4FOBA

Crystal structure of human anaplastic lymphoma kinase in complex with acyliminobenzimidazole inhibitor 1
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
310
structure length
295
Chain Sequence
NPNYSFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRAGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIEYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK tyrosine kinase receptor
publication title The Discovery and Optimization of a Novel Class of Potent, Selective, and Orally Bioavailable Anaplastic Lymphoma Kinase (ALK) Inhibitors with Potential Utility for the Treatment of Cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 100
structure length 295
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-06-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4fobA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4fobA01
4USFA 3FYKX 3EIDA 3VQUA 2I0YA 5EHYA 2QKWB 3R7GA 1UU9A 4Y5HA 4EC9A 4QP4A 3UG2A 4BKZA 1SVHA 4ZLZA 4BDBA 5D12A 2YAAA 3NUYA 4S33A 3QC4A 5JQ8A 2UVZA 4CXAA 4M84A 4EOOA 2BTSA 5AUTA 3E3PA 2GNJA 3SAYA 4FI1A 3TL8A 3R7VA 1J1CA 3ZO1A 3NGAA 4O21A 1ZAOA 3CTHA 4EOJA 3HAMA 3V8TA 3JPVA 3P23A 3JR1A 3ZUVA 3NNWA 4N6YA 5J95A 3FZSA 4O2PA 3TNIA 3S1HA 1DM2A 4RC3A 3IECA 1W98A 3HDNA 2I0EA 2C6LA 4WNKA 3LXKA 2ZMCA 4I4FA 4IANA 3MFSA 3FQEA 4OBQA 2ZMDA 4O7ZA 4BDAA 2ZAZA 3NUSA 3VAPA 3LOKA 4QPSA 3R8ZA 4AG8A 4CV8A 1A48A 3BBTB 3W2CA 4F0FA 2XK6A 4BWXA 3BYVA 3PE2A 4V05A 2X4FA 3FJQE 3AGLA 3B2TA 3FZPA 5EDQA 5A4TA 5KZIA 4QMPA 4ZTLA 4GT4A 5A4CA 2YIYA 4II5A 4RIXA 4AZVA 3LM0A 2YISA 3BYSA 1TVOA 4FEQA 4DE4A 3K3IA 4IX4A 4JI9A 2X9FA 1ATPE 2C3IB 4EUTA 2FGIA 3KXZA 5KMOA 2FB8A 4BDHA 5IPJA 5DI1A 1JSTA 2C3JA 3E8DA 4DGOA 4AZSA 2YM8A 4MXZA 1RE8A 3V5PA 3FXXA 4TYGA 3W2RA 4BF2A 5LARA 3R04A 2X0GA 5BVWA 3VRYA 3BYMA 2IZRA 4C37A 3F5UA 4K6ZA 5EKOA 4F6SA 3NIZA 2WU6A 3BU6A 5EM7A 4YLKA 1M7QA 4BGGA 2X7OA 4QTEA 3QZFA 2BHHA 4R7BA 4ZXTA 3OUNB 3TNWA 4YJRA 1Q99A 4DGGA 5IQCA 1YXXA 3S4QA 2XMYA 3K5VA 5AP1A 3UODA 2O3PA 3EQGA 4U0IA 5BYZA 1R0PA 5AM7A 3JY9A 2GFSA 3OC1A 4HCTA 5HVJA 1X8BA 4ERWA 3ENHA 3LCSA 4FC0A 2CNVA 2PMLX 4YJNA 1Q62A 3CPCA 4WBBB 3UOJA 3QD3A 5J79A 2P0CA 2JKMA 4D55A 2QOCA 2C3KA 2IVSA 2WTKB 3A7HA 4RX7A 4FKQA 3RI1A 1PXJA 2QOBA 2YDJA 3KF7A 5IA5A 3NIEA 3VBTA 4EYMA 3QRJA 5AV4A 3CY3A 2Z7QA 3KRXA 3MV5A 3F2AA 3U8WA 5EQEA 4FZ6A 5IQIA 4UMQA 4EZ5A 5CEPA 3UC4A 2DQ7X 4WT6A 5M09A 2ERZE 4I6QA 4FZ7A 3JXWA 2EUFB 4RJ7A 5IZFA 5E1SA 3RAWA 4UMRA 4XLIA 2WO6A 4DEBA 4ZK5A 2VWXA 5DN3A 4HNIA 3A8XA 4R7HA 3RK5A 2JBOA 2ITNA 4UZHA 4J71A 4XG9A 3PXQA 2W17A 4DGMA 3ZFMA 3Q2JA 3E3BX 1SMHA 2B52A 3PWDA 1WMKA 1DAYA 2BZKB 5AIRA 4EOMA 3UIXA 1LP4A 4PWNA 2EWAA 2BMCA 1RQQA 2F9GA 2YABA 4FKPA 4IZYA 3U6HA 1R0EA 2V55A 1QL6A 4YZCA 4AW2A 2JGZA 3DDQA 1V0OA 2OKRA 3VJOA 1OL1A 3WF9A 2OF4A 3FC1X 4E5AX 4JL9A 3DKOA 5C1QB 2J0JA 4RA4A 4UN0C 3FLZA 2VTAA 4O84A 3EL7A 4F6UA 4EQMA 2O65A 2RFNA 2Z7RA 4Q5HA 1ZMUA 3FWQA 1ZY4A 5EW9A 3PXYA 4C3FA 3C4EA 3E63A 2PUUA 3OCTA 3K54A 5HZNA 2H96A 3S95A 5BUEA 1OGUA 3HV7A 3I60A 3LFFA 3IG7A 5TO8A 2WTIA 4BHZA 3R83A 4AX8A 1S9IA 2BR1A 2R64A 5KNJA 3LXPA 3RPVA 3CJGA 2SRCA 3A61A 4WHZA 4C2WA 4IH8A 2OIBA 4DEIA 2EXCX 3EQBA 4QP9A 5I9UA 3UMWA 1BYGA 4CNHA 3T9TA 3V5LA 3OTVA 4BTKA 3IKAA 4C4IA 3SQQA 3C4CA 4IDTA 5HESA 3QFVA 3EZRA 4JIAA 3L9NA 1L8TA 3TDVA 4AGCA 2OI4X 3U55A 4TKSA 4NWMA 2JFMA 3HECA 4QOXA 3IW7A 4YTHA 4AFEA 4CLIA 4EWHA 3N4TA 2J51A 5TOZA 1JBPE 1LUFA 5M44A 5DNRA 3NYNA 3LCDA 3UYTA 5JN2A 2UZBA 3UIBA 2QOQA 1OKZA 2OWBA 2R3NA 5CF5A 1M2QA 2QU6A 4XCUA 2WTDA 5IQGA 3FV8A 1UU8A 4LUEA 4PDPA 3L1SA 1H1QA 3ZCLA 1WBNA 4WG4A 5FEDA 3L9MA 5L4QA 3FMLA 2OSCA 3JYAA 3NLBA 2F7XE 2WZJA 4CTBA 4C4JA 4APPA 4AA0A 2R3JA 5ACKA 4KKEA 3U9NA 2C30A 5L6PA 4ZS4A 2IVTA 3TNQB 2V7OA 2PY3A 2QURA 4ASZA 1OBDA 4EKKA 4J7BA 1GZ8A 3QD0A 4FSWA 5L6WL 4G6LA 5L3AA 2YM7A 4XV1A 1XQZA 1MQBA 4GK4A 5J9ZA 4YURA 1Q3DA 4Z7GA 5JEBA 2QOLA 2JITA 1OIQA 5HCYA 4IADA 5GZ9A 4MQ2A 4QMOA 4L46A 4APCA 4BL1A 3HMIA 1KE9A 4FNZA 5EHLA 4RX5A 2B9FA 2XBJA 3EKKA 2ZYBA 4FTLA 4IAAA 4IVCA 3PG3A 4PNKA 4JRNA 2JAMA 4EQUA 4ENYA 3QBNA 3BLQA 3GU7A 4QYFA 2J0IA 3PDTA 3RCDA 3HMMA 4RFYA 4NKAA 3C51A 5EM5A 3F7ZA 3AC5A 4IZAA 1B6CB 1PXKA 3HV6A 4IQ6A 4J8NA 3PXRA 4XH6A 4HZSA 2XZSA 3R7YA 5BVDA 2B55A 1BMKA 2BKZA 2VTOA 5E8ZA 4F0IA 4U79A 3V5WA 4EKLA 5FXQA 4AOTA 2ZV8A 1ZARA 3VUMA 2VRXA 3R1QA 1XH9A 4ZSLA 5HICA 4F7LA 5CU0A 1ZZ2A 2GSFA 5IEVA 5K5NA 3EKNA 3PLAE 5AEPA 4MBIA 3W2SA 1VYWA 3QKLA 4O0TA 4FYOA 4HGEA 1ZOEA 2JC6A 3UE4A 4BB4A 3F3ZA 1YXVA 3H9RA 3U51A 3TZ8A 3CGOA 4QMZA 2R3FA 5M4IA 4BCJA 3BHHA 4L45A 5DMZA 5AUXA 3C1XA 4LRJA 3KB7A 2UV2A 3D15A 3EFKA 2A4LA 4CGAA 2YDIA 4EOQA 1SVGA 3R8MA 1ZOHA 4AN3A 4C4FA 5IA1A 3A7IA 2XK8A 3AD5A 2HW6A 4FT7A 3WF8A 4CZTA 4K2RA 2V0DA 5HTIA 4MNEB 3FMKA 4I93A 2OJJA 4RC2A 5BMMA 4F99A 5GINE 3SXRA 2VV9A 3QRKA 3SD0A 4Q9ZA 5H2UA 4OTHA 4R6VA 1JOWB 4JX7A 3EQIA 3FKOA 2ZM4A 3UIMA 3BYOA 4C33A 2OJIA 4D9TA 2A0CX 1OKWA 2VTMA 3VS6A 2ACXA 1CKJA 5DT3A 3PTGA 1EH4A 2JDRA 3MH0A 2BZIB 5AP4A 3GU6A 5L2QA 1H08A 2G2HA 3R71A 4D1XA 4IZ5A 4F1MA 5L2SA 4DHFA 5HHWA 3OCGA 5A4LA 5KKRC 4NIFA 4BCPA 3N51A 4IACA 2C1BA 1W83A 2GTMA 4OTGA 4ACHA 