3OVVA

Human camp-dependent protein kinase in complex with an inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
337
structure length
335
Chain Sequence
SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title fragment based drug design on PKA
rcsb
source organism Homo sapiens
total genus 110
structure length 335
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-09-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ovvA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ovvA02
1SVGA 2XEYA 3QLGA 1YHSA 2R3NA 3BE2A 3CGOA 3I5NA 4HCUA 1OB3A 4L00A 3QTXA 4XEYA 5DH3A 2QD9A 4E20A 2WQEA 3HRBA 4FT9A 3SAYA 3G6HA 4F7NA 4MXCA 4LQMA 4ALVA 5CF5A 2WTIA 5HG8A 2W5AA 5HHWA 1G5SA 4FC0A 2I6LA 3JVRA 4DE4A 2XA4A 4IWDA 1J7IA 1OZ1A 2WOUA 1YOMA 5A14A 5JEBA 3CLYA 4LM5A 3PE1A 2XK9A 4J99A 4BI2A 4A7CA 2ERKA 3SG9A 2XF0A 3A8XA 4RIOA 5HVYA 3CCNA 2ZB0A 2YLFA 4CFUA 4PNKA 1P5EA 3ALNA 3LFQA 5IUIA 3H30A 3HMPA 5FWKK 4HYUA 4FTRA 1PXKA 2HCKA 3NW7A 3ZC6A 2W4OA 3VS7A 2PU8A 1OL6A 1ZYDA 4PUZA 1F3MC 1GY3A 4G6OA 5CQUA 5AP3A 4BTMA 5FEEA 3MPTA 4FE2A 3ERKA 1FGIA 3C0HA 4TN6A 5AAGA 2V0DA 4QTAA 4CQEA 3O8PA 4M66A 5EG3A 5FM2A 2ZDTA 2PVJA 4H3QA 3I7BA 4UZHA 3E64A 4EWQA 5LMKA 4C3PA 3M1SA 2YIYA 5HESA 3TNHA 4CSVA 3UMXA 5LMAA 5A3XA 5EQPA 2H6DA 4GRBA 4S34A 3BYSA 3UBDA 5DGZA 3G15A 3D2KA 4EQUA 4L52A 3PWDA 4FKLA 4TYIA 4YC8A 4L68A 3TNQB 4D2SA 3NYNA 3EKNA 3GCUA 4ANSA 1XH9A 3DFCB 4J96A 3VUMA 5IZFA 4I5HA 3A7JA 5H9BA 2GCDA 3UMWA 5AAEA 4ACHA 1WBVA 3ZM4A 4LUEA 4AWIA 4IVCA 3QUPA 4GG5A 3GP0A 4YLLA 4AGDA 2J51A 5AV1A 2W06A 1H4LA 3QTIA 4N0SA 4DEEA 1SYKA 4J97A 3LE6A 2VTLA 2YABA 3EHAA 3H0YA 3O0GA 4QMXA 2W1DA 4D2VA 5CF8A 3ZBFA 2J0MB 4PF4A 5IU2A 3BV2A 3BX5A 5AAFA 2NRUA 4ENYA 3MY5A 2XKCA 4GIHA 5DIAA 1UWJA 2QLUA 5CANA 3DPKA 4L67A 3E5AA 4ZTHA 4FL1A 2WQNA 4HGTA 4PTEA 4OTFA 4QQCA 4DFXE 1SVHA 2VTAA 2WXVA 4I20A 3UE4A 4KKEA 5J1WA 4GCJA 3FZTA 4KS8A 4F70A 3ENHA 1GZNA 5GJGA 4ANLA 4FIFA 1OPJA 2ZOQA 3RCJA 2I0VA 4TY1A 5JFSA 3TTIA 3P7CA 3BYOA 3HGKA 3Q6UA 2OGVA 3M2WA 4AS0A 3ZSGA 2OJ9A 2YDKA 5AR3A 3LPBA 2B9IA 2OF4A 2F7EE 4BYIA 3O23A 3ZXZA 4KIQA 3ROCA 2WU7A 4AN2A 5HVJA 4ZSLA 2VWUA 4WSQA 5TR6A 3ET7A 2DUVA 1GIIA 3M42A 4ZTQA 4NKAA 4RLLA 1SMHA 4EEVA 2X9FA 3GB2A 1O6KA 1T45A 4TTHB 4D58A 5AUTA 4J71A 1H24A 2X8EA 4YLJA 5C8NA 2VU3A 3V6SA 3R73A 4F1TA 2GQSA 3Q4TA 4RVKA 3FXZA 4QMYA 3QGYA 2Y9QA 4F1MA 4JT3A 4Z55A 4M84A 4D0WA 1WBTA 2CLQA 4JDKA 4L3LA 4UXLA 4WO5A 4W9WA 3Q4CA 2QCSA 4G16A 3R22A 3FLNC 4W4WA 3KFAA 4UYAA 3F7ZA 4TXCA 3AC1A 4QPMA 3SXRA 3TTJA 1H27A 4FUXA 1ZY4A 1URWA 2WHBA 3FL5A 3W2SA 3BEAA 4QO9A 5KX8A 1OKZA 4WSYA 3N4TA 5JZNA 3AXWA 2JC6A 3AGLA 3MDYA 3ZUUA 4FG8A 3WBLA 3UQGA 2Y4IB 3R7EA 3EKKA 1UA2A 4Z16A 2JAMA 3VBTA 2B1PA 2JKQA 5I4NA 4IAKA 5HBHA 2RFNA 4JIKA 3CY3A 4D4YA 2XRUA 5AR7A 5I9UA 4QRCA 2JGZA 2V7OA 4YPDA 2JLDA 4CNHA 4X6RA 3CEKA 3OY1A 1LEZA 1WAKA 3BU6A 3TKUA 3ZEPA 1KV1A 3FC1X 3LCSA 4IACA 4ARKA 3NAXA 3ZC5A 4OAUC 2XRWA 2I0YA 1A9UA 3HNGA 3W2QA 2NP8A 3G2FA 3R71A 1QPDA 5ETCA 4I5CA 3RM6A 3QWJA 1J7UA 4LRJA 4NT4A 2IVTA 3LLTA 4CKIA 5KKRC 2XKFA 4BIBA 3BYUA 3OWLA 3R01A 4E5AX 2CSNA 2C6IA 2QO2A 4FICA 