3OFMA

Structure of a human ck2alpha prime, the paralog isoform of the catalytic subunit of protein kinase ck2 from homo sapiens
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
325
structure length
325
Chain Sequence
b'SRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha'
publication title Structural basis of the reduced affinity between the protein kinase CK2 subunits CK2alpha prime and CK2beta
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 114
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ofmA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ofmA02
4GSBA 2PZIA 2W9FB 3FC2A 5E90A 4BZDA 3WF5A 4DTAA 4Y83A 4EZ5A 2YM6A 4USFA 3G9NA 2WQNA 5JGDA 5HG8A 3RPYA 4XUFA 3I60A 4R7HA 4GMYA 3IECA 5AR8A 1YWVA 2B9JA 4U3ZA 4YU2A 1OKWA 1OL1A 4L53A 2BILB 2XNOA 3EFJA 5AR4A 3THBA 4FKWA 5E92A 5CALA 5DR9A 4FT0A 3QCYA 3NNVA 3U6HA 4RIYB 2GTNA 4YZ9A 2VTQA 5KKRC 2J0JA 2WQBA 4KKGA 4CV9A 2XF0A 3R02A 5A14A 4C2WA 1ZYCA 2QOCA 4S31A 5DN3A 3OWLA 5DOSA 2UVYA 1XH8A 2VWUA 4RFMA 2Q0NA 4XRLA 5FUTA 3M2WA 3UIUA 4EJNA 4K2RA 3Q04A 2YM4A 2X6DA 4ASXA 2C6KA 2PVKA 3GCPA 3ACJA 3NWWA 1VEBA 4JR3A 4KBKA 3GGFA 2FVDA 1IG1A 4IVDA 4O2PA 3A7GA 4UYNA 2BMCA 2BRHA 2C6TA 1TQIA 3UC4A 1KE9A 4X2GA 2WTCA 4BTKA 1E9HA 2BKZA 4TYHA 3ZM4A 3G0EA 2PVMA 5AUWA 2PVLA 3DV3A 5F4NA 5IQGA 4DFNA 5ANIA 2A0CX 2VD5A 4UZHA 5IA5A 3RNIA 3VJOA 4F63A 5JGBA 2HZ0A 4AN9A 2XB7A 4W8EA 4GCJA 4ZMEA 2XP2A 4WUNA 3D14A 2O5KA 2OW3A 4QYFA 2Y4IB 4DBXA 2XA4A 4FKIA 4FIGA 3Q4ZA 5H8GA 3RNYA 5AP0A 3Q32A 3LXKA 3FMMA 4F4PA 1IAHA 3OT3A 4WSQA 4EHGA 2RFSA 3CTHA 5EM7A 5C4LA 4ITJA 2XUUA 3LCTA 4BHZA 3FI8A 3S00A 3TM0A 3D7TA 3ZM9A 4KBAA 3UQFA 3DKCA 5E8SA 3F3WA 5DYJA 3SV0A 3FYJX 2VTTA 3QTWA 3LM0A 3QCQA 4QYHA 4JRVA 3DXNA 2UW5A 4DEEA 3SHEA 4M0YA 2PUNA 5B2KA 3FQHA 4D4RA 2FYSA 4PTEA 4ASDA 3NEWA 4C58A 3DLZA 4TYHB 5KHWA 3QD0A 5E8TA 5DLSA 3HRFA 3TV7A 4CRSA 2F7ZE 4PY1A 2WIHA 3OD6X 5AAFA 2JD5A 4O0RA 3WI6A 4L3LA 4E6DA 4I23A 4XG3A 3R73A 1UWHA 4GT3A 5HIDA 4HYSA 4D2TA 4QMZA 1YDRE 2XNGA 3IS5A 4G34A 3RWPA 2C3KA 2UW7A 1DI9A 3DQXA 3IOPA 1FINA 3PPJA 2GS2A 4V01A 4F9YA 3BU5A 3POOA 5AUUA 4QMQA 4M67A 3UO5A 3WE8A 4AW2A 4M66A 4D1ZA 3UZPA 3BHUA 4FZDB 3Q2JA 3OP5A 5E4HA 3NAYA 2R3KA 3D7TB 3DA6A 2Q0BA 5EFQA 4YTIA 1DM2A 5CSWA 3S1HA 5IA4A 3QZHA 4I93A 3K5VA 4I20A 3TIYA 3ELJA 3VUHA 3UDBA 3WF6A 4A07A 4GIIA 5GZ9A 5CSHA 1OIQA 5K4JA 3FV8A 4O6LA 4RFYA 4BDFA 5M4UA 4GKHA 2ITPA 5E8UA 4ARKA 5F9EA 4G6LA 4DF3A 5FM2A 1WBOA 3A4OX 4QPAA 2FO0A 1H28A 4E1ZA 2XEZA 3FQEA 4A9UA 2VUWA 4ZLOA 2WKMA 4CFNA 2BTRA 2X39A 4KS8A 3LOKA 2H8HA 2W4OA 1G8AA 4MNFA 3HMMA 3LFNA 1OVEA 3QU0A 2IZTA 4EHEA 4ANNA 3Q60A 3FMKA 1YW2A 4OTHA 3QTQA 2W1EA 3UQGA 3MDYA 4R3CA 4QP7A 3O7LB 3U51A 2R3PA 3UOKA 2IN6A 4H36A 2JIVA 3UJGA 2JIIA 5IQEA 4IADA 4W8DA 5H2UA 4IBMA 1MQBA 4J8NA 2XCHA 1OL5A 3ALNA 2W96B 3WOWA 4HVIA 2ZM4A 4FGRA 2XK6A 4GT5A 3F61A 2OIQA 4IWDA 3LIJA 5GZ8A 2OO8X 3UE4A 4IIRA 4BCOA 4IB1A 5JMSA 3R7GA 1OBGA 2RG5A 4OTWA 2YEXA 3FSKA 3HMOA 3K3IA 4O21A 4JRNA 2OIBA 1V0OA 3OZ6A 4TYJA 3AC1A 4I24A 5HE1A 3ATTA 4RRVA 3HX4A 3D15A 2IZSA 3MVHA 2VX3A 4RZVA 1XQZA 2OH4A 3MJ1A 3VS7A 4IQ6A 2OF4A 2G1TA 4R5SA 3B8RA 5AP3A 3VBQA 2CCIA 5HZNA 5B2LA 4OBPA 1OIYA 3ZLYA 5BUEA 2OJFE 2QKRA 3BGQA 3P7BA 4FTKA 4K77A 4YHTA 3QA8A 5HBJA 2XKDA 3GC0A 5GNKA 5J8IA 4TNBA 1GAGA 1FMOE 1JSTA 2YDKA 3A61A 3PJ8A 2XNBA 3Q9WA 5JRQA 5LOHA 3FQSA 4V04A 3IPHA 2ITZA 1RE8A 4OGRA 3F3ZA 2CKEA 3QFVA 4FNYA 3LFBA 4U7ZA 5FEEA 4BWXA 4EH2A 3OROA 5L6OA 1R0EA 3ZLSA 1UKIA 3LJ1A 4QP4A 4XG9A 3OOGA 3P86A 1M7QA 5AFVA 2W1FA 4HYIA 3Q9XA 4S32A 4N70A 4FL3A 1SMHA 1FOTA 4DFUA 4F7SA 3Q52A 3LZBA 5HIBA 4CEGA 3ULZA 3DOGA 4NK9A 3TZMA 1CM8A 1RW8A 1Z9XA 4KA3A 4UYAA 2OXDA 3NLBA 4G9RA 4GIHA 3BE9A 4OT6A 4KIKA 4F64A 2DQ7X 1VYWA 4ID7A 4S2ZA 3DT1A 5IA3A 3EN5A 2WMTA 3HMIA 4RIWA 2XNMA 2BIKB 4ZS0A 2ZAZA 4BCMA 3QKMA 2PZYA 4DTKA 3V01A 4XV1A 2IPXA 4KKEA 1OL2A 2R3IA 4YO4A 4FV7A 5CLPA 2XBAA 3PP0A 4FODA 2F49A 4YBJA 4BIBA 4MXOA 4Y5HA 1DI8A 2UZNA 5LMKA 3FMDA 4TL0A 3LHJA 5JSMA 4CLIA 3MFUA 3QAME 1J7IA 1PXNA 4EK5A 4AOIA 2UZLA 3G9LX 4FV9A 1M7NA 2V62A 2OLCA 3UIBA 2OIDA 2QOOA 3QXPA 5DVRA 1B38A 3UVQA 3GP0A 4BDDA 4KRDA 4FA2A 4O7SA 2JEDA 4IAIA 5L3AA 3DGKA 3E5AA 3TNPC 2W5AA 4ZJVA 2F9GA 4EOPA 3B8QA 4AA4A 3DCVA 4XG6A 2ERKA 4EOLA 4F9AA 4FGBA 5JN2A 3QHRA 2PVJA 4C7TA 4KIKB 4I3ZA 3BYMA 4BGHA 5CS6A 4OAVB 4OLIA 2XZSA 3CXWA 4UZDA 4YGAA 3VULA 3BEGA 4RIWB 2VRXA 4IX5A 4ANMA 4FTJA 4BDHA 3HRBA 3MTFA 4EI4A 4EOQA 5EI8A 3S4QA 1T46A 3EQIA 5M4IA 1PMUA 1YOJA 1YXTA 1F3MC 5DBXA 3TZ7A 5AV1A 3VS2A 1J7UA 1IA9A 4CFFA 3QRKA 3A7HA 5BVKA 3Q4TA 3CD8A 3UO6A 5HTBA 4KUJA 3IW7A 3PA3A 3KRJA 4S33A 4CQEA 4IB3A 3ZBFA 3KRRA 4RSSA 4BDJA 3NNUA 5KMNA 1PMEA 3KRXA 2X7FA 1SVGA 1CSNA 3OEFX 4FT7A 3ANRA 5IA2A 5AAEA 3LCKA 4FT5A 1W82A 2BDWA 5AR3A 4ZTRA 2IO6A 4DFXE 3RJCA 3COIA 5CU0A 3ZTXA 2QI8A 3DJ6A 3OCBA 3HV7A 5FRIA 2ZDTA 3ZO2A 3R7YA 5C8NA 1UU9A 1ZLTA 5A4QA 3MS9A 3A2CA 3KK9A 4QMTA 5FDPA 3MFRA 3POZA 3O0GA 2RFDA 3REPA 5ANKA 5IF1A 1LPUA 4W9XA 3F5GA 3QQUA 4XMOA 4XS2A 3IW8A 5C26A 2C0IA 4V0GB 2B52A 2Y9QA 3GCQA 2Z7RA 5BVEA 3UTOA 4WNKA 3OFMA 2UZTA 2BR1A 3L9PA 1JOWB 