3OVVA

Human camp-dependent protein kinase in complex with an inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title fragment based drug design on PKA
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 110
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ovvA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ovvA02
1H07A 3DBCA 3EQRA 4K1BA 1LP4A 1OL7A 3F88A 4RWLA 2PSQA 2PL0A 3ANQA 5L6OA 2OI4X 5E8XA 3HAMA 3C5UA 3DNEA 1UWHA 3EQDA 4UWYA 3ULZA 3VBQA 3BWFA 5EKNA 1FGKA 4M69A 4TYHB 4CKJA 4C3PA 1GOLA 1H1WA 4FSMA 4UALA 4W8DA 4D9UA 3E8CA 5I9YA 5CI7A 4UMUA 4C4JA 4X2JA 5CQWA 4D2PA 1NVQA 5AUUA 2W99B 3NW7A 3F5PA 2XRWA 2UZWE 5HX6A 3BU5A 3HYHA 1FOTA 2XK9A 3CJGA 3DTWA 2JGZA 2OJIA 3G51A 3FXZA 3NPCA 1VYZA 5DNRA 3LMHA 3SG9A 4TNDA 5AP4A 4O7VA 3T3UA 3W8LA 5AEPA 4EH6A 4FEVA 4FKWA 5HO7A 4UBAA 1YOLA 2O8YA 3LQ3A 2V7OA 4TWNA 2BFXA 2YLEA 4WKQA 3RM6A 3Q2JA 2XM8A 3LPBA 1V1KA 4QMUA 3ACJA 4A07A 2OW3A 2X39A 3LM5A 2BAKA 4NCTA 4WG5A 3HP5A 4CTCA 3VS6A 3EZVA 5IEXA 4UXQA 1ZMUA 3AC3A 3R00A 3TUCA 3R1SA 3MA3A 5GINE 2GNIA 3EFWA 2OJ9A 3FWQA 1CSNA 1OKWA 3CY3A 3DAJA 3VBYA 4MYGA 3F66A 3WZDA 4ANBA 2CHLA 4PMMA 2CSNA 4QYYA 4BDIA 3NNXA 3UO6A 3MJ2A 3QKKA 1WBVA 4J8MA 1VR2A 5GJGA 2V0DA 3UVRA 3KREA 2J0LA 3FI2A 4WBBB 3C4WA 3CGOA 4BWPA 3NYOA 4C61A 3MWUA 5CAPA 3K54A 5EM5A 2OK1A 3H30A 4NJ3A 1BL6A 4D2RA 4E3CA 2H8HA 1F0QA 2R2PA 3ALNA 4X3JA 3VS3A 5KMOA 1IRKA 3ORTA 4J8NA 4LI5A 4Y85A 3OT3A 2WHBA 1BMKA 4F64A 5J5SA 5E7RA 1WBSA 2O63A 3EOCA 4K8AA 4M84A 4CRLA 4NKAA 3I7BA 3SV0A 4B8MA 5KO1A 3UIUA 2CMWA 5FP5A 4AN9A 1XWSA 3RHKA 5JRQA 3GVUA 3SXFA 3UNZA 3ZZWA 4QD6A 5GIOE 4B4LA 2JKKA 4FVRA 3HMOA 2UW9A 3I0QA 5AP6A 3Q4TA 3ZHPC 2W5AA 5HOAA 1Z57A 3F3TA 4AFJA 4G5PA 4BB4A 4L7FA 2VV9A 3KA0A 4K6ZA 3F2RA 3OXIA 1OL5A 5HCZA 3WF8A 4AW2A 2NNWB 3R22A 5AUVA 1OUKA 3MFRA 3VW8A 2XEZA 3U6HA 3KF4A 1FQ1B 3WIKA 1PKDA 2X2MA 3FMKA 3M11A 3PLSA 4U97A 4XRJA 5T68A 5IUHA 3AC4A 4OTWA 5F20A 3KCFA 5CXHA 5D7VA 2ZM4A 4TZRA 4ACHA 4FSUA 4MXOA 3EN9A 5I3OA 5DEWA 2UV2A 2HXLA 2W1FA 3LQ5A 4DFBA 3TNWA 5HKMA 3ZS5A 2B0QA 4LOPA 2XK8A 3COMA 3NLBA 3FKNA 2J0IA 3KMMA 3Q2MA 4EL9A 2BRNA 4OAVB 2VWIA 2WEVA 3ANRA 4C4FA 2XIYA 4RVLA 2R3NA 3VS0A 1F5QA 3C9WA 4G31A 4QT1A 4LMUA 1FGIA 3UBDA 5IDPA 2IVSA 5M51A 4OTFA 2OFVA 4FKTA 4E5AX 2BRBA 3QTQA 5D41A 3L9PA 4YSJA 4KIQA 4ZLOA 4F99A 4H39A 2J4ZA 5CQUA 3ROYA 4XG2A 3TV7A 2PVNA 4DEDA 4GYGA 4BCGA 3PVGA 4IWPA 1NA7A 4PX6A 4RIOA 4BC6A 3FLNC 4FKSA 4RIWA 4C36A 4FG7A 4Z7GA 1VYWA 5L2TA 2O0UA 3FQSA 4YPSA 2WEIA 3DLSA 3O17A 4J98A 5D7AA 5EI8A 4F0FA 2W1ZA 4DFZE 2HWPA 4LL5A 4NIFA 1Q24A 4JG8A 3QRJA 4LGHA 4O0XA 1YQJA 4OBQA 5T6KA 3QTSA 3QLFA 3N4VA 2IVTA 5IU2A 4A4XA 3EJ1A 4RJ6A 2ITOA 5DGZA 3AXWA 4HGSA 5FEEA 4G34A 4C57A 2WIPA 4YTIA 2QOKA 5D12A 1LPUA 2VN9A 4YGAA 1PF8A 3DBQA 2FO0A 3JXWA 3SX9A 4FSTA 4MVFA 2J5EA 3A62A 5HIDA 5HNIX 4UYAA 4ZTRA 2JKOA 3D7TB 4FV9A 3KXMA 2X0GA 1UNLA 4QO9A 4ANMA 3C4EA 1OPKA 2WGJA 1SVGA 3KN5A 4CT1A 2PZYA 2WOUA 4R1VA 5IA2A 5IZFA 4YJUA 3VN9A 2Y4IC 4E6CA 3KXHA 4RVMA 3VAPA 4BIEA 2EWAA 5EHYA 4CYJA 3GC8A 5BPYA 1H1SA 4ALUA 5AAGA 5LOHA 4ZS4A 3FZOA 3A7FA 4FTNA 1PYXA 1YI3A 3EIDA 2CNUA 5KCVA 3LXLA 5AAFA 5BVKA 4FV3A 4O0UA 3W55A 1W84A 4LFIA 3CTQA 3ORMA 4U80A 5ANJA 4FV0A 4L42A 4CSVA 4JBPA 2W96B 3BZ3A 5HICA 4FODA 4AA4A 4EC9A 2WO6A 4EZ5A 3HA8A 2ERKA 4QP7A 4ZY6A 3RMFA 3CKXA 4E20A 4O7ZA 2YJRA 1YI6A 3LFNA 3KVXA 4IJ9A 3C7QA 4OBOA 2WMXA 5EDPA 2PULA 3TDVA 3BYOA 3MS9A 5G1XA 4I93A 5KKRB 2A4LA 4EOLA 3JPVA 1PMVA 4JQ7A 4M15A 4XG7A 5L2IA 3DV3A 5M09A 5HE0A 1YHVA 1XBCA 3ZUUA 3CS9A 3K3IA 3TZ7A 4YJOA 4FEUA 5CYIA 3U54A 4HVIA 4HYUA 3HMIA 4ZSGA 5AA9A 2QU5A 4ERKA 2BILB 3Q52A 2AC3A 4MQ1A 3SOCA 4PL3A 1JNKA 2R3HA 2PU8A 1P5EA 3QRTA 4TYHA 4I24A 4JS8A 3VIDA 1OI9A 5H3QA 3ZDUA 2UVYA 3TUBA 3PE2A 4C38A 4S31A 4YC6A 3DB8A 4L00A 2VNYA 3KFAA 4PL5A 4RPVA 2CLXA 1Q41A 3LXKA 3VS4A 3TI1A 3ACKA 1S9JA 3BBTB 3CLYA 1GNGA 3FLWA 2GS7A 5I0BA 4FUXA 4NM5A 4QYFA 4V0GB 4V05A 3WF7A 4L3LA 3IDBA 5CNOA 3FI3A 3K3JA 4B9DA 1TVOA 2OXXA 1PHKA 3IW7A 3H0ZA 4JJRA 2F49A 3I60A 3MBLA 4O0SA 2LGCA 3RPOA 4GKHA 5IF1A 1H08A 3QL8A 5F94A 4FV8A 5HE2A 3RJCA 4EOSA 5IEVA 5HTCA 2J50A 1ZY5A 4DFYA 2BROA 3AT4A 2PVKA 4NM3A 2WQBA 1FMOE 5FG8A 4M67A 3C0IA 3AGMA 1WBOA 3WBLA 4Q5HA 1T45A 1R3CA 4IAFA 3ENHA 2YM6A 3BRBA 3NZ0A 4QP2A 1A48A 4K33A 4OTDA 4EOOA 1OITA 2OWBA 3G33A 2YCRA 3SLSA 4IDTA 5KBQA 3CPCA 3A2CA 5HHWA 4O0TA 3W33A 4O27B 4BGGA 1YXXA 4BI2A 4FIIA 1W98A 1GZNA 3KC3A 5JEBA 3FMJA 3W18A 5J9LA 3MVMA 3OW4A 4H05A 3ZRMA 5GNKA 5K0XA 5FDPA 2QO2A 3ZM4A 3HGKA 4AP7A 3QUDA 4ANQA 2P2HA 4TYIA 3ORZA 5AIKA 1GIIA 2B53A 3OP5A 3ZLSA 4YU2A 2R9SA 4KRDA 5CF4A 3BHUA 5HCYA 1BI8A 4AN2A 4EK6A 4F6SA 4O0VA 3II5A 2BRHA 3UE4A 1SNXA 3EB0A 2VX0A 3FMNA 3R02A 4AGUA 4WRGA 2RFSA 3OXTA 2C1BA 2CKPA 2W06A 4OLIA 3HA6A 2XB7A 4XOZA 2ITNA 3B2TA 1OVEA 5KMKA 3EFKA 2ZMDA 1JKTA 1KUTA 4WNPA 3EYHA 4RGJA 3H4JA 1ZYDA 1XH4A 2VX1A 3PSCA 4H3PA 3NUUA 2VTLA 2J0MB 2BDJA 4KB8A 1IAJA 1T46A 3GBZA 4IMYA 4C3FA 3TL8A 2P33A 3F5XA 4FV7A 4BTKA 3ID6C 4IDVA 2VGPA 4B6LA 2RGPA 3EZRA 4S34A 4A9TA 3GUBA 3QHWA 4BTFA 4EONA 5ITAA 3ZZEA 4AZVA 2UZBA 