2AC5A 1OGUA 4PMMA 3LFCA 5EI2A 3POZA 5C4KA 5CSWA 4UMUA 1XJDA 4C3RA 2YCFA 4QP6A 5C9CA 1ZY5A 3UNZA 1H07A 4RQKA 3QD0A 2UW6A 3MH1A 5J7BA 4YO6A 4FOCA 3EQRA 4O22A 1VEBA 1UU8A 4FVQA 2WU6A 4FKPA 2YAAA 5GJDA 4ZJVA 4HCVA 3ORKA 3AQVA 1AQ1A 3U51A 4JG8A 2VO0A 5CEQA 2V7AA 2VUWA 2OWBA 3HRCA 3K3IA 5BVOA 3AMYA 5GIOE 3V3VA 2CN5A 4GU9A 2YM6A 3C13A 4QQ5A 5TO8A 2Y0AA 4X2GA 5JH6A 4LI5A 2PWLA 2QHMA 4FSNA 3QX4A 4KKHA 3PXRA 3SV0A 4XUFA 5AP1A 1X8BA 4QTCA 2UW0A 4YBJA 4CRSA 2B53A 3O7LB 3KRXA 2P2IA 2PUUA 3RBWA 4HZRA 5HD4A 4R77A 5IQFA 5FM3A 3O17A 2BRNA 3NR9A 3R63A 3UG1A 1OL5A 3ORTA 4YTIA 2PUNA 3CS9A 2KULA 2QOOA 5FUTA 4C4EA 3WF9A 3VQUA 4K2RA 3PLAE 5CU4A 1U5RA 2CN8A 5K9IA 4XLIA 3BGPA 1G3NA 1R1WA 3P7AA 3A7GA 2YLEA 3NUYA 4G2FA 4UWBA 2HZIA 3GCVA 4YNOA 2B0QA 4IZ7A 2C6LA 4FT3A 4PY1A 4AFJA 4G31A 4M13A 4B8MA 2PMNX 5KNJA 4L8MA 3I1AA 5F95A 2JDTA 3FC2A 1BI7A 3QCSA 3P23A 3QHRA 3DQXA 1ZAOA 4RWIA 5IQDA 1M17A 5M06A 3NCGA 3OWKA 4XV3A 1EH4A 4G3DA 3S0OA 4FTNA 5CAQA 2BROA 1SNXA 2JFLA 3MH2A 5IQAA 1DI8A 1OUKA 3PXQA 2IW9A 3SHEA 2UZVA 4ZK5A 3TV7A 3O8TA 5GIPE 3IDCA 3GU4A 3HKOA 3ZUTA 2BKZA 2YDIA 5DA3A 3LMHA 3D15A 3HMOA 1JNKA 4BICA 1HCLA 3SOAA 4ALUA 3A2CA 3KMUA 2XH5A 4WG5A 3RMFA 4PTCA 4ERWA 5L6PA 3U6HA 3WE8A 4PWNA 2BFYA 3OBGA 1Q8TA 3R1QA 1MRVA 4XP2A 4EUTA 2XM8A 3PPJA 4FSTA 3JYAA 5CSHA 5ANKA 1TVOA 3S1HA 4O81A 3E88A 3I4BA 2J2IB 1YRPA 5L6OA 2WQBA 4FEWA 4FSRA 2JIVA 5IDPA 3C7QA 4BZOA 2FH9A 4MX9A 1P4FA 3UO6A 4BKZA 4MQ1A 3BQCA 3Q4ZA 4E4NA 3EYGA 3QX2A 5M4IA 5AP4A 3DXPA 4YMJA 4RJ6A 4BBEA 2R3JA 4FBXA 4C62A 4Z7HA 2H34A 4JQEA 1R0PA 3HVCA 3FI4A 5K4JA 5KHXA 2F2CB 2VTOA 3LCOA 3NYVA 3R04A 5M44A 4XP0A 4DFLA 1J91A 4U43A 3R2YA 4E26A 5JFWA 4IB3A 2YDJA 3F3WA 4DC2A 4W9XA 4JBVA 4KINA 5L8KA 2VWWA 2IN6A 4YTCA 1QCFA 3LMIA 3VC4A 4FUYA 2UZTA 3HV3A 3VULA 3CD3A 4WBBB 3CE3A 4UB7A 3EFWA 3QD2B 2CHLA 3D83A 5TKDA 4E3CA 3GXLA 3UQCA 4RT7A 3HEGA 4EONA 5HE2A 2ITTA 4P5ZA 4C4FA 4K11A 1J7LA 2R4BA 4OT5A 5BX0A 4YNEA 4M14A 5E8YA 4IFCA 3ZYAA 4A4OA 4AZEA 4UZDA 4PTGA 4HPTE 4E8AA 2PULA 2CGVA 2VTQA 4F6WA 4AT4A 4CFWA 1IR3A 4XS2A 5AUUA 3A60A 4JR3A 3DTCA 5ANEA 2GNIA 2OU7A 5IISA 3PA3A 4M97A 4B99A 2ITXA 3BU3A 4YJPA 2OIDA 3ZHPC 2ZM4A 3AC8A 4F0GA 2QOBA 3MVHA 1AGWA 1J3HA 1YVJA 2BAJA 1Y8YA 4YPSA 4O0YA 1DM2A 5C8MA 1YI4A 4IXPA 1CMKE 5A6NA 3DTWA 3LXKA 5JQ8A 1KUTA 2YM8A 5K3YA 2BKKA 4R5YA 4RWLA 1GNGA 3RWPA 4FT0A 3NUXA 5E8XA 3BHYA 2EB2A 2R2PA 2ZV8A 4L3PA 2J6MA 2WTDA 3BGZA 3Q4UA 4O21A 3NLBA 3FKOA 5HD7A 4F9BA 4WUNA 3UIUA 3MVJA 2PE2A 2VTSA 5CS6A 4NEUA 3EFKA 2PVFA 2EUFB 1XR1A 2VWVA 3EFLA 4O7ZA 4BDEA 5IQBA 2AUHA 2BRHA 5DMZA 4CVAA 3FLQA 2FSLX 4U41A 1OITA 3UPXA 4YJSA 3DNDA 3HA8A 3QZGA 5ANIA 4BGHA 4C2WA 3KULB 2SRCA 3D9VA 3K3JA 4KA3A 3IECA 4PDSA 5CT7A 4XG9A 3KULA 3QA0A 5AIKA 4HYIA 1U54B 4IBMA 5EDPA 3V8TA 4YZDA 2GTMA 2JIIA 2GNHA 1U54A 2ACXA 2QHNA 3GU6A 3FMJA 4FF8A 5DHJA 3WF7A 4LL5A 1ZZ2A 3COHA 2J50A 2JITA 4EL9A 3LFNA 3A8WA 3FJQE 4CLJA 3LHJA 3H0ZA 4EHEA 5EYDA 4PP9A 4F99A 4R78A 2X7GA 3BYMA 3AC5A 3F9NA 3HL7A 3JVSA 3MI9A 2WTCA 3JY9A 4QNYA 3V6RA 4ZY5A 3UOJA 1Q97A 4DLIA 2HZ4A 4N6YA 3ZUVA 3L9LA 4CGAA 1FINA 2YA9A 1P4OA 4LOOA 4X0MA 2ITOA 