2GTNA 4D2SA 2XIXA 3QWKA 4AT5A 2RF9A 2X2MA 5BVNA 4DN5A 2WFYA 3P4KA 2C6TA 4FTKA 2GNIA 1KE6A 3OBGA 1PKGA 2YCQA 3IPHA 5EK7A 3ELJA 4EHGA 2PVJA 4E8AA 4FKRA 4FSUA 4IFCA 3I6UA 2WMUA 2PZYA 3MSSA 4M15A 3RPYA 2OW3A 2YM6A 4JR7A 5LMBA 1YI4A 3FI4A 4ACGA 3C13A 1MRUA 4U40A 2QNJA 4A9YA 4MNFA 3VBYA 3FL4A 3TV4A 2W9FB 4HYHA 4U43A 1H4LA 4ITIA 5HU3A 4EJ7A 1ND4A 3MFTA 4A06A 2R4BA 3N4VA 4YJVA 5E91A 2OU7A 2HW7A 1YWVA 2HWPA 3KFAA 1QPDA 4ZIMA 3C4FA 5HBJA 3ATTA 4IVDA 2YJRA 3DU8A 2ZDUA 3TUDA 2BUJA 5J87A 2BAJA 5LMKC 1KOAA 3K2LA 4V01A 2ETRA 4C57A 2X81A 4G2FA 2O64A 4MXYA 4Y95A 3SG9A 5AP6A 1YVJA 1REKA 4FIJA 4RIWB 3F3WA 5DE2A 3ZRMA 2IG7A 4PF4A 2XRUA 5GNKA 2IPXA 3LJ2A 4E73A 5DR2A 2JDVA 4DC2A 4E4XA 3F5XA 3G6HA 4PPCA 4S31A 3KK8A 3E8NA 3LHJA 2UVYA 2R2PA 4BWPA 4B6LA 4G5JA 4M7IA 4RC4A 5CSHA 5CEIA 4FIEA 4J97A 1H8FA 4XG8A 2XJ1A 3GOKA 2X9EA 4LMUA 4USDA 4MBJA 4XX9A 2F7ZE 3KU2A 4KIOA 4O0SA 4IW0A 5E8UA 2GNLA 4DFYA 4NTTA 3U6IA 5AAFA 4D0WA 2W05A 3QWJA 2ONLA 1J7IA 2W1HA 2YFXA 4E5BA 1MRVA 3ZUUA 4ANOA 3A2CA 2VWBA 3WI6A 3FAAA 4G9CA 4GK3A 3EN6A 2X8IA 2WIHA 4O6LA 2OZOA 3TUCA 4Y46A 1H26A 3H10A 1STCE 4S34A 3ZLSA 5EDRA 4NKSA 5LJJA 4I20A 5IDNA 4IEBA 4D5KA 2OBJA 4EH9A 3OEFX 4EEVA 3WOWA 3VS2A 2ZJWA 5FBOA 4BRXA 4I22A 2JKKA 5CZHA 3UDBA 2ESMA 2ZOQA 4PDYA 4NT4A 4BDCA 3R1SA 1W82A 3R9RA 4N57A 5F9EA 4V0GA 2UZVA 4MWHA 4XRJA 5DIAA 4FG7A 4G5PA 3QKKA 5D9HA 4K18A 3ZFYA 3TN8A 2QO7A 4DFXE 1ZMWA 1WAKA 5A4QA 4RRVA 2VTIA 5C4KA 2J7TA 2G01A 5EQPA 5HQ0A 1MRYA 3V5TA 4RIXB 4A4LA 2Z7SA 4NU1A 1CSNA 4MBLA 4DLIA 2OXYA 2WNTA 5GIOE 4HVIA 4RT7A 4XEYA 4F9CA 5M4CA 1M14A 1Q61A 3BEGA 4FIGA 3MJ1A 4FSMA 2FSOX 2RFEA 2JD5A 4FV0A 5FTGA 3NR9A 3I5NA 4DH3A 1VEBA 2XUUA 4RWJA 2OXXA 2XJ2A 1XBCA 2HENA 3FLWA 3QHRA 4YLJA 4Z3VA 3GNIB 5DH3A 4RVLA 4KBCA 3OS3A 1KUTA 2R3KA 3PY0A 5CXZA 3CJFA 3FMJA 3QRIA 2QC6A 3E62A 4FTRA 3COKA 3RBWA 5L6OA 5AAEA 3RAIA 3IW6A 5KE0A 4U5JA 2E9NA 2VO3A 2OJ9A 3DB8A 3BU3A 4QD6A 5JZNA 3NPCA 4R3RA 2W9ZB 2XEZA 5CTPA 2WKMA 4EK4A 4O83A 2QOHA 4A4OA 3O23A 5EYMA 4GU9A 1XR1A 5KX8A 3QUPA 3UC3A 4GCJA 3V8SA 4JG8A 3GUBA 4D4RA 5JFWA 3VS7A 2BILB 1YXTA 2X7GA 4FR4A 4AT4A 1Q5KA 5CQUA 2UW7A 4DTKA 5AX3A 4F9AA 4ZZOA 2Q83A 1JLUE 3VUHA 3OY1A 3DK7A 5IEYA 5HNBA 4AQCA 1LEZA 2RG5A 4X21A 3ULZA 3UQCA 3QX2A 5CQWA 1Z9XA 2BFXA 2QQ7A 1NVRA 3MY0A 5E92A 4FSNA 3FSKA 4O0VA 3ZM4A 3ZSHA 2X6EA 3RWPA 4X2NA 3LFSA 3O17A 3H3CA 4K8AA 3G6GA 4EWQA 3KRJA 2P55A 3OXIA 3KULA 3KN6A 5ANDA 3HRFA 4YP8A 5HE1A 5ANGA 2QOFA 1Q41A 1O6KA 4HPUE 4YZBA 4DH7A 4F7JA 2BRHA 2G1TA 4DH1A 5AM6A 3TTIA 4BHNA 2XBAA 2YHVA 3PY1A 4JX3A 3ANQA 2HYYA 4KKGA 2PVKA 4QMTA 4DEGA 2ZB0A 4RSSA 4F64A 4TL0A 3ZEPA 1OPLA 5HTBA 4B8LA 2JIIA 4ZSJA 4ZTQA 1OPJA 3RJCA 3ORPA 2J5FA 5KMMA 2CJMA 4UB7A 2IZUA 4YC3A 5ANJA 3ZLXA 4AN2A 4IAFA 3DCVA 4FICA 1OL5A 3OEZA 1W7HA 2C4GA 3ZLYA 4ACMA 3JUHA 2FVDA 4YJQA 5K3YA 3EN9A 5IU2A 5FEEA 2JLDA 4F9YA 3R9HA 4KWPA 3COMA 2CMWA 3KXMA 5M4FA 3DXPA 1ZRZA 4U8ZA 4DFUA 3D7TA 3TIZA 2I40A 4BDFA 3E8CA 2W4JA 3NNVA 2GS2A 3AT4A 4CTCA 5BUIA 4DG2E 2F2UA 3JVRA 2B4SB 2XIYA 4IJPA 3FLNC 3Q9WA 1Z57A 5C01A 4GL9A 3KREA 4AE9A 5J5TA 3BLRA 3NWWA 2X2LA 3R28A 4NYEA 1W8CA 2R5TA 3Q32A 5CU3A 4EOKA 3VIDA 3G90X 3IO7A 3MVJA 3TZ7A 4TYHA 2QOKA 1YDSE 4YC6A 3DFAA 4BIDA 5HIDA 4RX8A 3QQHA 5CF4A 2DUVA 4DFZE 2QLUA 1KSWA 4BTJA 2HY81 2ZDTA 4M12A 5HG7A 3QLGA 4GG5A 5DVRA 3PFQA 3Q60A 4BCNA 5K4JA 1XH7A 1ZYJA 4KS8A 4D28A 4J1RA 4YTCA 4BICA 4YMJA 2BAQA 3B2WA 3EN4A 4TYJA 5I3OA 4BDIA 4FV1A 4K77A 1GNGA 3NVKI 4TWCA 5HLNA 4A07A 3DPKA 4Q5EA 4WA9A 4XG3A 3ODYX 4QMMA 3BRBA 3WILA 3KXHA 4F9WA 2GHLA 4N4SA 4G6OA 3TIYA 3F5PA 4QP1A 2W1GA 4HPTE 4L9IA 3ZDIA 4GS6A 4HW7A 2UZOA 3D83A 2QHMA 2F2CB 5IDPA 4L44A 5T68A 4A9UA 2XP2A 4FVPA 3W2QA 4ZZMA 5HOAA 3TKHA 5FLFA 4ACDA 4UX9A 2P3GX 5J1VA 3E88A 2V5QA 4LGHA 4UWYA 4RG0A 4JNWA 3RAHA 3BU5A 3WZKA 3A60A 4D4YA 4IM3A 3TEIA 3FEGA 3W2OA 3BHYA 4YSMA 4M3QA 5CU2A 3SV0A 3TJCA 5L2TA 4W4WA 5HEZA 4GKIA 5HKMA 5T6KA 3LJ1A 1GZNA 5AR3A 4IZ7A 1Q3WA 5M06A 4BI1A 3T3UA 3QRUA 2XNPA 3PXFA 4OTDA 4XUFA 3RZFA 5HO8A 4DYMA 4DGNA 3HA8A 4FVQA 2UZWE 3LLTA 1WBWA 5CI6A 3VUIA 1GZKA 2GNHA 2UZTA 1S9JA 2JKOA 1KE7A 3TT0A 4FX3A 1DAWA 3PA5A 3ZONA 3M2WA 4GYGA 3FMDA 4KIQA 1O9UA 2UW3A 5D7VA 3C9WA 4ZS0A 2R3MA 3O96A 1J91A 5HLWA 2CKPA 4BDJA 3EQDA 5HNIX 1W84A 4PTCA 2Y4IB 3L9PA 2FSTX 5FBNC 2ETKA 5FM3A 4PP9A 5CNOA 2QONA 3TNHA 3S3IA 3RNIA 4BBEA 5IQAA 5AJQA 4FSTA 5GIPE 2BROA 2F57A 3DAKA 4I94A 4O91A 2J5EA 2OJGA 5EW3A 2QR8A 3AC8A 4YR8A 5E90A 4TT7A 3AXWA 3O0GA 3ZLWA 5KBRA 4YJOA 4E4LA 4FIIA 4FSYA 3ACJA 4HCUA 5EOLA 1A06A 3DA6A 3UTOA 4DEEA 1VYZA 4W4VA 4R5SA 5F95A 3RTPA 4F6WA 3FKNA 2C0TA 3R73A 4IFGA 4QMNA 3UMXA 1OKVA 3R9OA 2XIZA 2BDWA 3QYWA 3HRBA 5D41A 5FDXA 3T9IA 4ANNA 3QRTA 3DXQA 2LAVA 4CYJA 4LM5A 5M08A 5HO6A 3ATSA 5AP7A 4U80A 5HE2A 1BX6A 3EYHA 3ZYAA 1SNUA 2Z60A 3OF0A 4FUXA 4FZFB 2WMRA 5IMEA 4CFWA 2GQGA 4JBPA 5AP3A 4C38A 3O2MA 3AC2A 1PXNA 3I81A 3KMMA 4U45A 4L8MA 2W5BA 1XKKA 4ZSEA 4NIFB 4UZDA 4FKGA 5E8TA 2J50A 2J0MB 1QMZA 3ZH8A 4NSTA 1J7UA 2AYPA 3V04A 3A7FA 3DS6A 4JOAA 5AR4A 4FV6A 4GJ2A 3AC1A 4U42A 2VZ6A 2PVHA 4XV9A 4Y83A 4R7IA 3QTIA 3HUBA 2C5NA 4TW9A 4F09A 5J9LA 5HO7A 3GQIA 4FBXA 5GJGA 4FNXA 2WEIA 3HMNA 4GMYA 