4FOBA

Crystal structure of human anaplastic lymphoma kinase in complex with acyliminobenzimidazole inhibitor 1
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
310
structure length
295
Chain Sequence
b'NPNYSFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK tyrosine kinase receptor
publication title The Discovery and Optimization of a Novel Class of Potent, Selective, and Orally Bioavailable Anaplastic Lymphoma Kinase (ALK) Inhibitors with Potential Utility for the Treatment of Cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 100
structure length 295
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fobA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fobA01
2C1AA 2UZVA 4FSRA 1H1RA 3R1QA 4BDEA 4BWXA 4C2VA 4EH7A 4KSPA 2BRNA 4EL9A 3SKCA 4AW5A 4AE6A 3G33A 2KTYA 3OCSA 1FQ1B 2OJ9A 2W7XA 4OAUC 3AC3A 3H0YA 5M55A 1GZKA 2VUWA 3D4QA 4YPSA 3RALA 2W05A 3KN6A 4XMOA 3ZC5A 1WVWA 2JDSA 2YACA 3QRTA 4O27B 5EKOA 4EHZA 4D2RA 3HA8A 2J5FA 3KXMA 5L6WL 3NYXA 3TNIA 4ZLZA 4HZSA 4MXOA 4FIJA 1FMKA 5JKGA 1IA8A 5I9ZA 4O7TA 5B7VA 4RG0A 4O1OA 3LOKA 5C8MA 4IM2A 2PMIA 3JY9A 4M13A 4EK8A 4NCTA 5H2UA 1H27A 3FZTA 4U41A 2W17A 2QOIA 3DB8A 4G6OA 2B7AA 3ZXZA 4NSTA 5HIEA 3CKXA 4PP9A 1CKIA 3Q04A 3PVBA 4Q5EA 1KWPA 3DPKA 2W4JA 4LI5A 3W2CA 5GZ8A 4OBPA 4U8ZA 4CFNA 2PVJA 4WSYA 3EQPA 4GKHA 1AQ1A 2HZIA 2XJ0A 2RFDA 2X1NA 2XEZA 3K5UA 1VZOA 3OZ6A 4FZ6A 4GYGA 4IZAA 3DLZA 4YJRA 5KKRC 4CZTA 3BQRA 2ZVAA 3MVMA 5LVNA 2BRBA 3LMHA 3Q2MA 2IN6A 3W55A 3Q5IA 3BGPA 3KXHA 5HG9A 1OPKA 3REPA 2YJRA 4L67A 4JG7A 3OT3A 3EQRA 3BELA 3KRLA 2VTQA 5DVRA 3QWJA 3QTZA 1PMVA 2IJMA 1BMKA 4DTAA 2IZRA 2PZ5A 2WMSA 3O8PA 4RPVA 4ZY6A 2OO8X 1FINA 3DS6A 4EZ7A 5AR3A 2P55A 2Q0BA 3LLTA 3BHYA 3N4UA 4R3PA 3EFWA 4EORA 4XRLA 4N57A 3FLWA 3QUDA 4BZOA 4RQVA 4JQ8A 3SXRA 1STCE 2WTKB 3PXKA 5E8YA 3EN7A 1Q8WA 3UOLA 2R64A 2O5KA 4IQ6A 2VX3A 4NW5A 2QG7A 4I6FA 2J2IB 2YITA 2O65A 4NCTC 1KE6A 2VTJA 4JX7A 3MTLA 4RC3A 4FA2A 4IJ9A 4J99A 4A9UA 5AP7A 3FMKA 3EB0A 3FUPA 3RKBA 1ZYDA 1KOAA 2YA9A 3OVVA 3QTSA 2RG6A 4YSMA 5HGIA 5HOAA 5M07A 3R0TA 2VRXA 3UODA 2UUEA 1WMKA 2VX1A 4W4WA 4PV0A 4EOSA 2ACXA 1JNKA 4U80A 3WZUA 1QPCA 3G2FA 3COIA 3TG1A 1GIHA 4HYHA 1HCKA 4F09A 4H1JA 3TUDA 2X4FA 3FQEA 2HIWA 5ETCA 4EH2A 4II5A 4TNDA 4RC2A 1DM2A 5AX9A 2QOFA 2Z7RA 3LCOA 4DINA 2C3JA 4G3FA 3C0GA 1FGKA 4D1ZA 4XLVA 2WZJA 4MD8E 4AOJA 2BZJA 3SLSA 3KB7A 4IE9A 3DDQA 4BKJA 3QALE 2XK7A 4L44A 4CTBA 2ITOA 4FG9A 1IAHA 5CEPA 4P5QA 5EH0A 3A2CA 3ELJA 1R0EA 5JN2A 2Y0AA 3F2RA 2HELA 4WNMA 5AR7A 3FYKX 5K0KA 4CT1A 1U5QA 4GFGA 1FOTA 4S32A 3W2RA 1OB3A 3OXIA 2H6DA 4QPMA 3LLAA 4FKGA 2W1CA 4FEVA 2ZV9A 2VWBA 5L6OA 1BI8A 4YZNA 4O7YA 4B99A 3PA5A 4RVLA 2GDOA 4ZLYA 4RWJA 5ANIA 4G2FA 5CENA 3ZFYA 4J96A 4BGHA 2YIXA 4ZMEA 1K2PA 2GNGA 3GC9A 2QNJA 4HJOA 5AMNA 4BIDA 2UVYA 3DOGA 2GTMA 4ZS4A 4OTFA 3QRIA 4ANQA 3ORMA 5E9EA 2YDJA 3FY0A 3CBLA 2X81A 4PUZA 4QP6A 4L43A 2GS2A 3OXTA 4ENXA 4FSQA 5HX6A 1ZMVA 4KA3A 3EN5A 1J7UA 2YIRA 3V5WA 4ACMA 2YM4A 5KBRA 3PY1A 4GT5A 1SM2A 2XIXA 2QLQA 3IONA 4YTHA 4HPUE 4U0IA 1GZ8A 3ZLYA 1M7QA 1H8FA 3V5TA 3Q4ZA 3NVMB 3R1YA 3ORZA 4QRCA 2ZDTA 3A8WA 1G8AA 4HYIA 4AGCA 5LMKA 4NM5A 3FKOA 3RPOA 1WBTA 5EDQA 1TKIA 3Q52A 3NX8A 5CEQA 3R7GA 3DT1A 4FT7A 2A4LA 2OI4X 2WMBA 4CFVA 2GQSA 4IZ7A 1B38A 4UY9A 5IMXA 5IQHA 4C62A 1Y6BA 3CKWA 2O64A 3VVHA 4FTIA 1V0OA 2VTLA 1UKHA 5HTCA 2Q0NA 3DV3A 3RNYA 4EOMA 3IDCA 4DA5A 4QP3A 4FKLA 3HA6A 3IGGA 5DG5A 4FKIA 4UBAA 3ZLSA 2CGXA 5DE2A 4FL2A 4QYHA 5E8XA 1UNLA 3O8TA 1VEBA 1M17A 3AT2A 4MVFA 5AA9A 4QTBA 3TNWA 5BUJA 4JVGA 1KSWA 2ZV8A 3RWPA 3R1SA 4QTDA 3EKKA 4BBFA 1XH5A 4ZY5A 4UMTA 2VWZA 5HQ0A 4F0FA 3OWJA 4MD7E 5EFQA 3WI6A 4E6QA 3DGKA 4WBBB 3FHRA 3GEQA 1BI7A 2X8DA 2QOHA 2FSLX 3DKFA 2CCHA 4O0XA 2F4JA 2FA2A 3FC1X 2JBPA 2JAMA 4E20A 3KXXA 3EL7A 5LVMA 3KY2A 5AP4A 1YKRA 3SQQA 3ZUTA 3UVPA 2UW9A 4RFMA 5CEOA 3NR9A 2VD5A 4AW0A 5KMJA 4G3CA 3VS2A 4JBQA 4I5HA 3LMIA 3MVJA 5BUEA 3AMBA 2PUUA 3Q9XA 4E5BA 4BI2A 1JKTA 2F49A 4EYJA 4J8MA 2C69A 4EHVA 5HG5A 4ASZA 4C4EA 4K11A 5AFVA 3M1SA 4QMVA 5T3QA 4XG2A 4RA4A 5AV3A 1PXMA 3R28A 4M12A 5LMKC 2VWIA 3QU0A 3TNQB 3W10A 5HHWA 4HNFA 3IOKA 1YXXA 5L8JA 1ZOEA 3EQHA 3QRJA 4TYJA 3TACA 5KMKA 3V01A 3II5A 3A4OX 3PE1A 3POZA 4IAYA 4QMYA 1YOLA 3R02A 1KV1A 4ZTMA 2WMAA 4WD5A 4RVTA 3G51A 3QYWA 3PXQA 4FZAB 4RIYB 2UW3A 2WIPA 1YOMA 4RJ4A 4Y73A 3ATTA 2W9FB 3VS7A 5H9BA 4C3PA 4X6RA 4C59A 1IA9A 2R3MA 4IAIA 5FWKK 2YJSA 3RBWA 3ZYAA 4M0YA 5IZFA 4USFA 4BR3A 1OITA 3UYSA 3PA4A 4JRVA 1PRYA 2JAVA 3BLQA 1SNXA 3BYSA 1Q3DA 3FHIA 3DKOA 5B2LA 3UQCA 1WBOA 4MHAA 2G1TA 4QYEA 5HVYA 4YZMA 4UALA 3F3WA 1WCCA 1OGUA 4XNEA 4MXZA 3AMAA 4GU6A 4ARKA 4HZRA 2BKKA 3L8SA 4EKKA 3Q9ZA 5KCVA 4IWQA 4EC9A 3AQVA 3QC4A 5H8BA 3DBDA 2BFYA 3RM6A 3QBNA 3FLZA 4GFMA 4O83A 3FSFA 2ERZE 3FXWA 4PDSA 4DGMA 3ZLWA 4TYHA 5C4LA 1BLXA 3R7UA 4RMZA 1YHVA 4FK6A 4RWLA 5FM3A 5AR8A 2YDKA 4FZFB 4G34A 1G5SA 3KEXA 4QPAA 3C4FA 4IANA 3UP7A 5EM5A 3LM5A 4MNEA 1VR2A 3VS0A 3MV5A 4QQJA 2CN8A 4M3QA 3WZEA 4RT7A 4DFBA 3H10A 5KMNA 4HGLA 5ANGA 5HE0A 3U9NA 3AOXA 3D9VA 4O1PA 4YZ9A 4FE2A 3DJ7A 1UU7A 4FV2A 1OI9A 2GS6A 2XNMA 3ROCA 2X2LA 5FLFA 2VU3A 5GJDA 