3EQFA

X-ray structure of the human mitogen-activated protein kinase kinase 1 (mek1) in a binary complex with k252a and mg2p
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
343
structure length
314
Chain Sequence
ELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCSTIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 314
sequence length 343
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2008-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3eqfA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3eqfA01
1AQ1A 2PMOX 1P5EA 4QTAA 4RBLA 3TNQB 4Z16A 3VBQA 4KABA 1NVQA 2IW8A 3MBLA 4Z55A 1PKDA 5EM8A 4B8MA 5D7VA 5E8WA 3VRZA 3I4BA 3PWDA 4C4FA 1ZMWA 3OXTA 4AQCA 2O64A 2YITA 4NUSA 5AIKA 3ZCLA 2QOKA 2CGWA 1IAJA 3KCFA 1NVSA 4IVBA 5HVJA 2R3FA 2I6LA 3R7EA 2EU9A 4OBOA 4H3PA 2FSTX 4CEGA 1GZKA 3ITZA 4ZS0A 1K2PA 2WZJA 1FPUA 2WKMA 3LCSA 4FL2A 4N6ZA 5HO6A 5L6WL 4ZY6A 2B9FA 3VBWA 4EJNA 3UJGA 4IHPA 3QRTA 3JXWA 2WOUA 4LMUA 4UWBA 4FIFA 1UA2A 5J1VA 3DKOA 2ITQA 3MV5A 4EH7A 5JT2A 3CTHA 3Q52A 3V5PA 4CFUA 5K9IA 4FT3A 5DI1A 4L3JA 2B53A 4FNZA 4PPAA 2C3IB 2NPQA 3NX8A 5F9EA 4CFMA 4DCAA 3SHEA 3DQWA 4LOQA 3BQCA 1Q4LA 4S2ZA 3LCKA 2V55A 2ITZA 4XG2A 4DH7A 3CPBA 3C1XA 5LMKA 4FEUA 4WRGA 1XH8A 5IKWA 4DBXA 3PXZA 4FV6A 3LFBA 4MXYA 4S30A 4Y8DA 2V0DA 2FB8A 2CLXA 2FSMX 5HLPA 4QTDA 5CI6A 3MSSA 1YHWA 3QZHA 3MPMA 2B4SB 3KVXA 3GUBA 4DFYA 3P86A 2HY81 1TQMA 3UMXA 1QPJA 1H27A 5EQEA 2CKEA 3SG9A 2UW9A 3L8VA 2EWAA 4FG9A 2JDOA 4D28A 2XIZA 2JDSA 3E7VA 4MWHA 5CSVA 4YJNA 2BZKB 3AMYA 2DQ7X 3MPTA 3F82A 4J98A 1JQHA 3ZRMA 2PVFA 5C27A 1Y57A 3KRRA 2XM8A 4G3EA 5B7VA 3Q6WA 1I09A 2AYPA 4KA3A 4DH8A 3FZOA 4L68A 1PXNA 1LPUA 4WKQA 3RK9A 3UO4A 2Z7LA 1R0PA 2BILB 3CCNA 4E4LA 4FV9A 3VUMA 2EXMA 5KMKA 1OPKA 3NYOA 3A62A 2RG6A 4YJOA 4O0VA 3WF8A 3K2LA 2F2UA 4CGAA 2WQMA 3DB6A 2BRMA 4D5KA 1FVTA 2R3OA 4IWOA 3C51A 2XNPA 3I5NA 4LOPA 5DN3A 4JAIA 2X39A 3P23A 2UZLA 4IB0A 2UW5A 4OGRA 4GS6A 4PNKA 3COKA 3F2RA 2H9VA 4H36A 4CFVA 4J99A 3HKOA 5D7AA 3I81A 1RDQE 3OCSA 4DYMA 5IZFA 1OL5A 3FQSA 4YTCA 4U97A 3IKAA 3ZEWA 1V1KA 2VTHA 5HNGA 1LP4A 3AC1A 4K0YA 5EKNA 2CGVA 3R71A 2YERA 2GNIA 3KGAA 3BE9A 4XV9A 3UZPA 3W2SA 5CASA 1AD5A 3AGMA 3FMNA 4Y85A 5E91A 2Z7RA 4CMTA 4H05A 5HQ0A 1M2RA 4WBBB 2R3NA 4QMPA 3FMLA 4YZDA 5EYKA 4J71A 3A2CA 3DDPA 4ZJIA 1OKZA 4ZTRA 1YW2A 3RWQA 4BDEA 1UU7A 3ZXZA 1Y6AA 4RFYA 4F64A 2ETKA 1TQPA 4FEWA 4RVMA 4RX5A 5AV0A 5BX0A 4E3CA 4XBUA 2IZSA 3KQ7A 1BI8A 4CRLA 3DBDA 2GS6A 3ALOA 4MXCA 3QTRA 2HELA 4XH6A 4PMSA 5AM7A 4QQTA 3DB8A 4QTBA 5DR9A 3TZMA 3E5AA 4YR8A 1E1VA 2J90A 1BYGA 2FO0A 3I1AA 5AUVA 1Y91A 1JSTA 4F65A 3BX5A 3FDNA 4DEEA 4TN6A 2EXCX 2IVSA 2WTKC 2ZV9A 5BVWA 3NMUF 3PA5A 4YBKA 3W2CA 1MRUA 2EB2A 5CWZA 5FTGA 2IZTA 3DBFA 1VJYA 3GFWA 4OTFA 2R3GA 3CY2A 5IH5A 3FMMA 3MFSA 4KSPA 4RA4A 4FV8A 1FGKA 3IDCA 1YWRA 3F3TA 5HHWA 3T9TA 4EOMA 2XZSA 4IB5A 3ORLA 1XQZA 4N6YA 3PIYA 1GIIA 5CVFA 3BLQA 5M55A 3UP7A 4YMJA 3G9LX 2DUVA 2BAJA 5FWKK 3BCEA 3CTJA 4FSTA 4F63A 5A4EA 4CKRA 2WELA 2W96B 3LXLA 3V5LA 3ZOSA 4GK2A 1WVWA 4BI1A 3EL7A 4FZFB 3QF9A 5IQBA 1FVVA 3MB7A 4RFZA 1H1QA 5M4IA 2XYNA 3G6GA 1ZOEA 3U6HA 4U9AA 5AV3A 2QI8A 4BR3A 1UU9A 2F4JA 3ZM9A 1ZY4A 2QODA 5CALA 3CQUA 4APPA 1YRPA 3KULB 3LQ8A 3R21A 4HYIA 1R0EA 2IPXA 5KMIA 4GKHA 3CBLA 4YPDA 2WD1A 1YHSA 4CV8A 3DJ7A 4JNWA 5CAQA 3KF4A 4RQKA 3UMWA 4RWIA 2F57A 2R3JA 4TT7A 4OT6A 3VS2A 4F08A 3NYNA 4U40A 2ITYA 4JQ7A 2O3PA 3HMNA 4KKEA 4DLJA 4HPUE 5AP6A 4R77A 2BHHA 1WAKA 4FKVA 5M09A 1GNGA 2E2BA 1R3CA 2WQEA 4I93A 3AD6A 4BCGA 2QOFA 2OLCA 1PY5A 3HAMA 4UMQA 3VW8A 4R3RA 5LCKA 4CRSA 2XJ1A 5E8XA 4PP9A 3V04A 4CFXA 4I24A 4EWQA 3U51A 3B2WA 5HICA 2VV9A 5BPYA 2QOHA 3LVPA 2G1TA 1CSNA 2BPMA 5J5TA 2F7XE 4AE9A 5M4CA 4ACGA 4PL3A 2CHLA 4Y46A 1H0VA 2XNOA 4TZRA 2C3KA 3FI2A 4FYOA 5E4HA 5DPVA 5AUYA 4XV2A 1G8AA 4C4EA 1H08A 1YDSE 4BF2A 2G2FA 3E8CA 3Q9YA 2JDTA 3AC5A 4D0WA 2HWOA 2QOCA 5E7RA 4GT4A 5JH6A 5JQ5A 2XKEA 4MQ1A 5GZ8A 2CGUA 3F7WA 1CDKA 2YAAA 3IW6A 3ACJA 2UVZA 4YC6A 5A4QA 4O7TA 4WUAA 3TJCA 4I1ZA 2I40A 3Q9XA 4GYGA 5L6PA 2XK7A 1YOJA 1U46A 5GHVA 3ZC5A 5LCJA 2C69A 5AR2A 5LARA 5JQ8A 3HV6A 4BI2A 1H1SA 4ID7A 1ATPE 4BYIA 5J1WA 2CKOA 2YFXA 2OH0E 5BYYA 3HL7A 1H1WA 1GZ8A 4GK4A 3WZDA 3RM6A 3CQEA 4DHFA 4EWHA 5K5XA 3KULA 5L2WA 4IDVA 3RAIA 5CNOA 2JIVA 4EEVA 5GIPE 2C3LA 2F7ZE 3RZFA 4QMSA 2X8DA 1WZYA 3ID6C 2ZV8A 1NXKA 3D15A 3ZLSA 5CQUA 3NNWA 3R83A 5FGKA 4U0IA 2BDWA 2PTKA 1PMEA 5DNRA 4WRSA 4FKUA 3VS5A 4DFNA 4GKIA 4LMNA 5C03A 3CPCA 5HE2A 4PMMA 4BBEA 3D5VA 4U3YA 4YZCA 4DCEA 5E8SA 3TKUA 3UOJA 2OSCA 4FT0A 3D9VA 3LQ3A 1H0WA 4L00A 2WTCA 3QTUA 3RCJA 3NIZA 4AS0A 1WVXA 1SMHA 4JBVA 4X2GA 2W5AA 5IEYA 3VULA 1SZMA 2C6MA 4WD5A 4MCVA 4RJ3A 4UMTA 2CMWA 2J0KA 3GCPA 4JR7A 4DH1A 2RSVA 1U54A 3E3PA 4ASEA 3LM5A 5B2KA 4CKIA 1OVEA 2YHVA 1JAMA 3OY1A 4NTTA 5ITAA 4FKLA 4E6AA 3R30A 5GJFA 5JSMA 3IK3A 1ERKA 3UG2A 1GZOA 4QP3A 3CSVA 5I3OA 3H3CA 1JKTA 5CEQA 4BBFA 4ZEGA 4FKOA 4TNBA 5KMMA 4GH2A 3EQCA 2CCHA 3FMKA 4UXLA 5GZ9A 2C5VA 4G3DA 3RPRA 5BUIA 4RC3A 2UZBA 4MYGA 4E4NA 4AW5A 5AV4A 2XNEA 4FI1A 5L2TA 4F1MA 1Q8WA 4NWMA 5JEBA 1V0PA 4U42A 1KSWA 3LLTA 