA 3R1SA 3IS5A 3OXZA 1J1CA 5IA5A 3S4QA 4O7YA 5CF4A 4U44A 2VZ6A 5EW3A 4LV7A 4FGBA 2C68A 3IOKA 3D83A 3ODYX 3VUTA 4H05A 5CF5A 4QMLA 4FKGA 2V62A 4QNAA 3Q4ZA 2RFNA 1UKHA 4FMQA 1OPKA 4FNXA 5IA0A 4TYEA 2IVVA 1FVTA 1IEPA 3DDQA 4W9XA 4XLVA 3VUHA 3F2NA 3KULA 2GHMA 4WG5A 3TNQB 3U6IA 4I0TA 1XMMA 1DAWA 4JBQA 3QRJA 2REIA 1OI9A 1OL6A 3U8WA 1G8KA 3OW4A 5D12A 1L8TA 5CZHA 4QQJA 4N4SA 1WBNA 3IGGA 2ZYBA 3VWAA 5LVMA 4I4FA 2PZIA 4G5JA 1G3NA 4YUQA 3EJ1A 4HNIA 5AA8A 1Q4LA 5JKGA 4MBJA 5IQGA 4UALA 2CPKE 2X2KA 3JVSA 3UMWA 3VQHA 2OH0E 2QI8A 3ZRKA 3NAYA 1KUTA 4J96A 5A4LA 2R7IA 2J90A 4Y8DA 3WIGA 4AGCA 1MQBA 5J87A 5KKRB 2WTJA 3RAWA 5DR9A 5I0BA 1ST0A 5GJGA 2W1DA 3JXWA 4QP7A 5HOAA 3LOKA 1SYKA 1R78A 4FEVA 3QCXA 2XBAA 1QPJA 2W0JA 1PXIA 3RINA 2YISA 5A54A 3UDBA 2CJMA 1Z5MA 2QOKA 4LM5A 3UOKA 4R7BA 2XIXA 4M69A 3KXGA 3FY2A 4MAOA 5HG7A 4ANOA 3KF4A 4JRVA 1NVSA 2QQ7A 4JBVA 4WNKA 3NW6A 3LMGA 4EWHA 4IX3A 3FJQE 4PP9A 2XAOA 4IW0A 1IG1A 1M7QA 4FV0A 3VHKA 4I4EA 3NUUA 5F9EA 5EQEA 4IBMA 5EM5A 4BHNA 2WMQA 3AC1A 4RSSA 3V04A 3NUPA 2IZUA 2XNOA 5ANJA 4YU2A 2XK8A 1ZOHA 3KEXA 3HKOA 1YWVA 3UODA 5JFXA 5DE2A 3F3VA 3LVPA 3ZZWA 4QRCA 1XR1A 1YXVA 4GYGA 4BCIA 5CU4A 3N4UA 1XBAA 2Z2WA 4IC8A 5J7HA 2O5KA 4FZ7A 3I7BA 3MFTA 5CQWA 2JDVA 5HLWA 5CTPA 1SM2A 3Q6UA 4FIFA 4P90A 4B6LA 3C4CA 1ZOEA 2BR1A 2OZAA 4H39A 3IW5A 4GS6A 4BI1A 3F66A 4AOIA 4P4CA 3GOPA 4UB7A 4YJNA 2VTTA 3ELJA 3VBWA 4FK6A 3ZH8A 4CLIA 3TUCA 4E6AA 4O7SA 4FTKA 2BKZA 1UU3A 2UZVA 4EZ7A 4RFYA 5HU3A 4FTTA 5T6KA 4X3FA 4MVFA 3FYJX 4MQ1A 4XG7A 5J5SA 4O1PA 3QD2B 1TQPA 4JG8A 3BHYA 1R0PA 2BALA 4A07A 3EIDA 3KREA 5K4IA 2Y7JA 3COIA 4QTAA 4BZOA 5JT2A 4BBFA 4QMZA 4Q5HA 4XP2A 5CWZA 1IR3A 4I6FA 4MXXA 4A7CA 4C4HA 4RVTA 4JG6A 3BBTB 3EQFA 4U97A 3W33A 3P0MA 4UEUA 4O81A 1GZKA 5AWMA 2GU8A 4E6QA 4ZIMA 4MNFA 1T45A 4FKJA 4I92A 4TYJA 5HO7A 4RJ8A 5CI7A 3TEIA 1ZYDA 5GZAA 