4AFEA

Nek2 bound to hybrid compound 21
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
277
structure length
253
Chain Sequence
SRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSHRDLKPANVFLDGKQNVKLGDFGLVGTPYYMSPEQMNRNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title Design of Potent and Selective Hybrid Inhibitors of the Mitotic Kinase Nek2: Structure-Activity Relationship, Structural Biology, and Cellular Activity.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 253
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4afeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4afeA01
2PVFA 2UW0A 1OPJA 5D1JA 4IB1A 1OKYA 5CASA 3FL5A 3ZUVA 4QP9A 2ONLC 4Q5HA 4AFEA 4FUYA 4QYYA 1J7UA 3VVHA 2W17A 4GIHA 4ASEA 1SVGA 4MCVA 5CVFA 4FKSA 2B9IA 4D9TA 3V6RA 3R04A 3FQEA 4TYGA 2CN5A 2R4BA 4IZ7A 3ZO4A 1G5SA 3O71A 2W7XA 4GT5A 4ENXA 5IMEA 4BGQA 2YLFA 3BU3A 4J8MA 5LMKA 5A3XA 2P33A 4GFOA 1I09A 4C4GA 3K5UA 3OFMA 5DOSA 1J91A 2YIXA 3I0OA 3IONA 3VBTA 4GU9A 4K11A 2PE2A 4FG7A 1LPUA 3BE9A 4HYHA 4KIPA 4PMTA 3TT0A 3UIMA 4YTHA 3PVGA 2BAQA 2UZLA 3DKFA 4X6QC 3CBLA 5CAVA 3EQGA 5HI2A 3ZEPA 2PVKA 5H2UA 3OCSA 3R9NA 2XK4A 5J1WA 2DWBA 3HYHA 3CY2A 4OBPA 4MKCA 1ZXEA 2QD9A 4YPDA 5AR2A 5J79A 2VTAA 4GKIA 3KF7A 3CKXA 1BYGA 3VUHA 4M67A 4BDGA 4GK4A 4YJTA 4BRXA 2PTKA 1CM8A 4G6LA 1B38A 3QHRA 3CQUA 3FMNA 3VQHA 3UO4A 1BLXA 5CWZA 5CX9A 1FGKA 1PXOA 4OGRA 1OZ1A 4UYNA 4V04A 4EC9A 4QYGA 3G0EA 4BDEA 1YHVA 2C0TA 3DZQA 3FKOA 2GTMA 4C4JA 5J9YA 1J3HA 5FD2A 3C13A 2IZTA 3C4EA 4C8BA 2OXXA 4QMXA 2OIDA 5CF5A 3HUBA 3SGCA 4H58A 1R0EA 4G9CA 2PU8A 4UN0C 3FDNA 3MBLA 2ITNA 3SXRA 3MYGA 2QOKA 2WTKC 1J7LA 1T45A 4NJ3A 3K3JA 3FJQE 4QMSA 2J0KA 5AJQA 4QRCA 2HIWA 2X6EA 5DH3A 4XG9A 1BUHA 1ZOEA 3EMGA 2WMRA 4BF2A 5FQDC 4F70A 4YR8A 4UXLA 4GFGA 5CENA 3MH0A 5JFXA 2YISA 5JGDA 1VYWA 3BEGA 1QPJA 4WBOA 2JBOA 3ITZA 4FZDB 2BZKB 3EFWA 5TO8A 5K0XA 5M06A 4KINA 4AWIA 3E8EA 1KE6A 3G90X 2PWLA 4HYSA 2W5BA 4O27B 3LPBA 5EM7A 3ZZWA 4EQMA 3SX9A 2QO2A 2R3PA 3FPMA 2RFSA 2Z2WA 3OT3A 1CTPE 4NCTC 2XNEA 4DFYA 3FSKA 4QTDA 4Y5QA 5AAGA 3ZFMA 4FL2A 1ZYJA 4RWLA 4YBKA 3LE6A 5AP3A 5F4NA 2H9VA 3VWAA 4JDHA 3DKCA 2YDJA 2WQNA 3E88A 3FXZA 5J9ZA 4BR3A 4QP6A 3R8PA 1V0OA 3M1SA 3WYXA 3E62A 3IPHA 2P4IA 3TJDA 4PUZA 4YZ9A 4QMWA 5DE2A 3R21A 2O5KA 3VQUA 4M7IA 3ZSHA 5KNJA 5DFPA 2JDVA 4C37A 2IVTA 5HLNA 2YM8A 3HLLA 3NUYA 3G0FA 2OJFE 3VHEA 5AUZA 4MWIA 4P5ZA 5IU2A 5LVNA 3P23A 5CU2A 3ACKA 2GFSA 1H25A 3GUBA 4MQ1A 1EH4A 3ZH8A 2YCFA 3MIYA 4QMQA 3QA0A 3WIGA 3KQ7A 4KKEA 5EYKA 2OICA 1TKIA 2HWOA 4A9TA 4F1TA 4PWNA 4O91A 4L8MA 3VS2A 2PUPA 2GNFA 3V5WA 2JEDA 4F9AA 5CF8A 4WNOA 5IA1A 2PHKA 3AC5A 1XBAA 3RHKA 3ZM9A 3IDCA 2W4OA 2FH9A 4CXAA 3R00A 4QMLA 2HWPA 3QQGA 4JBVA 4ZSGA 4RZVA 1K3AA 3FY2A 3AMBA 4A07A 4C2WA 4E4LA 1OBGA 4UB7A 1TQIA 5C4LA 2X7OA 4M97A 2IWIA 4JAIA 3TV7A 4AW2A 3BKBA 1WVYA 3O8PA 3EKKA 1UU3A 3QFVA 3I6WA 3CKWA 1CSNA 4C57A 3GC9A 3AMYA 1DI8A 5FTGA 4JBQA 2Q0BA 4TWPA 5IQEA 2JDSA 5E8VA 1Q61A 5CAPA 4FT7A 5IZFA 3E8CA 1PY5A 2GNJA 3HX4A 3AXWA 5BYYA 5BVKA 4XV3A 3L9MA 3OBGA 5HVJA 2R5TA 3UNKA 4CZUA 2J9MA 5CEKA 5CEQA 4XRJA 3I0QA 1FGIA 4IX4A 4FTTA 2OI4X 4BWKA 1GNGA 4ERKA 5AX9A 4OLIA 4RG0A 2HW6A 4F0IA 4OBOA 1WCCA 3P5KA 4FG8A 3QQFA 4PMPA 4BIBA 4QMZA 3V3VA 4E7WA 4G34A 1YDSE 3BI6A 4APPA 4AT3A 4DFUA 3QTIA 3UG2A 4RT7A 5E8WA 5AP2A 5ETAA 4A06A 1SYKA 3RK7A 1WFCA 3LAUA 4F7SA 5GIPE 2GNLA 5DLSA 4IVDA 2HXQA 4GL9A 1KUTA 4IIRA 5J8IA 2FGIA 3PRFA 1OPKA 3OTUA 4QOXA 3T9TA 2I1MA 2E9OA 4BBEA 4BCGA 3LCSA 3D5UA 2WQEA 3MV5A 2VV9A 3PZEA 4L68A 1ZRZA 1H1SA 3QGYA 4ZS0A 5HE0A 3EIDA 5EKNA 1IRKA 3C4FA 5C1QB 2ITWA 4GW8A 2YABA 4OTRA 2ZM1A 3QCSA 4W4WA 1JVPP 2WKMA 4J97A 5LCKA 3UO5A 1LR4A 3K5VA 1V0BA 4QMUA 4WG3A 4XG2A 4N70A 5AUYA 1QPDA 4RJ3A 4XV9A 2XA4A 5ETFA 3RPYA 2EXEA 1GAGA 2IG7A 5GJFA 2WHBA 3Q60A 3VJOA 1OM1A 4C59A 3P0MA 2C69A 5FP6A 2AYPA 4Q5EA 4BGGA 3IW8A 5CQUA 2BCJA 3GQIA 4JQ7A 5EDPA 3R1QA 5E8ZA 1JKSA 3ZS5A 3OCGA 2V55A 4OAVB 2J50A 4RMZA 2F57A 4G3DA 4GG5A 4ZLYA 5M4FA 3NNVA 3QC9A 1KE9A 3A99A 4RIYB 2XIZA 2QC6A 4PPCA 5IF1A 3KRXA 4FV1A 2C5XA 5EDRA 4UMPA 4YLKA 4L00A 4BI2A 5IDPA 4USEA 2EXMA 4IVCA 3MDYA 2UVXA 5HD4A 3PIZA 5GHVA 2JKQA 5JGBA 3UOJA 5HBJA 2XJ2A 2BRNA 2WB8A 4H1JA 4DBXA 2RL5A 3DKGA 3QCXA 3OS3A 2O63A 4G3CA 4HZSA 4FTNA 4KB8A 2J4ZA 2YM5A 4XG8A 4A9SA 4ASZA 4FSNA 4C38A 2WXVA 3Q2MA 5D11A 4MXOA 4R5SA 3S2PA 3HRFA 5AP7A 3SKCA 2BHEA 4KS8A 4U8ZA 2WMTA 4NIFA 4EH2A 4KD1A 2ERZE 1JKKA 1SM2A 2VTIA 1RQQA 2GSFA 4O0YA 4UY9A 3D15A 3TKIA 3ANRA 3ROYA 4M69B 2F7EE 2YIRA 5HE1A 3PDTA 4O7TA 2YCQA 5L3AA 4H3BA 4R7BA 4DEHA 3QRIA 4X2FA 2BALA 4DGMA 2QOBA 2B9HA 4IWOA 2C6OA 2WD1A 2PZPA 4MYGA 3HV3A 4HYIA 4WNMA 4WNPA 4DEBA 5FXRA 2C0OA 3ZLWA 4S2ZA 3EQPA 3VW8A 3T3UA 2VWVA 3VS0A 4MHAA 3A7HA 5EQYA 3LFNA 1OPLA 4XBUA 2QO9A 5C8MA 4CV9A 2IZUA 3I81A 3UQCA 5D41A 3RZBA 3C0HA 3LFDA 2ITXA 3SRVA 3OWLA 4G16A 4TWNA 2PZ5A 5FXQA 3RGFA 5IEXA 3WF9A 4EZ3A 3IW5A 3GFEA 5E91A 4BCQA 1UKIA 5G6VA 4IAFA 4K33A 3ZEWA 4MBIA 5H8BA 4DFXE 4JDIA 4DEAA 2XBJA 4WO5A 2GNIA 4K0YA 2JAMA 4USDA 2JIVA 5J9LA 2CSNA 4I22A 3WF7A 4C4FA 3M11A 3R7UA 4ANOA 4EHVA 3C4WA 3BE2A 