4CYIA 5DEYA 2E9VA 2UZEA 3RPSA 3ZDIA 1W83A 3EMGA 3H0ZA 4JX7A 3BHHA 4YZCA 5FQDC 1SVHA 2ETMA 2I7QA 5E9EA 4U41A 4X2NA 3UOJA 4QQCA 3ZMMA 2BPMA 3NYVA 3ZOSA 4DH3A 3ZBXA 5J7BA 4N57A 2VWBA 5AR7A 1WBPA 5EOBA 1QPEA 3K2LA 4C37A 4BDCA 5HQ0A 2GHLA 3WZEA 2I0HA 1PXJA 4GFMA 1PJKA 2WGJA 4FSUA 2WB8A 4KIPA 5JEBA 1UNHA 5BPYA 4PTCA 2AYPA 2NPQA 4D55A 2JDRA 4YNEA 2IG7A 2WELA 4XG2A 2QR7A 1OUKA 2B4SB 2F7XE 3R22A 5I0BA 4XCUA 3KY2A 4DAWA 3R01A 3LVPA 5HTIA 5DG5A 4NM3A 3PJCA 3PZHA 4CG9A 4FYNA 2BZKB 4XNEA 4X21A 5CZIA 3BGPA 1OPLA 3QRIA 2Y6OA 2OJJA 4MD8E 4IFGA 4H3PA 3NW6A 3NRMA 4MXYA 4OTGA 1H8FA 5KZ0A 1YDTE 3VBVA 2WMQA 3R1SA 2PUUA 4RC4A 4XBUA 4O6EA 3DZOA 5DI1A 3V51A 3OHTA 4H58A 1HCLA 2W5HA 3LM5A 1YHSA 5C4KA 3MN3A 3OY3A 2V7OA 3GI3A 4CXAA 1Q4LA 1WAKA 3PVGA 5DPVA 4GU6A 2FB8A 4AWIA 4EH7A 1JBPE 4ZTHA 4ZEGA 1CKIA 3D2KA 3RM7A 4ZAUA 4DEIA 4Y95A 1LUFA 5I9YA 3UVPA 2W1GA 3HP2A 3QQFA 4IEBA 1H07A 4U80A 1JVPP 3FMNA 4OUCA 2JDVA 4B99A 3O8UA 3FZTA 5LMBA 2ITOA 2RFEA 4O0UA 4I0TA 2XK7A 3KF7A 4YJSA 5LMKC 3ZLWA 3LMIA 2WXVA 4O0XA 5EQPA 3Q9YA 2HCKA 4Y85A 1XHAA 2NP8A 5IKWA 1XO2B 4D9TA 3OXZA 4IWQA 1H25A 3VS5A 2QONA 1KWPA 1YRPA 2WQEA 1WMKA 4QP3A 3R8LA 1U54A 4PP9A 4CFVA 4PDYA 2R3GA 4MCVA 1UU8A 4BKJA 4LV8A 3C4EA 1P4FA 3CQEA 3T9IA 4C35A 1ZYSA 4NW6A 3UP7A 3EFWA 3PIXA 4L45A 3R9OA 5BVDA 1TKIA 4MBLA 3C51A 2QQ7A 4L52A 5KMOA 3TUBA 3UQCA 4O84A 1WVWA 2C6MA 2JKOA 3CQWA 3V8WA 2DWBA 2HIWA 4QYGA 4HCUA 3DJ5A 4LOPA 4ALVA 2YCSA 3E93A 4F0FA 1O6YA 5J9LA 4X0MA 3F3UA 3FI3A 1ZAOA 2YZAA 3ORXA 4HNFA 3V5JA 3EWHA 1O6KA 1YXVA 3HV4A 4EC8A 2PPQA 4MEDA 4MH7A 3D83A 2JDSA 3R7UA 2OZOA 3VUGA 4PP7A 1OGUA 4OW8A 4C0TA 1QMZA 3MTLA 4DGMA 3ODYX 3BV3A 2VWXA 1OM1A 3OCTA 3WILA 5M44A 2BRMA 1REJA 3KGAA 4FL2A 1XH7A 4N0SA 2VAGA 4E6AA 3KN5A 4PL3A 4O7NA 2XIYA 1PMNA 2QO2A 3LCDA 2CCHA 5EM5A 5J79A 3N4UA 3JR1A 3MYGA 4UMTA 3PXRA 3V8TA 3NS9A 3AOXA 2JKQA 2VV9A 1J1CA 2J7TA 5HI2A 3ATSA 4PTGA 4ZS4A 4PMSA 1QL6A 5H8BA 4JAJA 3BPRA 2WQOA 2QO9A 4D1XA 3AC8A 2RF9A 2VO0A 5L8KA 4CTCA 2BIYA 2BAQA 3OTVA 4NTSA 3WYYA 3SX9A 1JPAA 3EZRA 3R0TA 2B55A 1BUHA 1FVVA 4O81A 3C4CA 3OWKA 4FTMA 5G1XA 3P78A 5AMNA 3ID6C 1AQ1A 3H3CA 4QMOA 3F66A 2QHNA 3FKOA 5EKOA 1R1WA 5AM6A 1GIHA 4ZTSA 4A9SA 4NYEA 3HA8A 5CZHA 2ZV2A 3R21A 5J5SA 5FTGA 1W7HA 3OCGA 3AT2A 2UZOA 3UG1A 3MIAA 4IC8A 4XBRA 4F7NA 4CMTA 2HWOA 4FTAA 4FZFB 5HORA 2XBJA 4EORA 4M7IA 3PA4A 4BICA 2CKQA 4TKSA 2OH0E 5CI7A 3RBWA 4EEVA 3W16A 5HTCA 2EUFB 2KTYA 2BDFA 2LGCA 2X0GA 1LR4A 3AD6A 1M17A 1Q8TA 3GQLA 4FEUA 3I5ZA 1UNGA 4E5BA 5AA8A 4I4EA 4L3PA 4F7LA 5KMJA 4M15A 1J1BA 2XNEA 3DK7A 1Y6BA 3DBFA 4EZ7A 3TIZA 3DKOA 1ZZLA 2WNTA 3IKAA 3GU5A 4CNHA 5GIOE 3R2YA 4JS8A 3OEZA 4LL0A 4UXLA 5DIAA 4Z16A 5F1ZA 2XKEA 3VN9A 2JDOA 4ZSAA 3PDTA 2DS1A 3ZSGA 5LWNA 3FLSA 1Q8UA 4UX9A 3EN6A 2ZDUA 1Q3WA 2GNIA 3MSSA 4HYHA 3PVUA 4FT3A 2RG6A 3ZZEA 2BZHB 2QOHA 4RG0A 5JZJA 3TG1A 3MW1A 4I92A 3ACKA 3VJNA 3NYNA 1XH6A 5FDXA 3ZUVA 2H34A 4FTLA 4MTAA 1OIUA 3K54A 3SVVA 1BI8A 4O0TA 3CY2A 4J97A 1Z57A 2BAKA 4AW0A 3BE2A 4FYOA 4FEWA 5AUTA 2OF2A 3HVCA 2PULA 4D2WA 1FQ1B 5KKRB 4C3RA 5D41A 4F6WA 4RWJA 4AZFA 3OOMA 3ZRMA 3DB8A 3GNIB 3NW5A 4I5HA 4BRXA 1YHWA 2R3MA 4LRJA 4WNPA 3AG9A 1IAJA 4ORKA 1UU7A 5HD7A 2UZBA 3CR0A 4ZJJA 4F0GA 4DITA 5FD2A 2YCQA 4AX8A 3UPZA 5CAPA 4APCA 4GRBA 4CKJA 3UYTA 4HGEA 4JQ7A 4DG0E 5CT7A 3L1SA 2BUJA 3R8ZA 1Q8YA 4D5HA 1KSWA 4RX7A 3T3UA 4MF1A 4TTHB 1H1PA 2ZV7A 4O83A 1AD5A 5C9CA 4BZNA 4LFIA 4K8AA 3H4JA 4U44A 4EOJA 3KXGA 4P5QA 3CGFA 5CEOA 3BCEA 4D0WA 1PXMA 4AT4A 2OI4X 2R3NA 5L2IA 3A99A 4DFLA 3WF8A 3D5WA 1QCFA 2XK9A 4F70A 1LEZA 4RWKA 4C36A 2CN8A 4HOKA 5AP5A 2WOTA 4L6QA 5GZAA 1H1RA 3WF9A 2PSQA 2PK9A 2JITA 2HENA 2QURA 4I6HA 3SRVA 3UNJA 4BI2A 2O64A 4BGQA 4EH4A 4EWQA 5KMKA 1A9UA 3FZ1A 5KCVA 3MPMA 4UWCA 4P2KA 3SW4A 3LXPA 4D4VA 3LJ2A 3QUPA 2QU5A 4JIAA 5KZIA 4ALUA 4APPA 3Q4CA 5ACKA 4CMUA 4FK3A 2BKKA 2C0OA 5CVGA 5FEDA 2CNUA 2BZJA 2YERA 3OCSA 1VJYA 4K11A 4UY9A 4BYJA 3PY3A 4WG3A 2CNVA 4I6QA 3VF8A 2P55A 4KNBA 2F57A 5L8JA 3BEAA 1AGWA 3D0EA 4EKLA 3QLFA 1URCA 2C3JA 4FSTA 3I5NA 2ZJWA 4U3YA 4O1OA 4ANBA 2F2UA 3BYSA 3E64A 2ONLA 5I5ZA 3EZVA 2W1IA 3F9NA 5A3XA 3RVGA 4MX9A 4P7EA 4ZY5A 4G5JA 4NTTA 1REKA 1PXPA 3R9HA 4DEDA 5J9YA 1Q8WA 3SKCA 3GFWA 3KULA 3M1SA 1I44A 3PUPA 3R8VA 1FPUA 2CN5A 4G3FA 5J1WA 3LXNA 2VTOA 4YR8A 4EL9A 3F7WA 4RVTA 4MNEB 4AW1A 4IAYA 4L67A 5HNIX 1PXKA 4UMQA 4MKCA 4UV0A 2YACA 3R9DA 3KCFA 3BWFA 2HZ4A 3HNGA 3H10A 3P79A 4TWCA 4FVPA 5AR2A 4D1SA 4DEHA 5DT4A 1XH4A 4I1ZA 1CKJA 1WBSA 4G9CA 1MRVA 4O91A 4QMVA 4XOYA 5HNGA 3V04A 4JXFA 3F6XA 4ZZMA 2I6LA 1U59A 2GFSA 2R7BA 5LVNA 4A9TA 4C4EA 3QD2B 3NAXA 2Z7LA 2R3RA 5HO7A 3QHWA 4QMLA 5FEQA 5L2QA 1XJDA 2PZRA 2QOFA 1B6CB 4IX3A 5CYIA 2J0KA 2VO3A 1DAYA 1PKDA 2XKFA 1GNGA 4WBOA 5A9UA 3PLSA 3MPTA 4FV5A 5FLFA 3GU7A 4ASZA 1NA7A 4ZSJA 2ZMCA 3BHTA 4WG5A 4D58A 5ANGA 5M4CA 2RSVA 5FGKA 2UW0A 5M55A 5EDQA 4XP0A 4FKTA 2JKMA 5CNOA 3KMMA 2WEIA 4P90A 4TPTA 3ZCLA 2C3IB 1FGIA 3DLSA 3MVMA 3HUCA 4CSVA 3SG9A 1ZOHA 5C27A 2OZAB 2YITA 3F2NA 2EWAA 5BQ0A 1MQ4A 3PXKA 4CV8A 4PL4A 3KMUA 3R7VA 3FXXA 4DN5A 2R3LA 2C68A 3FEGA 3N9XA 4X3FA 4MBIA 3R9RA 4NSTA 3TKHA 4B6LA 1W8CA 