4G3EA 3R73A 2R3NA 2YHVA 5B0XA 1YI4A 3JUHA 4XRJA 3E8CA 4MF1A 4V0GB 3T3UA 5DR2A 3EZRA 3K3JA 4OR5A 5A3XA 5FXQA 3JY0A 4FTNA 4GV1A 5GJFA 2WEVA 5L2SA 3EQIA 4D1XA 2W1EA 4C7TA 3RNIA 3PPKA 1E9HA 3TZMA 1JSTA 3QKLA 1OIUA 5D1JA 4BCFA 4I5PA 1GNGA 3KREA 3SC1A 2F7XE 3VRYA 5KHWA 3KK8A 4F6SA 5F94A 4TWOA 3RHXA 5LCKA 3MFUA 3EHAA 3HMNA 2Y6OA 3NPCA 3PIXA 4LMNA 4A9TA 1J7IA 3QD2B 4NTSA 5M09A 5EYKA 2PVLA 5ACBC 1R78A 4ASEA 3TTIA 2HZ0A 2ITQA 5E8VA 4EJNA 4IMYA 2PVMA 2HCKA 2ZM1A 1LPUA 3DAJA 3GCUA 1I09A 4GK2A 4QMOA 3U54A 1YVJA 4IBMA 2Z8CA 1MRVA 5DNRA 2PE2A 2XZSA 4QYFA 4OGRA 3W2SA 4HCUA 1OM1A 2OJFE 4YBKA 4G6LA 3WOWA 2EXMA 5DLSA 4EC8A 5CU4A 5EK7A 3ROYA 1WBPA 2OSCA 4JBVA 3LQ8A 1VYWA 4I93A 4IXPA 4JG6A 4ZSLA 5A4TA 4WG4A 2OF4A 3QD0A 3LJ2A 2YIWA 3EQFA 5IA5A 3C0IA 4DBNA 4QQTA 5HKMA 4EH5A 5L3AA 2QU5A 1RJBA 4X2JA 5T68A 5HD4A 2NNWB 3FXXA 4L01A 3AGLA 4AOIA 2GNJA 5AP5A 4BCJA 3F82A 4ZS0A 4QMNA 3E62A 3DZOA 5EW3A 2EXEA 2OXXA 3QYZA 2WTCA 5G1XA 2Y6MA 4I6BA 4PMPA 4FICA 5EW8A 4D2PA 2JIIA 2YIQA 2QHMA 2V55A 3L9MA 1E1VA 2RSVA 3POOA 4Y8DA 3ZXTA 4E1ZA 3I0QA 4RWIA 5LVOA 4HVGA 4O86A 3GU8A 4AA5A 1YW2A 3NUUA 4JIKA 4PY1A 4AU8A 4QP7A 4BWPA 5E1SA 3O23A 5AV0A 5I9UA 3IW6A 4ZAUA 4LFIA 1BX6A 2JIUA 4F7LA 2E9VA 4QP9A 4CZUA 2C0IA 3P86A 1OZ1A 4FT9A 3NWWA 4EWQA 3FLQA 4UWYA 3NUYA 3ULIA 5HTIA 4PL5A 1M2QA 4DLIA 5IH6A 1WBWA 2ITTA 4BYIA 4XEYA 1OMWA 4YMJA 1XJDA 1Z5MA 5HCZA 5JQ5A 2Y4IC 5BVNA 3PZEA 1KE5A 3DLSA 1JKSA 3ZDUA 3LE6A 4Y5HA 3PE2A 1OL2A 3KRJA 2GNLA 3MA6A 4GG7A 2QO2A 4FUYA 4FG7A 4I0RA 1YHWA 2CJMA 5TO8A 1QPJA 3PVUA 3T9IA 3UTOA 4JDKA 3MA3A 2UZUE 4ZOGA 4ZTNA 4QO9A 3QAME 2PPQA 4ASDA 2VTNA 3GUBA 5CI6A 4FV6A 4S34A 2XF0A 3LQ3A 5FG8A 5JT2A 3QQJA 4FV8A 3PVWA 4K2RA 3R7VA 3AT4A 5BVEA 2A1AB 3LCKA 4PF4A 1ZRZA 4LGGA 1MUOA 4LQMA 3DB6A 2IVUA 3JYAA 3LIJA 4JR3A 3D7TB 1DI9A 3AMYA 4FKRA 4DG2E 2YCSA 1KOBA 4FI1A 4MYGA 3WF5A 3K3IA 5EM8A 1WZYA 4TWCA 2YZLA 3O7LB 4F99A 3DQWA 4DEBA 1FVTA 4DHFA 3SOAA 1XKKA 2J0JA 2XKCA 4KIPA 3V5QA 3CEKA 5EG3A 3WZJA 2CHLA 3K5VA 4KBKA 2P2IA 1CTPE 4PPCA 4YJVA 5CNNA 4A4OA 3PJ2A 5HNIX 4AZWA 4O38A 4XCUA 4X3JA 5IKWA 5AAEA 2PZIA 3QCXA 2X39A 3Q3BA 4TYEA 3UMXA 4BCGA 4V04A 4ZTSA 4F9CA 5A4LA 2ZM3A 5KNJA 3HYHA 4C4GA 4EONA 4PTGA 3HZTA 2R3JA 3LXLA 4RJ8A 4M97A 4KWPA 4C33A 4NH1A 4G3GA 5AIKA 2XIZA 3UO4A 5DR6A 4O7ZA 4O84A 2W4KA 3S0OA 1H1QA 1PW2A 4ZJVA 4O91A 3FI8A 4IB1A 2C3IB 4JG8A 4L9IA 3U87A 4C8BA 3VUKA 3Q2JA 2GHGA 3N4TA 4G31A 4CMUA 5JZJA 2CNQA 1OVEA 3GU6A 4JAJA 3P7AA 5CAOA 4U97A 1R0PA 3VS1A 3NYOA 5FP6A 3ANQA 3R2BA 2WPAA 3PSDA 4XOYA 3ZH8A 3DXQA 4IWPA 2QR8A 3ALNA 4TKSA 3U55A 1J3HA 5HNBA 4W4XA 4ZXTA 5CF5A 2XK4A 2WOUA 1H0VA 2OIQA 2P0CA 4XHKB 3TNHA 3MI9A 4JAIA 3DZQA 1PXLA 5HG8A 4NT4A 4E4NA 5GHVA 4AUAA 4F9AA 1RQQA 3D2IA 5CNOA 2C6KA 3BHUA 4RIXB 4ANBA 4FKPA 3LJ0A 4U7ZA 2NPQA 4KABA 5DN3A 4UMRA 2SRCA 4W8DA 3VBTA 4C3FA 4CQEA 3NAYA 4BKZA 2C3KA 1GIJA 4WBOA 4RBLA 2RFNA 4X2KA 2XCKA 4BDDA 3QTQA 3SDJA 2WXVA 2DWBA 1K9AA 5AUXA 3FEGA 3ZEPA 4GL9A 4PQNA 4EH8A 5BVFA 2RG5A 3VF9A 4YURA 3P7BA 3HGKA 3E93A 4EJ7A 2I40A 3EQDA 1Q41A 2C5XA 3HP5A 5BYZA 3HV7A 1CDKA 4F64A 3H9RA 3RPVA 4MD9E 1KUTA 3ODYX 4U45A 3VQUA 5CZIA 3TV4A 3KRXA 4QOXA 2REIA 3TZ8A 2QURA 4R5SA 5M4FA 3FL5A 4JJRA 2G2FA 4NWMA 5C26A 4JS8A 3BEGA 3DBFA 4EQCA 5IG1A 3G5DA 2BCJA 3UPXA 3SA0A 1OBDA 1V0PA 4I6HA 1AD5A 4JQEA 2C0OA 3ZSGA 3N4VA 2XEYA 4JBOA 4KKHA 3VBXA 3U51A 4QP8A 3TUBA 2GU8A 2V7AA 3CQWA 4JR7A 5CXZA 1UA2A 4FKJA 3R7EA 1OKYA 5E90A 2R4BA 2C6TA 4JRNA 4QTCA 1F0QA 1J91A 5E8ZA 3R6XA 3C50A 4ZZMA 2C6LA 1OPLA 3MPMA 5HD7A 3ENMA 3TZ7A 2IZUA 4LRMA 5BYLA 4FSWA 3Q53A 3FPMA 4S31A 5FBOA 3G9NA 4W4VA 3WF9A 1UVRA 3E87A 2UZLA 4O0SA 5CASA 4C36A 3MJ2A 1XH9A 3FQHA 4X0MA 2WD1A 5CT7A 5EI2A 4QMQA 3FE3A 4MWHA 2Z60A 2B9IA 4AZEA 2AC5A 4GMYA 3GB2A 3TV6A 3U6HA 5J1VA 2CKOA 2A19B 2GNHA 2J7TA 5CSHA 4K0YA 4F9BA 2OZAB 4F0IA 4Q9ZA 4B0GA 4EOOA 3DFCB 2QD9A 5HO8A 4NJ3A 3SAYA 4ASXA 4XBRA 4DH7A 1IR3A 2XCHA 4RJ6A 4OAVB 5IH4A 4O0UA 3NUPA 4NM7A 4B7TA 5HU9A 3BYOA 2W1ZA 3QQUA 3RAWA 4M84A 2CN5A 2ZMCA 5J7BA 3D94A 3RCDA 1YWNA 3GP0A 4J1RA 1H4LA 2W1IA 4A9RA 1ZOHA 1IG1A 4AZVA 3R9RA 1U54B 2XBJA 5ANDA 1ZWSA 3W18A 4FSTA 5CU0A 1ZYLA 3R8UA 2XA4A 4AW2A 3VUTA 3G6HA 2JFLA 3C4CA 4BF2A 1GJOA 5CF4A 4OTHA 1JOWB 4Z7GA 4UYNA 5IA3A 5IA4A 2R3KA 1YRPA 4RIYA 4YTIA 2YAKA 2FVDA 3AC1A 4H39A 4X2FA 3WBLA 4ALWA 3SG8A 3ET7A 4I22A 4PTCA 2CGVA 3GQLA 3KULB 3QWKA 5AV4A 3CR0A 5KMIA 3AG9A 2CCIA 3ACKA 4M67A 5CAUA 2XK6A 3VN9A 3DBQA 3BU3A 3G0EA 2WQOA 3R30A 4MCVA 4BIBA 4M68A 2YISA 3P08A 2JKOA 4M69A 4EBVA 3UVRA 4XH6A 4NM0A 3P79A 4FTMA 3OUKA 5CU3A 2C5YA 2UV2A 5DEYA 4CFXA 5JRQA 3CTJA 1BYGA 2I0YA 2WTIA 3F2AA 4FT3A 2OBJA 4TPTA 3RI1A 5CAQA 3AXWA 1ND4A 4DH5A 2VO7A 3K2LA 1NT2A 4L68A 2ITXA 4O22A 5HI2A 2GS7A 4O0RA 1K3AA 3LFNA 3TEIA 4WSQA 5AR2A 4C4JA 1Y91A 4GVJA 3AD4A 4QTAA 2OFVA 5J87A 4D4SA 4F9WA 5J8IA 5IISA 3VBWA 4IAFA 3EFKA 4IVCA 4DGNA 2C6OA 3QQGA 3F66A 3FKNA 4KINA 5JGBA 2FB8A 3PG3A 4IAAA 3E3BX 3OTVA 4IWOA 2PVFA 3GI3A 2W5AA 3UNJA 3GVUA 1JSUA 3OEZA 3FAAA 1E1XA 4FKVA 4YC3A 4ANOA 4CKRA 5HCXA 5K4JA 2XNGA 2RFSA 3SV0A 1ZYJA 2VTSA 2XP2A 4FYOA 3ZSHA 3HVCA 2X9EA 4L3JA 2XYNA 3RGFA 4WG3A 2VTOA 2O2UA 1Q8TA 