3B2WA 4RWIA 3DQWA 4RC2A 4L7SA 3HMIA 3QUEA 5C9CA 3SW4A 3PJ8A 1U54B 1JSUA 1H1WA 1NXKA 2YCRA 3FE3A 3LCKA 4CLIA 4EUUA 3WILA 3DNEA 4Z16A 1JKLA 2C3KA 4YZMA 1OUYA 3OG7A 4U0IA 4O1OA 5E8SA 4ZTQA 3JPVA 3KRWA 3U6HA 3I7CA 5F94A 3NR9A 3W33A 3ERKA 5FEEA 1OGUA 2EB3A 2PVJA 4QPAA 4KBAA 3E7OA 4XNEA 2OH0E 2YM4A 4FTJA 5HCYA 2XNMA 3QTRA 2ZAZA 3ZZEA 4FT5A 1H01A 2QLUA 4IBMA 4BDCA 4Z9LA 1F3MC 4CFUA 5M4IA 4NL0A 4MD9E 4YJNA 3COIA 4DH5A 5DMZA 4QMMA 3Q9YA 4Y85A 3G33A 3U4WA 3F3VA 4V05A 2J90A 3FI3A 3GVUA 4MXAA 4FKWA 3OZ6A 4C7TA 3F2AA 2C6KA 3V5PA 1XKKA 1YVJA 2OJIA 3E5AA 3ZSIA 3QQUA 3IDBA 1SVHA 4QMOA 2RF9A 4FTUA 4I5MA 4LGGA 5KE0A 4U79A 2YAKA 4AGUA 3VS1A 4IJ9A 4LL5A 4L67A 4AACA 1GZ8A 5GINE 1LP4A 4C0TA 2UZEA 4W4VA 2VTHA 4JG6A 1XH6A 3LQ5A 4RX7A 4ZY6A 3ATTA 3R9RA 5HE2A 4CNHA 1REKA 4I3ZA 4V0GB 4QQTA 3HMMA 3BBTB 2X9EA 3R8UA 2BIYA 4D4SA 3COHA 5AA9A 5CQWA 2HZIA 2B7AA 5HU3A 2CNQA 1M2RA 3H30A 1Q97A 5JQ8A 4ACHA 2DQ7X 4G17A 5HO7A 3DK3A 4R77A 3KVXA 5HGIA 3Q52A 3BRBA 4EC8A 3AC1A 4CRLA 2HY0A 2ETRA 2QURA 2I0HA 1GIJA 4W4YA 1RE8A 3F2NA 4ITHA 5GZ9A 5HZNA 2W1ZA 2ITTA 5EM6A 4YZCA 4BIEA 3OVVA 4CFNA 2CGWA 1QPCA 3W8LA 5L2TA 2CKPA 3MB7A 4NSTA 2ZMCA 1R39A 3TKHA 4IQ6A 3EQDA 5CZHA 4Y46A 4C3FA 4ENYA 4EZ7A 5CU3A 5CALA 1HCKA 4O0UA 5ETIA 5ANGA 2CKOA 2VTLA 1XH5A 4GYIA 3QYZA 3O7LD 2HAKA 4LGDA 3K3IA 3DV3A 5EOLA 5E90A 3KMMA 3FSFA 5HG7A 5DG5A 2GNGA 2UZOA 4FEXA 2C30A 5CNOA 3OOGA 4D2TA 4IHPA 1KWPA 1FBNA 1WBPA 4HNIA 4AZTA 3AD6A 4CZYB 4TWCA 4O83A 4CFWA 3QRKA 3AC2A 3MPTA 4ACGA 3QLFA 4FT0A 3FC2A 4BB4A 3PP1A 4CGAA 4XG7A 3ET7A 5A14A 4G31A 4RJ4A 3R1SA 3PG1A 5DGZA 4G5PA 3TTJA 4DG2E 3VF9A 4DC2A 3I6UA 3PJ2A 4QO9A 2P2HA 2UZWE 3LQ8A 3NUSA 4PY1A 3DLSA 4TYHB 1GZNA 4PTCA 2C1AA 2RFEA 3GP0A 4JS8A 5DIAA 3H10A 3EB0A 3RZFA 2BHHA 3TG1A 3UC3A 2VTTA 2ZDTA 4UMQA 2OIQA 2XZSA 3DLZA 5GJDA 5I5ZA 1H0WA 3RCJA 3SG8A 1V0PA 2HCKA 3PJ3A 4YJQA 3A4OX 1P5EA 4AT5A 2QG5A 1UVRA 3ORNA 3FEGA 2NP8A 2Z7QA 3WARA 3ZU7A 1GIIA 1WAKA 4AZVA 3KXMA 3MPMA 4EWHA 3M2WA 5JFWA 2W1FA 5HNIX 5AV4A 3EQCA 3CSVA 4C3RA 2YACA 1YWNA 4UBAA 3RAHA 3LMHA 1OIQA 3E8DA 4AXAA 1PXIA 2NRUA 1VZOA 3OC1A 4M0ZA 5E1SA 4CTCA 1J7IA 4CCBA 5L2IA 5FUTA 3U6JA 3GFWA 4BTKA 1UV5A 3PFQA 2VTMA 3MH1A 2WTIA 4CV8A 5FRIA 1GZKA 3DKOA 4D0XA 3QQJA 2R2PA 4CVAA 5HCZA 2W1HA 2XK8A 2VX3A 3QX2A 5DNRA 2QHMA 1MRVA 2XEYA 5TKDA 4EH5A 4EH9A 2WFYA 3H9OA 4AA0A 3N4TA 1YI4A 1WBTA 3P7CA 3GC8A 4D2VA 4U3YA 1UA2A 3R7VA 2UW8A 3UBDA 2XIYA 2OJJA 5ANIA 4FT9A 4E6CA 5L6OA 3OEZA 2GHMA 4MQ2A 3EJ1A 4XEYA 2OZAB 3LFFA 2O8YA 5BYLA 3DFAA 4FI1A 4R7HA 3UP2A 1DM2A 1F5QA 2ESMA 4XX9A 3VAPA 5JFSA 4IM2A 2BFXA 1NA7A 2EXCX 3PSCA 3QL8A 4XP2A 5D9HA 2OXYA 3U4UA 3VF8A 5EHYA 5BMSA 4O7SA 2F2UA 4X21A 5AV3A 3KXGA 2SRCA 3R7OA 3WF8A 3PVBA 4KUJA 2IO6A 1UWJA 2NO3A 3QD2B 5CSXA 3VRZA 3F3TA 2XNBA 3R02A 1M14A 2W06A 2XNNA 3DBFA 4GEOA 4FICA 5FBOA 4BL1A 1W84A 3PE1A 4II5A 3I4BA 4X7QA 4YO4A 5F95A 1W8CA 3LJ1A 4L7FA 4IMYA 1SVEA 1KV2A 3EL7A 5DR6A 4EH6A 5F1ZA 3DBCA 3MS9A 3OMVA 3UTOA 5LCJA 4ANSA 3HL7A 4EJNA 3F6XA 3CTQA 2HZNA 2XF0A 4FUXA 3TUCA 3BHHA 3LXNA 5A4EA 5GJGA 3GBZA 4D1XA 5AP0A 4AFJA 3O17A 2OFVA 3AC8A 3KF4A 2UZBA 3C4CA 3V01A 3QWJA 4IAYA 3Q6WA 2OKRA 4HCVA 3RPRA 4AGDA 4U41A 4F9BA 4O22A 1LEWA 5AUTA 2OO8X 4HOKA 4GMYA 4ZSAA 2PULA 3D5VA 2ITZA 4J95A 4MAOA 5CSWA 4NUSA 3FZSA 4TYEA 4R78A 4GVAA 2YJSA 3PWYA 4I1ZA 3CIKA 3Q3BA 2XM9A 4D2WA 3O8UA 5KCVA 4O7WA 3KL8A 4RJ8A 2G2HA 3U9NA 2YCSA 4U97A 4O86A 5IA2A 4R8QA 1YOLA 4W9XA 2I0VA 2J0IA 2R3JA 4BHNA 4C58A 4QP8A 3DTWA 3IW7A 3F7WA 3R28A 3LLAA 2ZMDA 4UWBA 5C26A 3ATSA 5ANKA 4IACA 5I4NA 4I5HA 5JRSA 3JVSA 2G01A 4CYJA 4EH3A 3S1HA 4ANLA 2WTCA 3C4XA 3ZM4A 2A1AB 4NZWB 3W2QA 4H39A 3POOA 4OT6A 2J5EA 2QONA 4MXCA 3ELJA 4K2RA 5IPJA 4KBCA 3R1NA 3VBYA 4YC6A 3A62A 3EN4A 4D0WA 2O0UA 2NNWB 4E6QA 5T68A 4BC6A 4X3FC 3IGGA 3SDJA 4OBQA 2JD5A 2V22A 3L9NA 3QGWA 4IX3A 1KE7A 4MNEA 5H8GA 3QD4A 1UU8A 4RRVA 3TN8A 5EQPA 4GUEA 3EN9A 4YLJA 5EYCA 2WIPA 4B4LA 5M08A 3PIXA 4RBLA 2UW4A 3HDNA 3QU0A 5IUGA 3I60A 2R7IA 3IDPA 1YXXA 2ITPA 4G1WA 3ZC5A 3FUPA 5DRBA 2P55A 3VJNA 3MH2A 4DG0E 5M53A 4YJOA 2R64A 3THBA 4FODA 3RI1A 1K2PA 3AC3A 4EH8A 4WOVA 3FMHA 4DGLC 2W1CA 1BKXA 3DB6A 5AIKA 3IW6A 3CTHA 4ASXA 3LMGA 2J5FA 1O6YA 1OL2A 4HZRA 5EI2A 4YZNA 5BUEA 5CU0A 1JPAA 4NYEA 4YO6A 4C02A 5GZ8A 5AV2A 4BN1A 4UWCA 3DGKA 3ALNA 4NU1A 2I0YA 3D14A 2WOUA 3ORTA 4NH1A 2VO3A 4WUAA 4YMJA 2ZM3A 3CQWA 4DBNA 2QCSA 3OHTA 4CFFA 4FIIA 4PP7A 4QPSA 4USFA 4EHZA 3QA8A 2Y0AA 4E5WA 1WMKA 3QC4A 3WZDA 4CMOA 5F20A 5I3RA 4O0XA 2UZVA 3O8TA 3R7IA 3COKA 4V01A 2JFMA 4IAZA 2QNJA 5DEYA 4OTPA 4YUQA 1NY3A 2B9FA 3CXWA 4YPSA 4IZAA 3LW0A 1Q8UA 1FPUA 4ZY4A 4PMMA 3GNIB 3JR1A 4O81A 3QXOA 4YU2A 1Q3DA 3HRBA 5A54A 2XP2A 5AEPA 3U9CA 4NW6A 2JIUA 3FXWA 5DWRA 2WQOA 4DEGA 2FB8A 4R1VA 5DT4A 3FWQA 4WKQA 3MPAA 3LZBA 5EFQA 3BYOA 2QOFA 3QLGA 2XNPA 5AP1A 2BILB 4Z7GA 2UW5A 4EHGA 1JLUE 2Z7LA 1E1XA 3OT8A 1H24A 2XYNA 4K6ZA 1IR3A 4JBOA 4ZZNA 2V7OA 3D2IA 4I5CA 3UJGA 4DEEA 3UO6A 3DXNA 4JLCA 2B52A 2C47A 3CPCA 5AR4A 4NWMA 4DYMA 5D7VA 4LOOA 3ORXA 5EW9A 4WNKA 5EW3A 4I94A 5AUXA 1P4FA 3EFJA 3GCVA 3G2FA 3NYXA 2PK9A 4P4CA 4IM0A 2AUHA 4QMPA 1IEPA 4RA5A 4RA4A 4EOKA 