4RLLA 3EOCA 4A4OA 4AS0A 2VTJA 2CDZA 4KAOA 3ZYAA 3BLHA 4F09A 5LVLA 2BHEA 2QCSA 4FG8A 5CAOA 3RK5A 4O7YA 4FTIA 5EW9A 5CU2A 3HGKA 3F5XA 3LQ3A 2Z7QA 3CD3A 4YJRA 5GIPE 3DJ7A 3ZLXA 5IMXA 1GZKA 2QOIA 4GFOA 2VN9A 4JDIA 3GCVA 4MXCA 1ND4A 5G6VA 3I4BA 2IW9A 3DQWA 4IAFA 3DNDA 3NIZA 3IOKA 4K0YA 3PIYA 4K1BA 5TF9A 3SDJA 5AJQA 2UZWE 5JQ8A 5E8ZA 2Z2WA 4NKAA 4IM0A 3QF9A 5AIRA 2CGVA 3U4WA 3E8CA 3ETAA 5C01A 4ZJIA 3V6RA 3KXHA 4Z7HA 3FLQA 3UMXA 2J51A 4YJPA 3DXPA 4X3FB 2W0JA 5EH0A 3P08A 3Q9ZA 4L42A 3UZRA 4TWOA 2ETKA 5IH4A 2E9OA 5E8WA 2YLFA 3BYVA 1URWA 5DFPA 2PUIA 4R6VA 1KV1A 5BVOA 4GT4A 5E7RA 1I09A 5I9ZA 3PXQA 1Q41A 4YMJA 4IX4A 4O7WA 4FMQA 4GFGA 2HZIA 3C5UA 4FC0A 3U9CA 4HW7A 3DFCB 5HIEA 1XH9A 2X81A 4RX9A 3PA5A 1FMKA 3TDVA 2C47A 2ITUA 4YZNA 3K3JA 4FSNA 4DGNA 3D9VA 3ZC5A 3FMEA 3GC9A 3V5WA 4DC2A 2YA9A 3CKWA 3F5UA 3FMHA 3KXXA 5ANJA 4AGUA 4I4FA 4O7VA 5CAQA 3EFKA 4C59A 3LMHA 4FTUA 4C3PA 2IVVA 4TYGA 5I3RA 5BX0A 1JKLA 2C1AA 1JWHA 4R1YA 2XIZA 3P1AA 2R64A 1QPCA 3SA0A 1TVOA 4G6NA 4QPSA 4M97A 5IUHA 3OG7A 2JDTA 2P0CA 3KREA 3FXWA 4MXZA 4JT3A 4RA4A 3RAKA 5L8LA 1NT2A 4AU8A 1YXXA 3RZBA 5A4TA 2PWLA 4UBAA 2VTNA 2XK3A 2B9HA 4XP2A 3A7IA 2G2IA 1UWJA 3RCDA 2ONLC 4AT5A 3R63A 4CGAA 1YWRA 4FKLA 3VUTA 5KE0A 4BY9E 5FM3A 3R9NA 4YZBA 2F2CB 4FIHA 5AAGA 4BCKA 2BFXA 2Y6MA 2X8IA 4Q9ZA 4AOTA 4C57A 1YXSA 1WFCA 3EQCA 5CAVA 1SVEA 4BBFA 3AMAA 3PE1A 3E92A 4PX6A 4HVSA 5FBOA 2C6DA 5CSXA 4QOXA 4HZRA 3EQFA 2O8YA 2ZMDA 5H9BA 5LVPA 4ANSA 5FTQA 1BL7A 2OK1A 1W98A 5CVHA 4EUTA 4E26A 2BRGA 4HVGA 5M56A 1BYGA 4FT9A 3RMFA 4UWYA 2BRNA 3BIZA 4XRJA 3LQ8A 3AD5A 4O22A 3UIMA 1BLXA 4E4XA 4NW5A 3QA0A 3QALE 4G31A 4O1PA 5EDRA 3JS2A 4AG8A 3TKIA 5DGZA 4HGLA 4TNDA 1S9IA 2PTKA 1K9AA 2J0IA 3V5PA 4EK3A 2WMSA 4X7QA 4YZMA 5KNJA 4Q9SA 4ZY6A 2C5YA 1JSUA 3I79A 2QLQA 3DAEA 3E62A 2C3LA 1U5RA 2QKWB 4FSWA 4WHZA 2RFNA 5CTPA 4D2RA 4F1TA 3I0QA 3KEXA 3UG2A 3FKLA 4HGSA 2XCKA 4FUYA 1KV2A 1XWSA 2HXQA 3U54A 3IO7A 3PWYA 3NR9A 3PRFA 3O71A 4I5MA 3ORNA 3T8OA 4F7JA 3C4XA 3KQ7A 5D12A 4E6QA 3E3BX 4X3FC 4HPUE 4JQ8A 5IMEA 3M42A 2PUPA 4N4SA 4H3BA 3DY7A 4CCUA 1IASA 3JXWA 4AGDA 2IVSA 2JIUA 2O65A 2HY0A 3PRIA 2VX0A 4BDKA 4CYJA 5HG5A 1UNLA 3D4QA 4ZMFA 3PXZA 4YC8A 4K33A 4JBOA 4RMZA 4ALWA 3IW4A 4FSZA 4A9YA 1FGKA 4BI1A 3QCSA 4A4XA 4GKIA 2PVYA 5DE2A 3FZSA 3I6WA 3NW7A 4J71A 5FXQA 3KRWA 4HPTE 4G5PA 4AZVA 5JH6A 4HJOA 1OKZA 3GUBA 2Y8OA 4CKIA 1M2PA 3RP9A 3F3VA 1Q61A 3C5IA 4BWKA 4DEBA 4ENYA 1IA8A 5CNNA 2ZB0A 5M06A 2CLQA 4BKYA 3QC4A 4IXPA 1DS5A 2W1HA 1SNUA 5FXRA 1GZ8A 4QTCA 4TW9A 4W4VA 5HX8A 4C34A 4ACCA 3BBTB 3FWQA 2J90A 4DGLC 3C50A 1VR2A 3KRLA 5GJGA 3BYOA 3UGCA 4BL1A 5CSPA 2V5QA 3HEGA 4FBXA 4PMMA 4BGGA 4LMUA 4QQTA 3NUSA 4XLVA 3KF4A 5EHYA 5HU9A 2W5BA 2QOKA 2NNWB 3GFEA 5CQUA 3TNHA 4U43A 5KMIA 2X1NA 5M4FA 1PXLA 4FV4A 2C69A 2JAMA 1B39A 1LEWA 5CT0A 3U4UA 4E20A 2CGWA 5IA1A 2UW8A 5EM6A 2Z8CA 4KS7A 4HCVA 2CSNA 4C4JA 4EWHA 2J50A 3A8WA 3KK8A 3PVWA 3BRBA 4G1WA 3S3IA 3Q6UA 3G33A 2O63A 4GUEA 5LVOA 4O7TA 3Q5ZA 3VF9A 2XIKA 4O86A 4AZEA 4NH1A 4PUZA 4M13A 2YLEA 1JQHA 4RJ6A 3ZZWA 2GQRA 2H96A 5M57A 4PDPA 2WIPA 4AA0A 5AUXA 3VQHA 5JRSA 4XX9A 4C61A 2GQGA 4TXCA 5BVNA 2P3GX 5JT2A 5IQHA 1MUOA 3BWJA 4AGWA 4GYIA 3UNZA 5EDPA 3RINA 4C8BA 4YO6A 2X6EA 3ZSHA 2XVDA 5KBQA 5CEKA 1WZYA 3RI1A 2PE0A 4QMUA 4IDTA 3RK7A 3S0OA 3D5XA 3BU6A 4CFUA 4YP8A 4Z3VA 4ACGA 4TRLA 2WTKC 3MWUA 2IVUA 1ZMVA 3CC6A 4J99A 3ZC6A 3R8PA 3AXWA 5CXZA 4LMNA 3PTGA 2IJMA 4OTPA 2YHVA 3OC1A 2VNYA 3FXZA 1ZMUA 3AC5A 3OT8A 4RQKA 5DHJA 1WCCA 1E1XA 3EFLA 2W1CA 2YIYA 3ZSIA 4Y8DA 2WPAA 4MD7E 3DDQA 2XRUA 4MQ1A 4QRCA 5HLPA 2XIRA 3GVUA 5IH6A 3PSBA 4QTBA 4I41A 2QODA 3QYZA 3OVVA 3NUUA 3KN6A 5BUIA 1PYEA 4S30A 3TWJA 4CT2A 1QPJA 4WRSA 2W4KA 3P4KA 4NFMA 3UODA 1SM2A 2R0IA 2WEVA 4F9WA 4UMRA 2P2IA 3VBXA 4RJ5A 5E8VA 2EXEA 3WE4A 2C5VA 4KINA 1R78A 5CAUA 3U6IA 1CKPA 4HVDA 3FLNC 5BMMA 5IH5A 3WZJA 5KBRA 4FNXA 4GK2A 4RPVA 4YURA 4BTFA 1YHVA 2GPHA 4AOJA 1PMVA 5CU6A 4IAKA 1ZY5A 3KU2A 3EYHA 4K9YA 2YN8A 2NO3A 3BLQA 4X6QC 2BHHA 4FZ6A 1BI7A 1Y6AA 4NU1A 2VWZA 3TNQB 3I0OA 3VUDA 4M12A 2R0UA 4MD9E 4PF4A 3TACA 4DH8A 3W2SA 1IR3A 2WHBA 4FKUA 3GU4A 4GU9A 5JGAA 4YPSA 3VHKA 3WARA 3ANQA 1Q62A 4WD5A 3R7OA 4RJ7A 3SC1A 5LCKA 4HVHA 1PHKA 1JSVA 3MB6A 4QQ5A 4CFXA 4IM3A 4MQ2A 4TWPA 3SGCA 2ITWA 5CI6A 4FSRA 3KCKA 4GG5A 2B54A 3LXLA 4HGTA 3AT3A 4FEQA 4FI1A 4IZ7A 4GS6A 3MY1A 5E8YA 5K5XA 3EN4A 3ZUTA 5AV3A 2UZUE 3CY3A 3I81A 3JUHA 3HYHA 4N6YA 2HK5A 4XV2A 5HBHA 2WAJA 5HO6A 1CTPE 3N4TA 1YWNA 2KULA 3I7BA 3W32A 1PKGA 3ROCA 4RVKA 4BI0A 4O7ZA 3BI6A 4HYUA 3UIXA 5C8KA 5A4EA 4L43A 4BC6A 3LPBA 2GFCA 5AP1A 1U5QA 1X8BA 3DBEA 1GIIA 3FUPA 3R7EA 5L2WA 3EKNA 2VWIA 2O2UA 5TOZA 3DK3A 3OMVA 3VQUA 3SOAA 5EYMA 4A06A 4CMOA 3EB0A 2X2LA 4OTQA 1K3AA 3HV5A 4RWLA 3Q2MA 3BV2A 4U9AA 3P5KA 3O50A 5AX3A 3II5A 3PVBA 3HAMA 1PW2A 2ITNA 4NJDA 5I9UA 3TTIA 3ZEPA 4FEXA 2ZM3A 3SOCA 4IX6A 5F20A 2IVTA 3TV6A 3NVMB 4E4MA 5TR6A 3SLSA 4EOMA 2GMXA 4WUAA 3DTCA 3KXNA 2WMUA 2EVAA 1XBAA 3WIGA 3NNWA 3TJCA 3NSZA 2ITXA 2VO7A 3CKXA 4E73A 3DS6A 3HDNA 1YVJA 4AUAA 4O27B 4FSYA 5M09A 1Y57A 4XOZA 3ORPA 1XR1A 2J0LA 5IZFA 3VS0A 3COKA 4F6SA 1U54B 2UW4A 