4DG2E 4EOQA 4ZS4A 3IW7A 4QP4A 2OXDA 4BDBA 3GC9A 2VTRA 5M51A 3EQBA 2UW5A 3VBVA 5F4NA 3CKXA 4C38A 4I0SA 2WEIA 1JKTA 3QFVA 4C4GA 3IW6A 3WF5A 3UVQA 3MIAA 4E5BA 4HVHA 4O38A 3TZ9A 2X39A 3WYXA 4C4HA 1Q41A 1APME 5H3QA 5BYZA 2W1EA 2XJ1A 1E9HA 1UU9A 4NWMA 1GIHA 1IG1A 3P78A 3MPAA 2VO3A 5JRSA 5L2SA 2WTWA 3NEWA 4I0TA 4XRJA 5HG5A 1BLXA 3B2TA 4EUUA 1W0XC 2HZ0A 3QKLA 3VBWA 1WBSA 4WT6A 5DYJA 1YXXA 3UO5A 2BDWA 4WOVA 3PLSA 4F0IA 2GS2A 4RJ3A 4RPVA 3R02A 4RIWB 2Z7SA 3HUCA 5AP6A 3RPSA 1REJA 5I9YA 1BMKA 3PA5A 4RIWA 3UQFA 4BZDA 4RIXB 4HVGA 4V04A 2LGCA 5IF1A 5KMOA 4Q9ZA 2VNWA 3Q9ZA 4RIXA 5AM6A 5DT3A 2FO0A 1OIYA 3WI6A 3QA8A 3DJ7A 4ZLZA 4YLKA 3NZ0A 4DG0E 5LMBA 3FYKX 4LV8A 4Q5HA 3D14A 4BL1A 3L8VA 4GG7A 4GV1A 3P0MA 3HRFA 4XCUA 1A06A 3ZDIA 1Q99A 4JDJA 4NJ3A 3KCKA 3PP1A 4M3QA 4DTBA 4RC4A 4XV1A 5LMKC 4ZSGA 5FTGA 3ZONA 1ZYCA 2G9XA 3I6WA 3FZOA 3QQHA 3UP2A 5D7AA 4RWKA 2DS1A 2P3GX 5B0XA 4EH3A 2QR7A 4MYGA 3FMLA 3L1SA 4PQNA 4II5A 2BVAA 4F7JA 2YIRA 2BRGA 2O0UA 3NUPA 4TRLA 4YJRA 4J8NA 3VS2A 2GFSA 3DJ6A 2C6TA 5DWRA 4PP7A 1YXSA 3G6GA 3A61A 4FKSA 1S9JA 3QKMA 4IWOA 4FSMA 3T9IA 2HK5A 4FA2A 3MFSA 3AG9A 2XNOA 3HLLA 5AA8A 4MWHA 5TE0A 4FSYA 4KWPA 4D5HA 4C0TA 2OZOA 5AV4A 2QU5A 2IJMA 3H9RA 2F9GA 3A7IA 4QP1A 4R5SA 4E6AA 4USFA 3KVWA 4O1PA 3WF8A 5JKGA 2Z2WA 4L7FA 5AX9A 3EOCA 4Y85A 3OZ6A 4BDHA 2XNGA 3C4XA 3F61A 4LL0A 3RINA 5AEPA 2B9FA 4O7WA 4ZOGA 3UIBA 4NCTA 3BV3A 3PYYA 3V04A 4BWXA 2FGIA 3WIKA 4FG9A 5IA5A 4CZTA 4F9YA 2YACA 3OG7A 2O5KA 3IOKA 5HIDA 2QONA 2XIXA 2R7BA 3VAPA 4UMRA 2FA2A 4Q2AA 3DOGA 4NH1A 4ZY6A 3OXTA 2C68A 4DTKA 3KMWA 3C1XA 2KTYA 3RHXA 3O2MA 3W55A 5FDPA 1YOLA 1YDSE 1YOJA 3IGOA 4WNPA 4X2FA 3AD6A 4MXZA 5BMMA 4AG8A 1IAJA 4E73A 3PJ3A 3KF4A 3MA6A 4EOSA 2HENA 2PSQA 2WD1A 3QTUA 1ZMUA 1DAYA 2OO8X 4V05A 4TWPA 3QRKA 2C3LA 5E7RA 5ANJA 2QR8A 2CNVA 4KABA 2HW6A 5CXZA 2QG5A 2W0JA 3DBFA 4N4SA 2VWXA 1IAHA 3DU8A 1R78A 5BVNA 5AMNA 5F94A 2IZUA 4NM5A 4V01A 5J5SA 4GS6A 4JRNA 3LKMA 3KK9A 2W4JA 4HVSA 5AV2A 4F63A 5EYKA 3HV4A 2IZSA 1M2QA 4FIHA 3GU7A 4L7SA 3VUIA 4F08A 4RG0A 5CZHA 3V51A 5IDNA 1WCCA 3KB7A 4D1ZA 3TZ8A 3TDWA 2WTVA 2C0OA 4RLKA 5HORA 5E91A 3UZPA 5CSVA 2BRBA 4B9DA 1UVRA 2C0IA 3OCGA 3VRYA 1QPJA 4BF2A 1PXNA 4UMPA 5LJJA 4I6QA 3C4WA 4UV0A 4YTHA 4FTOA 5DT4A 1M14A 2Y4IC 4QP9A 3ACJA 3VF8A 4G3EA 5CQWA 3W2RA 3OW3A 2HY0A 2E9OA 2WMTA 3RCDA 4ORKA 4OTGA 3VW8A 2R3GA 3KCFA 4WKQA 2BPMA 4CMOA 4D4RA 5K5NA 1FQ1B 3QL8A 1I44A 1OPKA 1FVTA 4WG3A 3TJCA 4ZSEA 2Y7JA 4EH4A 3RK5A 3W2PA 3H9FA 4AZSA 4RA5A 2VTTA 2O2UA 3QBNA 3JR1A 4CZUA 3TUDA 4BKJA 3QGWA 5BUEA 2CNQA 4QTEA 2QU6A 3WZDA 2YWVA 2ITUA 3HZTA 2EXCX 4EQCA 1V0BA 3RAWA 4EOMA 3POOA 4F64A 4ZTLA 3E8DA 2ZYBA 3AC3A 4FKOA 1Y91A 4I6BA 1A48A 2VGPA 1Y8GA 4MQ2A 1SZMA 5DR9A 1MRUA 1Q3DA 3R9NA 3OUNB 2WELA 3BWFA 2C1BA 1ZYJA 3VUHA 4NM7A 3ZZEA 3T8OA 5C4LA 2VTJA 3GC8A 3E3PA 5HLWA 3KKVA 4O27B 2UZBA 4ITIA 1M2PA 3MTLA 3V5TA 4OTQA 4JBOA 3FLZA 1JAMA 4H36A 2OH4A 5AV0A 4PDYA 4MTAA 4MK0A 1UNGA 2J5FA 5EHOA 2X2MA 2PYWA 2BZJA 2GDOA 5JT2A 2YZAA 3C0GA 3CQWA 3PFQA 2QO9A 3GT8A 4YZ9A 3R00A 2Y6MA 5FP5A 4EBWA 1OIUA 2RSVA 1WBOA 4KD1A 5IMXA 5CU2A 4EI4A 5HX8A 3HAMA 4C02A 