4A4OA 3IS5A 4WSQA 4A9UA 4F65A 1BMKA 1O6KA 3T3VA 2GS6A 5L6WL 3GCUA 3HAVA 5CF6A 4WUNA 3CQEA 3F5UA 5CSVA 4QYFA 4ALVA 4DN5A 1URCA 2UZTA 4FTIA 4Q9SA 4FEVA 5GIOE 1H28A 2C3LA 4BCPA 4AGWA 4RIWA 5J1VA 2PE0A 4I6FA 4M15A 1L3RE 4C35A 2XNOA 2XRWA 4IFCA 4F7NA 2R3OA 2EUFB 3BQRA 3P79A 4RIYA 4O7VA 2XK9A 2HENA 4GH2A 4ZK5A 4KS7A 3ZMMA 4EOJA 1Q62A 2R3MA 1Q99A 2YIYA 3ZYAA 3BEAA 5L2WA 5DRDA 4IW0A 1HCLA 5C4KA 3WE4A 4WRSA 3FXXA 4RSSA 1OBDA 2PUNA 3HGKA 2PPQA 4TNBA 4XYFA 3DBQA 2OJ9A 3OUKA 3VBVA 5T3QA 5LQFA 4AF3A 1ZOGA 1PMNA 3HRCA 4FOCA 1WBWA 3R0TA 4YLLA 3WF5A 5DYJA 3EN6A 5CNNA 5K0KA 2ONLA 2X0GA 3VS7A 4M0YA 3ID6C 4O7YA 1FVTA 2C6LA 2XK7A 2RFNA 3G5DA 3LHJA 4HGEA 4L01A 4MF1A 5LMAA 3UZPA 4YJUA 1PF8A 2XVDA 3B8QA 3E64A 3R63A 1UWHA 2W1EA 2AC5A 3EQFA 3MGYA 3UZTA 4M69A 3EQBA 4CLJA 1OIRA 3KCFA 4ZY5A 2XS0A 4BDFA 2YDKA 3LCDA 2EB2A 2J0LA 3RP9A 4ZTSA 3MJ2A 5FEQA 3R7YA 2RSVA 4L42A 4RFZA 3GU5A 3AQVA 4ANMA 2Y4IC 3PXRA 3D5XA 2W1DA 4M8TA 5KKRB 3RPVA 3R9OA 3TUBA 5CAOA 3DA6A 3SLSA 4D4RA 4PDYA 4BFMA 4ZSLA 3OY3A 4BBFA 1WBSA 1M2PA 4PPAA 1SZMA 2HZ0A 3F3ZA 1BL6A 5IEYA 4TYIA 4U9AA 4LMUA 4K77A 2EWAA 5FGKA 2BUJA 3DDQA 4CG9A 1Y8GA 4MNEB 3TEIA 4AZFA 5K5XA 1H1PA 4KWPA 5IQDA 4ZLZA 5HTCA 4DH8A 3K2LA 1Y8YA 3H0ZA 2ITUA 3FQHA 5L4QA 2LGCA 4FTQA 5CS6A 4BTMA 3FI4A 5JK3A 3PSDA 3KU2A 2FSOX 5KZIA 3P4KA 3OWKA 4ZTHA 1U54A 3ZXTA 4A4XA 4TYJA 5IA0A 4Y95A 4FSYA 4IB0A 3FZ1A 2VRXA 1J1CA 5EHOA 5ETCA 2VO0A 4JJRA 3UVRA 5HIEA 5KHXA 4YZBA 3DXPA 5JMSA 2X4FA 2YJRA 3C9WA 4DTBA 3W2CA 3BHVA 5E1EA 4EKKA 4DGNA 3EQRA 4G6NA 4YJVA 4KKGA 5B0XA 2Y4PA 3ZLYA 2Y6OA 4FKOA 5CEPA 5LVLA 3HA6A 4TRLA 5AR5A 2OSCA 5EYMA 3ZDIA 2C1BA 3LOKA 2OF2A 5A6OA 5LXMA 4F1OA 2W5AA 4RLLA 4EWQA 1WBVA 3QQLA 2X8DA 3RAIA 5K4IA 3KGAA 4JI9A 2VTOA 2YM3A 4IJPA 4CZTA 2BPMA 1OUKA 4ZAUA 4JX3A 2NRYA 1V1KA 3VUDA 2FA2A 3UGCA 5BVWA 3RKBA 3UIXA 4O1PA 4PDPA 4RJ6A 5ANJA 3KA0A 5HVKA 1Z5MA 2OF4A 4GU6A 1UU7A 3LJ0A 3PXKA 4IZYA 4A9RA 1APME 4RJ7A 3NVMB 5AUUA 5JQ5A 2RFDA 1XJDA 5C03A 3LFSA 3Q04A 4XRLA 3A7GA 2CKEA 2X7GA 1PXKA 4Y83A 5KMNA 3G9NA 5FDPA 2V7AA 3NNWA 3NWWA 4N0SA 3QWKA 4BCNA 2PZYA 4IB5A 4F6SA 3ACJA 3EFKA 5BX0A 4AZSA 2CJMA 3ORIA 2PZRA 2XIXA 5DBXA 3V6SA 3KN6A 1OVEA 4XHKB 4XP3A 3RNIA 3UOKA 4F08A 1T46A 4QMNA 1PKGA 2DUVA 3GU8A 1SNXA 4V0GA 3PY3A 3OY1A 4R1YA 5J87A 4TT7A 5FM2A 3ETAA 4ZMFA 3G6GA 4J71A 3HMOA 2QKRA 2HOGA 3IKAA 5E9EA 4FOBA 3TACA 2J0JA 4QNAA 4FV7A 1YXSA 3WE8A 4BCHA 4BYJA 3R01A 5HTBA 1Y57A 2VWXA 3ALOA 2CGUA 4LRMA 3CE3A 4R7IA 3NMUF 3E3PA 3FY0A 2HXLA 4IVBA 4RFYA 5AAEA 4F0FA 1ZOHA 5IUHA 2V0DA 4E4XA 4HVIA 5AADA 4MNFA 3KREA 1ZYDA 3LXLA 4X3FB 2YA9A 3DOGA 3L8XA 3PA4A 5AIRA 1NVRA 4MWHA 1XBBA 3JY0A 3CP9A 4XV2A 4L53A 2CKQA 3FI8A 2VN9A 2EVAA 3NNUA 3W10A 2YEXA 4LOQA 4RIWB 5BMMA 2P3GX 2YDIA 3PJCA 4RWKA 3AOXA 3ORMA 4U40A 1OMWA 5HO6A 3HV4A 5K5NA 3QZHA 1YRPA 4QMVA 2I40A 3RBWA 4JIAA 3P08A 4FTKA 4AAAA 5IMXA 3G6HA 1AGWA 4IXPA 5IG1A 2C4GA 4LG4A 5A6NA 1PXMA 1ZYSA 4I41A 5JZNA 4ZS4A 2HW7A 4EUTA 5JZJA 1P14A 3HUCA 4BWXA 4ANBA 2ZM4A 5A4QA 3DAJA 4UMTA 3JUHA 1TVOA 3LFBA 3FQSA 4FV6A 4I0RA 3ZHPC 3PY1A 2VD5A 4FKUA 4KIOA 3O51A 2IZSA 3OWPA 1IA8A 2XUUA 3KXZA 2YERA 4IAKA 4TKSA 3PPJA 2PVHA 3GC7A 2WMXA 3TCPA 4HGSA 3NYVA 5HVYA 1YKRA 4TYHA 3VRYA 4FMQA 1STCE 4FKJA 4I4FA 3GU4A 2C6DA 2UVZA 2Q83A 2VWIA 3BHUA 2BZJA 5LWNA 2OIBA 2UW7A 4F9CA 2VNYA 2AC3A 4GJ3A 3TIYA 4L46A 4DCAA 3FLQA 4JAJA 3BYMA 4PP9A 3VUMA 1PMVA 1ZWSA 3O2MA 3ODYX 3UZRA 2ZJWA 3MJ1A 2ZV2A 4EQUA 5KMIA 4U81A 2E9VA 1O9UA 2REIA 2ZV9A 4K18A 1OL6A 4DE4A 3S3IA 1Q5KA 4N57A 1ATPE 1KE5A 3TI1A 1H07A 3MY1A 3CCNA 3ZRKA 2WQMA 3ZRMA 1A9UA 4YURA 3TKUA 4G3FA 3ORKA 1YOJA 3OF0A 4ZIMA 4P90A 3E93A 3BLQA 3KCKA 2W4JA 3ENHA 4FG9A 5HBEA 4EYMA 3H3CA 4E20A 3EOCA 2YIWA 3D7TB 2QOCA 3P7BA 1GY3A 4XOYA 5IH4A 4FV4A 2YIQA 4KIKB 3VS3A 3DJ5A 1UNHA 3KRRA 1YXUA 4U43A 4FK6A 4FZAB 3FBVA 4PL4A 4U7ZA 4U45A 5D12A 4EK5A 4IDTA 4R6VA 4DH3A 2A2AA 4YJRA 2NPQA 2VTJA 5M07A 2OWBA 3ZSGA 2KTYA 4QP7A 2RG6A 3FZRA 2GNHA 3BYVA 5BVEA 3U87A 4LRKA 3AGLA 3CGFA 2OZAA 4OTDA 4BZOA 4ZTRA 4ZJIA 3R8MA 3AGMA 2WTKB 2ZV7A 3HV6A 4RIOA 3D0EA 3QKLA 3FZPA 4DINA 5LWMA 3KXXA 1M7QA 5E8UA 3IW4A 4X2KA 4LYNA 4HJOA 5EH0A 4DEIA 4F7LA 4TXCA 1AQ1A 5B2MA 5BPYA 4AA4A 4HVSA 2JGZA 4GRBA 4C61A 4ACCA 4EI4A 4OAUC 4D4VA 1YDRE 3L9PA 2VTSA 3LFQA 2QKWB 1H26A 4DAWA 1U59A 1PRYA 4FF8A 3PVWA 2OJGA 4FNYA 4MBJA 1OIYA 4MBLA 4APCA 3NS9A 4I6BA 2JAVA 2B0QA 3LFCA 5J7BA 5I3OA 3BV2A 4FA2A 2WPAA 5KO1A 3ZBXA 3BV3A 3IO7A 2ZYBA 4Z3VA 5FXSA 4FTLA 4XLVA 1S9IA 2IVVA 3D5WA 4LM5A 3F3UA 1OIUA 5HTIA 1PMUA 3GQLA 3VUTA 4EH4A 5GNKA 4AN2A 1ZY4A 3QTXA 2XM8A 2W1GA 3NUPA 1S9JA 2JIIA 3MB6A 4MEDA 2VX1A 4IFGA 5CT7A 5I0BA 3TZ8A 3MTFA 3KRLA 3DDPA 4UEUA 2R9SA 4ITIA 2Y7JA 4G3GA 2W9FB 3Q4CA 5M44A 4JG7A 1YQJA 2CNUA 1Z9XA 3F88A 3MFRA 4C4HA 3FYJX 4O2PA 3SHEA 2PE1A 4FIGA 4H05A 4I4EA 2YM6A 4DFZE 3Q6UA 4DGOA 1OECA 4EOPA 4G6OA 4NTTA 3VUIA 2I7QA 4O7LA 4I92A 5ICPA 5IH6A 4M3QA 4D1ZA 1L8TA 2XYUA 3C50A 5AR7A 5CSPA 5CXHA 2XJ0A 3PWDA 5LOHA 5CYIA 5E8YA 1TQPA 4JDJA 2ZVAA 3EN7A 4XP0A 2B1PA 4EK6A 4JL9A 4FSZA 4PPBA 1URWA 3I79A 4IWPA 4KABA 4YC3A 4Q2AA 2HYYA 4A4LA 3NLBA 1GIHA 3TTIA 4AUAA 5E7RA 4JRNA 