2PL0A 4JBVA 4YJPA 1UKHA 5AR7A 1TQMA 4K9YA 5HE0A 2WEVA 2C47A 4O0WA 3QYZA 3S00A 4IAIA 3BHTA 1NVSA 4UY9A 3IOPA 4R5YA 1QCFA 5EG3A 1YWNA 3UGCA 1GY3A 2A2AA 3NCZA 5IEXA 3BE2A 3ALNA 1H1SA 4JBQA 4Y72A 5HVYA 1JQHA 4PQNA 2GS7A 4P2KA 4OAVB 3UQGA 1FINA 3QC9A 2XA4A 3FMEA 4PL4A 5KMKA 1YXUA 4FG8A 3KA0A 1GIJA 3FXWA 4HVSA 3SDJA 2BIKB 3DKFA 5AV3A 3TDWA 2Z02A 4W8DA 2J0LA 4DH5A 4NM5A 3DNEA 4X3FA 4CKJA 5BYLA 4P4CA 4O7NA 4LV8A 1SVEA 4CYIA 2WTKC 4RZVA 3WIGA 1PMUA 2XIKA 3MDYA 4AWIA 3CBLA 3OROA 5CX9A 4PMMA 4QQCA 3HA6A 2E9UA 4C36A 5AUVA 4D5HA 4DEDA 3FZ1A 1IAHA 5TT7A 1TQPA 4TN6A 4WSYA 1TKIA 4I0SA 3G33A 2VX3A 4O0RA 2BVAA 1Z5MA 3FHIA 3KCKA 1JAMA 4XG7A 4L43A 4QTBA 2VTSA 3DBEA 2B53A 3GCUA 4NZWB 4D2PA 3W18A 4CVAA 2BZJA 4YHFA 4I23A 3LAUA 3PA4A 3LFQA 3U4UA 4GSBA 3NYOA 2VTHA 5KZ0A 2C0OA 3G51A 3R30A 4FKSA 4RJ8A 2R3GA 3FE3A 4LOOA 5IA4A 2X2KA 4OBOA 2IW8A 2YCFA 1P2AA 1PRYA 3UO6A 1JKKA 1FMKA 2XH5A 4YJUA 5C8KA 5E8WA 5KMNA 5M57A 3RGFA 4OTIA 3CP9A 4K1BA 5E8SA 3FXZA 5CAQA 4N70A 3IK3A 4KS7A 3TKUA 1WBPA 1NW1A 5E4HA 1WBVA 2HCKA 3QHWA 3RNYA 1YHSA 4FV9A 4UEUA 4YNEA 4YUQA 1YXSA 2PZIA 5CF6A 5I9XA 4GYIA 2YEXA 4HYIA 4NEUA 3BX5A 4HOKA 5AR2A 2HELA 4HGTA 4V0GB 3EQCA 1OIUA 3C7QA 2RFSA 3KQ7A 2CLXA 2X6DA 1OI9A 2C6OA 4O7VA 2F49A 5GJFA 4DCAA 3DBDA 5CSPA 2YZAA 3NAXA 2PMIA 4MAOA 2XB7A 3GC9A 3R21A 1CTPE 2OIDA 2R0UA 4G3EA 4PMSA 4TWPA 3OCBA 4RZWA 2C6IA 3P0MA 4FF8A 4S32A 2IN6A 2O5KA 3VS0A 4ASDA 2YZLA 4MXAA 4NJDA 4FT5A 3OHTA 4F4PA 5FRIA 2QU5A 5ACBC 4NTSA 1MQ4A 5L8KA 4IXPA 3D4QA 1K3AA 4NW6A 2KTYA 4A4XA 3E64A 1Y57A 4XNEA 3FMNA 2GDOA 4P90A 3VWAA 3LFEA 3MPMA 4RA5A 3OBJA 2IJMA 1UA2A 4HJOA 2PZRA 3F9NA 4HYUA 3N9XA 1PYXA 3H0ZA 4FVRA 4GVAA 1O6LA 2YACA 4LI5A 4RVTA 4XMOA 5CAOA 4Z7HA 5IH6A 3P7BA 2HK5A 2VWIA 4H3BA 2QI8A 3KC3A 1U4DA 5CSWA 3QUEA 1GIHA 5GJDA 3LCTA 2VUWA 4PPAA 2A1AB 4ARKA 3ZUTA 2BDJA 3H0YA 4WNPA 2O8YA 4U7ZA 3R7IA 1JSVA 2OICA 3R01A 2NO3A 2R3LA 5A9UA 3NUXA 2JDOA 4M0YA 5AUUA 3BV2A 5JRSA 5IQBA 2BZHB 3Q4TA 4CCBA 2ITPA 4DTAA 5CVGA 1PXPA 3VUDA 3ERKA 4F7NA 3I79A 4DITA 2DWBA 5FXSA 1UWHA 3UP7A 2XS0A 3P1AA 4FSZA 3CQUA 4X2KA 3UPZA 4BCQA 4NJ3A 1WVXA 5D7AA 4YO6A 2VX0A 1YW2A 4WRSA 4FTAA 3BBWA 3L8XA 2FYSA 5IISA 2ZM3A 4DCEA 3R9DA 1IA9A 4C7TA 1JPAA 3QKMA 3KULB 3WZUA 2PZPA 3PPKA 3IQ7A 1JKSA 2J9MA 1HOWA 4WSQA 3ZDUA 3I7BA 3OUKA 4EJNA 5M4UA 1OM1A 5C9CA 2B9JA 3EFLA 3QALE 5CU6A 2VTPA 1WZYA 5DRBA 3GC8A 3O8UA 4XYFA 3TTJA 4A7CA 4BR3A 1Y8GA 3NCGA 1U5RA 2JDTA 4J98A 2BRGA 3DJ5A 4EOSA 4J95A 5CAUA 2IO6A 1FVRA 4QT1A 2IZSA 3LXNA 4ANLA 4H36A 4UMPA 3PZHA 4NM3A 2JKQA 3OY3A 3QU0A 4F9BA 4LGDA 3KXGA 4CMUA 2FSMX 2PZ5A 4FTUA 3R8VA 5DA3A 5AUYA 3C5IA 5KMLA 4FGBA 4JG7A 3EB0A 4Y5QA 5H8EA 2WTCA 5CEMA 1UV5A 4E4NA 4XS2A 4EL9A 5K9IA 4O0UA 5HD7A 3RALA 3CTQA 4BKYA 3DLZA 3KXXA 3HX4A 5CS6A 3TG1A 3U4WA 3D5VA 1H07A 5FXRA 2V62A 3NUUA 3REPA 3ZSIA 4B99A 4E93A 4YZDA 4IWPA 1DS5A 3RHXA 4O7SA 5AAGA 4QMYA 3PUPA 1PYEA 3F2RA 3KVWA 4YPSA 4UYAA 2XYNA 2ZV9A 3WZEA 3ZS5A 1ZYSA 3ZTXA 3PJ3A 4BI2A 2WTVA 5CAVA 4AAAA 2GS6A 2FH9A 4AS0A 4R1YA 4BDDA 3TNPC 2BRBA 2WD1A 1OL6A 3DQWA 3TXOA 5JZJA 4C4EA 3ZEWA 4ENXA 4F1OA 3ORXA 3CIKA 5LVMA 3HNGA 5DPVA 2XKFA 5CAPA 2EVAA 2VGPA 3QCQA 4HGLA 3E87A 3Q4ZA 4H3QA 2FO0A 3C4XA 3HRCA 5HU9A 4C4HA 4BVUA 3DLSA 4LYNA 2BFYA 5KHWA 2GHGA 3TZMA 3V5JA 2B9IA 3CKWA 3TM0A 2VO7A 3UZRA 3QTZA 1PXIA 2XNBA 4OAUC 2VO6A 2VWVA 2UZUE 4DF3A 3EQPA 4B4LA 4C8BA 1A9UA 4TNDA 3MA6A 5LOHA 4AE6A 4JT3A 4PX6A 2DS1A 4LOPA 4X7QA 2C5OA 2WGJA 2J6MA 3MW1A 4BFMA 2CSNA 2UZDA 3FMMA 4I1ZA 4C58A 5CVFA 4RFMA 3ZFXA 5E8YA 5FM2A 2VNWA 4EONA 4P5QA 5E8XA 3DBQA 5TE0A 3C4ZA 3GEQA 4GFMA 3QTQA 3P79A 4S30A 4X6RA 5TF9A 2X39A 2HXLA 5IQHA 5CY3A 1H28A 2A19B 1B38A 1U59A 3AT3A 5FTOA 2XNOA 2WMQA 5AWMA 2G15A 4E6CA 1YWRA 3U9CA 1LPUA 3PJ2A 4CFUA 1UNGA 4FT9A 1H1WA 3QA8A 4FTMA 4AACA 2R7IA 2QODA 4WIHA 4E3CA 3FHRA 3ITZA 2YIWA 4MXXA 3ZRLA 3O8TA 4DT9A 3UP2A 3VBWA 3MH3A 1DI9A 5LCKA 4MF1A 2CHLA 3EQRA 3OFMA 3P9JA 4AGUA 5L2IA 4AW1A 4XHKB 2HZNA 2VAGA 4FV8A 3GU4A 1R1WA 5M51A 2RG6A 3AG9A 3EN5A 4ZY4A 4UMTA 3QQFA 3HZTA 5AP0A 3RPOA 2IVUA 3NW5A 4OW8A 4PUZA 3MH2A 3S2PA 3GFWA 3CD3A 4I6HA 3QCSA 3V01A 4DBNA 2VTLA 1OZ1A 2XK7A 2YIRA 4LUDA 1KE8A 2OZAA 3G2FA 5EI2A 4C62A 2CNQA 1YDRE 4D58A 3FI2A 4NFMA 4CD0A 5A6NA 3IS5A 4GH2A 3I0OA 3EN7A 2CGVA 4FIFA 4L53A 2JIUA 4MD7E 5HG5A 1ERKA 5A3XA 3QXPA 2PWLA 1ZLTA 4FTIA 3E7VA 5ETCA 4ZEGA 2UW0A 1J1BA 1BKXA 4I41A 4N6ZA 4M67A 4UXLA 3VS3A 4CLJA 4FODA 1BL6A 4IM2A 4RIYA 4DFLA 4JAIA 3EJ1A 2NP8A 4ALVA 4QQJA 2XEYA 3H9FA 3W10A 1HCLA 3R7OA 4FL2A 4BIEA 2QOIA 5LVLA 3RWQA 1UWJA 4FL1A 2AC5A 3O51A 3ZC6A 1NY3A 4QP2A 3SHEA 4HVDA 3F88A 1YKRA 3FC2A 3IW4A 4LRKA 4TNBA 5HI2A 5A46A 3H4JA 3IGOA 4M0ZA 4CSVA 1QPJA 3GVUA 4QNAA 2X7FA 2VN9A 2WMWA 2XK9A 3GBZA 3SW7A 5C03A 3PVGA 4RBLA 4YLLA 5IQDA 3VULA 3IW8A 3BYUA 3K3JA 3D2IA 4PV0A 5ETAA 2J0KA 2UW5A 4KIPA 3A99A 1AQ1A 2F4JA 3NYXA 4X3FC 5J8IA 3SX9A 3IDPA 4GG7A 2R3OA 3BQCA 3CQWA 4OTRA 3PA3A 2UUEA 1R3CA 3VN9A 4FKJA 3AMAA 3WYXA 4HVHA 3CTJA 4W4XA 5CXHA 3U87A 3FSFA 4ID7A 5FGKA 1V0BA 4XBUA 1URWA 3QD2B 1OBGA 2A27A 2C69A 3UQFA 2QG5A 3WYYA 3Q52A 3P86A 3ZZWA 3LFAA 1FGIA 3SW4A 5JGBA 5DG5A 2W7XA 2PUNA 4LL0A 4WOVA 3F66A 4CMTA 5HIBA 2Y4PA 