2VZ6A 2ZB1A 3DXQA 2VTMA 2XBAA 4CQGA 4DEIA 4L3JA 3ZC5A 4G2FA 2R3QA 3S0OA 3O51A 3FPQA 4ASEA 5IH6A 4L53A 4C62A 3Q9WA 2R3FA 4LQMA 3Q4CA 1OM1A 2IZUA 2I0YA 5HNBA 3Q60A 3DU8A 4FUYA 3KK9A 4YNOA 5M06A 5D1JA 3DBDA 3OROA 4C4IA 3RAWA 3UIBA 3MN3A 4EH9A 2Y6MA 3BV2A 3POZA 3N9XA 2IW6A 5AP7A 4DEHA 3QA0A 3PZEA 4EUUA 4PP7A 3QBNA 1NVRA 2W17A 4I5PA 2W1DA 2OIDA 5FGKA 4J95A 4BRXA 4JBQA 4EH4A 3QQKA 2O5KA 4OAUC 4K9YA 5CU3A 3SXRA 5LWMA 2GNGA 5TE0A 3TXOA 3A4OX 3G90X 5LCKA 4MNEA 5D10A 5IPJA 1GZ8A 3I5NA 3QXOA 3DQXA 3SW4A 3UG2A 2C0IA 4TW9A 3ZM9A 4FTQA 1UNHA 3SQQA 3R6XA 4ZOGA 2QG7A 4CNHA 4G3DA 3KXNA 3SVVA 2WMSA 1XH7A 4YJSA 5E91A 2XMYA 4FEQA 5IQHA 2BTSA 5LVMA 1Y6BA 1FBNA 1LUFA 3LMGA 5AUXA 2JAVA 5HX8A 5CU6A 1Q4LA 4FIEA 3TIYA 4F9CA 1ZAOA 2CDZA 4Q5EA 3UYSA 1R78A 2BAQA 4NK9A 2X2KA 1S9IA 3ZLYA 4E4NA 3NSZA 5GIPE 4EH2A 2W4KA 1PXMA 4C4EA 2QO9A 3DAKA 2PVYA 3D5UA 4WSQA 5BX0A 2YWVA 4DITA 3N4TA 4BWXA 3UZRA 4DG3E 3UIMA 3MB6A 5J9YA 5LVNA 5HBHA 3D7TA 5L6WL 4ANSA 3F61A 2GCDA 3C4XA 3OC1A 5LVPA 4GKIA 4CFNA 1OMWA 3U8WA 4EEVA 2CLQA 4D58A 3A7IA 5HLNA 3LFCA 5C4LA 2QQ7A 4HJOA 4JG6A 5CXZA 1TKIA 5C8MA 2VWZA 4AACA 2HIWA 3BE9A 3W8QA 3W10A 5I5ZA 5IQAA 2C6IA 3LJ1A 2R0IA 5DR2A 4M69B 4CFMA 4I5MA 3JR1A 2BALA 5ICPA 4G9CA 1SVEA 3BGQA 3LOKA 4QRCA 2NRYA 3DKOA 1O6YA 4YJRA 5CAUA 5J1WA 2BDWA 3SXSA 4CZUA 3UOJA 2XK4A 3RHXA 1APME 5A46A 3NNUA 5DT0A 3TKUA 1YOMA 3QGWA 3MV5A 1URWA 3UDBA 4ORKA 3NUAA 2KTYA 3EN4A 4AQCA 3IOKA 4YLLA 5B2KA 2VWUA 3KRXA 5C01A 1J1BA 3KK8A 3L9MA 3UP2A 1XH6A 1U5RA 5FD2A 4NCTC 2X8IA 5IQFA 3FUPA 4XG4A 5CU4A 5HG9A 5EYDA 5AP3A 3FV8A 2RIOA 4RZVA 5AP0A 4CRSA 5E8ZA 3FHIA 5K5NA 2HENA 4F4PA 5I9VA 5JRSA 3Q3BA 3UPZA 3OBGA 3R0TA 2ZDUA 1TQMA 2YEXA 2BRMA 3NCZA 3CQUA 4JBOA 1PXNA 5HCXA 3O50A 3UVQA 1QMZA 3N4UA 3D2KA 2GMXA 2X2LA 3SG8A 2C47A 3CGFA 2OIBA 4KAOA 4O2ZA 2UW7A 4F7LA 2UW5A 2ZJWA 1QPCA 1XHAA 3MTLA 2X6EA 5DT3A 3GU7A 4Y5QA 2ITVA 4ZS0A 5TF9A 5L6PA 4R7HA 5M53A 2J5FA 1MRVA 4PDYA 4ZP5A 4FTIA 5C1QB 5LWNA 1YRPA 2PE1A 2PVJA 4GJ2A 4UN0C 3FLYA 4RA5A 1DI9A 2OF2A 3A99A 3BI6A 5FM2A 1OZ1A 3PJ3A 4DEGA 4YUQA 5AX9A 1W83A 4U0IA 4PNIA 4GL9A 4ZSLA 3R21A 4EKKA 1BI7A 4W8EA 3ALOA 4RA4A 3W2QA 4BZDA 4UMPA 3H9FA 4S32A 5DIAA 3VBXA 5A6OA 3DTCA 5FP6A 3QZGA 4NJDA 2JDTA 2JIVA 3LE6A 1U54B 3HLLA 4C8BA 5L8JA 5HD4A 3UNKA 3H9OA 5FQDC 5DT4A 4IWOA 3V8TA 3CC6A 3NVKI 4IAYA 4YJTA 1UKIA 2YM8A 2UZNA 4D28A 1CDKA 2VWYA 2QR8A 5JKGA 4BCMA 4LOQA 3T3VA 3VUIA 4N57A 1CMKE 5ETAA 2PE0A 4II5A 4IADA 4XV3A 4UMRA 2CKQA 5AP1A 2VTOA 3POOA 1P4FA 3IGGA 3PXZA 4YHFA 3ZMMA 4C35A 4QYHA 4Q9ZA 4EK8A 3FLZA 3ZDIA 5BVFA 3HAVA 3PXRA 4RZWA 3TKHA 3F5UA 2BKZA 3H3CA 3DKFA 4Y83A 4EZ7A 4I94A 3EQHA 4DGMA 2JBOA 4R77A 2X1NA 2UZDA 3MJ1A 3PUPA 5HU9A 3PZHA 4KD1A 2VO7A 1LEWA 4CKIA 4X2FA 4LV8A 4F1TA 1KWPA 2XM9A 4H3QA 4GUEA 4F08A 2YIXA 1M52A 4L9IA 5CAVA 3NW6A 5E1EA 4O2PA 4BDFA 4USEA 3VUMA 4RFMA 4WNOA 4ZJJA 2QC6A 5A4EA 3LIJA 2W9ZB 3LFFA 4C2VA 3FC1X 3W32A 1H4LA 5BVDA 2V5QA 3OWLA 1ZMWA 2C5NA 4ZAUA 3KCKA 1O6KA 1OB3A 3FMDA 3KRWA 4GT4A 2W0JA 5DR6A 5FBNC 4ZZMA 3NWWA 4QMOA 2QOCA 1BX6A 4BTMA 4Y46A 5KMLA 2C3IB 4D5KA 2PMNX 1UNGA 3M2WA 3RK5A 2W4OA 5L3AA 4BHNA 1Y91A 5L4QA 5FTOA 3CD8A 3T9IA 4BKZA 1UU8A 2OIQA 5CVFA 3BHTA 5HIBA 4X6QC 4D1ZA 4FE2A 3D15A 5IQEA 1PW2A 4YJPA 2PK9A 2KULA 5BYYA 5CX9A 2Y4PA 5J95A 4Q2AA 5CLPA 3V5WA 4GK2A 4JR3A 4RIYA 1K9AA 5CSWA 3W2SA 4X3FB 1OKZA 1WVWA 2G15A 3HL7A 4FVPA 3LCKA 3R1YA 3ZOSA 4DGGA 4HCVA 3GCQA 2PVRA 4YLJA 3R2YA 5JQ8A 5JMSA 2W1EA 3CY2A 1OPLA 4FSQA 3H10A 3P9JA 5DLSA 4IAZA 3ZFMA 1JQHA 1YDSE 4KSQA 2Y9QA 4O84A 4XLIA 3CQWA 3FY2A 3CTJA 4BDGA 4QPAA 4AF3A 3B2WA 1XH8A 2FYSA 2I0EA 4L7SA 4IB3A 4G3FA 3DT1A 5HI2A 4DHFA 1CKPA 4YO6A 4O0YA 2YISA 5EW8A 2LAVA 2ETKA 2R4BA 4GCJA 4CFUA 1GAGA 1YXSA 3AQVA 3OY3A 1A9UA 4RX8A 4O38A 3E92A 5DWRA 1UU3A 3TCPA 2OH4A 4NUSA 3WYXA 4AA0A 4AT3A 1NY3A 4DGLC 3COIA 3ATTA 3ZSIA 2DQ7X 2HY0A 4XV9A 1OL2A 4AX8A 2O65A 2XF0A 3Q96A 4RLLA 4I6HA 4O81A 4WUNA 3O2MA 2GS2A 2FSMX 2WTWA 4IWQA 3MIAA 2FSOX 3R7GA 3VQUA 2OJJA 4BWKA 4TPTA 4ITIA 4K0YA 2J51A 5DI1A 3HV3A 4ERWA 4BY9E 4ANOA 3RNYA 3QGYA 4GK4A 5L8LA 4FL1A 5E8TA 4N70A 5IQIA 5LMKA 3MPTA 4TWOA 5BNJA 4FTKA 4ZLYA 4RBLA 2WZJA 2Z7SA 4UWCA 2OSCA 1M2PA 2R7IA 1Q97A 3RPVA 3NGAA 4BF2A 2GNFA 4KNBA 4XV1A 2OXDA 3FI8A 4FT9A 3GOKA 4RQKA 1BLXA 5FXRA 3G0EA 4HNIA 3R9HA 4FNXA 4AZWA 3UMXA 4AZEA 3E7VA 5GZ8A 4DF3A 4Y73A 3ZEWA 2CNVA 5E90A 2JKMA 4RX5A 3WOWA 3AMBA 3QTIA 4QTEA 1H24A 4CQEA 3MVHA 3BYMA 3L9LA 4DEAA 5H8GA 5G6VA 4GW8A 4R7IA 4F7NA 2WFYA 2X4FA 2WB8A 4IJPA 4W9WA 5KX8A 5EM6A 4LRKA 3U4UA 3QX2A 5EM8A 4UB7A 4DTBA 2ZB0A 1M17A 1CTPE 3FQEA 5C27A 3WZKA 3AOXA 2YACA 4IIRA 2BKKA 2PWLA 2XBJA 4YO4A 2GS6A 2F7ZE 3QWJA 5CALA 5J5TA 4DT9A 2WTKB 1H27A 4R5YA 4ASXA 3FYJX 1REJA 4C0TA 4D55A 3E3PA 3R63A 4DLJA 3HRBA 2VO0A 4IVBA 4KKGA 2RKUA 4WUAA 2QCSA 2IN6A 2JDSA 4FGBA 3OWPA 4X21A 5EQEA 4ZZNA 4CMOA 2C6KA 4MTAA 4WOVA 4KKEA 2BRGA 4RJ7A 3OCSA 3WF9A 4YTFA 2JC6A 4R3PA 2QOHA 2NO3A 2WXVA 3I5ZA 4RFZA 2JDRA 3OF0A 4XEYA 3ZU7A 3ORXA 5DFPA 4DFXE 4FV6A 4QP8A 4KRCA 2A27A 3DY7A 3OCBA 3NYNA 5IDNA 5AP2A 3NAXA 2CCIA 3ENMA 1V0BA 4MXCA 5CEPA 2PUNA 