3QQFA 4UWCA 5EYCA 5IEVA 4FIFA 4J97A 3CTQA 3S4QA 3HV6A 4UMQA 3R7YA 4BIEA 2CNVA 2YFXA 3GCQA 4ZSJA 5HO6A 4RWKA 3PA3A 4YO4A 4O0TA 2X6EA 5FBNC 3VRZA 4BYJA 2CKEA 4G9CA 1OKZA 2VTPA 5FD2A 4BHZA 1M52A 3LM0A 3UOJA 4MKCA 2ETKA 4OUCA 5FTQA 4LYNA 3D5XA 3QQHA 5HBHA 4ORKA 4OBOA 4YLLA 3DNEA 2E9OA 1PKGA 1FMOE 4KS7A 3R8PA 4AGUA 1DS5A 4YP8A 2CPKE 4XG7A 5CQWA 5IQFA 4XX9A 3LPBA 4K33A 4X3FA 4DCEA 1WBVA 1URCA 3ZU7A 3UNKA 1H1WA 3QZIA 4USEA 5M06A 2QODA 4MXYA 5KX8A 4JDJA 4YO6A 3CY3A 3OS3A 4FX3A 4RLLA 3GCPA 1QCFA 4E5AX 3R8ZA 2XBAA 2GNIA 3BGQA 3TDVA 3SRVB 3VWAA 4EH6A 3DKGA 3OHTA 2J9MA 4I0TA 3T9TA 4I4FA 4DEEA 3TUCA 5BYYA 5M56A 2C1BA 4FIHA 4H3QA 3OD6X 4BCOA 3P7CA 3WZKA 5LVPA 4DT9A 3LZBA 5I9XA 3O17A 4I41A 4AF3A 3G15A 5HESA 4LMUA 1J1BA 3E88A 3IQ7A 1H24A 3CGOA 2WB8A 1H26A 3UG2A 4FUXA 3FQSA 4AA4A 3NW5A 5HTBA 3ETAA 4U81A 4BDGA 4BTJA 2GFCA 2XNBA 3EFLA 4EOKA 5FP5A 3MIYA 3D0EA 3OEFX 4MBLA 5C27A 1YDRE 3C4WA 3ZM9A 4B4LA 4NK9A 5A14A 4QMSA 4AGWA 5LOHA 4LV8A 4L42A 4V05A 5HE2A 3I6UA 5L2IA 1JKLA 4IACA 4EUUA 4OTPA 4MQ2A 4D5KA 4C3RA 1ATPE 5K9IA 3KVXA 1B39A 3TNPC 4PDYA 5E8SA 4CLJA 3WE4A 4IVAA 4C2WA 4X3FC 5A4QA 5K5NA 5AV2A 3TXOA 1LEZA 3R01A 3BPRA 3I1AA 2J0IA 2IO6A 4Y72A 5C4KA 1H0WA 5M4UA 2HY81 2PVYA 3BHVA 3FC2A 4TT7A 3EOCA 4X2GA 3KMWA 5FDXA 2XK3A 3COKA 4D9UA 4ZTQA 4AW1A 1YDTE 1P2AA 5AJQA 3VW6A 1GY3A 1ZXEA 3RAIA 4J7BA 4MBIA 4CCUA 1NXKA 1REJA 3UZPA 3I60A 4UN0C 5HCYA 3UDBA 2B4SB 4IWDA 3BX5A 4DF3A 4D55A 2C6EA 1AGWA 3BKBA 5AUVA 3M42A 4IFGA 2CSNA 3UOKA 4H3PA 4CMOA 4CQGA 4BGGA 3MY1A 4FSMA 4FVPA 5AM7A 4HGEA 5AV1A 4D1SA 2JDRA 4E4XA 3C4EA 3T8OA 3C4ZA 5CALA 5M08A 5LMBA 3I79A 3TJDA 4FTKA 5K0XA 3GC0A 2QR7A 2W99B 4GEOA 3R9DA 4JL9A 3OF0A 5CF6A 5KUPA 1Y57A 4IB3A 2C5OA 3W2QA 1YOJA 3D7TA 3QRKA 3LFCA 1YXVA 2BDWA 2IZTA 3WF8A 4FNWA 2OJGA 3OTUA 5I9WA 5ANJA 4YR8A 4H05A 4CG9A 2VTHA 3LQ5A 4E4MA 1WAKA 4DGOA 2IWIA 3HUBA 3UIXA 2I1MA 2O0UA 2PSQA 2X9FA 3FJQE 3HMPA 2XNPA 5DT4A 3KXNA 1UWJA 4CRLA 1WBNA 4FTQA 2ITWA 3D7ZA 1TQPA 4WOVA 4GIHA 2ZMDA 2C6IA 5BUIA 1XH4A 1CMKE 3EN6A 4FSZA 2PZPA 2VWXA 3MVLA 4XP2A 4IX3A 4AGDA 4DTBA 4FTJA 5IMEA 3QGWA 4C57A 5BQ0A 1L8TA 3ORPA 5T6KA 4XG8A 4KIKB 5GJGA 3VJOA 4R1VA 2GPHA 2I0EA 3KA0A 3R63A 5L2TA 1UV5A 4IX6A 3BRBA 5D11A 3AT3A 4O0YA 1O6LA 2FSTX 3QLFA 3PJ3A 4X21A 4YHJA 5EYMA 1YWVA 4F7NA 1A06A 4ACHA 1JPAA 4U5JA 3LVPA 3N9XA 3F5PA 2BUJA 2DQ7X 2WQNA 5AUWA 3AGMA 1NY3A 5J95A 1M2RA 2QU6A 2O3PA 3PWYA 5EDPA 3WIGA 4Z7HA 4WUNA 3UJGA 3VO3A 3ORNA 4FVRA 3CJGA 4ITHA 1BUHA 1IEPA 4O0WA 3L8XA 2YM7A 2QKRA 4NEUA 4I1ZA 3OT8A 2W9ZB 3KN5A 5IQEA 3OOGA 3QTXA 5CSPA 3PFQA 3I7BA 3G9LX 4AOTA 3UQFA 3EL8A 4GIIA 3QL8A 5ETAA 1PY5A 3U4WA 3VUGA 2WMWA 4XG9A 5KZIA 2B54A 4KD1A 4EWHA 4U6RA 3RWQA 1S9IA 4AZFA 4RIXA 5HIBA 2BRGA 2V22A 3IDPA 2JKQA 3CQEA 4DEGA 3ERKA 5A4EA 5JK3A 3MFRA 1SZMA 4HVHA 4UMPA 5CANA 5KBQA 4Y95A 1OUKA 2NRYA 3TCPA 2OGVA 3KKVA 4MXXA 4WNPA 1W83A 4PPBA 4F0GA 4KB8A 4DTKA 2G9XA 2R3LA 3TWJA 4A4LA 4EZ3A 3O0GA 4ZSAA 5DMZA 2I6LA 4FSYA 4HYUA 4J95A 4UYAA 5HEZA 1JAMA 1REKA 3OOMA 5CWZA 1OL7A 3F3UA 1SVEA 2G2HA 5DT3A 4RFYA 4YJNA 4FR4A 2ETRA 4FV9A 3P1AA 3ZBXA 1DAYA 2JDTA 4XOZA 4XP0A 5AA8A 4YU2A 1ZARA 3BHTA 3Q6UA 4JNWA 2QOOA 4NZWB 3OBGA 3ZO3A 1U5RA 4O7LA 1Z9XA 3TM0A 2UW0A 1PXOA 3PSCA 3NDMA 4CNHA 4Z55A 3DNDA 4HW7A 1OIRA 3Q9WA 2WMUA 2VWUA 4EI4A 5BX0A 4BGQA 3NUSA 4AQCA 2Z7SA 1RDQE 1UNGA 2C68A 5CXHA 1KE8A 3FZ1A 5F1ZA 5AAFA 3ZRLA 3CSVA 2BTRA 5GNKA 4DE4A 4BY9E 1OPJA 3R8LA 5IQDA 4YNEA 2UZEA 2PUNA 4I0SA 3PXRA 4TXCA 4O7WA 2C30A 5CVHA 4E7WA 4N6YA 2PMOX 4AN2A 3V6SA 4HCVA 3KF7A 5FGKA 1O9UA 3IW5A 4CEGA 4L52A 4S33A 3GCSA 4IAKA 4QMTA 2VO6A 4BWKA 3GBZA 3D5VA 4IJPA 1DI8A 4U42A 3RK5A 2XMYA 4A07A 3UPZA 4O82A 5HIDA 1OUYA 4JOAA 3QXPA 2PVRA 2BAQA 5KMOA 4QT1A 4CFMA 3S95A 5L8LA 1W7HA 3GU4A 3RP9A 3VF8A 3FMHA 3LFEA 3GU7A 4AZSA 3UC4A 4FV5A 4ZSEA 4R7HA 3RAKA 4EK5A 1CKJA 1OBGA 2Y4PA 3F3ZA 4CG8A 2VAGA 5TF9A 5A54A 3ALOA 3MESA 3QHRA 4AE9A 4BDJA 3PZHA 2PTKA 2VO3A 3CPCA 3NNWA 4FSUA 4O2PA 3KL8A 1Q62A 3ZCLA 4XV9A 4IZ5A 4QMLA 4TY1A 3SX9A 4AFEA 4RVMA 2UZOA 2VGOA 4EOLA 4KAOA 1U54A 5HVKA 4K18A 1YQJA 2ZAZA 4XS2A 1H08A 4BB4A 5BVKA 4RVKA 5IA1A 5JFSA 4FTOA 3I4BA 4D4VA 3NMUF 2OJJA 4N70A 1YHSA 3KMUA 3OY1A 2YCRA 3F9NA 4BN1A 1P14A 4FL3A 3QZGA 5L8KA 3VUIA 3U9CA 3OWKA 4U40A 5M57A 4G3DA 1A48A 1XHAA 2H9VA 2VWVA 3FMDA 2XJ1A 2NO3A 4RRVA 1ZY4A 4D58A 5LJJA 3C13A 3PPJA 3R21A 2IVTA 2XKFA 3TIZA 4Z3VA 2CGWA 1Q8ZA 4YZBA 4HCTA 4CYJA 5D12A 4ZY4A 3BYVA 1A9UA 2QHNA 3MB6A 5JGDA 5JFXA 2QONA 2VWYA 4CFWA 1P4OA 4CVAA 2AUHA 3PJ1A 3R1NA 5CSWA 3NUAA 3MW1A 4QYGA 2YM5A 4TTHB 4MWIA 4EEVA 4RLKA 5DR9A 5HO7A 1ZYCA 3B2WA 2R2PA 5A9UA 2W06A 4YTFA 2W5BA 4DGLC 4BL1A 2VTRA 2WEIA 3DAEA 2XNEA 4IW0A 3W1FA 2XKEA 4EQUA 2PYWA 2WGJA 3LFAA 2FSMX 5EQYA 2BROA 4FK3A 4BI0A 5L2QA 5CVGA 4FZ7A 4DC2A 2PULA 1LR4A 4IVBA 5LXMA 5TT7A 2DS1A 3VUDA 4FNYA 3RZFA 2PL0A 1PXNA 3E8EA 2B1PA 5E1EA 5AUTA 4F6WA 5ANKA 1V1KA 4KRCA 5LARA 3F3TA 4Z16A 4DFZE 1JSVA 3GOKA 4JDIA 3S3IA 4BHNA 5M44A 5FUTA 4NW6A 4YJSA 2QOBA 4EHEA 4HVSA 4DEIA 4PNKA 2JEDA 3U4UA 4DH1A 3PYYA 1MRUA 4LL5A 3QC9A 1XR1A 3BBWA 5GIOE 1J7LA 4WG5A 5M53A 2X8IA 2WQEA 4FEQA 1W98A 2YDIA 4FL1A 2UW4A 4TWPA 