3ZEWA 4U45A 3FKNA 3LMGA 2HWPA 4DHFA 4MAOA 3RAIA 4MYGA 3TCPA 2JFLA 5IEVA 2B9IA 3FZRA 3ENMA 4I6FA 2XYUA 3ZRKA 3C0IA 3E3PA 3CLYA 2HXLA 3EQBA 3ERKA 3O17A 4N6ZA 4FZAB 3C0HA 4W4WA 4IH8A 2W1ZA 1GIJA 1MP8A 3F2AA 2EU9A 4KWPA 4C4IA 2JLDA 4D2SA 3QUDA 3W2QA 4RX5A 4H1JA 1H01A 3W1FA 1GJOA 5EYKA 4EH6A 2YM3A 4CT1A 3EQDA 3QTZA 4MF0A 4PDSA 4RIXA 1ZARA 5AX9A 4I0RA 3QWJA 5IEXA 4UXQA 4RGJA 3ZHPC 4CFWA 3CPBA 4MHAA 3R00A 2B7AA 5K3YA 3P0MA 2HW6A 2PVFA 3IONA 4WO5A 2VO6A 3LKMA 2W06A 4H05A 1OZ1A 1ZOGA 3VW8A 4IE9A 4JR7A 2OSCA 3C0GA 1YOMA 3VC4A 4FIFA 4O38A 4DYMA 5E8XA 2ITTA 3CGOA 4ZSGA 3A7JA 3GC8A 3L8PA 3PJ3A 4E5WA 5I9VA 2ITQA 3I6UA 3D94A 1H26A 3PE2A 4Q2AA 4YJUA 2W7XA 3PY1A 3SQQA 4YJVA 2XK4A 1T45A 2C5OA 2WZJA 5DNRA 3CPCA 2PVHA 4U97A 5AUVA 4A7CA 3MFTA 3U55A 4RIXB 4D2PA 1TQMA 4ERWA 3L8SA 3TNIA 4BDAA 4R1VA 4DH1A 1OBDA 2YM8A 4IC7A 3NYOA 3DTWA 3MFSA 4XHKB 1UA2A 2E2BA 2ETRA 4G2FA 4BVUA 2BRBA 3CJFA 2HYYA 3CTJA 4NUSA 1ZWSA 2P4IA 1UVRA 3KXZA 4L9IA 3ORTA 4O7RA 3QRJA 2OG8A 2B53A 4NM0A 3L8VA 1HOWA 2ITYA 4IVBA 4P4CA 2J6MA 3QBNA 2XNNA 3QTIA 2PL0A 2FSOX 2UW6A 4R3RA 3PPZA 4QYYA 4D9UA 5HE3A 4D2VA 4M69A 4ANQA 3CEKA 4DH7A 3R04A 3MJ2A 3UC3A 3QKLA 4OT5A 4GK4A 2A19B 3R8MA 2W1DA 4Q5EA 4QT1A 3MESA 4X6RA 1OMWA 4ZOGA 2XEYA 4ZZNA 3QXOA 3NIEA 2XH5A 1PF8A 2GNGA 4AA5A 1V0PA 5BVWA 4ZY4A 4BTMA 2YIXA 2W17A 4AT3A 4ERKA 4G3GA 4XH6A 3TEIA 1UKHA 4PQNA 4FV6A 4I6BA 3ULIA 3G0FA 4BTJA 3JYAA 4E7WA 4MXAA 4LRKA 4R8QA 5HE2A 3PXYA 4XV9A 4BCJA 2UVZA 2GS6A 2YJSA 3U6JA 1M2QA 3W8QA 4X3JA 4B7TA 3BHVA 5T68A 4EUUA 2XJ2A 4L8MA 5ETIA 4JDJA 3SXFA 3IW6A 4FK6A 4QP2A 5AV0A 5IQDA 4IAAA 4IB0A 4WNOA 5GHVA 1QPDA 3EN7A 5IUIA 3CIKA 3H9FA 2X2KA 4J98A 2IZUA 2WTJA 4BB4A 3PYYA 4FKGA 4FKJA 5ACBC 4JVGA 4ZP5A 3A8XA 4YHJA 2Z60A 3C9WA 1HCKA 3RPRA 5B2MA 5KMLA 2P2HA 2WO6A 5KHXA 5KO1A 3PFQA 2Z7SA 3MH1A 4FG7A 4J52A 1JKSA 5HOAA 5HESA 4I0SA 4I21A 5D7AA 1PXIA 4BZOA 4XG8A 5A54A 3VS3A 2O0UA 3IQ7A 1H1WA 2X9EA 4DBNA 4G16A 4HZSA 4J95A 4JBVA 4M0ZA 2EB3A 3HMPA 3V3VA 3HLLA 3E8EA 3R1YA 4YC3A 3UBDA 4FV1A 4BDIA 5AEPA 5LARA 2Y0AA 5HHWA 4UMUA 4ACMA 4BWPA 4GEOA 4MWIA 2OWBA 4NJ3A 3GEQA 4GVAA 3MB7A 2ZV9A 4FSMA 4HCTA 3LFAA 4CG8A 1JKTA 4NM5A 5J95A 2ZYBA 3D7ZA 3EYGA 4IWOA 3TZ8A 2CHLA 5K5NA 3WZDA 4C4FA 1NW1A 5A4LA 4A9RA 3SRVB 4C38A 3QD4A 4AW5A 2HZNA 3A60A 1V0BA 3I7CA 4QMWA 1YI4A 5DR6A 2GQSA 5JK3A 1Q3DA 3QLGA 4TN6A 4M84A 4E6CA 4GL9A 3ZO3A 3QYWA 4DCEA 4CLJA 2P33A 3WF7A 4LQMA 3MH3A 1PXOA 3A62A 3EL7A 2G15A 5D1JA 2PE2A 3FMJA 5D7VA 4ACHA 4FSQA 4UB7A 4E93A 4RIYA 2BZIB 2I0YA 4LRMA 5DH3A 1M52A 1GZNA 3F82A 2R5TA 3F7ZA 4MXXA 5EQEA 4FF8A 2WTWA 4FVRA 1Q97A 3VUKA 2FSTX 2H6DA 4L7SA 2EXMA 1P4OA 3Q96A 3OUNB 4FKRA 3PIZA 4JG7A 2I0VA 2QC6A 2OBJA 2E9UA 4FTNA 4JNWA 5IDNA 5E1EA 3ZUUA 2CGXA 3KULB 3TNWA 1GY3A 4O96A 1YQJA 3FY2A 4JX3A 1OL7A 3GENA 2J2IB 3CBLA 4L00A 1JKKA 5DRBA 2YIQA 3ZU7A 4EYMA 5BNJA 5CF5A 4UN0C 5B0XA 3GBZA 3OWJA 4IZ5A 4KABA 4BCNA 4QQJA 4QMPA 3S2PA 3QC9A 4XG4A 4C02A 2JKKA 1XKKA 3VBWA 3HZTA 2VTIA 3R71A 4GVJA 4ZTMA 1YXUA 3ORZA 5FTOA 2G9XA 5L4QA 3VUMA 2WQMA 5EM8A 4J8MA 1R3CA 3W2OA 1G8SA 3P9JA 3HAVA 2YIRA 2PVRA 2QHMA 4G6OA 4WRGA 4EH5A 3ZRLA 5EKNA 3WZKA 1BMKA 2GTMA 3P7AA 3AGLA 3G2FA 3FE3A 2B0QA 3CCNA 1CMKE 4R5YA 3C4WA 5GJDA 3QQGA 4FOCA 3A4PA 2QD9A 4UWBA 4P5ZA 3AMYA 4JBPA 2WMBA 4MBJA 2QO7A 4BFMA 2IWIA 4Z9LA 4QNYA 4XP3A 4YLJA 4RJ8A 3ROYA 3DBCA 3L8XA 3VNTA 2OFVA 5CF6A 1NVRA 4GV1A 5AP7A 4KB8A 3AD4A 3NUXA 5ANOA 2OJ9A 1MRUA 4J96A 3T3VA 3O51A 4QO9A 3CQUA 3ZONA 4BR3A 2C5NA 1Q5KA 3HDMA 4AE9A 1ZOEA 1Q99A 3FYKX 2OXYA 4ITIA 3U8WA 5BYLA 3EKKA 3MH0A 4ENXA 1TQPA 4BIEA 3PSDA 3EQGA 2G01A 4L44A 4F99A 4L46A 3OWPA 4IB5A 4YC6A 2WMXA 3HUBA 5T3QA 2CLXA 2PMLX 4CD0A 3FC1X 2QOLA 2W4JA 3QQJA 5L2SA 4EOKA 4OTDA 3E63A 1OL6A 3EHAA 3GQIA 4F08A 2YDJA 4ZSLA 1XBBA 4OBOA 1J91A 5E1SA 5CEQA 5GINE 3GU8A 4JLCA 5C8MA 2GSFA 2XIXA 3UYSA 2EXCX 4WBBB 5J9ZA 4BCGA 1NY3A 5EW8A 3ZFMA 2QOBA 3AC2A 3CS9A 2AC3A 3DK6A 3FLWA 4Y73A 4BIDA 3I1AA 4RVLA 5JFWA 3HP5A 1KE6A 4CQGA 4OR5A 3QRTA 3FHIA 5F95A 3PSCA 4LUEA 1O9UA 4EQUA 3B2WA 3CP9A 3LCOA 4GW8A 4RJ3A 4J53A 3RALA 1H08A 4EQMA 4U81A 3Q4UA 4M68A 4EH9A 4C33A 2NRYA 4FKOA 5HCZA 2XMYA 3OW3A 2QU6A 4NIFA 5CEMA 3ET7A 4QP9A 2Y7JA 3VS4A 1KOAA 2B9FA 5A4CA 4EOIA 1RDQE 1RQQA 5IA0A 1WBTA 2UW3A 4QP6A 4RBLA 5CENA 2FA2A 2QNJA 3Q53A 3LW0A 4TZRA 4AAAA 4LGHA 2QLUA 4MK0A 5L2TA 5CSVA 1R39A 2FSLX 1YOLA 2BALA 2R3FA 4YNOA 4BBMA 1SNXA 2R3QA 5ETCA 4W4XA 2X4FA 2V22A 1Z5MA 4EOSA 4PPBA 3TV4A 4Z55A 2CJMA 2A1AB 4FICA 3RKBA 3MV5A 3W10A 5B7VA 3FL5A 4EKKA 3C7QA 1H24A 3FPMA 3LFCA 4ZIMA 2OFUA 3HV3A 3VO3A 4OBQA 4DGGA 3H9RA 1WBNA 5AV4A 1H27A 1WVXA 5HD4A 1KE7A 4IACA 3ZO4A 4L01A 3DDPA 5LMAA 5FP6A 4IANA 2UV2A 2HELA 3E88A 4PNIA 3NUNA 2ZV8A 2V55A 3IGGA 4AN2A 3MI9A 4AXAA 4NIFB 1LP4A 4Y46A 3KC3A 2H9VA 4YJTA 4B8MA 2X7GA 5ICPA 4RFZA 3UOHA 5D9HA 1IRKA 4EBVA 4W9WA 2PE1A 3CE3A 3D5VA 5I9WA 2BAJA 1CDKA 3RPVA 3PJ1A 4FIIA 5EG3A 2OKRA 3DBDA 4BYIA 5DR2A 5K4IA 3ORLA 3QL8A 2WTKB 3IW5A 4NKSA 4NWMA 1KE5A 3IDCA 3FMLA 4GG7A 4U8ZA 3RK9A 4C4GA 4D5KA 5EI2A 1JNKA 4EH8A 2WOUA 5LCJA 4LG4A 3ORMA 4LM5A 4O7LA 3C4ZA 3FI4A 3PXFA 2I40A 4USDA 5EYDA 2CKOA 2WTDA 