2PVFA 4MYGA 3MS9A 4KKHA 3UOHA 4OT6A 3ROYA 4MX9A 4X3FB 2X8EA 2HZIA 3OMVA 3PP0A 4ZJIA 3F3UA 2H8HA 2WHBA 3ORLA 3QTWA 2PE0A 1L3RE 3D5UA 3MIYA 4OGRA 4EZ3A 3QTUA 3MVMA 3PVUA 4XG2A 4O86A 3SA0A 4FTOA 2VGOA 4TYEA 2AUHA 4GKHA 5GHVA 1PJKA 1FOTA 3KVXA 4RJ6A 5EDPA 1XH6A 2WQNA 1URCA 2CGUA 5IQEA 1UU7A 3TKIA 4PDOA 3R0TA 3RKBA 5BVFA 3RINA 3TUBA 3ZHPC 4A9SA 3RPSA 4DBXA 4ALWA 4KAOA 3PPJA 4M66A 3CPBA 3MI9A 4MVFA 4CFFA 2VO0A 3DDPA 3QTXA 3THBA 4TY1A 2Z2WA 2QKRA 3SC1A 2Y6OA 3PIXA 2ETMA 2W1DA 4U81A 3EFJA 1WFCA 5DT0A 4D2WA 2E9VA 4CFNA 4EBVA 3SOAA 5CYIA 3KEXA 2W0JA 3ZMMA 4C59A 2QLQA 1H0WA 1UKIA 4J8MA 4WUNA 5A54A 3DKGA 2ITXA 2UW9A 1H1PA 5JMSA 2BCJA 3QD4A 3HAVA 5BNJA 4ZAUA 5FUTA 5DYJA 1OUKA 4EH4A 2XYUA 1PXMA 3I0QA 3KKVA 3UZTA 5C8MA 4M97A 1PKDA 3UNKA 4FYNA 4AW5A 2IWIA 2C6DA 2XKCA 5LVOA 5KBQA 1Q4LA 4XG6A 4C0TA 4FGRA 1OIRA 3O71A 4PDSA 5D1JA 2ITTA 3UVQA 5I9YA 3PE1A 3MJ2A 4FG9A 4ZY6A 4DEAA 3EMGA 3OT8A 4FV2A 2RGPA 5M53A 4TZRA 4OUCA 4ZTMA 1MUOA 3E8EA 3AC4A 3HP2A 4Y85A 4YGAA 2BDFA 3KXNA 4FTNA 5GZ8A 4FEVA 2I7QA 2X1NA 3A4OX 2WMVA 5JFSA 3RPRA 2CDZA 4XG4A 3SRVA 4W8EA 4H39A 3GB2A 2Y6MA 2RIOA 3Q53A 4EK8A 5I0BA 2RL5A 2O0UA 4D2VA 1YOJA 3BLHA 2XCKA 4FUYA 4O38A 3AC3A 4H58A 3Q3BA 5I9VA 5J7BA 4WD5A 1T46A 4RWIA 4W9WA 3F2NA 3PIZA 2V22A 2VD5A 4G34A 5J5SA 3DAEA 4FKWA 5G1XA 4GJ3A 3CQEA 4BIBA 4EK3A 3UYSA 4KB8A 1ZYCA 3CXWA 4HNFA 3BWJA 4N0SA 5FP5A 2UZEA 2UW4A 3ENMA 4IX5A 3O8PA 2PYWA 4CG9A 3P5KA 5ANOA 2NNWB 5E1EA 3LZBA 2PPQA 5C4LA 1PMNA 3GCSA 2WOUA 3NX8A 4QQ5A 2ZM1A 3VC4A 3NVMB 3AQVA 4R3PA 2O2UA 4CFVA 4EOLA 3COIA 4FKIA 3Q9XA 3WF5A 3HV3A 3A7JA 4KSPA 4BCOA 2I0HA 4LRMA 1ZZLA 2FUMA 3EHAA 1KE5A 2C5YA 3EWHA 3T8OA 3W8QA 3ZM9A 3COHA 5B0XA 3LMIA 4U41A 1OIYA 2XM8A 1JNKA 1Q8WA 4GEOA 4HGSA 4I6FA 4IWOA 1OVEA 3C5UA 2W5HA 3GCVA 3IDBA 4KD1A 4GW8A 5DEWA 4FEUA 2QO2A 5LWMA 3BGPA 3FZTA 2CPKE 5ANEA 5FG8A 3FDNA 1YI6A 3POZA 1PW2A 2HY0A 4JR3A 3CE3A 2P33A 4IWDA 1GZOA 2FA2A 3AOXA 3LCKA 3CSVA 4JQEA 2W96B 4FA2A 3TZ9A 4EQCA 4M8TA 1O6YA 5K5XA 4BI0A 4G9RA 3F69A 1H1RA 1Q8ZA 5BUJA 4I92A 3RK9A 2BHEA 2VNYA 4QP6A 3RM6A 4DG3E 2YLFA 3EOCA 5A6OA 3UO4A 2WB8A 4FZAB 3PY3A 2Y4IC 3GU5A 2BTRA 4GT5A 3VS1A 5H3QA 2PVLA 2C0IA 4EH3A 3A62A 3ZO3A 4IM0A 4C4GA 1M2RA 1WCCA 2YDKA 3OWPA 3S0OA 1RW8A 2EU9A 4O82A 2VTRA 2ITUA 3SLSA 3Q5ZA 5IH5A 1MP8A 5AX9A 2BAKA 3I4BA 3SGCA 3MTLA 4NCTA 4YBKA 4JJRA 3MESA 3NSZA 2ZV2A 3NNUA 4EC8A 4EHVA 3UZPA 1Q97A 2CGWA 2R3RA 3AMBA 4GT3A 3VJNA 4B9DA 4QTDA 3EH9A 5KMIA 3GP0A 4KA3A 4F70A 4RGJA 4RQVA 2YCRA 4WNMA 4AGDA 2PSQA 2JAVA 2RKUA 3FQHA 4O27B 4CCUA 3LE6A 3R1YA 3KRLA 3W55A 4BGQA 3HYHA 4ZMEA 5EI6A 2I1MA 4AA5A 3BIZA 4BBFA 2PVYA 4I0RA 3FPQA 1K9AA 3ZBXA 4DAWA 1DI8A 5CU4A 1BI8A 3VQHA 2Y8OA 4I6BA 5DLSA 4PP7A 3QQJA 5CEOA 4QPMA 4JDJA 1CMKE 4XP0A 1RDQE 3E5AA 1T45A 3PPZA 4IX3A 4B7TA 5CT7A 2HOGA 3MY1A 4XP3A 2XK3A 1FVVA 2Z8CA 4PTEA 2XVDA 5H8GA 4DH8A 4QMWA 3DQXA 1M52A 3DZOA 3O50A 3FQSA 5LMAA 4FKLA 3OCSA 2BPMA 4CMOA 1REJA 4TYIA 4KIKA 5LQFA 3CGFA 3RMFA 4UYNA 1G5SA 2VWUA 1IRKA 3DBCA 4FE2A 3U6JA 5E7RA 2PULA 4U3YA 3V8WA 1IEPA 2NRYA 1U5QA 4UBAA 4MTAA 3FI8A 3DY7A 4G31A 5ETFA 1V1KA 1FBNA 5CSXA 1GAGA 1Q24A 4QP3A 3VS5A 3SKCA 3W32A 4NM7A 5HIEA 1KOBA 4YJSA 3HV5A 5LMKA 5IA0A 1XBBA 1WVWA 1UVRA 3FYJX 4LV5A 3BCEA 4QTCA 4YZ9A 2YM4A 2ITQA 5AV1A 1FQ1B 3GQLA 4D2RA 4P5ZA 5E9EA 1CM8A 1ZXEA 4O2ZA 5AA9A 4UALA 2R7BA 2WPAA 2VTTA 3LFNA 3LFCA 3NMUF 3KF4A 4QTAA 4ASXA 5I4NA 2GNFA 1W0XC 2VX1A 3KK9A 1K2PA 3CKXA 3PSDA 5CALA 4KBAA 4CRLA 4C35A 4FKTA 5HBEA 2ERKA 1HCKA 3NUNA 4J99A 4E4MA 3KRRA 4ZZNA 3NUPA 3R1NA 3GC0A 3D7ZA 4FV4A 3WF7A 2ONLC 4CZYB 3A8WA 5HVKA 5DHJA 3OVVA 2WMAA 2QCSA 3WZDA 4AFJA 5IF1A 4D0XA 4GRBA 1M7NA 3DKCA 3QQUA 1E9HA 2OZAB 4K33A 4LL5A 5AP5A 4BCMA 2OFVA 4ANQA 4M69A 1G8AA 4FEXA 3CY2A 3PSBA 5IA2A 2JBPA 4FMQA 3MN3A 4CT1A 4BZOA 4CT2A 3R8LA 3VVHA 1OL7A 4ITJA 1IAJA 4EYJA 3QA0A 5CENA 5BVOA 1JWHA 4NFNA 3QQLA 2R3PA 4V04A 4KSQA 1SYKA 1VZOA 2LGCA 4RIYB 4IVBA 5EFQA 1FGKA 1XH5A 4HYSA 3C0HA 2YWPA 4RVMA 4GUEA 4BCIA 2YAKA 4Y8DA 4G3DA 4AW0A 2ITOA 3WZJA 4D4VA 3G0EA 2P2HA 4FV3A 5LCJA 4DG0E 2PTKA 4Z9LA 4YPDA 4E5WA 4PY1A 3F5GA 3FY0A 3RZBA 2YM3A 1Q8UA 1I44A 5I9ZA 4DT8A 1TQIA 4JRVA 5KHXA 3GENA 4AZEA 3FKLA 2IZTA 2WIPA 2H6DA 2OO8X 4KINA 3FZOA 3ORZA 3R2YA 3SXFA 5BPYA 5JGAA 5BVKA 3K5UA 4UWCA 5G6VA 4MHAA 3UNJA 4AF3A 5F20A 2XNNA 3GT8A 5IQFA 3TCPA 2WMXA 2B7AA 2ITVA 3BELA 4J52A 4PNIA 5AP2A 4KUJA 1YRPA 3QZIA 3W1FA 1U46A 3H30A 5HNGA 5TKDA 4CG8A 1YHVA 3D14A 1APME 4U44A 3ULIA 3SVVA 1H01A 3EZVA 2C3LA 2Y0AA 4QYHA 3OWLA 2EXMA 2WMBA 4Y73A 3QX4A 4LOQA 1Y91A 4FTQA 5DOSA 2JDSA 3PWYA 1M2PA 4EHZA 4BCHA 4O1PA 3OW3A 5AV0A 4W4YA 2JFLA 5EW8A 3UNZA 4Z16A 3HUCA 1XH4A 3GOPA 3BGQA 4JDIA 4QMQA 3LQ5A 3HDMA 1XWSA 3OTUA 4JVGA 3ZXTA 3BHVA 5CVHA 3BPRA 5DT4A 4B0GA 3EQHA 2HZ0A 4E6AA 2W5AA 4XV2A 4D1ZA 3ZO2A 2VTQA 3OWKA 3HVCA 4JAJA 3UPXA 4CKRA 5EI8A 3PVBA 3RM7A 4GFGA 3MB7A 4JG6A 4RMZA 3MPTA 3PXKA 3GCQA 4E1ZA 2G2IA 2WQEA 4NK9A 4RVKA 4D4SA 4FK3A 5EYDA 2OIQA 5K0KA 5HD4A 3M42A 4ANMA 5ANKA 1UU3A 4F1TA 5LXMA 3D2KA 2ITYA 4R8QA 5J7HA 5M56A 3ANRA 4AZFA 3FLQA 3UOLA 3UBDA 2C1AA 3QL8A 5FDPA 5DBXA 1OL2A 4IIRA 1B39A 4ITHA 2H9VA 2IW6A 3PVWA 4U97A 1PY5A 4OLIA 2CKOA 