4IAZA 4GFMA 5CEIA 3KC3A 4A9SA 3FV8A 4S32A 2GNHA 4HVIA 4WKQA 1OKWA 2OJFE 2WQNA 2QOCA 3QZIA 4U8ZA 5JGBA 4J52A 5LOHA 5AUUA 4AQKA 4ZS4A 2WIPA 5AAGA 2A27A 2GS2A 3FI3A 5HESA 2XIYA 4FTQA 3R83A 3V5QA 3TZMA 4EH7A 4F4PA 4MH7A 3TNPC 1H1RA 4DA5A 3PFQA 2VTJA 4PMPA 4JLCA 2FSLX 4UZDA 4EHVA 4YTIA 1J7LA 4CTBA 3EQBA 3U9NA 4FE2A 4YHFA 4DLIA 4MXCA 3UNKA 4EJ7A 1WAKA 5IH5A 5AUWA 4RC2A 4AAAA 1H4LA 3FZRA 3KGAA 4D55A 3FC1X 4E4LA 3F82A 1UWJA 3NPCA 4ZXTA 3DXNA 3ITZA 4MF1A 4WIHA 3QYZA 3DA6A 5BVOA 4CFWA 1B6CB 2F9GA 3FZ1A 3LKMA 5HEZA 3DGKA 3TNWA 3VF8A 5BMSA 2XK6A 4GU6A 3WF9A 4FV2A 5AADA 3NYNA 3QUPA 2PZPA 4I94A 4KS8A 3ZO2A 4UMPA 2CKPA 1JVPP 1E1XA 4FSRA 3F5GA 4TW9A 4ENXA 5M4CA 3MH1A 3UOJA 4F9AA 3PJ3A 4FEXA 4FIHA 1OKVA 3GCPA 3OTUA 2WFYA 5HICA 1CSNA 2XKFA 2R7BA 5C9CA 4F65A 5AP2A 4C57A 2C6LA 4Y95A 4R5SA 1OPLA 3ERKA 4GKHA 2W1CA 5H8BA 2NRYA 2ZVAA 4RT7A 5BV3A 3V8WA 3R9OA 1ZXEA 2QO7A 4Z3VA 3RBWA 3Q9XA 5IZFA 3N4VA 5GNKA 4FYNA 4JRNA 4CG8A 3R8UA 4ASXA 5LMAA 5E92A 3M1SA 4TWPA 3VS1A 4JG7A 3DBDA 2VAGA 4NJDA 3Q04A 4ZY6A 2JKOA 3EQPA 4ALVA 3SOAA 3WZDA 4BFMA 4MBIA 3M42A 3NEWA 3ZCLA 5KO1A 4L00A 1M2RA 2WTDA 3OMVA 2NYAA 3QALE 1U5RA 3OUKA 1QPDA 5KX8A 3GFWA 1BL7A 4FZFB 3CJFA 4IVAA 2HW7A 3GCVA 5IA1A 4R8QA 3HDNA 5FTQA 3RHXA 4YZCA 3F61A 1R3CA 2PVNA 2VTNA 2XB7A 5C8MA 3AQVA 2J51A 3KQ7A 3PPZA 3QLFA 4OTHA 4CXAA 3MS9A 5KMNA 3QKMA 4XG9A 5A4CA 4BDAA 3IPHA 1S9JA 4K9YA 5KZIA 3RAHA 4FVQA 2C0TA 5LMBA 3V5PA 2B7AA 4MXAA 1SVEA 3GQLA 1ZY4A 2YZLA 5CSHA 3BEAA 4F6UA 4JR3A 4FV5A 2BIYA 4CYJA 1H27A 4YP8A 3R9NA 3C50A 4Z9LA 4M12A 1UKIA 2NPQA 2R3IA 5E7RA 3ZSIA 4IB3A 5IMXA 3GC8A 2PTKA 5FG8A 3ID6C 1OITA 5J9YA 4C33A 3QWJA 5DEWA 2BPMA 4N0SA 4BDFA 3E8CA 2ERZE 4IIRA 4M66A 2NP8A 3A4PA 4PPAA 3AD5A 3BLHA 3P5KA 4FV3A 5DRDA 2ZMCA 3KMWA 2GNFA 5I9ZA 2UW5A 2A1AB 3DKOA 3FZOA 3A4OX 4LMNA 2VTSA 4LGHA 3TKIA 3U9CA 3LCTA 4FODA 