4MNFA 3ETAA 3PPKA 5JGBA 3D5XA 4IX6A 2XKEA 5A3XA 1OKVA 1F3MC 5F4NA 3G15A 2FB8A 3ZUTA 2HW6A 5EHLA 1IASA 1XQZA 5AP5A 4DH8A 3RGFA 2Y8OA 3Q9YA 3DJ5A 2R3RA 2UZTA 3QRKA 3O7LB 3QAME 3FMMA 1U54A 5FXQA 1UWJA 4HYHA 3W2PA 2VD5A 2YM7A 4TYEA 2DUVA 4PTGA 1UU7A 1R39A 2FGIA 3EKKA 3SOAA 3JS2A 3T9TA 2HCKA 5IMEA 5HVJA 1WFCA 3PA5A 3D94A 2QKWB 4K77A 4U7ZA 5GJDA 4TL0A 4DG0E 4AZTA 5FUTA 4L68A 4OTRA 1YWVA 3OD6X 2OICA 4IB0A 4GG7A 2W1CA 5EG3A 5A4LA 4BN1A 3FMLA 4UZDA 4JIAA 4Y8DA 4FI1A 4FK3A 3L8VA 4HCTA 4NU1A 4O91A 5KMIA 2G2IA 5HTIA 1MRUA 1YXTA 4NYEA 2XJ0A 3GU8A 3LHJA 3V04A 2PZ5A 4GV1A 4YJNA 4FZAB 4CZTA 4CLJA 2ITQA 4IACA 1Q99A 4D4RA 3VWAA 4FTMA 2UVZA 4RWIA 3OY1A 5CVGA 2E9PA 3P86A 3Q5ZA 4KBKA 4ACGA 3ODZX 3PJ2A 4I92A 4KIKA 1KE6A 4XV2A 5HO6A 4O21A 4O96A 4RJ3A 3VRYA 3OHTA 4WHZA 3KVWA 5DVRA 4AW0A 4O1PA 5HE1A 3AC8A 4FNWA 4O7YA 3TJCA 3RCDA 5HLWA 2IO6A 2VAGA 1DI8A 2X9FA 3C50A 3E64A 4FTRA 4MCVA 2YWPA 3P1AA 2VO3A 1R0EA 2OFUA 3FLSA 3HUCA 5CZHA 4BR3A 3IECA 2PE2A 4ITJA 5DH3A 4U3YA 5J7BA 2QLUA 1H8FA 4FKRA 4KIOA 4AFEA 1ZARA 2BZKB 3V8SA 3VNTA 1ZOHA 4A06A 3R8MA 4LGDA 2GSFA 2C5XA 4TYJA 5FM3A 4TTHB 4TY1A 1HCLA 1PXIA 3VHEA 4MNEB 4NH1A 3ULIA 4U41A 3EL7A 4F9BA 4FV1A 1G5SA 1M2QA 3AGLA 2P55A 2YDIA 2IVUA 3EYGA 3HRFA 3UMWA 4I5HA 3LCSA 4AW5A 3Q9ZA 3L8SA 1YDRE 4L01A 4IVDA 4L67A 5T3QA 3EH9A 4BVUA 1Q3WA 3PJ1A 3PJ8A 3H0YA 2WTDA 4EK5A 4PPBA 2RFNA 5LARA 2X4ZA 5EQYA 4CGAA 3R8LA 2GDOA 4X3FA 5KHWA 2W5HA 4G17A 4O0WA 3R8PA 2YIQA 3PSDA 3IW8A 1I09A 5BUEA 5A4QA 4CTBA 4YZBA 4E26A 5JGAA 2C5OA 4KBAA 3MGYA 4AE9A 4PF4A 4DGNA 1WVXA 2IZSA 1UU9A 2WU6A 3LFSA 2OZOA 2AC5A 4L6QA 3VF8A 3ZCLA 2Y6OA 4OT5A 4GU6A 1FVRA 2PZRA 3HDNA 5AR4A 4JLCA 4NTSA 1XBAA 5M4UA 4O1OA 4P7EA 4G5JA 2JD5A 4YZCA 5AX3A 4EH3A 1J7IA 1M14A 4E6QA 5DE2A 2F7XE 4F9YA 1VJYA 3HMMA 3RAKA 3BX5A 3SDJA 5IISA 5HZNA 3K5UA 4ZTHA 4RJ8A 3FZSA 1QL6A 5JGDA 3IW4A 2J2IB 2WD1A 2X7FA 3BGZA 3KL8A 3MDYA 5BVEA 4ZJVA 3L8XA 4ENXA 4K11A 3E8EA 4U43A 1J7LA 3GQLA 4KA3A 5KKRC 3LLTA 4AGDA 2R3JA 3E88A 3WE8A 5IA1A 5LCJA 4FTLA 4GT3A 2FSLX 4X7QA 4GH2A 3GCSA 2IWIA 4FKUA 4G3EA 5DEYA 2YFXA 3HMNA 3UJGA 3R8VA 2F2CB 3QKLA 5CAOA 5HTBA 1P4OA 4RVKA 5EFQA 4YC8A 3NNWA 2J6MA 2BIYA 5AM7A 3NIEA 5IEYA 1IA9A 3U51A 4QYGA 5EYKA 3OOGA 3G9LX 3V6SA 3VBWA 2FH9A 3PY0A 2PPQA 1JVPP 4YSMA 1PXLA 3NIZA 1A06A 1J3HA 3KRJA 4WG4A 2G01A 3UIXA 4QQCA 2P4IA 3FXXA 3AD5A 3TDWA 3RP9A 3PXKA 4CYIA 3QZIA 2OZAB 4CKRA 1OKYA 2WMTA 3I4BA 2B9IA 4DBNA 4E6DA 4QQTA 3NAYA 5EI2A 2I0HA 4G9RA 3NUXA 1URCA 3BYUA 4UY9A 2XYUA 4FK6A 5CU2A 1BYGA 3S2PA 3A7HA 4C3RA 3BHYA 3PWDA 2BPMA 3DK3A 1ZY4A 2H9VA 3EKNA 4DH7A 3CP9A 3IOPA 2ETRA 5AR7A 1ZLTA 3PJCA 3SRVB 4MAOA 5L2WA 2I40A 1SVHA 2R3MA 2OXYA 4P90A 4TWCA 3TACA 3NUYA 3U9NA 2WAJA 1M7QA 4MXZA 3GU6A 3F6XA 3NNVA 4FKVA 4J97A 3L9NA 4D1XA 4ZIMA 4QNAA 3R71A 4DH1A 2XKFA 4YTCA 2A0CX 2XJ1A 5HU3A 4D4SA 4MBJA 5K3YA 2C0OA 3FE3A 4E93A 2Z02A 4LMNA 2CPKE 3HKOA 4YHJA 2B1PA 4EORA 2YITA 4ZMEA 4X2KA 3KMWA 4A9RA 4FOCA 4FR4A 4QPSA 4PWNA 4G3CA 2RSVA 2REIA 2RFEA 5JZNA 2CGVA 3JVSA 4FKOA 4EC8A 3TZ8A 3LM0A 5IA4A 3GCPA 4AWIA 2ITYA 3C0HA 3KY2A 4JOAA 3DK7A 5BMSA 3HX4A 3QC9A 4RMZA 4OTHA 3S00A 5JN2A 5TT7A 3PG3A 4GFMA 2IW9A 3U9CA 4HZRA 3V8WA 5CAQA 4BIBA 2YAKA 2QNJA 3BLHA 2ITPA 4QPMA 4XP3A 4HYSA 1PXPA 2DS1A 1UVRA 2OJGA 5TR6A 4DFUA 2QR7A 3W1FA 1WBNA 3QD4A 4ZTLA 5JQ5A 5AM6A 4UYNA 3OZ6A 5DPVA 4F09A 3RCJA 4M12A 2UZEA 3QALE 2X8EA 5HGIA 3MYGA 3RWQA 2UW6A 3NUSA 2OG8A 5IG1A 1ZOEA 4BZNA 3C5IA 4JDHA 3A7JA 2GFCA 3FZTA 4IE9A 1J1CA 3COKA 2C6TA 3R9RA 4IZ5A 4QP1A 4EHVA 4QMMA 3P0MA 3V5JA 3DZQA 2QVSE 4DGOA 3FI4A 4XLVA 5KZ0A 4GG5A 2BAJA 3FPMA 4UMTA 4EBVA 2W4JA 2O2UA 3LFQA 4AOTA 4ACDA 4EH5A 2W05A 4UEUA 5L8KA 1G8AA 4B0GA 2R5TA 2X9EA 5M56A 2H96A 2PMOX 3KRRA 3C4ZA 3A7GA 3TM0A 3WARA 3AT2A 3DXNA 3D5VA 4ZXTA 1WVYA 2WMRA 5KE0A 4M0ZA 3UGCA 3CBLA 4QP4A 4J7BA 4PDSA 3TV6A 5EM7A 2VWVA 2F4JA 3F3ZA 3UOHA 5K4IA 2PYWA 1WBTA 3L1SA 2ITXA 4HGTA 4KABA 4EOPA 4R1YA 4RIYB 2CJMA 1V0OA 3HV5A 4Q9SA 4XG6A 1OGUA 5GZ9A 1JKSA 3R7IA 3R7VA 1WZYA 2NRUA 3DOGA 3NX8A 5AMNA 3ET7A 2R3IA 4ACCA 4HVHA 2F57A 3DGKA 5IQCA 3ATSA 3VBVA 2BZJA 3R01A 2YM5A 2XIKA 2BFYA 3LXNA 3PA4A 2YM4A 3P23A 1B6CB 3DS6A 4DH5A 5C4KA 1CM8A 4PP9A 3BU6A 1CKIA 2GNLA 2Z8CA 5KHXA 1Y6AA 4HCUA 4BI1A 2V55A 3FMEA 1OIQA 4XBRA 2VWBA 3P08A 3AG9A 2DYLA 2E9UA 3QF9A 3BQCA 3V5QA 5AUYA 3BU3A 5B2LA 4O7NA 2R3LA 4D1SA 5EOBA 5EW9A 3HV6A 3IKAA 2GQRA 3BBWA 1Y57A 2B9JA 1JSTA 4ZSJA 2XJ2A 2R7BA 2XRUA 4AT5A 4CMTA 4Z7HA 3RWPA 5B0XA 4M7IA 2IG7A 2OF4A 4QMPA 3A4PA 2JLDA 4DG2E 3IPHA 4R7BA 5AV0A 1MUOA 1TQPA 3PYYA 4M68A 1PRYA 5LMKC 3FXWA 1H1RA 3BEAA 4H1JA 3CPBA 3MH0A 3BLRA 4QNYA 2QOQA 4C7TA 3S95A 3R83A 3F82A 4DTKA 2HK5A 4IM0A 5FLFA 3GT8A 1Q61A 4DE4A 4DTAA 2E9OA 2OH0E 4KSPA 4NWMA 3G5DA 3OCTA 3PPZA 4KBCA 4Y72A 4BCJA 4EJ7A 5CSXA 3ZXZA 3JUHA 2VX3A 3PIZA 4R6VA 1FVVA 5J87A 4YZNA 3S3IA 5AUTA 3ZFXA 3KB7A 4XG3A 5HQ0A 3RBWA 2Z7QA 3CXWA 3SW7A 3AC5A 3C4CA 4DBXA 5CWZA 1G3NA 4FEXA 2XIXA 3GNIB 4F1MA 3PVBA 5EOLA 5HEZA 4EBWA 3PP1A 1B38A 2UW4A 2XKCA 2CKOA 2OLCA 2WQEA 4D0XA 2IW8A 3HP2A 4MD9E 2PTKA 4QMXA 3Q04A 4AOJA 3K5VA 5HBJA 4CMUA 