2OJFE 1ZYDA 4TXCA 4O0XA 4XOZA 5AR5A 4MXCA 4F65A 3JVSA 4U9AA 5JFXA 4F63A 3QCYA 4X2JA 5HG8A 4GK2A 2P4IA 4AA4A 4CEGA 5AA8A 5K4IA 2HXQA 1VJYA 4AOIA 3R8PA 5C26A 1WVYA 4PMPA 5DFPA 4IJ9A 5HX8A 3DT1A 3MYGA 3Q4CA 5M07A 4OT5A 3TJDA 2BIYA 3NDMA 4I5MA 2E9PA 4UWBA 3V3VA 2C5XA 4JXFA 2XNGA 5C8NA 4EOPA 4RJ4A 2ZVAA 4RWKA 5HTCA 4RWLA 5ICPA 4TWNA 3MA3A 1P4FA 4GIIA 3GU8A 4TPTA 3V6RA 3MH1A 3WARA 4ZTRA 2OXDA 3EFWA 3IOKA 4PL5A 4MKCA 2ITWA 3SOCA 3LMHA 3UG1A 3U54A 3DNDA 3R9NA 4DFBA 3QLFA 3II5A 2VWWA 2QOOA 2XJ0A 5F4NA 4UV0A 4OTQA 5B7VA 5BX0A 2REIA 5AUZA 1U54A 4PMTA 3VUKA 4ERKA 3FZRA 4FOBA 3QQGA 1IG1A 2W4OA 3NW7A 4BGHA 2XNMA 3BE9A 3FBVA 3FI3A 3UIUA 3VBXA 3SRVB 2G2FA 1M17A 1ZWSA 2C68A 4JDHA 4AUAA 4FV5A 4PTGA 4TRLA 3KRWA 5IUHA 2I6LA 2XRWA 3MPAA 2R3HA 3MVHA 5BVEA 3D7TB 1LEWA 4YHTA 3VUTA 4QQTA 3AD6A 4XRLA 3WF6A 4HVGA 1SNXA 2F7EE 4U3ZA 5IUGA 2ZB1A 2CGXA 3L9LA 3MY5A 3VNTA 2XK4A 2XKDA 5ETIA 4QMSA 3DTCA 1XBAA 2HZ4A 4IE9A 4QP8A 3Q2MA 3MBLA 2GQRA 2YIXA 5KO1A 4CFMA 3LPBA 3ORNA 3MTFA 3RCJA 2W1CA 4FKUA 4IMYA 2CN5A 5B2KA 4AU8A 3R22A 4PPBA 4GUBA 5HCZA 5CF8A 5JT2A 3KMWA 3FUPA 4DA5A 1FVTA 3BEAA 2BKKA 4BC6A 4YTFA 3NW6A 4TYHB 5IH4A 4KNBA 5DGZA 1P5EA 3KGAA 1I09A 3TI1A 4A9RA 5CEKA 2OH4A 3NEWA 3FMHA 3DK3A 4JIKA 5JH6A 4XJ0A 5CLPA 2OF2A 3CC6A 4E6QA 4OBPA 1J7LA 1GJOA 4XV3A 3NS9A 4YTIA 3UO5A 2PK9A 4YSJA 3QAME 3GI3A 4MF0A 4RLKA 2GPHA 5K0XA 3DB6A 4O96A 4USEA 3BHUA 3LCOA 1BLXA 5DRDA 5F94A 3T3VA 5KUPA 4GV1A 3PP1A 5HCXA 3PG1A 3W33A 3ETAA 3ZRKA 2NRUA 4YJTA 2XIRA 1CKIA 4FKVA 2OLCA 3DXNA 3E93A 3ET7A 3JS2A 3OOMA 3QGWA 2IW9A 4QO9A 5I9WA 3EQFA 4XOYA 4YHJA 1KWPA 4MWIA 5EHOA 5EM6A 3R8UA 5B2LA 3C0IA 4BTMA 4RJ3A 4QYEA 5JK3A 3A4PA 4CRSA 2E9OA 4G3CA 4I5PA 3Q6WA 4BCFA 2JEDA 4WNOA 1CKPA 1ZMVA 4JLCA 2HAKA 1NXKA 4ZLYA 2YLEA 3ZO4A 4BBMA 3ACKA 4NCTC 3WIKA 1SZMA 3L8SA 5JKGA 1ZYLA 3HLLA 3QCXA 3QZHA 4W9XA 1CDKA 2WAJA 2GHMA 4ANSA 2CNUA 3PJ8A 1NVQA 4X6QC 4BDGA 2QG7A 4YO4A 4IB3A 2RFDA 4L01A 3CS9A 4P7EA 4BY9E 1Y6AA 5CWZA 3EL8A 2B0QA 3O7LB 3DFCB 2UW6A 3M11A 4KRDA 4YC8A 5AFVA 2QR7A 5FTQA 1UNLA 4UXQA 2V7AA 3TV7A 4B8MA 4R77A 4AT3A 3W16A 4F7SA 2WMSA 2PVMA 4EK5A 4IX6A 5JFVA 3PLSA 4DFNA 3OXZA 5DR9A 4OTPA 4M14A 1PHKA 3BGZA 4BCGA 5ANIA 2B9HA 2CKEA 1WBSA 3C0GA 3F82A 4MK0A 4O0YA 4WBOA 5L8JA 4E7WA 4EUUA 5L8LA 3OZ6A 4ZMFA 1H25A 4BDEA 4R78A 2J2IB 2I0VA 5HX6A 4EZ7A 2KULA 3Q5IA 2GNGA 3FY2A 4IHPA 4FV7A 4ANBA 2J4ZA 4EH6A 3D5WA 5ITAA 1IR3A 4IBMA 3DGKA 4EORA 4I5HA 5KKRB 1V0PA 4FTCA 4QYGA 3W8LA 2YITA 3N4UA 4U6RA 3RVGA 4F08A 1WBOA 3LIJA 4MCVA 3ALOA 2JIVA 3CR0A 3PJCA 3DBFA 5EM8A 3NUAA 4YBJA 5M55A 2GCDA 3MVLA 3P78A 2G9XA 1YI3A 3G5DA 3PRFA 4CZUA 1OKYA 2WOTA 4MH7A 4LG4A 5IA3A 2GMXA 2PE2A 1UNHA 2B1PA 1PF8A 3IONA 4QNYA 4CKIA 5J1WA 3P08A 1AGWA 1R78A 2Y9QA 5H9BA 4GIHA 4LMNA 4ZTSA 1BUHA 2WU7A 4QPAA 4G6NA 4KIKB 4L6QA 2YM5A 4RLLA 5TR6A 5B2MA 5JGDA 3DAJA 4G17A 1NT2A 2RSVA 4EH5A 2WELA 5EKNA 4AP7A 4ZSAA 3BQRA 1Q8TA 3VF9A 5JQ5A 4O7WA 5CT0A 3I5ZA 3QTRA 3LM5A 3PXZA 4LFIA 3AGMA 3VHKA 4E20A 3VW6A 4EHEA 4EI4A 4LGGA 5CNNA 3ZXZA 4ONAA 5JRQA 3BWFA 2PHKA 2W1IA 3LFDA 3M1SA 3MFRA 5CZIA 5IUIA 3LLAA 4BN1A 5IMXA 3WE8A 3SXSA 2CCHA 4Z55A 2QVSE 3EYGA 3Q6UA 4EOIA 5FD2A 4OR5A 2J90A 1RJBA 3ORKA 5L2WA 1JKTA 1NA7A 3PJ1A 1BL7A 2OG8A 4GVJA 4WO5A 4AOJA 3LQ3A 2ZV7A 4C3RA 4FOCA 3QZGA 4UMUA 3HEGA 4JQ7A 4IAKA 4IB5A 2Q0BA 3DJ6A 4X0MA 4H05A 3BKBA 3F61A 3E92A 3HL7A 4G1WA 3CD8A 4ZTNA 1YHWA 3ORIA 4FTJA 3PRIA 1G8SA 2CKQA 4E6DA 3OP5A 4Q9SA 3OOGA 3V5QA 5BMSA 4L3PA 3QF9A 4FSQA 4RX9A 4HZRA 2W4KA 2B54A 1KV2A 4KABA 4XLVA 3AD4A 4X3JA 3LQ8A 3FL5A 5F1ZA 1F0QA 1OITA 3UVRA 3L8PA 3E7OA 2X4ZA 4Q2AA 3RHKA 3CLYA 4YZNA 4ZJJA 3Q4UA 4BTFA 2WTJA 3IW5A 3WBLA 4G16A 3Q9YA 4QRCA 3NAYA 5KCVA 2EXEA 3CCNA 4M69B 2R9SA 4IB1A 4JS8A 5HGIA 4ALUA 1SM2A 3F6XA 3NNXA 1Y8YA 2E2BA 4H1MA 3VHEA 2WXVA 2PVNA 3MFUA 5HLPA 5IG1A 4FEWA 1F5QA 1P4OA 4BDKA 4L7FA 4D9UA 1ZY5A 2OGVA 3JY0A 5HORA 2VU3A 3MGYA 2GQSA 4GFOA 4EK6A 5HG9A 2QHNA 2WTWA 3VBVA 4G3GA 4HCVA 4F0GA 3I7CA 1QPCA 3KN5A 4IB0A 4IC8A 3ZU7A 4YU2A 5CANA 2UVXA 3R7EA 4YZMA 4L52A 3CEKA 2UZNA 4X2FA 1IASA 4BYJA 2CLQA 4O22A 3HV4A 3R7UA 3QUDA 4IAYA 3LXLA 2EB3A 4M13A 4NH1A 5DWRA 3VUGA 4IDVA 3TACA 5EQYA 4J53A 4C34A 3A7GA 1H00A 5AADA 3PZEA 4ASEA 2YWVA 3D5XA 3DK6A 4I21A 4L3JA 4BKJA 1H27A 3VRZA 4C3PA 2R3IA 5DEYA 3ZOSA 3GCPA 3PSCA 3OG7A 4KBKA 5C27A 4EH2A 1GOLA 3HMOA 5BQ0A 4FT3A 2PU8A 3B8QA 4FNWA 3V6SA 4FKOA 4WKQA 3FPMA 3F7WA 3TWJA 3SG8A 4RFZA 2XCHA 2YCSA 3ZSGA 4L68A 4IWQA 4AN9A 4BZDA 1VR2A 2R3QA 5A4EA 5D10A 4FZDB 4JQ8A 2VWZA 4S2ZA 3VF8A 2FSLX 4WRGA 4QMLA 3D94A 3HP5A 1F3MC 3AMYA 3LMGA 3OD6X 1JKLA 2GFCA 3Q96A 4H1JA 3KY2A 4ZP5A 4ZTHA 4FIHA 4EH7A 2OH0E 1YQJA 4QMUA 3TV6A 4EBWA 4RPVA 3F3VA 4C61A 2CCIA 4MQ1A 4XBRA 3UOKA 4MEDA 4DTBA 4FNYA 3FLSA 1J3HA 4R1VA 4O7LA 1G3NA 4O1OA 3QQKA 4YNOA 4ZJVA 3LW0A 3PYYA 2WQBA 2NPQA 3GXLA 1GIIA 5AIKA 1XHAA 3IGGA 5EH0A 2W1ZA 4NW5A 3RAKA 4FT0A 5LWNA 3O7LD 3LKMA 5AUWA 3BI6A 1H24A 3LJ0A 5T3QA 3WE4A 4C2VA 5A14A 5GZAA 3PIYA 1YDTE 4PL3A 2YJSA 4O81A 3BZ3A 4AZWA 3VO3A 2WMTA 3G9LX 2WQMA 4E26A 4I4EA 5EYCA 5IKWA 2C6EA 4DEHA 3KL8A 4QYYA 2W99B 3Q9ZA 3R00A 4AZTA 5CASA 3QTSA 4G3FA 1OMWA 3F3TA 4X2GA 4QMXA 1PMVA 4M68A 4IAZA 