3BLRA 3L8SA 1X8BA 4FTMA 4UEUA 4ITJA 5HIDA 5AAFA 3TG1A 5AR8A 1ZOGA 4FF8A 2Q83A 3DGKA 1JKSA 4F1OA 1PJKA 3QQJA 2XK6A 1XJDA 3FHRA 5K0KA 4MD9E 3JS2A 2PVYA 2WEVA 4KD1A 5EOLA 3KMUA 4ZTQA 2C0OA 2P2HA 3GEQA 1JLUE 5L2QA 4D2TA 5D1JA 2XCHA 2PVLA 3BYOA 3H30A 5AUXA 3ZEPA 4QPSA 2WMAA 5DYJA 1B39A 3OW4A 4L01A 2A19B 3KC3A 4BIDA 2VGPA 5HBJA 5HNBA 5J8IA 4ACHA 3PJ8A 5LOHA 2X9FA 3ORKA 4X3FB 3WF6A 4C02A 2CPKE 5HU9A 2X8IA 4MAOA 4FSMA 1YKRA 4LGHA 5CY3A 4P5QA 4JG8A 3VF8A 4AGUA 5CF8A 1F0QA 2GS2A 4JX7A 4G3GA 4YJRA 3GI3A 3C4XA 4EBWA 3WILA 4KB8A 3GCUA 5EYCA 5J95A 4E4MA 4IFGA 1TVOA 2GPHA 4ERKA 4QMMA 3ORIA 4AOTA 4C37A 2OJFE 4L42A 3A7FA 5EW8A 3ULIA 3GC0A 5K5NA 3FLNC 3NVKI 3EYGA 3EQIA 5EHOA 3Q9ZA 4M0ZA 1B6CB 2EUFB 3FLZA 4F9AA 4O2PA 2WQBA 4YJPA 2XNMA 5A9UA 3P4KA 3VHEA 2XIRA 2R3QA 5CTPA 4JLCA 3QCSA 2VX0A 3BYMA 3LE6A 3QRKA 2J0MB 4KS7A 4RIYB 5JFWA 3DU8A 3QUPA 4DTBA 4MHAA 3ZO1A 2W1ZA 4HYSA 2VWBA 3K5UA 4FSYA 4ZSJA 3R9HA 4DGOA 4BCMA 4DG3E 4M13A 1YXVA 3AGLA 4I6FA 3ZFXA 5I4NA 4ZZNA 1XHAA 3OCGA 1H24A 5L2IA 4BDGA 4JBOA 3UPXA 2CGXA 1OIYA 3OBJA 4QMTA 3S3IA 3CC6A 3Q4TA 4Q9SA 4EH8A 2IZUA 4RVKA 5DWRA 1OKYA 5IUHA 4NL0A 4O82A 1O6LA 2ESMA 2ZYBA 4CNHA 3O23A 2HZ0A 2P3GX 1OZ1A 3OF0A 1RJBA 3R22A 1IA8A 4I5HA 4JIKA 5HO7A 2R3KA 3E62A 3VJOA 3D94A 1SYKA 3E92A 2OKRA 3FLYA 4OTQA 5CSXA 4QMXA 3C0GA 3GC9A 3QBNA 4NTSA 2JDVA 3RAWA 5A4TA 3VS3A 4GFOA 4QQCA 3THBA 4WG3A 3ZBXA 1CKPA 4AGWA 4C0TA 1GJOA 4V0GB 3UNKA 5CX9A 4FTOA 4EH2A 4RIXA 3U6IA 2PU8A 3GVUA 3HLLA 4H3QA 5JK3A 2GQSA 2G9XA 4TYIA 4X3FA 4D1ZA 4G6NA 1Q8YA 2F49A 3AG9A 3L9LA 3WZUA 4C4JA 4L9IA 1G3NA 3MW1A 4TWNA 4B99A 2VGOA 3II5A 1IEPA 4NM7A 3TN8A 3O0GA 1LEZA 4GRBA 2VO6A 5KCVA 2PZPA 4MD7E 4FKJA 2BIYA 1NT2A 3FL5A 2J2IB 3R63A 2DWBA 1OKWA 2VTOA 3IONA 3JPVA 2J9MA 4MXXA 3EZVA 3OWLA 4OUCA 4QP4A 4ALWA 3LFQA 4ENXA 4N4SA 2VD5A 4RC2A 1VR2A 2C1AA 4TKSA 3QTIA 5FLFA 1WBSA 4EKLA 3NNUA 1T45A 5A4LA 1YWNA 4E73A 3LKMA 1XBBA 4DN5A 2B9JA 3C9WA 2ZB0A 2RF9A 4FSNA 3QUEA 5IQCA 3U9CA 1H4LA 3OD6X 3AD4A 3SDJA 5A3XA 4FTAA 4YTIA 3TV4A 4A7CA 4O7RA 1HOWA 4CG9A 1IA9A 3FMDA 4H39A 4HCUA 5C26A 2XCKA 1FMKA 2C6KA 4LL0A 3ZUUA 2PK9A 4BDDA 3VUTA 4W4WA 4JDIA 4XG8A 4F9BA 5AR4A 4UXQA 5J9ZA 4FUXA 4ZLYA 3G33A 1Q61A 4JG6A 1PYEA 4XP3A 4FNYA 5LMKC 1OL6A 2CNUA 4GJ3A 4D9TA 3QGWA 3OS3A 4X2NA 4AU8A 3M42A 4CYJA 5KO1A 1KOBA 4TYHB 5IMXA 1WMKA 5AP7A 3V3VA 3NYVA 3R7OA 4FL1A 5FM2A 1H25A 4J7BA 2CKQA 2VAGA 3QXPA 3DAKA 2V7AA 3K54A 4V0GA 1BL7A 3VN9A 5LVPA 3RBWA 2QURA 4KWPA 2PMIA 4DH3A 4O0YA 2PUUA 5K0XA 2F2CB 5I5ZA 1J7LA 1FINA 1Q97A 3CGOA 3G9NA 4ANBA 3MY1A 5A6NA 3V8TA 3EB0A 3FEGA 4G5PA 2PUNA 5AFVA 5GIOE 3C5IA 4CQGA 4HNFA 4DEDA 4GUBA 4FKSA 5HCZA 3OY3A 1W98A 2B1PA 2W1EA 3UC3A 2ZDUA 5EW3A 5BVDA 4MNEB 4R6VA 4FTCA 1UNHA 4UX9A 2UW7A 3EFJA 4AA4A 4BCIA 3FMEA 3UYTA 3FPQA 3C4EA 4AN9A 4O1PA 2R2PA 3F9NA 4IAZA 4JDJA 3SG8A 4O22A 2I0VA 1M14A 4OAVB 4G9RA 3GOPA 1DI8A 2ONLC 3D7TB 1R78A 3AC3A 3PLSA 4QMWA 4R5YA 4YC3A 3U4UA 4D55A 4QQ5A 2PZ5A 1YXUA 1WFCA 2OF2A 3OROA 3UTOA 4C36A 3LFAA 4DC2A 3QTWA 3KN6A 2BTRA 4N70A 4BYJA 4D58A 3OEZA 4AZSA 3DZOA 4DAWA 3A8XA 2UVXA 3CIKA 2GS7A 4FNWA 4A9SA 4EH6A 1OUKA 4PMPA 3SGCA 3R7GA 2A0CX 3BU6A 5AP3A 3QQUA 2UZDA 2ZB1A 4HVDA 2IG7A 2Y6OA 5T3QA 3FMHA 1W0XC 4XLIA 4DFLA 1L3RE 4JOAA 3M11A 4YLJA 3KL8A 5CT0A 2CNVA 3HMOA 4D2RA 2E9NA 3LFFA 4HVHA 4YTFA 1LUFA 1WBTA 4E20A 4JT3A 2E9UA 4A4OA 4BTKA 5F4NA 4KIQA 4LGDA 3LCDA 3LXKA 2VTLA 3GU4A 3A60A 1LR4A 5JFXA 3ZSHA 4A9UA 3BV3A 2DS1A 4O6EA 3TTJA 4L43A 3T9IA 4R78A 1BX6A 1UWJA 3EMGA 4ZMFA 4MEDA 3SW7A 4AZVA 5IDPA 2WTVA 3PDTA 2XNGA 4YO6A 4F70A 3BPRA 2UZUE 3U9NA 2VTMA 1YQJA 2PMLX 4FKRA 3BHUA 2QLQA 2UW6A 3N9XA 2YWVA 2B7AA 3NIEA 3RGFA 3GQIA 4YLLA 3R8UA 4CXAA 4F6UA 5KBRA 1PRYA 1IASA 4MNEA 4CCUA 5HX6A 5IUGA 4O96A 1SVGA 2HYYA 5E8TA 5M08A 4YO4A 2X2LA 2GQRA 3R7IA 3BZ3A 3ZO3A 2JIUA 3K3IA 4ZJJA 2ZAZA 1Y8GA 3F5GA 1OB3A 3BGPA 5FRIA 1M17A 4F9YA 3ZLYA 3IW4A 4AF3A 4X2JA 3D7TA 3IECA 3VC4A 4D4YA 4MTAA 3QRJA 4FIEA 4W8EA 3UIMA 2VO7A 1JKKA 4E8AA 5I9WA 2ZJWA 4O7LA 3MFRA 4FSRA 1M52A 5FDXA 2W1IA 4TPTA 2XMYA 3KA0A 4KKHA 4KUJA 5DR6A 2P55A 3NCZA 3R02A 3UYSA 2JITA 4UY9A 4KAOA 3MI9A 4FV7A 4O38A 4C33A 1PXIA 4IZAA 1RW8A 4FKIA 4BHNA 5CANA 4QYYA 3BQRA 2NP8A 3ZFYA 5M44A 3FZTA 3Q32A 1Q5KA 3LIJA 4G6OA 4NM0A 4EHGA 4P2KA 3E8DA 3OP5A 4FTNA 4DEAA 4QPMA 3LMGA 2IZRA 1GIJA 4RZVA 5CVHA 5CEOA 5EI8A 3JY0A 3GQLA 2JEDA 3FZ1A 4KRDA 3RPOA 4C34A 1URCA 2VNYA 3JYAA 2ITWA 3SVVA 4FUYA 5I9VA 1MQ4A 3ORXA 2VRXA 3IOPA 4G9CA 4TTHB 3BWJA 5BMSA 4DT8A 2R3RA 3NCGA 2QNJA 2V62A 3Q04A 4MK0A 4KIKB 2Z7SA 4H1MA 2J7TA 5I9ZA 5H8EA 5KMOA 5HU3A 2PMNX 3EN5A 5CSHA 5CAPA 3D4QA 5DR2A 3AD5A 4D1XA 5LVOA 2RG5A 4XBRA 5FTQA 3PXQA 4D2SA 2IVUA 3F2AA 1PMVA 2C5OA 4RFMA 4R1YA 3VBXA 4GMYA 4AACA 3CJFA 3GCQA 1KE5A 3CXWA 4M67A 5IPJA 5AV1A 1FVRA 2OXYA 3NWWA 2XRUA 3DNEA 2Y8OA 4RC4A 4F7LA 1J7UA 1AGWA 4FKWA 3HX4A 3VUIA 2VWUA 4DFUA 1H1PA 3EFWA 5I3RA 3Q60A 3QD2B 4C61A 4O1OA 2QR8A 5DRBA 5E90A 5EM7A 5HVYA 5IA2A 1UWHA 2R0UA 3OMVA 3F7ZA 3PE1A 2QR7A 4DTAA 3ENHA 4ITIA 4RJ6A 4XP0A 5AAEA 4RRVA 4Z7HA 4ZLOA 5F95A 4CZYB 3QRUA 3VS0A 3ZTXA 2OZOA 4S33A 2HAKA 4EH3A 2HIWA 2WMRA 4G3CA 