4GCJA 4WRGA 3FMKA 4WBBB 2J51A 4AE9A 4CMTA 4HVGA 3Q4ZA 3W18A 1RW8A 3RJCA 4BDBA 3AMAA 3DBDA 4IC7A 5IA3A 4E4NA 3VBWA 4H3PA 4R3CA 4E6AA 1M17A 1JQHA 2GQSA 4MXXA 2E9UA 3FL4A 3RWQA 2KULA 4TL0A 3V04A 4FKGA 3Q5IA 2OH4A 3IG7A 3UE4A 1QCFA 2BVAA 3W2RA 1FMKA 4CTBA 4D1SA 5HLWA 3S0OA 4DFBA 3FMLA 2W05A 2Y8OA 3NIEA 2FSTX 3VS6A 3NDMA 4MTAA 3U54A 1QMZA 4FZ6A 1OL1A 3NW5A 4QTCA 4AGCA 4FNZA 3QHWA 3LKMA 4EOMA 1MQ4A 4YSJA 4N4SA 3RNYA 3DY7A 3PJ1A 2WELA 3F82A 3OD6X 3IECA 4K8AA 1YDTE 3DK7A 3QQHA 4N6ZA 3OBJA 1Q8ZA 3Q9ZA 3F2RA 3D94A 3DJ6A 5EYDA 5HOAA 4E73A 3PYYA 5AM7A 4RFMA 4UMUA 4PQNA 4S31A 1XO2B 2WEVA 3MW1A 3UDBA 5AA8A 1H1QA 2RIOA 2VO6A 3W32A 4D58A 1P2AA 2VWWA 3EL8A 4IE9A 4O96A 4OT5A 2UZUE 4CG8A 3UG1A 3TV4A 1P4OA 1W83A 4DGGA 4M12A 2WZJA 5AUVA 4RLKA 4BZNA 2C6TA 2B4SB 3FMMA 4LL0A 2ZV8A 3EQIA 3TJCA 4AOIA 4DITA 1OKZA 1YWRA 4NM7A 3VS5A 3VUGA 2JBPA 4YSMA 1WVWA 4KAOA 3HV5A 3ORPA 3CGOA 5EW8A 5ANEA 4ID7A 2C3JA 3NUNA 1H08A 3JS2A 1WBOA 4PL3A 5BQ0A 3ZFXA 3POZA 3IOKA 4FV9A 4EYJA 3RPOA 3BU5A 4R3RA 3RTPA 4MD7E 2R3GA 4CFVA 4KA3A 1XBCA 3MH3A 4F63A 3DK6A 4JG8A 2IW8A 5HG5A 4X2GA 2XK6A 4QTEA 3W1FA 5H8EA 5BUIA 3V8WA 4AOJA 5KMJA 4QMTA 4K1BA 4YC8A 5ACBC 1JSTA 3AT3A 5HX6A 4DF3A 2O64A 4RVKA 3NUAA 2RGPA 2O3PA 3D7ZA 3SOCA 3H9RA 2ITQA 2UW9A 4QQCA 3A60A 2UW3A 4AE6A 3HP2A 3VO3A 1G3NA 3NIZA 4WG4A 2VWUA 3TWJA 2DYLA 5L6PA 3ZRLA 3CLYA 3NZ0A 3V8SA 5LMBA 3U55A 4U42A 4YJPA 1CKPA 3EYHA 4BDIA 4GFMA 3T8OA 3I5NA 5LVPA 4LV8A 4YJSA 4EL9A 4Z55A 4DLIA 2W0JA 5AR3A 4F9YA 5EOBA 3U8WA 1MUOA 3DPKA 3QTQA 3BLHA 2BR1A 1TQMA 2JKMA 2QOQA 2W5HA 3PPKA 2BTRA 4F6UA 5C8KA 3FLSA 4BHZA 3AD5A 3CJGA 4JVGA 5KBRA 1JSVA 1OKWA 3MFUA 3R2YA 3FAAA 2G2IA 4ERWA 5AMNA 3PY0A 4GK2A 2QHNA 2XKEA 4B0GA 5AV1A 2PUUA 2UZNA 2XIKA 4PMSA 2WMQA 4CCUA 3VBXA 4RPVA 1PXPA 5JEBA 3FV8A 5FEDA 3SXFA 5HU9A 5JGAA 3LFEA 4MXZA 3PG3A 4W8DA 3KY2A 3GXLA 3OCBA 3PTGA 5DI1A 2X7FA 3FZTA 5CTPA 4ZP5A 1YXVA 5CSHA 2PY3A 4FV8A 4BDAA 3EFLA 3U6IA 3PLSA 2BZHB 5K4JA 5LMKC 1SNUA 1M52A 2JKOA 3FMEA 1KOBA 3GCSA 4FX3A 3DJ7A 4BY9E 2E9NA 4L3JA 2R0UA 2XK3A 2Q0NA 3TDVA 1U4DA 3UVQA 2BTSA 3ULIA 2I6LA 3R7EA 4NFNA 3R71A 5CZIA 3R6XA 3R8VA 5I9WA 4FZFB 4BCMA 3BCEA 4OW8A 4FTCA 5HO8A 4M84A 3QUPA 4DEDA 4QP3A 4J8NA 4G9RA 4L52A 2CN8A 4I0TA 3RAKA 1FVVA 4LGHA 3EYGA 2WMBA 1B39A 2YWVA 4DLJA 3WYYA 2E2BA 2UV2A 4M13A 5A4LA 4C33A 2BRHA 3LM5A 4IAAA 4F64A 2XJ1A 3GEQA 4E4MA 5CI7A 1ERKA 5IQGA 4E1ZA 3UQFA 3RMFA 1Q4LA 3Q9XA 2F9GA 4FKVA 2XRUA 4MK0A 3VW6A 4EOOA 2V62A 4H1MA 5EM5A 5HBHA 2UW6A 3IGOA 3BGQA 2QOIA 3DZOA 4UYAA 2HY81 5IQCA 1XH9A 4L6QA 2PMNX 3NUXA 3HNGA 4UMRA 5K9IA 3R8LA 4EK8A 2BRBA 3QRJA 3V5TA 2GU8A 3VN9A 5B2LA 3KRJA 3UODA 2VNWA 4AW5A 4ITJA 3QD3A 3UOLA 3EHAA 5ANOA 2YHVA 3N51A 2XCHA 4XG4A 5AM6A 4OTQA 3ZTXA 4BGHA 3EQHA 4TZRA 2R3QA 5IISA 4C3PA 3ZLSA 4PRJA 1ZARA 2OK1A 1H8FA 1CKJA 5FG8A 3WZEA 3DXQA 3JY9A 3ZLXA 3ORLA 3F5GA 4D5HA 3AT2A 5BVFA 3SAYA 3CD8A 3QRTA 5JN2A 3OXTA 1KOAA 3GU7A 3RK5A 2P2IA 4FYOA 5KX8A 1K9AA 5HG8A 3FYKX 4H3QA 5DT3A 5DN3A 4XOZA 2QLQA 1FQ1B 3FKLA 2BROA 1R1WA 4EEVA 4EJ7A 2IPXA 4W8EA 1G8AA 2WU6A 5I9XA 2OW3A 5KBQA 5AP6A 1CKIA 3PA3A 1VYZA 4O0WA 4CQEA 3UMXA 4IC8A 2RG5A 4ZEGA 2YITA 2GHLA 3WOWA 3ZDUA 1R3CA 4I20A 2QR7A 3QKMA 4QP1A 3QX4A 3LXPA 1PJKA 4FEUA 5CVGA 2LAVA 4F6WA 5TOZA 1MRUA 1W98A 2XCKA 4O21A 1UU9A 4AA5A 2GTNA 3GOPA 4BCIA 4YTCA 3E87A 4RX5A 5JT2A 3DAEA 5ITAA 5KZ0A 5FBNC 3QTSA 4M14A 3WI6A 5AV0A 3H0YA 5HEZA 4C34A 3PE2A 3BWJA 4TNDA 3FC1X 2ACXA 3A61A 4XCUA 5EI8A 2X1NA 3ZC6A 5J5TA 4X2JA 5L2QA 5HHWA 2JC6A 4E5AX 3CEKA 2JDOA 4FBXA 2VTPA 2IVSA 3UPXA 4Z7HA 1PXJA 3JYAA 4DTAA 2QODA 3NCZA 3NYOA 4NEUA 4C4EA 2FSMX 4X3FA 4XLIA 5G1XA 1FINA 4F0GA 3AC4A 4FNWA 4TPTA 3EKNA 3MFTA 4NFMA 4BDHA 4U3ZA 4G2FA 2F4JA 3WZUA 5C8NA 4KSPA 1VJYA 4RC4A 3HMNA 4RQVA 1UNGA 4FKQA 4FR4A 3AG9A 3QXPA 4QP2A 1JKTA 4D4YA 2WTDA 4GIIA 4GKHA 3MVLA 5H9BA 2PL0A 2CMWA 4WD5A 4QQJA 4LMNA 2WTVA 3BPRA 5ANDA 2BDFA 2W1IA 3S00A 3SV0A 2I0EA 3BWFA 4S33A 4FC0A 4BDDA 1JOWB 1H4LA 4JR7A 4O0TA 4YHFA 4FGRA 4O7RA 3OCTA 4YZDA 5M56A 3QCYA 2H8HA 2C6MA 2PMIA 4IVAA 2Z8CA 1ZZ2A 2ZDUA 2JKKA 3MFSA 1DAWA 4N6YA 4PF4A 3LCTA 3CTJA 4LOPA 5TR6A 5BUJA 3KULB 5KHWA 2ETMA 5CT0A 2W9ZB 2JDTA 5CAQA 5BVDA 1IAHA 3PIYA 3I1AA 4ZSEA 3C4ZA 3GGFA 2WU7A 4BTJA 3ANQA 1NVSA 1Z57A 2HZ4A 3KC3A 3RVGA 3UNJA 4ARKA 5CXZA 3B8RA 4C2VA 3MVJA 5DPVA 3SC1A 3BELA 2OZOA 4OTHA 3HVCA 3N9XA 4RIXB 4FZ7A 2VO7A 5HQ0A 3Q5ZA 4YTIA 4W9WA 4QQ5A 2VZ6A 3C7QA 4FVRA 4WT6A 1QL6A 2WOTA 3BU6A 2VU3A 4RX8A 3BIZA 4L44A 2WEIA 3OP5A 5IKWA 4CKRA 4OTIA 2VTRA 5IQIA 1YWVA 4FVQA 1I44A 4EK3A 1PMEA 3LXKA 2EU9A 3KK8A 4RJ5A 4ZTNA 3UMWA 4FKIA 4S34A 2IN6A 3KMWA 5EI6A 3BHYA 3JVRA 4XG3A 3VS4A 4DG3E 3D83A 2B9JA 1ZY5A 2PUIA 3D7TA 3FLNC 3V5JA 1MRYA 1G8SA 4KIKA 5EHLA 1Y91A 4H36A 2WMAA 4HVDA 3PSBA 2XEZA 3FZOA 5H3QA 2B55A 2FUMA 4FYNA 4TY1A 1KE8A 5HD7A 3WIKA 2PVNA 4F1MA 3EH9A 4O6EA 4DH1A 2GQRA 3I7BA 2PMOX 4OTFA 4EOLA 4ZZOA 3ZO1A 1W0XC 3MA6A 3EN5A 5HCXA 5HX8A 3W2PA 2WTWA 3HECA 3CJFA 3VIDA 4EZ5A 4KNBA 2WQBA 4E8AA 3T9IA 4AU8A 4PTEA 2R3NA 5HICA 1Q3WA 3H4JA 4BI0A 2JITA 5HORA 3SA0A 2YAAA 3PP0A 4HVHA 5DA3A 3E63A 3CR0A 1YXTA 1R0PA 3P7AA 5IA5A 1FMOE 