3OFMA

Structure of a human ck2alpha prime, the paralog isoform of the catalytic subunit of protein kinase ck2 from homo sapiens
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
325
structure length
325
Chain Sequence
SRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha'
publication title Structural basis of the reduced affinity between the protein kinase CK2 subunits CK2alpha prime and CK2beta
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 114
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ofmA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ofmA02
3BGQA 2PTKA 3U4UA 1UWHA 3IGOA 4JDJA 1ZXEA 2YN8A 3LE6A 4NKSA 5HNBA 5IQEA 3AXWA 1UV5A 3KF4A 5CASA 3SC1A 2JAMA 1MRUA 2PVYA 4H3PA 2YIXA 4MK0A 4X3FA 3R0TA 4AGDA 4MBJA 4C0TA 5LMKA 4HGEA 4JI9A 2R3HA 1Y57A 5ETIA 4FTLA 1DAYA 4FZDB 4HNIA 4H05A 2WEIA 1WBPA 3EQFA 2YIQA 4D2TA 3ALOA 2IN6A 5ETAA 3TNWA 2GSFA 1PJKA 3ZXZA 4IWOA 2XJ0A 2HY81 4EUUA 5AP2A 2J0JA 2OH4A 2WKMA 3IK3A 2GNFA 5EI2A 3R8PA 4Y85A 2OXYA 5CNOA 2X6EA 1W0XC 4LG4A 3NYNA 3LZBA 2R5TA 3QU0A 5HCZA 5LVOA 2X8DA 3VS0A 4N6YA 4NSTA 3PXFA 4Y5QA 3TDWA 4BFMA 2W1GA 1YDRE 1YW2A 3DK3A 5FWKK 2WGJA 5HG7A 4NKAA 1YHSA 1KV2A 3Q2JA 2YERA 4WG5A 1FGKA 4PUZA 1SNUA 3NCZA 3NZ0A 1YDTE 3BLRA 1H07A 2YWVA 1IRKA 4HYUA 3QUPA 5LWMA 2GNJA 4TWNA 3OP5A 3FHIA 5AR2A 1QL6A 3HMMA 3W8QA 4TYHA 2XCHA 1W8CA 2P0CA 2X81A 5HHWA 3V6RA 3U6JA 2CN5A 3B2WA 2W5AA 1O6YA 3KL8A 2VWXA 4KIPA 4RWIA 5EG3A 3HGKA 3DOGA 2GNGA 4E20A 2I0YA 4QYEA 1UU8A 2VX0A 2IG7A 1BYGA 2FSTX 2CGUA 3U51A 2CDZA 4LUDA 2ETMA 4ZTHA 3NSZA 1P5EA 5AV4A 1KSWA 4MD8E 2QONA 3Q9YA 5KX8A 3IG7A 2G15A 4UY9A 4OTQA 1Q8TA 3GVUA 4CFFA 4D2WA 5IF1A 4RVTA 5KE0A 3C4FA 4KBAA 2OSCA 4FT3A 3VVHA 4EOOA 3V01A 4PQNA 5AX3A 5CF5A 4QTBA 5K0KA 4FTUA 2BR1A 3VBQA 4O0XA 3MPMA 4AFEA 4HYIA 4OTFA 5C8MA 2OZOA 2ZMDA 3L8XA 2YCFA 5FXQA 2RIOA 2JIVA 4GK4A 2IW9A 4FIFA 3VJNA 4BDJA 5HO7A 4FSZA 2EB2A 1ZLTA 4BZNA 4GFOA 5A9UA 2X9FA 5D10A 4EEVA 3D5UA 1PKGA 4E6QA 2IZSA 3AC2A 4NZWB 4O0SA 4CFMA 3QZHA 3LJ1A 2OJIA 3RALA 4XYFA 3U4WA 2I7QA 1GOLA 5KZIA 4U79A 1Q24A 3Q4UA 4RVMA 2W7XA 3T8OA 2W1EA 3DK7A 3FMDA 2E9VA 4C3PA 4FNWA 4EHZA 2F7EE 3QRJA 2C3JA 4OW8A 3F5UA 4FTKA 3HMPA 4IE9A 4JAJA 1JOWB 1OUKA 3TZ7A 3QFVA 3GNIB 5CLPA 4AA5A 2GNIA 2PHKA 1CMKE 2UW7A 2VO3A 4JG7A 3F9NA 2EWAA 2QO2A 4WNPA 2YIWA 3CTQA 2VZ6A 1UU9A 5ACKA 3KRJA 4EH8A 1BI8A 4L3LA 4D9TA 3T9IA 1GZNA 5DLSA 3OFMA 2GQGA 2PULA 2YFXA 3POZA 4OUCA 1HOWA 1VYWA 3VWAA 3L9LA 3DXQA 3KXGA 3R7IA 3IW8A 2ZM1A 4DTKA 1K2PA 3C4XA 3R04A 5IA1A 3CY2A 2WPAA 3EL8A 3RZFA 4E4NA 4UMRA 3S95A 4MH7A 2VWIA 4I5CA 3I7CA 5CXZA 5A4LA 4D2PA 4FV2A 4QPMA 3IDBA 3LCOA 4B6LA 4F6SA 4BTKA 2FUMA 4D9UA 3C4EA 3SAYA 2PMOX 3BEAA 3FYJX 4KA3A 2XKDA 5LQFA 4L68A 5BPYA 4PV0A 4YLLA 3VS4A 2R3MA 2F2UA 2XYNA 2ZB0A 3EFWA 1XBAA 2C1AA 3OY1A 4JG6A 5IQHA 2W96B 1I44A 3V8WA 2HAKA 2XCKA 3BI6A 1O6LA 1J3HA 3HRCA 3LJ0A 4FKIA 1LP4A 2BDFA 3ZCLA 1Q8UA 5CF4A 3ZSIA 2F2CB 2PVNA 5M4UA 3MY0A 3ACJA 2X4FA 5CVFA 3ET7A 2BFYA 3OC1A 3OT8A 1MP8A 4O1OA 5DGZA 1Q4LA 4Y83A 4BDCA 4YLJA 3G0EA 2O64A 5BVWA 1Z57A 2HWPA 4ZJIA 4AX8A 3HECA 3PXKA 4MXZA 3Q52A 3QQJA 4IZAA 5ANDA 5H9BA 2GHLA 4QMMA 2ITOA 2WMTA 4AACA 4BZOA 1IAHA 3EWHA 4M68A 5EYMA 4B8LA 1PRYA 3H4JA 5FEDA 1OZ1A 4XOYA 3P86A 3M2WA 4YZBA 4CG9A 1ZYLA 2J51A 3PA5A 2OIDA 2QI8A 3C13A 4FOBA 4I6HA 4M0ZA 2YJRA 4JQ8A 3HRBA 4QTCA 3QTIA 4BTFA 3QD3A 3PXZA 4NM7A 3TZ8A 4C61A 4OTWA 3ZDIA 1UU7A 2PUIA 3EN5A 3TUBA 4N4SA 2HW6A 3NUPA 2V0DA 1HCKA 3R02A 2X0GA 4FSYA 4QMXA 4YC6A 4Y72A 2BTRA 4R3RA 5CF6A 5FUTA 1WVWA 3EQRA 2UVYA 4AFJA 3AMYA 3QYZA 4E73A 5M08A 2UZUE 2ZB1A 3DU8A 3P7CA 4FL3A 4M13A 3DS6A 4RJ7A 4BBMA 4NJDA 1Q99A 3BYMA 4PMMA 3P08A 1WVYA 5CAPA 5L6PA 2HOGA 2YDIA 4HYSA 4WA9A 5E8XA 4O7WA 3IPHA 1FQ1B 3DCVA 4E6CA 4Y95A 5K5XA 3U55A 5AJQA 3PDTA 4W4VA 4USDA 5HE1A 3NVMB 2UZOA 5FXSA 4DFLA 1H28A 3R1QA 4YZ9A 3WARA 4MAOA 5L2SA 4FT0A 2JEDA 4GT4A 4JDKA 4K18A 3S2PA 1JQHA 3ZSHA 4BCJA 2XNEA 4YJPA 4UB7A 4GKHA 4W8EA 1SZMA 4MWIA 4XG2A 5IA5A 3PSBA 3THBA 4H3BA 3VUTA 4FTQA 4I20A 4D1SA 3G6GA 5AV0A 4H1MA 2QG7A 4DG2E 5AUUA 3SOAA 1U54A 3CGFA 2YA9A 4P90A 3GOPA 3BHUA 3R28A 4FG9A 1GY3A 2I6LA 3UGCA 4KUJA 4OBQA 3FBVA 3IQ7A 3QZIA 4CCBA 1H24A 5ANJA 1OITA 5E1SA 3ZU7A 5G1XA 3BRBA 3EFLA 2ZYBA 3R7VA 1R0EA 4GJ3A 4NIFB 1OKYA 3QUDA 3HNGA 3IECA 2PU8A 2B1PA 3AGMA 2NPQA 1PXKA 1SMHA 4FV1A 4FKWA 3RNIA 3D5WA 5KMLA 4AW5A 5IQDA 4I92A 2JFLA 3L9MA 1OM1A 4ACMA 4APCA 4YNEA 1OL1A 2C68A 3R63A 2HK5A 5M07A 4MF1A 2H6DA 4JDIA 4E1ZA 3IS5A 4KNBA 4C02A 3ELJA 3VF8A 1AGWA 2C0OA 4NJ3A 3DBCA 5JGDA 3PJCA 3HYHA 4L43A 4D4SA 5DEWA 4OAVB 3SG8A 5GIPE 3BU3A 3MFSA 1PYEA 3HRFA 5DT0A 3FLQA 2E9NA 1A9UA 3OUKA 1YKRA 4QMTA 3R9DA 4BCOA 4GW8A 3AOXA 3PA3A 2OJGA 2YIRA 4EHGA 4EWHA 5HLNA 4GG5A 3QD4A 3NRMA 2PYWA 2XK8A 2JD5A 3EIDA 4K77A 2V7OA 3UDBA 3WOWA 2HENA 4BCGA 1R39A 4YO6A 3LM0A 4O83A 3GC0A 3UIBA 2E2BA 4QTDA 3L8VA 3OF0A 3QTXA 4PY1A 3BU6A 1H00A 3VUIA 4X3JA 5DA3A 3A7GA 3FZPA 5JFWA 2J6MA 2QODA 4CTCA 2HXQA 2I40A 4PDOA 3DAEA 3FY0A 3KY2A 1XH4A 2X8EA 4AE9A 3S1HA 2J7TA 2R7BA 2PZYA 2QD9A 3O17A 3Q96A 4UZDA 4JDHA 2CPKE 2IVSA 3QYWA 4O38A 4A9UA 5CY3A 