3HV5A 3ZHPC 4BRXA 3JVSA 3NUXA 4C3PA 3C50A 4O0XA 2GTNA 3BE2A 4K33A 4F9CA 1W7HA 4HVGA 3L8PA 4RGJA 4XCUA 2I1MA 2W9FB 1O6KA 3U55A 4F7SA 1XR1A 3R9OA 3DV3A 1PXKA 4YZNA 5HG8A 2BRNA 3DK3A 2XK9A 4GV1A 1XH5A 1XH4A 5DFPA 3TZ9A 4C59A 2JBOA 2BZHB 2UUEA 1VYZA 2X6EA 3IO7A 4HYHA 4PPCA 5I9UA 4CCBA 4FKPA 4OR5A 3O17A 3MTLA 3WF9A 4QNYA 4XG7A 4EOOA 4J97A 3ZLXA 3EWHA 3PP1A 3UQGA 2C4GA 2C47A 4DH5A 3EQRA 4EK3A 3VUKA 1KV2A 2F9GA 3COHA 4PDSA 2VNWA 5IQIA 3A7HA 2ONLA 1STCE 2OO8X 3EN9A 3HV4A 4JR3A 2VX3A 4KRCA 5AP5A 4A06A 3LPBA 3ORMA 3SA0A 4KIKA 2EVAA 5CEPA 4IB1A 3F88A 4C3FA 4AZFA 5B2MA 5KUPA 3GCVA 5LVLA 4EHVA 5ACKA 3QLFA 3FLQA 4IM0A 3PYYA 4IZYA 2PUPA 2GNJA 5IMEA 4WG4A 5TT7A 3L9PA 3WYXA 3E3BX 3L8XA 3VUGA 5HORA 3S4QA 2XIXA 4K8AA 3S00A 2E9PA 4TWOA 2W05A 2QKWB 3G5DA 4LG4A 2XIYA 2C6OA 4NKAA 1REJA 4YUQA 3H4JA 4G3FA 2GU8A 2WMVA 2CKPA 2R3IA 2QG7A 4FL3A 1OM1A 2J0LA 2PVNA 4ZXTA 4DEHA 2V22A 5IQFA 2QLUA 3CGFA 3R73A 4DEIA 4ANMA 2VTIA 3RNYA 4FC0A 4Q9ZA 4FTIA 4M84A 4EOKA 3FXWA 4OW8A 3MH2A 4LI5A 2JAVA 4JRNA 2YIXA 3Q5IA 5J87A 5KKRB 5LXMA 3PA4A 2B55A 4IAAA 2Z02A 2XK3A 3AT4A 3QGYA 4FA2A 4AOIA 3TUBA 5CEMA 3FQHA 2QVSE 3KKVA 3VS1A 4DE4A 5ETFA 4JIAA 3UOHA 3PY1A 4DGNA 4IX4A 1OITA 4FIGA 3UP2A 4EOLA 1UNLA 4EOPA 5HO8A 3PUPA 3RTPA 3T8OA 4IWPA 3Q3BA 4M68A 5AP4A 5FXSA 4AUAA 4JXFA 4M3QA 4ERWA 2JKOA 2YIQA 2WMBA 2REIA 3OXIA 4W4XA 5ANIA 4GIHA 4O6LA 4HPTE 3IDBA 2X1NA 3QYWA 5AP2A 4PRJA 4PL4A 3VBTA 3VS4A 5EKOA 3UIUA 1H26A 3VVHA 4FSZA 1P2AA 3HV7A 3PFQA 2B52A 4FTJA 5ACBC 4O7VA 5EH0A 2CNQA 3H0ZA 3C0IA 5J9LA 2AUHA 3Q96A 3OWPA 5ANGA 3DY7A 3TDVA 3Q53A 4BDHA 5HTBA 2GQGA 2W0JA 3PXRA 3ZFMA 4BL1A 4F0IA 3MS9A 3KFAA 5FBOA 2O63A 3AT3A 3JVRA 3LJ0A 3OBGA 3F61A 4IM2A 4BI0A 1H28A 1R39A 5JGDA 3R01A 3FI8A 4FTTA 4IC7A 3K3JA 3ZBFA 5KMNA 3ZU7A 3F66A 3GXLA 4GU6A 5BUEA 2RFSA 2XBAA 4MVFA 3V51A 3F3UA 5L8JA 4LV8A 3O96A 2IW9A 3TWJA 2R4BA 2VTNA 4YSJA 5JMSA 4MWIA 3R04A 5AIRA 3KU2A 3POOA 2YM4A 3NZ0A 5C01A 3PG1A 3NR9A 3GP0A 3NUYA 1W84A 2W1CA 2O8YA 4WIHA 1GIHA 3HYHA 4YHFA 4XG3A 3RINA 2X4FA 3W2QA 5IQHA 3IW8A 3CS9A 3H10A 3PVWA 3KRLA 3OTUA 3BBTB 3REPA 1APME 3N4VA 3COIA 3L1SA 3PSCA 4BDAA 5CENA 3RMFA 1OGUA 5EOBA 4A4LA 4C7TA 5JGBA 4EOSA 4S34A 4EI4A 3CR0A 2OJ9A 4AT4A 4PTCA 3U8WA 4PV0A 4O21A 5BUJA 5J79A 4F9WA 4PL5A 3ORPA 4EUTA 1Q8UA 3CEKA 3RALA 4R7HA 3D5XA 4FODA 4PPBA 2XNNA 4RMZA 4RJ8A 2VO3A 3RWPA 4ITHA 1RE8A 2ZV2A 3EHAA 4EONA 1DM2A 3WE8A 2BZIB 1KE7A 4YTHA 3QYZA 1QPEA 3WZKA 4QNAA 2PVRA 4S32A 2VUWA 2R3LA 4BCNA 3PZEA 5IISA 5CAVA 2WEIA 4UZHA 5AMNA 5C8NA 3EKNA 5CS6A 2YCQA 3MIYA 4KIOA 2VU3A 4FTQA 4FTLA 4MXAA 5DGZA 2YZAA 2I0EA 3OW3A 4J53A 3FYKX 5DRDA 3RM7A 5CYIA 4DEGA 4UMUA 1DS5A 4U3ZA 3FSFA 5DHJA 3NS9A 2YISA 2R3PA 1U5QA 4XHKB 3O8TA 4BICA 3A7JA 4X0MA 3E8NA 3R6XA 4X3FC 3Q4ZA 3PVBA 4BDCA 3FWQA 1A06A 1XH6A 1PYXA 2XIKA 4PWNA 1S9JA 4NEUA 4Y72A 3MB6A 1F3MC 5EK7A 4FE2A 3C0HA 2BDFA 1JWHA 2ITVA 4GG5A 4CTCA 4O91A 5C1QB 1NW1A 5C9CA 4A9RA 4FYNA 3LFDA 3M1SA 4KBCA 1OBDA 3NPCA 3R1YA 4AGDA 4U44A 4QMLA 4B0GA 3NUAA 3IPHA 4BTMA 2UZTA 4P4CA 2Y0AA 5AUUA 2PUIA 3RHXA 4RT7A 5E8VA 4EHZA 3ULZA 2BROA 1ZXEA 3UNJA 4ACCA 4ZOGA 4AA5A 4IX6A 3FV8A 2BALA 4ASDA 2Q0NA 2PZIA 2W5HA 3RZBA 1YHVA 2G15A 3QQKA 5CI7A 4EK8A 5KE0A 4DFXE 4CMOA 2I0HA 2YN8A 2PE2A 5BVEA 2Y6MA 3UQFA 2W1DA 3SRVB 2BRHA 2VTRA 3FE3A 4C2VA 2XB7A 3SV0A 4EC8A 5EFQA 1ZZ2A 3C4CA 4RIWB 1PXLA 3LJ1A 3FXXA 2XEYA 4GT5A 4UV0A 2FSOX 4E6DA 2PL0A 4FT7A 2W99B 4RWKA 3EQBA 3PPKA 4W9WA 4IB3A 5HG7A 3QL8A 5L6OA 3HRCA 2YIWA 3W8LA 3B2TA 2C6IA 3SAYA 3WIKA 2X7FA 3LCOA 1U5RA 4FG7A 5FEQA 5D41A 5ETAA 3FUPA 4FVQA 4I4EA 3DFAA 2YLEA 3GENA 4H58A 4G34A 2ZM1A 3EL8A 3EYHA 5HE1A 4JL9A 5ANKA 5HCXA 4YZBA 3W2OA 5KX8A 2C0IA 4FSWA 5CU2A 3E88A 4TWPA 4BIEA 3QCYA 4ACMA 4D1SA 5C4LA 4FK6A 2NRUA 5EDQA 5IQEA 2QQ7A 4GEOA 4QMOA 3EQFA 3EZRA 3F3ZA 4PNIA 2ETMA 5DIAA 5TE0A 4DLIA 5JZJA 5H3QA 1JOWB 3ATSA 3DZQA 3V5QA 5E9EA 3TUDA 2J5FA 4C2WA 4PP7A 3OUKA 2RFEA 3HMPA 1H8FA 4XMOA 4EZ7A 4ZSAA 2OXDA 4IMYA 3LFSA 2WAJA 4FTRA 3V5JA 1OPJA 2VO0A 1ZLTA 3FPMA 1Q8ZA 4IWDA 5C4KA 3MIAA 4ZK5A 5AP1A 4WUNA 4QP1A 3IG7A 4G1WA 4LYNA 2JFMA 4UWYA 4ZTHA 2OWBA 4NKSA 4X6RA 1V0OA 4GVAA 2VTJA 3LXNA 4YPSA 4D5HA 3CY3A 4A9TA 4PUZA 4EZ5A 3U54A 3HECA 2Y4PA 1YOLA 3K5VA 5BYZA 3R9DA 2W1HA 3DOGA 4QPAA 4DITA 4YBJA 1J3HA 2WMQA 4E26A 5HTIA 3ZM4A 4EOIA 5ETCA 2HXQA 4KNBA 5J5SA 3DCVA 3FHIA 5LMAA 5CAUA 2VTQA 3PXYA 4ASZA 4RX7A 3EKKA 4W4VA 3TUCA 3CQWA 3ZRKA 3ORNA 4OBQA 5A14A 3QD3A 1O6YA 3CKWA 3QKKA 3DXNA 1PXPA 4K9YA 4IX3A 4RJ7A 1XWSA 3ZZEA 4DG2E 3U6JA 3I0QA 5HNIX 4BDIA 4EUUA 2JLDA 1NY3A 4FKQA 4BCQA 2A27A 4TYJA 3WOWA 3GC8A 5IF1A 2CJMA 2XVDA 1YI3A 3UIXA 5AR3A 3PTGA 4XRLA 1IRKA 1CMKE 1O9UA 2YCFA 1MQBA 3PWYA 4D2PA 4XJ0A 5K3YA 4A07A 5AAGA 2XRWA 2I7QA 3V8WA 1Q62A 4L53A 5DOSA 4RA5A 3E87A 4QP7A 2C6TA 4L7FA 4AG8A 5IH6A 1QPDA 4BVUA 3KCKA 3POZA 4ANLA 3R1SA 3ORTA 3UOKA 3O51A 4QOXA 4CTBA 4M8TA 5DLSA 4ZMEA 4Q5EA 4WNKA 5GNKA 4Q2AA 4FKTA 4X6QC 3QCXA 4N0SA 4FZ7A 3RKBA 5LMBA 2BKZA 4OBPA 4OTHA 4ZTSA 3AMAA 4NH1A 3WBLA 5B2LA 5CZIA 2BVAA 3GGFA 3QRIA 5IQGA 3RCDA 3TDWA 4JRVA 1H01A 2PWLA 4JBPA 4C4IA 5A46A 1UV5A 4OLIA 2HY0A 3KK9A 