4DH3A 4B99A 5AA8A 3RVGA 4RG0A 5BVOA 2OKRA 4F1OA 4FKGA 3P7BA 4FKJA 2YLFA 4W4YA 4DLIA 3CKWA 5EYMA 2OGVA 4MF0A 5IA0A 4JDKA 1DM2A 1GIHA 3QCXA 2Z7RA 5DRBA 3BQRA 1FPUA 2C3JA 2C5VA 3DBEA 3LW0A 4IAIA 4I4EA 4C34A 3LKMA 4E1ZA 4O22A 2XK3A 3G0FA 4GFGA 3UODA 5TOZA 2C30A 4IC7A 3ZH8A 2PHKA 3IK3A 3H9RA 1SZMA 4FYOA 4MHAA 5FXSA 5ACBC 3DFAA 4GK3A 3EQFA 5HO8A 2W1GA 3PWYA 4IBMA 5FBOA 4EQCA 4DN5A 1WMKA 2QI8A 4MBIA 1JBPE 1CKJA 5AR2A 3FHRA 3QYZA 4WD5A 1XJDA 5IH5A 2OZAA 2PVFA 3JVRA 3G2FA 4CCUA 1Z9XA 3KQ7A 3OTUA 4QMYA 4RWJA 2F9GA 4XCUA 5L2QA 1JAMA 4BKYA 4EH8A 3WI6A 2J9MA 2WTVA 4N0SA 2RG6A 2WMUA 4RX9A 3TEIA 2O64A 3KU2A 2PZIA 3SRVA 2JFMA 4PRJA 5HE3A 1EH4A 2WIHA 4PPCA 4JQEA 4MX9A 4WRSA 3UO4A 2XCKA 2B9HA 2YHVA 3LXPA 1ZWSA 2VGOA 4DYMA 1DS5A 1WCCA 3BYVA 3F3UA 4PY1A 4F7JA 4F0IA 3F69A 2YDKA 2ZDTA 3VUGA 1K2PA 1Q8TA 1PMUA 3EQPA 1BKXA 3AC2A 4C02A 5AR3A 1P14A 3F7ZA 4JXFA 2I1MA 4FTUA 4BDDA 2H6DA 5EK7A 5EI6A 4PTCA 1Y8GA 5C9CA 4OW8A 4FIJA 4MKCA 4L45A 4N4SA 4O6EA 3SC1A 4USFA 3DQWA 4LGGA 3Q6UA 1JSVA 4CLIA 5C8KA 4QQJA 4PMTA 1YOJA 3QA8A 3AMAA 5TKDA 4BDJA 3ODYX 3ORNA 4J99A 4O7RA 3C4FA 3VS2A 3OCGA 5JT2A 4L43A 3BGPA 3PFQA 4C4GA 3UC3A 1H00A 1E9HA 3AC1A 3GC7A 1Z5MA 4FIHA 2YIWA 3PRFA 3R9NA 3MA6A 3Q4UA 2ZMCA 3F3VA 4KIKB 4IHPA 1KSWA 3KULB 3OUKA 4Y5HA 1Q8WA 2XUUA 4IM2A 5A6NA 2VWXA 1SNUA 2BHEA 3LJ0A 4BDCA 2YM3A 3UO5A 1RW8A 4IAAA 5J7HA 2Z60A 3RAHA 4RVTA 2C68A 2XYNA 5M4CA 4RRVA 4RQVA 4I0SA 4FSZA 4IC8A 4EOQA 1VZOA 4E6AA 2EXCX 2GPHA 2EXMA 2ITWA 1U4DA 1QCFA 3MFTA 4FMQA 3TT0A 3LFAA 4FT0A 4EOJA 1ZYJA 4V01A 3EMGA 4QMWA 3UPXA 2OBJA 4D9TA 2P0CA 3IONA 3BCEA 5ETFA 2WMBA 3LMIA 3I0OA 4DCAA 3DA6A 4U81A 3PRIA 5TO8A 1Y8YA 4EZ3A 2QHMA 4JR7A 1G8SA 4I4FA 3QTXA 4IFGA 4IVCA 4WBOA 3REPA 5EKOA 4AZFA 3IO7A 2XNOA 3RZBA 1Q5KA 4UMQA 1GY3A 4FG8A 3L8PA 4ACMA 3MY0A 4X3FC 4DFLA 5I9ZA 2OU7A 4M0YA 4WO5A 2PUPA 3P79A 3TJDA 3WF6A 4NW5A 2B52A 4QP6A 4J96A 4U44A 3TKIA 3ZRLA 4HW7A 4APCA 3R04A 5HBEA 4IVAA 3QCYA 5C26A 1GJOA 1PXJA 4XX9A 2ITUA 3QD2B 2HZIA 4MH7A 4N6ZA 4JDJA 4EKLA 2BCJA 4FT5A 5JZJA 4RWKA 1X8BA 2WQNA 4FL2A 3WZJA 3IG7A 2YABA 5E8YA 2JDOA 5I3RA 4FGRA 3PLAE 2RF9A 3ZO1A 5KMMA 4WNKA 3EN7A 5DOSA 3B8RA 5DBXA 1MQBA 1OPJA 3HV4A 4V04A 2ZVAA 4FV4A 4BTJA 5A14A 5AFVA 3MTFA 3HVCA 5H8EA 5AUZA 5IMXA 5CSHA 2UZVA 2C6EA 2FSTX 1YDTE 4IZAA 5J8IA 4CT2A 3LCTA 3MY5A 2J0KA 3PVWA 4YHTA 4A9UA 2ZYBA 3MVJA 3BWJA 3E7OA 3IW5A 4KS7A 4F63A 2XEYA 5FEDA 4NL0A 2VNWA 3LJ2A 5IA5A 5A9UA 3GEQA 3BPRA 4FT7A 3TTIA 1VEBA 5FTGA 3VW6A 1W82A 1FVTA 2ITTA 4FSNA 3QQLA 4TN6A 2FUMA 3R9OA 4L3PA 4AT4A 3DB6A 3FYKX 4I41A 4CV8A 4D2WA 4DFNA 5KUPA 3MH2A 1KOAA 3R1QA 5FRIA 3TNPC 3V5PA 4BICA 3VHKA 2XIZA 3EN5A 3E3BX 3VUDA 1H25A 2AYPA 1U59A 2HYYA 1YKRA 3WIGA 2BMCA 4A9SA 4I5CA 4BBMA 5BMMA 2QO7A 4P5QA 3A61A 4FL3A 2JIUA 4ONAA 3P7CA 4UXLA 2RL5A 2PVLA 2EU9A 3EHAA 3E8NA 3F7WA 3EL8A 3OOMA 1O9UA 3OVVA 4XP0A 2C3KA 2V22A 4HGLA 4OTIA 5EH0A 5ETIA 2F7EE 5K4JA 4I0TA 5E9EA 2GTNA 4XOYA 2BVAA 4ITHA 5I9UA 3RPYA 4LOOA 5E8UA 3RZFA 4D2SA 4E5WA 3DFCB 3QFVA 5GZAA 3LLAA 4O7TA 3VS1A 3GCUA 4AGWA 2HW7A 4ALWA 4DEBA 3TUDA 3F5GA 2QODA 1YXUA 2NP8A 4FC0A 3KXXA 1XR1A 4FZ6A 4IB5A 1YXVA 5LVOA 2YZAA 1YHWA 4TXCA 1O6LA 3P7AA 4C2WA 2WTKC 4NT4A 4D4VA 3DCVA 1NT2A 3ITZA 5DYJA 4WIHA 3LFEA 1BL7A 3ORLA 3QKMA 2GQSA 3EWHA 5CEIA 1JWHA 5E92A 5F95A 5M08A 1LR4A 3O7LD 4YZMA 2O3PA 4R78A 4MD7E 5CVHA 4WA9A 3R8ZA 2QOLA 3PP0A 3GFEA 3PY1A 5IH4A 2C5YA 4ZY5A 4BDKA 5E4HA 5AR8A 4YZ9A 4EUTA 3NDMA 1TQIA 5HORA 4BGQA 4K2RA 2A2AA 4LYNA 4JG7A 3SGCA 4W4WA 5FEQA 3G6HA 2R3PA 3OWKA 4XHKB 5CF8A 3Q32A 4CG9A 4FKPA 2YJSA 3W2OA 5CT7A 4I3ZA 4EJNA 3CIKA 5EQPA 4O6LA 4XG9A 3UOKA 4A9YA 4LL0A 2JFLA 4YTHA 4DA5A 4FIFA 1PY5A 4G6LA 3FZPA 4X6RA 4O86A 4ENYA 1QPJA 1RJBA 1H28A 4ZTNA 4FVQA 4ZZOA 4FKQA 1H26A 2W7XA 4GIIA 4XMOA 4PDPA 3FY0A 4BI0A 5BUJA 4WT6A 2B55A 3ZTXA 1BUHA 1HOWA 2E2BA 5A4TA 4BGHA 3JY9A 4B8LA 1K3AA 2G2HA 4CZYB 2CKEA 3WYYA 4ZK5A 2WQMA 5CS6A 3ZLXA 3HZTA 2XCHA 4ZMFA 2WMQA 3SKCA 4U79A 4C33A 3HDMA 1ND4A 3F9NA 4I1ZA 2FVDA 4AZSA 4C58A 1ZMVA 2OO8X 4Y95A 2BTRA 5IQGA 1PJKA 4ASDA 3VF9A 1J7UA 1XBBA 5CEOA 3BIZA 3ZO4A 2NPQA 5M55A 3HUBA 2CCHA 4CG8A 4DC2A 3DKCA 2E9VA 3A8XA 1WBPA 1M7NA 3R1NA 5FTQA 4BCIA 3U6JA 1ZOGA 4I21A 3S4QA 3ZO3A 2EB3A 4HVDA 2JKQA 4W4XA 5D11A 3D4QA 4EOIA 5HG7A 3TNQB 4BCHA 4RFYA 4E8AA 2XNPA 3GC9A 4DEEA 2ONLA 2Y7JA 3E62A 4OBPA 1M2RA 4PNKA 2YCFA 3HMPA 2GHLA 1UA2A 2ZV9A 1HCKA 3DAEA 4BYJA 4BCOA 1P2AA 3KULA 4HPUE 1OIUA 3RPRA 3TN8A 2B54A 3NRMA 4MEDA 4RJ5A 5AV3A 2PUIA 3UP7A 3PE1A 4BDHA 4EI4A 2BDFA 4KINA 1B39A 3LCOA 3GP0A 4WG3A 4YBKA 4EOMA 3Q53A 1H0WA 5CEKA 3QCSA 4OTPA 2BIKB 3FBVA 4U40A 2XK7A 1JKKA 4JBVA 3KKVA 4FIGA 4FTOA 2GHMA 1PMNA 4KUJA 2X81A 3VBTA 3NYXA 5IA3A 3I7CA 3V51A 3ZSGA 4RIXB 5AJQA 5K5XA 2BHHA 4M14A 2XS0A 4I23A 4ZTSA 2CN8A 1YW2A 3UZTA 3S1HA 1SMHA 3OUNB 3Q9XA 3CEKA 4FTAA 3AT3A 2VTRA 5E8VA 1YHSA 4H1MA 2HZNA 2YN8A 3JYAA 3R7UA 2WMVA 3FKLA 3OFMA 4NEUA 5E8SA 2VTTA 5ACKA 3R7EA 4NFMA 4I0RA 5EW3A 4IZ7A 3C0GA 4HZSA 3ZONA 5AWMA 3LZBA 5B2MA 5KBRA 3MVLA 1GIJA 4CEGA 3D5WA 5C8NA 1J91A 4NTTA 4ANLA 4S30A 3RINA 3OBJA 3CE3A 2QLQA 5LVLA 