3MB6A 3MWUA 4I24A 5D11A 4DGLC 2C6KA 4J96A 3H9OA 2C5VA 5AR8A 2VTNA 2BALA 3R6XA 2YN8A 2YERA 4MD9E 3NZ0A 3AT2A 4I0TA 5HE3A 4CQEA 2PE1A 2PVRA 1AD5A 2W1EA 4ZLOA 2VTJA 3OXTA 4BZNA 3OT3A 3UVPA 4C02A 1OUYA 3RK7A 2HWOA 2Z7LA 1FMOE 4L00A 2QD9A 3HKOA 1YOMA 3L8VA 2XNEA 4JDKA 4RQKA 5CEQA 4D2TA 3HGKA 4L3LA 4NUSA 5FP6A 4CQGA 4EH8A 2PMNX 1OB3A 5AV2A 4OTWA 1JVPP 3OW4A 3G0FA 3BV3A 4GU6A 5CSVA 5EOBA 1PXOA 5KMJA 5FWKK 2HIWA 3D9VA 3I6WA 4K11A 3ZBFA 3HMPA 3LVPA 2H34A 3R63A 1U54B 3ROCA 3V51A 1PXLA 4BCKA 1H0VA 2BRMA 3IDCA 1ZOGA 4TTHB 2CN8A 2WQOA 3DTWA 1IA8A 3GGFA 3R2BA 4BWKA 3LFBA 3DZQA 3P7AA 4MNEA 4L42A 1Q8YA 4FK6A 4QP7A 4RJ5A 1E1XA 3GC7A 4O7TA 3GFEA 2W06A 3FLYA 4I5CA 4ZOGA 2AC3A 2VWYA 4AXAA 5JSMA 2Q0NA 3ORMA 4L67A 4IC7A 3QXOA 4ACCA 4L7SA 2DYLA 2Y7JA 1BI7A 3B8RA 2UW8A 3DJ7A 3ODZX 4FTTA 4I3ZA 4PRJA 4IVAA 2YIQA 4WG5A 4AGWA 4DLJA 3QGYA 3P7CA 2GU8A 5J9YA 2EB2A 4KRCA 1PMEA 4JBOA 4LQMA 4QMVA 5DR6A 5AMNA 3VS4A 3G9NA 2BRNA 4O7YA 4H3PA 3KCFA 4CFXA 1P14A 1JSUA 2OK1A 5I3RA 3MIAA 3Q04A 3D0EA 3POOA 2P2IA 1LR4A 5BYYA 2C6MA 3RP9A 3DOGA 3R02A 2XM9A 4CV9A 2PMOX 2YA9A 3KMUA 1XJDA 1QPEA 1XH8A 1OECA 4WG3A 4A9TA 2X8DA 3NYVA 4ZSGA 3UJGA 5I5ZA 4MXOA 3C50A 2PUPA 3ZZEA 1XO2B 3DV3A 4BYIA 2UZLA 5LVPA 3ID6C 4O7RA 2PUIA 4FL3A 1YOLA 5FEQA 5H8BA 3C4WA 1E1VA 2R0IA 1OPKA 4FSRA 2OFUA 4NM0A 5HBHA 5CI7A 4O6EA 2QO9A 3NRMA 4RIOA 4XP2A 3G15A 4ORKA 1WBTA 5LVNA 2W1FA 3ZC5A 3ORTA 5EYKA 4TWOA 3W2PA 5FQDC 4NL0A 4R3CA 3VBQA 3OWJA 1KV1A 2ITZA 4RIWA 4DINA 1Y6BA 2O63A 4OTFA 2XF0A 4D1SA 2XKEA 3VW8A 1FPUA 4WUAA 4ZY5A 3I1AA 4K0YA 4MD8E 1R39A 5E8VA 2IVVA
chains in the Genus database with same CATH superfamily
4USFA 3FYKX 3EIDA 3VQUA 2I0YA 5EHYA 3AKKA 2QKWB 3R7GA 1UU9A 4Y5HA 4EC9A 4QP4A 3UG2A 4BKZA 1SVHA 4ZLZA 4BDBA 5D12A 2YAAA 3NUYA 4S33A 3QC4A 5JQ8A 2UVZA 4CXAA 4M84A 4EOOA 2BTSA 5AUTA 3E3PA 2GNJA 3SAYA 4FI1A 3TL8A 3R7VA 1J1CA 3ZO1A 3NGAA 4O21A 1ZAOA 3CTHA 4EOJA 3HAMA 3V8TA 3JPVA 3P23A 3JR1A 3ZUVA 3NNWA 4N6YA 5J95A 3FZSA 4O2PA 3TNIA 3S1HA 1DM2A 4RC3A 3IECA 1W98A 3HDNA 2I0EA 2C6LA 4WNKA 3LXKA 2ZMCA 4I4FA 4IANA 3MFSA 3FQEA 4OBQA 2ZMDA 4O7ZA 4BDAA 2ZAZA 3NUSA 3VAPA 3LOKA 4QPSA 3R8ZA 4AG8A 4CV8A 1A48A 3BBTB 3W2CA 4F0FA 2XK6A 4BWXA 3BYVA 3PE2A 4V05A 2X4FA 3FJQE 3AGLA 3B2TA 3FZPA 5EDQA 5A4TA 5KZIA 4QMPA 4ZTLA 4GT4A 5A4CA 2YIYA 4II5A 4RIXA 4AZVA 3LM0A 2YISA 3BYSA 1TVOA 4FEQA 4DE4A 3K3IA 4IX4A 4JI9A 2X9FA 1ATPE 2C3IB 4EUTA 2FGIA 3KXZA 5KMOA 2FB8A 4BDHA 5IPJA 5DI1A 1JSTA 2C3JA 3E8DA 4DHZA 4DGOA 4AZSA 2YM8A 4MXZA 1RE8A 3V5PA 3FXXA 4TYGA 3W2RA 4BF2A 5LARA 3R04A 2X0GA 5BVWA 3VRYA 3BYMA 2IZRA 4C37A 3F5UA 4K6ZA 5EKOA 4F6SA 3NIZA 2WU6A 3BU6A 5EM7A 4YLKA 1M7QA 4BGGA 2X7OA 4QTEA 3QZFA 2BHHA 4R7BA 4ZXTA 3OUNB 3TNWA 4YJRA 1Q99A 4DGGA 3W0QA 5IQCA 1YXXA 3S4QA 2XMYA 3K5VA 5AP1A 3UODA 2O3PA 3EQGA 4U0IA 5BYZA 1R0PA 1ST0A 5AM7A 3JY9A 2GFSA 3OC1A 4HCTA 5HVJA 1X8BA 4ERWA 3ENHA 3LCSA 4FC0A 2CNVA 2PMLX 4YJNA 1Q62A 3CPCA 4WBBB 3UOJA 3QD3A 5J79A 2P0CA 2JKMA 4D55A 2QOCA 2C3KA 2IVSA 2WTKB 3A7HA 4RX7A 4FKQA 3RI1A 1PXJA 2QOBA 2YDJA 3KF7A 5IA5A 3NIEA 3VBTA 4EYMA 3QRJA 5AV4A 3CY3A 2Z7QA 3KRXA 3MV5A 3F2AA 3U8WA 5EQEA 4FZ6A 5IQIA 4UMQA 4EZ5A 5CEPA 3UC4A 2DQ7X 4WT6A 5M09A 2ERZE 4I6QA 4FZ7A 3JXWA 2EUFB 4RJ7A 5IZFA 5E1SA 3RAWA 4UMRA 4XLIA 2WO6A 4DEBA 4ZK5A 2VWXA 5DN3A 4HNIA 3A8XA 4R7HA 3RK5A 2JBOA 2ITNA 4UZHA 4J71A 4AAYA 4XG9A 3PXQA 2W17A 4O4BB 3ZFMA 4DGMA 3Q2JA 3E3BX 1SMHA 2B52A 3PWDA 1WMKA 1DAYA 2BZKB 5AIRA 4EOMA 3UIXA 1LP4A 4PWNA 2EWAA 2BMCA 1RQQA 2F9GA 2YABA 4FKPA 4IZYA 3U6HA 1R0EA 2V55A 1QL6A 4YZCA 4AW2A 2JGZA 3DDQA 1V0OA 2OKRA 3VJOA 1OL1A 3WF9A 2OF4A 3FC1X 4E5AX 4JL9A 3DKOA 5C1QB 2J0JA 4RA4A 4UN0C 3FLZA 2VTAA 4O84A 3EL7A 4F6UA 4EQMA 2O65A 2RFNA 2Z7RA 4Q5HA 1ZMUA 3FWQA 1ZY4A 5EW9A 3PXYA 4C3FA 3C4EA 3E63A 2PUUA 3OCTA 3K54A 5HZNA 2H96A 3S95A 5BUEA 1OGUA 3HV7A 3I60A 3LFFA 3IG7A 5TO8A 2WTIA 4BHZA 3R83A 4AX8A 1S9IA 2BR1A 2R64A 5KNJA 3LXPA 3RPVA 3CJGA 2SRCA 4BJJA 3A61A 4WHZA 4C2WA 4IH8A 2OIBA 4DEIA 2EXCX 3EQBA 4QP9A 5I9UA 3UMWA 1BYGA 4CNHA 3T9TA 3V5LA 3OTVA 4BTKA 3IKAA 4C4IA 3SQQA 3C4CA 4IDTA 5HESA 3QFVA 3EZRA 4JIAA 3L9NA 1L8TA 3TDVA 4AGCA 2OI4X 3U55A 4TKSA 4NWMA 2JFMA 3HECA 4QOXA 3IW7A 4YTHA 4AFEA 4CLIA 4EWHA 3N4TA 2J51A 5TOZA 1JBPE 1LUFA 5M44A 5DNRA 3NYNA 3LCDA 3UYTA 5JN2A 2UZBA 3UIBA 2QOQA 1OKZA 2OWBA 2R3NA 5CF5A 1M2QA 2QU6A 4XCUA 2WTDA 5IQGA 3FV8A 1UU8A 4LUEA 4PDPA 3L1SA 1H1QA 3ZCLA 1WBNA 4WG4A 5FEDA 3L9MA 5L4QA 3FMLA 2OSCA 3JYAA 3NLBA 2F7XE 2WZJA 4CTBA 4C4JA 4APPA 4AA0A 2R3JA 5ACKA 4KKEA 3U9NA 2C30A 5L6PA 4ZS4A 2IVTA 3TNQB 2V7OA 2PY3A 2QURA 4ASZA 1OBDA 4EKKA 4J7BA 1GZ8A 3QD0A 4FSWA 5L6WL 4G6LA 5L3AA 2YM7A 4XV1A 1XQZA 1MQBA 4GK4A 5J9ZA 4YURA 1Q3DA 4Z7GA 5JEBA 2QOLA 2JITA 1OIQA 5HCYA 4IADA 5GZ9A 4MQ2A 4QMOA 4L46A 4APCA 4BL1A 3HMIA 1KE9A 4FNZA 5EHLA 4RX5A 2B9FA 2XBJA 3EKKA 2ZYBA 4FTLA 4IAAA 4IVCA 3PG3A 4PNKA 4JRNA 2JAMA 4EQUA 4ENYA 3QBNA 3BLQA 3GU7A 4QYFA 2J0IA 3PDTA 3RCDA 3HMMA 4RFYA 4NKAA 3C51A 5EM5A 3F7ZA 3AC5A 4IZAA 1B6CB 1PXKA 3HV6A 4IQ6A 4J8NA 3PXRA 4XH6A 4HZSA 2XZSA 3R7YA 5BVDA 2B55A 1BMKA 2BKZA 2VTOA 5E8ZA 4F0IA 4U79A 3V5WA 4EKLA 5FXQA 4AOTA 2ZV8A 1ZARA 3VUMA 2VRXA 3R1QA 1XH9A 