4X7QA 3A61A 3UC4A 3LXPA 4I6QA 5DEWA 1OL7A 4C3RA 2GTMA 4TL0A 5H8GA 4BDKA 1J7IA 1OIQA 2PZRA 2QC6A 2XS0A 3Q2MA 3D5UA 3BIZA 3UIBA 4CFNA 5E8YA 4FOBA 3HP5A 4CV9A 2YA9A 3BYSA 3ZUVA 4O7SA 4EJ7A 2YABA 2HOGA 3KY2A 4GU9A 4HOKA 5KZ0A 3TL8A 4WOVA 4CKJA 1BUHA 1VZOA 3R1NA 3RI1A 3VUDA 4YURA 4YNEA 1Q41A 4Y95A 3QFVA 3RPSA 4CT2A 2ITPA 3OT8A 5KHWA 5CVGA 3LM0A 5FEEA 3QD0A 2YCSA 5HESA 4FX3A 2YIRA 5HCYA 1UKIA 4ORKA 5HEZA 4J1RA 2OW3A 5HZNA 4IDTA 1JSUA 2ITTA 2CSNA 2VWZA 3P0MA 4RQVA 4WBOA 1XO2B 4I21A 2ZDTA 3HNGA 4BIBA 1YXSA 3FQEA 3QLGA 2JDRA 3EN6A 3R2YA 2QO9A 5TOZA 2WIHA 4G17A 2WXVA 3SXSA 3KMMA 4C4GA 1GOLA 3D0EA 4AN3A 3F3VA 2PE1A 1JPAA 3E64A 3HVCA 1ZZLA 2X0GA 3W32A 3WARA 4PDYA 4I92A 1MRVA 2KULA 4LM5A 4NZWB 5AUTA 3UQCA 3LJ2A 3ZSGA 3QXOA 4BCHA 1MP8A 1WBVA 5CLPA 4IZ5A 4OTWA 3OT3A 3BI6A 4II5A 5KZIA 4RIYA 4QYHA 4IZ7A 3E93A 3QZIA 5JGAA 2CCIA 4WSQA 1YXXA 3MWUA 4AZTA 3RAKA 2BIKB 3QQGA 4FR4A 3QC4A 3W2PA 4CT1A 3UG1A 4BKZA 4UB7A 4F7NA 3H9OA 5EI6A 3PZHA 4CG8A 4YC8A 3EQPA 4MXZA 4NM5A 1JBPE 2WMTA 2UVYA 5L3AA 2YM6A 1EH4A 4U6RA 2C5XA 3P7CA 4EL9A 2GMXA 3T3VA 4IE9A 4WNOA 3UO6A 4D2VA 4U45A 5CEIA 3OOGA 2FVDA 4K6ZA 3FAAA 3WZEA 4ANNA 5EQYA 3VIDA 3BBWA 1FGIA 4CFFA 4K11A 4H3BA 5FEDA 1P4OA 4BCPA 4E4XA 4FIJA 4WO5A 4XOZA 5BMMA 2YCRA 2HW6A 4XS2A 4IX5A 4FV0A 5I0BA 3AC4A 3OWKA 5IUIA 3W10A 3EFLA 2ZV7A 5DT4A 4R7BA 4X2FA 1XH7A 1OUYA 2XF0A 5DE2A 3P9JA 3EOCA 2Y4IB 4AE6A 4LFIA 4NCTA 4FZAB 5ICPA 5AWMA 4FNXA 4CD0A 3F5XA 3KK8A 4UYAA 3A99A 5FXQA 5HKMA 3QTXA 4PX6A 3QQLA 2ZM3A 4F6WA 2V7OA 4FZ6A 3QCQA 4K1BA 1FBNA 4D4RA 4O81A 3QU0A 2GDOA 4I0RA 5B0XA 1M2PA 4O84A 1OL2A 4UALA 3NUPA 4IAKA 1K3AA 4MXOA 3DXPA 5FUTA 4GG7A 4L45A 2RFNA 3SQQA 4XP2A 3B8QA 3P5KA 4UYNA 4BGGA 3I7CA 3W2RA 4MF0A 2X4ZA 2OU7A 4EBVA 3UDBA 5CF6A 5AADA 3DLSA 3V6RA 3F2NA 4J8MA 5E8ZA 4QMZA 4U5JA 4LOOA 4YP8A 2Z60A 3Q5ZA 3BHTA 4R8QA 2X7OA 2YM7A 2JIIA 2R5TA 4L8MA 2YM8A 1H1RA 5EQPA 2P4IA 4DA5A 3CP9A 4WSYA 4HVIA 1S9IA 1DAWA 2ERZE 4FT9A 4GVJA 1BLXA 4QRCA 2YDJA 2ITOA 4DEBA 3RVGA 3LAUA 3O71A 4MH7A 1UU8A 2GHGA 2XUUA 4USDA 4QTEA 2X2KA 3CD8A 3SXFA 2PVMA 3FLSA 3NDMA 3QZGA 4XX9A 5D11A 3PPZA 3QWKA 3BYUA 4HJOA 3O8UA 3SD0A 3WF5A 1BKXA 3PJ3A 3UVQA 3P78A 4QP8A 3R0TA 5CF4A 1BL6A 3HUCA 1Q3DA 3FBVA 4LRKA 4TYHA 2XKFA 3FKLA 2XA4A 3P7AA 3QQFA 3QQHA 2ZMDA 4J95A 2WQOA 4FEQA 2JAMA 3MDYA 4NJ3A 3O50A 5IG1A 3VQHA 2PULA 2WTJA 2WTIA 2JKKA 5I9YA 3DLZA 3MFUA 5LVNA 3KXXA 4O0SA 1ZYJA 4IVAA 2F7EE 5FTOA 2QOQA 4D0XA 2YLFA 3ANRA 5ANJA 1YOMA 2QO7A 3FZRA 4I5CA 4O2ZA 2QKRA 2HZ4A 4OTRA 2B0QA 5J7HA 4AW2A 4D2WA 4BTJA 5JKGA 3Q2JA 2C6DA 4IJPA 5HBHA 2HW7A 1XBAA 2QHMA 3KXHA 3ZRLA 3DKFA 3IOKA 3OC1A 4BBMA 1PHKA 2ERKA 4KSQA 4RVTA 2WPAA 5AX3A 2UW4A 1W8CA 3RK7A 3JR1A 2XKDA 4QP9A 4E6CA 3FC2A 4OTIA 2VTSA 2VTTA 4R5SA 3NAYA 1OKVA 3TKIA 2IN6A 3PPJA 3P7BA 4IADA 4XG6A 1IG1A 3PP0A 3PSBA 4A4XA 2YWPA 4BTFA 2E9VA 3ZSIA 2Y9QA 4RLLA 4J96A 3ZYAA 3GFEA 4YJQA 1OI9A 1KV1A 3ERKA 5M51A 3AOXA 3W1FA 3I60A 4XNEA 2KTYA 4R3CA 4XOYA 5G6VA 3ZXTA 4AT5A 5ETIA 4ZIMA 4JQ8A 3DBQA 5LVMA 3ZONA 1ZYCA 2C3JA 3VF9A 2QO2A 3D5WA 4ZZMA 3DTCA 5CT7A 2C6LA 1CKJA 1GZNA 3FKNA 4BZOA 2FA2A 1K9AA 4NW6A 3RP9A 4QP2A 1SM2A 3QUDA 3WIGA 2QOIA 1PF8A 2J5EA 3W8QA 3D83A 2P33A 4XG4A 5JFVA 2QU5A 4FIHA 4NFMA 4UN0C 4RJ5A 2AC3A 5E1EA 3R7VA 2G2IA 4IACA 1SVEA 4L67A 4W9XA 4HVSA 3W55A 3D7ZA 4E1ZA 5L2SA 4JX3A 5M56A 2ZOQA 3DKGA 5HG5A 2R64A 4ACDA 3R28A 3VQUA 3NUNA 1Z9XA 1CM8A 4EK6A 4B7TA 4UMPA 4P90A 2C6EA 2WOTA 4HZRA 5FXRA 4P7EA 5KKRC 2XP2A 2Y7JA 1WBPA 2WMSA 2YM3A 4KS8A 2GSFA 4L44A 4WA9A 4Y73A 3LFEA 4I0TA 2BAKA 3DBEA 1OBGA 3QALE 3HRBA 4O7WA 1YI4A 1WVYA 3QAME 5ANDA 2XEZA 4QMNA 3UZRA 5J7BA 3R9NA 1XKKA 3ZUTA 4CLJA 4YJUA 1HCKA 4RIOA 4AW0A 3TCPA 4FV2A 4TY1A 2YJRA 3G0FA 3HRFA 2JC6A 3VNTA 5IEVA 4AXAA 2OIQA 4DGLC 3DKCA 2C0TA 4ARKA 5JZNA 4AFJA 3S0OA 3FI4A 5A4CA 3BEAA 2H8HA 4E5WA 3GBZA 3FI3A 2JBPA 3ROCA 2C30A 2XKCA 1SVHA 2YZLA 3A4PA 4ZTLA 3R9RA 4CZTA 4QT1A 2HCKA 2OI4X 2H34A 4NJDA 3IGGA 1E9HA 3OZ6A 4WG5A 4YU2A 2IJMA 2RL5A 3ZH8A 4EH9A 4EYJA 2XM9A 2RIOA 3UGCA 2X7GA 1J91A 3EIDA 4TYGA 4O7NA 3B8RA 4E7WA 2UW8A 2PYWA 3BWFA 4B9DA 3T3UA 4YSMA 2ITNA 2R9SA 2VTAA 3MVHA 3TJDA 1QCFA 4BCFA 4HGEA 5JFSA 2HWPA 3GCSA 4I5PA 4G16A 3QC9A 3IS5A 4Y83A 3EQGA 5GJDA 4ZLZA 4LRJA 3OTVA 1QL6A 4IVCA 3F3WA 3MFTA 5HTCA 1CKIA 1JVPP 4IAFA 4BZNA 2P2IA 3WE4A 2VTPA 5T6KA 1E1XA 4G2FA 4GL9A 1LEWA 1PMUA 4FICA 4EH4A 1OL1A 2ZM4A 4RX8A 3VAPA 4DBNA 4F7JA 4C8BA 4I20A 2BTSA 3LLAA 5FM3A 3IW5A 3LW0A 3QKMA 4JI9A 4RJ4A 4Y5QA 3N4UA 3FLWA 1ZY5A 3H0YA 5CZHA 1SNXA 4TNDA 4AWIA 4E5BA 5CSWA 3MPAA 4XG9A 2WMWA 1Q24A 3QWJA 1ZARA 3ANQA 3LQ5A 2J51A 2J6MA 1TKIA 4MBJA 4DT9A 3DA6A 4XV3A 2UW3A 3GT8A 4I6HA 3RNIA 4ZS4A 1FQ1B 5KNJA 3Q6UA 2QD9A 2PVJA 3UZTA 2HENA 4GW8A 4D4SA 1DI9A 2UZOA 4UZDA 1OIUA 5DA3A 4B6LA 4DFBA 3F5UA 2C1BA 3UODA 2BHEA 5HIBA 4HGTA 2XJ0A 4O7ZA 4MX9A 4ZY4A 2R7IA 4IQ6A 4RZWA 2A2AA 3TNHA 2BFXA 4GT3A 1OMWA 5HD4A 2GNGA 2WU7A 1Q8TA 2HK5A 4AAAA 1KE8A 3OHTA 3SOCA 4M12A 2IVTA 4ASXA 1KUTA 4IIRA 5HE0A 3EH9A 2JD5A 3DAEA 3VS7A 3VHKA 5AX9A 5IA0A 4R7IA 5E8UA 3MJ1A 3TNWA 2E9OA 5HBEA 4BWPA 3MY5A 5L8KA 4FVPA 1GAGA 3HDNA 4KINA 4U79A 