1Q24A 5FBNC 5HLWA 4DE4A 4BDBA 4FTRA 1Y8YA 3FZOA 4LV5A 1K2PA 5KMMA 4H39A 1J3HA 3QTRA 4D4SA 4YJQA 3WZUA 4DG3E 3R7IA 2GS7A 4YBKA 2Y4IC 4ZTNA 2R7IA 2WU7A 2X2MA 3ODZX 4IZYA 3H30A 3T9TA 3WYXA 4U0IA 2GNFA 5AP4A 3OTUA 1L8TA 4UALA 3ZS5A 4FKQA 1OPJA 2PU8A 4IWPA 4BCPA 4JIKA 1V1KA 4RJ4A 4YLKA 3PJ2A 5IQFA 2GDOA 2VWYA 2PMOX 2ZM1A 3BELA 3E87A 2V7AA 3NDMA 3UVRA 2VWVA 1APME 3TL8A 4YSMA 4D28A 3KB7A 5FXSA 1NXKA 2G2HA 4L68A 4KSPA 1RJBA 3AC3A 4BCHA 1OKVA 5F94A 3QZIA 4FUXA 3EQPA 2A4LA 4JL9A 5HVKA 3DFAA 4WT6A 4RQVA 4YJNA 2I0EA 4O2ZA 2AUHA 2X9FA 2SRCA 3MGYA 4KBCA 4E3CA 5IQAA 3H0YA 2F7EE 4O82A 1JLUE 2VGPA 2WFYA 2YDIA 3KKVA 3V5TA 2NRUA 4XLIA 5I3OA 2VTAA 3BBWA 4LOQA 3FLZA 5CWZA 2QVSE 5HCXA 4CKRA 1IEPA 3IGOA 1DAWA 4K6ZA 2HY81 3NNXA 5AP6A 5DRDA 5A6NA 3JVRA 5CX9A 3KMWA 4X2KA 2XM9A 5I9XA 4I5PA 3Q6WA 5L6WL 5CF8A 3P23A 4ANOA 4NL0A 4ZK5A 4ZXTA 3BU3A 3WBLA 4LYNA 2C6OA 3AGMA 4JDKA 3IDBA 3NUYA 4UMPA 4PWNA 3KVWA 3VRZA 3IK3A 2B1PA 4C2VA 2C0TA 2C6LA 2YWPA 3L9NA 3QGWA 2UZVA 4EONA 5AADA 2XKCA 5TO8A 3K5UA 5IUGA 2QG5A 5EK7A 4FIEA 3FZPA 5TKDA 3DU8A 2R3JA 5KUPA 2VGOA 4C3FA 4TWNA 3F69A 5DT3A 3IG7A 1P5EA 3H9OA 4DEGA 3WIKA 2Z02A 1UU3A 2W9ZB 3DZQA 4AP7A 4FG9A 1H0WA 2JFMA 4JQEA 4BCIA 2A2AA 2YAKA 1OPKA 3GCSA 4J1RA 4H3QA 4Y72A 1PY5A 4RZWA 4G3DA 5TT7A 4AF3A 2C6EA 3R83A 4E8AA 3DNEA 5HGIA 3COHA 4ASEA 5L6PA 3QZGA 3NX8A 2YCRA 5HKMA 5J87A 4EYJA 1PYXA 5DT0A 3RCJA 2WMRA 1ZYLA 4BDEA 3FDNA 1U46A 4RVMA 3TT0A 3S95A 3CTQA 4GYGA 4R7IA 4R3PA 2IW8A 3RGFA 3RTPA 5IISA 4V0GA 3QTXA 4EK6A 3FSFA 3MY0A 4CTBA 4YTCA 4QMSA 4E4LA 4O0WA 5LQFA 3ZXTA 2X7OA 4OTRA 4FV2A 2JBOA 3E7VA 4O0YA 4F9BA 4EJ7A 2WMAA 4GH2A 2JC6A 3NCGA 4L7FA 4RWIA 2VTSA 2W05A 3R8UA 3VIDA 2JAVA 1OI9A 2A27A 2YWVA 3EL8A 5HEZA 5AA9A 5J5TA 3CSVA 4AE6A 1NVQA 4IHPA 4DGOA 2YABA 3F5PA 3PP1A 3ORKA 4ONAA 4BF2A 5J7HA 5A6OA 3SD0A 3VBTA 2UVXA 3MBLA 4FL1A 4F0IA 2JBPA 4QMXA 2YISA 3AC4A 4PL5A 4FX3A 2OJGA 3RHXA 4OTIA 3LE6A 2C30A 3FAAA 2C1BA 3PZEA 2HAKA 2PHKA 3QD3A 4FV3A 4DTBA 3VHEA 3O23A 3QQLA 5JZNA 4WA9A 5I4NA 3LAUA 4OAUC 2R3HA 4BBEA 3QGYA 1GZOA 5E91A 1STCE 2BDJA 1W84A 3OXTA 4M8TA 1E1VA 5AR5A 5BMSA 5CEPA 4QTEA 3TUCA 4G3EA 4O0VA 3OF0A 4RC2A 4FR4A 4ANLA 5AM7A 4S34A 4FEVA 3GU6A 4MVFA 3A7FA 3SW7A 3L9LA 3W55A 3FL4A 3KFAA 3RPOA 3V6SA 1FVTA 4QP8A 3EIDA 4B4LA 3ZXZA 4ZTLA 2VX1A 5JQ5A 4DINA 5EW3A 2AC5A 4AZTA 1SZMA 4J7BA 4M14A 5IG1A 1H0VA 4ITHA 2WTIA 2OGVA 3DAKA 4ACDA 1A06A 3LLAA 5IQIA 3LQ5A 3NMUF 3QKKA 3RAHA 2XRWA 4Y5QA 2UW9A 4EHZA 3OY1A 4EK8A 3ZH8A 4KRCA 5HX6A 3OBGA 3U9NA 3EJ1A 3EQHA 1G5SA 3UO4A 1ZZ2A 5DA3A 4EQCA 3RWQA 3JVSA 3GOKA 4FTQA 1S9JA 4FVQA 3RZFA 2EB2A 3JY9A 4R77A 2YIWA 5KX8A 4JDHA 3HA6A 2J5EA 4KD1A 4B9DA 3HECA 3RM6A 3R2BA 3VW6A 2YM5A 5CF4A 3SXRA 3KA0A 3OS3A 4U40A 3TKUA 4L3JA 3R1QA 3COMA 2J4ZA 4U42A 1WBVA 3JY0A 1ZYJA 3UPXA 3W33A 3TZ9A 1H1QA 2FGIA 2BFYA 2XM8A 4FOBA 5CU3A 4EK4A 5BYYA 5LVMA 4YZDA 1U4DA 3C1XA 5BYZA 2CGUA 3MVJA 5AUZA 2G2FA 3LFFA 4U79A 2E9PA 3VWAA 3FBVA 4CZYB 3HV6A 5M51A 2CPKE 1P14A 4WKQA 2UUEA 4IAZA 4BCQA 3FHRA 4ZZOA 4E5AX 4OTFA 5FP5A 5EHLA 3UP2A 3BQRA 3LFSA 2PMIA 2VZ6A 4NCTA 3TUDA 4NM7A 3Q3BA 3MIYA 3GXLA 5HNBA 2Y4PA 2ZB1A 3QX4A 2DYLA 4YSJA 4QTDA 4JAIA 3KXMA 4MWHA 4PV0A 3NYXA 4EZ3A 4FZ7A 1OB3A 4CZTA 1F5QA 3EQRA 5A46A 2BCJA 2FH9A 2O3PA 2XJ1A 4QMNA 3QUEA 5DMZA 4BHNA 4JG8A 2BROA 2GNHA 2RGPA 5IPJA 3QX2A 2IW6A 4KIOA 1WVYA 2ERZE 4XEYA 5CQWA 3VAPA 5IEYA 3ITZA 4YUQA 3AMBA 4FTTA 4YJOA 2VTHA 5ETAA 3UZTA 3G51A 2HW7A 1ERKA 4PMTA 3NUAA 4B8LA 3SAYA 5DEWA 4ZLZA 2RIOA 4XV3A 5CEIA 3C4FA 4FNZA 4PRJA 2PZPA 1YI3A 2LAVA 4U5JA 2RL5A 1L3RE 4YPDA 2W99B 3PWDA 4C62A 3ZO1A 3F88A 4PMPA 4WNMA 1Y91A 3AQVA 3BGZA 3R1NA 4QMYA 4WSYA 4QP1A 4CZUA 4I22A 3SG8A 4DEAA 3ZFXA 4RA5A 2ZOQA 4NEUA 3BQCA 4XYFA 2GHMA 4F65A 2E9NA 1WBWA 4BN1A 5M07A 4DFBA 1H00A 3KVXA 3QTSA 4FNWA 4FV0A 4I94A 4AGCA 3O8TA 4FTOA 4JI9A 2QG7A 3DAJA 3O2MA 1OIRA 1BX6A 4G17A 1UV5A 3UNKA 4IM2A 5HVYA 2WU6A 4B0GA 3V5QA 2FUMA 4AFJA 1BKXA 4RX8A 3HRCA 3NGAA 4Q5HA 2HOGA 3BYUA 4TYIA 5DWRA 2ESMA 4XG7A 4QYEA 1EH4A 4AN3A 3G6GA 5AV2A 4DT9A 3CJGA 5T6KA 5JFVA 3BX5A 4F9CA 5HVJA 3L9MA 1VZOA 3DPKA 3R30A 2R2PA 2R4BA 3VBYA 3FJQE 2RKUA 4WIHA 3RHKA 3LJ0A 4DCAA 1XH5A 3BHYA 1SYKA 5D10A 2PVNA 4D0XA 3ENHA 4QPMA 5LWMA 2Q83A 5EYCA 2GCDA 5CVFA 4EHVA 2QOQA 2WD1A 3LFQA 2ZVAA 5HG7A 3W2PA 3LCSA 4GJ2A 4NT4A 2PYWA 4RIOA 4ZSEA 3PG3A 3JPVA 5HICA 4V05A 3GCUA 3F3TA 3ZDUA 1W0XC 3E8NA 3QTUA 4A4LA 4CVAA 5EQYA 2CNQA 5TE0A 3OW4A 2REIA 4LL5A 2PMNX 1JAMA 3FI2A 4DA5A 3GB2A 3OBJA 3MA6A 5M53A 5JFSA 2OXXA 5ANDA 5H8EA 4IDVA 4LGDA 4E4NA 3O96A 3VS1A 5AWMA 2FSMX 2XNPA 4IZAA 3R6XA 2OJIA 1O6LA 2OU7A 3ZFYA 4KKHA 1OECA 1ZY4A 3W8LA 5IQCA 3Q5IA 1ZXEA 3U87A 5C1QB 1M14A 5JKGA 3NCZA 5EOLA 3VRYA 5BVFA 3QRUA 4EOOA 3EH9A 4DH5A 3MPAA 1ZRZA 1YKRA 3PPKA 4EH3A 2X8DA 5C03A 2DUVA 5HE0A 1G3NA 3ALOA 4U6RA 4IW0A 2UZDA 4D4YA 4JOAA 1XBCA 4WG4A 5CASA 2X4ZA 2IZRA 5ITAA 1H4LA 4FKVA 2CKPA 4FKPA 5FG8A 3TN8A 3SXSA 2JGZA 3E8DA 3FPQA 2X8EA 3GC7A 3FLYA 3FY0A 4QD6A 5K0XA 3N4VA 5CANA 4CFMA 4DFYA 1NVSA 4EC9A 4W4YA 4GJ3A 1H1SA 3MH2A 2VTMA 4QTAA 5EI6A 3P7CA 3HKOA 3C13A 5D11A 4AQCA 2BTSA 2YFXA 3PG1A 2XK8A 1BL6A 