4N70A 4KAOA 5HCYA 2JIUA 5GJFA 4TYJA 1OKVA 5H8BA 4YZBA 2RFSA 1ZXEA 3FQHA 4G17A 2C3KA 5I3RA 4D2TA 4XG3A 3NVKI 3FLYA 3FI8A 3FZPA 2R3FA 1NVQA 4CT2A 3U6JA 3K5UA 2PE0A 2W9ZB 2QOLA 2PVKA 4ZZOA 5AADA 3NX8A 1XHAA 2BTRA 5DPVA 1REKA 3PIZA 3UTOA 3D4QA 5IA1A 4AA0A 5EHYA 4RQVA 3VO3A 1YXTA 4C4IA 1PXLA 2JDVA 4LGHA 4S2ZA 3ZLYA 4ZLOA 3F2NA 2Q0NA 3KC3A 3QF9A 5T68A 4CTBA 5ANGA 4EHGA 2BAQA 3PP0A 1H1SA 2RIOA 4MAOA 4FV5A 4YSJA 3MY1A 4BDIA 4ZZMA 3W2OA 3E63A 3FV8A 1CKIA 2VO6A 4XJ0A 4MKCA 3O51A 1LR4A 5CSXA 3R1NA 2Q0BA 5DEYA 1QPEA 4XBUA 2QNJA 1U5QA 2J90A 3EL8A 4CKJA 3OT3A 3E3BX 4GVAA 2XM9A 2UW4A 3U87A 3ZLWA 4GH2A 3CKWA 3TNWA 4AA4A 3PXZA 4EJNA 1HCKA 2J0LA 2A19B 3G9NA 4GK3A 2CNUA 2H96A 1PRYA 4GKIA 3ULZA 2ZV9A 3WF6A 3MWUA 5DLSA 3NSZA 3AT3A 3S2PA 4AU8A 4XP3A 3L8PA 3KL8A 4EHVA 3DB6A 4USDA 5BPYA 3PVGA 3U9NA 2VNYA 2VTIA 3DNEA 4IVBA 3Q04A 4AOIA 4IWPA 3HV6A 5CTPA 4G9CA 2IW8A 3REPA 5E4HA 4QYYA 3O50A 5HNIX 2HIWA 3OCBA 4CV9A 2GHLA 2XEZA 3CTQA 3CXWA 4O7LA 2H9VA 4ACGA 4EK8A 1LEWA 1NT2A 2VX0A 2XK3A 4D2WA 3TIZA 2X7FA 3IW8A 5CI6A 3MB7A 2X0GA 3EZRA 4ZY4A 2YCRA 4HYHA 4ZTRA 3SX9A 4BCNA 4ZSAA 3PXYA 4D4SA 4DCEA 5JGAA 3ORIA 3QRIA 4AF3A 4L3JA 3RHKA 1W98A 4ZP5A 3FE3A 3UNJA 4WD5A 1B6CB 5C26A 4M0ZA 3BHVA 4RA4A 4E7WA 5E8WA 4CYJA 3TEIA 5DRBA 1BUHA 4F9WA 3TG1A 4FX3A 4F0FA 3ENMA 5L8LA 5AUZA 3LJ0A 3PZHA 4DF3A 1YI6A 4DT9A 4MVFA 3R1SA 4MBLA 4IAAA 4RWJA 4CFFA 4EK3A 4BR3A 1RJBA 3OMVA 4WG4A 5ETAA 4EC9A 4AT3A 4HW7A 3ODYX 4AP7A 1SNUA 3VJOA 3PSCA 3PRIA 4C7TA 5LOHA 1CKJA 4MXAA 4CFVA 4EJ7A 5HBJA 5CU3A 3DLSA 5AP0A 3BE9A 1Q8ZA 5EM7A 1LUFA 3GQIA 3FWQA 2JEDA 3FSKA 1YHVA 3BYVA 4P5QA 5E8SA 2A0CX 4KNBA 3NNXA 3SKCA 3LQ3A 2ITWA 2YCQA 3LMGA 3KXXA 4QMMA 1BKXA 2ONLA 4DLJA 4DINA 5IQCA 2CKPA 2PZPA 3VHEA 5EHLA 5CAPA 3FZ1A 1XWSA 1V1KA 4UXQA 2IVUA 4AX8A 4YU2A 1Q61A 2FB8A 2R3RA 3CTHA 5BNJA 2BHEA 2VN9A 4ALWA 1IA8A 1GOLA 1BL7A 4Q5EA 5D7VA 5M4CA 3TL8A 2IW6A 1VYZA 3S95A 3FBVA 4ENXA 2J5EA 4IE9A 3DKGA 5A4EA 3IDBA 5C03A 3FLWA 3GCPA 5CU0A 2ZDUA 1WBNA 1OL2A 4EC8A 2EVAA 4ACMA 4AUAA 4Y95A 3CC6A 2X4FA 3DK6A 4JG6A 3OFMA 2C6KA 4BCFA 4C57A 4QTDA 2QKRA 1BX6A 1K3AA 3QAME 2ZV7A 2JD5A 2OXYA 4DITA 4ASXA 5AP2A 3C4EA 2C5NA 5K4IA 3H9OA 2C47A 2Z7RA 4FKWA 3CTJA 3EZVA 4OUCA 4ANNA 3NIEA 2ETMA 5J87A 3THBA 4PPBA 4BDGA 3VJNA 3D2IA 4NM0A 5M57A 3ZM9A 2WPAA 4BGGA 4NZWB 4TWNA 5EM5A 2XYUA 2BALA 2DQ7X 2ITNA 3ACKA 4JR7A 5EM8A 4U45A 5EKNA 2OIBA 4ZMFA 2BHHA 1YDRE 3F6XA 2LAVA 3GFWA 4TW9A 5FD2A 3RK7A 2WIPA 1WVWA 4NL0A 5CASA 3MYGA 4L44A 2WTKB 3ORMA 3DBDA 3MSSA 1K2PA 4J98A 3OEZA 4NW6A 3VS6A 4YHJA 5GHVA 5FXRA 5IEXA 5IQEA 2BDJA 2R7IA 4E93A 1G8SA 4R8QA 3CJFA 3JPVA 4X3FB 2Z7LA 2YITA 2BR1A 2P4IA 3N51A 2R3KA 3QZFA 4EZ7A 5CAUA 4X3FA 1PF8A 1RDQE 1U4DA 3NNWA 3PE2A 2WAJA 4K0YA 5DEWA 5AA9A 3LFDA 4PV0A 3R7YA 4DGGA 3VF9A 4WA9A 1RE8A 3D94A 4F9AA 3R7VA 3IW4A 3R7IA 1Q4LA 4QYGA 4A9YA 4BB4A 5TF9A 3N4VA 3G0FA 4RSSA 3ITZA 3BELA 4Z9LA 1PKGA 3IGGA 4L45A 3C9WA 2WMBA 2XBAA 4AA5A 1Q62A 1OKYA 3OOGA 2GHMA 2XB7A 4XG2A 4XYFA 5CI7A 4R1YA 4S30A 4NTSA 2GFCA 3ZBXA 3RM7A 3E8EA 4G3CA 1FBNA 4IMYA 5IEVA 5H2UA 2B9HA 1OI9A 2GMXA 3ORXA 3F3UA 4XG4A 4R7HA 4I3ZA 3DS6A 