4ZSLA 5HICA 4F7LA 5CU0A 1ZZ2A 2GSFA 5IEVA 5K5NA 3EKNA 3PLAE 5AEPA 4MBIA 3W2SA 1VYWA 3QKLA 4O0TA 4FYOA 4HGEA 1ZOEA 2JC6A 3UE4A 4BB4A 3F3ZA 1YXVA 3H9RA 3U51A 3TZ8A 3CGOA 2XALA 4QMZA 2R3FA 5M4IA 4BCJA 3BHHA 4L45A 5DMZA 5AUXA 3C1XA 4LRJA 3KB7A 2UV2A 3D15A 3EFKA 2A4LA 4CGAA 2YDIA 4EOQA 1SVGA 3R8MA 1ZOHA 4AN3A 4C4FA 5IA1A 3A7IA 2XK8A 3AD5A 3P5JC 2HW6A 4FT7A 3WF8A 4CZTA 4K2RA 2V0DA 5HTIA 4MNEB 3FMKA 4I93A 2OJJA 4RC2A 5BMMA 4F99A 5GINE 3SXRA 2VV9A 3QRKA 3SD0A 4Q9ZA 5H2UA 4OTHA 4R6VA 1JOWB 4JX7A 3EQIA 3FKOA 2ZM4A 3UIMA 3BYOA 4C33A 2OJIA 4D9TA 2A0CX 1OKWA 2VTMA 3VS6A 2ACXA 1CKJA 5DT3A 3PTGA 1EH4A 2JDRA 3MH0A 2BZIB 5AP4A 3GU6A 5L2QA 1H08A 2G2HA 3R71A 4D1XA 4IZ5A 4F1MA 5L2SA 4DHFA 5HHWA 3OCGA 5A4LA 5KKRC 4NIFA 4BCPA 3N51A 4IACA 2C1BA 1W83A 2GTMA 4OTGA 4ACHA 2GTNA 4D2SA 2XIXA 3QWKA 4AT5A 2RF9A 2X2MA 5BVNA 4DN5A 2WFYA 3P4KA 2C6TA 4FTKA 2GNIA 1KE6A 3OBGA 1PKGA 2YCQA 3IPHA 5EK7A 3ELJA 1VLRA 4EHGA 2PVJA 4E8AA 4FKRA 4FSUA 4IFCA 3I6UA 2WMUA 2PZYA 3MSSA 4M15A 3RPYA 2OW3A 2YM6A 4JR7A 1ST4A 5LMBA 3TYKA 1YI4A 3FI4A 4ACGA 3C13A 1MRUA 4U40A 2QNJA 4A9YA 4MNFA 3VBYA 3FL4A 3KIOC 3TV4A 2W9FB 4HYHA 4U43A 3NFFB 1H4LA 4ITIA 5HU3A 4EJ7A 1ND4A 3MFTA 4A06A 2R4BA 3N4VA 4YJVA 5E91A 2OU7A 2HW7A 1YWVA 2HWPA 3KFAA 1QPDA 4ZIMA 3C4FA 5HBJA 3ATTA 4IVDA 2YJRA 3DU8A 2ZDUA 3TUDA 2BUJA 5J87A 2BAJA 5LMKC 1KOAA 3K2LA 4V01A 2ETRA 4C57A 2X81A 4G2FA 2O64A 4MXYA 4Y95A 3PUFC 3SG9A 5AP6A 1YVJA 1REKA 4FIJA 4RIWB 3F3WA 5DE2A 3ZRMA 2IG7A 4PF4A 2XRUA 5GNKA 2IPXA 3LJ2A 4E73A 5DR2A 2JDVA 4DC2A 4E4XA 3F5XA 3G6HA 4PPCA 4S31A 3KK8A 3E8NA 3LHJA 2UVYA 2R2PA 4BWPA 4B6LA 4G5JA 4M7IA 4RC4A 5CSHA 5CEIA 4FIEA 4J97A 1H8FA 4XG8A 2XJ1A 3GOKA 2X9EA 4LMUA 4USDA 4MBJA 4XX9A 2F7ZE 3KU2A 4KIOA 4O0SA 4IW0A 5E8UA 2GNLA 4DFYA 4NTTA 3U6IA 5AAFA 4D0WA 2W05A 3QWJA 2ONLA 1J7IA 2W1HA 2YFXA 4E5BA 1MRVA 3ZUUA 4ANOA 3A2CA 2VWBA 4AXFA 3WI6A 3FAAA 4G9CA 4GK3A 3EN6A 4QDVA 2X8IA 2WIHA 4O6LA 2OZOA 3TUCA 4Y46A 1H26A 3H10A 1STCE 4S34A 3ZLSA 5EDRA 4NKSA 5LJJA 4I20A 5IDNA 4IEBA 4D5KA 2OBJA 4EH9A 3OEFX 4EEVA 3WOWA 3VS2A 2ZJWA 5FBOA 4BRXA 4I22A 2JKKA 5CZHA 3UDBA 2ESMA 2ZOQA 4PDYA 4NT4A 4BDCA 3R1SA 1W82A 3R9RA 4N57A 5F9EA 4V0GA 2UZVA 4MWHA 4XRJA 5DIAA 4FG7A 4G5PA 3QKKA 5D9HA 4K18A 3ZFYA 3TN8A 2QO7A 4DFXE 1ZMWA 1WAKA 5A4QA 4RRVA 2VTIA 5C4KA 2J7TA 2G01A 5EQPA 5HQ0A 1MRYA 3V5TA 4RIXB 4A4LA 2Z7SA 4NU1A 1CSNA 4MBLA 4DLIA 2OXYA 2WNTA 5GIOE 4HVIA 4RT7A 4XEYA 4F9CA 5M4CA 1M14A 1Q61A 3BEGA 4FIGA 3MJ1A 4FSMA 2FSOX 2RFEA 2JD5A 4FV0A 5FTGA 3NR9A 3I5NA 4DH3A 1VEBA 2XUUA 4RWJA 2OXXA 2XJ2A 1XBCA 2HENA 3FLWA 3QHRA 4YLJA 4Z3VA 3GNIB 5DH3A 4RVLA 4KBCA 3OS3A 1KUTA 2R3KA 3PY0A 5CXZA 3CJFA 3FMJA 3QRIA 2QC6A 3E62A 4FTRA 3COKA 3RBWA 5L6OA 5AAEA 3RAIA 3IW6A 5KE0A 4U5JA 2E9NA 2VO3A 2OJ9A 3DB8A 3BU3A 4QD6A 5JZNA 3NPCA 4R3RA 2W9ZB 2XEZA 5CTPA 2WKMA 4EK4A 4O83A 2QOHA 4A4OA 3O23A 5EYMA 4GU9A 1XR1A 5KX8A 3QUPA 3UC3A 4GCJA 3V8SA 4JG8A 3GUBA 4D4RA 5JFWA 3VS7A 2BILB 1YXTA 2X7GA 4FR4A 4AT4A 1Q5KA 5CQUA 2UW7A 4DTKA 5AX3A 4F9AA 4ZZOA 2Q83A 1JLUE 3VUHA 3OY1A 3DK7A 5IEYA 5HNBA 4AQCA 1LEZA 2RG5A 4X21A 3ULZA 3UQCA 3QX2A 5CQWA 1Z9XA 2BFXA 2QQ7A 1NVRA 3MY0A 5E92A 4FSNA 3FSKA 4O0VA 3ZM4A 3ZSHA 2X6EA 3RWPA 4X2NA 3LFSA 3O17A 3H3CA 4K8AA 3G6GA 4EWQA 3KRJA 2P55A 3OXIA 3KULA 3KN6A 5ANDA 3HRFA 4YP8A 5HE1A 5ANGA 2QOFA 1Q41A 1O6KA 4HPUE 4YZBA 4DH7A 4F7JA 2BRHA 2G1TA 4DH1A 5AM6A 3TTIA 4BHNA 2XBAA 2YHVA 3PY1A 4JX3A 3ANQA 2HYYA 4KKGA 2PVKA 4QMTA 4DEGA 2ZB0A 4RSSA 4F64A 4TL0A 3ZEPA 1OPLA 5HTBA 4B8LA 2JIIA 4ZSJA 4ZTQA 1OPJA 3RJCA 3ORPA 2J5FA 5KMMA 2CJMA 4UB7A 2IZUA 4YC3A 5ANJA 3ZLXA 4AN2A 4IAFA 3DCVA 4AXEA 4FICA 1OL5A 3OEZA 1W7HA 2C4GA 3ZLYA 4ACMA 3JUHA 2FVDA 4YJQA 5K3YA 3EN9A 5IU2A 5FEEA 2JLDA 4F9YA 3R9HA 4KWPA 3COMA 2CMWA 3KXMA 5M4FA 3DXPA 1ZRZA 4U8ZA 4DFUA 3D7TA 3TIZA 2I40A 4BDFA 3E8CA 2W4JA 3NNVA 2GS2A 3AT4A 4CTCA 5BUIA 4DG2E 2F2UA 3JVRA 2B4SB 2XIYA 4IJPA 3FLNC 3Q9WA 1Z57A 5C01A 4GL9A 3KREA 4AE9A 5J5TA 3BLRA 3NWWA 2X2LA 4BJJB 3R28A 4NYEA 1W8CA 2R5TA 3Q32A 5CU3A 4EOKA 3VIDA 3G90X 3IO7A 3MVJA 3TZ7A 4TYHA 2QOKA 1YDSE 4YC6A 3DFAA 4BIDA 5HIDA 4RX8A 3QQHA 5CF4A 2DUVA 4DFZE 2QLUA 1KSWA 4BTJA 2HY81 2ZDTA 4M12A 5HG7A 3QLGA 4AQKA 4GG5A 5DVRA 3PFQA 3Q60A 4BCNA 5K4JA 1XH7A 1ZYJA 4KS8A 4D28A 4J1RA 4YTCA 4BICA 4YMJA 2BAQA 3B2WA 3EN4A 4TYJA 5I3OA 4BDIA 4FV1A 4K77A 1GNGA 3NVKI 4TWCA 5HLNA 4A07A 3DPKA 4Q5EA 4WA9A 4XG3A 3ODYX 4QMMA 3BRBA 3WILA 3KXHA 4F9WA 2GHLA 4N4SA 4G6OA 3TIYA 3F5PA 4QP1A 2W1GA 4HPTE 2A98A 4L9IA 4GS6A 3ZDIA 4HW7A 2UZOA 3D83A 2QHMA 2F2CB 5IDPA 3BL9A 4L44A 5T68A 4A9UA 2XP2A 4FVPA 3W2QA 4QDEA 4ZZMA 5HOAA 3TKHA 5FLFA 4ACDA 4UX9A 2P3GX 5J1VA 3E88A 2V5QA 4LGHA 4UWYA 4RG0A 4JNWA 3RAHA 3BU5A 3WZKA 3A60A 4D4YA 4IM3A 3TEIA 3FEGA 3W2OA 3BHYA 4YSMA 4M3QA 5CU2A 3SV0A 3TJCA 5L2TA 4W4WA 5HEZA 4GKIA 5HKMA 5T6KA 3LJ1A 1GZNA 5AR3A 4IZ7A 1Q3WA 5M06A 4BI1A 3T3UA 3QRUA 2XNPA 3PXFA 4OTDA 4XUFA 3RZFA 5HO8A 4DYMA 2X0PA 4DGNA 3HA8A 4FVQA 2UZWE 3LLTA 1WBWA 5CI6A 3VUIA 1GZKA 2GNHA 2UZTA 1S9JA 2JKOA 1KE7A 3TT0A 4FX3A 1DAWA 3PA5A 3ZONA 3M2WA 4GYGA 3FMDA 4KIQA 1O9UA 2UW3A 5D7VA 3C9WA 4ZS0A 2R3MA 3O96A 1J91A 5HLWA 2CKPA 4BDJA 3EQDA 5HNIX 1W84A 4PTCA 2Y4IB 