4KIQA 3DKFA 4X2JA 3QQKA 3LLTA 1M2RA 4YLLA 4DG2E 1J7LA 1P2AA 4QNAA 2VWWA 1VYZA 2ITVA 2VTRA 3BKBA 3GT8A 3NUPA 4JG6A 4RT7A 3TXOA 4USEA 3PLAE 3UOLA 3LFDA 4QMMA 5K9IA 2ACXA 2VNWA 4R7BA 4BDGA 4EBWA 4ZTQA 5ETFA 3MVLA 1MRYA 3O8PA 4M3QA 4YHFA 3R28A 2GHGA 4PPAA 1OKYA 4LGGA 5M08A 5H3QA 4NCTC 5K0KA 1YI6A 4F1MA 3D2IA 5LJJA 1YDSE 4AZWA 4IVAA 2YAAA 3E7OA 3MY5A 4TY1A 2YZLA 1KOBA 4LOOA 1R0PA 2YJRA 3QZFA 4FKSA 4PDOA 2R3OA 4ZLYA 5AUYA 3VS6A 5IU2A 5J1VA 1GOLA 4M69B 4CCBA 4BCFA 4DLIA 4DLJA 4FIJA 4Z7GA 2WTVA 2XYNA 2F4JA 3V5LA 5HU3A 3TI1A 5GJFA 2J9MA 3QCXA 5IDPA 2VTPA 3BLRA 4O0SA 2GNLA 5HO8A 4AFEA 1ZYDA 3UMWA 4IJ9A 3MA3A 4NFNA 5CU4A 3DKGA 1FBNA 2WMVA 3W2RA 3G15A 5AP2A 5HG9A 3ORIA 5CY3A 1FVRA 3QQHA 1Y8GA 3NPCA 4CRLA 4IFCA 4RC3A 3OUKA 4JJRA 3RAWA 3B2TA 4FV8A 4TT7A 3W2CA 4R78A 3HMNA 4XJ0A 4LUDA 5HLNA 2PY3A 3W18A 2QR8A 2YM7A 4H1MA 4FE2A 4WOVA 2C5XA 4LI5A 4MNEA 4DFZE 4F1OA 2J5FA 3N51A 3O7LD 4GK3A 5HBEA 2BVAA 3LFEA 4PNKA 1OUYA 4C4HA 4IVCA 2R9SA 2VTLA 3M11A 3TTJA 3G5DA 3BZ3A 3G6HA 4DT8A 2J0MB 3DBQA 4I5CA 5IQBA 2C4GA 3F2RA 4PPCA 2WMWA 4TYEA 1PRYA 4UEUA 5FWKK 1ATPE 4KSQA 1OITA 1Q8ZA 4F6UA 2I1MA 5JFXA 3DB6A 2YCFA 3PY0A 5HCYA 4NZWB 2PZ5A 2CMWA 4FTCA 2V0DA 3OXIA 5EHOA 4IMYA 1F0QA 2OICA 1A48A 5BUJA 4IJPA 3AT4A 4X2FA 4G3CA 3IDPA 3VVHA 5ANEA 3GOPA 3NVKI 2GNJA 5AIKA 3TJDA 3EN9A 3DXQA 4K18A 4JBQA 4RLKA 1KUTA 3QWKA 2GU8A 3D5UA 1ZMWA 5CXHA 3V8SA 2C6IA 3VUIA 5LXMA 3NZ0A 4II5A 3TDWA 4YTHA 2XJ0A 4GUBA 2VU3A 2OZAA 4HNIA 4BKZA 2XS0A 3G90X 3KL8A 4AACA 4AZSA 4YTFA 1KE8A 3HL7A
chains in the Genus database with same CATH superfamily
4GSBA 2PZIA 2W9FB 3FC2A 5E90A 4BZDA 3WF5A 4DTAA 4Y83A 4EZ5A 2YM6A 4USFA 3G9NA 2WQNA 5JGDA 5HG8A 3RPYA 4XUFA 3I60A 4R7HA 4GMYA 3IECA 5AR8A 1YWVA 2B9JA 4U3ZA 4YU2A 1OKWA 1OL1A 4L53A 2BILB 2XNOA 3EFJA 5AR4A 3THBA 4FKWA 4BJJB 5E92A 5CALA 5DR9A 4FT0A 3QCYA 3NNVA 3U6HA 4RIYB 2GTNA 4YZ9A 2VTQA 5KKRC 2J0JA 2WQBA 4KKGA 4CV9A 2XF0A 3R02A 5A14A 4C2WA 1ZYCA 2QOCA 4S31A 5DN3A 3OWLA 5DOSA 2UVYA 1XH8A 2VWUA 4RFMA 2Q0NA 4XRLA 5FUTA 3M2WA 3UIUA 4EJNA 4K2RA 3Q04A 2YM4A 2X6DA 4ASXA 2C6KA 2PVKA 3GCPA 3ACJA 3NWWA 1VEBA 4JR3A 4KBKA 3GGFA 2FVDA 1IG1A 4IVDA 4O2PA 3A7GA 4UYNA 2BMCA 2BRHA 2C6TA 1TQIA 3UC4A 1KE9A 4AXEA 4X2GA 2WTCA 4BTKA 1E9HA 2BKZA 4TYHA 3ZM4A 3G0EA 2PVMA 5AUWA 2PVLA 3DV3A 5F4NA 5IQGA 4DFNA 5ANIA 2A0CX 2VD5A 4UZHA 5IA5A 3RNIA 3VJOA 4F63A 5JGBA 2HZ0A 4AN9A 2XB7A 4W8EA 4GCJA 4ZMEA 2XP2A 4WUNA 3D14A 2O5KA 2OW3A 4QYFA 4DHZA 2Y4IB 4DBXA 2XA4A 4FKIA 4FIGA 3Q4ZA 5H8GA 3RNYA 5AP0A 3Q32A 3LXKA 3FMMA 4F4PA 1IAHA 3OT3A 4WSQA 4EHGA 2RFSA 3CTHA 5EM7A 5C4LA 4ITJA 2XUUA 3LCTA 4BHZA 3FI8A 3S00A 3W0QA 3TM0A 3D7TA 3ZM9A 4KBAA 3UQFA 3DKCA 5E8SA 3F3WA 5DYJA 3SV0A 3UDTA 3FYJX 2VTTA 3QTWA 3LM0A 3QCQA 4QYHA 4JRVA 3DXNA 2UW5A 4DEEA 3SHEA 4M0YA 2PUNA 5B2KA 3FQHA 4D4RA 2FYSA 4PTEA 4ASDA 3NEWA 4C58A 3DLZA 4TYHB 5KHWA 3QD0A 5E8TA 5DLSA 3HRFA 3TV7A 4CRSA 2F7ZE 4PY1A 2WIHA 3OD6X 5AAFA 2JD5A 4O0RA 3WI6A 4L3LA 4E6DA 4I23A 4XG3A 3R73A 1UWHA 4GT3A 5HIDA 4HYSA 4D2TA 4QMZA 1YDRE 2XNGA 3IS5A 4G34A 3RWPA 2C3KA 2UW7A 1DI9A 3DQXA 3IOPA 1FINA 3PPJA 2GS2A 4V01A 4F9YA 3BU5A 3POOA 5AUUA 4QMQA 4M67A 3UO5A 3WE8A 4AW2A 4M66A 4D1ZA 3UZPA 3BHUA 4FZDB 3Q2JA 3OP5A 5E4HA 3NAYA 2R3KA 3D7TB 3DA6A 4O4FA 2Q0BA 5EFQA 4YTIA 1DM2A 5CSWA 3S1HA 5IA4A 3QZHA 4I93A 3K5VA 4I20A 3W0SA 3TIYA 3ELJA 3VUHA 3UDBA 3WF6A 4A07A 4GIIA 5GZ9A 5CSHA 1OIQA 5K4JA 3FV8A 4O6LA 4RFYA 4BDFA 5M4UA 4GKHA 2ITPA 5E8UA 4ARKA 5F9EA 4G6LA 4DF3A 5FM2A 1WBOA 3A4OX 4QPAA 2FO0A 1H28A 4E1ZA 2XEZA 3FQEA 4A9UA 2VUWA 4ZLOA 2WKMA 4CFNA 2BTRA 2X39A 4KS8A 3LOKA 2H8HA 2W4OA 1G8AA 4MNFA 3HMMA 3LFNA 1OVEA 3QU0A 2IZTA 4EHEA 4ANNA 3Q60A 3FMKA 1YW2A 4OTHA 3QTQA 2W1EA 3UQGA 3MDYA 4R3CA 4QP7A 3O7LB 3U51A 2R3PA 3UOKA 2IN6A 4H36A 2JIVA 3UJGA 2JIIA 5IQEA 4IADA 4W8DA 5H2UA 4IBMA 1MQBA 4J8NA 2XCHA 1OL5A 3ALNA 2W96B 3WOWA 4HVIA 2ZM4A 4FGRA 2XK6A 4GT5A 3F61A 2OIQA 4IWDA 3LIJA 5GZ8A 2OO8X 3UE4A 4IIRA 4BCOA 4IB1A 5JMSA 3R7GA 1OBGA 2RG5A 4OTWA 2YEXA 3FSKA 3HMOA 3K3IA 4O21A 4JRNA 2OIBA 1V0OA 3OZ6A 4TYJA 3AC1A 4I24A 5HE1A 3ATTA 4RRVA 3HX4A 3D15A 2IZSA 3MVHA 2VX3A 4RZVA 1XQZA 2OH4A 3MJ1A 3VS7A 4IQ6A 3BL9A 2OF4A 2G1TA 4R5SA 3B8RA 5AP3A 3VBQA 2CCIA 5HZNA 5B2LA 4OBPA 1OIYA 3ZLYA 5BUEA 2OJFE 2QKRA 3BGQA 3P7BA 4FTKA 4K77A 4YHTA 3QA8A 5HBJA 2XKDA 3GC0A 5GNKA 5J8IA 4TNBA 1GAGA 1FMOE 1JSTA 2YDKA 3A61A 3PJ8A 2XNBA 3Q9WA 5JRQA 5LOHA 3FQSA 4V04A 3IPHA 2ITZA 1RE8A 4OGRA 3F3ZA 2CKEA 3QFVA 2XAMA 4FNYA 3LFBA 4U7ZA 5FEEA 4BWXA 4EH2A 3OROA 5L6OA 1R0EA 3ZLSA 1UKIA 3LJ1A 4QP4A 4XG9A 3OOGA 3P86A 1M7QA 5AFVA 2W1FA 4HYIA 3Q9XA 4S32A 4N70A 4FL3A 1SMHA 1FOTA 4DFUA 4F7SA 3Q52A 3LZBA 5HIBA 4CEGA 3ULZA 3DOGA 4NK9A 3TZMA 1CM8A 1RW8A 1Z9XA 4KA3A 4UYAA 2OXDA 3NLBA 4G9RA 4GIHA 3BE9A 4OT6A 4KIKA 4F64A 2DQ7X 1VYWA 4ID7A 4S2ZA 3DT1A 5IA3A 3EN5A 2WMTA 3HMIA 4RIWA 2XNMA 2BIKB 4ZS0A 2ZAZA 4BCMA 3QKMA 2PZYA 4DTKA 3V01A 4XV1A 2IPXA 4KKEA 1OL2A 2R3IA 4YO4A 4DHJA 4FV7A 5CLPA 2XBAA 3PP0A 4FODA 2F49A 4YBJA 4BIBA 4MXOA 4Y5HA 1DI8A 2UZNA 5LMKA 3FMDA 4TL0A 3LHJA 5JSMA 4CLIA 3MFUA 3QAME 1J7IA 1PXNA 4EK5A 4AOIA 2UZLA 3G9LX 4FV9A 