3MPAA 2YM5A 3TG1A 4CKRA 5EI6A 4JJRA 4CRSA 4KIQA 4E4MA 3R9HA 5B7VA 5IUGA 2ITWA 3E92A 4FGBA 3AMAA 3BBTB 4QQTA 5AR7A 3TNQB 4MXCA 2PWLA 4FA2A 3SW4A 4HYHA 1PMEA 3LKMA 2W1HA 4IB3A 2VAGA 3R2BA 4EOKA 3IOKA 4LMUA 2VWZA 2VNYA 4TXCA 3EKKA 3K3JA 4L44A 4QMQA 4USFA 3E7OA 4P4CA 4AW0A 2WU7A 5AUVA 5HE3A 1Z9XA 1E9HA 3KU2A 5HI2A 4BICA 3ATTA 2DS1A 3FQHA 4MD7E 3LFAA 2YITA 2QOCA 5ITAA 2C30A 3UNZA 4EYMA 4UX9A 4WT6A 2FSOX 3U9NA 4LI5A 4RQKA 5EYKA 1RJBA 5AV2A 3UVQA 4E5BA 5AM7A 5AP3A 4WSYA 3PUPA 2C5YA 3HV5A 3O7LB 2R3GA 3TV6A 4I24A 4A7CA 4L42A 3F7WA 4BYIA 3AC4A 4J95A 2BROA 3R1NA 4F9CA 3VBXA 2PMIA 4M3QA 1RW8A 2XKCA 5HICA 3AT4A 3D9VA 1ZZLA 3F5PA 5FBNC 4AXAA 2BRHA 2EXEA 3F2RA 3MA6A 2VTIA 1F0QA 3GOKA 2BRMA 3MDYA 2XK6A 4YJQA 4W4XA 5BUEA 1UVRA 1U5RA 2A0CX 4QTAA 1JPAA 2A27A 2XP2A 2YM8A 4QYHA 2W4JA 2BZHB 2PVHA 1ERKA 5EQYA 3O8UA 4FTIA 3NW6A 4NCTC 5EH0A 5EHYA 3RNYA 1QPEA 3LLAA 3WZJA 4NFNA 4FTOA 3L1SA 4BGHA 4I0SA 4OTDA 2QNJA 3HA8A 3QTUA 5HGIA 2IO6A 4XS2A 4F9BA 3OMVA 5IQIA 5FBOA 3LFFA 2CKPA 2W9ZB 4I4EA 1H1SA 3DJ5A 3TL8A 1Q62A 3CKWA 3SG9A 3E87A 4O21A 5BVKA 5KMJA 1CKIA 1T45A 3KQ7A 2ZDUA 5J7BA 4M0YA 3D94A 4FIHA 1O6KA 4E5AX 3UO4A 4L52A 4ACHA 4RJ5A 3NUXA 3EQPA 4FL1A 3COKA 1IA8A 3CQUA 5CU2A 2UW0A 5I9YA 5K4JA 4J97A 5G6VA 5IH4A 4XRLA 5JK3A 3W55A 1YVJA 3CE3A 2B7AA 2IZUA 2YACA 3EN4A 1PHKA 4LGGA 1GZOA 3D7TA 3MA3A 1U46A 5CAOA 4EH5A 2Q0BA 3Q32A 5M53A 4A9YA 3IO7A 4BCIA 5K4IA 5CYIA 3KXZA 2O63A 3GENA 4EC8A 2KTYA 3B8QA 3F3WA 3IW7A 4I6BA 3U87A 2YM3A 2WOUA 3H0YA 3I0OA 3NYOA 2JITA 3ZFYA 4EZ3A 4F1TA 4X2JA 4EONA 3TN8A 4DGMA 1OI9A 4ZK5A 3CR0A 4AZEA 5CTPA 4XV2A 4EK4A 3QXOA 4WNMA 5A6OA 4ZTLA 3KCKA 4MVFA 4KIKB 1Z5MA 2P4IA 3MIAA 2V62A 4PMTA 4IM2A 4P7EA 4ERWA 4RJ8A 2A2AA 1L3RE 1ND4A 2BPMA 3QZGA 3NYVA 4HGTA 4O6LA 3LFSA 4FIJA 1WBVA 2UZBA 4TN6A 4TWOA 1JSVA 4L6QA 5EOLA 3UJGA 4DITA 3K5VA 5FLFA 3VHEA 5IH5A 5LJJA 1NW1A 3A7HA 3NS9A 3E3PA 3RPYA 4BHZA 5AX9A 4XNEA 3VS2A 2QO7A 4XMOA 4U40A 5TE0A 3PRIA 2REIA 2OJ9A 3WIKA 5CI6A 2BKKA 1QPJA 3DJ6A 4AE6A 3DBEA 5A4TA 4UEUA 3KULB 3RAHA 5AR5A 2J0IA 4WOVA 1OBGA 3QQLA 4JVGA 3P9JA 4XP3A 3ORTA 1PY5A 3PPKA 5CVHA 4FKTA 2IVUA 2R3KA 3FKOA 4NUSA 5CQWA 5LXMA 3QC4A 4RIYA 5JFVA 5A54A 4BI2A 1J7UA 5CX9A 2F7ZE 4AZSA 1NY3A 3ANQA 3PG1A 4V0GB 4DEAA 4TPTA 3UOHA 3RPVA 4G2FA 4BDIA 4MD9E 5LMKC 3DA6A 4UALA 2WIPA 4RX5A 3MFTA 1W84A 2WMRA 1K9AA 4L3JA 4K6ZA 4FF8A 4E6DA 2E9UA 3U54A 1U59A 2BRNA 3FQSA 4RLKA 1WAKA 3D2IA 1FVRA 3HL7A 5EHLA 3TUDA 4AZFA 4R8QA 3UZPA 4JL9A 2DUVA 4IC8A 3AD4A 3UO6A 4IH8A 1VEBA 5FEEA 4MTAA 2XMYA 5DT3A 4ZJJA 3I81A 4LL5A 3WZDA 2PVLA 4QYYA 4UXQA 4YC8A 1JNKA 5D11A 3K3IA 4U0IA 4GVAA 4AWIA 3TACA 4FYNA 5IU2A 5LMBA 5IKWA 3O2MA 3QKMA 2B52A 4IDTA 4QPAA 3FSFA 4N6ZA 2WMVA 2YM6A 3SQQA 4DGNA 3LHJA 5CSXA 1ZYJA 2BUJA 2HYYA 4IBMA 3GC8A 2FVDA 2FO0A 5BYZA 2IVVA 2GQSA 2C3KA 4HJOA 5DEYA 5GZ9A 2XKEA 5JSMA 2XB7A 2VTPA 2PY3A 1PXMA 4P5QA 4IVBA 5TF9A 3C4CA 3R1YA 4QP1A 4F65A 3GB2A 5DH3A 2Q83A 1DS5A 4IX6A 4NM5A 3SXFA 2OFVA 4C59A 2CKOA 4DTBA 1YXSA 1PYXA 4F08A 1IEPA 3R21A 3M1SA 2JBPA 3KC3A 2ZJWA 4FKLA 2WTKC 3BYSA 4IADA 3QALE 3OWPA 4LGDA 4OT5A 4WRSA 4UWBA 4I21A 2X39A 4EHVA 4BBEA 3UZTA 4G3EA 3JUHA 3Q4CA 3OXTA 5CAQA 2B53A 3QTWA 3AC8A 5BVEA 4MXAA 1PMVA 5GIOE 4F99A 5JZJA 3CY3A 4FL2A 5CAVA 2I0HA 4R78A 2YM4A 4D4VA 3BZ3A 4EQMA 4EH6A 4TL0A 2O65A 2UVXA 2NO3A 3LMIA 1UA2A 4LUEA 4QD6A 5CEPA 4EQUA 2O2UA 1BX6A 5EHOA 1XH8A 4RWJA 3ZLYA 1KUTA 5HVYA 3PLAE 3AC1A 4IAIA 4K2RA 5JH6A 5K0XA 2DYLA 5BMSA 4NYEA 4IVDA 3BHHA 5FM3A 3QLFA 5AAFA 4B9DA 4FEXA 1W82A 1YI3A 3AC3A 1QPCA 2Y0AA 5DMZA 2F4JA 5IMXA 4PPBA 4IB1A 4ITIA 1GZKA 4F6WA 4M8TA 3FL5A 1KOAA 2HZIA 3HDNA 3KFAA 4DE4A 4L9IA 5D7VA 1BL7A 1V0BA 1RE8A 1GIHA 4QMPA 5AUTA 1RDQE 3E8NA 3VUKA 1UNHA 4M67A 4FIGA 5J9LA 3FXWA 4DA5A 3CD3A 3EQIA 3OD6X 5BVDA 3UPXA 2J90A 4TTHB 3FWQA 5H2UA 3DT1A 3BX5A 1CKPA 4ZZMA 4LRJA 3JXWA 3BKBA 3CJGA 3FYKX 3GU4A 2PMLX 3CGOA 2XM8A 4PPCA 3ZM9A 1QCFA 1R3CA 2GFCA 2XEYA 4GSBA 4JOAA 2VD5A 2X7GA 3E63A 3IDCA 3MYGA 4J99A 4FX3A 3WBLA 4D2VA 3HDMA 3MSSA 3V5QA 3PE1A 4BR3A 3VBYA 4TYEA 5A6NA 4MNEA 4EZ7A 2XK9A 4C4FA 4IZYA 4O1PA 2Y4PA 4FT5A 3W10A 5HQ0A 2E9PA 3LLTA 3MJ1A 4MBLA 3JPVA 3VN9A 4M7IA 3GEQA 4GMYA 3ZLWA 5K9IA 3BHTA 2WMBA 3CJFA 4IAZA 4A06A 2VO6A 4YPDA 4C4EA 4CMUA 3C4WA 5AAEA 4BI1A 4E8AA 5TT7A 5HCXA 4CCUA 4RVKA 3H30A 4XEYA 2WTVA 2IZRA 5K5NA 4ACCA 5CU4A 4EJ7A 1LEZA 3IDPA 4FVRA 2JDVA 4DBNA 4FKOA 4O7ZA 4LV5A 5ANKA 3JYAA 3KN5A 4F09A 2ZMCA 4PNIA 5I9XA 2EVAA 5JEBA 2VX3A 3SRVB 3R9NA 2PL0A 3VBWA 4CKJA 4NTSA 5F1ZA 1M2RA 4D55A 2ITPA 2OF2A 4BC6A 5F20A 3LCDA 4FIEA 1MRYA 4QOXA 5CQUA 3GCVA 3WZEA 4BCKA 2PZPA 3FSKA 5DPVA 3PJ8A 1KV1A 3OXIA 3UQGA 2WAJA 3HUCA 4O0YA 2VWYA 3SKCA 3RCJA 4FZ7A 3UG2A 4DCEA 5HTIA 3FZ1A 4U41A 5LARA 3BE9A 2JIUA 2OK1A 4EBWA 4FE2A 3BGPA 3GCPA 3NX8A 3DFCB 4S34A 1LEWA 3LMGA 2OZAB 2WMWA 3ORMA 4RGJA 4R77A 4EUTA 1WBTA 3LVPA 1TQIA 5AP1A 4XLIA 4ASXA 4HVHA 5HU3A 3UVRA 4MQ2A 2UV2A 2UZNA 3F2NA 4FKVA 4IANA 1JSTA 3R22A 4DGLC 2ERKA 4AW1A 4WBBB 3QTSA 4IM0A 5EW8A 1UWJA 4WSQA 3TXOA 3ENHA 3NIZA 2J5FA 4I4FA 3CC6A 3O71A 4G17A 3BQCA 5B2KA 1JKKA 1LPUA 3NUNA 3NVKI 3OEZA 1IR3A 2XRUA 1OL6A 