3H4JA 4YBJA 3OC1A 4BTMA 2ITZA 4E5WA 4F1OA 2YERA 4QYYA 3R9NA 3C7QA 5K3YA 3WARA 5HLNA 3BLHA 1QPEA 3CIKA 2R3RA 5FEDA 5A6OA 1W82A 3A4PA 3G90X 1SVHA 3RZBA 5IEXA 5D9HA 3FZSA 2P4IA 3LFQA 4UZDA 2YLEA 4GT3A 4Q9SA 5HORA 5ICPA 3SW7A 3OROA 3P78A 2GMXA 2C6DA 3OXZA 3KQ7A 3QA0A 3HKOA 4TYGA 2OLCA 1H01A 4O96A 3BE2A 4RX8A 3R9OA 3Q4CA 2E9PA 3MFTA 4M66A 2JDOA 4UXLA 3R8VA 4F6UA 4RIWB 2J6MA 3C0HA 3R71A 2QCSA 3CD3A 2WTWA 3GGFA 2JKMA 2PVKA 3PUPA 3F61A 3HL7A 4MXCA 4QP4A 4FTUA 4GJ2A 4RJ3A 5EDRA 2LGCA 4G1WA 4L3PA 4YGAA 3UE4A 2YCFA 3BU5A 3JXWA 2YIYA 5FXRA 3AC5A 2EB2A 2OG8A 4MX9A 3QX4A 4MF0A 5IQAA 4QPSA 2OFUA 2R3QA 3I7CA 4KIOA 4Y85A 5AP2A 3U6JA 4GKIA 4IVDA 4IM3A 4YJTA 3W2PA 3DQXA 4BCMA 1MRYA 4I3ZA 2YLFA 4EUTA 2RL5A 4GS6A 4MH7A 4YUQA 2BTSA 3GXLA 1XH6A 2OF2A 3IECA 3MH0A 4E3CA 4JT3A 4ZZOA 4YJOA 3D5WA 4FZDB 3F88A 3MYGA 3ODZX 4FKSA 3OFMA 2I7QA 5CTPA 4FF8A 5I5ZA 2PU8A 4YHFA 2VTMA 4I4EA 4YZDA 3UGCA 4ANSA 4U9AA 4F63A 4V01A 4NIFB 3TKUA 2BILB 4UWBA 3G6GA 5IH5A 3NNVA 3DK6A 3OP5A 2WTKC 1ZLTA 4FNZA 4K8AA 3VHKA 4G6NA 4QNYA 3P5KA 2PUIA 4DBXA 5E4HA 3FMNA 4I92A 1FVRA 4L7SA 1YDSE 2BZKB 1EH4A 4PRJA 1PXJA 2A2AA 2HENA 2I0VA 2F2UA 2PY3A 3VUHA 4NUSA 1Y8GA 5LMAA 2XB7A 5C9CA 3F5UA 3CCNA 3VJNA 1XBAA 3UVQA 4F4PA 4QTEA 4FEXA 5CAPA 2IVVA 3QKMA 2B9FA 4PDOA 4I23A 4KS8A 2XM9A 3FMEA 3HLLA 4R6VA 2GQGA 4IC7A 3V5PA 4ZEGA 4EK6A 4FKTA 2Q83A 1UWHA 3ID6C 3HECA 5EHYA 3CS9A 5J9YA 3IKAA 3VAPA 3ORKA 5D7VA 3GOPA 3F2NA 3W32A 3OY3A 4BZNA 2C6MA 4GUBA 4RJ7A 3COMA 5EI6A 3MFSA 5KE0A 5JSMA 5FM2A 3FWQA 5IQGA 2QKWB 4D0XA 3NSZA 4GT4A 3RPSA 3V5LA 2CNUA 3L1SA 2X7FA 3R2YA 4OW8A 4WNKA 4B9DA 4P5ZA 2WTVA 3I5NA 4IX4A 5GZ9A 2Z02A 3W16A 4NYEA 3ZUUA 4Y46A 2XNNA 1QPDA 2XK9A 4MK0A 5CVFA 1MQBA 3KCKA 4ZTHA 3SD0A 3WYYA 1OIYA 4IH8A 2X8EA 3VS6A 2RKUA 4BZDA 2G01A 3BWFA 1Q3WA 2A27A 4RQKA 2BIYA 5BNJA 2BR1A 3FY2A 2IW8A 5DHJA 1W84A 2PK9A 4FOBA 4OTDA 3ULZA 1LUFA 3WYXA 4JLCA 5J1WA 3NUXA 4FMQA 4B8MA 1JQHA 4ZMFA 5CU2A 4O2ZA 4UZHA 3PVGA 3FBVA 4H3BA 4QMPA 3NS9A 4ANLA 3RVGA 3LAUA 3TKIA 4KKEA 3A7FA 4DYMA 5CS6A 4JX3A 4C4HA 4KBCA 4ZTLA 2CLQA 3RJCA 4FC0A 4A4XA 2HYYA 5CU6A 3F7ZA 5DT0A 3AC2A 3BEAA 5DYJA 4YC8A 4YHTA 5BVOA 4XG3A 2GCDA 4NFMA 3RPYA 2X4ZA 4ZJJA 2XRWA 3GT8A 3IG7A 5F4NA 4RGJA 5J9LA 2X7OA 3EQCA 3JPVA 4GW8A 3FI4A 5HLWA 3V04A 4EOQA 3V5JA 3OCGA 5FRIA 3TZ9A 3ZFXA 4IDTA 3R8MA 3A61A 3WILA 3ZM4A 3RM7A 1GZNA 2BMCA 3EYGA 2QVSE 4E4LA 2FUMA 4OT6A 4KIKA 3BYMA 5FQDC 4EBWA 3E7OA 3VQHA 4HYSA 2W1FA 4WRGA 4MNFA 4AX8A 2XKDA 4LL0A 4DT8A 4XUFA 5D41A 2X2MA 5DEWA 4FGRA 2BKZA 4U43A 1TQMA 2ZJWA 4F1MA 4ID7A 4IM0A 1UU3A 2P3GX 3MY5A 4IC8A 2OIDA 4ZSGA 4PMTA 3IGOA 4BCPA 1F3MC 4EH9A 4PWNA 1PHKA 3OBJA 1NVQA 4KBAA 3UO6A 3RHKA 3NAXA 5JGAA 4O6EA 5HG7A 5I3RA 2BHEA 5I4NA 4HOKA 4AG8A 3ATSA 4I24A 2WQMA 3FMLA 4CYIA 3LXKA 2Y8OA 3EWHA 3HRBA 4IHPA 2Y9QA 5HLPA 4BDAA 3FDNA 5DPVA 5ETFA 3DA6A 2PMLX 3PY3A 2VV9A 3LFBA 3ZMMA 4FTRA 3LMGA 4LG4A 5TOZA 4W8EA 3W2OA 2VNWA 5IF1A 4K77A 1R3CA 3COHA 1M14A 4GUEA 3PRFA 3A62A 3LJ1A 3GC7A 3MJ1A 4F9YA 1ZMWA 4TL0A 3EQBA 4WNOA 2ZV2A 3V51A 5AP0A 4ACGA 2WHBA 4R3CA 4YLKA 3UQGA 1U46A 3ZOSA 3QCSA 3UBDA 2WAJA 3KMMA 2PE0A 3MWUA 3O71A 2EU9A 3A7HA 3FI2A 2BIKB 3HUCA 2BRMA 4IX5A 5DRBA 5HE3A 3RMFA 3UC3A 4ANMA 3ACJA 4I5MA 5C8NA 2X7GA 2XH5A 4CD0A 3KGAA 2VN9A 4ERKA 3MGYA 3F3VA 3FI3A 2BPMA 2C47A 5HE1A 3AC4A 4WRSA 3KXGA 4Q5HA 1U4DA 3PXZA 3FMJA 2WO6A 4C58A 3HV3A 5D7AA 2Z2WA 4LRJA 4E6AA 1F5QA 3H30A 4XBUA 3UIMA 4C35A 3CLYA 4WA9A 5J79A 4V0GA 4APPA 3B8RA 2A0CX 5KMLA 4FEUA 3FMMA 3DDPA 3DU8A 2WQBA 2UZBA 4OTRA 3FLYA 4YJPA 3WIKA 1ERKA 4UXQA 4LUDA 3CY2A 4YJQA 2R0UA 2XRUA 3CE3A 4J98A 1L3RE 4EOIA 5J9ZA 1URWA 4EQMA 2HXLA 3QHWA 5DI1A 5E8UA 4HVIA 4LOQA 5A6NA 1Q99A 2HWPA 1Y6AA 3QFVA 5CSVA 4H1MA 4L45A 5H8GA 3VBVA 4EH3A 4UX9A 4D4RA 4EOPA 3QA8A 3QTUA 3PJ8A 1X8BA 4B6LA 5EHLA 3CQUA 2WFYA 4D5HA 2X2KA 3LFDA 4TNBA 1ZY5A 1SNUA 3SGCA 5HU3A 4C0TA 5E91A 1PMNA 4TWNA 4JI9A 4GH2A 4GVAA 1OKVA 2UVZA 4P90A 4CTCA 2FGIA 1H00A 3NUNA 1LEWA 3O8UA 3EIDA 4I20A 3DJ5A 3BQCA 4PP7A 2CDZA 3QUEA 4ACDA 2HW7A 3MTFA 4YZCA 3TI1A 4JQ7A 4EZ5A 3I0OA 3EYHA 5J5SA 4E93A 3WZDA 2VO0A 3SG9A 5AP1A 3MH1A 4BRXA 2JITA 4FKOA 2ETMA 5AUUA 3SW4A 1J1CA 2XIKA 2NP8A 3ENHA 2HZ4A 3GFEA 2B9HA 3LKMA 3ANRA 2BFXA 3ZHPC 4IB5A 4W4YA 1WVXA 3P23A 3R7OA 5AM6A 4KIQA 4DCAA 2WTDA 3OWLA 2H96A 4CKIA 3R83A 3HMOA 5FTOA 4CXAA 4DITA 3VNTA 4OBQA 3MY0A 1BKXA 3P4KA 4YJUA 2WNTA 4LM5A 3R7IA 5C03A 4YTCA 2V5QA 1H25A 3UZRA 1NW1A 5GIPE 4FIIA 4OT5A 3ITZA 1JLUE 2R5TA 3VS5A 4E6CA 2AYPA 3BI6A 5LVLA 4FEWA 3BHHA 3DXPA 5EOBA 1APME 2JLDA 2P2HA 2R3HA 1XQZA 3D14A 2F7ZE 3RK9A 5AADA 4AACA 4RA5A 1XH8A 2HWOA 2W1HA 2WU7A 5J7HA 3FSKA 3C5IA 4U44A 4LOOA 5C8KA 3LHJA 3ZC6A 1XBBA 1TVOA 3QZHA 3NRMA 3GCVA 4PNIA 5A4CA 4IAZA 3PY0A 5K4IA 4XV2A 5HZNA 4LGHA 1SMHA 3LCDA 3PXFA 4DN5A 4WO5A 5IUHA 4RSSA 5KO1A 4PMSA 4RX7A 2ZDUA 2F7EE 3ZTXA 2Y7JA 2VWWA 3OCBA 2CGUA 2ITYA 5M51A 5IA2A 3CD8A 1ZYSA 3R22A 2GNFA 3ORXA 5CEIA 3IW7A 4OTGA 4YSJA 4DGGA 4ITIA 4I94A 3M2WA 4E6DA 3NEWA 1OL1A 1UU8A 4FNXA 3V3VA 3MB7A 3PLAE 2B53A 4ENYA 1GIIA 2J90A 4TRLA 2YEXA 4MQ1A 3A60A 1S9JA 3QKKA 5HICA 1NVRA 2ZYBA 1G8SA 2UW6A 5IEYA 1Q4LA 2BDJA 2WTJA 1PMUA 