5HE3A 1H07A 2OIBA 5LWNA 5H8BA 4A9YA 3HEGA 4G31A 5CU4A 5DVRA 5HLWA 2JFLA 4L6QA 4MKCA 3JUHA 3W18A 4XRJA 3MVMA 1OECA 4HCVA 4M69B 2C5YA 3GU8A 1VYWA 3P08A 1R1WA 2J0IA 2BZJA 3BGQA 5EM6A 4EQCA 2QONA 1WCCA 4M14A 5EI2A 3ZZWA 4LUDA 5M07A 3GU7A 3BV2A 5DT0A 3V5TA 1U4DA 4NU1A 3OVVA 2VWWA 1YXTA 2NNWB 3I79A 3ZC6A 4DGMA 4FMQA 5M4UA 3O7LB 2X2MA 3L9NA 5BYLA 3QTSA 3RK5A 1ND4A 4JQEA 2CDZA 3SOAA 2NO3A 5L4QA 4JG7A 1RQQA 1Z5MA 1Z57A 2W4OA 2X8EA 3BELA 3N51A 3AC8A 1QPCA 4PMTA 4EHEA 1YVJA 2WB8A 3ODZX 2W7XA 1J1CA 2UZWE 2WTDA 3Q4CA 2GNFA 3C4ZA 4OTGA 3ODYX 3QHRA 5CXZA 4JVGA 3DDQA 5GINE 5D12A 4Q5HA 3UVRA 4RSSA 3V8SA 5BNJA 2PPQA 4AW1A 1J1BA 4XEYA 3F5PA 1UNGA 4XLVA 2OGVA 3KXGA 3WZJA 4AZWA 3PRIA 2A4LA 2R0IA 2UW0A 4J52A 3TI1A 2X6DA 3OWJA 4UBAA 3CE3A 4APCA 4AGCA 3TZ8A 4ENYA 4ZTMA 3FZSA 4FTKA 4ZSEA 3R2BA 3KXZA 4IAIA 2ITXA 2OH4A 5BQ0A 5IEXA 3PVGA 2BRBA 3PG3A 3OCBA 5K4JA 3NYXA 1JNKA 2H6DA 4AFEA 3M2WA 2IWIA 2RGPA 2PZYA 3G51A 3NRMA 1TQIA 3FMJA 3WF7A 5TF9A 3ZO4A 4QQJA 4QD6A 4AA0A 3ZDIA 3C7QA 4O86A 3QX2A 3NW6A 1QMZA 5D9HA 2WU6A 3MA3A 4E6QA 4M69A 2CN5A 2G01A 3NAXA 5AV2A 2CN8A 1ZAOA 2X81A 3PLAE 4U81A 1OPLA 2OF4A 3C4FA 3DPKA 4I6BA 4NT4A 1Q3WA 3R00A 4K18A 3RJCA 2VWXA 4ONAA 4FBXA 3D2IA 5AA8A 3S1HA 4CFWA 3KEXA 4MD8E 3MYGA 2ACXA 2H96A 1U54B 4EORA 5T68A 4AP7A 4ZAUA 3R7UA 2O2UA 4BC6A 4BKJA 4USFA 3UNZA 2QOBA 3VWAA 2OIDA 4BCOA 3R8LA 3TIZA 3ATTA 4FEVA 3I7BA 3BKBA 3G0EA 3S2PA 4CYIA 2CLQA 5HD7A 3U87A 1ZMUA 2B9HA 2IW6A 4U7ZA 2FGIA 5AUZA 4O0TA 5GZAA 1IR3A 3ETAA 3FC1X 3BLHA 5CU0A 2B9IA 4IFCA 4UMRA 4FV4A 2YDIA 4KIPA 4JS8A 3R7YA 2GFSA 4RX9A 2P0CA 4IEBA 5EYMA 3BGZA 3A4OX 4NK9A 3PY3A 3MESA 2R3MA 3H9RA 3PXFA 3NSZA 4K2RA 3ORZA 3A7IA 4QTCA 3HDMA 1ZYLA 4FSUA 4CLIA 1HCLA 2FSLX 3MH0A 3MN3A 1BI7A 3KRWA 4R3PA 4V01A 1ZYSA 1WBNA 3EQHA 3R8VA 2PVKA 2WTKB 5HVKA 3F69A 3UPZA 3SW4A 4WNMA 4X3JA 2Z8CA 2RKUA 1P14A 4EKKA 2I0YA 5CNNA 4EYMA 5FP6A 3TV6A 2GCDA 2BUJA 2DYLA 4EK4A 4LGGA 4YLKA 3HUBA 3MA6A 3SX9A 4C62A 1SNUA 4RWJA 3EN7A 3QKLA 3RPVA 4CMUA 2OZAB 4JJRA 4YHTA 3W16A 2J50A 1XH9A 5G1XA 3EJ1A 4C57A 4S31A 4TRLA 2O0UA 3KMWA 5TKDA 1VEBA 3BHHA 4QMYA 4FGBA 3QA0A 4RVLA 4FTUA 4NCTC 1GY3A 4C58A 3HV3A 4U41A 2OFVA 3P1AA 4MNFA 4IVDA 3NUUA 1YDTE 5BVFA 2JKMA 1L8TA 1A9UA 3O8PA 4QMUA 3E8EA 4GUEA 3QX4A 3UOLA 4R1VA 4W4YA 4X21A 5TR6A 4ALUA 3HAVA 2LGCA 4WNPA 2GHMA 3PXKA 2AC5A 2VX1A 1URWA 4L52A 3G15A 3DJ5A 1PW2A 4QMQA 2HZNA 2R7BA 4D4VA 5KMJA 5IA1A 3DK7A 2XYUA 3DAJA 3FY0A 4FG8A 4IBMA 2ETRA 2W4JA 5AR5A 3RAHA 3TIYA 2WO6A 2UV2A 3DBCA 3TTIA 5BVNA 3NUSA 1BMKA 3DTWA 4FGRA 3I6WA 4DTKA 2FYSA 3EQDA 5DH3A 4N57A 2W5BA 4M0YA 4YZ9A 3TV7A 4ANOA 3SRVA 2OICA 5J9YA 5FG8A 1T46A 4FSQA 4RIWA 2GNHA 2O65A 4LUEA 4DINA 2QG5A 4HCTA 1G8SA 4YNOA 3ROYA 3UVPA 3HMIA 1W82A 4AOJA 3HGKA 1Q99A 4LQMA 1A48A 2C68A 1U59A 3HA6A 5AP0A 5E1SA 3TACA 3HP2A 3FSKA 3ZS5A 4C4HA 4I5MA 3FZPA 5F94A 4EZ3A 5KMLA 5CAOA 4MBIA 3I0OA 4I22A 3ET7A 1B38A 4HGSA 5AR7A 2BCJA 3AQVA 5FP5A 3MJ2A 3UBDA 1DAYA 3GNIB 2WGJA 1Y6BA 2OZAA 3VJNA 3BHYA 4RIXB 4XUFA 3GC7A 4OT5A 4EH5A 2RFDA 4AN2A 4EOJA 5IA3A 2QU6A 1F5QA 3NEWA 5AA9A 4KBAA 2YACA 4PDOA 2BKKA 3AT2A 1NVRA 4YGAA 5BVKA 2Y4IC 3KB7A 4PQNA 2Z7QA 2UZEA 2WNTA 4PTGA 2GNLA 2BAQA 2V5QA 4FV5A 4GJ2A 2VZ6A 4IC8A 2LAVA 2VWIA 4E5AX 5KBQA 4I41A 1NA7A 3DFCB 3Q9WA 3UO5A 3MH3A 4LV5A 4GCJA 4X2KA 3ZDUA 5ANEA 5CXHA 5BVOA 4P5ZA 4QMVA 4CQEA 3I6UA 3EN4A 4C35A 4XV1A 4IWQA 4K77A 2OXXA 5DMZA 3HA8A 3COMA 4LL5A 3CTQA 3ACKA 1ZRZA 3R8ZA 1WBWA 2J4ZA 4QP6A 3BRBA 1KWPA 1UVRA 2JKQA 4BGHA 4IXPA 3RHKA 3VO3A 1XBCA 2PHKA 4FT5A 3KVWA 3TNPC 5E92A 4F0FA 1W83A 3PJCA 2IVVA 2PY3A 1FOTA 2UZNA 2W9ZB 3NW7A 5JRSA 4QYGA 3KF7A 4QYFA 3G90X 2UZVA 3PIZA 3JY9A 3KRJA 4L3LA 3ZLWA 3GU5A 5CU6A 4BWXA 3V6SA 3E7OA 2OFUA 4TXCA 1OIRA 4FOCA 4ALVA 3FXZA 4BWKA 5IDNA 3MH1A 5DBXA 2B54A 4CVAA 2OJJA 2GFCA 4OTDA 4ANSA 5EYDA 4NFNA 4JAJA 5EG3A 3W33A 2OJIA 1M7NA 3NGAA 4D9UA 5C8KA 2BFYA 2J0JA 3UE4A 1KOAA 3DNDA 5IU2A 4DF3A 4M97A 4I4FA 4DGGA 2JGZA 4PTEA 5DEYA 4BDBA 5AEPA 3BU3A 3ZMMA 4KBKA 4L3PA 3QD4A 4IANA 3U4WA 3VS6A 3NLBA 3TT0A 3LMHA 2W1FA 1JKLA 2XH5A 4F1TA 5I9XA 4GK3A 2A1AB 2PVHA 3P79A 3PE2A 4U8ZA 2EXEA 4USEA 4BDJA 3HMMA 4NSTA 4O7YA 3Q4UA 3ALNA 3C5UA 4EQUA 3TM0A 3RPYA 4B4LA 4E93A 2C5NA 2WMXA 4Z9LA 5KHXA 4ANQA 3O2MA 1FMOE 4DFZE 2QCSA 5EDPA 5GJGA 4TYEA 4FZDB 5TO8A 5HX8A 3R8PA 4ZSLA 3E63A 2PSQA 5IH4A 3VBVA 4L7SA 4GYIA 4V04A 5EHYA 4L46A 4BN1A 1MUOA 2GHLA 3IGOA 4TWCA 4F0GA 4RG0A 1PXOA 4RLKA 4JDHA 3AC2A 3NW5A 1PKGA 2R3HA 3DK6A 4I23A 5F20A 4ZY5A 1M7QA 4HZSA 5L8LA 5HOAA 4RWLA 1Y8YA 1ZMVA 3AXWA 3ENMA 3S95A 2W4KA 3CLYA 3FKOA 4O0RA 3TXOA 3QTQA 1V0BA 2W06A 3OFMA 3EFKA 3GB2A 5EW9A 2XJ2A 2SRCA 5FQDC 4F09A 2VWVA 3QZFA 5A6OA 2OG8A 3BHVA 5DT3A 2QOOA 4FKGA 5LQFA 5CF5A 2YEXA 1UU3A 4DG0E 3C4WA 3I5ZA 4O0WA 3G6HA 4BZDA 3LMIA 4CZUA 1M2QA 2XNBA 5AUWA 5FDPA 2EB3A 2WMUA 4UWCA 3PJ2A 4I0SA 1I44A 3C13A 4IAYA 4BDFA 4HYUA 4F4PA 3LZBA 3MGYA 2WIPA 1ZYDA 3KXNA 2WHBA 2ITUA 5M06A 4AZEA 2X9EA 4MQ2A 1MRYA 3DS6A 3DT1A 3G2FA 4I94A 5EHLA 2OK1A 4TW9A 4ZJVA 3SKCA 3O7LD 5IQDA 2HXLA 4EK5A 4JBQA 4YJTA 4CSVA 1IAHA 3CJGA 3IQ7A 4NW5A 5M53A 5FD2A 4AT3A 3CKXA 4KKGA 