1H01A 1OIYA 2XP2A 2IZRA 3R8UA 2Z2WA 5HNGA 5JFSA 2ZV2A 3ZBXA 5DRDA 5K0KA 1OUYA 4AA5A 5M07A 2R3KA 3BELA 3QTWA 4JI9A 4K18A 2Q83A 2VWWA 3I6UA 4MWHA 1UKHA 4E4XA 4MQ2A 1DAYA 4QYEA 4X2NA 2PVHA 2I6LA 4YJQA 4AS0A 4G6NA 1XO2B 2E9NA 3DPKA 4F7SA 5CASA 2B7AA 4IH8A 2IVVA 5E8WA 4BHZA 2HWOA 2P2IA 3PXQA 3IGOA 2BUJA 4NW6A 3Q4ZA 2B4SB 1OECA 3NR9A 3WE4A 2QOFA 5HG8A 3QRIA 5L2SA 2PVMA 4FF8A 2VTHA 3VS7A 4S2ZA 1RQQA 4QOXA 5IQDA 3MI9A 3EQBA 3RTPA 2EUFB 5M44A 3Q5IA 3KGAA 2PY3A 5CI6A 5JSMA 3U6IA 4Z9LA 5EDQA 3UOLA 5HIEA 2WTIA 4AOIA 1Q8YA 1MQ4A 3QD0A 2ZAZA 3DNDA 3W16A 2FA2A 1MP8A 4N6YA 4ZTMA 3VUHA 4YBJA 4F70A 4E4LA 1NXKA 1Q8UA 4NFNA 1WAKA 3I79A 3BEGA 4JQ8A 4FSYA 3PXYA 1PKGA 4Z16A 5CTPA 1JSUA 4A7CA 4XS2A 3ZLWA 4G1WA 4L46A 3DLZA 2QG5A 3GU4A 4A4OA 4ZLZA 3DXPA 4QTBA 4I6FA 4R5SA 3SAYA 4FSWA 2X8DA 3KXGA 4JRNA 5CY3A 2C6MA 2Y4IB 2IPXA 1KE9A 3GB2A 2XA4A 2A1AB 4I22A 5C03A 3FZ1A 4FYNA 5DN3A 4E4MA 1I44A 4YC3A 4UWBA 3EQGA 3RI1A 3K2LA 2GTMA 2HELA 5H9BA 4EYJA 4PTEA 5BYLA 3LVPA 3DK6A 3C13A 2WMWA 5AV2A 5GHVA 5IQBA 4YR8A 4YLKA 3DDPA 4EQMA 5A4CA 2WKMA 3QUEA 2XK6A 3D2IA 4FZFB 4EHZA 3TV4A 4U42A 4DAWA 1H0VA 1ZZ2A 5FWKK 4B7TA 4BYIA 3BKBA 5KZIA 5H8BA 4QQ5A 4F0GA 3QQHA 5DHJA 3BHHA 5IKWA 3ZC6A 4ALVA 4BCKA 2A19B 2VTQA 5IUGA 1H1PA 2JITA 4RSSA 4WNMA 5AV4A 3GGFA 4LUDA 3KN6A 3NW5A 5I4NA 1DAWA 4M8TA 4EHGA 4CV9A 4GYIA 2J0JA 2QHNA 4IXPA 3LQ8A 3FMHA 2XVDA 1XH5A 2CGXA 5J9ZA 3EN6A 5HVKA 2VTNA 3QRUA 3R9DA 2YIRA 3WILA 2OJFE 1KV1A 3QD3A 4QMZA 3D9VA 5AADA 3EFJA 2R3OA 5CEMA 4UZHA 3RKBA 4OT6A 1NVSA 1Q62A 3DBFA 3FC2A 2HY81 3OS3A 3ZXTA 4F9WA 5ANDA 1ATPE 5CF5A 2X7GA 4JT3A 3NUPA 3O96A 4GT5A 3QZFA 4CVAA 4IX4A 4DT8A 4QTDA 4PDOA 2HAKA 4YMJA 3OTVA 2XH5A 2VRXA 3ELJA 3IW6A 2V62A 3VUKA 3BV3A 2VU3A 2GNHA 2WOTA 5J1VA 4RT7A 1STCE 1IEPA 2HOGA 3F2AA 3F3WA 3OWJA 3VVHA 4C37A 2F2UA 4G3GA 3FEGA 4ANNA 2CN5A 2DWBA 4LV5A 5BVNA 3AMYA 1QPDA 4TNBA 4EYMA 2UZLA 3KXZA 3QWKA 2QOIA 4XUFA 5CU0A 4QMSA 3QU0A 3UTOA 3NMUF 4JAIA 4BBEA 3IDCA 4G16A 3WZUA 3FDNA 4XG8A 3E93A 1Q8ZA 1SYKA 1R1WA 2R0UA 4TYGA 3THBA 2C3LA 5ETCA 2X6DA 3IS5A 4USDA 5JH6A 3W2CA 3PA3A 4EQUA 4GU9A 2XIRA 3PY3A 4FT3A 4KWPA 5IUIA 4CXAA 4D2TA 3R73A 3QQFA 3QYWA 3NS9A 4P2KA 3MH3A 3O71A 3G6GA 3QZHA 4OR5A 3D14A 3R7YA 5DG5A 4F6UA 2EXEA 5LJJA 1L8TA 4BCNA 4YURA 3OEFX 3NCGA 5DA3A 3PSBA 3VO3A 3DJ6A 3V5TA 3CJFA 4BZOA 4ZY4A 4EK3A 5HVYA 4I20A 4I6BA 4PL4A 4O0RA 3JY0A 2CNQA 3A60A 4BBFA 3W2RA 3KEXA 4YNEA 4ID7A 4MD8E 3VS5A 3ZBFA 4FSRA 3WF5A 3HNGA 2C6OA 3GU5A 2HXQA 4YZDA 5F1ZA 1AQ1A 2ZM1A 4M66A 3TZMA 4CFXA 4BDAA 2VTPA 4JRVA 2WU7A 4YPDA 3QTUA 4NZWB 4O7SA 5KNJA 4KIPA 5BQ0A 3FSKA 4IX3A 3VUTA 4M97A 1FMKA 4A4LA 4Z3VA 3I1AA 1U5QA 2Q0NA 2ZV8A 2I7QA 3E63A 4RIXA 3QXPA 4XBUA 2WTCA 3HEGA 4D2VA 4EOKA 2HZ4A 3RK7A 4H58A 2ZOQA 2RFDA 2UUEA 5ANEA 2XNMA 3UVPA 4OTGA 5M4IA 3GFWA 1XH9A 4KKHA 4S33A 3UNJA 1OL1A 4PV0A 3D83A 5K9IA 4RC2A 4XYFA 4FKLA 5AIRA 4LRMA 4XH6A 3RPSA 1OL6A 3FSFA 4BL1A 2WPAA 3UQFA 4FKIA 3DDQA 2VUWA 4EWQA 2G9XA 2VTAA 3D7ZA 3QHRA 3VQHA 4HVSA 3QUPA 4IWDA 4FX3A 1GZOA 3RALA 3U4WA 5J79A 4GVJA 5CSVA 2EVAA 5EHOA 5BUIA 3CSVA 2W1IA 5CENA 4CFFA 4QMNA 2QKRA 2X7OA 1ZZLA 1GZKA 4ZSEA 4MBLA 3BLQA 4L44A 3QC4A 3TNIA 4YJVA 5I9WA 3E8DA 4WSYA 3SD0A 5JFVA 3U55A 4MK0A 4QP3A 2YDJA 5E1SA 4BCPA 1ERKA 4GVAA 5ANOA 3V01A 3OG7A 4IZYA 3O23A 4FOBA 5CEQA 3QCQA 4H36A 2JAMA 2XNEA 4O83A 3EFLA 3FZRA 3P78A 4AU8A 3CQEA 4HGEA 3MFUA 4D4YA 3TTJA 4J71A 4J53A 4PPAA 4X2GA 3QQJA 1ZRZA 3NEWA 2WTJA 3PPJA 4MXAA 4W4VA 1JLUE 4HYIA 2J90A 2ZV7A 2CGUA 3BYSA 3HECA 4H3BA 4J1RA 3NVMB 5GJFA 2BZIB 4EH7A 1KE8A 2WNTA 3GENA 3A8WA 4F9AA 3T8OA 3KMUA 3RNIA 4KS8A 3NYVA 5KMNA 2PMIA 3R2BA 4EHEA 3COHA 4QP9A 4D0WA 4FZ7A 4JL9A 4U45A 4GIHA 4C59A 3OW3A 4FV2A 4FNYA 4TT7A 3QLGA 5HLPA 4FV5A 4GS6A 3QQGA 3KF7A 3UQGA 4IX5A 1W8CA 2PZPA 5LMBA 3G9NA 2VTJA 4Z55A 2YCSA 3UG1A 3ZEPA 2YIYA 4E5BA 2XZSA 4FNZA 3C51A 2V7AA 4BIDA 2IJMA 2XNGA 3TG1A 4BDEA 3SHEA 4EK4A 4IW0A 4TRLA 3GQIA 4JAJA 4OTQA 4XP2A 3M42A 5CT0A 4GRBA 4QTCA 2CGWA 3OT8A 4O7WA 4ASZA 3ZUVA 3QTZA 2YERA 3ORPA 5DMZA 4O7LA 1H1QA 2YCQA 3O8TA 4O82A 3EQIA 4L52A 4R3RA 2BZHB 4FBXA 4DINA 4AAAA 2XNNA 2W5BA 3HV7A 3MSSA 3KRLA 3Q6WA 3UZPA 4ZTQA 1PMEA 1OBDA 3LAUA 1IR3A 2VO6A 4L8MA 4PMSA 4RC4A 4M3QA 4AUAA 2SRCA 1ZXEA 5BYZA 1KOBA 3IDPA 4D5HA 4LM5A 4RJ4A 2ITZA 4HPTE 4QTAA 5LQFA 2QD9A 4F6WA 2YA9A 3O8PA 4NSTA 3MY1A 5LMAA 4JX3A 5H2UA 3ERKA 4ZEGA 3WZEA 3HRCA 2HZ0A 4MF1A 4FZDB 4MXYA 3O8UA 1OBGA 4IEBA 2GQGA 4NM7A 3IQ7A 3LFBA 4P4CA 2P3GX 2WMAA 2QONA 1IG1A 2YAAA 4LRJA 1PXKA 4GUBA 4U3ZA 3ZYAA 1PXOA 2UZOA 1QPEA 4GJ3A 4V0GA 4APPA 3FQHA 4GEOA 3PTGA 4UX9A 3CD3A 3DJ7A 2ONLC 4RC3A 4BFMA 2EB2A 3FAAA 3OMVA 2ETMA 4AG8A 5EDRA 1Q3DA 4XNEA 2VTIA 1U46A 5DR9A 1MRYA 1W0XC 2UW8A 3FLQA 2GFSA 1ZYCA 4QMQA 3CCNA 1WBWA 3ZO2A 4R8QA 3NUNA 2I0VA 3AD4A 1IA8A 1AD5A 1YWNA 4JIKA 3CR0A 1W7HA 3EQCA 5ANIA 3FKOA 3TIZA 4BCFA 3QTRA 3MB7A 3PVUA 1E1XA 5M57A 3MESA 4NM0A 3RK9A 2W9FB 4JNWA 4FICA 3MFSA 2C1AA 3D0EA 4AW1A 1IAHA 1ZYSA 2YZLA 3SA0A 2G1TA 2B9FA 3FJQE 2PUUA 2ZM3A 4IANA 3ZFYA 2H34A 1JOWB 4NKSA 3TNHA 2JEDA 4IM3A 5BVWA 2QOBA 4I6QA 4CD0A 5CZIA 2GHGA 4TWPA 