4DFNA 2YAAA 3JVRA 4WUAA 3SVVA 3MIAA 3FLNC 2OXYA 1MQ4A 5JFWA 1HCLA 4GCJA 4K1BA 3SXFA 5ITAA 4E73A 4ZTRA 3CPBA 4DFLA 1Q97A 2GSFA 4Q2AA 2GHMA 3ZDIA 2FSOX 2XIYA 4ERWA 3MPAA 4BDIA 5CT0A 4DG3E 4BCKA 4C38A 2WU6A 4AT3A 3TV7A 2GQRA 4R7IA 4UEUA 2ZB1A 2UW5A 3RINA 1RW8A 3ZFMA 4BCQA 2HY0A 4A7CA 4CFFA 3IK3A 1Q24A 3Q96A 4L7FA 5AWMA 4HGTA 5E92A 4FV0A 3M11A 3WE8A 4RIOA 4G9RA 4ZJIA 3QQLA 4D2SA 3O51A 2W1GA 5L4QA 1PYEA 2OXDA 3LXPA 3HAVA 2J4ZA 4AT5A 5DWRA 5HBEA 5IPJA 3CP9A 3HV5A 1KE7A 3D2KA 3BIZA 4F08A 3E63A 3GENA 2HK5A 3UG1A 2BALA 3IPHA 3QD4A 4AFJA 4QMMA 3LW0A 3GQIA 4M7IA 4EK4A 4KKGA 3UP2A 3VC4A 4GRBA 3FZRA 1YWRA 2R3IA 3O2MA 3Q5ZA 2IW9A 2UZNA 3H9OA 3RAHA 2BHHA 5DOSA 3C1XA 3MS9A 4O7SA 4QQ5A 4Y5QA 2EB3A 3UIBA 5KKRB 3OCTA 2PMNX 4RIWA 3EFJA 3KF4A 5FEEA 3CGFA 2C5NA 5J5TA 5EI8A 4PL3A 2R3PA 2YWPA 3H0ZA 4P2KA 2OK1A 3FV8A 1PKDA 1W8CA 1IASA 4GK3A 3HP2A 4E8AA 5I9YA 3OW3A 2OZOA 5CF8A 4S2ZA 4YC6A 3B8QA 1M2PA 4R3RA 3HMMA 4FYNA 5CAVA 2V62A 3KK9A 4ITJA 5FXSA 3F7WA 2WMRA 3DK3A 2C0TA 3FYJX 2V7OA 3OG7A 4GYIA 4J52A 4M0ZA 4TW9A 5HNGA 3BLRA 3A7IA 5ACKA 3WF7A 4CCBA 2F9GA 4N4SA 3NW7A 1FBNA 1H28A 2OICA 3DXNA 1W0XC 1JBPE 4BCNA 5CQUA 3PP1A 5DA3A 3TTJA 4AN3A 4GU9A 3LXNA 4G17A 3UYTA 3LCSA 2E9NA 5CYIA 4NIFA 3V6RA 1ZZLA 4CGAA 3I6WA 2EVAA 4AS0A 4XG6A 4GFOA 2VX0A 1YXTA 3EZVA 2JC6A 2QI8A 3IDBA 4M69B 4RZWA 4EYMA 3UOHA 4QMZA 2PUPA 2W4OA 2CLXA 4PMMA 3BYUA 4CKJA 3IW8A 3I5ZA 4S30A 5LQFA 2J0LA 3O96A 5DRDA 2ITPA 2P33A 3QXOA 4DEHA 4BTFA 1NA7A 4X2NA 3VULA 4QMWA 2VNYA 2ITUA 2XS0A 4CSVA 1PYXA 5FDPA 5IA0A 1U59A 3JVSA 1H1SA 2R3FA 3V8WA 4JIAA 3HNGA 3EQGA 3PRIA 2IVSA 4ZP5A 3ZUVA 2YWVA 3BV2A 3MDYA 3UO5A 4KRDA 5EQEA 4PPAA 2WMXA 4C4IA 1Q61A 2R9SA 4U3YA 5GZAA 1O6YA 2HOGA 5IQIA 1JKKA 3DBEA 3MPTA 4FTTA 4I21A 4O7VA 5BPYA 1OIQA 4PTEA 3TN8A 4APCA 3VS3A 1PF8A 3L9PA 3PSBA 3CJFA 4K6ZA 5EW9A 5F20A 5F9EA 1B6CB 2XVDA 4BDKA 4W9XA 5IUIA 2XJ2A 4IDVA 4IEBA 5CSXA 2IZSA 3DBCA 3BBTB 3E92A 5EOLA 2VZ6A 2QC6A 4F70A 3ZZEA 1Q8YA 2J0MB 3EMGA 3HRFA 3ZZWA 5I0BA 2QOCA 3FPQA 2WOTA 5AIRA 2G2IA 5I9VA 3S00A 2EWAA 4OTIA 3B2TA 3WF6A 3ZONA 3OMVA 3ZO4A 3W33A 1CKPA 3CTHA 4GK4A 4UV0A 2DUVA 2BZIB 2JIVA 3H9FA 2YM8A 4CZYB 4TZRA 4J71A 2JDVA 1HOWA 5E8TA 2DYLA 1BL6A 4FIGA 4MBJA 3MSSA 1SYKA 4D4YA 2C4GA 2O63A 2WIHA 3BZ3A 5LWMA 3L8PA 3BGZA 4H58A 2HAKA 4FIEA 4BI1A 2R0IA 4DAWA 4RJ5A 4R7BA 5JH6A 2OZAA 5CZHA 3VBQA 5KZ0A 4EH4A 3E7VA 2YZAA 4U79A 4F7SA 5EKNA 2PWLA 3NNXA 4X3FB 4ACCA 4ALVA 5TKDA 3PWDA 2F2CB 3HX4A 1ZAOA 4O0VA 5ANEA 1T46A 3D83A 4AT4A 3C4XA 5EQPA 3P0MA 5E7RA 3RK7A 1VYZA 2ZB0A 1R39A 4CRSA 3PP0A 4Z9LA 2XK8A 2XM8A 3UMWA 5M4CA 4ZLOA 3Q32A 3UIUA 4I6QA 4CV8A 4M14A 3DJ6A 5HBJA 1GOLA 2BVAA 3IO7A 4BCIA 3V8TA 4N6ZA 5B2MA 4LUEA 2B55A 3PDTA 5IU2A 3LCTA 2Z7LA 2UW8A 2ITVA 3K54A 4FT5A 1XWSA 3HDNA 3KC3A 3QZFA 2WELA 4FG8A 3TL8A 1Q8UA 4BTKA 1PXKA 4DFYA 2OW3A 4ZIMA 5JFVA 5AAGA 4O7RA 4BDFA 2PZYA 2IW6A 5I3OA 1WBSA 1H07A 5JRSA 3UNZA 2ONLA 3NZ0A 4FKWA 4UB7A 4JXFA 4F7JA 3KULA 3NNUA 2W96B 3MVHA 4YLJA 5JZNA 4FVQA 3DY7A 3KVWA 3MH3A 3SHEA 2O8YA 3QCYA 5EYDA 5AX3A 2PVHA 4MXAA 2BAJA 5DIAA 4PDPA 4GSBA 1BL7A 4BKYA 3EH9A 4KNBA 4WKQA 3OUNB 4M8TA 3ZEWA 4UMUA 1KV2A 1I44A 3FZOA 3PTGA 3EJ1A 3ZLXA 3ZS5A 1ZOGA 2OU7A 3E8NA 4DLJA 2LAVA 5FTGA 2OH4A 3DTCA 4P7EA 1P5EA 3QCQA 1P4FA 3L8VA 4JDHA 3ORLA 4ZZNA 2X6DA 3DK7A 3TKHA 2BDFA 4G5PA 4XG4A 2AC3A 3VS4A 2R3OA 1UNHA 1OKWA 4D0WA 2QQ7A 4RX9A 4JBPA 2UZDA 3EN4A 3BCEA 3E5AA 1FGIA 3Q4UA 4N0SA 5CX9A 5F95A 4DH8A 2R3GA 3NVKI 1ZZ2A 3C5UA 3QRUA 1QMZA 4IIRA 4FV3A 4C61A 5HX8A 4KUJA 4O6LA 4WIHA 2ZM4A 3F6XA 3FZPA 3R9HA 4BVUA 3HV4A 3QQKA 3BV3A 4QMXA 3HRCA 2B0QA 4FTAA 5DFPA 3F5XA 1T45A 3IS5A 4NTTA 4R5YA 2KULA 5CY3A 2H34A 4LOPA 4RC4A 4LGDA 4AA0A 4MAOA 4BICA 2GHLA 4L53A 4A9YA 4FOCA 5DH3A 2IPXA 3QTIA 2J5EA 2J0KA 4XLIA 5AR4A 1JVPP 4C4FA 3MN3A 3D5UA 2VTIA 4L6QA 2RF9A 2ONLC 4ALUA 3GC8A 3VBYA 4F65A 5EHOA 3QLGA 3NLBA 3H3CA 2H8HA 3D15A 2ESMA 4FTCA 3RCJA 4CLIA 4XJ0A 3OW4A 3NW6A 3JR1A 3ORIA 2R7BA 2XNOA 4EOJA 2RGPA 3KCFA 4O7NA 4IZYA 4L8MA 1CM8A 3A99A 3DAKA 4WHZA 3CXWA 4BC6A 3EN9A 4IB0A 1XH7A 3W8QA 4DFUA 3PIZA 3KXZA 5EM7A 3DCVA 3SOCA 1Z57A 3AD6A 4FV1A 4USDA 2CKQA 5D10A 3MH2A 4TYIA 2QLUA 2J51A 2EUFB 3AD5A 2PVNA 3NIZA 2UVXA 4RZVA 3VUMA 4D2TA 3T3VA 4QQCA 4RFZA 5H8EA 2CMWA 3NYNA 1SVGA 4L3LA 3AC8A 5M4IA 3HAMA 4NKSA 4J53A 4C02A 2OWBA 5AR5A 2HZNA 3KFAA 3L9LA 5CEKA 4FSNA 3BE9A 3DFAA 3F5GA 4GJ3A 3C9WA 4CMTA 1PMEA 3ZSIA 5ANOA 5LWNA 1R1WA 2PE1A 4ZK5A 4CV9A 4F1TA 3QGYA 5FEQA 5L2WA 2B52A 2IG7A 4NM3A 3SRVA 2YCQA 4D2WA 3IOPA 1MP8A 2GTNA 3UZTA 4X6QC 1IRKA 4XV3A 2QOQA 2C5VA 3BU6A 4NKAA 4R1YA 4D2VA 3QF9A 5TR6A 1G3NA 5JMSA 3LFFA 1YI3A 1LP4A 3R04A 3ZRKA 4A9SA 2EXCX 1ZMUA 2W1DA 3ZO2A 3GFWA 5KMMA 3FLSA 3QTWA 1NVSA 4ANNA 2WKMA 1OL6A 4B8LA 5IDPA 2JFMA 4BFMA 4O81A 1RE8A 4G5JA 3E8DA 3PIYA 1Y8YA 2QG5A 2G15A 4G16A 4HPTE 4PX6A 3OWPA 5DBXA 3MBLA 4FV4A 3THBA 1YXSA 5JEBA 2VTTA 5AP6A 2YM6A 3EKNA 3Q4TA 3R00A 5BMMA 4FT0A 2OIBA 4FBXA 5CEMA 2BZHB 3LFSA 3N51A 3ORTA 2VGPA 3KRWA 4BCHA 3KU2A 1PJKA 1YI6A 4Y83A 4P4CA 1KE9A 4BDCA 5HVJA 3E3PA 2WMVA 1O6KA 4AXAA 1UKIA 4IFCA 1V0BA 2OJIA 1FPUA 2XIRA 4YNOA 2CKPA 3NIEA 4XP3A 2JD5A 3ZBFA 3QTRA 4C34A 