4ALUA 5BVKA 3KK8A 5AP1A 3WILA 4GSBA 2JGZA 5H8EA 5IQAA 4AOJA 4XOZA 3RNIA 3G0EA 3QBNA 4WNOA 2ERKA 4YBKA 2PE2A 5FGKA 2HWPA 2FA2A 3Q2MA 2GNGA 5TT7A 1H28A 5B2LA 2C69A 1PXJA 4RWLA 4QDVA 4FSUA 3LLAA 1M14A 2G2IA 2YIYA 3Q32A 2J5EA 3GQIA 3PZEA 2XNMA 4KRCA 4D2RA 3KMUA 4FTCA 4DFBA 3UGCA 1OIQA 4BDHA 2GQSA 5IDNA 5AFVA 5E9EA 3KULB 3D9VA 3P23A 4J98A 1B38A 4FTMA 1K9AA 4YJTA 5ANIA 5AUVA 4TXCA 4BB4A 2H96A 3G9LX 3BZ3A 4IZ5A 3A99A 3NNVA 3I5ZA 3UPXA 4ZOGA 1LEWA 2I0VA 3NUNA 4X7QA 4F9BA 5HTBA 5IUHA 1K2PA 2WMXA 4X21A 4FKVA 5A9UA 2GHLA 3RPSA 3FLNC 2F7EE 4Q2AA 1YXTA 2JKMA 4L42A 3QKLA 5HCZA 3RPRA 4EH2A 1YDRE 5J7BA 3U4WA 4D2WA 5J5TA 3BLQA 3ZC6A 1VJYA 3QQUA 5HE3A 5HKMA 4I6HA 3QC4A 4O0YA 2B0QA 2VWXA 1Q41A 2VTQA 4O38A 3MH2A 4RWIA 4U3ZA 3NLBA 3T3UA 5JSMA 2B55A 4BYJA 3KXHA 3E64A 3LFBA 4O2ZA 3ATTA 5EFQA 2E9OA 3T3VA 4GVJA 3SXRA 3SW7A 3K2LA 3L1SA 2I0EA 4IB0A 3UTOA 4ACMA 3VS6A 3I1AA 3ENHA 1OECA 4XX9A 3ZXTA 2PK9A 2EWAA 1FMKA 3E7OA 3FXXA 3TZ9A 3ZU7A 3DQWA 4UY9A 1OKZA 3DKFA 4J97A 1JLUE 4TZRA 2DWBA 3R1QA 3CQUA 5AR5A 3DK6A 4QP1A 2A98A 2C3LA 3UPZA 2Z7QA 2WGJA 4BN1A 3CPCA 2BFYA 1XH8A 1XH6A 5HG8A 4FSZA 4OW8A 4FL3A 3V3VA 2ZM3A 3O7LD 3E8NA 3MB6A 5AP3A 1PYXA 2WTKB 3LCKA 1ZWSA 2NO3A 3KN6A 4BWPA 3VBYA 4ZSAA 4H3QA 5EDPA 3FZPA 4DHFA 4EONA 5L6OA 3H4JA 1OZ1A 3TIYA 5M07A 3KRRA 5EHOA 1TFFA 1STCE 4HYHA 2X7GA 5E8ZA 3RTPA 3L8PA 2WB8A 3SA0A 4DG2E 2V5QA 2IZTA 4F99A 4NU1A 3VVHA 4V04A 1IA9A 3HGKA 3M2WA 2Y9QA 3NZ0A 5ACKA 3LFCA 4L52A 1J7UA 5T3QA 3RHKA 2J4ZA 2VWWA 5HBJA 2HELA 3TNIA 2R3FA 4O0TA 4Y5HA 3D2IA 4NKAA 3UO5A 2ETKA 3IG7A 3NNXA 5DVRA 3NS9A 1GIHA 4NW6A 3TG1A 1YDTE 1NT2A 2HZ0A 3HL7A 1HOWA 3QZHA 4F9WA 5L8JA 1OBGA 4EK8A 4O7VA 3U55A 3AKLA 1H0VA 4TNDA 2A19B 4O6LA 5GINE 2BKKA 3TACA 4E93A 2E9UA 5E8XA 4EL9A 4IXPA 4X3FB 4AAYA 2XIRA 5BX0A 3HUCA 3W2CA 4C58A 1A9UA 1OGYA 4M3QA 4OTWA 4U3YA 2WEIA 4G3DA 