2CMWA 3QQUA 5FP6A 3RHKA 2C0TA 1YOJA 3R8ZA 2WIHA 4JX7A 3R7GA 1ZZ2A 5C8KA 3KMUA 4L45A 1NVRA 2NP8A 4C2WA 3JS2A 3V04A 3NNWA 1XH5A 3QTZA 4DG3E 3MH1A 4Q9ZA 1OUYA 3E8CA 3QRUA 5E1EA 3BCEA 3D7ZA 3LXNA 5E9EA 3OT3A 4ZIMA 4RX9A 4W4WA 2FSMX 3GCUA 3LFDA 4WNOA 3AD5A 2C6LA 2VTSA 4JQ7A 4FTMA 4USEA 1JBPE 4FV6A 4IZ7A 3PXYA 3KRWA 4HPTE 2G1TA 2Z8CA 1REKA 5AP4A 4B4LA 3E8DA 5L4QA 4DH8A 1JSUA 3P0MA 3QHWA 2WMUA 2QVSE 4XBUA 3DLSA 4CZTA 4ENYA 5KHWA 1SVHA 4G3CA 3RVGA 2VGPA 3WZKA 3V6SA 3LMHA 3U8WA 3NR9A 4FV8A 1GIIA 1B39A 2XVDA 4NT4A 3D5XA 3F5XA 4BTMA 3TKIA 1LUFA 4NM0A 3EB0A 2C69A 3CIKA 3NLBA 3ANRA 5TOZA 4A4LA 4FEUA 3SVVA 2O3PA 4FBXA 3FLNC 1G5SA 3ZXTA 4G9RA 4KB8A 5KBQA 3UTOA 2GCDA 4WRGA 2W1ZA 4A9RA 5JFXA 3E62A 4E7WA 3LFEA 1PMUA 2C5OA 3Q2MA 1Q8ZA 3Q3BA 5AA8A 2YHVA 3QWKA 4UXLA 4D2RA 5J87A 3QA0A 1GZ8A 2Y8OA 4CEGA 1CKJA 1DI9A 4O7NA 4O2PA 3I60A 3MB6A 1IG1A 4IFGA 2XF0A 3NPCA 2V55A 4CFUA 1DI8A 4CNHA 4L7FA 4RIOA 4E6AA 4Z7GA 5FRIA 4MXYA 1YDSE 4IAKA 4JR7A 4PDPA 1R1WA 3WF6A 4JLCA 2RL5A 5AADA 4RA4A 4FGRA 2F57A 5IA4A 3BV2A 3C50A 4RFMA 1W98A 3PP0A 4YJUA 4U3YA 2Y9QA 3VF9A 3EKNA 4BCMA 4WUAA 1AD5A 1FPUA 3MY5A 3SXSA 1YRPA 2ONLA 4CQGA 5AR8A 3MJ2A 2OKRA 3TCPA 2R2PA 1H4LA 4KAOA 3FY2A 2C5VA 4JBVA 4LL0A 4AOJA 3GFWA 4C8BA 4HNFA 3ZUVA 5A14A 5EW9A 2VWUA 2PK9A 3PJ3A 3R1SA 5L8LA 4I23A 5FGKA 3SXRA 3C0HA 4MXOA 3FJQE 4F7SA 3NAYA 4FNXA 4E93A 4XV3A 5JMSA 5J5TA 4BWKA 4Q5HA 3MBLA 2LGCA 4JBQA 3OWLA 4EL9A 3RK5A 5FXRA 3ZONA 4BKZA 3CQWA 2EXCX 2X4ZA 4FNYA 2O5KA 1UNLA 4L8MA 2QR8A 5HE0A 4M69A 4F9YA 2JFMA 2PVJA 2BTSA 2R3NA 3UOKA 3QXPA 4TNDA 5DRDA 3VUGA 3UG1A 1T46A 3KK8A 3MN3A 4ANQA 3DTCA 4YTFA 4J96A 5E4HA 3A8WA 4J71A 5DIAA 4JIAA 4RBLA 1GNGA 3RAKA 5E8UA 2QR7A 2W06A 4GVJA 2B4SB 4X6QC 2OFUA 2GU8A 4I6FA 4E5WA 2JAVA 1XH7A 4IM3A 4R7IA 3Q60A 1KE5A 4M66A 4LOQA 5ANEA 5F94A 3CQEA 4K11A 4FKSA 4Y73A 3FC1X 4YHTA 4CYIA 3NEWA 4QYGA 4IX5A 5AM6A 2UW5A 3ENMA 3LXPA 4Y8DA 3WYXA 3BHVA 3W2PA 1OIRA 2DQ7X 3H9FA 5FP5A 4BZDA 3EQHA 4OBPA 3II5A 5F9EA 4FVPA 3OCGA 4W9WA 4IWDA 3OZ6A 2ETKA 4AGUA 2XJ1A 4BDFA 1F5QA 4F7JA 1ZYDA 5T6KA 3ZMMA 1H1WA 1YOLA 3GFEA 3OBGA 4ASDA 4FKJA 3UYSA 4BF2A 5J9YA 3KA0A 3QWJA 4DEDA 3CCNA 1BL6A 2IZTA 2V5QA 5CVGA 1S9JA 2YAAA 1MQBA 1OKVA 2F9GA 2VRXA 5D12A 1E1XA 1YXUA 1PXIA 3QQHA 1H27A 1QMZA 2C5XA 2Z7LA 3F3ZA 4LRKA 4YZCA 5HESA 3E88A 4IB5A 4APPA 3D83A 4D28A 4L7SA 4U5JA 2XNOA 2C6KA 3EHAA 5DG5A 3C0GA 2VTMA 2Y4IC 2XEZA 1ZYSA 3F7ZA 4BDBA 3VW6A 1M7NA 4L3PA 3HP2A 2PUNA 3FMNA 2OGVA 2R7IA 3IONA 3N51A 5A4CA 5DBXA 3Q9XA 2WMAA 5CT0A 5C1QB 2ITZA 2UZTA 2YLEA 2WTKB 3ZDUA 2J0LA 5HE2A 4F7NA 5AAGA 4DBXA 2Q0NA 3C0IA 3LXKA 3DPKA 3LJ2A 4DFXE 5AEPA 5T68A 4IC7A 3JR1A 3HMNA 4BDKA 2ZM4A 3NYXA 5H8BA 2CNVA 2ITNA 3D14A 4NW5A 3WIGA 5KUPA 3KK9A 3ZBXA 4EK5A 4V05A 4C38A 1YXVA 4I1ZA 3UC3A 3O0GA 3UOLA 3U9CA 4QMOA 4GIHA 5FTGA 4L46A 3G9LX 2GQRA 3UYTA 3ZSGA 3ZO4A 2QQ7A 5DR9A 2GNHA 4A4OA 2OXDA 3Q5IA 4AN2A 5A3XA 3ZC6A 1URWA 2J50A 3Q9ZA 2CGWA 3VW8A 4YJTA 2W1DA 3EQCA 3S0OA 4R6VA 3UNKA 3CS9A 3P23A 3F61A 3G90X 3GCQA 4FT9A 4OGRA 5TKDA 3BELA 1OGUA 5FDXA 3OCSA 2QURA 4P5ZA 4W4YA 4XG4A 4UV0A 3G6HA 4HGSA 2VTNA 5EM8A 2YISA 3W16A 4AT4A 3PTGA 5T3QA 2YABA 4AOTA 3GC9A 2OIQA 4FYOA 5IMEA 2P2IA 3ZC5A 4V01A 4I94A 4EYJA 3KULA 4EK6A 3MV5A 3V5LA 4MBIA 2BIYA 2IW6A 5EK7A 2Z7SA 4PRJA 4IVCA 4C57A 3LFQA 1VYZA 2X7OA 3RAWA 5EYDA 4AT3A 3FLWA 4CV8A 5CF8A 3FXXA 2PSQA 4J52A 4P2KA 4QMYA 3OOMA 3KCFA 2UW8A 4C3FA 2HIWA 2JKMA 4V0GA 2G2HA 3ORIA 4FODA 4IXPA 4RZVA 3V5TA 1XBBA 5LCJA 3FPMA 4LM5A 4KBKA 4GYGA 4MYGA 5BUIA 2WQNA 2OXXA 1AQ1A 5HU9A 1M14A 2H8HA 1U5QA 5M57A 1ZYCA 5JQ5A 4X0MA 2WMQA 4BDAA 3FEGA 5E8VA 4I93A 5E8YA 3MESA 2PPQA 4PMPA 4G6OA 4RIWA 1O9UA 5FG8A 3CP9A 5H8GA 3W2QA 4DH7A 5HNGA 1KE8A 4RJ3A 4KWPA 3PJ2A 5GJFA 2ZV9A 3ZOSA 4ZTSA 4GCJA 2IJMA 5BVNA 1XKKA 2CLQA 4FTRA 3A7IA 4A07A 3ETAA 4CKIA 3Q53A 5L2TA 4NM3A 5CU3A 1Y8YA 5CSWA 2IW8A 4N57A 2ESMA 1TKIA 1YOMA 4IQ6A 3VBTA 5IISA 2R9SA 5J8IA 3L9PA 3PVBA 5GJGA 4EH4A 1DM2A 4OBOA 5IUIA 5B2MA 3ORPA 4YHJA 5BNJA 3JVSA 3NNXA 1WFCA 4FSUA 5M4CA 5BMMA 3DLZA 4JG8A 2V22A 4A9SA 2VWVA 2A19B 2BZKB 3RPSA 4CT2A 1YHVA 4X2FA 4DFBA 3UVPA 4KKEA 1YI4A 3QC9A 2XNPA 4E4XA 4YHFA 4FZ6A 5AP6A 3VAPA 4BCFA 2GHGA 4YC3A 3T3UA 2XNGA 4FKUA 4IAYA 5F95A 5L6OA 4GFGA 3EOCA 4FT7A 4ZY6A 4BN1A 3DDQA 2PE0A 4JBPA 3LFNA 3HEGA 1YWVA 2W5HA 4AF3A 4C37A 4HW7A 3R7OA 3ERKA 3OTUA 4EOJA 2YAKA 4DFYA 3BIZA 4E3CA 3ZH8A 1UKHA 2C0IA 2FSLX 3W2SA 2WMXA 3V8TA 3G33A 4DG0E 3SHEA 4CLJA 2JC6A 3TJDA 3WYYA 4BI0A 2H34A 1ZAOA 4XG7A 5IDPA 2HCKA 3EN9A 2HELA 1OL7A 3I5ZA 2JGZA 4ZSEA 5H8EA 3F69A 3R7YA 2R4BA 5HCYA 4C4JA 2Y6MA 3QL8A 4O0RA 4KIOA 4PWNA 3WF5A 4F9WA 3KF7A 4PMSA 4FEVA 4ORKA 4QQCA 3FUPA 1QPDA 3N4VA 3PY1A 4G16A 2ITVA 3N4UA 1M7QA 4UZHA 4I41A 4O7LA 5DHJA 3UP2A 4YP8A 4AGCA 3RCDA 3O51A 4RIXA 4ANNA 4ASZA 2B54A 5AUYA 4DT9A 2ZV2A 4RJ6A 1ZMWA 4CXAA 3JY9A 3ZRMA 4J98A 3E5AA 5A46A 5E7RA 4AU8A 1OKZA 3UMXA 4TWCA 4XHKB 3QCXA 4DYMA 3A60A 4I6QA 3PIYA 1SM2A 2CGVA 2UZDA 4X2NA 4NL0A 4HCVA 1PXPA 4FK6A 1URCA 4KRDA 2BILB 3DKCA 2VTJA 3VS1A 4F4PA 4FICA 3A4PA 1OL2A 4FSQA 3W2OA 3SLSA 5HLPA 4EC9A 4EQCA 4C7TA 3IW5A 4IMYA 1Y8GA 4OT6A 4U9AA 