3HMIA 5AEPA 3E64A 1XBCA 3QD3A 4TYHB 3A8XA 2PZRA 4J8NA 3O50A 3NGAA 4H36A 4KSQA 4MTAA 5DGZA 4ONAA 3FKLA 3GU5A 4EHGA 3TDWA 4LV5A 2BAKA 3U8WA 4CFUA 2JGZA 4QD6A 3S2PA 4MNEB 3VIDA 2QO9A 1GZOA 4NL0A 4FGBA 2YN8A 5IQCA 4EKLA 4XYFA 1WVYA 2E9UA 3GNIB 4IADA 2BRHA 2JBOA 3VHEA 3L9NA 4HVDA 5GINE 4HNIA 4A06A 5JQ8A 4EK3A 3W8LA 3FL4A 5BMSA 5LCJA 3BWJA 3HEGA 4M15A 5B2KA 5IUGA 2GFSA 3HDMA 4GG5A 4L46A 4AAAA 4AP7A 3F69A 4BBMA 3A7JA 2HXQA 2W0JA 2W5HA 4D9TA 3KRRA 2RIOA 2C3LA 3DKCA 3PLSA 4MEDA 4QNAA 3TJCA 4HGSA 4OTWA 4BDBA 3PXYA 4DEAA 5L6PA 5AUZA 4BDHA 3FXZA 5BVWA 5IQBA 2WMTA 3JS2A 2OKRA 2R7IA 5A46A 5ETIA 2WMQA 2ITNA 4W9WA 2B9JA 4FKQA 1DAWA 5E8WA 2NRUA 3G0FA 5CI7A 1FVVA 4AN9A 2PHKA 2QOKA 4O21A 4QP1A 4RX5A 2QOLA 2J50A 1M7NA 3IW4A 3P9JA 3A7GA 1PXIA 3Q9YA 2V0DA 3O7LD 2XUUA 3TIYA 1CSNA 4DFXE 3SXSA 2I0HA 1PXPA 3C51A 5K5XA 4CT2A 4QMUA 1JWHA 1Q5KA 2VTAA 4FTLA 3I81A 4LRKA 4U3ZA 2F57A 4YPDA 4DEDA 3Q6WA 2YABA 3QUPA 4C37A 1OECA 5TE0A 4FKUA 4R77A 5G6VA 3NCZA 2ZOQA 1TQIA 2FO0A 3CC6A 5EM6A 1VJYA 2XYUA 2UZTA 2QO7A 5H3QA 4AZTA 4DH3A 2FH9A 4NFNA 4I5CA 5AUYA 4AWIA 2FYSA 2Z7QA 2Y4IB 1H1PA 3NCGA 4D28A 2UW7A 1GAGA 1IAJA 4OLIA 2OH0E 2JKKA 4K9YA 4XV1A 4PL4A 4TN6A 1YXUA 4R8QA 3Q60A 4FV7A 1XO2B 3PJCA 4QP2A 4WT6A 3RPRA 3PPZA 3V8SA 4X7QA 4DG0E 3ZRMA 5AP3A 4NJDA 5BVDA 2X0GA 3QX2A 3PG1A 1QL6A 2YM3A 1UU9A 1OL5A 1WFCA 4L00A 4NU1A 4FODA 4OTQA 5C01A 2RFEA 3DTWA 3RTPA 2ERKA 3VW8A 5KHXA 4BBEA 5IDNA 3TT0A 2HW6A 5CLPA 2E2BA 3NYVA 3ZO1A 2UZWE 3S1HA 4R78A 5C1QB 2ZV7A 3U6IA 4E26A
chains in the Genus database with same CATH superfamily
2C1AA 2UZVA 4FSRA 1H1RA 3R1QA 4BDEA 4BWXA 4C2VA 4EH7A 4KSPA 2BRNA 4EL9A 3SKCA 4AW5A 4AE6A 3G33A 2KTYA 3OCSA 1FQ1B 2OJ9A 2W7XA 4OAUC 3AC3A 3H0YA 5M55A 3W0MA 1GZKA 2VUWA 3D4QA 4YPSA 3RALA 2W05A 3KN6A 4XMOA 3ZC5A 1WVWA 2JDSA 2YACA 3QRTA 4O27B 5EKOA 4EHZA 4D2RA 3HA8A 2J5FA 3KXMA 5L6WL 3NYXA 3TNIA 4ZLZA 4HZSA 4MXOA 4FIJA 1FMKA 5JKGA 1IA8A 5I9ZA 4O7TA 5B7VA 4RG0A 4O1OA 3LOKA 5C8MA 3NFFB 4IM2A 2PMIA 3JY9A 4M13A 4EK8A 4NCTA 5H2UA 1H27A 3FZTA 4U41A 2W17A 2QOIA 3DB8A 4G6OA 2B7AA 3ZXZA 4NSTA 5HIEA 3CKXA 4PP9A 1CKIA 3Q04A 3PVBA 4Q5EA 1KWPA 3DPKA 2W4JA 4LI5A 3W2CA 5GZ8A 4OBPA 4U8ZA 4CFNA 2PVJA 4WSYA 3EQPA 4GKHA 1AQ1A 2HZIA 2XJ0A 2RFDA 2X1NA 2XEZA 3K5UA 1VZOA 3OZ6A 4FZ6A 4GYGA 4IZAA 3DLZA 4YJRA 5KKRC 4CZTA 3BQRA 2ZVAA 3MVMA 5LVNA 2BRBA 3LMHA 3Q2MA 2IN6A 3W55A 3Q5IA 3BGPA 3KXHA 5HG9A 1OPKA 3REPA 2YJRA 4L67A 4JG7A 3OT3A 3EQRA 3BELA 3KRLA 2VTQA 5DVRA 3QWJA 3QTZA 1PMVA 2IJMA 1BMKA 4DTAA 2IZRA 2PZ5A 2WMSA 3O8PA 4RPVA 4ZY6A 2OO8X 1FINA 3DS6A 4EZ7A 5AR3A 2P55A 2Q0BA 3LLTA 3BHYA 3N4UA 4R3PA 3EFWA 4EORA 4XRLA 4N57A 3FLWA 3UDZA 3QUDA 4BZOA 4RQVA 4JQ8A 3SXRA 1STCE 2WTKB 3PXKA 5E8YA 3EN7A 1Q8WA 3UOLA 2IF8A 2R64A 2O5KA 4IQ6A 2VX3A 4NW5A 2QG7A 4I6FA 2J2IB 2YITA 2O65A 3W0OA 4NCTC 1KE6A 2VTJA 4JX7A 3MTLA 4RC3A 4FA2A 4IJ9A 4J99A 4A9UA 5AP7A 3FMKA 3EB0A 3FUPA 3RKBA 1ZYDA 1KOAA 2YA9A 3OVVA 3QTSA 2RG6A 4YSMA 5HGIA 5HOAA 5M07A 3R0TA 2VRXA 3UODA 2UUEA 1WMKA 2VX1A 4W4WA 4PV0A 4O4CA 4EOSA 2ACXA 1JNKA 4U80A 3WZUA 1QPCA 3G2FA 3COIA 3TG1A 1GIHA 4HYHA 1HCKA 4F09A 4H1JA 3TUDA 2X4FA 3FQEA 2HIWA 5ETCA 4EH2A 4II5A 4TNDA 4RC2A 1DM2A 5AX9A 2QOFA 2Z7RA 3LCOA 4DINA 2C3JA 4G3FA 3C0GA 1FGKA 4D1ZA 4XLVA 2WZJA 4MD8E 4AOJA 2BZJA 3SLSA 3KB7A 4IE9A 3DDQA 4BKJA 3QALE 2XK7A 4L44A 4CTBA 2ITOA 4FG9A 1IAHA 5CEPA 4P5QA 5EH0A 3A2CA 3ELJA 1R0EA 5JN2A 2Y0AA 3F2RA 2HELA 4WNMA 5AR7A 3FYKX 5K0KA 4CT1A 1U5QA 4GFGA 1FOTA 4S32A 3W2RA 1OB3A 3OXIA 2H6DA 4QPMA 3LLAA 4FKGA 2W1CA 4FEVA 2ZV9A 2VWBA 5L6OA 1BI8A 4YZNA 4O7YA 4B99A 3PA5A 4RVLA 2GDOA 4ZLYA 4RWJA 5ANIA 4G2FA 5CENA 3ZFYA 4J96A 4BGHA 2YIXA 4ZMEA 1K2PA 2GNGA 3GC9A 2QNJA 4HJOA 5AMNA 4BIDA 2UVYA 3DOGA 2GTMA 4ZS4A 4OTFA 3QRIA 4ANQA 3ORMA 5E9EA 2YDJA 3FY0A 3CBLA 2X81A 4PUZA 4QP6A 4L43A 2GS2A 3OXTA 4ENXA 4FSQA 5HX6A 1ZMVA 4O4BB 4KA3A 3EN5A 1J7UA 2YIRA 3V5WA 4ACMA 2YM4A 5KBRA 3PY1A 4GT5A 1SM2A 2XIXA 2QLQA 3IONA 1W2DA 4HPUE 4YTHA 4U0IA 1GZ8A 3ZLYA 1M7QA 1H8FA 3V5TA 3Q4ZA 3NVMB 3R1YA 3ORZA 4QRCA 2ZDTA 3A8WA 1G8AA 4HYIA 4AGCA 5LMKA 4NM5A 3FKOA 3RPOA 1WBTA 5EDQA 1TKIA 3Q52A 3NX8A 5CEQA 3R7GA 3DT1A 4FT7A 2A4LA 2OI4X 2WMBA 4CFVA 2GQSA 4IZ7A 1B38A 4UY9A 5IMXA 5IQHA 4C62A 1Y6BA 3CKWA 2O64A 3VVHA 4FTIA 1V0OA 2VTLA 1UKHA 5HTCA 2Q0NA 3DV3A 3RNYA 4EOMA 3IDCA 4DA5A 4QP3A 4FKLA 3HA6A 3IGGA 5DG5A 4FKIA 4UBAA 3ZLSA 2CGXA 5DE2A 4FL2A 4QYHA 5E8XA 1UNLA 3O8TA 1VEBA 1M17A 3AT2A 4MVFA 5AA9A 4QTBA 3TNWA 5BUJA 4JVGA 1KSWA 2ZV8A 3RWPA 3R1SA 4QTDA 3EKKA 4BBFA 1XH5A 4ZY5A 4UMTA 2VWZA 5HQ0A 4F0FA 3OWJA 4MD7E 5EFQA 3WI6A 4E6QA 3DGKA 4WBBB 3FHRA 3GEQA 1BI7A 4AQKA 2X8DA 2QOHA 2FSLX 3DKFA 2CCHA 4O0XA 2F4JA 2FA2A 3FC1X 2JBPA 2JAMA 4E20A 3KXXA 3EL7A 5LVMA 3KY2A 5AP4A 1YKRA 3SQQA 3ZUTA 3UVPA 2UW9A 4RFMA 5CEOA 3NR9A 2VD5A 4AW0A 5KMJA 4G3CA 3VS2A 4JBQA 4I5HA 3LMIA 3MVJA 5BUEA 3AMBA 2PUUA 3Q9XA 4E5BA 2XAOA 4BI2A 1JKTA 2F49A 4EYJA 4J8MA 2C69A 4EHVA 5HG5A 4ASZA 4C4EA 4K11A 5AFVA 3M1SA 4QMVA 5T3QA 4XG2A 4RA4A 5AV3A 1PXMA 3R28A 4M12A 5LMKC 2VWIA 3QU0A 3TNQB 3W10A 5HHWA 4HNFA 3IOKA 1YXXA 5L8JA 1ZOEA 3EQHA 3QRJA 4TYJA 3TACA 5KMKA 3V01A 3II5A 3A4OX 