1M7NA 2V62A 2OLCA 3UIBA 2OIDA 2QOOA 3QXPA 5DVRA 1B38A 3UVQA 3GP0A 4BDDA 4KRDA 4FA2A 4O7SA 2JEDA 4IAIA 5L3AA 3DGKA 3E5AA 3TNPC 2W5AA 4ZJVA 2F9GA 4EOPA 3B8QA 4AA4A 3DCVA 4XG6A 3UDSA 2ERKA 4EOLA 4F9AA 4FGBA 5JN2A 3QHRA 2PVJA 4C7TA 4KIKB 3P5JC 4I3ZA 3BYMA 4BGHA 5CS6A 4OAVB 4OLIA 2XZSA 3CXWA 4UZDA 4YGAA 3VULA 2X0OA 3BEGA 4RIWB 2VRXA 4IX5A 4ANMA 4FTJA 4BDHA 3HRBA 3MTFA 4EI4A 4EOQA 5EI8A 3S4QA 1T46A 3EQIA 5M4IA 1PMUA 1YOJA 1YXTA 1F3MC 5DBXA 3TZ7A 5AV1A 3VS2A 1J7UA 1IA9A 4CFFA 3QRKA 3A7HA 5BVKA 3Q4TA 3CD8A 3UO6A 5HTBA 2NYAA 4KUJA 3IW7A 3PA3A 3KRJA 4S33A 4CQEA 4IB3A 3ZBFA 3KRRA 4RSSA 4BDJA 3NNUA 5KMNA 1PMEA 3KRXA 2X7FA 1SVGA 1CSNA 3OEFX 4FT7A 3ANRA 5IA2A 5AAEA 3LCKA 4FT5A 1W82A 2BDWA 5AR3A 4ZTRA 2IO6A 4DFXE 3RJCA 3COIA 5CU0A 3ZTXA 2QI8A 3DJ6A 3OCBA 3HV7A 5FRIA 2ZDTA 3ZO2A 3R7YA 5C8NA 1UU9A 1ZLTA 5A4QA 3MS9A 3A2CA 3KK9A 4QMTA 5FDPA 3MFRA 3POZA 3O0GA 2RFDA 3REPA 5ANKA 5IF1A 1LPUA 4W9XA 3F5GA 3QQUA 4XMOA 4XS2A 3IW8A 5C26A 2C0IA 4V0GB 2B52A 2Y9QA 3GCQA 2Z7RA 5BVEA 3UTOA 4WNKA 3OFMA 2UZTA 2BR1A 3L9PA 1JOWB 4CYIA 5DEYA 2E9VA 2UZEA 3RPSA 3ZDIA 1W83A 3EMGA 3H0ZA 4JX7A 3BHHA 4YZCA 5FQDC 1SVHA 2ETMA 2I7QA 5E9EA 4U41A 4X2NA 3UOJA 4QQCA 3ZMMA 2BPMA 3NYVA 3ZOSA 4DH3A 3ZBXA 5J7BA 4N57A 2VWBA 5AR7A 1WBPA 5EOBA 1QPEA 3K2LA 4C37A 4BDCA 5HQ0A 2GHLA 3WZEA 2I0HA 1PXJA 4GFMA 1PJKA 2WGJA 4FSUA 2WB8A 4KIPA 5JEBA 1UNHA 5BPYA 4PTCA 2AYPA 2NPQA 4D55A 2JDRA 4YNEA 2IG7A 2WELA 4XG2A 2QR7A 1OUKA 2B4SB 2F7XE 3R22A 5I0BA 4XCUA 3KY2A 4DAWA 3R01A 3LVPA 5HTIA 5DG5A 4NM3A 3PJCA 3PZHA 4CG9A 4FYNA 2BZKB 4XNEA 4X21A 5CZIA 3BGPA 1OPLA 3QRIA 2Y6OA 2OJJA 4MD8E 4IFGA 4H3PA 3NW6A 3NRMA 2A98A 4MXYA 4OTGA 1G8KA 1H8FA 5KZ0A 1YDTE 3VBVA 2WMQA 3R1SA 2PUUA 4RC4A 4XBUA 4O6EA 3DZOA 5DI1A 3V51A 3OHTA 4H58A 1HCLA 2W5HA 3LM5A 1YHSA 5C4KA 3MN3A 3OY3A 2V7OA 3GI3A 4CXAA 1Q4LA 1WAKA 3PVGA 5DPVA 4GU6A 2FB8A 4AWIA 4EH7A 1JBPE 4ZTHA 4ZEGA 1CKIA 3D2KA 3RM7A 4ZAUA 4DEIA 4Y95A 1LUFA 5I9YA 3UVPA 2W1GA 3HP2A 3QQFA 4IEBA 1H07A 4U80A 1JVPP 3FMNA 4OUCA 2JDVA 4B99A 3O8UA 3FZTA 5LMBA 2ITOA 2RFEA 4O0UA 4I0TA 2XK7A 3KF7A 4YJSA 5LMKC 3ZLWA 3LMIA 2WXVA 4O0XA 5EQPA 3Q9YA 2HCKA 4Y85A 1XHAA 2NP8A 5IKWA 1XO2B 4D9TA 3OXZA 4IWQA 1H25A 3VS5A 2QONA 1KWPA 1YRPA 2WQEA 1WMKA 4QP3A 3R8LA 1U54A 4PP9A 4CFVA 4PDYA 2R3GA 4MCVA 1UU8A 4BKJA 4LV8A 3C4EA 1P4FA 3CQEA 3T9IA 4C35A 1ZYSA 4NW6A 3UP7A 3EFWA 3PIXA 4L45A 3R9OA 5BVDA 1TKIA 4MBLA 3C51A 2QQ7A 4L52A 5KMOA 3TUBA 3UQCA 4O84A 1WVWA 2C6MA 2JKOA 3CQWA 3V8WA 2DWBA 2HIWA 4QYGA 4HCUA 3DJ5A 4LOPA 4ALVA 2YCSA 3E93A 4F0FA 1O6YA 5J9LA 4X0MA 3F3UA 3FI3A 1ZAOA 2YZAA 3ORXA 4HNFA 3V5JA 3EWHA 1O6KA 1YXVA 3HV4A 4EC8A 2PPQA 4MEDA 4MH7A 3D83A 2JDSA 3R7UA 2OZOA 3VUGA 4PP7A 1OGUA 4OW8A 4C0TA 1QMZA 3MTLA 4DGMA 3ODYX 3BV3A 2VWXA 1OM1A 3OCTA 3WILA 5M44A 2BRMA 1REJA 3KGAA 4FL2A 1XH7A 4N0SA 1XMLA 2VAGA 4E6AA 3KN5A 4PL3A 4O7NA 2XIYA 1PMNA 2QO2A 3LCDA 2CCHA 5EM5A 5J79A 4MUQA 3N4UA 3JR1A 3MYGA 4UMTA 3PXRA 3V8TA 3NS9A 3AOXA 2JKQA 2VV9A 1J1CA 2J7TA 5HI2A 3ATSA 4PTGA 4ZS4A 4PMSA 1QL6A 5H8BA 4JAJA 3BPRA 2WQOA 2QO9A 4D1XA 3AC8A 2RF9A 2VO0A 5L8KA 4CTCA 2BIYA 2BAQA 3OTVA 2XAOA 4NTSA 3WYYA 3SX9A 1JPAA 3EZRA 3R0TA 2B55A 1BUHA 1FVVA 4O81A 3C4CA 3OWKA 4FTMA 5G1XA 3P78A 5AMNA 3ID6C 1AQ1A 3H3CA 4QMOA 3F66A 2QHNA 3FKOA 5EKOA 1R1WA 5AM6A 1GIHA 4ZTSA 4A9SA 4NYEA 3HA8A 5CZHA 2ZV2A 3R21A 5J5SA 5FTGA 1W7HA 3OCGA 3AT2A 2UZOA 3UG1A 3MIAA 4IC8A 4XBRA 4F7NA 4CMTA 2HWOA 4FTAA 4FZFB 5HORA 2XBJA 4EORA 4M7IA 3PA4A 4BICA 2CKQA 4TKSA 2OH0E 5CI7A 3RBWA 4EEVA 3W16A 5HTCA 2EUFB 2KTYA 2BDFA 2LGCA 2X0GA 1LR4A 3AD6A 1M17A 1Q8TA 3GQLA 4FEUA 3I5ZA 1UNGA 4E5BA 5AA8A 4I4EA 4L3PA 4F7LA 5KMJA 4M15A 1J1BA 2XNEA 3DK7A 1Y6BA 3DBFA 4EZ7A 3TIZA 3DKOA 1ZZLA 2WNTA 3IKAA 3GU5A 4CNHA 5GIOE 3R2YA 4JS8A 3OEZA 4LL0A 4UXLA 5DIAA 4Z16A 5F1ZA 2XKEA 3VN9A 2JDOA 4ZSAA 3PDTA 2DS1A 3ZSGA 5LWNA 3FLSA 1Q8UA 4UX9A 3EN6A 2ZDUA 1Q3WA 2GNIA 3MSSA 4HYHA 3PVUA 4FT3A 2RG6A 3ZZEA 3W0PA 2BZHB 2QOHA 4RG0A 5JZJA 3TG1A 3MW1A 4I92A 3ACKA 3VJNA 3NYNA 1XH6A 5FDXA 3ZUVA 2H34A 4FTLA 4MTAA 1OIUA 3K54A 3SVVA 1BI8A 4O0TA 3CY2A 4J97A 1Z57A 2BAKA 4AW0A 3BE2A 4FYOA 4FEWA 5AUTA 2OF2A 3HVCA 2PULA 4D2WA 1FQ1B 5KKRB 4C3RA 2IF8A 5D41A 4AXDA 4F6WA 4RWJA 4AZFA 3OOMA 3ZRMA 3DB8A 3GNIB 3NW5A 4I5HA 4BRXA 1YHWA 2R3MA 4LRJA 4WNPA 3AG9A 1IAJA 4ORKA 1UU7A 5HD7A 2UZBA 3CR0A 4ZJJA 2X0PA 4F0GA 4DITA 5FD2A 2YCQA 4AX8A 3UPZA 5CAPA 4APCA 4GRBA 4CKJA 3UYTA 4HGEA 4JQ7A 4DG0E 5CT7A 3L1SA 2BUJA 3R8ZA 1Q8YA 4D5HA 1KSWA 4RX7A 3T3UA 4MF1A 4TTHB 1H1PA 2ZV7A 4O83A 1AD5A 5C9CA 4BZNA 4LFIA 4K8AA 3H4JA 4U44A 4EOJA 3KXGA 4P5QA 3CGFA 5CEOA 3BCEA 4D0WA 1PXMA 4AT4A 2OI4X 2R3NA 5L2IA 3A99A 4DFLA 3WF8A 3D5WA 1QCFA 2XK9A 4F70A 1LEZA 4RWKA 4C36A 2CN8A 4HOKA 5AP5A 1TFFA 2WOTA 4L6QA 2XANA 5GZAA 1H1RA 3WF9A 2PSQA 2PK9A 2JITA 2HENA 2QURA 4I6HA 3SRVA 3UNJA 4BI2A 2O64A 4BGQA 4EH4A 4EWQA 5KMKA 1A9UA 3FZ1A 5KCVA 3MPMA 4UWCA 4P2KA 3SW4A 3LXPA 4D4VA 3LJ2A 3QUPA 2QU5A 4JIAA 5KZIA 4ALUA 4APPA 3Q4CA 5ACKA 4CMUA 4FK3A 2BKKA 2C0OA 5CVGA 5FEDA 2CNUA 2BZJA 2YERA 3OCSA 1VJYA 4K11A 4UY9A 4BYJA 3PY3A 4WG3A 2CNVA 4I6QA 3VF8A 2P55A 4KNBA 2F57A 5L8JA 