4EOIA 2XJ2A 3LOKA 5HZNA 1SYKA 3TKUA 1OIYA 1OIUA 4JBOA 4FZAB 2WQMA 3CXWA 4Z7HA 3GQLA 1Q5KA 3BU5A 5AUZA 3RI1A 4RC4A 3R7UA 4U43A 3DBFA 1M17A 4G5PA 3PP1A 5DE2A 3G2FA 4DLIA 5M55A 4O82A 3R71A 4U3ZA 4PP9A 1M52A 4K9YA 1H8FA 3QQKA 4EBVA 3FMKA 3LW0A 4IFCA 2ZAZA 4D4YA 4GIIA 4NU1A 3QF9A 4RG0A 3RPRA 2R3IA 3MS9A 5L2QA 3DQXA 1A06A 3ORLA 4YZNA 5I5ZA 4ANMA 4Q9SA 3UP7A 3ZO3A 2AYPA 4AQCA 2O8YA 5CEIA 5E8TA 4PPAA 2P33A 3LCSA 5EDPA 3BPRA 4F7LA 3PXQA 4ZMEA 5HBJA 2QKRA 1PF8A 2VTHA 5DN3A 4PTCA 5J9ZA 3BYVA 2PVKA 3QLGA 2Z7RA 4GG7A 3SRVA 4KABA 3N4TA 3FZTA 4LYNA 4X3FC 3R8UA 2CNQA 1H08A 4BCNA 4BVUA 4D5HA 4F63A 2W99B 5I9UA 4ZS4A 1XQZA 2C6IA 2OI4X 2Z60A 4DF3A 4D5KA 3UPZA 5ETFA 3C51A 4BTJA 2C3LA 4FV4A 4KSQA 2OF4A 2JDSA 3FLSA 3O50A 2OW3A 5TR6A 1TVOA 3EQDA 3AQVA 3NUUA 4O6EA 4FV9A 4GT5A 4IDVA 2WB8A 3QRTA 3DKFA 4BIBA 3E64A 5HIBA 4C35A 5KHXA 2ACXA 4B0GA 1VZOA 4FG7A 3GXLA 3HMOA 2CNUA 2FB8A 2VN9A 4XX9A 4AT5A 2CHLA 2Z2WA 1STCE 5HG8A 1KWPA 3FI3A 3LPBA 5M56A 2FH9A 4FI1A 4IZ5A 3HA6A 2WO6A 4ONAA 4YUQA 3QHRA 3E3BX 5BQ0A 2PUPA 3TTIA 5IEYA 5A4QA 4II5A 3KVWA 2UZEA 3IOPA 5J7HA 2XZSA 4NWMA 2QHMA 5J5SA 3CKXA 3DDPA 3ORNA 1TQPA 2WMSA 2QCSA 5HEZA 3UNJA 4ZLZA 2RFDA 5CSPA 3KEXA 3OBJA 3QCYA 5DI1A 3OTVA 2H96A 1F3MC 4YTIA 5M09A 3EZVA 5J1VA 3WZUA 3EQGA 3BHYA 2JKKA 3D0EA 3AD6A 3FE3A 1SVGA 2WEVA 3ALNA 5HKMA 4JT3A 3H3CA 3GCSA 2W5BA 3DNDA 4PL3A 1JKSA 3R00A 4O96A 4TZRA 1SNXA 5DVRA 2CKEA 4CFXA 4EKKA 3W2CA 3TJCA 1UNGA 3RMFA 2CN8A 2UW6A 3NDMA 3ULIA 3GI3A 4ANLA 3UIMA 2XS0A 4DFUA 3DXPA 4BWPA 3UE4A 5IQAA 3BQRA 4RFYA 2FGIA 1Q97A 3AGLA 3IGGA 2CLXA 4UBAA 4QNYA 2Y6OA 4Y5HA 4YJVA 1OBDA 4QMZA 4ZP5A 4NCTA 3CLYA 5CALA 3HP5A 4XBRA 4CGAA 1PKDA 1FMKA 3A62A 3DKGA 2YCSA 4WHZA 2OU7A 5IG1A 4M84A 1G8AA 2CCIA 1JAMA 2GDOA 3ZEPA 4EOLA 1XH6A 4M12A 4QMSA 3KB7A 4KBCA 5HTBA 4L67A 4ZTMA 5M4IA 3S00A 4O7VA 5FEQA 3R9OA 4ERKA 4BRXA 3ORKA 4XRJA 2BIKB 2QOBA 2Y4IB 3A7JA 3GUBA 3WE8A 4AZWA 5HO6A 1FVVA 1WCCA 2WD1A 3LQ5A 4IVAA 3ZLXA 4U42A 3TWJA 2YEXA 1WBSA 3OWKA 3FI4A 4ZMFA 4YTHA 5CS6A 3KRRA 3BYUA 3LXLA 1M2QA 3QRIA 3AC5A 1J1BA 4O91A 3E93A 3HZTA 3OWJA 4MCVA 4AN9A 3MVMA 2R64A 1NVSA 2JIIA 3SX9A 2CJMA 4XCUA 4XP2A 5C4LA 4C36A 4RPVA 4IX4A 5GHVA 1PXJA 4FK3A 4Z55A 4K8AA 1HCLA 2W05A 2XIYA 3BLQA 5CEQA 4F9AA 5KMMA 4YNOA 1ZWSA 4BKJA 2PMNX 4ITHA 2PZ5A 4CZYB 5ICPA 3P5KA 3EZRA 4ZTNA 5HOAA 1ZARA 3REPA 4CLIA 4EWQA 4KKGA 4CTBA 2PZRA 4F6UA 2YCRA 1FINA 3P79A 3D7TB 1RQQA 5GINE 4ZZOA 4FEWA 4QTEA 2E9OA 2VTAA 4N0SA 3D15A 4QYFA 5LVPA 3F88A 1OIQA 1J1CA 1BUHA 3NUSA 3PPZA 5BVOA 2YWPA 4IX3A 4RT7A 3F82A 3ULZA 1JKTA 2A1AB 2NRYA 5HIDA 3FPQA 3FXZA 3TNPC 1G3NA 2R3RA 4AP7A 4DLJA 2QOFA 4DHFA 4EORA 3WI6A 4U7ZA 3A2CA 4YSMA 5DOSA 3RKBA 3PG3A 4R1YA 1REJA 2OWBA 5J95A 4G31A 5AWMA 4LOOA 4X7QA 1OECA 2VU3A 2WTDA 2XA4A 3R73A 1JVPP 3PVWA 4QQ5A 4EH9A 1L8TA 2PUUA 4FKPA 1BKXA 2J0KA 2WQEA 4KINA 1ZMUA 4BCHA 4KS8A 4ID7A 3ROCA 3NMUF 2SRCA 3DQWA 3O8TA 4I5PA 5CU6A 4ANSA 4NW6A 1SVEA 3F3TA 3O8PA 4YLKA 3ZBFA 3DAKA 3H9OA 4O0WA 4TT7A 1WMKA 1LR4A 3TIZA 1XH9A 3MW1A 2B9FA 3QCSA 3PA4A 4M97A 4J8MA 2X9EA 3HV4A 4RA5A 4FZFB 4DFNA 1J7LA 1NT2A 1PXLA 2ZVAA 2C6OA 1GJOA 4TNBA 3KVXA 4DN5A 4O86A 4AG8A 4RC2A 5ETCA 5K3YA 2DWBA 3I4BA 4O2ZA 4GK2A 4XV1A 2OG8A 4HZRA 4ZY5A 3L8PA 3SGCA 4K33A 3PZEA 4FV3A 4PDSA 4RIYB 3R8LA 2BMCA 3V8SA 4PP7A 3IW6A 4JIKA 3OVVA 5CZIA 4PL4A 2VTQA 2UZWE 4RRVA 3KXHA 4WKQA 3TKHA 1IASA 4YTCA 3I6WA 2X2KA 3C5UA 2PZIA 2X1NA 4JR3A 3SDJA 5DYJA 2GMXA 4ITJA 4RZWA 2JDRA 4G9CA 5HO8A 4DTAA 3V5JA 2RFEA 4UN0C 1P4FA 3UBDA 3DB8A 4OAUC 3HAMA 2C6TA 1M2PA 3TZ9A 4B8MA 1P2AA 2Z7QA 3SD0A 3QGWA 3VS5A 4YR8A 3R83A 2OO8X 2VTRA 2VNWA 3FLZA 3OOGA 3QX4A 4NEUA 4F1MA 4OTIA 5I3OA 3C5IA 1XO2B 2AC5A 4I22A 3RTPA 4F1OA 3RM7A 3DKOA 5FTOA 1YWNA 2XIXA 3D4QA 2YCQA 5HD7A 1XR1A 4UMUA 2EUFB 3P1AA 2GTMA 4FTAA 3AG9A 4DCAA 4KKHA 3ZO2A 5CWZA 5HBHA 3CPBA 5H3QA 4RQVA 3M11A 5KZ0A 4C3RA 3G5DA 3QGYA 3BWJA 2CCHA 4IACA 3RAIA 1ZMVA 4K0YA 2ITUA 4DGGA 5BX0A 1OPLA 2VUWA 2WELA 4H36A 2WZJA 4K1BA 3QAME 1JKLA 2RF9A 3G0FA 3KRLA 1OL5A 3LIJA 1R0PA 3OW3A 4U45A 4MEDA 2BRBA 5CXHA 3DY7A 2EB3A 4NIFA 4HPUE 4AA4A 3AT3A 4UYNA 3ZEWA 5CU0A 5IQCA 3BBWA 3K54A 4FUYA 4QMVA 2X8IA 4ARKA 5IQGA 1OKWA 4R5SA 5FM2A 1NXKA 3P7AA 3QBNA 4L00A 4XG9A 5IEVA 2YJSA 4FSNA 3RWPA 4CYJA 4O7RA 3FC2A 3L8SA 1XBCA 4O7SA 2ITTA 3OG7A 4FR4A 2HZNA 3R8VA 4O27B 4YBJA 5I0BA 4GKIA 3ZZWA 4F64A 5L3AA 1FGIA 2ZV7A 3FMLA 3P4KA 3C7QA 4A4XA 4S30A 3BV3A 2OIBA 4V04A 1MQ4A 2NRUA 1B38A 1P4OA 4KSPA 4Z16A 2J2IB 1J7IA 5EQEA 4YZDA 3TNIA 4ZS0A 2VTLA 4MX9A 4GFMA 4R1VA 4O81A 3RINA 4RVLA 1APME 3AT2A 4HVGA 4U97A 4WBOA 4EH7A 1FVTA 3ZTXA 4MKCA 1W7HA 4AUAA 2J9MA 4C4GA 3PSDA 2QU5A 2R3PA 3C1XA 2F7XE 2QC6A 5KNJA 4H39A 3AMBA 4DEEA 1DAWA 2X2LA 4G1WA 1B6CB 3F2AA 4YJOA 3VIDA 3UODA 5HTCA 5HG9A 3FI2A 3FQEA 5J79A 3TT0A 4AA0A 1ATPE 3R01A 4GL9A 4DH3A 2UZLA 4O22A 1MRVA 3DFAA 4YZMA 3RP9A 2UW9A 3VUDA 4CVAA 4WG4A 3VULA 3F3UA 4FG8A 3B2TA 2C4GA 4RX8A 3FZRA 3MIYA 3A61A 4G6LA 4O0UA 4X21A 4X6RA 1YXXA 5LVMA 1PW2A 4FEQA 3PPJA 3QQGA 5F4NA 3ROYA 4S33A 5CAUA 4X2KA 3KMMA 3FAAA 1GIJA 5FDPA 3VO3A 3COIA 1XWSA 1CTPE 2UUEA 3TNHA 2C6MA 3PWYA 2YDJA 3TV4A 