3R28A 5HG5A 3RAIA 4CCBA 4E7WA 4G6OA 5B7VA 3MPMA 3PG1A 3PIXA 4IB1A 4IFCA 3E87A 4YP8A 3O0GA 4AXAA 3TWJA 3ZRKA 4ZSAA 2W1HA 3MPAA 3QX4A 2C6DA 4F65A 4XJ0A 5LXMA 3OEZA 3BHVA 3V5LA 1PYEA 4UV0A 4FA2A 2AUHA 1REKA 4AGCA 4GMYA 3VRZA 3B8QA 2QURA 4W9XA 3VC4A 5JFXA 3F2NA 5CF6A 5JFWA 1OIRA 3C1XA 2UVXA 2UW3A 2ACXA 3VJOA 3DKGA 4EWHA 4OGRA 4FTJA 3DZOA 3E5AA 4BKJA 2C4GA 3P5KA 4HNFA 1RE8A 4FTTA 3GOPA 5AV1A 3V6RA 2Q0BA 4M13A 4C4HA 2GNJA 2BR1A 3LCDA 5FDXA 4P5ZA 5I9XA 2R64A 3FL4A 3I6WA 4U9AA 5ANGA 3M1SA 4X0MA 3PXFA 1UV5A 4IQ6A 3ZSHA 2Z7LA 4HOKA 4FEWA 2WELA 3N51A 3V3VA 3P4KA 5AR5A 2C6LA 2XKDA 3LFDA 3ORKA 4RIWB 4J52A 4GFOA 5EYCA 3UC4A 5CSPA 4MXXA 5JK3A 3MIYA 4FG9A 1V0PA 2QOOA 5HESA 1RDQE 3U87A 3VJNA 4DCEA 1FINA 4NIFB 3ROCA 3UQCA 3PDTA 3R30A 4AE6A 4JX7A 5AAEA 5CANA 2ERZE 1AGWA 4JVGA 1ZYLA 4QMLA 5HD7A 4FTCA 5KMJA 4TKSA 4PQNA 3GCVA 4QMTA 4R3CA 5AUWA 1JKLA 1KV2A 2R3GA 4XRLA 3RM7A 3GC0A 3FL5A 2C0TA 3OXZA 1SM2A 2RG5A 5M4FA 2ESMA 3AD6A 1L3RE 2QU6A 4OUCA 2C69A 2JIIA 3MH1A 2GU8A 4JDIA 4CFWA 4LUEA 5A54A 2Y0AA 2J7TA 3ORIA 5F9EA 4LG4A 3CTHA 4ARKA 5D9HA 2JBPA 4U8ZA 4E73A 2XNBA 4QMVA 3GXLA 3MW1A 2UZUE 4PUZA 4RX7A 2IZTA 1KE7A 3QQUA 4U5JA 2UW0A 1KE5A 1XKKA 4IAKA 2PMLX 3VULA 3I81A 4AN3A 4BCQA 5CNNA 4CFVA 2VTSA 3PIYA 1JPAA 2WQOA 3BE2A 1NW1A 4ZJIA 1E1VA 1LEZA 3R7OA 1YVJA 3GI3A 3UYTA 1R0PA 4RLKA 2G2FA 4GSBA 1YI4A 2JDVA 4BDBA 4HVGA 1YWRA 4U6RA 3TZ9A 4PMPA 4MWIA 5ANKA
chains in the Genus database with same CATH superfamily
1H07A 3DBCA 3EQRA 4K1BA 1LP4A 1OL7A 3F88A 4RWLA 2PSQA 2PL0A 3ANQA 5L6OA 2OI4X 5E8XA 3HAMA 3C5UA 3DNEA 1UWHA 3EQDA 4UWYA 3ULZA 3VBQA 3BWFA 5EKNA 1FGKA 4M69A 2IEWA 4TYHB 4CKJA 4C3PA 1GOLA 1H1WA 4FSMA 4UALA 4W8DA 4D9UA 3E8CA 5I9YA 5CI7A 4UMUA 4C4JA 4X2JA 5CQWA 4D2PA 1NVQA 5AUUA 2W99B 3NW7A 3F5PA 2XRWA 2UZWE 5HX6A 3BU5A 3HYHA 1FOTA 2XK9A 3CJGA 3DTWA 2JGZA 2OJIA 3G51A 3FXZA 3NPCA 1VYZA 5DNRA 3LMHA 3SG9A 4TNDA 5AP4A 4O7VA 3T3UA 3W8LA 5AEPA 4EH6A 4FEVA 4FKWA 5HO7A 4UBAA 2XAOA 1YOLA 2O8YA 3LQ3A 2V7OA 4TWNA 2BFXA 2YLEA 4WKQA 3RM6A 3Q2JA 2XM8A 3LPBA 1V1KA 4QMUA 3ACJA 4A07A 2OW3A 2X39A 3LM5A 2BAKA 4NCTA 4WG5A 3HP5A 4CTCA 3VS6A 3EZVA 5IEXA 4UXQA 1ZMUA 3AC3A 3R00A 3TUCA 3R1SA 3MA3A 5GINE 3O5AA 2GNIA 3EFWA 2OJ9A 3FWQA 1CSNA 1OKWA 3CY3A 3DAJA 3VBYA 4MYGA 3F66A 3WZDA 4ANBA 2CHLA 4PMMA 2CSNA 4QYYA 4BDIA 3NNXA 3UO6A 3MJ2A 3QKKA 1WBVA 4J8MA 1VR2A 5GJGA 2V0DA 3UVRA 3KREA 2J0LA 3FI2A 4WBBB 3C4WA 3CGOA 4BWPA 3NYOA 4C61A 3MWUA 5CAPA 3K54A 5EM5A 2OK1A 3H30A 4NJ3A 1BL6A 4D2RA 4E3CA 2H8HA 2X0PA 1F0QA 2R2PA 3ALNA 4X3JA 3VS3A 5KMOA 1IRKA 3ORTA 4J8NA 4LI5A 4Y85A 3OT3A 2WHBA 1BMKA 4F64A 5J5SA 5E7RA 1WBSA 2O63A 3EOCA 3W0NA 4K8AA 4M84A 4CRLA 4NKAA 3I7BA 3SV0A 4B8MA 5KO1A 3UIUA 2CMWA 5FP5A 4AN9A 1XWSA 3RHKA 5JRQA 3GVUA 3SXFA 3UNZA 3ZZWA 4QD6A 5GIOE 4B4LA 2JKKA 4FVRA 3HMOA 2UW9A 3I0QA 5AP6A 3Q4TA 3ZHPC 2W5AA 5HOAA 1Z57A 3F3TA 4AFJA 4G5PA 4BB4A 4L7FA 2AEGA 2VV9A 3KA0A 4K6ZA 3F2RA 3OXIA 1OL5A 5HCZA 3WF8A 4AW2A 2NNWB 3R22A 5AUVA 1OUKA 3MFRA 3VW8A 2XEZA 3U6HA 3KF4A 1FQ1B 3WIKA 1PKDA 2X2MA 3FMKA 3M11A 3PLSA 4U97A 4XRJA 5T68A 5IUHA 3AC4A 4OTWA 5F20A 3KCFA 5CXHA 5D7VA 2ZM4A 4TZRA 4ACHA 4FSUA 4MXOA 3EN9A 5I3OA 5DEWA 2UV2A 2HXLA 2W1FA 3LQ5A 4DFBA 3TNWA 5HKMA 3ZS5A 2B0QA 4LOPA 2XK8A 3COMA 3NLBA 2X0QA 3FKNA 2J0IA 3KMMA 3Q2MA 4EL9A 2BRNA 4OAVB 2VWIA 2WEVA 3ANRA 4C4FA 2XIYA 4RVLA 2R3NA 3VS0A 1F5QA 3C9WA 4G31A 4QT1A 4LMUA 1FGIA 3UBDA 5IDPA 2IVSA 5M51A 4OTFA 2OFVA 4FKTA 4E5AX 2BRBA 4O4BB 3QTQA 5D41A 3L9PA 4YSJA 4KIQA 4ZLOA 4F99A 4H39A 2J4ZA 5CQUA 3ROYA 4XG2A 3TV7A 2PVNA 4DEDA 4GYGA 4BCGA 3PVGA 4IWPA 1NA7A 4PX6A 4RIOA 4BC6A 3FLNC 4FKSA 4RIWA 4C36A 4FG7A 4Z7GA 1VYWA 5L2TA 2O0UA 3FQSA 4YPSA 2WEIA 3DLSA 3O17A 4J98A 5D7AA 5EI8A 4F0FA 2W1ZA 4DFZE 2HWPA 4LL5A 4NIFA 1Q24A 4JG8A 3QRJA 4LGHA 4O0XA 1YQJA 4OBQA 5T6KA 3QTSA 3QLFA 3N4VA 2IVTA 5IU2A 4A4XA 3EJ1A 4RJ6A 2ITOA 5DGZA 3AXWA 4HGSA 5FEEA 4G34A 4C57A 2WIPA 4YTIA 2QOKA 5D12A 1LPUA 2VN9A 4YGAA 1PF8A 3DBQA 2FO0A 3JXWA 3SX9A 4FSTA 4MVFA 2J5EA 3A62A 5HIDA 5HNIX 4UYAA 4ZTRA 2JKOA 3D7TB 4FV9A 3KXMA 2X0GA 1UNLA 4QO9A 4ANMA 3C4EA 1OPKA 2WGJA 1SVGA 3KN5A 4CT1A 2PZYA 2WOUA 4R1VA 5IA2A 5IZFA 4YJUA 3VN9A 2Y4IC 4E6CA 3KXHA 4RVMA 3VAPA 4BIEA 2EWAA 5EHYA 4CYJA 3GC8A 5BPYA 1H1SA 4ALUA 5AAGA 5LOHA 4ZS4A 3FZOA 3A7FA 4FTNA 1PYXA 1YI3A 3EIDA 2CNUA 5KCVA 3LXLA 5AAFA 5BVKA 4FV3A 4O0UA 3W55A 1XMLA 1W84A 4LFIA 3CTQA 3ORMA 4U80A 5ANJA 4FV0A 4L42A 4CSVA 4JBPA 3P5JC 2W96B 3BZ3A 5HICA 4FODA 4AA4A 4EC9A 2WO6A 4EZ5A 3HA8A 2ERKA 4QP7A 4ZY6A 3RMFA 3CKXA 4E20A 4O7ZA 2YJRA 1YI6A 3LFNA 3KVXA 4IJ9A 3C7QA 4OBOA 2WMXA 5EDPA 2PULA 3TDVA 3BYOA 3MS9A 5G1XA 4I93A 5KKRB 2A4LA 4EOLA 3JPVA 1PMVA 4JQ7A 4M15A 4XG7A 5L2IA 3DV3A 5M09A 5HE0A 1YHVA 1XBCA 3ZUUA 3CS9A 3K3IA 3TZ7A 4YJOA 4FEUA 5CYIA 3U54A 4HVIA 4HYUA 3HMIA 4ZSGA 5AA9A 2QU5A 4ERKA 2BILB 3Q52A 2AC3A 4MQ1A 3SOCA 4PL3A 1JNKA 2R3HA 2PU8A 1P5EA 3QRTA 4TYHA 4I24A 4JS8A 3VIDA 1OI9A 5H3QA 3ZDUA 2UVYA 3TUBA 3PE2A 4C38A 4S31A 4YC6A 3DB8A 4L00A 4JMQA 2VNYA 3KFAA 4PL5A 4RPVA 2CLXA 1Q41A 3LXKA 3VS4A 3TI1A 3ACKA 1S9JA 3BBTB 3CLYA 1GNGA 