2XK8A 3QA8A 2IO6A 3TZ7A 4J8NA 4I3ZA 3SC1A 3TNIA 5F1ZA 5M4FA 2FUMA 4GFMA 3KXMA 4O0UA 4ZTNA 3OXZA 4G5JA 4BFMA 2O5KA 4YJVA 1YDRE 2FH9A 3LFCA 4NIFB 1KE9A 2G2HA 5HLNA 3AMBA 3FYJX 4O83A 5HG9A 3IW7A 1H00A 4NM3A 4F6SA 5AM6A 4BKYA 4EC9A 5IA4A 4Z3VA 3GU6A 3H9FA 3OCTA 3NVMB 5K4IA 1WBOA 3ZO2A 2XK4A 2WTWA 4IJ9A 3DXQA 4EOQA 4NYEA 4BY9E 4GIIA 4M7IA 4FEXA 4RPVA 3KREA 3OEFX 3PVUA 2YM5A 4M15A 4QO9A 5CQWA 5CU3A 2QHNA 3F6XA 4GSBA 4W8DA 5HGIA 3TKHA 4BCKA 5DG5A 2BR1A 5AJQA 2ZMCA 1PMNA 2BDJA 5LWMA 4O27B 4XYFA 4PDPA 3PSDA 3OG7A 5D10A 5EM5A 3LOKA 5M57A 4Z7GA 3A7GA 3DJ6A 3CD3A 4ZP5A 1KE6A 2HZIA 2YDKA 3SXRA 1REKA 4YHJA 4BGQA 3NNXA 5IQAA 3VUHA 2BMCA 3PIXA 4V05A 4H1JA 5H9BA 3WYYA 3FJQE 3L9MA 5JRQA 4OTPA 4PY1A 4AX8A 1UKHA 4WHZA 5CEKA 5HI2A 3MVLA 4FV3A 5CSPA 2OBJA 3OUNB 4FVRA 4G6LA 3KN5A 5A54A 3V01A 1P4FA 4HNIA 3MVJA 3VBYA 5C8MA 2YIYA 3KRXA 2VN9A 1ZWSA 2VWYA 3BU5A 3PY0A 4MBLA 4YJSA 3OOMA 5EDRA 4U80A 3R8MA 3LFNA 5LJJA 4IH8A 2ZVAA 3GOKA 5FBNC 5HIEA 2QOLA 2OJGA 2YJSA 3FL4A 3VRYA 3MTFA 3PRFA 4FV1A 1YWVA 4M66A 4U43A 4MF1A 3HZTA 4WT6A 3ELJA 3FY2A 3VW6A 4B8LA 2W1GA 2Z2WA 3IDPA 3LCTA 1PXMA 4FIIA 4JDKA 4NIFA 4FK3A 5IA5A 3TEIA 1G5SA 3V5WA 3D14A 2WQNA 3LHJA 3QHWA 4ZZOA 4PF4A 2PE0A 3NNVA 4IM3A 3QTZA 1YI6A 3SLSA 3BYVA 1JSVA 3PA3A 4IW0A 3MY0A 2BRGA 3PJ1A 1ZOHA 5ANOA 5H2UA 2Q0BA 2WFYA 3N4TA 3D2KA 4HGLA 2NRYA 3WI6A 2YAKA 3BEGA 3R1QA 4GFGA 4HW7A 1CTPE 1PXJA 4QYEA 5JN2A 4C38A 2XBJA 4F99A 4BHZA 2W17A 4OAUC 4ZSGA 4BB4A 4Y5HA 4EQMA 4BCJA 3DQXA 3A8WA 4LRMA 4YZMA
chains in the Genus database with same CATH superfamily
1AQ1A 2PMOX 1P5EA 4QTAA 4RBLA 3TNQB 4Z16A 3VBQA 4KABA 1NVQA 2IW8A 3MBLA 4Z55A 1PKDA 5EM8A 4O4BB 4B8MA 5D7VA 5E8WA 3VRZA 3I4BA 3PWDA 4C4FA 1ZMWA 3OXTA 4AQCA 2O64A 2YITA 4NUSA 5AIKA 3ZCLA 2QOKA 2CGWA 1IAJA 3KCFA 1NVSA 4IVBA 5HVJA 2R3FA 2I6LA 3R7EA 2EU9A 4OBOA 4H3PA 2FSTX 4CEGA 1GZKA 3ITZA 4ZS0A 1K2PA 2WZJA 1FPUA 2WKMA 3LCSA 4FL2A 4N6ZA 5HO6A 5L6WL 2ZFYA 4LDTA 4ZY6A 2B9FA 3VBWA 4EJNA 3UJGA 4IHPA 3QRTA 4LV7A 3JXWA 2WOUA 4LMUA 4UWBA 4FIFA 1UA2A 5J1VA 3DKOA 2ITQA 3MV5A 4EH7A 5JT2A 3CTHA 3Q52A 3V5PA 4CFUA 5K9IA 4FT3A 5DI1A 4L3JA 2B53A 4FNZA 4PPAA 2C3IB 2NPQA 3NX8A 5F9EA 4CFMA 4DCAA 3SHEA 3DQWA 4LOQA 3BQCA 1Q4LA 4S2ZA 3LCKA 2V55A 2ITZA 4XG2A 4DH7A 3CPBA 3C1XA 5LMKA 4FEUA 4WRGA 1XH8A 5IKWA 4DBXA 3PXZA 4FV6A 3LFBA 4MXYA 4S30A 4Y8DA 2V0DA 2FB8A 2CLXA 2FSMX 5HLPA 4QTDA 5CI6A 3MSSA 1YHWA 3QZHA 3MPMA 2B4SB 3KVXA 3GUBA 4DFYA 3P86A 2HY81 1TQMA 3UMXA 1QPJA 1H27A 5EQEA 2CKEA 3SG9A 2UW9A 3L8VA 2EWAA 4FG9A 2JDOA 4D28A 2XIZA 2JDSA 3E7VA 4MWHA 5CSVA 4YJNA 2BZKB 3AMYA 2DQ7X 3MPTA 3F82A 4J98A 1JQHA 3ZRMA 2PVFA 5C27A 1Y57A 3KRRA 2XM8A 4G3EA 5B7VA 3Q6WA 1I09A 2AYPA 4KA3A 4DH8A 3FZOA 4L68A 1PXNA 1LPUA 4WKQA 3RK9A 3UO4A 2Z7LA 1R0PA 2BILB 3CCNA 3UDSA 4E4LA 4FV9A 3VUMA 2EXMA 5KMKA 1OPKA 3NYOA 3A62A 2RG6A 4YJOA 4O0VA 3WF8A 3K2LA 2F2UA 4CGAA 2WQMA 3DB6A 2BRMA 4D5KA 1FVTA 2R3OA 4IWOA 3C51A 2XNPA 3I5NA 4LOPA 5DN3A 4JAIA 2X39A 3P23A 2UZLA 4IB0A 2UW5A 4OGRA 4GS6A 4PNKA 3COKA 3F2RA 2H9VA 4H36A 4CFVA 4J99A 3HKOA 5D7AA 3I81A 1RDQE 3OCSA 4DYMA 5IZFA 1OL5A 3FQSA 4YTCA 4U97A 3IKAA 3ZEWA 1V1KA 2VTHA 5HNGA 1LP4A 3AC1A 4K0YA 5EKNA 2CGVA 3R71A 2YERA 2GNIA 3KGAA 3BE9A 4XV9A 3UZPA 3W2SA 5CASA 1AD5A 3AGMA 3FMNA 4Y85A 5E91A 2Z7RA 4CMTA 4H05A 5HQ0A 1M2RA 4WBBB 2R3NA 4QMPA 3FMLA 4YZDA 5EYKA 4J71A 3A2CA 3DDPA 4ZJIA 1OKZA 4ZTRA 1YW2A 3RWQA 4BDEA 1UU7A 3ZXZA 1Y6AA 4RFYA 4F64A 2ETKA 1TQPA 4FEWA 4RVMA 4RX5A 5AV0A 5BX0A 4E3CA 4XBUA 2IZSA 3KQ7A 1BI8A 4CRLA 3DBDA 2GS6A 3ALOA 4MXCA 3QTRA 2HELA 4XH6A 4PMSA 5AM7A 4QQTA 3DB8A 4QTBA 5DR9A 3TZMA 3E5AA 4YR8A 1E1VA 2J90A 1BYGA 2FO0A 3I1AA 5AUVA 1Y91A 1JSTA 4F65A 3BX5A 3FDNA 4DEEA 4TN6A 2EXCX 2IVSA 2WTKC 2ZV9A 5BVWA 3NMUF 3BLAA 3PA5A 4YBKA 3W2CA 1MRUA 2EB2A 5CWZA 5FTGA 2IZTA 3DBFA 1VJYA 3GFWA 4OTFA 4AXCA 2R3GA 3CY2A 5IH5A 3FMMA 3MFSA 4KSPA 4RA4A 4FV8A 1FGKA 3IDCA 1YWRA 3F3TA 5HHWA 3T9TA 4EOMA 2XZSA 4IB5A 3ORLA 1XQZA 4N6YA 3PIYA 1GIIA 5CVFA 3BLQA 5M55A 3UP7A 4YMJA 3G9LX 2DUVA 2BAJA 5FWKK 3BCEA 3CTJA 4FSTA 4F63A 5A4EA 4CKRA 2WELA 2W96B 3LXLA 3V5LA 3ZOSA 4GK2A 1WVWA 4BI1A 3EL7A 4FZFB 3QF9A 5IQBA 1FVVA 3MB7A 4RFZA 1H1QA 5M4IA 2XYNA 3G6GA 1ZOEA 3U6HA 4U9AA 5AV3A 2QI8A 4BR3A 1UU9A 2F4JA 3ZM9A 1ZY4A 2QODA 5CALA 3CQUA 4APPA 1YRPA 3KULB 3LQ8A 3R21A 4HYIA 1R0EA 2IPXA 5KMIA 4GKHA 3CBLA 4YPDA 2WD1A 1YHSA 4CV8A 3DJ7A 4JNWA 5CAQA 3KF4A 4RQKA 3UMWA 4RWIA 2F57A 2R3JA 4TT7A 4OT6A 3VS2A 4F08A 3NYNA 4U40A 2ITYA 4JQ7A 2O3PA 3HMNA 4KKEA 4DLJA 4HPUE 5AP6A 4R77A 2BHHA 1WAKA 4FKVA 5M09A 1GNGA 2E2BA 1R3CA 2WQEA 4I93A 3AD6A 4BCGA 2QOFA 2OLCA 1PY5A 3HAMA 4UMQA 3VW8A 4R3RA 5LCKA 4CRSA 2XJ1A 5E8XA 4PP9A 3V04A 4CFXA 4I24A 4EWQA 3U51A 3B2WA 5HICA 2VV9A 5BPYA 2QOHA 3LVPA 2G1TA 1CSNA 2BPMA 5J5TA 2F7XE 4AE9A 5M4CA 4ACGA 4PL3A 2CHLA 4Y46A 1H0VA 2XNOA 4TZRA 2C3KA 3FI2A 4FYOA 5E4HA 5DPVA 5AUYA 4XV2A 1G8AA 4C4EA 1H08A 1YDSE 4BF2A 2G2FA 3E8CA 3Q9YA 2JDTA 3AC5A 4D0WA 2HWOA 2QOCA 5E7RA 4GT4A 5JH6A 5JQ5A 2XKEA 2NYAA 4MQ1A 5GZ8A 2CGUA 3F7WA 1CDKA 2YAAA 3IW6A 3ACJA 2UVZA 4YC6A 5A4QA 4O7TA 4WUAA 3TJCA 4I1ZA 2I40A 3Q9XA 4GYGA 