2NNWB 4ZLOA 1WVXA 1NVQA 3NW7A 4G6NA 3NWWA 2W17A 2BDWA 4AZTA 4AW2A 3LCKA 5M06A 5EDRA 3GP0A 4TYGA 4YBKA 4PTGA 2GHMA 3A7FA 4FVQA 3Q9WA 4MNEB 5EQPA 2KULA 4GEOA 3NNUA 2Y7JA 4EH2A 2UVZA 4DEIA 4XJ0A 4DEHA 4U44A 3KGAA 3MGYA 5EDQA 4BDEA 5ANOA 4TYIA 3KMWA 3IKAA 4X3FB 3PJ1A 3COMA 2IVTA 3VS7A 2ETRA 5I9WA 4DC2A 3EN7A 4GU9A 3R9RA 1K3AA 2GS2A 3D5VA 2QO9A 3DZOA 4MWHA 1TQMA 2VTTA 2WFYA 2W1CA 5D41A 3DBDA 4BDDA 4CT1A 3TM0A 3GC7A 4ZZNA 4ZSLA 2C47A 3F3VA 1OPJA 4R7HA 4NFMA 5ANGA 4HCUA 3V5PA 3I79A 4E26A 1BLXA 3DJ7A 2CSNA 4QP9A 2JKQA 4UWYA 5J1WA 4I5MA 3KREA 3PVUA 2OJFE 2EXMA 3MFRA 5EW3A 5HVKA 5C4KA 1X8BA 2WTWA 3FLYA 3KXNA 2HZ4A 2J5EA 3ODYX 5M44A 4ZTRA 4EKLA 4O7YA 3UOJA 3RWQA 3EQBA 3R8MA 4IJPA 4QMLA 3MVLA 2JLDA 4Z9LA 4GYIA 5HG5A 1Y6BA 1WBNA 3NCGA 4BBFA 4BCQA 4HVIA 1VJYA 3LQ8A 4IAFA 5HIEA 3HAVA 1EH4A 1CSNA 1OVEA 3VRYA 2W9FB 3Q4ZA 3QUEA 5AR4A 5IUHA 3QTQA 4XH6A 2VTOA 2XK4A 4ASEA 4FSRA 4ZSGA 5GZAA 2WOTA 5DFPA 4ANOA 3MWUA 3VUHA 3ZLSA 5AMNA 4WO5A 2GTNA 3LCTA 4LOPA 5LVLA 2BCJA 2XYUA 3PYYA 3GU8A 5BYLA 3UMWA 3I1AA 5KKRC 4WG3A 3FMMA 3HV6A 5JN2A 4O7TA 4FUXA 4TYHB 4WIHA 4A9TA 4BIDA 4BWXA 4QP7A 2B9JA 3QZFA 5IZFA 3UZRA 4LQMA 4D0WA 4ZSAA 4X2GA 5L8KA 3GBZA 1I09A 5DR6A 3KRXA 5IA0A 2WTCA 5D1JA 4BKYA 5BUJA 2V7AA 4EH3A 2OBJA 1IAJA 5IA3A 5LCKA 5LVNA 4BCPA 2AUHA 3VQUA 3CTHA 4XG6A 4JNWA 2ITQA 3U6HA 3QRKA 3OW4A 4R3PA 2VO7A 4FC0A 1YQJA 2ERZE 3MVJA 4RSSA 2VV9A 4CD0A 3NAXA 2XUUA 3HV3A 3OXZA 3ITZA 3ZFXA 4CMTA 5C8NA 4F0FA 4UMTA 3H0ZA 4O84A 4DT8A 3BGZA 1Q41A 2P2HA 3PIZA 4D0XA 1YHWA 2WU6A 3VUMA 5KMOA 5IQFA 3F6XA 1CM8A 5CANA 3EFJA 2XBAA 2YLFA 4XLVA 3DTWA 3MH3A 3N9XA 2PE1A 4FTJA 3FMEA 4KIKA 2W1FA 2BHEA 2X7FA 4IWPA 5KBRA 3SV0A 3QX2A 3OS3A 4HCTA 1ZOEA 5I4NA 2RG5A 2G01A 1OMWA 3DV3A 4QRCA 3IW4A 3DGKA 4BYJA 3R7EA 2O0UA 5D9HA 3DXNA 3GU6A 5DR2A 4AZVA 5JQ8A 3RM6A 5AFVA 4JX3A 4U80A 3MY1A 3UIXA 3GT8A 2LAVA 5EM5A 3VS6A 3VS3A 4ZLYA 3DBQA 4BL1A 3WE4A 4R7BA 4CG8A 2B9HA 3COHA 3ACKA 4YSJA 3PLSA 4FV5A 4HGLA 4AAAA 3CD8A 1KE6A 3ZUTA 2GNLA 2QLQA 1A48A 2WQBA 4M14A 1H0WA 5KMNA 2R3FA 4GS6A 1Q8YA 2OICA 5C03A 4N70A 5EYCA 2UZVA 4ANBA 1UU3A 4FTNA 5DRBA 3P7BA 4L53A 1FOTA 4R5YA 2H9VA 3VNTA 3FMHA 3PXRA 4DEBA 2VO0A 3MTFA 2XBJA 4ZXTA 5HLWA 2R0UA 3G15A 4IEBA 5AIKA 1NA7A 2BALA 4RC3A 4WNKA 3T9TA 2QOIA 4H3QA 5EKOA 2PVRA 3LFCA 4QP8A 4YJNA 5ANIA 3E8EA 3MPTA 5CENA 4RWLA 4EK3A 3PY0A 4Y46A 1Y91A 3PRFA 2BAQA 2HZ0A 5B2LA 3W1FA 3SW7A 3RPOA 3CPCA 4G3FA 4BDHA 5FTQA 3ODZX 4I3ZA 3RK9A 4GV1A 3PY3A 2PVFA 5ACBC 3TTJA 5JRQA 2I1MA 4JQEA 4BY9E 3TZMA 5CEMA 4RX7A 2WTJA 1H1RA 3V51A 5L2IA 4LMNA 3A4OX 5JRSA 2XKFA 2XNMA 2R3JA 3KN6A 3QTRA 4I0TA 4G34A 5CNNA 3I7BA 3U6IA 3H9RA 3DNEA 3K2LA 4MXXA 4QP6A 2QU6A 5E90A 5M51A 4QP4A 3MVHA 4DAWA 4DINA 2JKOA 5IA2A 3BEGA 3M42A 3FKLA 5FQDC 1VR2A 4FNZA 3MFUA 4FTTA 1H1PA 1XHAA 3VC4A 5KO1A 5HVJA 3NIEA 2XIZA 2I0VA 5EM6A 3W33A 4MF0A 5C9CA 2XM9A 5LOHA 2HWOA 3POOA 1Q3DA 1WBOA 4KS7A 2FYSA 4M69B 5CEOA 2Z02A 3EYGA 2JDOA 4F70A 2QOLA 4ZAUA 3TI1A 5BVFA 3QCQA 4QT1A 5E91A 3FV8A 4KRCA 4QMUA 3V3VA 3LQ3A 3W2RA 4G3GA 3ZRKA 4DGOA 4IW0A 4YU2A 3H10A 3FZOA 4IWQA 3OY3A 4FSMA 4LV8A 3UO5A 4QMWA 2WXVA 2BVAA 4ZEGA 3VRZA 3KKVA 2RKUA 4E4LA 2ZM3A 4C58A 3PIXA 1KE9A 3QQFA 3GU5A 4GT3A 3CEKA 3Q4TA 5JGBA 4J1RA 2ITXA 4B99A 4FKRA 4FV7A 4DH5A 3GGFA 2QKWB 4RWKA 3I6UA 4HZSA 3QKLA 3B8RA 4QP2A 5AIRA 5AUXA 4B7TA 1XJDA 4TW9A 3ZFMA 4IB0A 1H0VA 4EI4A 3QD0A 4NTTA 4RJ4A 5GJDA 5A4EA 4IHPA 2G2FA 2FA2A 5GNKA 5LWNA 4UWCA 1S9IA 4XV9A 1YI6A 4EHEA 4IJ9A 3MH0A 3DK6A 3JVRA 1U4DA 3QD2B 4FKGA 4JS8A 3RBWA 4I0RA 5JT2A 4J7BA 4RLLA 3NNVA 3PZHA 2R3QA 4BGQA 4C33A 3K5UA 4HVSA 4D4RA 3EJ1A 4BIEA 4ALUA 4CFVA 3DAJA 3OROA 4FSTA 2YDKA 5EFQA 5E8WA 2P55A 5AP7A 4ZJVA 4CFWA 5AA9A 4O0VA 5C26A 4FTCA 3FDNA 5AR3A 5B0XA 2XIRA 4GUEA 2XNBA 5DT4A 4ACDA 5E92A 3TIYA 2B0QA 1JWHA 4Z3VA 2C1BA 3R2YA 2HW7A 4XP0A 1WZYA 5IPJA 4CQEA 5KMKA 2BRGA 3GQIA 4LFIA 4BDGA 3JY0A 4FOCA 3FKNA 1U54B 2XRWA 1OPKA 3OHTA 1BMKA 1ZOHA 2QOOA 3O96A 4F0IA 4CZUA 5CEKA 4QPSA 4C4IA 2XH5A 1FMOE 4GH2A 4RMZA 1UKIA 5EI8A 3TUCA 4EK8A 5IH6A 4PTEA 3I0QA 2PVMA 1J91A 4XOZA 2UW4A 2AC3A 3W32A 4C4HA 3CBLA 3EMGA 4FV0A 2JDTA 4S31A 4UYAA 3MH2A 4IAAA 3VHKA 5HORA 4CSVA 4YJSA 4HOKA 3RJCA 3HLLA 4C2VA 4U8ZA 3BWFA 2BZJA 4YGAA 3ZO1A 1PMNA 4JAIA 5E8ZA 3LFBA 2BHHA 3RZBA 2CKQA 3WILA 3FI8A 3ZHPC 2RFNA 4BHNA 4H1JA 2VX1A 3EL7A 4FSWA 4TWPA 3RK7A 4C34A 2OLCA 3C9WA 1KOBA 4W8DA 2QOKA 4QQJA 3VBVA 4AN3A 3LM5A 4PL5A 3ZUUA 5IDNA 2BAKA 3BLHA 2F49A 5E8SA 5HX8A 5CT7A 4YPSA 2G9XA 4XUFA 1H25A 2HY0A 2RFSA 3Q5ZA 5AV3A 4BGGA 3F66A 4UMPA 3OCTA 2XK3A 3BYOA 5CZHA 4PX6A 4AOIA 3UIUA 4OTHA 4MNFA 4S2ZA 5JFSA 2IWIA 5LMAA 5HD4A 5L8JA 2GPHA 4ENXA 3ORZA 4FMQA 4YURA 5GZ8A 3A99A 4UMQA 1H1QA 5AP5A 4TKSA 3HKOA 1ZRZA 4CV9A 1Q61A 4GRBA 5CSVA 3MB7A 2OZAA 4S32A 2QOHA 2QHNA 2BKZA 4FKQA 4G3DA 2P3GX 4G5JA 1W83A 3CSVA 2ITYA 3HX4A 3L9NA 2QLUA 1H26A 3Q6WA 3GU7A 3S4QA 3UC4A 4DEGA 3EN6A 3FZSA 4W9XA 4XG8A 1ZY5A 2C3IB 3ZS5A 4F0GA 3RGFA 3OUNB 2R3LA 2VWBA 3WF9A 1IA9A 1MUOA 2YIYA 4BB4A 4RIWB 3O7LD 3NGAA 1JLUE 3BE2A 3RHXA 5L6WL 5KMIA 1PXOA 4ZOGA 4OLIA 4L01A 3SOCA 2J4ZA 2JBOA 3PVGA 5IQBA 2BFXA 2WQOA 3HV7A 