4AOTA 2GS7A 3MJ2A 3PJ8A 4JI9A 4Y83A 4BCHA 3NIZA 5ITAA 1FVRA 2A27A 3BI6A 2JBOA 3MS9A 4OTPA 3DZOA 1Q3WA 2CLXA 3DFAA 5EKOA 4DFBA 1E1VA 4H1MA 4RC3A 1XKKA 2QI8A 3OP5A 1YWRA 3EQPA 1GIJA 4O82A 4EZ3A 3C5UA 4H1JA 4U7ZA 5E1SA 5AR2A 3RGFA 1WVYA 3PJ2A 1XBCA 2WMAA 3SC1A 2XIKA 3RWQA 3ORNA 3NNVA 2WZJA 4P7EA 3Q52A 2ZB1A 1Q5KA 3MY0A 1FMOE 1XH8A 5DE2A 4QYEA 3NPCA 4ANQA 4L46A 1JSVA 2RF9A 2UZEA 2YIQA 3DBQA 5CENA 3G90X 4K8AA 2WKMA 2G01A 2FYSA 2G15A 4QMZA 5TT7A 1Q8UA 4ITHA 1YQJA 3BZ3A 5BVWA 4EH2A 2J0IA 2ZMCA 3L8SA 5J8IA 1Q8YA 4R3CA 4HOKA 3E8NA 5KE0A 4O7SA 1WBPA 5ACBC 2VWIA 5IA4A 4ZLYA 3UZRA 3FEGA 5BVDA 1IASA 3TNPC 3VWAA 1ZLTA 5M55A 5LARA 2NO3A 3GC0A 4ACDA 1MRYA 2VGOA 3WARA 4HYSA 3EWHA 2QVSE 4FTMA 1Y6BA 3I5ZA 2HELA 4NCTC 5J9YA 3C51A 4JXFA 5CF6A 1OBDA 2PY3A 3Q9WA 3LJ1A 3ZO1A 1G8AA 5KUPA 2J9MA 5FLFA 4EH9A 4R3PA 3P4KA 5E8VA 1OMWA 5F1ZA 5C01A 5KMJA 3C5IA 3IO7A 2PL0A 5EI8A 5FXSA 3MH3A 4TYEA 2BCJA 4LYNA 5GZ9A 1E1XA 4XLVA 5JFVA 5HNBA 4QMSA 3I0QA 5FBNC 5LVNA 2F7XE 4LOPA 3BLRA 2XUUA 2PVRA 3QRUA 4DHFA 2PUIA 4XG7A 2C69A 5CVGA 4CD0A 3NUSA 4WNMA 2FSMX 4FK6A 4FV1A 4GW8A 2B9JA 4F1OA 2QLQA 4KIKB 4R7BA 2FSOX 2WTJA 3WOWA 3ZLSA 2XYNA 2G1TA 3KQ7A 3RI1A 4WNOA 4KIKA 4XBRA 4O7YA 3AMBA 4YJVA 1GZKA 4D55A 3H10A 1W83A 4RVTA 3QXPA 4ZTSA 4TYHB 3DQWA 5T3QA 1M7NA 3BHTA 4CMUA 3B8RA 1BL6A 2UW7A 5B2MA 5BUJA 5CZIA 4TYHA 2WMUA 3BRBA 4I21A 3FY2A 3LJ2A 3PIYA 1NA7A 4R6VA 1RW8A 3QC9A 4FNYA 2Z60A 4RVMA 4FVPA 5L3AA 5M08A 3ATTA 4PDPA 5JN2A 5JFXA 3QCQA 2ITZA 2XS0A 2C3JA 4RX8A 4AW2A 5CAVA 4FT5A 2W1GA 4O0XA 4DN5A 4KS7A 1V0PA 2PMIA 2ZMDA 3Q60A 4UMTA 3VBXA 3FXXA 4O0SA 5E90A 3A62A 3BBWA 4S32A 2G2IA 4MNFA 1FOTA 2WGJA 4YZMA 5GNKA 3W8LA 4M15A 2CJMA 4EZ5A 4NK9A 4PRJA 2YWPA 4BC6A 3MBLA 3HMIA 3RNYA 4QYFA 1PXIA 1H0VA 1WVXA 3KEXA 3IOPA 4OBPA 3GCSA 3V8SA 5EOBA 2HYYA 2XIYA 3SVVA 3B8QA 3GU8A 1KSWA 4D28A 2OIQA 2CMWA 2F49A 4APPA 3PPZA 4L53A 4N57A 4NFNA 3QZIA 5DVRA 5HIEA 2W5HA 3L9MA 5GZAA 3TUCA 4CMTA 3IK3A 2QURA 3Q3BA 3LFEA 4M0YA 5EW9A 3KXGA 4B0GA 5CVHA 3UO4A 4BZNA 1H1QA 3ZO2A 4IVAA 2C6OA 4FYOA 3ZDUA 5FEQA 1H1WA 1JWHA 3DXNA 1Y57A 1XO2B 3PJCA 4PL4A 2XVDA 5IUHA 3BHHA 4I92A 2R3HA 3HAVA 1UU3A 3R8MA 3ROYA 3BHUA 3ZEWA 4DG3E 3VQHA 3JUHA 4IB5A 1AD5A 2QQ7A 2IPXA 3IKAA 3BU5A 3L9NA 4FV3A 4U44A 4ZJJA 2UUEA 3LM5A 4IAFA 3V01A 4C36A 4HJOA 1GAGA 2XCKA 3E7OA 4Z3VA 3D0EA 3PRFA 2UW8A 4KBCA 3AT4A 3FMDA 3D5WA 5D12A 5D41A 3UGCA 4C2VA 4FNWA 1QL6A 4DH7A 4YUQA 4HPUE 5I0BA 4C34A 4GIIA 4TWCA 2R3LA 3F3ZA 3OBJA 5HOAA 2BUJA 4U6RA 2XK7A 4IB0A 4YJTA 1JQHA 1NXKA 3PJ1A 3NW5A 5KO1A 1CTPE 3LQ8A 3O8UA 5J9ZA 4BDKA 1K9AA 4KRCA 5M53A 2VWYA 4YGAA 4I5MA 4FKJA 3MFTA 4Y46A 3QQKA 4XX9A 4GMYA 1LPUA 2CDZA 1MQBA 2R0IA 3D5VA 3F5GA 4UMQA 3R8PA 3QLFA 5DFPA 1QMZA 2W17A 3EYHA 4IW0A 4RJ7A 2OJGA 2FUMA 5HE0A 2QG7A 3EN5A 4D9TA 4CRLA 4EK5A 1R0EA 4FOBA 3TWJA 3SW4A 2BDFA 3DV3A 4IZ5A 1ZMVA 3QALE 4I5PA 4U40A 4G9RA 4HNFA 3GC7A 2F4JA 2J0KA 5LQFA 4U5JA 4BYJA 3UC3A 4QMQA 3FQSA 4UWYA 4YJNA 3FMHA 5HX6A 4O7VA 4CG9A 2BTSA 3R9RA 5KMIA 3F2RA 3EL7A 1MQ4A 4RIYB 3JY0A 4G5JA 5AP5A 2XNMA 5EQYA 3EQGA 4FEQA 4IHPA 4RIYA 5ANDA 4WRGA 4CXAA 4DGNA 5J1VA 3VS4A 2IG7A 