4IX5A 3HV7A 4HYUA 3N4VA 4ZOGA 3D4QA 2VWBA 3OXZA 4QTAA 4ZXTA 2OBJA 2X6DA 4HW7A 1RJBA 5M09A 2YZLA 1E1VA 4I21A 2R3FA 5E92A 4J53A 4E3CA 5M51A 2BAJA 2PMLX 3NAYA 4BTFA 3R7GA 3A7IA 4XMOA 5AP5A 1VR2A 3O7LB 1QPEA 2F2CB 3MN3A 4P2KA 3F7ZA 5IQFA 5HE3A 2CGXA 4WA9A 2YZAA 4JRVA 5IDNA 1SMHA 2OFUA 3QF9A 4B6LA 4AX8A 3UYSA 4CSVA 4KBKA 3OOMA 4FIJA 4NCTA 3Q53A 4BBMA 5BNJA 2BDWA 4RGJA 4JX7A 4AW1A 4FV2A 2FO0A 2BZIB 2YM7A 4WIHA 1A48A 4D55A 3CS9A 5IEVA 4QT1A 2QR8A 4HNFA 4E6DA 4R3PA 4UX9A 4MH7A 4BKJA 3NEWA 1A06A 4FKRA 5AWMA 2ETKA 4GVJA 2CPKE 5EDQA 3LIJA 3NAXA 4Y5HA 3GENA 5L8LA 5LJJA 3TL8A 4GV1A 1KV1A 3DTCA 5D10A 4D5KA 3QUDA 1DI9A 4BICA 2CNVA 3E7VA 5CI6A 4O38A 3QTZA 2G2FA 2BIKB 2HK5A 3HDMA 3F69A 2XKDA 4UV0A 5L8JA 3Q32A 3WZJA 4C62A 2WGJA 4E93A 4Y72A 3ZUTA 4O0RA 3CY3A 4DTKA 3KEXA 4FTAA 1CDKA 4CYIA 5FTQA 3NW7A 5CEOA 3BYUA 3P78A 3UOHA 3W8QA 2G9XA 4ACDA 3EZRA 4FV0A 3UQGA 2Z7RA 4ZTMA 5IQAA 4ZJJA 5HNGA 4QPMA 4BIDA 2ERKA 4GJ2A 3FPQA 3OW4A 2GQGA 3R83A 3QZIA 3VC4A 1BL7A 2X8EA 3OUNB 2VUWA 3N4UA 2W96B 4CFXA 3QAME 5DVRA 3UIBA 4AOTA 4XG6A 2BRMA 3D9VA 4DFNA 3RCDA 4IZ5A 4KRDA 2GFCA 3SOAA 2CHLA 4FSUA 1YW2A 4FSTA 4EQCA 4I6HA 1ZZLA 4FSQA 3S95A 3HEGA 4CFMA 4DFLA 2X2KA 3GOKA 4XV1A 3REPA 3V51A 3R9DA 4RVTA 5T6KA 4A7CA 4CT2A 2X4ZA 4FK3A 1XWSA 3FLYA 1ZLTA 4BDJA 3GT8A 3HKOA 4HCUA 4QYHA 3TV6A 4BKYA 3DAKA 4DT9A 2R3IA 4Y73A 2H34A 3A4PA 4EBWA 2Z02A 3IQ7A 4YBJA 4R5YA 3GB2A 4WG5A 1UNLA 3R30A 4FIFA 5EK7A 2J0MB 1XH8A 2WMSA 4FKLA 4ZZMA 4F7JA 5A46A 2C6EA 3UC4A 3QYWA 3UVPA 5A4TA 1O6LA 4CD0A 2GHGA 5AUWA 1DAYA 1R78A 4ANNA 3NYNA 4U80A 5TF9A 2PVRA 2X9FA 3BQCA 3PPZA 3Q96A 3QZFA 3R22A 2B53A 4L3PA 4EOIA 1YI6A 4TWOA 1Q8TA 2R0IA 4FV3A 4O82A 5JKGA 4B9DA 2O2UA 2W99B 4FIHA 4CMUA 4LV5A 3ZCLA 1LEZA 4FGBA 4U5JA 3FHIA 1OI9A 3HP5A 5IQBA 2XBAA 3IK3A 4NM0A 4B8MA 3MY0A 4NK9A 2XIRA 3I5ZA 3MVMA 1NW1A 5L8KA 5DT0A 4GK3A 4F4PA 3F66A 4S32A 2X81A 1F0QA 4OR5A 5I9YA 4RQKA 4GSBA 3II5A 3E92A 4X3JA 4AS0A 5B7VA 1Y6AA 3W55A 2BFYA 1JBPE 4AG8A 1PHKA 4ZLOA 1ZMVA 5LVOA 4FSMA 1LUFA 2OG8A 3QCQA 5LVMA 5E4HA 3FKNA 1M2QA 4BCFA 3R1YA 4HPUE 3WZKA 2ITYA 4EBVA 4JQ8A 1XHAA 1JWHA 1XQZA 2IW9A 4FTMA 2XB7A 3DNDA 5CVHA 3ORZA 4D2RA 1CMKE 2C5NA 4IEBA 4IX6A 3QZGA 4NTSA 4M68A 4QNYA 3GCQA 4F9WA 4FT3A 3PLAE 3M42A 4GYGA 2ITVA 4O7ZA 3G51A 4PX6A 4D9UA 3Q9WA 4O2ZA 2J2IB 2WMWA 4AZWA 4GUBA 2F7XE 3KXHA 3LM0A 3P1AA 3ZO2A 3RM6A 4KKHA 3RM7A 3BHTA 1H00A 3F5XA 4W4XA 4AN9A 4U6RA 2Y9QA 3CC6A 5GZAA 1ZYLA 4PDOA 4XJ0A 5EM8A 3TIZA 4ZMEA 5HESA 1GZOA 5TE0A 5M4CA 4FL1A 3RWPA 3TZ7A 4LUDA 4D2PA 4QMYA 1ND4A 4WHZA 2PYWA 1U46A 2E9PA 2FYSA 5E8TA 4X2NA 5LARA 2F7ZE 2FVDA 5TT7A 1UKHA 4FVPA 4NM5A 4ANQA 1NT2A 3SW7A 2C5OA 5KMKA 2A19B 2R3KA 3V5QA 3KFAA 4C4IA 4LRJA 5IA4A 3KMUA 3DQXA 3RALA 4MXYA 1VEBA 5M57A 4FEWA 3TNPC 4YTFA 2OLCA 2BMCA 3ENMA 3UIUA 1U5RA 4DHFA 4JT3A 4JBPA 1MP8A 4YHJA 3TDWA 4GS6A 3F61A 4ALWA 2WMVA 4UWYA 1U5QA 4B7TA 5I9VA 4FL3A 4BVUA 3PXFA 4KIQA 2BKKA 4YNEA 2GPHA 4PV0A 1Q41A 2C5YA 5CEIA 2UZDA 4FEQA 4J96A 3ZBFA 5JSMA 2Y4IB 1DS5A 4G3EA 5AP4A 4MX9A 2QO7A 3U51A 2PSQA 4HPTE 5ACKA 1J1BA 4JDKA 1Q24A 4L43A 4BCJA 2W4KA 5DHJA 4IWDA 4JOAA 3V8TA 4XS2A 4ZJVA 4D28A 2A27A 2X39A 4UZDA 3BGZA 3KB7A 3FLWA 2YWPA 1X8BA 3TXOA 2CDZA 4QD6A 3SD0A 3UPZA 4KRCA 4FKTA 3P86A 3ZUUA 1PKDA 4IAIA 3UYTA 5HLPA 1ZYCA 3DT1A 2WAJA 3ZOSA 4E5BA 5JFVA 3ULZA 1WBNA 2XKCA 2C68A 5IUIA 3OROA 5CLPA 3NNXA 4I23A 2UUEA 2HELA 3QALE 4PNIA 5FDXA 2C6IA 5FWKK 1Q8WA 3NGAA 3VBQA 4EORA 3F5PA 4HGTA 4ASDA 3C5UA 5EG3A 4TTHB 4CKJA 4X0MA 3MWUA 5M55A 3RINA 2QQ7A 5DR2A 1NVQA 3RK9A 4ACMA 4LQMA 3A7FA 4CQGA 5A4CA 5BVOA 1IAJA 3ZONA 3BBWA 1OL5A 3A2CA 4RZWA 3JXWA 5HIDA 5I9ZA 4FE2A 2VWZA 4FKPA 2Z7SA 4L3LA 3QKKA 5CEMA 5CF4A 1M7NA 3NCGA 3C5IA 3PXQA 3BX5A 1YI3A 4RX9A 3Q2JA 4FV5A 3MA3A 3CD3A 2QU6A 5EKOA 4FIEA 3KN5A 4FTRA 4AT4A 3KK9A 5FP5A 4AZEA 1IA9A 3TNIA 3MSSA 3QRUA 3QBNA 4PDSA 5B2KA 5KMMA 1BI8A 2GCDA 2WIHA 4LUEA 3C1XA 3OEFX 1H0VA 4UZHA 2H6DA 1REJA 2V5QA 3H9FA 4GT4A 4JNWA 5CU6A 3ZXZA 2IVUA 3O96A 2XMYA 3ODZX 3WBLA 2GMXA 4NKAA 4OTWA 4DCEA 3L8VA 2QU5A 3EZVA 4TN6A 3QD0A 4C36A 3R8ZA 3W2OA 2GDOA 4AP7A 4EH7A 4QP4A 4XH6A 4QYEA 5FLFA 4EK4A 2R7BA 3BZ3A 5DR9A 3ZO3A 2C5VA 3DB8A 4NJDA 4K9YA 2GS7A 3FI2A 3Q4UA 2WNTA 4HGLA 4QTBA 4EOSA 2VTQA 5J5SA 3TNHA 3FMDA 1GOLA 1B6CB 3NW6A 5JH6A 2B54A 4NIFB 3PA5A 1Q8YA 2C0IA 3NRMA 2CCIA 2PVLA 3W2SA 4BCKA 1ZMUA 4BZDA 5J7HA 3NSZA 4I93A 3BGPA 4O0SA 2VGPA 3EWHA 3G15A 4EOQA 4FSWA 1XR1A 5EQEA 3R9HA 5HIBA 3VNTA 4XBRA 2IJMA 3RHXA 2JFLA 3PUPA 3LCOA 3PXZA 5CU4A 3LFAA 4L9IA 4NKSA 5HG9A 5C27A 4RVLA 3TZ9A 3SXSA 2ZOQA 2XKFA 3AT4A 1ZAOA 3OWJA 3GCPA 2JDRA 3L1SA 3MIAA 3WF6A 3MI9A 2F49A 4GT3A 3DU8A 4G5JA 2PZIA 4MD8E 2BAKA 5A9UA 4RC3A 4DT8A 4L45A 1IG1A 5F9EA 5KUPA 4IANA 3Q4TA 3SRVB 4LI5A 1W7HA 4PNKA 4IADA 3AD4A 4ONAA 4P5QA 4Y8DA 3L8SA 4M66A 2R3LA 2G15A 3S4QA 4EKLA 3K54A 4JIKA 1PXLA 1RDQE 5BVNA 2J7TA 2OU7A 2QOOA 4IWQA 5KKRC 5M4UA 1YHWA 2WTJA 4IH8A 3P9JA 2BRGA 5IQHA 3A7JA 5FTOA 3TNWA 3HAMA 5BYZA 4O6LA 4RVMA 3SG9A 4J1RA 2IW6A 3VHKA 5AAFA 1H1RA 4WSYA 4PTGA 2X2LA 4UXQA 2UVYA 2JLDA 2A4LA 2DS1A 5AFVA 2Z60A 3ZFYA 3CPBA 2XNGA 2PVYA 5HNBA 4AN3A 1AD5A 1KSWA 