3R6XA 4D1XA 3E7VA 4IIRA 3FHRA 3MTLA 4J53A 4NH1A 4PF4A 3HUBA 1ZY4A 2W4OA 2BDJA 3ORXA 3TV7A 4JRNA 3FMJA 4OR5A 3WF8A 1YWRA 2W4KA 3T3VA 4U81A 5D7AA 4Q5EA 2WTIA 3P78A 2W1IA 3CTJA 2EU9A 4FIIA 4KD1A 3EYHA 3PFQA 4GK3A 5HBEA 5I3RA 5I9ZA 5I9VA 1WBWA 3QKKA 2ZDTA 2BZIB 5HNIX 3TEIA 3MI9A 4QNAA 5AV1A 5DWRA 1Q8WA 2X2MA 2PE2A 2C5NA 4ACGA 3DB6A 2XIKA 5EM7A 3C4ZA 3ZM4A 4OTRA 3ZYAA 5BYYA 2XK7A 4TRLA 5JKGA 3ZRLA 3I5NA 1G8SA 3O23A 4DFZE 2QG5A 2RSVA 5M4FA 2YZLA 4TY1A 4MHAA 5L2WA 4O0TA 4AGWA 4GJ2A 4NK9A 4YJRA 4EOSA 1GAGA 2XNNA 3EFKA 4RFZA 2RGPA 2ZOQA 4Q2AA 5EOBA 4TYJA 4D2SA 4D58A 2YZAA 3KXMA 3VJOA 5KKRB 1FBNA 2CGXA 2GFSA 5HX6A 1YXTA 3HMIA 4JXFA 3WF7A 1BI7A 2GS7A 2G2IA 4QMNA 4QP3A 3QA8A 4XG3A 3UQFA 3Q6UA 3G9NA 3S3IA 1V1KA 1E1VA 4ZTQA 2IPXA 3SA0A 3D2KA 3W8LA 4ALWA 4HVDA 4GU6A 3ZZEA 1Y6AA 4LGHA 3G51A 4R3CA 1KE7A 4WUNA 5JGAA 5KCVA 3A8XA 5AP0A 4PNKA 1R78A 4H58A 3PWDA 3Q04A 4JRVA 4U6RA 3ATSA 4C62A 2R0IA 2B9IA 2UW3A 4J8NA 4MQ1A 3W18A 3EH9A 4RIXB 4QO9A 1OB3A 3DZQA 3NUYA 2ZV8A 4ZY4A 2J0MB 3NW5A 3R30A 2VGOA 2C6DA 3VQHA 4YO4A 2YM7A 4I5HA 5AUWA 2HXLA 2WNTA 3F5GA 3V5WA 5CSHA 2X6DA 3HVCA 4OTGA 4D1ZA 1CDKA 4ALVA 4GUBA 3PE2A 4EJNA 4EOMA 5C27A 4DH1A 2C6EA 4WD5A 2VWWA 2OJJA 2QOQA 4EOPA 4YMJA 5IEXA 1Q3WA 4PDYA 2WHBA 3UQCA 3PSCA 3KXXA 5TO8A 5C01A 2GS6A 5DNRA 5JZNA 3TDVA 3NUAA 4EZ5A 1V0OA 1V0PA 1H01A 2R3OA 4OTPA 4AS0A 5FD2A 2BAJA 2ONLC 2B55A 4CMOA 2RG6A 3ID6C 2I0EA 5EKNA 4M15A 4ZSJA 1P14A 4CFNA 4LRMA 4CRLA 2W0JA 3OCBA 1PXNA 3FL4A 3LAUA 3OEFX 2OH0E 4EOQA 5CI7A 2A4LA 1ZOGA
chains in the Genus database with same CATH superfamily
3BGQA 2PTKA 3U4UA 1UWHA 3IGOA 4JDJA 1ZXEA 2YN8A 3LE6A 4NKSA 5HNBA 5IQEA 3AXWA 1UV5A 3KF4A 5CASA 3SC1A 2JAMA 1MRUA 2PVYA 4H3PA 2YIXA 4MK0A 4X3FA 3R0TA 4AGDA 4MBJA 4C0TA 5LMKA 4HGEA 4JI9A 2R3HA 1Y57A 5ETIA 4FTLA 1DAYA 4FZDB 4HNIA 4H05A 2WEIA 1WBPA 3EQFA 2YIQA 4D2TA 3ALOA 2IN6A 5ETAA 3TNWA 2GSFA 1PJKA 3ZXZA 4IWOA 2XJ0A 2HY81 4AAYA 4EUUA 5AP2A 2J0JA 2OH4A 2WKMA 3IK3A 2GNFA 5EI2A 3R8PA 4Y85A 2OXYA 5CNOA 2X6EA 1W0XC 4LG4A 3NYNA 3LZBA 2R5TA 3QU0A 5HCZA 5LVOA 2X8DA 3VS0A 4N6YA 4NSTA 3PXFA 4Y5QA 3TDWA 4BFMA 2W1GA 1YDRE 1YW2A 3DK3A 5FWKK 2WGJA 5HG7A 4NKAA 1YHSA 1KV2A 3Q2JA 2YERA 4WG5A 1FGKA 4PUZA 1SNUA 3NCZA 3NZ0A 1YDTE 3BLRA 1H07A 2YWVA 1IRKA 4HYUA 3QUPA 5LWMA 2GNJA 4TWNA 3OP5A 3FHIA 5AR2A 1QL6A 3HMMA 3W8QA 4TYHA 2XCHA 1W8CA 2P0CA 2X81A 5HHWA 3V6RA 3U6JA 2CN5A 3B2WA 2W5AA 1O6YA 3KL8A 2VWXA 4KIPA 4RWIA 4DDGA 5EG3A 3HGKA 3DOGA 2GNGA 4E20A 2I0YA 4QYEA 1UU8A 2VX0A 2IG7A 1BYGA 2FSTX 2CGUA 3U51A 3KIOC 2CDZA 4LUDA 2ETMA 4ZTHA 3NSZA 1P5EA 5AV4A 1KSWA 4MD8E 2QONA 3Q9YA 5KX8A 3IG7A 2G15A 4UY9A 4OTQA 1Q8TA 3GVUA 4CFFA 4D2WA 5IF1A 4RVTA 5KE0A 3C4FA 4KBAA 2OSCA 4FT3A 3VVHA 4EOOA 3V01A 4PQNA 5AX3A 5CF5A 4QTBA 5K0KA 4FTUA 2BR1A 3VBQA 4O0XA 3MPMA 4AFEA 4HYIA 4OTFA 5C8MA 4AXFA 2OZOA 2ZMDA 3L8XA 2YCFA 5FXQA 2RIOA 2JIVA 4GK4A 2IW9A 4FIFA 3VJNA 4BDJA 5HO7A 4FSZA 2EB2A 1ZLTA 4BZNA 4GFOA 5A9UA 2X9FA 5D10A 4EEVA 3D5UA 1PKGA 4E6QA 2IZSA 3AC2A 4NZWB 4O0SA 4CFMA 3QZHA 3LJ1A 2OJIA 3RALA 4XYFA 3U4WA 2I7QA 1GOLA 5KZIA 4U79A 1Q24A 3Q4UA 4RVMA 2W7XA 3T8OA 3BL7A 2W1EA 3DK7A 3FMDA 2E9VA 4C3PA 4FNWA 4EHZA 2F7EE 3QRJA 2C3JA 4OW8A 3F5UA 4FTKA 3HMPA 4IE9A 4JAJA 4FJVA 1JOWB 1OUKA 3TZ7A 3QFVA 3GNIB 5CLPA 4AA5A 2GNIA 2PHKA 1CMKE 2UW7A 2VO3A 4JG7A 2A98A 2EWAA 3F9NA 2QO2A 4WNPA 2YIWA 3CTQA 2VZ6A 1UU9A 5ACKA 3KRJA 4EH8A 1BI8A 4L3LA 4D9TA 3T9IA 1GZNA 5DLSA 3OFMA 2GQGA 2PULA 2YFXA 3POZA 4OUCA 1HOWA 1VYWA 3VWAA 3L9LA 3DXQA 3KXGA 3R7IA 3IW8A 2ZM1A 4DTKA 1K2PA 3C4XA 3R04A 5IA1A 3CY2A 2WPAA 3EL8A 3RZFA 4E4NA 4UMRA 3S95A 4MH7A 2VWIA 4I5CA 3I7CA 5CXZA 5A4LA 4D2PA 4FV2A 4QPMA 3IDBA 3LCOA 4B6LA 4F6SA 4BTKA 2FUMA 4D9UA 3C4EA 3SAYA 2PMOX 3BEAA 3FYJX 4KA3A 2XKDA 5LQFA 4L68A 5BPYA 4PV0A 4YLLA 3VS4A 2R3MA 2F2UA 2XYNA 2ZB0A 3EFWA 1XBAA 2C1AA 3OY1A 4JG6A 5IQHA 2W96B 1I44A 3V8WA 2HAKA 2XCKA 3BI6A 1O6LA 1J3HA 3HRCA 3LJ0A 4FKIA 1G8KA 1LP4A 2BDFA 3ZCLA 1Q8UA 5CF4A 3ZSIA 2F2CB 2PVNA 5M4UA 3MY0A 3ACJA 3W0OA 2X4FA 5CVFA 3ET7A 4I6LA 2BFYA 3OC1A 3OT8A 1MP8A 4O1OA 5DGZA 1Q4LA 4Y83A 4BDCA 4YLJA 3G0EA 2O64A 5BVWA 1Z57A 2HWPA 4ZJIA 4AX8A 3HECA 3PXKA 4MXZA 3Q52A 3QQJA 4IZAA 5ANDA 5H9BA 2GHLA 4QMMA 2ITOA 2WMTA 4AACA 4BZOA 1IAHA 3EWHA 4M68A 5EYMA 4B8LA 1PRYA 3H4JA 5FEDA 1OZ1A 4XOYA 3P86A 3M2WA 4YZBA 4CG9A 1ZYLA 2J51A 3PA5A 2OIDA 2QI8A 3C13A 4FOBA 4I6HA 4M0ZA 2YJRA 4JQ8A 3HRBA 4QEBA 4QTCA 3QTIA 4BTFA 3QD3A 3PXZA 4NM7A 3TZ8A 4C61A 4OTWA 3ZDIA 1UU7A 2PUIA 3EN5A 3TUBA 4N4SA 2HW6A 3NUPA 2V0DA 1HCKA 3R02A 2X0GA 4FSYA 4QMXA 4YC6A 4Y72A 2BTRA 4R3RA 5CF6A 5FUTA 1WVWA 3EQRA 2UVYA 4AFJA 3AMYA 3QYZA 4E73A 5M08A 2UZUE 2ZB1A 3DU8A 3P7CA 4FL3A 4M13A 3DS6A 4RJ7A 4BBMA 4NJDA 1Q99A 3BYMA 4PMMA 3P08A 1WVYA 5CAPA 5L6PA 2HOGA 2YDIA 4HYSA 4WA9A 5E8XA 4O7WA 3IPHA 1FQ1B 3DCVA 4E6CA 4Y95A 5K5XA 3U55A 5AJQA 3PDTA 4W4VA 4USDA 5HE1A 3NVMB 2UZOA 5FXSA 4DFLA 1H28A 3R1QA 4YZ9A 3WARA 4MAOA 5L2SA 4FT0A 2JEDA 4GT4A 4JDKA 3W0MA 4K18A 3S2PA 1JQHA 3ZSHA 4BCJA 2XNEA 4YJPA 4UB7A 4GKHA 4W8EA 1SZMA 4MWIA 4XG2A 5IA5A 3PSBA 3THBA 4H3BA 3VUTA 4FTQA 4I20A 4D1SA 3G6GA 5AV0A 4H1MA 