4FIIA 4H3BA 3OHTA 1XQZA 2YN8A 5A4CA 4AAAA 4L01A 4IVDA 1Y6AA 4FV2A 2C5VA 3F5PA 4B6LA 4B8LA 5BMSA 1O6LA 5LVMA 3HECA 3SXFA 3RVGA 1T46A 3OTVA 3KMMA 5BVEA 3TZ7A 1TQIA 1O6YA 2JAVA 4CFNA 2C0TA 4J95A 4GFMA 3CQUA 4JIAA 1IA9A 2YAKA 4PNIA 2X81A 4ASEA 3RZBA 3ODZX 4TWOA 1R3CA 4FSQA 4TZRA 4E6DA 5A6OA 5HTIA 4J7BA 4DFYA 4TKSA 4LRMA 3HV7A 2W1ZA 3GI3A 1STCE 4P4CA 5KMKA 2PK9A 3ZH8A 2RGPA 5AX3A 2F57A 3ORLA 2E9UA 3FI2A 5TOZA 2O8YA 3QTWA 3CSVA 2V62A 2X8IA 2E9PA 1PMNA 2W1CA 3RP9A 4O0WA 1JSUA 3EB0A 2BZHB 4HVIA 3AOXA 3MH0A 4IB1A 3V8WA 4X3JA 3ZSIA 4HZSA 2WFYA 1ZOEA 4BDFA 3DY7A 1KE7A 2OJIA 3PVBA 3QTSA 3ATSA 4FG7A 5KHWA 3EQDA 2BIKB 2XNNA 4FKRA 5HO8A 3NMUF 4X21A 4NIFB 4RGJA 2G2HA 1WBWA 3PZEA 4U0IA 3R1YA 4MD9E 1KV2A 2AC3A 3GOKA 3KREA 4W4VA 5E9EA 4NIFA 4DH5A 3MW1A 2ETRA 2R3QA 3OEFX 3DBCA 2XK8A 5DN3A 4OR5A 4BCPA 4O86A 4FEUA 4G3FA 1DI9A 5HVKA 3LXPA 3BKBA 4MD7E 3WZUA 4I94A 3UYSA 2C6EA 3RALA 3NUUA 1GZ8A 4I24A 3QTZA 5DT0A 2OSCA 4QTBA 5DNRA 3OVVA 4NJDA 1ZYLA 4L6QA 1WZYA 2GU8A 3LVPA 3BIZA 4FT7A 4XOYA 2XKEA 5LVPA 1L8TA 4YTFA 5FBOA 3V5QA 2UVXA 3CQEA 3W10A 2XIRA 2HW7A 3PWYA 4MCVA 5I9VA 2YM7A 5CEPA 2RFEA 4DA5A 3QXOA 4JOAA 3OCTA 5KMMA 1OKWA 2HXQA 2R5TA 4IX6A 4ERKA 4JVGA 2F2UA 3JXWA 3P5KA 1KE5A 3OCSA 4QP8A 3RK9A 2XJ2A 2ITPA 4GK4A 4C33A 2C6DA 2HOGA 4I1ZA 3AD4A 3Q9YA 3G0EA 4JAJA 2R9SA 3QU0A 3KK8A 4MXXA 3ZFMA 2B54A 2WMXA 2X6DA 4JJRA 3C4CA 4GFGA 4IANA 3R83A 5A9UA 3MGYA 3WZKA 2PZYA 4K6ZA 1H01A 3E92A 3P79A 4RJ4A 5JK3A 5IEYA 4YHTA 2QC6A 3Q2JA 3CPCA 5EYMA 3GOPA 4FZAB 4UYNA 5FTOA 5JZJA 4JDHA 2RFDA 3FHIA 3WYYA 4JAIA 4PDOA 4RMZA 4S33A 3ZO4A 3RPRA 4CFXA 3VUKA 3MTFA 3NWWA 3P86A 4H39A 4I22A 3Q6WA 2QODA 3EFJA 5AR5A 4C61A 4FTCA 4EOLA 2PHKA 1PMEA 4USEA 5L4QA 3SW7A 2WOTA 5IMEA 4QPSA 5I9ZA 4FR4A 3GENA 3VS3A 4D5KA 2V55A 5KBRA 4FV4A 2W5BA 4MBJA 2X2LA 1CDKA 3CD8A 3KXMA 3LQ5A 2F7ZE 3LW0A 3NAYA 4IAZA 3DZQA 4J8MA 3NUNA 1GZOA 2OK1A 4RVLA 4Y73A 3LLAA 3ANQA 5CEOA 3OTUA 2PZRA 4DBXA 3BGQA 2WMWA 5DI1A 3R7UA 2V5QA 3BLHA 4AQCA 3W2CA 2EU9A 2RG5A 3FZSA 3FHRA 2EB3A 4BWKA 4F6SA 2FVDA 1PXOA 4GK2A 4PL5A 4NKSA 1KOBA 1P2AA 4FMQA 3U54A 5H8EA 3PTGA 4DEDA 4QQTA 4H58A 4BFMA 4C59A 3LXLA 1WMKA 2I0HA 4OBQA 4DEHA 5A46A 4AXAA 2RKUA 3O7LD 4J52A 4JBQA 2OJFE 1UNLA 2HXLA 2BFXA 5EI6A 3SDJA 4IAYA 4E4XA 5J5TA 4DGOA 4GVJA 3A7FA 5HLPA 3HMMA 2OICA 3LAUA 5EW8A 5BUIA 4H3PA 3N4UA 2WTKC 4PMTA 2C30A 4ITJA 2BRMA 4BHZA 5HO7A 2GNGA 4I4EA 4X7QA 3KXNA 3E62A 4QMLA 4QT1A 2W05A 3CP9A 1XBBA 2YM3A 3M11A 5FGKA 4FKUA 4MHAA 5AJQA 4X3FC 1I09A 2DWBA 2P0CA 4O7TA 2BZKB 3FZRA 3MIYA 3QTRA 4OT6A 3OS3A 4G1WA 4FTTA 2HWOA 1JOWB 4HNIA 5J7HA 3OY3A 2YCSA 5HIBA 2CPKE 3RAKA 4GT4A 4OTRA 3TCPA 5IH4A 1H08A 2QOKA 1YWVA 4U9AA 2UW3A 4GSBA 2UW9A 5HI2A 5AUXA 4BCKA 1MUOA 3AC4A 3EJ1A 5CU6A 2GNFA 3TUBA 3TXOA 4GT3A 1HOWA 5HU9A 4UEUA 4YJQA 4FIJA 4GL9A 2X9EA 2B55A 2XMYA 4JX3A 5L2IA 3C50A 4O2PA 4XHKB 2BAKA 5CSPA 4ZTMA 2GQRA 1V0OA 3DCVA 3DK3A 5CVFA 4OAVB 3CR0A 1NVSA 1SM2A 2I0EA 2WQMA 4C35A 1JSTA 2XZSA 4FZ6A 4JG7A 1P14A 3C0IA 4E4LA 5FP6A 4UN0C 3C4ZA 5JMSA 2C3IB 4FSWA 4BCQA 4BGQA 4L42A 3NW6A 3KU2A 5CAOA 3ZMMA 3BEGA 2NRYA 4YC3A 5IH6A 2W1IA 5LXMA 5M07A 3VNTA 