2C3IB 2QOLA 3TZMA 3LMIA 2CLXA 3KXNA 4YGAA 3G9LX 2H96A 2BKZA 4F99A 2IZRA 3OXIA 2GS2A 4B8LA 3PZHA 4JQEA 1MQBA 5IH5A 5JRQA 1BI7A 3HMPA 3C51A 4U44A 2ZB0A 5D7AA 3GC0A 2FSLX 3BLRA 4IDVA 4GG7A 4NT4A 3TUDA 1YOMA 4FSRA 4DH7A 5KMOA 4AQCA 4MVFA 3DS6A 3LVPA 3GI3A 3GU6A 3PRIA 4OUCA 1JNKA 2CLQA 3SQQA 2X2MA 1BX6A 4EHEA 3NUUA 1PYXA 3DBEA 3W16A 3KULA 4F09A 4OTGA 1OKVA 4ZSJA 3IOPA 4FNXA 5FM3A 2YFXA 4Q9ZA 4YHTA 3F9NA 4ORKA 4FTOA 3NPCA 3PXYA 3OTVA 4KSQA 1FVRA 4BDKA 3TM0A 2ZB1A 3MY5A 3B2TA 1Y6BA 2YLEA 4UALA 4EONA 3A8WA 4RIXA 1IASA 2VGOA 3RPSA 5K3YA 4AW0A 3MVHA 3L9LA 1XH7A 2OGVA 4TW9A 3UP7A 4BYIA 4BKZA 3OW3A 4CKIA 3SVVA 3C0GA 4ALUA 3O50A 5E8XA 4E26A 2VX0A 4IM3A 3L8PA 2QG7A 4D2SA 3HZTA 3LLTA 3TNQB 1GJOA 1OL7A 3DFCB 1W82A 1WZYA 3QTUA 5CY3A 2BDJA 3PVUA 4I5PA 4X6RA 4DA5A 3A8XA 2QVSE 3BYSA 4NW5A 4JR3A 4JXFA 3O23A 2A0CX 3UNZA 3QTWA 3KVWA 4CEGA 3LQ3A 4J99A 5CAUA 5J95A 1HOWA 3E3BX 1FOTA 2WO6A 2VAGA 4O84A 3R73A 4J52A 3HA8A 3VUKA 1PXNA 3D2KA 2WMUA 3NVKI 4BI1A 1PW2A 2P0CA 5AX3A 1ZMWA 2RKUA 4I24A 2J6MA 3C0IA 3QQKA 4I0SA 2VTNA 4S30A 4O7NA 5HKMA 2CCHA 3LJ2A 1H27A 3E8NA 1OB3A 4O0VA 4I6QA 4ZTLA 2PVMA 3R2BA 1YHSA 5AR8A 2QOHA 2X8IA 4J7BA 2G1TA 5C01A 5I9UA 5KMLA 4MF0A 3COMA 4PL5A 2R3RA 4LFIA 2O65A 4CT1A 2XH5A 2R3HA 3VULA 4P7EA 4IB3A 2CGVA 2OXDA 3DCVA 3O0GA 4J98A 4HCTA 4NM3A 4YP8A 1PYEA 3KKVA 3V5LA 3F3WA 4BWPA 2Y6MA 3MESA 2ITOA 1JAMA 5CANA 1E9HA 4YNOA 5L2SA 2YN8A 4XUFA 1WVXA 3FMJA 3MTLA 3RAWA 3FLZA 5DEWA 4B99A 3NX8A 4BCOA 4RWJA 3ROCA 4A9YA 4CRSA 1XH4A 2VWYA 2QI8A 1OITA 3FHRA
chains in the Genus database with same CATH superfamily
2PVFA 2UW0A 4O4CA 1OPJA 5D1JA 4IB1A 1OKYA 5CASA 3FL5A 3ZUVA 4QP9A 2ONLC 4Q5HA 4AFEA 4FUYA 4QYYA 1J7UA 3VVHA 2W17A 4GIHA 4ASEA 1SVGA 4MCVA 5CVFA 4FKSA 2B9IA 4D9TA 3V6RA 3R04A 3FQEA 4TYGA 2CN5A 2R4BA 2X0OA 4IZ7A 3ZO4A 1G5SA 2XAMA 3O71A 2W7XA 4GT5A 4ENXA 5IMEA 4BGQA 2YLFA 3BU3A 4J8MA 5LMKA 5A3XA 2P33A 4GFOA 1I09A 4C4GA 3K5UA 3OFMA 5DOSA 1J91A 2YIXA 3I0OA 3IONA 3VBTA 4GU9A 4K11A 2PE2A 4FG7A 1LPUA 3BE9A 4HYHA 4KIPA 4PMTA 3TT0A 3UIMA 4YTHA 3PVGA 2BAQA 2UZLA 3DKFA 4X6QC 3CBLA 5CAVA 3EQGA 5HI2A 3ZEPA 2PVKA 5H2UA 3OCSA 3R9NA 2XK4A 5J1WA 2DWBA 3HYHA 3CY2A 4OBPA 4MKCA 1ZXEA 2QD9A 4YPDA 5AR2A 5J79A 2VTAA 4GKIA 3KF7A 3CKXA 1BYGA 3VUHA 4M67A 4BDGA 4GK4A 4YJTA 4BRXA 2PTKA 1CM8A 4G6LA 1B38A 3BL7A 3QHRA 3CQUA 3FMNA 3VQHA 3UO4A 1BLXA 5CWZA 5CX9A 1FGKA 1PXOA 4OGRA 1OZ1A 4UYNA 4V04A 4EC9A 4QYGA 3G0EA 4BDEA 1YHVA 2C0TA 3DZQA 3FKOA 2GTMA 4C4JA 5J9YA 1J3HA 5FD2A 3C13A 2IZTA 3C4EA 4C8BA 2OXXA 4QMXA 2OIDA 5CF5A 3HUBA 3SGCA 4H58A 1R0EA 4G9CA 2PU8A 4UN0C 3FDNA 3MBLA 2ITNA 3SXRA 3MYGA 2QOKA 2WTKC 1J7LA 1T45A 4NJ3A 1TZDA 3K3JA 3FJQE 4QMSA 2J0KA 5AJQA 4QRCA 2HIWA 2X6EA 5DH3A 4XG9A 1BUHA 1ZOEA 3EMGA 2WMRA 4BF2A 5FQDC 4F70A 4YR8A 4UXLA 4GFGA 5CENA 3MH0A 5JFXA 2YISA 5JGDA 1VYWA 3BEGA 1QPJA 4WBOA 2JBOA 3ITZA 4FZDB 2BZKB 3EFWA 5TO8A 5K0XA 5M06A 4KINA 4AWIA 3E8EA 1KE6A 3G90X 2PWLA 4HYSA 2W5BA 4O27B 3LPBA 5EM7A 3ZZWA 4EQMA 3SX9A 2QO2A 2R3PA 3FPMA 2RFSA 2Z2WA 3OT3A 1CTPE 4NCTC 2XNEA 4DFYA 3FSKA 4QTDA 4Y5QA 5AAGA 3ZFMA 4FL2A 1ZYJA 4RWLA 4YBKA 3LE6A 5AP3A 5F4NA 2H9VA 3VWAA 4JDHA 3DKCA 2YDJA 2WQNA 3E88A 3FXZA 5J9ZA 4AXCA 4BR3A 4QP6A 3R8PA 1V0OA 3M1SA 3WYXA 3E62A 3IPHA 2P4IA 3TJDA 4PUZA 4YZ9A 4QMWA 5DE2A 3R21A 2O5KA 3VQUA 4M7IA 3ZSHA 5KNJA 5DFPA 2JDVA 4C37A 2IVTA 5HLNA 2YM8A 3HLLA 3NUYA 3G0FA 2OJFE 3VHEA 5AUZA 4MWIA 4P5ZA 5IU2A 5LVNA 3P23A 5CU2A 3ACKA 2GFSA 1H25A 3GUBA 4MQ1A 1EH4A 3ZH8A 2YCFA 3MIYA 4QMQA 3QA0A 3WIGA 3KQ7A 4KKEA 5EYKA 2OICA 1TKIA 2HWOA 4A9TA 4F1TA 4PWNA 4O91A 4L8MA 3VS2A 2PUPA 2GNFA 3V5WA 2JEDA 4F9AA 5CF8A 4WNOA 5IA1A 2PHKA 3AC5A 1XBAA 4DHJA 3RHKA 3ZM9A 3IDCA 2W4OA 2FH9A 4CXAA 3R00A 4QMLA 2HWPA 3QQGA 4JBVA 4ZSGA 4RZVA 1K3AA 3FY2A 3AMBA 4A07A 4C2WA 4E4LA 1OBGA 4UB7A 1TQIA 5C4LA 2X7OA 4M97A 2IWIA 4JAIA 3TV7A 4AW2A 3BKBA 1WVYA 3O8PA 3EKKA 1UU3A 3QFVA 3I6WA 3CKWA 1CSNA 4C57A 3GC9A 3AMYA 1DI8A 2X0QA 4JBQA 5FTGA 2Q0BA 4TWPA 5IQEA 2JDSA 5E8VA 1Q61A 5CAPA 4FT7A 5IZFA 3E8CA 1PY5A 2GNJA 3HX4A 3AXWA 5BYYA 5BVKA 4XV3A 3L9MA 3OBGA 5HVJA 2R5TA 3UNKA 4CZUA 2J9MA 5CEKA 5CEQA 4XRJA 3I0QA 1FGIA 4IX4A 4FTTA 3W0MA 2OI4X 4BWKA 1GNGA 4ERKA 5AX9A 4OLIA 4RG0A 2HW6A 4F0IA 4OBOA 1WCCA 3P5KA 4FG8A 3QQFA 4PMPA 4BIBA 4QMZA 3V3VA 4E7WA 4G34A 1YDSE 3BI6A 4APPA 4AT3A 4DFUA 3QTIA 3UG2A 4RT7A 5E8WA 5AP2A 5ETAA 4A06A 2XAOA 1SYKA 3RK7A 1WFCA 3LAUA 4F7SA 5GIPE 2GNLA 5DLSA 4IVDA 2HXQA 4GL9A 1KUTA 4IIRA 5J8IA 2FGIA 3PRFA 1OPKA 3OTUA 4QOXA 3T9TA 2I1MA 2E9OA 4BBEA 4BCGA 3LCSA 3D5UA 2WQEA 3MV5A 2VV9A 3PZEA 4L68A 1ZRZA 1H1SA 3QGYA 4ZS0A 5HE0A 3EIDA 5EKNA 1IRKA 3C4FA 5C1QB 2ITWA 4GW8A 2YABA 4OTRA 2ZM1A 3QCSA 4W4WA 1JVPP 2WKMA 4J97A 5LCKA 3UO5A 1LR4A 3K5VA 1V0BA 4QMUA 4WG3A 4XG2A 4N70A 5AUYA 1QPDA 4RJ3A 4XV9A 2XA4A 5ETFA 3RPYA 2EXEA 1GAGA 2IG7A 5GJFA 2WHBA 3Q60A 3VJOA 1OM1A 4C59A 3NFFB 3P0MA 2C69A 5FP6A 2AYPA 4Q5EA 4BGGA 3IW8A 5CQUA 2BCJA 3GQIA 4JQ7A 5EDPA 3R1QA 5E8ZA 1JKSA 3ZS5A 3OCGA 2V55A 4OAVB 2J50A 4RMZA 2F57A 4G3DA 4GG5A 4ZLYA 5M4FA 3NNVA 3QC9A 1KE9A 3A99A 4RIYB 2XIZA 2QC6A 4PPCA 5IF1A 3KRXA 4FV1A 2C5XA 5EDRA 4UMPA 