2QG7A 4DG2E 5AUUA 3SOAA 1U54A 3CGFA 2YA9A 4P90A 3GOPA 3BHUA 3R28A 4FG9A 1GY3A 2I6LA 3UGCA 4KUJA 4OBQA 3FBVA 3IQ7A 3QZIA 4CCBA 1H24A 5ANJA 1OITA 5E1SA 3ZU7A 5G1XA 3BRBA 3EFLA 2ZYBA 3R7VA 1R0EA 4GJ3A 4NIFB 1OKYA 3QUDA 3HNGA 3IECA 2PU8A 2B1PA 3AGMA 2NPQA 1PXKA 1SMHA 4FV1A 4FKWA 3RNIA 3D5WA 5KMLA 4AW5A 5IQDA 4I92A 2JFLA 3L9MA 1OM1A 4ACMA 4APCA 4YNEA 1OL1A 2C68A 3R63A 2HK5A 5M07A 4MF1A 2H6DA 4JDIA 4E1ZA 3IS5A 4KNBA 4C02A 3ELJA 3VF8A 1AGWA 2C0OA 4NJ3A 3DBCA 5JGDA 3PJCA 3HYHA 4L43A 4D4SA 5DEWA 4OAVB 3SG8A 5GIPE 3BU3A 3MFSA 1PYEA 3HRFA 5DT0A 3FLQA 2E9NA 1A9UA 3OUKA 1YKRA 4QMTA 3R9DA 4BCOA 4GW8A 3AOXA 3PA3A 2OJGA 2YIRA 4EHGA 4EWHA 5HLNA 4GG5A 3QD4A 3NRMA 2PYWA 2XK8A 2JD5A 3EIDA 4K77A 2V7OA 3UDBA 3WOWA 2HENA 4BCGA 1R39A 4YO6A 3LM0A 4O83A 3GC0A 3UIBA 2E2BA 4QTDA 3L8VA 3OF0A 3QTXA 4PY1A 3BU6A 1H00A 3VUIA 4X3JA 5DA3A 3A7GA 3FZPA 5JFWA 2J6MA 2QODA 4CTCA 2HXQA 2I40A 4PDOA 3DAEA 3FY0A 3KY2A 1XH4A 2X8EA 4AE9A 2X0OA 3S1HA 2J7TA 2R7BA 2PZYA 2QD9A 3O17A 3Q96A 4UZDA 4JDHA 2CPKE 2IVSA 3QYWA 4O38A 4A9UA 5CY3A 3MPAA 2YM5A 3TG1A 4CKRA 5EI6A 4JJRA 4CRSA 4KIQA 4E4MA 3R9HA 5B7VA 5IUGA 2ITWA 3E92A 4FGBA 3AMAA 3BBTB 4QQTA 5AR7A 3TNQB 4MXCA 2PWLA 4FA2A 3SW4A 4AQKA 4HYHA 1PMEA 4DHIB 3LKMA 2W1HA 4IB3A 2VAGA 3R2BA 4EOKA 3IOKA 4LMUA 2VWZA 2VNYA 4TXCA 3EKKA 3K3JA 4L44A 4QMQA 4USFA 3E7OA 4P4CA 4AW0A 2WU7A 5AUVA 3BLAA 5HE3A 1Z9XA 1E9HA 3KU2A 5HI2A 4BICA 3ATTA 2DS1A 3FQHA 4MD7E 3LFAA 2YITA 2QOCA 5ITAA 2C30A 3UNZA 4EYMA 4UX9A 4WT6A 2FSOX 3U9NA 4LI5A 4RQKA 5EYKA 1RJBA 5AV2A 3UVQA 4E5BA 5AM7A 5AP3A 4WSYA 3PUPA 2C5YA 3HV5A 3O7LB 2R3GA 3TV6A 4I24A 4A7CA 4L42A 3F7WA 4BYIA 3AC4A 4J95A 2BROA 3R1NA 4F9CA 3VBXA 2PMIA 4M3QA 1RW8A 2XKCA 5HICA 3AT4A 3D9VA 1ZZLA 3F5PA 5FBNC 4AXAA 2BRHA 2EXEA 3F2RA 3MA6A 2VTIA 1F0QA 3GOKA 2BRMA 3MDYA 1XMLA 2XK6A 4YJQA 4W4XA 5BUEA 1UVRA 1U5RA 2A0CX 4QTAA 1JPAA 2A27A 2XP2A 2YM8A 4QYHA 2W4JA 2BZHB 2PVHA 1ERKA 5EQYA 3O8UA 4FTIA 3NW6A 4NCTC 5EH0A 5EHYA 3RNYA 1QPEA 1G8JA 3LLAA 3WZJA 4NFNA 4FTOA 3L1SA 4BGHA 4I0SA 4OTDA 2QNJA 3HA8A 3QTUA 5HGIA 2IO6A 4XS2A 4F9BA 3OMVA 5IQIA 3W0PA 5FBOA 3LFFA 2CKPA 2W9ZB 4I4EA 1H1SA 3DJ5A 3TL8A 1Q62A 3CKWA 3SG9A 3E87A 4O21A 5BVKA 5KMJA 1CKIA 1T45A 3KQ7A 2ZDUA 5J7BA 4M0YA 3D94A 4FIHA 1O6KA 4E5AX 3UO4A 4L52A 4ACHA 4RJ5A 3NUXA 3EQPA 4FL1A 3COKA 1IA8A 3CQUA 5CU2A 2UW0A 5I9YA 5K4JA 4J97A 5G6VA 5IH4A 4XRLA 5JK3A 3W55A 1YVJA 3CE3A 2B7AA 2IZUA 2YACA 3EN4A 1PHKA 4LGGA 1GZOA 3D7TA 3MA3A 1U46A 5CAOA 4EH5A 2X0QA 2Q0BA 3Q32A 5M53A 4A9YA 3IO7A 4BCIA 5K4IA 5CYIA 3KXZA 2O63A 3GENA 4O4CA 4EC8A 2KTYA 3B8QA 3F3WA 3IW7A 4I6BA 3U87A 2YM3A 2WOUA 3H0YA 3I0OA 3NYOA 2JITA 3ZFYA 4EZ3A 4F1TA 4X2JA 4EONA 3TN8A 4DGMA 1OI9A 4ZK5A 3CR0A 4AZEA 5CTPA 4XV2A 4EK4A 3QXOA 4WNMA 5A6OA 4ZTLA 3KCKA 4MVFA 4KIKB 1Z5MA 2P4IA 3MIAA 2V62A 4PMTA 4IM2A 4P7EA 4ERWA 4BJJA 4RJ8A 2A2AA 1L3RE 1ND4A 2BPMA 3QZGA 3NYVA 4HGTA 4O6LA 3LFSA 4FIJA 1WBVA 2UZBA 4TN6A 4TWOA 1JSVA 4L6QA 5EOLA 3UJGA 4DITA 3K5VA 5FLFA 3VHEA 5IH5A 5LJJA 1NW1A 3A7HA 3NS9A 3E3PA 3RPYA 4BHZA 5AX9A 4XNEA 3VS2A 2QO7A 4XMOA 4U40A 5TE0A 3PRIA 2REIA 2OJ9A 3WIKA 5CI6A 2BKKA 1QPJA 3DJ6A 4AE6A 3DBEA 5A4TA 4UEUA 3KULB 3RAHA 5AR5A 2J0IA 4WOVA 1OBGA 3QQLA 4JVGA 3P9JA 4XP3A 3ORTA 1PY5A 3PPKA 5CVHA 4FKTA 2IVUA 2R3KA 3FKOA 4NUSA 5CQWA 5LXMA 3QC4A 4RIYA 5JFVA 5A54A 4BI2A 1J7UA 5CX9A 2F7ZE 4AZSA 1NY3A 3ANQA 3PG1A 4V0GB 4DEAA 4TPTA 3UOHA 3RPVA 4G2FA 4BDIA 4MD9E 5LMKC 3UDZA 3DA6A 3VONA 4UALA 2WIPA 4RX5A 3MFTA 1W84A 2WMRA 1K9AA 4L3JA 4K6ZA 4FF8A 4E6DA 2E9UA 3U54A 1U59A 2BRNA 3FQSA 4RLKA 1WAKA 3D2IA 1FVRA 3HL7A 5EHLA 3TUDA 4AZFA 4R8QA 3UZPA 4JL9A 2DUVA 4IC8A 3AD4A 3UO6A 4IH8A 1VEBA 5FEEA 4MTAA 2XMYA 5DT3A 4ZJJA 3I81A 4LL5A 3WZDA 2PVLA 4QYYA 4UXQA 4YC8A 1JNKA 5D11A 3K3IA 4U0IA 4GVAA 4AWIA 3TACA 4FYNA 5IU2A 5LMBA 5IKWA 3O2MA 3QKMA 2B52A 4IDTA 4QPAA 3FSFA 4N6ZA 2WMVA 2YM6A 3SQQA 4DGNA 3LHJA 5CSXA 1ZYJA 2BUJA 2HYYA 4IBMA 2XAOA 3GC8A 2FVDA 2FO0A 5BYZA 2IVVA 2GQSA 2C3KA 4HJOA 5DEYA 5GZ9A 2XKEA 5JSMA 2XB7A 2VTPA 2PY3A 1PXMA 4P5QA 4IVBA 5TF9A 3C4CA 3R1YA 4QP1A 4F65A 3GB2A 5DH3A 2Q83A 1DS5A 4IX6A 4NM5A 3SXFA 2OFVA 4C59A 2CKOA 4DTBA 1YXSA 1PYXA 4F08A 1IEPA 3R21A 3M1SA 2JBPA 3KC3A 2ZJWA 4FKLA 2WTKC 3BYSA 4IADA 3QALE 3OWPA 4LGDA 4OT5A 4WRSA 4UWBA 4I21A 2X39A 4EHVA 4BBEA 3UZTA 4G3EA 3JUHA 3Q4CA 3OXTA 5CAQA 2B53A 3QTWA 3AC8A 5BVEA 4MXAA 1PMVA 5GIOE 4F99A 5JZJA 3CY3A 4FL2A 5CAVA 4AXEA 2I0HA 4R78A 2YM4A 4D4VA 3BZ3A 4EQMA 4EH6A 4TL0A 2O65A 2UVXA 2NO3A 3LMIA 1UA2A 4LUEA 4QD6A 5CEPA 4EQUA 2O2UA 1BX6A 5EHOA 1XH8A 4RWJA 3ZLYA 1KUTA 5HVYA 3PLAE 3AC1A 4IAIA 4K2RA 5JH6A 5K0XA 2DYLA 5BMSA 4NYEA 4IVDA 3BHHA 5FM3A 3QLFA 5AAFA 4B9DA 4FEXA 1W82A 1YI3A 3AC3A 1QPCA 2Y0AA 5DMZA 2F4JA 5IMXA 4PPBA 4IB1A 4ITIA 1GZKA 4F6WA 4M8TA 3FL5A 1KOAA 2HZIA 3HDNA 3KFAA 3P5JC 4DE4A 4L9IA 5D7VA 1BL7A 1V0BA 1RE8A 1GIHA 4QMPA 1W2DA 5AUTA 1RDQE 3E8NA 3VUKA 1UNHA 4M67A 4FIGA 5J9LA 3FXWA 4DA5A 3CD3A 3EQIA 3OD6X 5BVDA 3UPXA 2J90A 4TTHB 3FWQA 5H2UA 3DT1A 3BX5A 1CKPA 3AKJA 4ZZMA 4LRJA 3JXWA 4F78A 3BKBA 3CJGA 3FYKX 3GU4A 2PMLX 3CGOA 2XM8A 4PPCA 3ZM9A 1QCFA 1R3CA 2GFCA 2XEYA 4GSBA 4JOAA 2VD5A 