3FLWA 2GS7A 5I0BA 4FUXA 4NM5A 4QYFA 4V0GB 4V05A 3WF7A 4L3LA 3IDBA 5CNOA 3FI3A 3K3JA 4B9DA 1TVOA 2OXXA 1PHKA 3IW7A 3H0ZA 4JJRA 2F49A 3I60A 3MBLA 4O0SA 2LGCA 3RPOA 4GKHA 5IF1A 1H08A 3QL8A 5F94A 4FV8A 5HE2A 2A98A 3RJCA 4EOSA 5HTCA 5IEVA 2J50A 1ZY5A 4DFYA 2BROA 3AT4A 2PVKA 4NM3A 2WQBA 1FMOE 5FG8A 4M67A 3C0IA 3AGMA 1WBOA 3WBLA 4Q5HA 1T45A 1R3CA 4IAFA 3ENHA 2YM6A 3BRBA 3NZ0A 4QP2A 1A48A 4K33A 4OTDA 4EOOA 1OITA 2OWBA 3G33A 2YCRA 3SLSA 4IDTA 5KBQA 3CPCA 3A2CA 5HHWA 4O0TA 3W33A 4O27B 4BGGA 1YXXA 4BI2A 4FIIA 1W98A 1GZNA 3KC3A 5JEBA 3FMJA 3W18A 5J9LA 3MVMA 3OW4A 4H05A 3ZRMA 5GNKA 5K0XA 5FDPA 2QO2A 3ZM4A 3HGKA 4AP7A 3QUDA 4ANQA 2P2HA 4TYIA 3ORZA 5AIKA 1GIIA 2B53A 3OP5A 3ZLSA 4YU2A 2R9SA 4KRDA 5CF4A 3BHUA 5HCYA 1BI8A 4AN2A 4EK6A 4F6SA 2ZFYA 4O0VA 3II5A 2BRHA 3UE4A 1SNXA 3EB0A 2VX0A 3FMNA 3R02A 4AGUA 4WRGA 2RFSA 3OXTA 2C1BA 2CKPA 2W06A 4OLIA 3HA6A 2XB7A 4XOZA 2ITNA 3B2TA 1OVEA 5KMKA 3EFKA 2ZMDA 1JKTA 1KUTA 4WNPA 3EYHA 4RGJA 3H4JA 1ZYDA 1XH4A 2VX1A 3PSCA 4H3PA 3NUUA 2VTLA 2J0MB 2BDJA 4KB8A 1IAJA 1T46A 3GBZA 4IMYA 4C3FA 3TL8A 2P33A 3F5XA 4FV7A 4BTKA 3ID6C 4IDVA 1VLRA 2VGPA 4B6LA 2RGPA 3EZRA 4S34A 4A9TA 3GUBA 3QHWA 4BTFA 4EONA 5ITAA 3ZZEA 4AZVA 2UZBA 2VZ6A 2ZB1A 3DXQA 1G8JA 2VTMA 2XBAA 4CQGA 4DEIA 4L3JA 3ZC5A 4G2FA 2R3QA 3S0OA 3O51A 3FPQA 4ASEA 5IH6A 4L53A 4C62A 3Q9WA 2R3FA 4LQMA 3Q4CA 1OM1A 2IZUA 2I0YA 5HNBA 3Q60A 3DU8A 4FUYA 3KK9A 4YNOA 5M06A 5D1JA 3DBDA 3OROA 4C4IA 3RAWA 3UIBA 3MN3A 4EH9A 2Y6MA 3BV2A 3POZA 3N9XA 2IW6A 5AP7A 4DEHA 3QA0A 3PZEA 4EUUA 4PP7A 3QBNA 2IF8A 1NVRA 2W17A 4I5PA 2W1DA 3W0RA 2OIDA 5FGKA 4J95A 4BRXA 4JBQA 4EH4A 3QQKA 2O5KA 4OAUC 4K9YA 5CU3A 3SXRA 5LWMA 2GNGA 5TE0A 3TXOA 3A4OX 3G90X 5LCKA 4MNEA 5D10A 5IPJA 1GZ8A 3I5NA 3QXOA 3DQXA 3SW4A 3UG2A 2C0IA 4TW9A 3ZM9A 4FTQA 1UNHA 3SQQA 3R6XA 4ZOGA 3UDTA 2QG7A 4CNHA 4G3DA 3KXNA 3SVVA 2WMSA 1XH7A 4YJSA 5E91A 2XMYA 4FEQA 5IQHA 2BTSA 5LVMA 1Y6BA 1FBNA 1LUFA 3LMGA 5AUXA 2JAVA 5HX8A 5CU6A 1Q4LA 4FIEA 3TIYA 4F9CA 1ZAOA 2CDZA 4Q5EA 3UYSA 1R78A 2BAQA 4NK9A 2X2KA 1S9IA 3ZLYA 4E4NA 3NSZA 5GIPE 4EH2A 2W4KA 3ML1A 1PXMA 4C4EA 2QO9A 3DAKA 2PVYA 3D5UA 4WSQA 5BX0A 2YWVA 4DITA 3N4TA 4BWXA 3UZRA 4DG3E 3UIMA 3MB6A 5J9YA 5LVNA 5HBHA 3D7TA 5L6WL 4ANSA 3F61A 2GCDA 3C4XA 3OC1A 5LVPA 4GKIA 4CFNA 1OMWA 3U8WA 4EEVA 2CLQA 4D58A 3A7IA 5HLNA 3LFCA 5C4LA 2QQ7A 4HJOA 4JG6A 5CXZA 1TKIA 5C8MA 2VWZA 4AACA 2HIWA 3BE9A 3W8QA 3W10A 5I5ZA 5IQAA 2C6IA 3LJ1A 2R0IA 5DR2A 4M69B 4CFMA 4I5MA 3JR1A 2BALA 5ICPA 4G9CA 1SVEA 3BGQA 3LOKA 4QRCA 2NRYA 3DKOA 1O6YA 4YJRA 5CAUA 5J1WA 2BDWA 3SXSA 4CZUA 3UOJA 2XK4A 3RHXA 1APME 5A46A 3NNUA 5DT0A 3TKUA 1YOMA 3QGWA 3MV5A 1URWA 3UDBA 4ORKA 3NUAA 2KTYA 3EN4A 4AQCA 3VONA 3IOKA 4YLLA 3W0SA 5B2KA 2VWUA 3KRXA 5C01A 1J1BA 3KK8A 3L9MA 3UP2A 1XH6A 1U5RA 5FD2A 4NCTC 2X8IA 5IQFA 3FUPA 4XG4A 5CU4A 5HG9A 5EYDA 5AP3A 3FV8A 2RIOA 4RZVA 5AP0A 4CRSA 5E8ZA 3FHIA 5K5NA 2HENA 4F4PA 5I9VA 5JRSA 3Q3BA 3UPZA 3OBGA 3R0TA 2ZDUA 1TQMA 2YEXA 2BRMA 3NCZA 3CQUA 4JBOA 1PXNA 5HCXA 3O50A 3UVQA 1QMZA 3N4UA 3D2KA 2GMXA 2X2LA 3SG8A 2C47A 3CGFA 2OIBA 4KAOA 4O2ZA 2UW7A 4F7LA 2UW5A 2ZJWA 1QPCA 1XHAA 3MTLA 2X6EA 5DT3A 3GU7A 4Y5QA 2ITVA 4ZS0A 5TF9A 5L6PA 4R7HA 5M53A 2J5FA 1MRVA 4PDYA 4ZP5A 4FTIA 5C1QB 5LWNA 1YRPA 2PE1A 2PVJA 4GJ2A 4UN0C 3FLYA 4RA5A 1DI9A 2OF2A 3A99A 3BI6A 5FM2A 1OZ1A 3PJ3A 4DEGA 4YUQA 5AX9A 1W83A 4U0IA 4PNIA 4GL9A 4ZSLA 3R21A 4EKKA 1BI7A 4W8EA 3ALOA 4RA4A 3W2QA 4BZDA 4UMPA 3H9FA 4S32A 5DIAA 3VBXA 5A6OA 3DTCA 5FP6A 1W2DA 3QZGA 4NJDA 2JDTA 2JIVA 3LE6A 1U54B 3HLLA 4C8BA 5L8JA 5HD4A 3UNKA 3H9OA 5FQDC 5DT4A 4IWOA 3V8TA 3CC6A 3NVKI 4IAYA 4YJTA 1UKIA 2YM8A 2UZNA 4D28A 1CDKA 2VWYA 2QR8A 5JKGA 4BCMA 4LOQA 3T3VA 3VUIA 4N57A 1CMKE 5ETAA 2PE0A 4II5A 4IADA 4XV3A 4UMRA 2CKQA 5AP1A 2VTOA 3POOA 1P4FA 3IGGA 3PXZA 4YHFA 3ZMMA 4C35A 4QYHA 4Q9ZA 4EK8A 3FLZA 3ZDIA 5BVFA 3HAVA 3PXRA 4RZWA 3TKHA 3F5UA 2BKZA 3H3CA 3DKFA 4Y83A 4EZ7A 4I94A 3EQHA 4DGMA 2JBOA 4R77A 2X1NA 2UZDA 3MJ1A 3PUPA 5HU9A 3PZHA 4KD1A 2VO7A 1LEWA 4CKIA 4X2FA 4LV8A 4F1TA 1KWPA 2XM9A 4H3QA 4O4CA 4GUEA 4F08A 2YIXA 1M52A 4L9IA 4FJVA 3UDZA 5CAVA 3NW6A 5E1EA 4O2PA 4BDFA 4USEA 3VUMA 4RFMA 4WNOA 4ZJJA 2QC6A 5A4EA 1XMMA 3LIJA 2W9ZB 3LFFA 4C2VA 3FC1X 3W32A 1H4LA 5BVDA 2V5QA 3OWLA 1ZMWA 2C5NA 4ZAUA 3KCKA 1O6KA 1OB3A 3FMDA 3KRWA 4GT4A 2W0JA 5DR6A 5FBNC 4ZZMA 3NWWA 4QMOA 2QOCA 1BX6A 4BTMA 4Y46A 5KMLA 2C3IB 4D5KA 2PMNX 1UNGA 1ST4A 3M2WA 3RK5A 2W4OA 5L3AA 4BHNA 1Y91A 4MUQA 5L4QA 5FTOA 3CD8A 3T9IA 4BKZA 1UU8A 2OIQA 5CVFA 3BHTA 5HIBA 4X6QC 4D1ZA 4FE2A 3D15A 5IQEA 4DHZA 1PW2A 4YJPA 2PK9A 2KULA 5BYYA 5CX9A 2Y4PA 5J95A 4Q2AA 5CLPA 3V5WA 4GK2A 4JR3A 4RIYA 1K9AA 5CSWA 3W2SA 4X3FB 1OKZA 1WVWA 2G15A 3HL7A 4FVPA 3LCKA 3R1YA 3ZOSA 4DGGA 4HCVA 3GCQA 2PVRA 4YLJA 3R2YA 5JQ8A 5JMSA 2W1EA 3CY2A 1OPLA 4FSQA 3H10A 3P9JA 5DLSA 4IAZA 3ZFMA 1JQHA 1YDSE 4KSQA 2Y9QA 4O84A 4XLIA 3CQWA 3FY2A 3CTJA 4BDGA 4QPAA 4AF3A 3B2WA 1XH8A 4QDVA 2FYSA 2I0EA 4L7SA 4IB3A 4G3FA 3DT1A 5HI2A 4DHFA 1CKPA 4YO6A 4LV7A 4O0YA 2YISA 5EW8A 2LAVA 2ETKA 2R4BA 4GCJA 4CFUA 1GAGA 1YXSA 3AQVA 3OY3A 1A9UA 4RX8A 