4YLKA 4L00A 4BI2A 5IDPA 4USEA 2EXMA 4IVCA 3MDYA 2UVXA 5HD4A 3PIZA 5GHVA 2JKQA 5JGBA 3UOJA 4O4DA 5HBJA 3W0NA 2XJ2A 2BRNA 2WB8A 4H1JA 4DBXA 2RL5A 3DKGA 3QCXA 3OS3A 2O63A 4G3CA 4HZSA 4FTNA 4KB8A 2J4ZA 2YM5A 4XG8A 4A9SA 4ASZA 4FSNA 4C38A 2WXVA 3Q2MA 5D11A 4MXOA 4R5SA 3S2PA 3HRFA 5AP7A 3SKCA 2BHEA 4KS8A 4U8ZA 2WMTA 4NIFA 4EH2A 4KD1A 2ERZE 1JKKA 1SM2A 2VTIA 1RQQA 2GSFA 4O0YA 4UY9A 3D15A 3TKIA 3ANRA 3ROYA 4M69B 2F7EE 2YIRA 5HE1A 3PDTA 4O7TA 2YCQA 5L3AA 4H3BA 4R7BA 4DEHA 3QRIA 2NYAA 4X2FA 2BALA 4DGMA 4LV7A 2QOBA 2B9HA 4IWOA 2C6OA 2WD1A 2PZPA 4MYGA 3HV3A 4HYIA 4WNMA 4WNPA 4DEBA 5FXRA 2C0OA 3ZLWA 4S2ZA 3EQPA 3VW8A 3T3UA 2VWVA 3VS0A 4MHAA 3A7HA 5EQYA 3LFNA 1OPLA 4XBUA 2QO9A 5C8MA 4CV9A 2IZUA 3I81A 3UQCA 5D41A 3RZBA 3C0HA 3LFDA 2ITXA 3SRVA 3OWLA 4G16A 4TWNA 2PZ5A 5FXQA 3RGFA 5IEXA 3WF9A 4EZ3A 3IW5A 3GFEA 5E91A 4BCQA 1UKIA 5G6VA 4IAFA 4K33A 3ZEWA 4MBIA 5H8BA 4DFXE 4JDIA 2IF8A 4DEAA 2XBJA 4WO5A 2GNIA 4K0YA 2JAMA 4USDA 2JIVA 5J9LA 2CSNA 4I22A 3WF7A 4C4FA 3M11A 3R7UA 4ANOA 4EHVA 3C4WA 3BE2A 3B2WA 4RWIA 3DQWA 4RC2A 4L7SA 3HMIA 3QUEA 5C9CA 3SW4A 3PJ8A 1U54B 1JSUA 1H1WA 1NXKA 2YCRA 3FE3A 3LCKA 4CLIA 4EUUA 3WILA 3DNEA 4Z16A 1JKLA 2C3KA 4YZMA 1OUYA 3OG7A 4U0IA 4O1OA 5E8SA 4ZTQA 3JPVA 3KRWA 3U6HA 3I7CA 5F94A 3NR9A 3W33A 3ERKA 5FEEA 1OGUA 2EB3A 2PVJA 4QPAA 4KBAA 3E7OA 4XNEA 2OH0E 2YM4A 4FTJA 5HCYA 2XNMA 3QTRA 2ZAZA 3ZZEA 4FT5A 1H01A 2QLUA 4IBMA 4BDCA 4Z9LA 1F3MC 4CFUA 5M4IA 4NL0A 4MD9E 4YJNA 3COIA 4DH5A 5DMZA 4QMMA 3Q9YA 4Y85A 3G33A 1G8JA 3U4WA 3F3VA 4V05A 2J90A 3FI3A 3GVUA 4MXAA 4FKWA 3OZ6A 4C7TA 3F2AA 2C6KA 3V5PA 1XKKA 1YVJA 2OJIA 3E5AA 3ZSIA 3QQUA 4I6LA 3IDBA 1SVHA 4QMOA 2RF9A 4FTUA 4I5MA 4LGGA 5KE0A 4U79A 2YAKA 4AGUA 3VS1A 4IJ9A 4LL5A 4L67A 4AACA 3W0SA 1GZ8A 5GINE 1LP4A 4C0TA 2UZEA 4W4VA 2VTHA 4JG6A 1XH6A 3LQ5A 4RX7A 4ZY6A 3ATTA 3R9RA 5HE2A 4CNHA 1REKA 4I3ZA 4V0GB 4QQTA 3HMMA 3BBTB 2X9EA 3R8UA 2BIYA 4D4SA 3COHA 5AA9A 5CQWA 2HZIA 2B7AA 5HU3A 2CNQA 1M2RA 3H30A 1Q97A 5JQ8A 4ACHA 2DQ7X 4G17A 5HO7A 3DK3A 4R77A 3KVXA 5HGIA 3Q52A 3BRBA 4EC8A 4DHZA 3AC1A 4CRLA 2HY0A 2ETRA 2QURA 2I0HA 1GIJA 4W4YA 1RE8A 3F2NA 4ITHA 5GZ9A 5HZNA 2W1ZA 2ITTA 5EM6A 4O4FA 4YZCA 3OVVA 4BIEA 2CGWA 4CFNA 1QPCA 3W8LA 5L2TA 2CKPA 3MB7A 4NSTA 2ZMCA 1R39A 3TKHA 4IQ6A 3EQDA 3BLAA 5CZHA 4Y46A 4C3FA 4ENYA 4EZ7A 5CU3A 5CALA 1HCKA 4O0UA 5ETIA 5ANGA 2CKOA 2VTLA 1XH5A 4GYIA 3QYZA 3O7LD 2HAKA 4LGDA 3K3IA 3DV3A 5EOLA 5E90A 3KMMA 3FSFA 5HG7A 5DG5A 2GNGA 2UZOA 4FEXA 2C30A 5CNOA 3OOGA 4AXFA 4D2TA 4IHPA 1KWPA 1FBNA 1WBPA 4HNIA 4AZTA 3AD6A 4CZYB 4TWCA 4O83A 4CFWA 3QRKA 3AC2A 3MPTA 4ACGA 3QLFA 4FT0A 3FC2A 4BB4A 3PP1A 4CGAA 2AQXA 4XG7A 3ET7A 5A14A 4G31A 4RJ4A 3R1SA 3PG1A 5DGZA 4G5PA 3TTJA 4DG2E 3VF9A 4DC2A 3I6UA 3PJ2A 4QO9A 4QDEA 2P2HA 2UZWE 3LQ8A 3NUSA 4PY1A 3DLSA 4TYHB 1GZNA 4PTCA 2C1AA 2RFEA 3GP0A 4JS8A 5DIAA 3H10A 3EB0A 3RZFA 2BHHA 3TG1A 3UC3A 2VTTA 2ZDTA 4UMQA 2OIQA 2XZSA 3DLZA 5GJDA 5I5ZA 1H0WA 3RCJA 3SG8A 1W2CA 1V0PA 2HCKA 3PJ3A 4YJQA 3A4OX 1P5EA 4AT5A 2QG5A 1UVRA 3ORNA 3FEGA 2NP8A 2Z7QA 3WARA 3ZU7A 1GIIA 1WAKA 4AZVA 3KXMA 3MPMA 4EWHA 3M2WA 5JFWA 2W1FA 5HNIX 5AV4A 3EQCA 3CSVA 4C3RA 2YACA 1YWNA 4UBAA 3RAHA 3LMHA 1OIQA 3E8DA 4AXAA 1PXIA 2NRUA 1VZOA 3OC1A 4M0ZA 5E1SA 4CTCA 1J7IA 4CCBA 5L2IA 5FUTA 3U6JA 3GFWA 4BTKA 1UV5A 3PFQA 2VTMA 3MH1A 2WTIA 4CV8A 5FRIA 1GZKA 3DKOA 4D0XA 3QQJA 2R2PA 4CVAA 5HCZA 2W1HA 2XK8A 2VX3A 3QX2A 5DNRA 2QHMA 1MRVA 2XEYA 5TKDA 4EH5A 4EH9A 2WFYA 3H9OA 4AA0A 3N4TA 1YI4A 1WBTA 3P7CA 3GC8A 4D2VA 4U3YA 1UA2A 3R7VA 2UW8A 3UBDA 2XIYA 2OJJA 5ANIA 4FT9A 4E6CA 5L6OA 3OEZA 2GHMA 4MQ2A 3EJ1A 4XEYA 2OZAB 3LFFA 2O8YA 5BYLA 3DFAA 4FI1A 4R7HA 3UP2A 1DM2A 1F5QA 2ESMA 4QDVA 4XX9A 3VAPA 5JFSA 4IM2A 2BFXA 1NA7A 2EXCX 3PSCA 3QL8A 4XP2A 5D9HA 2OXYA 3U4UA 3VF8A 5EHYA 5BMSA 4O7SA 2F2UA 4X21A 5AV3A 3KXGA 2SRCA 3R7OA 3WF8A 3PVBA 4KUJA 2IO6A 1UWJA 2NO3A 3QD2B 5CSXA 3VRZA 3F3TA 2XNBA 3R02A 1M14A 2W06A 2XNNA 3DBFA 4GEOA 4FICA 5FBOA 4BL1A 1W84A 3PE1A 4II5A 3I4BA 4X7QA 4YO4A 5F95A 1W8CA 3LJ1A 4L7FA 4IMYA 1SVEA 1KV2A 3EL7A 5DR6A 3AKJA 4EH6A 5F1ZA 3DBCA 4AXEA 3NFGB 3MS9A 3OMVA 3UTOA 5LCJA 4ANSA 3HL7A 4EJNA 3F6XA 3CTQA 2HZNA 2XF0A 4FUXA 3TUCA 3BHHA 3LXNA 5A4EA 5GJGA 3GBZA 4D1XA 5AP0A 4AFJA 3O17A 2OFVA 3AC8A 3KF4A 2UZBA 3C4CA 3V01A 3QWJA 4IAYA 3Q6WA 2OKRA 4HCVA 3RPRA 4AGDA 4U41A 4F9BA 4O22A 1LEWA 5AUTA 2OO8X 4HOKA 4GMYA 4ZSAA 2PULA 3D5VA 2ITZA 4J95A 4MAOA 5CSWA 4NUSA 3FZSA 4TYEA 4R78A 4GVAA 2YJSA 3PWYA 4I1ZA 3CIKA 3Q3BA 2XM9A 4D2WA 3O8UA 5KCVA 4O7WA 3KL8A 4RJ8A 2G2HA 3U9NA 2YCSA 4U97A 4O86A 5IA2A 4R8QA 1YOLA 4W9XA 2I0VA 2J0IA 2R3JA 4BHNA 4C58A 4QP8A 3DTWA 3IW7A 3F7WA 3R28A 3LLAA 2ZMDA 4UWBA 5C26A 3ATSA 5ANKA 4IACA 5I4NA 3TMOA 4I5HA 5JRSA 3JVSA 2G01A 4CYJA 4EH3A 3S1HA 4ANLA 2WTCA 3C4XA 3ZM4A 2A1AB 4NZWB 3W2QA 4H39A 3POOA 4OT6A 1OGYA 2J5EA 2QONA 4MXCA 3ELJA 4K2RA 5IPJA 4KBCA 3R1NA 3VBYA 4YC6A 3A62A 3EN4A 4D0WA 2O0UA 2NNWB 4E6QA 5T68A 4BC6A 4X3FC 3IGGA 3SDJA 4OBQA 2JD5A 2V22A 3L9NA 3QGWA 4IX3A 1KE7A 4MNEA 5H8GA 3QD4A 1UU8A 4RRVA 3TN8A 5EQPA 4GUEA 3EN9A 4YLJA 5EYCA 2WIPA 4B4LA 5M08A 3PIXA 4RBLA 2UW4A 3HDNA 3QU0A 5IUGA 