2X7GA 3E63A 3IDCA 3MYGA 4J99A 4FX3A 3WBLA 4D2VA 3HDMA 3MSSA 3V5QA 3PE1A 4BR3A 3VBYA 4TYEA 5A6NA 4MNEA 4EZ7A 2XK9A 4C4FA 4IZYA 4O1PA 2Y4PA 4DHJA 4FT5A 3W10A 5HQ0A 2E9PA 3LLTA 3MJ1A 4MBLA 3JPVA 3VN9A 4M7IA 3GEQA 4GMYA 3ZLWA 5K9IA 3BHTA 2WMBA 3CJFA 4IAZA 4A06A 2VO6A 4YPDA 4C4EA 4CMUA 3C4WA 5AAEA 4BI1A 4E8AA 5TT7A 5HCXA 4CCUA 4RVKA 3H30A 4XEYA 2WTVA 2IZRA 5K5NA 4ACCA 5CU4A 4EJ7A 1LEZA 3IDPA 4FVRA 2JDVA 4DBNA 4FKOA 4O7ZA 4LV5A 5ANKA 3JYAA 3KN5A 4F09A 2ZMCA 4PNIA 5I9XA 2EVAA 5JEBA 2VX3A 3SRVB 1TZDA 3R9NA 2PL0A 3VBWA 4CKJA 4NTSA 5F1ZA 1M2RA 4D55A 2ITPA 2OF2A 4BC6A 5F20A 3LCDA 4FIEA 1MRYA 4QOXA 5CQUA 3GCVA 3WZEA 4BCKA 2PZPA 3FSKA 5DPVA 3PJ8A 1KV1A 3OXIA 3UQGA 2WAJA 3HUCA 4O0YA 2VWYA 3SKCA 3RCJA 4FZ7A 3UG2A 4DCEA 5HTIA 3FZ1A 4U41A 5LARA 3BE9A 2JIUA 2OK1A 4EBWA 4FE2A 3BGPA 3GCPA 3NX8A 3DFCB 4S34A 1LEWA 3LMGA 2OZAB 2WMWA 3ORMA 4RGJA 4R77A 4EUTA 1WBTA 3LVPA 1TQIA 5AP1A 4XLIA 4ASXA 4HVHA 5HU3A 3UVRA 4MQ2A 2UV2A 2UZNA 3F2NA 4FKVA 4IANA 1JSTA 3R22A 4DGLC 2ERKA 4AW1A 4WBBB 3QTSA 4IM0A 5EW8A 1UWJA 4WSQA 3TXOA 3ENHA 4DHZA 3NIZA 2J5FA 4I4FA 3CC6A 3O71A 4G17A 3W0QA 3BQCA 5B2KA 1JKKA 1LPUA 3NUNA 3NVKI 3OEZA 1IR3A 2XRUA 1OL6A 2CMWA 3QQUA 5FP6A 3RHKA 2C0TA 1YOJA 3R8ZA 2WIHA 4JX7A 3R7GA 1ZZ2A 5C8KA 3KMUA 4L45A 1NVRA 2NP8A 4C2WA 3JS2A 3V04A 3NNWA 1XH5A 3QTZA 4DG3E 3MH1A 4Q9ZA 1OUYA 3E8CA 3QRUA 5E1EA 3BCEA 3D7ZA 3LXNA 5E9EA 3OT3A 4ZIMA 4RX9A 4W4WA 2FSMX 3GCUA 3LFDA 4WNOA 3AD5A 2C6LA 2VTSA 4JQ7A 4FTMA 4USEA 1JBPE 4FV6A 4IZ7A 3PXYA 3KRWA 4HPTE 2G1TA 2Z8CA 1REKA 5AP4A 4B4LA 3E8DA 5L4QA 4DH8A 1JSUA 3P0MA 3QHWA 2WMUA 2QVSE 4XBUA 3DLSA 4CZTA 4ENYA 5KHWA 1SVHA 4G3CA 3RVGA 2VGPA 3WZKA 3V6SA 3LMHA 3U8WA 3NR9A 4FV8A 1GIIA 1B39A 2XVDA 4NT4A 3D5XA 3F5XA 4BTMA 3TKIA 1LUFA 4NM0A 3EB0A 2C69A 3CIKA 3NLBA 3ANRA 5TOZA 4A4LA 4FEUA 3SVVA 2O3PA 4FBXA 3FLNC 1G5SA 3ZXTA 4G9RA 4KB8A 5KBQA 3UTOA 2GCDA 4WRGA 2W1ZA 4A9RA 5JFXA 3E62A 4E7WA 3LFEA 1PMUA 2C5OA 3Q2MA 1Q8ZA 3Q3BA 5AA8A 2YHVA 3QWKA 4UXLA 4D2RA 5J87A 3QA0A 1GZ8A 2Y8OA 4CEGA 1CKJA 1DI9A 4O7NA 4O2PA 3I60A 3MB6A 1IG1A 4IFGA 2XF0A 3NPCA 2V55A 4CFUA 1DI8A 4CNHA 4L7FA 4RIOA 4E6AA 4Z7GA 5FRIA 4MXYA 1YDSE 4IAKA 4JR7A 4PDPA 1R1WA 3WF6A 4JLCA 2RL5A 5AADA 4RA4A 4FGRA 2F57A 5IA4A 3BV2A 3C50A 4RFMA 1W98A 3PP0A 4YJUA 4U3YA 2Y9QA 3VF9A 3EKNA 4BCMA 4WUAA 1AD5A 1FPUA 3MY5A 3SXSA 1YRPA 1ST4A 2ONLA 4CQGA 5AR8A 3MJ2A 2OKRA 3TCPA 2R2PA 1H4LA 4KAOA 3FY2A 2C5VA 4JBVA 4LL0A 4AOJA 3GFWA 4C8BA 4HNFA 3ZUVA 5A14A 5EW9A 2VWUA 2PK9A 3PJ3A 3R1SA 5L8LA 4I23A 5FGKA 3SXRA 2X0PA 3C0HA 4MXOA 3FJQE 4F7SA 3NAYA 4FNXA 4E93A 4XV3A 5JMSA 5J5TA 4BWKA 4Q5HA 3MBLA 2LGCA 4JBQA 3OWLA 4EL9A 3RK5A 5FXRA 3ZONA 4BKZA 2EXCX 2X4ZA 3CQWA 4FNYA 2O5KA 1UNLA 4L8MA 2QR8A 5HE0A 4M69A 4F9YA 2JFMA 2PVJA 2BTSA 2R3NA 3UOKA 3QXPA 4TNDA 5DRDA 3VUGA 3UG1A 1T46A 3KK8A 3MN3A 4ANQA 3DTCA 4YTFA 4J96A 5E4HA 3A8WA 4J71A 5DIAA 4JIAA 4RBLA 1GNGA 3RAKA 5E8UA 3PFYA 2QR7A 2W06A 4GVJA 2B4SB 4X6QC 2OFUA 2GU8A 4I6FA 4E5WA 2JAVA 1XH7A 4IM3A 4R7IA 3Q60A 2AQXA 1KE5A 4M66A 4LOQA 5ANEA 5F94A 3CQEA 4K11A 4FKSA 4Y73A 3FC1X 4YHTA 4CYIA 3NEWA 4QYGA 4IX5A 5AM6A 2UW5A 3ENMA 3LXPA 4Y8DA 3WYXA 3BHVA 3W2PA 1OIRA 2DQ7X 3H9FA 5FP5A 4BZDA 3EQHA 4OBPA 3II5A 5F9EA 4FVPA 3OCGA 4W9WA 4IWDA 3OZ6A 2ETKA 4AGUA 2XJ1A 4BDFA 1F5QA 4F7JA 1ZYDA 5T6KA 3ZMMA 1H1WA 1YOLA 3GFEA 3OBGA 4ASDA 4FKJA 3TMOA 3UYSA 4BF2A 5J9YA 3KA0A 3QWJA 4DEDA 3CCNA 1BL6A 2IZTA 2V5QA 5CVGA 1S9JA 2YAAA 1MQBA 1OKVA 2F9GA 2VRXA 5D12A 1E1XA 1YXUA 1PXIA 3QQHA 1H27A 1QMZA 2C5XA 2Z7LA 3F3ZA 4LRKA 4YZCA 5HESA 3E88A 4IB5A 4APPA 3D83A 4D28A 4L7SA 4U5JA 2XNOA 2C6KA 3EHAA 5DG5A 3C0GA 2VTMA 2Y4IC 2XEZA 1ZYSA 3F7ZA 4BDBA 1W2FA 1M7NA 4L3PA 3HP2A 3VW6A 3FMNA 2PUNA 2OGVA 2R7IA 3IONA 3N51A 5A4CA 5DBXA 3Q9XA 2NYAA 2WMAA 5CT0A 5C1QB 2ITZA 2UZTA 2YLEA 2WTKB 3ZDUA 2J0LA 5HE2A 4F7NA 5AAGA 4DBXA 2Q0NA 3C0IA 3LXKA 3DPKA 3LJ2A 4DFXE 5AEPA 5T68A 4IC7A 3JR1A 3ML1A 3HMNA 4BDKA 2ZM4A 3NYXA 5H8BA 2CNVA 2ITNA 3D14A 4NW5A 3WIGA 5KUPA 3KK9A 3ZBXA 4EK5A 4V05A 4C38A 1YXVA 4I1ZA 3UC3A 3O0GA 3UOLA 3U9CA 4QMOA 4GIHA 5FTGA 4L46A 3G9LX 2GQRA 3UYTA 3ZSGA 3ZO4A 2QQ7A 5DR9A 2GNHA 4A4OA 2OXDA 3Q5IA 4AN2A 5A3XA 3ZC6A 1URWA 2J50A 3Q9ZA 2CGWA 3VW8A 4YJTA 2W1DA 3EQCA 3S0OA 4LV7A 4R6VA 3UNKA 3CS9A 3P23A 3F61A 3G90X 3GCQA 4FT9A 4OGRA 5TKDA 3BELA 1OGUA 5FDXA 3OCSA 2QURA 4P5ZA 4W4YA 4XG4A 4UV0A 3G6HA 4HGSA 2VTNA 5EM8A 2YISA 3W16A 4AT4A 3PTGA 5T3QA 2YABA 4AOTA 3GC9A 2OIQA 4FYOA 5IMEA 2P2IA 3ZC5A 4V01A 4I94A 4EYJA 3KULA 4EK6A 3MV5A 3V5LA 4MBIA 2BIYA 2IW6A 5EK7A 2Z7SA 4PRJA 4IVCA 4C57A 3LFQA 1VYZA 2X7OA 3RAWA 5EYDA 4AT3A 3FLWA 4CV8A 5CF8A 3FXXA 2PSQA 4J52A 4P2KA 4QMYA 3OOMA 3KCFA 2UW8A 4C3FA 2HIWA 2JKMA 4V0GA 3O5AA 2G2HA 3ORIA 4FODA 4IXPA 4RZVA 3V5TA 1XBBA 5LCJA 3FPMA 4LM5A 4KBKA 4GYGA 4MYGA 5BUIA 2WQNA 2OXXA 3PUFC 1AQ1A 5HU9A 1M14A 2H8HA 1U5QA 5M57A 1ZYCA 5JQ5A 4X0MA 2WMQA 4BDAA 3FEGA 5E8VA 4I93A 5E8YA 3MESA 2PPQA 4PMPA 4G6OA 4RIWA 3NFFB 1O9UA 5FG8A 3CP9A 5H8GA 3W2QA 4QDEA 4DH7A 5HNGA 1KE8A 4RJ3A 4KWPA 3PJ2A 4AXCA 5GJFA 2ZV9A 3ZOSA 4ZTSA 4GCJA 2IJMA 5BVNA 1XKKA 2CLQA 4FTRA 3A7IA 4A07A 3ETAA 4CKIA 3Q53A 5L2TA