3PE1A 3POZA 4IAYA 4QMYA 1YOLA 3R02A 1KV1A 4ZTMA 2WMAA 4WD5A 4RVTA 3G51A 3QYWA 3PXQA 4FZAB 4F78A 4RIYB 2UW3A 2WIPA 1YOMA 4RJ4A 4Y73A 3ATTA 2W9FB 3VS7A 5H9BA 4C3PA 4X6RA 4C59A 1IA9A 2R3MA 4IAIA 5FWKK 2YJSA 3RBWA 3ZYAA 4M0YA 5IZFA 4USFA 4BR3A 1OITA 3UYSA 3PA4A 4JRVA 1PRYA 2JAVA 3BLQA 4FJVA 1SNXA 3BYSA 1Q3DA 3FHIA 3DKOA 5B2LA 3UQCA 1WBOA 4MHAA 2G1TA 4QYEA 5HVYA 4YZMA 4UALA 3F3WA 1WCCA 1OGUA 4XNEA 4MXZA 3AMAA 4GU6A 4ARKA 4HZRA 2BKKA 3L8SA 4EKKA 3Q9ZA 5KCVA 4IWQA 4EC9A 3AQVA 3QC4A 5H8BA 3DBDA 2BFYA 3RM6A 3QBNA 3FLZA 4GFMA 4O83A 3FSFA 2ERZE 3FXWA 4PDSA 4DGMA 3ZLWA 4TYHA 5C4LA 1BLXA 3R7UA 4DHJA 4RMZA 1YHVA 4FK6A 4RWLA 5FM3A 5AR8A 2YDKA 4FZFB 4G34A 1G5SA 3KEXA 4QPAA 3C4FA 4IANA 3UP7A 5EM5A 3LM5A 4MNEA 1VR2A 3VS0A 3MV5A 4QQJA 2CN8A 4M3QA 3WZEA 4RT7A 4DFBA 3H10A 5KMNA 4HGLA 5ANGA 5HE0A 3U9NA 3AOXA 3D9VA 4O1PA 4YZ9A 4FE2A 3DJ7A 1UU7A 4FV2A 1OI9A 2GS6A 2XNMA 3ROCA 2X2LA 5FLFA 2VU3A 5GJDA 4G3EA 3R73A 2R3NA 2YHVA 5B0XA 1YI4A 3JUHA 4XRJA 3E8CA 4MF1A 4V0GB 3T3UA 5DR2A 3EZRA 3K3JA 4OR5A 5A3XA 5FXQA 3JY0A 4FTNA 4GV1A 5GJFA 2WEVA 5L2SA 3EQIA 2X0PA 4D1XA 2W1EA 4C7TA 3RNIA 3PPKA 1E9HA 3TZMA 1JSTA 3QKLA 1OIUA 5D1JA 4BCFA 4I5PA 1GNGA 3KREA 3SC1A 2F7XE 3VRYA 5KHWA 3KK8A 4F6SA 5F94A 4TWOA 3RHXA 5LCKA 3MFUA 3EHAA 3HMNA 2Y6OA 3NPCA 3PIXA 4LMNA 4A9TA 1J7IA 3QD2B 4NTSA 5M09A 5EYKA 2PVLA 5ACBC 1R78A 4ASEA 3TTIA 2HZ0A 2ITQA 5E8VA 4EJNA 4IMYA 2PVMA 2HCKA 2ZM1A 1LPUA 3DAJA 3GCUA 1I09A 4GK2A 4QMOA 3U54A 1YVJA 4IBMA 2Z8CA 1MRVA 5DNRA 2PE2A 2XZSA 4QYFA 4OGRA 3W2SA 4HCUA 1OM1A 2OJFE 4YBKA 4G6LA 2AQXA 3WOWA 2EXMA 5DLSA 4EC8A 5CU4A 5EK7A 3ROYA 1WBPA 2OSCA 4JBVA 3LQ8A 1VYWA 4I93A 4IXPA 4JG6A 4ZSLA 5A4TA 4WG4A 2OF4A 3QD0A 3LJ2A 2YIWA 3EQFA 5IA5A 3C0IA 4DBNA 4QQTA 5HKMA 4EH5A 5L3AA 2QU5A 1RJBA 4X2JA 5T68A 5HD4A 2NNWB 3FXXA 4L01A 3AGLA 4AOIA 2GNJA 5AP5A 4BCJA 3F82A 4ZS0A 4QMNA 3E62A 3DZOA 5EW3A 2EXEA 2OXXA 3QYZA 2WTCA 5G1XA 2Y6MA 4I6BA 4PMPA 4FICA 5EW8A 4D2PA 2JIIA 2YIQA 2QHMA 2V55A 3L9MA 1E1VA 2RSVA 3POOA 4Y8DA 3ZXTA 4E1ZA 3I0QA 4RWIA 5LVOA 4HVGA 4O86A 3GU8A 4AA5A 1YW2A 3NUUA 4JIKA 4PY1A 4AU8A 4QP7A 4BWPA 5E1SA 3O23A 5AV0A 5I9UA 3IW6A 4ZAUA 4LFIA 1BX6A 2JIUA 4F7LA 2E9VA 4QP9A 4CZUA 2C0IA 3P86A 1OZ1A 4FT9A 3NWWA 4EWQA 3FLQA 4UWYA 3NUYA 3ULIA 5HTIA 4PL5A 1M2QA 4DLIA 5IH6A 1WBWA 2ITTA 4BYIA 4XEYA 1OMWA 4YMJA 1XJDA 1Z5MA 5HCZA 5JQ5A 2Y4IC 5BVNA 3PZEA 1KE5A 3DLSA 1JKSA 3ZDUA 3LE6A 4Y5HA 3PE2A 1OL2A 3KRJA 2GNLA 3MA6A 4GG7A 2QO2A 4FUYA 4FG7A 4I0RA 1YHWA 2CJMA 5TO8A 1QPJA 3PVUA 3T9IA 3UTOA 4JDKA 3MA3A 2UZUE 4ZOGA 4ZTNA 4QO9A 3QAME 2PPQA 4ASDA 2VTNA 3GUBA 5CI6A 4FV6A 4S34A 2XF0A 3LQ3A 5FG8A 5JT2A 3QQJA 4FV8A 3PVWA 4K2RA 3R7VA 3AT4A 5BVEA 2A1AB 3LCKA 4PF4A 1ZRZA 4LGGA 1MUOA 4LQMA 3DB6A 2IVUA 3JYAA 3LIJA 4JR3A 3D7TB 1DI9A 3AMYA 4FKRA 4DG2E 2YCSA 1KOBA 4FI1A 4MYGA 3WF5A 3K3IA 5EM8A 1WZYA 4DHZA 4TWCA 2YZLA 3O7LB 4F99A 3DQWA 4DEBA 1FVTA 4DHFA 3SOAA 1XKKA 2J0JA 2XKCA 4KIPA 3V5QA 3CEKA 5EG3A 3WZJA 3AKLA 2CHLA 3K5VA 4KBKA 2P2IA 1CTPE 4PPCA 4YJVA 5CNNA 4A4OA 3PJ2A 5HNIX 4AZWA 4O38A 4XCUA 4X3JA 5IKWA 5AAEA 2PZIA 3QCXA 2X39A 3Q3BA 4TYEA 3UMXA 4BCGA 4V04A 4ZTSA 4F9CA 5A4LA 2ZM3A 5KNJA 3HYHA 4C4GA 4EONA 4PTGA 3HZTA 2R3JA 3LXLA 4RJ8A 4M97A 4KWPA 4C33A 4NH1A 4G3GA 5AIKA 2XIZA 3UO4A 5DR6A 4O7ZA 4O84A 2W4KA 3S0OA 1H1QA 1PW2A 4ZJVA 4O91A 3FI8A 4IB1A 2C3IB 4JG8A 4L9IA 3U87A 4C8BA 3VUKA 3Q2JA 2GHGA 3N4TA 4G31A 4CMUA 5JZJA 2CNQA 1OVEA 3GU6A 4JAJA 3P7AA 5CAOA 4U97A 1R0PA 3VS1A 3NYOA 5FP6A 3ANQA 3R2BA 2WPAA 3PSDA 4XOYA 3ZH8A 1TZDA 3DXQA 4IWPA 2QR8A 3ALNA 4TKSA 3U55A 1J3HA 5HNBA 4W4XA 4ZXTA 5CF5A 2XK4A 2WOUA 1H0VA 2OIQA 2P0CA 4XHKB 3TNHA 3MI9A 4JAIA 3DZQA 1PXLA 5HG8A 4NT4A 4E4NA 5GHVA 4AUAA 4F9AA 1RQQA 3D2IA 1TFFA 5CNOA 2C6KA 3BHUA 4RIXB 4ANBA 4FKPA 3LJ0A 4U7ZA 2NPQA 4KABA 5DN3A 4UMRA 2SRCA 4W8DA 3VBTA 3BLAA 4C3FA 4CQEA 3NAYA 4BKZA 2C3KA 1GIJA 4WBOA 4RBLA 2RFNA 4X2KA 2XCKA 4BDDA 3QTQA 3SDJA 2WXVA 2DWBA 1K9AA 5AUXA 3BL7A 3FEGA 3ZEPA 4GL9A 4PQNA 4EH8A 5BVFA 2RG5A 3VF9A 4YURA 3P7BA 3HGKA 3E93A 4EJ7A 2I40A 3EQDA 1Q41A 2C5XA 3HP5A 5BYZA 3HV7A 1CDKA 4F64A 3H9RA 3RPVA 4MD9E 1KUTA 3ODYX 4U45A 3VQUA 5CZIA 3TV4A 3KRXA 4QOXA 2REIA 3TZ8A 2QURA 4R5SA 5M4FA 3FL5A 4JJRA 2G2FA 4NWMA 5C26A 4JS8A 3BEGA 3DBFA 4EQCA 5IG1A 3G5DA 2BCJA 3UPXA 3SA0A 1OBDA 1V0PA 4I6HA 1AD5A 4JQEA 2C0OA 3ZSGA 3N4VA 2XEYA 4JBOA 4KKHA 3VBXA 3U51A 4QP8A 3TUBA 2GU8A 2V7AA 3CQWA 4JR7A 5CXZA 1UA2A 4FKJA 3R7EA 1OKYA 5E90A 2R4BA 2C6TA 4JRNA 4QTCA 1F0QA 1J91A 5E8ZA 3R6XA 3C50A 4ZZMA 2C6LA 1OPLA 3MPMA 5HD7A 3ENMA 3TZ7A 2IZUA 4LRMA 5BYLA 4FSWA 3Q53A 3FPMA 4S31A 5FBOA 3G9NA 4W4VA 3WF9A 1UVRA 3E87A 2UZLA 4O0SA 5CASA 4C36A 3MJ2A 1XH9A 3FQHA 4X0MA 2WD1A 5CT7A 5EI2A 4QMQA 3FE3A 4MWHA 2Z60A 2B9IA 4AZEA 2AC5A 4GMYA 3GB2A 3TV6A 3U6HA 5J1VA 2CKOA 2A19B 2GNHA 2J7TA 5CSHA 4K0YA 4F9BA 2OZAB 4F0IA 4Q9ZA 4B0GA 4EOOA 3DFCB 2QD9A 5HO8A 4NJ3A 3SAYA 4ASXA 4XBRA 4DH7A 1IR3A 2XCHA 4RJ6A 4OAVB 5IH4A 4O0UA 3NUPA 4NM7A 4B7TA 5HU9A 3BYOA 2W1ZA 3QQUA 3RAWA 4M84A 2CN5A 2ZMCA 5J7BA 3D94A 3RCDA 1YWNA 3GP0A 4J1RA 1H4LA 2W1IA 4A9RA 1ZOHA 1IG1A 4AZVA 3R9RA 3VONA 1U54B 2XBJA 5ANDA 1ZWSA 3W18A 4FSTA 5CU0A 1ZYLA 3R8UA 