5L6PA 2XK7A 1YOJA 1U46A 5GHVA 3ZC5A 5LCJA 2C69A 5AR2A 5LARA 5JQ8A 3HV6A 4BI2A 1H1SA 4ID7A 1ATPE 4BYIA 5J1WA 2CKOA 2YFXA 2OH0E 5BYYA 3HL7A 1H1WA 1GZ8A 4GK4A 3WZDA 3RM6A 3CQEA 4DHFA 4EWHA 5K5XA 3KULA 5L2WA 4IDVA 3RAIA 5CNOA 2JIVA 4EEVA 5GIPE 2C3LA 2F7ZE 3RZFA 4QMSA 2X8DA 1WZYA 3ID6C 2ZV8A 1NXKA 3D15A 3ZLSA 5CQUA 3NNWA 3R83A 5FGKA 4U0IA 2BDWA 2PTKA 1PMEA 5DNRA 4WRSA 4FKUA 3VS5A 4DFNA 4GKIA 4LMNA 5C03A 3CPCA 5HE2A 4PMMA 4BBEA 3D5VA 4U3YA 4YZCA 4DCEA 4AXEA 5E8SA 3TKUA 3UOJA 2OSCA 4FT0A 3D9VA 3LQ3A 1H0WA 4L00A 2WTCA 3QTUA 3RCJA 3NIZA 4AS0A 1WVXA 1SMHA 4JBVA 4X2GA 2W5AA 5IEYA 3VULA 1SZMA 2C6MA 4WD5A 4MCVA 4RJ3A 4UMTA 2CMWA 2J0KA 3GCPA 4JR7A 4DH1A 2RSVA 1U54A 3E3PA 4ASEA 3LM5A 5B2KA 4CKIA 1OVEA 2YHVA 1JAMA 3OY1A 4NTTA 5ITAA 4FKLA 4E6AA 3R30A 5GJFA 5JSMA 3IK3A 1ERKA 3UG2A 1GZOA 2X0OA 4QP3A 3CSVA 5I3OA 3H3CA 1JKTA 5CEQA 4BBFA 4ZEGA 4FKOA 4TNBA 5KMMA 4GH2A 3EQCA 2CCHA 3FMKA 4UXLA 5GZ9A 2C5VA 4G3DA 3RPRA 3W0QA 5BUIA 4RC3A 2UZBA 4MYGA 4E4NA 3PUFC 4AW5A 5AV4A 2XNEA 4FI1A 5L2TA 4F1MA 1Q8WA 4NWMA 5JEBA 4QDVA 1V0PA 4U42A 1KSWA 3LLTA 3BLRA 3L8SA 1X8BA 4FTMA 4UEUA 4ITJA 5HIDA 5AAFA 3TG1A 5AR8A 1ZOGA 4FF8A 2Q83A 3DGKA 1JKSA 4F1OA 1PJKA 3QQJA 2XK6A 1XJDA 3FHRA 5K0KA 4MD9E 3JS2A 2PVYA 2WEVA 4KD1A 5EOLA 3KMUA 4ZTQA 2C0OA 2P2HA 3GEQA 1JLUE 5L2QA 4D2TA 5D1JA 2XCHA 2PVLA 3BYOA 3H30A 5AUXA 3ZEPA 4QPSA 2WMAA 5DYJA 1B39A 3OW4A 4L01A 2A19B 3KC3A 4BIDA 2VGPA 5HBJA 5HNBA 5J8IA 4ACHA 3PJ8A 5LOHA 2X9FA 3ORKA 4X3FB 3WF6A 4C02A 2CPKE 5HU9A 2X8IA 4MAOA 4FSMA 1YKRA 4LGHA 5CY3A 4P5QA 4JG8A 3VF8A 4AGUA 5CF8A 1F0QA 2GS2A 4JX7A 4G3GA 4YJRA 3GI3A 3C4XA 4EBWA 3WILA 4KB8A 3GCUA 5EYCA 5J95A 4E4MA 4IFGA 3BL9A 1TVOA 2GPHA 4ERKA 4QMMA 3ORIA 4AOTA 4C37A 2OJFE 4L42A 3A7FA 5EW8A 3ULIA 3GC0A 5K5NA 3FLNC 3NVKI 3EYGA 3EQIA 5EHOA 3Q9ZA 4M0ZA 1B6CB 2EUFB 3FLZA 4F9AA 4O2PA 2WQBA 4YJPA 2XNMA 5A9UA 3P4KA 3VHEA 2XIRA 2R3QA 5CTPA 4JLCA 3QCSA 2VX0A 3BYMA 3LE6A 3QRKA 2J0MB 4KS7A 4RIYB 5JFWA 3DU8A 3QUPA 4DTBA 4MHAA 3ZO1A 2W1ZA 4HYSA 2VWBA 3K5UA 4FSYA 4ZSJA 3R9HA 4DGOA 4BCMA 4DG3E 4M13A 1YXVA 3AGLA 4I6FA 3ZFXA 5I4NA 4ZZNA 1XHAA 3OCGA 1H24A 5L2IA 4BDGA 4JBOA 3UPXA 2CGXA 1OIYA 3OBJA 4QMTA 3S3IA 3CC6A 3Q4TA 4Q9SA 4EH8A 2IZUA 4RVKA 5DWRA 1OKYA 5IUHA 4NL0A 4O82A 1O6LA 2ESMA 2ZYBA 4CNHA 3O23A 2HZ0A 2P3GX 1OZ1A 3OF0A 1RJBA 3R22A 1IA8A 4I5HA 4JIKA 5HO7A 2R3KA 3E62A 3VJOA 3D94A 1SYKA 3E92A 2OKRA 3FLYA 4OTQA 5CSXA 4QMXA 3C0GA 3GC9A 3QBNA 4NTSA 2JDVA 3RAWA 5A4TA 3VS3A 4GFOA 4QQCA 3THBA 4WG3A 3ZBXA 1CKPA 4AGWA 4C0TA 1GJOA 4V0GB 3UNKA 5CX9A 4FTOA 4EH2A 4RIXA 3U6IA 2PU8A 3GVUA 3HLLA 4H3QA 5JK3A 2GQSA 2G9XA 4TYIA 4X3FA 4D1ZA 4G6NA 1Q8YA 2F49A 3AG9A 3L9LA 3WZUA 4C4JA 4L9IA 1G3NA 3MW1A 4TWNA 4B99A 2VGOA 3II5A 1IEPA 4NM7A 3TN8A 3O0GA 1LEZA 4GRBA 2VO6A 5KCVA 2PZPA 4MD7E 4FKJA 2BIYA 1NT2A 3FL5A 2J2IB 3R63A 2DWBA 1OKWA 1W2CA 2VTOA 3IONA 2J9MA 3JPVA 3EZVA 3OWLA 4MXXA 4OUCA 4ALWA 3LFQA 4ENXA 4N4SA 2VD5A 4RC2A 1VR2A 2C1AA 4TKSA 3QTIA 5FLFA 1WBSA 4EKLA 3NNUA 1T45A 5A4LA 1YWNA 4E73A 3LKMA 1XBBA 4DN5A 2B9JA 3C9WA 2ZB0A 2RF9A 4FSNA 3QUEA 5IQCA 3U9CA 1H4LA 3OD6X 3AD4A 3SDJA 5A3XA 4FTAA 4YTIA 3TV4A 4A7CA 4O7RA 1HOWA 4CG9A 1IA9A 3FMDA 4H39A 4HCUA 5C26A 2XCKA 1FMKA 2C6KA 4LL0A 3ZUUA 2PK9A 4BDDA 3VUTA 4W4WA 4JDIA 4XG8A 4F9BA 5AR4A 4UXQA 5J9ZA 4FUXA 4ZLYA 3G33A 1Q61A 4JG6A 1PYEA 4XP3A 4FNYA 5LMKC 1OL6A 2CNUA 4GJ3A 4D9TA 3QGWA 3OS3A 4X2NA 4AU8A 3M42A 4CYJA 5KO1A 3TMOA 3W0MA 1KOBA 4TYHB 5IMXA 1WMKA 5AP7A 3V3VA 3NYVA 3R7OA 4FL1A 5FM2A 1H25A 4J7BA 2CKQA 2VAGA 3QXPA 3DAKA 1TFFA 2V7AA 3K54A 4V0GA 1BL7A 3VN9A 5LVPA 3RBWA 2QURA 4KWPA 2PMIA 4DH3A 4O0YA 2PUUA 5K0XA 2F2CB 5I5ZA 1J7LA 1FINA 1Q97A 3CGOA 3G9NA 4ANBA 3MY1A 5A6NA 3V8TA 3EB0A 3FEGA 4G5PA 2PUNA 5AFVA 5GIOE 3C5IA 4CQGA 4HNFA 4DEDA 4GUBA 4FKSA 5HCZA 3OY3A 1W98A 2B1PA 2W1EA 3UC3A 2ZDUA 5EW3A 5BVDA 4MNEB 4R6VA 4FTCA 1UNHA 4UX9A 2UW7A 3EFJA 4AA4A 4BCIA 3FMEA 3UYTA 3FPQA 3C4EA 4AN9A 4O1PA 2R2PA 3F9NA 4IAZA 4JDJA 3SG8A 4O22A 2I0VA 1M14A 4OAVB 4G9RA 3GOPA 1DI8A 2ONLC 3D7TB 1R78A 3AC3A 3PLSA 4QMWA 4R5YA 4YC3A 3U4UA 4D55A 4QQ5A 2PZ5A 1YXUA 1WFCA 2OF2A 3OROA 3UTOA 4C36A 3LFAA 4DC2A 3QTWA 3KN6A 2BTRA 4N70A 4BYJA 4D58A 3OEZA 4AZSA 3DZOA 4DAWA 3A8XA 2UVXA 3CIKA 2GS7A 4FNWA 4A9SA 4EH6A 1OUKA 4PMPA 3SGCA 3R7GA 2A0CX 3BU6A 5AP3A 3QQUA 2UZDA 2ZB1A 4HVDA 2IG7A 2Y6OA 5T3QA 3FMHA 1W0XC 4XLIA 4DFLA 1L3RE 4JOAA 3M11A 4YLJA 3KL8A 5CT0A 2CNVA 3HMOA 4AAYA 4D2RA 2E9NA 3LFFA 4HVHA 4YTFA 1LUFA 1WBTA 4E20A 4JT3A 1G8KA 2E9UA 4A4OA 4BTKA 5F4NA 4KIQA 4LGDA 3LCDA 3LXKA 2VTLA 3GU4A 3A60A 1LR4A 4QEBA 5JFXA 3ZSHA 4A9UA 3BV3A 2DS1A 4O6EA 3TTJA 4L43A 3T9IA 4R78A 1BX6A 1UWJA 3EMGA 4ZMFA 4MEDA 3SW7A 4AZVA 5IDPA 4F78A 2WTVA 3PDTA 2XNGA 4YO6A 4F70A 3BPRA 2UZUE 3U9NA 2VTMA 1YQJA 2PMLX 4FKRA 3BHUA 2QLQA 2UW6A 3N9XA 2YWVA 2B7AA 3NIEA 3RGFA 3GQIA 4YLLA 3R8UA 4CXAA 4F6UA 5KBRA 1PRYA 1IASA 4MNEA 4CCUA 5HX6A 5IUGA 4O96A 1SVGA 2HYYA 5E8TA 5M08A 4YO4A 2X2LA 2GQRA 3R7IA 3BZ3A 3ZO3A 2JIUA 3K3IA 4ZJJA 2ZAZA 1Y8GA 3F5GA 1OB3A 3BGPA 5FRIA 1M17A 4F9YA 3ZLYA 3W0NA 3IW4A 4AF3A 4X2JA 3D7TA 3IECA 3VC4A 4D4YA 4MTAA 4BJJA 3QRJA 4FIEA 4W8EA 