2CKQA 4AZWA 3V5PA 4MD8E 4EK6A 4XG8A 4IJPA 5LWMA 1J1BA 4AW1A 2W7XA 1OBGA 5JGDA 2R3PA 4BDCA 1UKIA 2OW3A 2PUPA 3R9OA 4UX9A 2NNWB 3G5DA 4DGLC 2YZLA 3R8ZA 4TNDA 4BTFA 1SVEA 1WFCA 2WMQA 5FTQA 3CBLA 4TNBA 5EK7A 2GPHA 5HQ0A 5JQ5A 3TKHA 5ANOA 2VO7A 3IPHA 3PXKA 3QD3A 4OTHA 4UY9A 3U9CA 1OL1A 4GU6A 3DAKA 1OECA 2IWIA 4MXYA 3LIJA 4U80A 2OFUA 3EQFA 3QUDA 2VRXA 3KVXA 3WE4A 3TV6A 3K2LA 4IX4A 1YWNA 2WB8A 4KSQA 4JDIA 4AN3A 4BBFA 3EQCA 3VUGA 5ETFA 1M2RA 1PXMA 3FSFA 3VHKA 1IEPA 4MEDA 4CTCA 1KOAA 3VUTA 4AACA 4EOJA 2GSFA 2H8HA 3UJGA 3LCKA 3FLSA 3P1AA 4NM3A 4OW8A 4PPCA 4FTIA 5HGIA 4ZJIA 3T3UA 3ULIA 2UVZA 5HTCA 4BDJA 5EH0A 2QOCA 3COIA 3F3TA 4QMTA 4JQ7A 4MNEB 3PY0A 4ANBA 4MNEA 4KIPA 4O6EA 3IONA 3FL4A 2PE1A 3OROA 1URCA 3PG3A 5JRQA 4LOQA 5HCXA 4YSMA 4M67A 3F69A 2YM5A 2V22A 4R7IA 1KE9A 5DR2A 3ZZWA 4O83A 3OXIA 3ORPA 3OT8A 2QOFA 3QQFA 2WMVA 2C4GA 2IZRA 3QTQA 3R30A 3R7OA 3SQQA 4D1SA 4D2RA 5HCZA 3GBZA 1OIQA 2YIWA 3R2BA 5ACKA 3T3VA 4FZDB 4QOXA 2YFXA 3D7ZA 4M7IA 4ZSJA 2PMOX 5FXQA 5AIRA 3KXHA 4XG6A 3FPQA 4DH1A 3NDMA 4IH8A 4ANMA 4BCOA 4BCMA 5AR4A 4E6QA 4BKYA 1ZARA 4RX5A 2W4KA 2Y6OA 4O2ZA 1OVEA 1H0WA 4S31A 5HG7A 2GS6A 3E7VA 3W8QA 4O0RA 3SRVB 3ZU7A 3LXNA 4NFMA 3HUBA 3OC1A 4YC6A 4BTKA 5IA3A 2WMRA 4U8ZA 3H3CA 3HA6A 3ZTXA 3GNIB 4WNKA 3SRVA 2ERZE 4BVUA 4EBVA 3BCEA 2X2KA 2PZ5A 5AM7A 2QOIA 3DKOA 2W96B 3U4UA 4DBNA 4DYMA 4MWIA 4EHZA 4FTJA 4F65A 5IQGA 1F0QA 5K0KA 4R3RA 3MFUA 3UC4A 4EOIA 1Q24A 1ZYSA 2YHVA 1XBAA 2VX1A 3HX4A 2CCHA 3NCZA 1BI8A 4IM2A 5AFVA 5HLNA 3TV4A 1YXVA 1PW2A 2CKEA 4YR8A 1FPUA 4EOPA 1PKDA 3IG7A 3P7BA 3SXSA 3SD0A 2EWAA 1R39A 4JNWA 1FVVA 3F5XA 4J53A 2AYPA 1OUYA 2X6EA 4RJ5A 4AE9A 4CZYB 5L2WA 1DS5A 2IVVA 3OW4A 4CEGA 4CCUA 3NS9A 3SGCA 1ERKA 5H8GA 3SLSA 4RFYA 3RZFA 5KCVA 1PXPA 2ITQA 3U6IA 3GGFA 5E8TA 5M56A 4GJ2A 5IKWA 2BILB 2B4SB 3E93A 3W18A 4FKTA 3UZTA 4OGRA 4D2PA 4KRDA 2YIXA 4BHNA 1U46A 3PVWA 4ZIMA 4AGCA 4CKRA 5I9XA 3W1FA 5ICPA 2ETKA 3UNKA 3I81A 5CNOA 3VN9A 5FG8A 3D7TB 3DBEA 3HYHA 5ETIA 3R6XA 3QCYA 4MBIA 4TPTA 5D1JA 3TT0A 3TI1A 4XV9A 1W84A 5L2QA 3D7TA 5CEIA 3VBYA 2PVHA 4IEBA 1FMKA 3Q2MA 3S4QA 1JKSA 3CJGA 5AUYA 4DEIA 3QD4A 5EQEA 2OBJA 2W99B 2VX3A 3H4JA 3A99A 2FSTX 4O1OA 4E4MA 4EYMA 2OF2A 4DH3A 3T9TA 5GINE 2A2AA 5DRDA 5E92A 4ONAA 2E9VA 2ITVA 2I1MA 2GNLA 3Q53A 2XP2A 3IQ7A 4XH6A 3PXFA 3DLZA 3GCQA 4I41A 4AE6A 4AZVA 3MB6A 1TKIA 4FV0A 3HDNA 3FXWA 5D11A 4G3GA 3A4PA 4AOJA 2W9FB 4FNZA 3EN6A 2XK4A 5HE3A 2C6MA 3RAHA 2C5OA 2Y4PA 3ZO3A 1W7HA 3BBTB 4XMOA 2PVNA 5IA2A 4EOOA 3TIYA 3VS1A 4Y5QA 5A4TA 3FI3A 4GYGA 3ZRKA 2YEXA 3U8WA 4A9UA 4CG8A 1JKLA 3WZEA 3G33A 3P9JA 3CIKA 3R7GA 4G34A 3NYOA 4I0RA 3F88A 4A4XA 4K9YA 4NYEA 1YKRA 5L6WL 4AW5A 4C8BA 3UPZA 1JLUE 3DAEA 3RKBA 4D0XA 4IADA 3I7CA 3QQJA 5EW3A 3MA3A 2OFVA 4QNAA 3NVMB 3RPVA 2QOQA 2JKKA 2XNBA 1H28A 3QZHA 4C37A 3DAJA 3I79A 4DCAA 3TKIA 4WBOA 1W82A 1ZRZA 3OD6X 3HV5A 2CCIA 4FGBA 1M52A 3R8VA 3BWJA 3Q9XA 3C4FA 1O9UA 3DT1A 3IW5A 4IX3A 1KE6A 3RJCA 2CKOA 4GFOA 2OZAB 1Q8WA 4XRLA 5CLPA 2IZTA 3E87A 3ZFYA 1JPAA 3GVUA 3UOLA 2OZAA 1NVRA 2R3MA 2JDSA 4GEOA 4QMWA 4HCTA 4N6ZA 5AUVA 2QO7A 4FL2A 4DTAA 1Z57A 5JSMA 3TZMA 4U79A 