4O38A 3E92A 5DWRA 1UU3A 3TCPA 2OH4A 4NUSA 3WYXA 4AA0A 4AT3A 1NY3A 4DGLC 3COIA 3ATTA 3ZSIA 2DQ7X 2HY0A 4XV9A 1OL2A 4AX8A 2O65A 2XF0A 3Q96A 4RLLA 4I6HA 4O81A 4WUNA 3O2MA 2GS2A 2FSMX 2WTWA 4IWQA 3MIAA 2FSOX 3R7GA 3VQUA 2OJJA 4BWKA 4TPTA 4ITIA 4K0YA 2J51A 5DI1A 3HV3A 4ERWA 4BY9E 4ANOA 3RNYA 3QGYA 4GK4A 5L8LA 4FL1A 5E8TA 4N70A 5IQIA 5LMKA 3MPTA 4TWOA 5BNJA 4FTKA 4ZLYA 4RBLA 2WZJA 2Z7SA 4UWCA 2OSCA 1M2PA 2R7IA 1Q97A 3RPVA 3NGAA 4BF2A 2GNFA 4KNBA 4XV1A 2OXDA 3FI8A 4FT9A 3GOKA 4RQKA 1BLXA 5FXRA 3G0EA 4HNIA 3R9HA 4FNXA 4AZWA 3UMXA 4AZEA 3E7VA 5GZ8A 4DF3A 4Y73A 3ZEWA 2CNVA 5E90A 2JKMA 4RX5A 3WOWA 3AMBA 3QTIA 4QTEA 1H24A 4CQEA 3MVHA 3BYMA 3L9LA 4DEAA 5H8GA 4AXEA 5G6VA 4GW8A 4R7IA 4F7NA 2WFYA 2X4FA 2WB8A 4IJPA 4W9WA 5KX8A 5EM6A 5BV3A 4LRKA 3U4UA 3QX2A 5EM8A 4UB7A 4DTBA 3W0QA 2ZB0A 1M17A 1CTPE 3FQEA 5C27A 3WZKA 3AOXA 2YACA 4IIRA 2BKKA 2PWLA 2XBJA 4YO4A 2GS6A 2F7ZE 3QWJA 5CALA 5J5TA 4DT9A 2WTKB 1H27A 4R5YA 4ASXA 3FYJX 1REJA 4C0TA 4D55A 3E3PA 3R63A 4DLJA 3HRBA 2VO0A 4IVBA 4KKGA 2RKUA 4WUAA 2QCSA 2IN6A 2JDSA 4FGBA 3OWPA 4X21A 5EQEA 4ZZNA 4CMOA 2C6KA 4MTAA 4WOVA 4KKEA 2BRGA 4RJ7A 3OCSA 1W2FA 3WF9A 4YTFA 2JC6A 4R3PA 2QOHA 2NO3A 2WXVA 3I5ZA 4RFZA 2JDRA 3OF0A 4XEYA 3ZU7A 3ORXA 5DFPA 4DFXE 4FV6A 4QP8A 4KRCA 2A27A 3DY7A 3OCBA 3NYNA 5IDNA 5AP2A 3NAXA 2CCIA 3ENMA 1V0BA 4MXCA 5CEPA 2PUNA 4AQKA 4MNFA 3ETAA 3PPKA 5JGBA 3D5XA 4IX6A 2XKEA 5A3XA 1OKVA 1F3MC 5F4NA 3G15A 2FB8A 1W2CA 3ZUTA 2HW6A 5EHLA 1IASA 1XQZA 5AP5A 4DH8A 3RGFA 2Y8OA 3Q9YA 3DJ5A 2R3RA 2UZTA 3QRKA 3O7LB 3QAME 3FMMA 1U54A 3TMOA 5FXQA 1UWJA 4HYHA 3W2PA 2VD5A 2YM7A 4TYEA 2DUVA 4PTGA 1UU7A 1R39A 2FGIA 3EKKA 3SOAA 3JS2A 3T9TA 2HCKA 5IMEA 5HVJA 1WFCA 3PA5A 3D94A 2QKWB 4K77A 4U7ZA 5GJDA 4TL0A 4DG0E 4AZTA 5FUTA 4L68A 4OTRA 1YWVA 3OD6X 2OICA 4IB0A 4GG7A 2W1CA 5EG3A 5A4LA 2XANA 4BN1A 3FMLA 4UZDA 4JIAA 4Y8DA 4FI1A 4FK3A 3L8VA 4HCTA 4NU1A 4O91A 5KMIA 2G2IA 5HTIA 1MRUA 1YXTA 4NYEA 2XJ0A 3GU8A 3LHJA 3V04A 2PZ5A 4GV1A 4YJNA 4FZAB 4CZTA 4CLJA 2ITQA 4IACA 1Q99A 4D4RA 3VWAA 4FTMA 2UVZA 4RWIA 3OY1A 5CVGA 2E9PA 3P86A 3Q5ZA 4KBKA 4ACGA 3ODZX 3PJ2A 4I92A 4KIKA 1KE6A 4XV2A 5HO6A 4O21A 4O96A 4RJ3A 3VRYA 3OHTA 4WHZA 3KVWA 5DVRA 4AW0A 4O1PA 5HE1A 3AC8A 4FNWA 4O7YA 3TJCA 3RCDA 5HLWA 2IO6A 2VAGA 1DI8A 2X9FA 3C50A 3E64A 3W0PA 4FTRA 4MCVA 2YWPA 3P1AA 2VO3A 1R0EA 2OFUA 3FLSA 3HUCA 5CZHA 4BR3A 3IECA 2PE2A 4ITJA 5DH3A 4U3YA 5J7BA 4LDTA 2QLUA 1H8FA 4FKRA 4KIOA 4AFEA 1ZARA 2BZKB 3V8SA 3VNTA 1ZOHA 4A06A 3R8MA 4LGDA 2GSFA 2C5XA 4TYJA 5FM3A 4TTHB 4TY1A 1HCLA 1PXIA 3VHEA 4MNEB 4NH1A 3ULIA 4U41A 3EL7A 4F9BA 4FV1A 1G5SA 1M2QA 3AGLA 2P55A 2YDIA 2IVUA 3EYGA 3HRFA 3UMWA 4I5HA 3LCSA 4AW5A 3Q9ZA 3L8SA 1YDRE 4L01A 4IVDA 4L67A 5T3QA 3EH9A 4BVUA 1Q3WA 3PJ1A 3PJ8A 3H0YA 2WTDA 4EK5A 4PPBA 2RFNA 5LARA 2X4ZA 5EQYA 4CGAA 3R8LA 2GDOA 4X3FA 5KHWA 4BJJB 2W5HA 4G17A 4O0WA 3R8PA 2YIQA 3PSDA 3IW8A 1I09A 5BUEA 2XAMA 5A4QA 4CTBA 4YZBA 4E26A 5JGAA 2C5OA 4KBAA 3MGYA 4AE9A 4PF4A 4DGNA 1WVXA 2IZSA 1UU9A 2WU6A 3LFSA 2OZOA 2AC5A 4L6QA 3VF8A 3ZCLA 2Y6OA 4OT5A 4GU6A 1FVRA 2PZRA 3HDNA 5AR4A 4JLCA 4NTSA 1XBAA 5M4UA 4O1OA 4P7EA 4G5JA 2JD5A 4AXFA 4YZCA 5AX3A 4EH3A 1J7IA 1M14A 4E6QA 5DE2A 2F7XE 4F9YA 1VJYA 3W0OA 3HMMA 3RAKA 3BX5A 3SDJA 5IISA 5HZNA 3K5UA 4ZTHA 4RJ8A 3FZSA 1QL6A 5JGDA 3IW4A 2J2IB 2WD1A 2X7FA 3BGZA 3KL8A 3MDYA 5BVEA 4ZJVA 3L8XA 4ENXA 4K11A 3E8EA 4U43A 1J7LA 3GQLA 4KA3A 5KKRC 3LLTA 4AGDA 2R3JA 3E88A 3WE8A 5IA1A 5LCJA 4FTLA 4GT3A 2FSLX 4X7QA 4GH2A 3GCSA 2IWIA 4FKUA 4G3EA 5DEYA 3NFFB 2YFXA 3HMNA 3UJGA 3R8VA 2F2CB 3QKLA 5CAOA 5HTBA 1P4OA 4RVKA 5EFQA 4YC8A 3NNWA 2J6MA 2BIYA 5AM7A 3NIEA 5IEYA 1IA9A 3U51A 4QYGA 5EYKA 3OOGA 3G9LX 3V6SA 3VBWA 2FH9A 3PY0A 2PPQA 1JVPP 2AQXA 1PXLA 3NIZA 4YSMA 1A06A 1J3HA 3KRJA 4WG4A 2G01A 3UIXA 4I6LA 4QQCA 2P4IA 3FXXA 3AD5A 3TDWA 3RP9A 3PXKA 4CYIA 3QZIA 2OZAB 4CKRA 1OKYA 2WMTA 3I4BA 2B9IA 4DBNA 4E6DA 4QQTA 3NAYA 5EI2A 2I0HA 4G9RA 3NUXA 1URCA 3BYUA 4UY9A 2XYUA 4FK6A 5CU2A 1BYGA 3S2PA 3A7HA 4C3RA 3BHYA 3PWDA 2BPMA 3DK3A 1ZY4A 2H9VA 3EKNA 4DH7A 3CP9A 3IOPA 2ETRA 5AR7A 1ZLTA 3PJCA 3SRVB 4MAOA 5L2WA 2I40A 1SVHA 2R3MA 2OXYA 4P90A 4TWCA 3TACA 3NUYA 3U9NA 2WAJA 1M7QA 4MXZA 3GU6A 3F6XA 3NNVA 4FKVA 4J97A 3L9NA 4D1XA 4ZIMA 4QNAA 3R71A 4DH1A 2XKFA 4YTCA 2A0CX 2XJ1A 5HU3A 4D4SA 4MBJA 5K3YA 2C0OA 3FE3A 4E93A 2Z02A 1TZDA 4LMNA 2CPKE 3HKOA 4YHJA 2B1PA 4AAYA 4EORA 2YITA 4ZMEA 4X2KA 3KMWA 4A9RA 4FOCA 4FR4A 4QPSA 4PWNA 4G3CA 2RSVA 2REIA 2RFEA 5JZNA 2CGVA 3JVSA 4FKOA 4EC8A 3TZ8A 3LM0A 5IA4A 3GCPA 4AWIA 2ITYA 3C0HA 3KY2A 4JOAA 3DK7A 5BMSA 3HX4A 3QC9A 4RMZA 4OTHA 3S00A 5JN2A 5TT7A 3PG3A 4GFMA 2IW9A 3U9CA 4HZRA 3V8WA 5CAQA 4BIBA 2YAKA 2QNJA 3BLHA 2ITPA 4QPMA 4XP3A 4HYSA 1PXPA 2DS1A 1UVRA 2OJGA 5TR6A 4DFUA 2QR7A 3W1FA 1WBNA 3QD4A 4ZTLA 5JQ5A 5AM6A 4UYNA 3OZ6A 5DPVA 4F09A 3RCJA 4M12A 2UZEA 3QALE 2X8EA 5HGIA 3MYGA 3RWQA 2UW6A 3NUSA 2OG8A 5IG1A 1ZOEA 4BZNA 3C5IA 4JDHA 3A7JA 2GFCA 3FZTA 4IE9A 1J1CA 3COKA 2C6TA 3R9RA 4IZ5A 4QP1A 4EHVA 4QMMA 3P0MA 3V5JA 3DZQA 2QVSE 4DGOA 3FI4A 4XLVA 5KZ0A 4GG5A 2BAJA 3FPMA 4UMTA 4EBVA 2W4JA 2O2UA 3LFQA