1Q3WA 4FSYA 2HIWA 1OGUA 4FOCA 4CMTA 1M2PA 5LWMA 4E5AX 2E9VA 4HCVA 4ZSLA 4I5PA 5HHWA 3W16A 4RJ3A 2C6MA 4EQCA 2BUJA 2B54A 4QMOA 2YHVA 4M97A 4NIFB 4FL1A 2GS7A 2VO0A 3DV3A 4I6BA 3ZONA 3FLSA 1CKIA 3NUYA 2CCIA 2DS1A 3SRVA 2EU9A 2JFMA 3N9XA 3HNGA 2BHEA 3E62A 3HP2A 3PRFA 4TYIA 5CEKA 5DWRA 2Z7SA 3CQEA 3GU8A 4C61A 4QTBA 3RMFA 3THBA 3VAPA 5I4NA 1W83A 2BZKB 2WZJA 4IFGA 4LDTA 2BILB 3SC1A 3UG1A 3H3CA 5CU6A 3HMIA 4F0FA 2O0UA 1ZYSA 1URWA 3RPVA 4A4LA 4IAIA 5TOZA 5A4EA 3QRTA 3WF7A 4USDA 5HORA 2Y4PA 1FBNA 4FKUA 3HAVA 3RZBA 1HCLA 4DEEA 5A6OA 2X4FA 3EN4A 3MGYA 3BLAA 3W0PA 3P7AA 1OM1A 4JT3A 3GENA 3ULIA 5F1ZA 3JPVA 4NWMA 2X81A 4YSMA 2CGVA 3G6GA 1J3HA 4BTFA 2WQOA 4ZZNA 4FOBA 4FT5A 4TRLA 2YACA 2HOGA 5KCVA 3EZVA 1QPCA 2VTLA 5LWNA 3DJ5A 4CRLA 2WXVA 1JBPE 4FKRA 4L46A 4D4SA 3ZC5A 3KU2A 4N6ZA 4J8NA 4EKLA 1PMUA 3F88A 4AACA 2CN8A 2BAKA 2YAAA 3TV7A 5CYIA 4E5BA 2HW6A 2W4JA 3RWPA 4NL0A 3RCDA 3RP9A 1U59A 1CDKA 5HBHA 3BCEA 3KRLA 4WO5A 5AP0A 1ST4A 2RGPA 2P2HA 4YJPA 2C6IA 3VUIA 3R7YA 1KOAA 3EQHA 4A06A 5AM7A 3POZA 4QYEA 3TYKA 1LPUA 4DF3A 3SW4A 3LMHA 4QP6A 2W4KA 5DPVA 4BGHA 2IVUA 4O22A 2R9SA 4FRFA 4HYIA 4YJOA 5JK3A 5HBEA 2UZDA 1YOJA 2UW6A 3FAAA 3FMKA 1FVRA 3V6RA 1KE8A 1DI8A 2ITYA 2ZJWA 3ZEPA 4HVDA 2BZIB 3CGFA 4RLKA 3FKOA 5EW9A 1OMWA 5J9ZA 4W4XA 4KKGA 3RPYA 3VS4A 4AS0A 2PU8A 5ANDA 2QC6A 1OB3A 2J0LA 1UA2A 4XV9A 3VNTA 3TDWA 4FKPA 3PY0A 2Z60A 3AMYA 3VUGA 2WTCA 4BKYA 4JJRA 4C38A 3GT8A 4AA0A 4F7NA 4QTEA 5EQYA 2UZUE 1UVRA 2QHNA 3DBCA 3IW6A 4JAIA 3F2RA 3MH3A 3TMOA 3R8ZA 3FZSA 2BTRA 2JDRA 4P5QA 4C59A 5CLPA 1ZZ2A 5LCKA 5IEVA 2PHKA 4CNHA 3VUDA 1YRPA 3WZEA 5EHYA 5DRBA 5CX9A 4GT3A 2R3OA 3ZLWA 5JGDA 5IDPA 3EKNA 4IC7A 3UZTA 5M09A 2BVAA 1I44A 3VS2A 4A9YA 4RMZA 3UIXA 1W84A 3W32A 2XEZA 1Q3DA 2BRHA 2QKRA 3BE2A 4KS7A 3RPOA 3KCKA 1FGIA 3CIKA 4TKSA 5FP6A 1PYEA 3H0YA 3PVUA 2RFDA 3TCPA 4BCHA 