3I60A 2R7IA 3IDPA 1YXXA 2ITPA 4G1WA 3ZC5A 3FUPA 5DRBA 2P55A 3VJNA 3MH2A 4DG0E 5M53A 4YJOA 2R64A 3THBA 4FODA 3RI1A 1K2PA 3AC3A 4EH8A 4WOVA 3FMHA 4DGLC 2W1CA 1BKXA 3DB6A 5AIKA 3IW6A 3CTHA 4ASXA 3LMGA 2J5FA 1O6YA 1OL2A 4HZRA 5EI2A 4YZNA 5BUEA 5CU0A 1JPAA 4NYEA 4YO6A 4C02A 5GZ8A 5AV2A 4BN1A 4UWCA 3DGKA 3ALNA 4NU1A 2I0YA 3D14A 2WOUA 3ORTA 4NH1A 2VO3A 4WUAA 4YMJA 2ZM3A 3CQWA 4DBNA 2QCSA 3OHTA 4CFFA 4FIIA 4PP7A 4QPSA 4USFA 4EHZA 3QA8A 2Y0AA 4E5WA 1WMKA 3QC4A 3WZDA 4CMOA 5F20A 5I3RA 4O0XA 2UZVA 3O8TA 3R7IA 3COKA 4V01A 2JFMA 4IAZA 2QNJA 5DEYA 4OTPA 4YUQA 1NY3A 2B9FA 3CXWA 4YPSA 4IZAA 3LW0A 1Q8UA 1FPUA 4ZY4A 4PMMA 3GNIB 3JR1A 4O81A 3QXOA 4YU2A 1Q3DA 3HRBA 5A54A 2XP2A 5AEPA 3U9CA 4NW6A 2JIUA 3FXWA 5DWRA 2WQOA 4DEGA 2FB8A 4R1VA 5DT4A 3FWQA 4WKQA 3MPAA 3LZBA 5EFQA 3BYOA 2QOFA 3QLGA 2XNPA 5AP1A 2BILB 4Z7GA 2UW5A 4EHGA 1JLUE 2Z7LA 1E1XA 3OT8A 1H24A 2XYNA 4K6ZA 1IR3A 4JBOA 4ZZNA 2V7OA 3D2IA 4I5CA 3UJGA 4DEEA 3UO6A 3DXNA 4JLCA 2B52A 2C47A 3CPCA 5AR4A 4NWMA 4DYMA 5D7VA 4LOOA 3ORXA 5EW9A 4WNKA 5EW3A 4I94A 5AUXA 1P4FA 3EFJA 3GCVA 3G2FA 3NYXA 2PK9A 4P4CA 4IM0A 2AUHA 4QMPA 1IEPA 4RA5A 4RA4A 4EOKA 4A4OA 3IS5A 4WSQA 4A9UA 4F65A 1BMKA 1O6KA 3T3VA 4QEBA 2GS6A 5L6WL 3GCUA 3HAVA 5CF6A 4WUNA 3CQEA 3F5UA 5CSVA 4QYFA 4ALVA 4DN5A 1URCA 2UZTA 4FTIA 4Q9SA 4FEVA 5GIOE 1H28A 2C3LA 4BCPA 4AGWA 4RIWA 5J1VA 2PE0A 4I6FA 4M15A 1L3RE 4C35A 2XNOA 2XRWA 4IFCA 4F7NA 2R3OA 2EUFB 3BQRA 3P79A 4RIYA 4O7VA 2XK9A 2HENA 4GH2A 4ZK5A 4KS7A 3ZMMA 4EOJA 1Q62A 2R3MA 1Q99A 4FRFA 2YIYA 3ZYAA 3BEAA 5L2WA 5DRDA 4IW0A 1HCLA 5C4KA 3WE4A 4WRSA 3FXXA 4RSSA 1OBDA 2PUNA 3HGKA 2PPQA 4TNBA 4XYFA 3DBQA 2OJ9A 3OUKA 3VBVA 5T3QA 5LQFA 4AF3A 1ZOGA 1PMNA 3HRCA 4FOCA 1WBWA 3R0TA 4YLLA 3WF5A 5DYJA 3EN6A 5CNNA 5K0KA 2ONLA 2X0GA 3VS7A 4M0YA 3ID6C 4O7YA 1FVTA 2C6LA 2XK7A 2RFNA 3G5DA 3LHJA 4HGEA 4L01A 4MF1A 5LMAA 3UZPA 4YJUA 1PF8A 2XVDA 3B8QA 3E64A 3R63A 1UWHA 2W1EA 2AC5A 3EQFA 3MGYA 3UZTA 4M69A 3EQBA 4CLJA 1OIRA 3KCFA 4ZY5A 2XS0A 4BDFA 2YDKA 3LCDA 2EB2A 2J0LA 3RP9A 4ZTSA 3MJ2A 5FEQA 3R7YA 4F78A 2RSVA 4L42A 4RFZA 3GU5A 3AQVA 4ANMA 2Y4IC 3PXRA 3D5XA 2W1DA 4M8TA 5KKRB 3RPVA 3R9OA 3TUBA 5CAOA 3DA6A 3SLSA 4D4RA 4PDYA 4BFMA 4ZSLA 3OY3A 4BBFA 1WBSA 1M2PA 4PPAA 1SZMA 2HZ0A 3F3ZA 1BL6A 5IEYA 4TYIA 4U9AA 4LMUA 4K77A 2EWAA 5FGKA 2BUJA 3DDQA 4CG9A 1Y8GA 4MNEB 3TEIA 4AZFA 5K5XA 1H1PA 4KWPA 5IQDA 4ZLZA 4A9RA 4DH8A 5HTCA 3K2LA 1Y8YA 3H0ZA 2ITUA 3FQHA 5L4QA 2LGCA 4FTQA 5CS6A 4BTMA 3FI4A 5JK3A 3PSDA 3KU2A 2FSOX 5KZIA 3P4KA 3OWKA 4ZTHA 1U54A 3ZXTA 4A4XA 4TYJA 5IA0A 4Y95A 4FSYA 4IB0A 3FZ1A 2VRXA 1J1CA 5EHOA 5ETCA 2VO0A 4JJRA 3UVRA 5HIEA 5KHXA 4YZBA 3DXPA 5JMSA 2X4FA 2YJRA 3C9WA 4DTBA 3W2CA 3BHVA 5E1EA 4EKKA 4DGNA 3EQRA 4G6NA 4YJVA 4KKGA 5B0XA 2Y4PA 3ZLYA 2Y6OA 4FKOA 5CEPA 5LVLA 3HA6A 4TRLA 5AR5A 2OSCA 5EYMA 3ZDIA 2C1BA 3LOKA 2OF2A 5A6OA 5LXMA 4F1OA 2W5AA 4RLLA 4EWQA 1WBVA 3QQLA 2X8DA 3RAIA 5K4IA 3KGAA 4JI9A 2VTOA 2YM3A 4IJPA 4CZTA 2BPMA 1OUKA 4ZAUA 4JX3A 2NRYA 1V1KA 3VUDA 2FA2A 3UGCA 5BVWA 3RKBA 3UIXA 4O1PA 4PDPA 4RJ6A 2AEGA 5ANJA 3KA0A 5HVKA 1Z5MA 1W2FA 2OF4A 1UU7A 3LJ0A 3PXKA 4GU6A 4IZYA 1APME 4RJ7A 3NVMB 5AUUA 5JQ5A 2RFDA 1XJDA 5C03A 3LFSA 3Q04A 4XRLA 3A7GA 2CKEA 2X7GA 1PXKA 4Y83A 5KMNA 3G9NA 5FDPA 2V7AA 3NNWA 3NWWA 4N0SA 3QWKA 4BCNA 2PZYA 4IB5A 4F6SA 3ACJA 3EFKA 5BX0A 4AZSA 2CJMA 3ORIA 2PZRA 2XIXA 5DBXA 3V6SA 3KN6A 1OVEA 4XHKB 4XP3A 3RNIA 3UOKA 4F08A 1T46A 4QMNA 1PKGA 2DUVA 3GU8A 1SNXA 4V0GA 3PY3A 3OY1A 4R1YA 5J87A 4TT7A 5FM2A 3ETAA 4ZMFA 3G6GA 4J71A 3HMOA 2QKRA 2HOGA 3IKAA 5E9EA 4FOBA 3TACA 2J0JA 4QNAA 4FV7A 1YXSA 3WE8A 4BCHA 4BYJA 3R01A 5HTBA 1Y57A 2VWXA 3ALOA 2CGUA 4LRMA 3CE3A 4R7IA 3NMUF 3E3PA 3FY0A 2HXLA 4IVBA 4RFYA 5AAEA 4F0FA 1ZOHA 5IUHA 2V0DA 4E4XA 4HVIA 5AADA 4MNFA 3KREA 1ZYDA 3LXLA 4X3FB 2YA9A 3DOGA 3L8XA 3PA4A 5AIRA 1NVRA 4MWHA 1XBBA 3JY0A 3CP9A 4XV2A 4L53A 2CKQA 3FI8A 2VN9A 2EVAA 3NNUA 3W10A 2YEXA 4LOQA 4RIWB 5BMMA 2P3GX 2YDIA 3PJCA 4RWKA 3AOXA 3ORMA 4U40A 1OMWA 5HO6A 3HV4A 5K5NA 3QZHA 1YRPA 4QMVA 2I40A 3RBWA 4JIAA 3P08A 4FTKA 4AAAA 5IMXA 4LDTA 3G6HA 1AGWA 4IXPA 5IG1A 2C4GA 4LG4A 5A6NA 1PXMA 1ZYSA 4I41A 5JZNA 4ZS4A 2HW7A 4EUTA 5JZJA 1P14A 3HUCA 4BWXA 4ANBA 2ZM4A 5A4QA 3DAJA 4UMTA 3JUHA 1TVOA 3LFBA 3FQSA 4FV6A 4I0RA 3ZHPC 3PY1A 2VD5A 4FKUA 4KIOA 3O51A 2IZSA 3OWPA 1IA8A 2XUUA 3KXZA 2YERA 4IAKA 4TKSA 3PPJA 2PVHA 3GC7A 2WMXA 3TCPA 4HGSA 3NYVA 5HVYA 1YKRA 4TYHA 3VRYA 4FMQA 1STCE 4FKJA 4I4FA 3GU4A 2C6DA 2UVZA 2Q83A 2VWIA 3BHUA 2BZJA 5LWNA 2OIBA 2UW7A 4F9CA 4DHIB 2VNYA 2AC3A 4GJ3A 3TIYA 4L46A 4DCAA 3FLQA 4JAJA 3BYMA 4PP9A 3VUMA 1PMVA 1ZWSA 3O2MA 3ODYX 3UZRA 2ZJWA 3MJ1A 2ZV2A 4EQUA 5KMIA 4U81A 2E9VA 1O9UA 2REIA 2ZV9A 4K18A 4DDGA 1OL6A 4DE4A 3S3IA 1Q5KA 4N57A 1ATPE 1KE5A 3TI1A 1H07A 3MY1A 3CCNA 3ZRKA 2WQMA 3ZRMA 1A9UA 4YURA 3TKUA 4G3FA 3ORKA 1YOJA 3OF0A 4ZIMA 4P90A 3E93A 3BLQA 3KCKA 2W4JA 3ENHA 4FG9A 5HBEA 4EYMA 3H3CA 4E20A 3EOCA 2YIWA 3D7TB 2QOCA 3P7BA 1GY3A 4XOYA 5IH4A 4FV4A 2YIQA 4KIKB 3VS3A 3DJ5A 1UNHA 3KRRA 1YXUA 4U43A 4FK6A 4FZAB 3FBVA 4PL4A 4U7ZA 4U45A 5D12A 4EK5A 4IDTA 4R6VA 4DH3A 2A2AA 4YJRA 2NPQA 2VTJA 5M07A 2OWBA</