3UIMA 1ST4A 2VO7A 1JKKA 4E8AA 5I9WA 2ZJWA 4O7LA 3MFRA 4FSRA 1M52A 5FDXA 2W1IA 4TPTA 2XMYA 3KA0A 4KKHA 4KUJA 4O4EA 5DR6A 2P55A 3NCZA 3R02A 3UYSA 2JITA 4UY9A 4KAOA 3MI9A 4FV7A 4O38A 4C33A 1PXIA 4IZAA 1RW8A 4FKIA 4BHNA 5CANA 4QYYA 3BQRA 2NP8A 3ZFYA 5M44A 3FZTA 3Q32A 1Q5KA 4FRFA 3LIJA 4G6OA 4NM0A 4EHGA 4P2KA 3E8DA 3OP5A 4FTNA 4DEAA 4QPMA 3LMGA 2IZRA 1GIJA 4RZVA 5CVHA 5CEOA 5EI8A 3JY0A 3GQLA 2JEDA 3FZ1A 2X0QA 4KRDA 3RPOA 1URCA 2VNYA 3JYAA 4C34A 2ITWA 3SVVA 4FUYA 5I9VA 1MQ4A 3ORXA 2VRXA 3IOPA 4G9CA 4TTHB 3BWJA 5BMSA 4DT8A 2R3RA 3NCGA 2QNJA 2V62A 3Q04A 4MK0A 4KIKB 2Z7SA 4H1MA 2J7TA 5I9ZA 5H8EA 5KMOA 5HU3A 2PMNX 1XMMA 3EN5A 5CSHA 5CAPA 3D4QA 5DR2A 3AD5A 4D1XA 5LVOA 2RG5A 4XBRA 5FTQA 3PXQA 4D2SA 2IVUA 3F2AA 1PMVA 2C5OA 4RFMA 4R1YA 3VBXA 4GMYA 4AACA 3CJFA 3GCQA 1KE5A 3CXWA 4M67A 5IPJA 5AV1A 1FVRA 2OXYA 3NWWA 2XRUA 3DNEA 2Y8OA 4RC4A 4F7LA 1J7UA 1AGWA 4FKWA 3HX4A 3VUIA 2VWUA 4DFUA 1H1PA 3EFWA 5I3RA 3Q60A 3QD2B 4C61A 1OGYA 4O1OA 2QR8A 5DRBA 5E90A 5EM7A 5HVYA 5IA2A 1UWHA 2R0UA 3OMVA 3F7ZA 3PE1A 2QR7A 3TYKA 4DTAA 3ENHA 4ITIA 4RJ6A 4XP0A 5AAEA 4RRVA 4Z7HA 4ZLOA 5F95A 4CZYB 3QRUA 3VS0A 3ZTXA 2OZOA 4S33A 2HAKA 4EH3A 2HIWA 2WMRA 4G3CA 3HV5A 3ZHPC 4BRXA 3JVSA 3NUXA 4C3PA 3C50A 4O0XA 2GTNA 3BE2A 4K33A 4F9CA 1W7HA 4HVGA 3L8PA 4RGJA 4XCUA 2I1MA 2W9FB 1O6KA 3U55A 4F7SA 1XR1A 3R9OA 3DV3A 3BL7A 1PXKA 4YZNA 5HG8A 2BRNA 3DK3A 2XK9A 4GV1A 1XH5A 1XH4A 5DFPA 3TZ9A 4C59A 2JBOA 2BZHB 2UUEA 1VYZA 2X6EA 3IO7A 4HYHA 4PPCA 5I9UA 4CCBA 4FKPA 4OR5A 3O17A 3MTLA 3WF9A 4QNYA 4XG7A 4EOOA 4J97A 3ZLXA 3EWHA 3PP1A 3UQGA 2C4GA 2C47A 4DH5A 3EQRA 4EK3A 3VUKA 1KV2A 2F9GA 3COHA 4PDSA 2VNWA 5IQIA 3A7HA 2ONLA 1STCE 2OO8X 3EN9A 3HV4A 4JR3A 2VX3A 4KRCA 5AP5A 4A06A 3LPBA 3ORMA 3SA0A 4KIKA 2EVAA 5CEPA 4IB1A 3F88A 4C3FA 4AZFA 5B2MA 5KUPA 3GCVA 1VLRA 5LVLA 4EHVA 5ACKA 3QLFA 3FLQA 4IM0A 3PYYA 4IZYA 2PUPA 2GNJA 5IMEA 4WG4A 5TT7A 3L9PA 3WYXA 3E3BX 3L8XA 3VUGA 5HORA 3S4QA 2XIXA 4K8AA 3S00A 2E9PA 4TWOA 2W05A 2QKWB 3G5DA 4LG4A 2XIYA 2C6OA 4NKAA 1REJA 4YUQA 3H4JA 4G3FA 2GU8A 2WMVA 2CKPA 2R3IA 2QG7A 4FL3A 1OM1A 2J0LA 2PVNA 4ZXTA 4DEHA 2V22A 5IQFA 2QLUA 3CGFA 3R73A 4DEIA 4ANMA 2VTIA 3RNYA 4FC0A 4Q9ZA 4FTIA 4M84A 4EOKA 3FXWA 4OW8A 3MH2A 4LI5A 2JAVA 4JRNA 2YIXA 3Q5IA 5J87A 5KKRB 5LXMA 3PA4A 2B55A 4IAAA 2Z02A 2XK3A 3AT4A 3QGYA 4FA2A 4AOIA 3TUBA 5CEMA 3FQHA 2QVSE 3KKVA 3VS1A 4AXDA 5ETFA 4JIAA 4DE4A 3UOHA 3PY1A 4DGNA 4IX4A 1OITA 4FIGA 3UP2A 4EOLA 1UNLA 4EOPA 5HO8A 3PUPA 3RTPA 3T8OA 4IWPA 3Q3BA 4M68A 5AP4A 5FXSA 4AUAA 4JXFA 4M3QA 4ERWA 2JKOA 2YIQA 4FJVA 2WMBA 2REIA 3OXIA 4W4XA 5ANIA 4GIHA 4O6LA 4HPTE 3IDBA 2X1NA 3QYWA 5AP2A 4PRJA 4PL4A 3VBTA 3VS4A 2AQXA 5EKOA 3UIUA 1H26A 3VVHA 4FSZA 1P2AA 3HV7A 3PFQA 2B52A 4FTJA 5ACBC 4O7VA 5EH0A 2CNQA 3H0ZA 3C0IA 5J9LA 2AUHA 3Q96A 3OWPA 5ANGA 3DY7A 3TDVA 3Q53A 4BDHA 5HTBA 2GQGA 2W0JA 3PXRA 3ZFMA 4BL1A 4F0IA 3MS9A 3KFAA 5FBOA 2O63A 3AT3A 3JVRA 3LJ0A 3OBGA 3F61A 4IM2A 4BI0A 1H28A 1R39A 5JGDA 3R01A 3FI8A 4FTTA 4IC7A 3K3JA 3ZBFA 5KMNA 3ZU7A 3F66A 3GXLA 4GU6A 5BUEA 2RFSA 2XBAA 4MVFA 4AXFA 3V51A 3F3UA 5L8JA 4LV8A 3O96A 2IW9A 3TWJA 2R4BA 2VTNA 4YSJA 5JMSA 4MWIA 3R04A 5AIRA 3KU2A 3POOA 2YM4A 3NZ0A 5C01A 3PG1A 3NR9A 3GP0A 3NUYA 1W84A 2W1CA 2O8YA 4WIHA 1GIHA 3HYHA 4YHFA 4XG3A 3RINA 2X4FA 3W2QA 5IQHA 3IW8A 3CS9A 3H10A 3PVWA 3KRLA 3OTUA 3BBTB 3REPA 1APME 3N4VA 3COIA 3L1SA 3PSCA 4BDAA 5CENA 3RMFA 1OGUA 5EOBA 4A4LA 4C7TA 5JGBA 4EOSA 4S34A 4EI4A 3CR0A 2OJ9A 4AT4A 4PTCA 3U8WA 4PV0A 3O5AA 4O21A 5BUJA 5J79A 4F9WA 4PL5A 3ORPA 4EUTA 1Q8UA 3CEKA 3RALA 4R7HA 3D5XA 4FODA 4PPBA 2XNNA 4RMZA 4RJ8A 2VO3A 3RWPA 4ITHA 1RE8A 2ZV2A 3EHAA 4EONA 1DM2A 3WE8A 2BZIB 1KE7A 4YTHA 3QYZA 1QPEA 3WZKA 4QNAA 2PVRA 4S32A 2VUWA 2R3LA 4BCNA 3PZEA 5IISA 5CAVA 2WEIA 4UZHA 5AMNA 5C8NA 3EKNA 5CS6A 2YCQA 3MIYA 4KIOA 2VU3A 4FTQA 4FTLA 4MXAA 5DGZA 2YZAA 2I0EA 3OW3A 4J53A 3FYKX 5DRDA 3RM7A 5CYIA 4DEGA 4UMUA 1DS5A 4U3ZA 3FSFA 5DHJA 4O4CA 3NS9A 2YISA 2R3PA 1U5QA 3PFYA 4XHKB 3O8TA 4BICA 3A7JA 4X0MA 3E8NA 3R6XA 4X3FC 3Q4ZA 3PVBA 4BDCA 3FWQA 1A06A 1XH6A 1PYXA 2XIKA 4PWNA 1S9JA 4NEUA 4Y72A 3MB6A 1F3MC 5EK7A 4FE2A 3C0HA 2BDFA 1JWHA 2ITVA 4GG5A 4CTCA 4O91A 5C1QB 1NW1A 5C9CA 4A9RA 4FYNA 3LFDA 3M1SA 4KBCA 1OBDA 3NPCA 3R1YA 4AGDA 4U44A 4QMLA 3UDTA 4B0GA 3NUAA 3IPHA 4BTMA 2UZTA 4P4CA 2Y0AA 5AUUA 2PUIA 3RHXA 4RT7A 5E8VA 4EHZA 3ULZA 2BROA 1ZXEA 3UNJA 4ACCA 4ZOGA 4AA5A 4IX6A 3FV8A 2BALA 4ASDA 2Q0NA 2PZIA 2W5HA 3RZBA 1YHVA 2G15A 3QQKA 5CI7A 4EK8A 5KE0A 4DFXE 4CMOA 2I0HA 2YN8A 2PE2A 5BVEA 2Y6MA 3UQFA 2W1DA 3SRVB 2BRHA 2VTRA 3FE3A 4C2VA 2XB7A 3SV0A 4EC8A 5EFQA 1ZZ2A 3C4CA 4RIWB 1PXLA 3LJ1A 3FXXA 2XEYA 4GT5A 4UV0A 2FSOX 4E6DA 2PL0A 4FT7A 2W99B 4RWKA 3EQBA 3PPKA 4W9WA 4IB3A 5HG7A 3QL8A 5L6OA 3HRCA 2YIWA 3W8LA 3B2TA 2C6IA 3SAYA 3WIKA 2X7FA 3LCOA 1U5RA 4FG7A 5FEQA 5D41A 5ETAA 3FUPA 4FVQA 4I4EA 3DFAA 2YLEA 3GENA 4H58A 4G34A 2ZM1A 3EL8A 3EYHA 5HE1A 4JL9A 5ANKA 5HCXA 4YZBA 3W2OA 5KX8A 2C0IA 4FSWA 5CU2A 1TZDA 3E88A 4TWPA 3QCYA 4ACMA 4BIEA 4D1SA 5C4LA 4FK6A 2NRUA 5EDQA 5IQEA 2QQ7A 4GEOA 4QMOA 3EQFA 3EZRA 3F3ZA 4PNIA 2ETMA 5DIAA 5TE0A 4DLIA