3L9PA 2FSTX 5FBNC 2ETKA 5FM3A 4PP9A 5CNOA 2QONA 3TNHA 3S3IA 3RNIA 4BBEA 5IQAA 5AJQA 4FSTA 5GIPE 2BROA 2F57A 3DAKA 4I94A 4O91A 2J5EA 2OJGA 5EW3A 2QR8A 3AC8A 4YR8A 5E90A 4TT7A 3AXWA 3O0GA 3ZLWA 5KBRA 4YJOA 4E4LA 4FIIA 4FSYA 3ACJA 4HCUA 5EOLA 1A06A 3DA6A 3UTOA 4DEEA 1VYZA 4W4VA 4R5SA 5F95A 3RTPA 4F6WA 3FKNA 2C0TA 3R73A 4IFGA 4QMNA 3UMXA 1OKVA 3R9OA 2XIZA 2BDWA 3QYWA 3HRBA 5D41A 5FDXA 3T9IA 4ANNA 3QRTA 3DXQA 2LAVA 4CYJA 4LM5A 2NYAA 5M08A 5HO6A 3ATSA 5AP7A 4U80A 5HE2A 1BX6A 3EYHA 3ZYAA 1SNUA 2Z60A 3OF0A 4FUXA 4FZFB 2WMRA 5IMEA 4CFWA 2GQGA 4JBPA 5AP3A 4C38A 3O2MA 2AEGA 3AC2A 1PXNA 3I81A 3KMMA 4U45A 4L8MA 2W5BA 1XKKA 4ZSEA 4NIFB 4UZDA 4FKGA 5E8TA 2J50A 2J0MB 1QMZA 3ZH8A 4NSTA 1J7UA 2AYPA 3V04A 3A7FA 3DS6A 4JOAA 5AR4A 4FV6A 4GJ2A 3AC1A 4U42A 2VZ6A 2PVHA 4XV9A 4Y83A 4R7IA 3QTIA 3HUBA 2C5NA 4TW9A 4F09A 5J9LA 5HO7A 3GQIA 4FBXA 5GJGA 4FNXA 2WEIA 3HMNA 4GMYA 2PL0A 4JBVA 4YJPA 1UKHA 5AR7A 1TQMA 4K9YA 5HE0A 2WEVA 2C47A 4O0WA 3QYZA 3S00A 4IAIA 3BHTA 1NVSA 4UY9A 3IOPA 4R5YA 1QCFA 5EG3A 1YWNA 3UGCA 1GY3A 2A2AA 3NCZA 5IEXA 3BE2A 3ALNA 1H1SA 4JBQA 4Y72A 5HVYA 1JQHA 4PQNA 2GS7A 4P2KA 4OAVB 3W0SA 3UQGA 1FINA 3QC9A 2XA4A 3FMEA 4PL4A 5KMKA 1YXUA 4FG8A 3KA0A 1GIJA 3FXWA 4HVSA 3SDJA 2BIKB 3DKFA 5AV3A 3TDWA 2Z02A 4W8DA 2J0LA 4DH5A 4NM5A 3DNEA 2X0QA 4X3FA 4CKJA 5BYLA 4P4CA 4O7NA 4LV8A 1SVEA 4CYIA 2WTKC 4RZVA 3WIGA 1PMUA 2XIKA 3MDYA 4AWIA 3CBLA 3OROA 5CX9A 4PMMA 4QQCA 3HA6A 2E9UA 4C36A 5AUVA 4D5HA 4DEDA 4JMQA 3FZ1A 1IAHA 5TT7A 1TQPA 4TN6A 4WSYA 1TKIA 4I0SA 3G33A 2VX3A 4O0RA 2BVAA 1Z5MA 3FHIA 3KCKA 1JAMA 4XG7A 4L43A 4QTBA 3UDZA 2VTSA 3DBEA 2B53A 3GCUA 4NZWB 4D2PA 3W18A 4CVAA 2BZJA 4YHFA 4I23A 3LAUA 3PA4A 3LFQA 3U4UA 4GSBA 3NFGB 1G8KA 3NYOA 2VTHA 5KZ0A 2C0OA 3G51A 3R30A 4FKSA 4RJ8A 2R3GA 3FE3A 4LOOA 5IA4A 2X2KA 4OBOA 2IW8A 2YCFA 1P2AA 1PRYA 3UO6A 1JKKA 1FMKA 2XH5A 4YJUA 5C8KA 5E8WA 5KMNA 5M57A 3RGFA 4OTIA 3CP9A 4K1BA 5E8SA 3FXZA 5CAQA 4N70A 3IK3A 4KS7A 3TKUA 1WBPA 1NW1A 5E4HA 1WBVA 2HCKA 3QHWA 3RNYA 1YHSA 4FV9A 4UEUA 4YNEA 4YUQA 1YXSA 2PZIA 5CF6A 5I9XA 4GYIA 2YEXA 4HYIA 4NEUA 3BX5A 4HOKA 5AR2A 2HELA 4HGTA 4V0GB 3EQCA 1OIUA 3C7QA 2RFSA 3KQ7A 2CLXA 2X6DA 1OI9A 2C6OA 4O7VA 2F49A 5GJFA 4DCAA 3DBDA 5CSPA 2YZAA 3NAXA 2PMIA 4MAOA 2XB7A 3GC9A 3R21A 1CTPE 2OIDA 2R0UA 4G3EA 4PMSA 4TWPA 4DDGA 3OCBA 4RZWA 2C6IA 3P0MA 4FF8A 4S32A 2IN6A 2O5KA 4FJVA 3VS0A 4ASDA 2YZLA 4MXAA 4NJDA 4FT5A 3OHTA 4F4PA 5FRIA 2QU5A 5ACBC 4NTSA 1MQ4A 5L8KA 4IXPA 3D4QA 1K3AA 4NW6A 2KTYA 4A4XA 3E64A 1Y57A 4XNEA 3FMNA 2GDOA 4P90A 3VWAA 3LFEA 3MPMA 4RA5A 3OBJA 2IJMA 1UA2A 4HJOA 2PZRA 3F9NA 4HYUA 3N9XA 1PYXA 3H0ZA 4FVRA 4GVAA 1O6LA 2YACA 4LI5A 4RVTA 4XMOA 5CAOA 4Z7HA 5IH6A 3P7BA 2HK5A 2VWIA 4H3BA 2QI8A 3KC3A 1U4DA 5CSWA 3QUEA 1GIHA 5GJDA 3LCTA 2VUWA 4PPAA 2A1AB 4ARKA 3ZUTA 2BDJA 3H0YA 4WNPA 2O8YA 4O4DA 4U7ZA 3R7IA 1JSVA 2OICA 3R01A 2NO3A 2R3LA 5A9UA 3NUXA 2JDOA 4M0YA 5AUUA 3W0OA 3BV2A 5JRSA 5IQBA 2BZHB 3Q4TA 4CCBA 2ITPA 4DTAA 5CVGA 1PXPA 3VUDA 3ERKA 4F7NA 3I79A 4DITA 2DWBA 5FXSA 1UWHA 3UP7A 2XS0A 3P1AA 4FSZA 3CQUA 4X2KA 3UPZA 4BCQA 4NJ3A 1WVXA 5D7AA 4YO6A 2VX0A 1YW2A 4WRSA 4FTAA 3BBWA 3L8XA 2FYSA 5IISA 2ZM3A 4DCEA 3R9DA 1IA9A 4C7TA 1JPAA 3QKMA 3KULB 3WZUA 2PZPA 3PPKA 3IQ7A 1JKSA 2J9MA 1HOWA 4WSQA 3ZDUA 3I7BA 3OUKA 4EJNA 5M4UA 1OM1A 5C9CA 2B9JA 3EFLA 3QALE 5CU6A 2VTPA 1WZYA 5DRBA 3GC8A 3O8UA 4XYFA 3TTJA 4A7CA 4BR3A 3TMOA 1Y8GA 3NCGA 1U5RA 2JDTA 4J98A 2BRGA 3DJ5A 4EOSA 4J95A 5CAUA 2IO6A 1FVRA 4QT1A 2IZSA 3LXNA 4ANLA 4H36A 4UMPA 3PZHA 4NM3A 2JKQA 3OY3A 3QU0A 4F9BA 4LGDA 3KXGA 4CMUA 2FSMX 2PZ5A 4FTUA 3R8VA 5DA3A 5AUYA 3C5IA 5KMLA 4FGBA 4JG7A 3EB0A 4Y5QA 5H8EA 2WTCA 5CEMA 1UV5A 4E4NA 4XS2A 4EL9A 5K9IA 4O0UA 5HD7A 3RALA 3CTQA 4BKYA 3DLZA 3KXXA 3HX4A 5CS6A 3TG1A 3U4WA 3D5VA 1H07A 5FXRA 2V62A 3NUUA 3REPA 3ZSIA 4B99A 4E93A 2XAMA 4YZDA 4IWPA 1DS5A 3RHXA 4O7SA 5AAGA 4QMYA 3PUPA 1PYEA 3F2RA 3KVWA 4YPSA 4UYAA 2XYNA 2ZV9A 3WZEA 2IF8A 3ZS5A 1ZYSA 3ZTXA 3PJ3A 4BI2A 2WTVA 5CAVA 4AAAA 2GS6A 2FH9A 4AS0A 4R1YA 4BDDA 3TNPC 2BRBA 2WD1A 1OL6A 3DQWA 3TXOA 5JZJA 4C4EA 3ZEWA 4ENXA 4F1OA 3ORXA 3CIKA 5LVMA 3HNGA 5DPVA 2XKFA 5CAPA 2EVAA 2VGPA 3QCQA 4HGLA 3E87A 3Q4ZA 4H3QA 2FO0A 3C4XA 3HRCA 5HU9A 4C4HA 4BVUA 3DLSA 4LYNA 2BFYA 5KHWA 2GHGA 3TZMA 3V5JA 2B9IA 3CKWA 3TM0A 2VO7A 3UZRA 3QTZA 1PXIA 2XNBA 4OAUC 2VO6A 2VWVA 2UZUE 4DF3A 3EQPA 4B4LA 4C8BA 1A9UA 4TNDA 3MA6A 5LOHA 4AE6A 4JT3A 4PX6A 4LDTA 2DS1A 4LOPA 4X7QA 2C5OA 2WGJA 2J6MA 3MW1A 4BFMA 2CSNA 2UZDA 3FMMA 4QEBA 4I1ZA 4C58A 5CVFA 4RFMA 3ZFXA 5E8YA 5FM2A 2VNWA 4EONA 2XANA 4P5QA 4DHJA 5E8XA 3DBQA 5TE0A 3C4ZA 3GEQA 4GFMA 3QTQA 3P79A 4S30A 4X6RA 5TF9A 2X39A 2HXLA 5IQHA 5CY3A 1H28A 2A19B 1B38A 1U59A 3AT3A 5FTOA 2XNOA 2WMQA 5AWMA 2G15A 4E6CA 1YWRA 3U9CA 1LPUA 3PJ2A 4CFUA 1UNGA 4FT9A 1H1WA 3QA8A 4FTMA 4AACA 2R7IA 2QODA 4WIHA 4E3CA 3FHRA 3ITZA 2YIWA 4MXXA 3ZRLA 3O8TA 4DT9A 3UP2A 3VBWA 3MH3A 1DI9A 5LCKA 4MF1A 2CHLA 3EQRA 3OFMA 3P9JA 4AGUA 5L2IA 4AW1A 4XHKB 2HZNA 2VAGA 4FV8A 4CZUA 3GU4A 1R1WA 5M51A 2RG6A 3AG9A 3EN5A 4ZY4A 4UMTA 3QQFA 3HZTA 5AP0A 3RPOA 2IVUA 3NW5A 4OW8A 4PUZA 3MH2A 3S2PA 3GFWA 3CD3A 4I6HA 3QCSA 3V01A 4DBNA 2VTLA 1OZ1A 2XK7A