4EH3A 3CD8A 3G51A 3O7LB 4DH7A 3R6XA 3A7FA 3FMMA 3DK3A 4NTSA 3VS0A 2XJ1A 5D41A 5FM3A 2HZNA 4FSTA 1M52A 4DTAA 1H1PA 2EXCX 1YOMA 3SAYA 1PXPA 5ETAA 3H0ZA 3OEZA 4OR5A 4UMTA 4KSQA 4WNMA 4CGAA 2R3KA 5HD7A 2VTRA 3HRCA 3W55A 5AEPA 2WMBA 5CT0A 3WE8A 3E92A 2ITOA 3OY3A 3A7HA 1TZDA 1Y57A 2B9IA 3R7EA 5ICPA 2OSCA 1W2FA 4IE9A 4UN0C 4XHKB 2IW9A 4NTTA 2C4GA 5I9UA 2C6DA 3A62A 4FV1A 3BHTA 3QGYA 4TYHA 3VO3A 3ZUUA 4FGRA 4BR3A 3WF6A 3HMOA 4KWPA 1Z9XA 4L6QA 5LVLA 3ROCA 4LMUA 5FP5A 4WRGA 5CT7A 3I4BA 4FV8A 2JFLA 3Q53A 2GSFA 3QX2A 3WF8A 4EOIA 3PSBA 3R0TA 3P7BA 2O3PA 4KABA 3G2FA 4FZDB 2BRGA 3Q5IA 4YC3A 2XKCA 4B99A 4DITA 4F9CA 3A2CA 4R3PA 2C5NA 3MIYA 4O91A 3TJCA 4C62A 3IK3A 3FQHA 3PA5A 4LRJA 5H3QA 3RK5A 5LJJA 2UW7A 4ASZA 5AP5A 5TE0A 2ZOQA 2C6EA 3VONA 4M14A 3LJ1A 2ONLC 4GVAA 4QMVA 3CTHA 5EM8A 3MW1A 3RWQA 3W8QA 3JY0A 4F08A 4E4XA 3BU5A 3C51A 4MBLA 1YI4A 2VRXA 2VWUA 3HMPA 4CCUA 2Y4IB 3LJ0A 2PUIA 4E6CA 5AA9A 3A7IA 2EB2A 2E2BA 2GMXA 2PZYA 3S95A 4CLJA 4U43A 3VN9A 3AKJA 3OROA 1ERKA 3UC4A 4AZVA 1KE6A 3ET7A 3PTGA 4RZWA 2XM9A 3CC6A 5IUGA 3CD3A 3IOPA 5M08A 3V6SA 3BYVA 4RQVA 1YI6A 2IO6A 4JX3A 2OICA 2XEYA 3E3BX 3FI2A 3HMMA 3Q4UA 1AD5A 5CXZA 2FYSA 1TVOA 3D2KA 4F09A 4YC8A 4FYOA 3PLSA 2GFSA 1Z57A 2PVKA 3ZLYA 1A48A 2PVRA 4ASEA 4FSQA 4Q9SA 3EKKA 3V5LA 3LCOA 4GUEA 3M11A 3F3WA 4X6RA 2XNGA 1H08A 4D2SA 2XIZA 4J71A 5FWKK 5K9IA 4BDGA 2UZBA 2C47A 3NYVA 4KIKB 2G01A 3HA8A 4V0GB 3JS2A 5DT4A 3K54A 3GC9A 4LG4A 1U46A 3LM5A 5L2TA 4GIIA 2Z02A 4AFEA 3MTFA 4APCA 2RG6A 4WG4A 4C4IA 2PVMA 4L67A 4O0VA 4MX9A 4I5MA 3BBWA 5IA2A 3HVCA 4YHTA 4D2TA 3I81A 2I1MA 4IWDA 4JQEA 4D9TA 5EI2A 3PE2A 4FA2A 4AP7A 1T46A 3HV3A 3BEGA 5A4TA 4K18A 4WA9A 4UMUA 3QQJA 2NNWB 3C4ZA 4FX3A 4L01A 4O96A 3GP0A 2J0IA 2XYNA 2QOQA 4GK3A 2R0IA 3R28A 3EFKA 3IECA 3D5WA 1V1KA 4NCTC 4R7IA 5ACBC 3SKCA 1PJKA 2VTPA 4HCTA 4PY1A 4EH8A 5CF8A