2XA4A 4AW2A 3VUTA 3G6HA 2JFLA 3C4CA 4BF2A 1GJOA 3NFGB 5CF4A 4OTHA 1JOWB 4Z7GA 4UYNA 5IA3A 5IA4A 2R3KA 1YRPA 4RIYA 4YTIA 2YAKA 2FVDA 3AC1A 4H39A 4X2FA 3WBLA 4ALWA 3SG8A 4AXEA 3ET7A 4I22A 4PTCA 2CGVA 3GQLA 3KULB 3QWKA 5AV4A 3CR0A 5KMIA 3AG9A 2CCIA 3ACKA 4M67A 5CAUA 2XK6A 3VN9A 3DBQA 3BU3A 3G0EA 2WQOA 3R30A 4MCVA 4BIBA 4M68A 2YISA 3P08A 2JKOA 4M69A 4EBVA 3UVRA 4XH6A 4NM0A 3P79A 4FTMA 3OUKA 5CU3A 2C5YA 2UV2A 5DEYA 4CFXA 5JRQA 3CTJA 1BYGA 2I0YA 2WTIA 3F2AA 4FT3A 2OBJA 4TPTA 3RI1A 5CAQA 3AXWA 1ND4A 4DH5A 2VO7A 3K2LA 1NT2A 2XAMA 4L68A 2ITXA 4O22A 5HI2A 2GS7A 4O0RA 1K3AA 3LFNA 3TEIA 4WSQA 5AR2A 4C4JA 1Y91A 4GVJA 3AD4A 4QTAA 2OFVA 5J87A 4D4SA 4F9WA 5J8IA 5IISA 3VBWA 4IAFA 3EFKA 4IVCA 4DGNA 2C6OA 3QQGA 3F66A 4DDGA 3FKNA 4KINA 5JGBA 2FB8A 3PG3A 4IAAA 3E3BX 3OTVA 4IWOA 2PVFA 3GI3A 2W5AA 3UNJA 3GVUA 1JSUA 3OEZA 3FAAA 1ST4A 1E1XA 4FKVA 4YC3A 4ANOA 4CKRA 5HCXA 5K4JA 2XNGA 2RFSA 3SV0A 1ZYJA 2VTSA 2XP2A 4FYOA 3ZSHA 4QDEA 3HVCA 2X9EA 4L3JA 2XYNA 3RGFA 4WG3A 2VTOA 2O2UA 1Q8TA 3QQFA 4UWCA 5EYCA 5IEVA 4FIFA 4J97A 3CTQA 3S4QA 3W0PA 3HV6A 4UMQA 3R7YA 4BIEA 2CNVA 2YFXA 3GCQA 4ZSJA 5HO6A 4RWKA 3PA3A 4YO4A 4O0TA 2X6EA 5FBNC 3VRZA 4BYJA 2CKEA 4G9CA 1OKZA 2VTPA 5FD2A 4BHZA 1M52A 3LM0A 3UOJA 2NYAA 4MKCA 2ETKA 4OUCA 5FTQA 4LYNA 3D5XA 3QQHA 5HBHA 4ORKA 4OBOA 4YLLA 3DNEA 2E9OA 1PKGA 1FMOE 4KS7A 3R8PA 4AGUA 1DS5A 4YP8A 2CPKE 4XG7A 5CQWA 5IQFA 4XX9A 3LPBA 4K33A 4X3FA 4DCEA 1WBVA 1URCA 3ZU7A 3UNKA 1H1WA 3QZIA 4USEA 5M06A 2QODA 4MXYA 5KX8A 4JDJA 4YO6A 3CY3A 3OS3A 4FX3A 4RLLA 3GCPA 1QCFA 4E5AX 3R8ZA 2XBAA 2GNIA 3BGQA 3TDVA 2IEWA 3SRVB 3VWAA 4EH6A 3DKGA 3OHTA 5BV3A 2J9MA 4I0TA 3T9TA 4I4FA 4DEEA 3TUCA 5BYYA 5M56A 2C1BA 4FIHA 4H3QA 3OD6X 4BCOA 3P7CA 3WZKA 5LVPA 4DT9A 3LZBA 5I9XA 3O17A 4I41A 4AF3A 3G15A 2XARA 5HESA 4LMUA 1J1BA 3E88A 3IQ7A 1H24A 3CGOA 2WB8A 1H26A 3UG2A 4FUXA 3FQSA 4AA4A 3NW5A 5HTBA 3ETAA 4U81A 4BDGA 4BTJA 2GFCA 2XNBA 3EFLA 4EOKA 5FP5A 3MIYA 3D0EA 3OEFX 4MBLA 5C27A 1YDRE 3C4WA 3ZM9A 4B4LA 4NK9A 5A14A 4QMSA 4AGWA 5LOHA 4LV8A 4L42A 4V05A 5HE2A 3I6UA 5L2IA 1JKLA 4IACA 4EUUA 4OTPA 4MQ2A 4D5KA 4C3RA 1ATPE 5K9IA 3KVXA 2X0QA 1B39A 3TNPC 4PDYA 5E8SA 4CLJA 3WE4A 4IVAA 4C2WA 4X3FC 5A4QA 5K5NA 4O4DA 5AV2A 3TXOA 1LEZA 3R01A 3BPRA 3I1AA 2J0IA 2IO6A 1XMMA 4Y72A 5C4KA 1H0WA 5M4UA 2HY81 2PVYA 3BHVA 3FC2A 4TT7A 3EOCA 4X2GA 3KMWA 5FDXA 2XK3A 3COKA 4D9UA 4ZTQA 4AW1A 1YDTE 1P2AA 5AJQA 3VW6A 1GY3A 1ZXEA 3RAIA 4J7BA 4MBIA 4CCUA 1NXKA 1REJA 3UZPA 3I60A 4UN0C 5HCYA 3UDBA 2B4SB 4IWDA 3BX5A 4DF3A 4D55A 2C6EA 1AGWA 3BKBA 5AUVA 3W0RA 3M42A 4IFGA 2CSNA 3UOKA 4H3PA 4CMOA 4CQGA 4BGGA 3MY1A 4FSMA 4FVPA 5AM7A 4HGEA 3KIOC 5AV1A 4D1SA 2JDRA 4E4XA 3C4EA 3T8OA 3C4ZA 5CALA 5M08A 5LMBA 3I79A 3TJDA 4FTKA 5K0XA 3GC0A 2QR7A 2W99B 3W0QA 4GEOA 3R9DA 4JL9A 3OF0A 5CF6A 5KUPA 1Y57A 4IB3A 2C5OA 3W2QA 1YOJA 3D7TA 3QRKA 3LFCA 1YXVA 2BDWA 2IZTA 3WF8A 4FNWA 2OJGA 3OTUA 5I9WA 5ANJA 4YR8A 4H05A 4CG9A 2VTHA 3LQ5A 4E4MA 1WAKA 4DGOA 2IWIA 3HUBA 3UIXA 2I1MA 2O0UA 2PSQA 2X9FA 3FJQE 3HMPA 2XNPA 5DT4A 3KXNA 1UWJA 4CRLA 1WBNA 4FTQA 2ITWA 3D7ZA 1TQPA 4WOVA 4GIHA 2ZMDA 2C6IA 4DHIB 5BUIA 1XH4A 1CMKE 3EN6A 4FSZA 2PZPA 2VWXA 3MVLA 4XP2A 4IX3A 4AGDA 4DTBA 4FTJA 5IMEA 3QGWA 4C57A 5BQ0A 1L8TA 3ORPA 5T6KA 4XG8A 4KIKB 5GJGA 3VJOA 4R1VA 2GPHA 2I0EA 3KA0A 3R63A 5L2TA 1UV5A 4IX6A 3BRBA 5D11A 3AT3A 4O0YA 1O6LA 2FSTX 3QLFA 3PJ3A 4X21A 4YHJA 5EYMA 1YWVA 4F7NA 1A06A 4ACHA 1JPAA 4U5JA 3LVPA 3N9XA 3F5PA 2BUJA 2DQ7X 2WQNA 5AUWA 3AGMA 1NY3A 5J95A 1M2RA 2QU6A 2O3PA 3PWYA 5EDPA 3WIGA 4Z7HA 4WUNA 3UJGA 3VO3A 3ORNA 4FVRA 3CJGA 4ITHA 1BUHA 1IEPA 4O0WA 3L8XA 2YM7A 2QKRA 4NEUA 4I1ZA 3OT8A 2W9ZB 3KN5A 5IQEA 3OOGA 3QTXA 5CSPA 3PFQA 3I7BA 3G9LX 4AOTA 3UQFA 3EL8A 4GIIA 3QL8A 5ETAA 1PY5A 3U4WA 3VUGA 2WMWA 4XG9A 5KZIA 2B54A 4KD1A 4EWHA 4U6RA 3RWQA 1S9IA 4AZFA 4RIXA 5HIBA 2BRGA 2V22A 3IDPA 2JKQA 3CQEA 4DEGA 3ERKA 5A4EA 5JK3A 3MFRA 1SZMA 4HVHA 4UMPA 5CANA 5KBQA 4Y95A 1OUKA 2NRYA 3TCPA 2OGVA 3KKVA 4MXXA 4WNPA 1W83A 4PPBA 4F0GA 4KB8A 4DTKA 2G9XA 2R3LA 3TWJA 4A4LA 4EZ3A 3O0GA 4ZSAA 5DMZA 2I6LA 4FSYA 4HYUA 4J95A 4UYAA 5HEZA 1JAMA 1REKA 3OOMA 5CWZA 1OL7A 3F3UA 1SVEA 2G2HA 5DT3A 4RFYA 4YJNA 4FR4A 2ETRA 4FV9A 3P1AA 3ZBXA 1DAYA 2JDTA 4XOZA 4XP0A 5AA8A 4YU2A 1ZARA 3BHTA 3Q6UA 4JNWA 2QOOA 4NZWB 3OBGA 3ZO3A 1U5RA 4O7LA 1Z9XA 3TM0A 2UW0A 1PXOA 3PSCA 3NDMA 4CNHA 4Z55A 3DNDA 4HW7A 1OIRA 3Q9WA 2WMUA 2VWUA 4EI4A 5BX0A 4BGQA 3NUSA 4AQCA 2Z7SA 1RDQE 1UNGA 2C68A 5CXHA 1KE8A 3FZ1A 5F1ZA 5AAFA 3ZRLA 3CSVA 2BTRA 5GNKA 4DE4A 4BY9E 1OPJA 3R8LA 5IQDA 4YNEA 2UZEA 2PUNA 4I0SA 3PXRA 4TXCA 4O7WA 2C30A 5CVHA 4E7WA 4N6YA 2PMOX 4AN2A 3V6SA 4HCVA 3KF7A 5FGKA 4QEBA 1O9UA 3IW5A 4CEGA 4L52A 4S33A 3GCSA 4IAKA 4MUQA 4QMTA 2VO6A 4BWKA 3GBZA 3D5VA 4IJPA 1DI8A 4U42A 3RK5A 2XMYA 4A07A 3UPZA 4O82A 5HIDA 1OUYA 4JOAA 3QXPA 2PVRA 2BAQA 5KMOA 4QT1A 4CFMA 3S95A 5L8LA 1W7HA 3GU4A 3RP9A 3VF8A 3FMHA 3LFEA 3GU7A 4AZSA 3UC4A 4FV5A 4ZSEA 4R7HA 3RAKA 4EK5A 1CKJA 1OBGA 2Y4PA 3F3ZA 4CG8A 2VAGA 5TF9A 5A54A 3ALOA 3MESA 3QHRA 4AE9A 4BDJA 3PZHA 2PTKA 2VO3A 3CPCA 3NNWA 4FSUA 4O2PA 3KL8A 1Q62A 3ZCLA 4XV9A 4IZ5A 4QMLA 4TY1A 3SX9A 4AFEA