3BEAA 1AGWA 3D0EA 4EKLA 4F78A 3QLFA 1URCA 2C3JA 4FSTA 3I5NA 2ZJWA 4U3YA 4O1OA 4ANBA 2F2UA 3BYSA 3E64A 2ONLA 5I5ZA 3EZVA 2W1IA 3F9NA 5A3XA 3RVGA 4MX9A 4P7EA 4ZY5A 4G5JA 4NTTA 1REKA 1PXPA 3R9HA 4DEDA 5J9YA 1Q8WA 3SKCA 3GFWA 3KULA 3M1SA 1I44A 3PUPA 3R8VA 1FPUA 2CN5A 4G3FA 5J1WA 3LXNA 2VTOA 4YR8A 4EL9A 3F7WA 4RVTA 4MNEB 4AW1A 4IAYA 4L67A 5HNIX 1PXKA 4UMQA 4MKCA 4UV0A 2YACA 3R9DA 3KCFA 3BWFA 2HZ4A 3HNGA 3H10A 3P79A 4TWCA 4FVPA 5AR2A 4D1SA 4DEHA 5DT4A 1XH4A 4I1ZA 1CKJA 1WBSA 4G9CA 1MRVA 4O91A 4QMVA 4XOYA 5HNGA 3V04A 4JXFA 3F6XA 4ZZMA 2I6LA 1U59A 2GFSA 2R7BA 5LVNA 4A9TA 4C4EA 3QD2B 3TMOA 3NAXA 2Z7LA 2R3RA 5HO7A 3QHWA 4QMLA 5FEQA 5L2QA 1XJDA 2PZRA 2QOFA 1B6CB 4IX3A 5CYIA 2J0KA 2VO3A 1DAYA 1PKDA 2XKFA 1GNGA 4WBOA 5A9UA 3PLSA 3MPTA 4FV5A 5FLFA 3GU7A 4ASZA 1NA7A 4ZSJA 2ZMCA 3BHTA 4WG5A 4D58A 5ANGA 5M4CA 2RSVA 5FGKA 2UW0A 5M55A 5EDQA 4XP0A 4FKTA 2JKMA 5CNOA 3KMMA 2WEIA 4P90A 4TPTA 3ZCLA 2C3IB 1FGIA 3DLSA 3MVMA 3HUCA 4CSVA 3SG9A 1ZOHA 5C27A 2OZAB 2YITA 3F2NA 2EWAA 5BQ0A 5BV3A 1MQ4A 3PXKA 4CV8A 4PL4A 3KMUA 3R7VA 3FXXA 4DN5A 2R3LA 2C68A 3FEGA 3N9XA 4X3FA 4MBIA 3R9RA 4NSTA 3TKHA 4B6LA 1W8CA 4RLLA 3EOCA 4A4OA 4AS0A 1W2DA 2VTJA 2CDZA 4KAOA 3ZYAA 3BLHA 4F09A 5LVLA 2BHEA 2QCSA 4FG8A 5CAOA 3RK5A 4O7YA 4FTIA 5EW9A 5CU2A 3HGKA 3F5XA 3LQ3A 2Z7QA 3CD3A 4YJRA 5GIPE 3DJ7A 3ZLXA 5IMXA 1GZKA 2QOIA 4GFOA 2VN9A 4JDIA 3GCVA 4MXCA 1ND4A 5G6VA 3I4BA 2IW9A 3DQWA 4IAFA 3DNDA 3NIZA 3IOKA 4K0YA 3PIYA 3W0MA 4K1BA 5TF9A 3SDJA 5AJQA 2UZWE 5JQ8A 5E8ZA 1ST4A 2Z2WA 4NKAA 4IM0A 3QF9A 5AIRA 2CGVA 3U4WA 3E8CA 3ETAA 5C01A 4ZJIA 3V6RA 3KXHA 4Z7HA 3FLQA 3UMXA 2J51A 4YJPA 3DXPA 4X3FB 2W0JA 5EH0A 3P08A 3Q9ZA 4L42A 3UZRA 4TWOA 2ETKA 5IH4A 2E9OA 5E8WA 2YLFA 3BYVA 1URWA 5DFPA 2PUIA 4R6VA 1KV1A 5BVOA 4GT4A 5E7RA 1I09A 5I9ZA 3UDZA 3PXQA 1Q41A 4YMJA 4IX4A 4O7WA 4FMQA 3ML1A 4GFGA 2HZIA 3C5UA 4FC0A 3U9CA 4HW7A 3DFCB 5HIEA 1XH9A 2X81A 4RX9A 3PA5A 1FMKA 3TDVA 2C47A 2ITUA 4YZNA 3K3JA 4FSNA 4DGNA 3D9VA 3ZC5A 3FMEA 3GC9A 3V5WA 4DC2A 2YA9A 3CKWA 3F5UA 3FMHA 3KXXA 5ANJA 4AGUA 4I4FA 4O7VA 5CAQA 3EFKA 4C59A 3LMHA 4FTUA 4C3PA 2IVVA 4TYGA 5I3RA 5BX0A 1JKLA 2C1AA 1JWHA 4R1YA 2XIZA 3P1AA 2R64A 1QPCA 3SA0A 1TVOA 4G6NA 4QPSA 4M97A 5IUHA 3OG7A 2JDTA 2P0CA 3KREA 3FXWA 4MXZA 4JT3A 4RA4A 3RAKA 5L8LA 1NT2A 4AU8A 1YXXA 3RZBA 5A4TA 2PWLA 4UBAA 2VTNA 2XK3A 2B9HA 4XP2A 3A7IA 2G2IA 1UWJA 3RCDA 2ONLC 4AT5A 3R63A 4CGAA 1YWRA 4FKLA 3VUTA 5KE0A 4BY9E 5FM3A 3R9NA 4YZBA 2F2CB 4FIHA 5AAGA 4BCKA 2BFXA 2Y6MA 2X8IA 4Q9ZA 4AOTA 4C57A 1YXSA 1WFCA 3EQCA 5CAVA 1SVEA 4BBFA 3AMAA 3PE1A 3E92A 4PX6A 4HVSA 5FBOA 2C6DA 5CSXA 4QOXA 4HZRA 3EQFA 2O8YA 2ZMDA 5H9BA 5LVPA 4ANSA 5FTQA 1BL7A 2OK1A 1W98A 5CVHA 4EUTA 4E26A 2BRGA 4HVGA 5M56A 1BYGA 4FT9A 3RMFA 4UWYA 2BRNA 3BIZA 4XRJA 3LQ8A 3AD5A 4O22A 3UIMA 1BLXA 4E4XA 4NW5A 3QA0A 3QALE 4G31A 4O1PA 5EDRA 3JS2A 4AG8A 3TKIA 5DGZA 4HGLA 4TNDA 1S9IA 2PTKA 1K9AA 2J0IA 3V5PA 4EK3A 2WMSA 4X7QA 4YZMA 5KNJA 4Q9SA 4ZY6A 2C5YA 1JSUA 3I79A 2QLQA 3DAEA 3E62A 2C3LA 1U5RA 2QKWB 4FSWA 4WHZA 2RFNA 5CTPA 4D2RA 4F1TA 3I0QA 3KEXA 3UG2A 3FKLA 4HGSA 2XCKA 4FUYA 1KV2A 1XWSA 2HXQA 3U54A 3IO7A 3PWYA 3NR9A 3PRFA 3O71A 4I5MA 3ORNA 3T8OA 4F7JA 3C4XA 3KQ7A 5D12A 4E6QA 3E3BX 4X3FC 4HPUE 4JQ8A 5IMEA 3M42A 2PUPA 4N4SA 4H3BA 3DY7A 4CCUA 1IASA 3JXWA 4AGDA 2IVSA 2JIUA 2O65A 2HY0A 3PRIA 3W0RA 2VX0A 4BDKA 4CYJA 5HG5A 1UNLA 3D4QA 4ZMFA 3PXZA 4YC8A 4K33A 4JBOA 4RMZA 4ALWA 3IW4A 4FSZA 4A9YA 1FGKA 4BI1A 3QCSA 4A4XA 4GKIA 2PVYA 5DE2A 3FZSA 3I6WA 3NW7A 4J71A 5FXQA 3KRWA 4HPTE 3NFGB 4G5PA 4AZVA 5JH6A 4HJOA 1OKZA 3GUBA 2Y8OA 4CKIA 1M2PA 3RP9A 3F3VA 1Q61A 3C5IA 4BWKA 4DEBA 4ENYA 4FRFA 1IA8A 5CNNA 2ZB0A 5M06A 2CLQA 4BKYA 3QC4A 4IXPA 1DS5A 2W1HA 1SNUA 5FXRA 1GZ8A 4QTCA 4TW9A 4W4VA 5HX8A 4C34A 4ACCA 3BBTB 3FWQA 2J90A 4DGLC 3C50A 1VR2A 3KRLA 3AKLA 5GJGA 3BYOA 3UGCA 4BL1A 5CSPA 2V5QA 3HEGA 4FBXA 4PMMA 4BGGA 4LMUA 4QQTA 3NUSA 4XLVA 3KF4A 5EHYA 5HU9A 2W5BA 2QOKA 2NNWB 3GFEA 5CQUA 3TNHA 4U43A 5KMIA 2X1NA 5M4FA 1PXLA 4FV4A 2C69A 2JAMA 1B39A 1LEWA 5CT0A 3U4UA 4E20A 2CGWA 5IA1A 2UW8A 5EM6A 2Z8CA 4KS7A 4HCVA 2CSNA 4C4JA 4EWHA 2J50A 3A8WA 3KK8A 3PVWA 3BRBA 4G1WA 3S3IA 3Q6UA 3G33A 2O63A 4GUEA 5LVOA 4O7TA 3Q5ZA 3VF9A 2XIKA 4O86A 4AZEA 4NH1A 4PUZA 4M13A 2YLEA 1JQHA 4RJ6A 3ZZWA 2GQRA 2H96A 3AKKA 5M57A 4PDPA 2WIPA 4AA0A 5AUXA 3VQHA 5JRSA 4XX9A 4C61A 2GQGA 4TXCA 5BVNA 2P3GX 5JT2A 3PUFC 3VONA 5IQHA 1MUOA 3BWJA 4AGWA 4GYIA 3UNZA 5EDPA 3RINA 4C8BA 4YO6A 2X6EA 3ZSHA 2XVDA 5KBQA 5CEKA 1WZYA 3RI1A 2PE0A 4QMUA 4IDTA 3RK7A 3S0OA 4DDIA 3D5XA 3BU6A 4CFUA 4YP8A 4Z3VA 4ACGA 4TRLA 2WTKC 3MWUA 2IVUA 1ZMVA 3CC6A 4J99A 3ZC6A 3R8PA 3AXWA 5CXZA 4LMNA 3PTGA 2IJMA 4OTPA 2YHVA 3OC1A 2VNYA 3FXZA 1ZMUA 3AC5A 3OT8A 4RQKA 5DHJA 1WCCA 1E1XA 3EFLA 2W1CA 2YIYA 3ZSIA 4Y8DA 2WPAA 4MD7E 2IEWA 3DDQA 2XRUA 4MQ1A 4QRCA 5HLPA 2XIRA 3GVUA 5IH6A 3PSBA 4QTBA 4I41A 2QODA 3QYZA 3OVVA 3NUUA 3KN6A 5BUIA 1PYEA 4S30A 2XALA 3TWJA 4CT2A 1QPJA 4WRSA 2W4KA 3P4KA 4NFMA 3UODA 1SM2A 2R0IA 2WEVA 4F9WA 4UMRA 2P2IA 3VBXA 4RJ5A 5E8VA 2EXEA 3WE4A 2C5VA 4KINA 1R78A 5CAUA 3U6IA 1CKPA 4HVDA 3FLNC 5BMMA 5IH5A 3WZJA 5KBRA