3FY0A 2R0UA 4EH7A 3KRLA 3U55A 1OPLA 4BBMA 3I0OA 3EN7A 5C27A 4FODA 3UODA 3DK7A 3Q5IA 4AGWA 4K33A 1BYGA 3A4OX 4W8EA 2Z8CA 4D4VA 1YHWA 1VR2A 3FMEA 1LP4A 4KKGA 4KUJA 2GNJA 4KBKA 4J1RA 3KN6A 4LGDA 3LZBA 3UDBA 1PMUA 3R0TA 3W33A 4P90A 5IQIA 4DT8A 4QMUA 4BIEA 4C3FA 3NNUA 3FMKA 4E6CA 5C8KA 2J4ZA 5LVOA 2O64A 2RG6A 2YISA 4RFMA 4OBOA 4XV2A 4BI0A 1XH7A 4DEAA 5CEMA 4W8DA 4F09A 3A7HA 3FKNA 2HAKA 3P08A 1W8CA 4FK3A 3QQGA 3UP7A 4O0VA 3RTPA 4X6QC 1NW1A 4NSTA 5IH5A 4G6LA 3KRRA 3MPMA 3EN9A 4FSZA 4O6LA 3F82A 4NTTA 4QP7A 2B52A 3F7WA 4DFZE 4IM0A 2J0JA 5M09A 4JX7A 5CALA 3OWPA 4RZWA 3S3IA 3VS5A 4ASDA 4P2KA 1VYWA 1PJKA 1UV5A 2VV9A 3DKFA 2VWZA 5T6KA 3DGKA 2ESMA 5FRIA 5BVFA 4JBPA 5HICA 5I5ZA 4DH8A 1PY5A 2UVYA 3PG1A 3EH9A 3KA0A 3FPMA 3PVUA 4YJOA 4EH5A 2QKWB 4F9CA 3LFFA 5EDRA 2CGUA 2G2FA 5D9HA 4H05A 3OWJA 4FTQA 4BCGA 4WHZA 2PZIA 4AT5A 1ZOHA 2VAGA 3AGMA 2WO6A 4LMUA 3MVMA 4BWPA 2VTNA 3BQRA 4A9TA 4PMSA 2WNTA 5J95A 3HDMA 2YJSA 3NGAA 4M69B 3ZFXA 4IX5A 2VD5A 3KY2A 3MESA 4DFNA 2IO6A 4M69A 3TN8A 1M7QA 4LRKA 4GYIA 3FQEA 2W1HA 3O71A 5EM6A 3GUBA 4FL3A 4FKQA 4HVDA 3UIXA 1OL7A 4AW0A 5J79A 4PPAA 1B39A 2UZOA 4B7TA 4MXOA 4FKGA 4O7NA 3SOCA 2JBPA 5L2TA 1F5QA 3COMA 2C5XA 4KSPA 5CX9A 1OIRA 4WIHA 4O96A 4I6HA 2IVSA 4DEGA 4LUDA 3K54A 4LMNA 3QYZA 3I60A 1ATPE 5M4UA 5J9LA 2BMCA 4EQMA 4DFUA 3LFAA 2EXMA 4FV6A 4FV9A 3FYJX 5B2KA 4U3ZA 4FYNA 4YZCA 4CT1A 2P33A 2XNPA 2ZV2A 4MF1A 1H1PA 4QQJA 3F3VA 3CPBA 3FMMA 5KZIA 3ZOSA 1DAWA 2A1AB 4FEXA 4ACCA 2C5YA 3JS2A 4I4FA 5KKRB 3F2AA 4BDDA 2X4ZA 4AGUA 1RQQA 4XOZA 2O65A 2XBJA 5C1QB 4BN1A 3TJDA 4E1ZA 1IRKA 4FTAA 4FNXA 3VBQA 3E8CA 3QRTA 2CGXA 2VTPA 4O0UA 4OTDA 1QPCA 4RX7A 2OI4X 5KZ0A 1CM8A 3LFBA 2OG8A 4ZXTA 3R8UA 4BCJA 5LCJA 4LG4A 2X8DA 4G6NA 3VVHA 2E2BA 3DDPA 5JGBA 4GJ3A 4KIOA 3UG2A 4ZZNA 3QQUA 3FMNA 5IPJA 2HWPA 4TT7A 4TYGA 2I7QA 3IDPA 4YZNA 2R3OA 4FZ7A 4F7LA 4IAIA 3W16A 4I93A 1Z9XA 5AWMA 3V5WA 4PMPA 5FEDA 4EOKA 3CGFA 4IM3A 4U42A 2XJ0A 5K5XA 1TQMA 3EQIA 3ELJA 2VTHA 4GKHA 4FTKA 3WZJA 2VWBA 3QC4A 3U4WA 4CFMA 4Y72A 4L9IA 3ZXTA 2O63A 1H25A 4ZMEA 2WIHA 5EFQA 4APCA 5DG5A 5KMLA 4CLIA 4Y5HA 3PA4A 1JBPE 3DA6A 3EIDA 4DAWA 1YDTE 3F66A 5I3OA 1PXJA 4QPAA 4QD6A 2EXEA 3VRZA 4IZYA 5G1XA 4DEBA 1S9IA 3KXZA 4ANOA 3AT2A 5IA0A 1KE8A 3VS0A 5HBEA 3S00A 2REIA 3QHWA 5EOLA 4RC2A 4W4XA 4BCIA 3R9HA 4F7SA 5IUGA 4FKIA 2VTMA 3DXQA 4BDAA 2GTNA 4DGMA 3LOKA 3PIXA 4K77A 4EKLA 4FIEA 5CT0A 5D10A 3ZCLA 1PMVA 4F6UA 4JLCA 4RZVA 5DR6A 3FKLA 2UZLA 4PX6A 2C1AA 4QP3A 5HG9A 5BVKA 3R21A 5AP7A 3I6UA 4G5PA 5E8UA 4A9SA 4IZAA 4Y8DA 4L43A 3OUKA 2OJJA 3MJ1A 2XIZA 3QWKA 3GEQA 2RL5A 4O91A 4E5WA 4GUEA 1XH6A 2UV2A 4OTWA 4FKVA 5F9EA 2YM4A 1OM1A 1GJOA 4D9UA 2Y8OA 4IC7A 5CXHA 5M4FA 4TL0A 3ID6C 3ZRMA 4CQGA 5CF4A 5KMNA 3NUAA 4F4PA 5HU3A 4M12A 4U81A 4AZFA 3TDVA 5AUWA 4EWHA 3RAIA 2PPQA 2B7AA 3KF7A 5FQDC 5HNGA 4EH8A 3KN5A 3ALOA 4FI1A 3CY2A 4U97A 1MP8A 1ZWSA 4JS8A 3PSBA 4LV5A 4QMOA 4QMPA 2DYLA 4JRVA 4RJ8A 3W32A 1UU7A 4FEVA 5A54A 2ITYA 3G9LX 1VJYA 3COKA 3HMNA 1UNHA 2NPQA 2E9NA 3Q96A 3ANRA 3Q5ZA 3RPOA 2XK6A 1U59A 5CNNA 3VIDA 4V0GB 3IS5A 4HGLA 1XH4A 4RX9A 2OXXA 5IQHA 2PVLA 4V0GA 4BI1A 4FZFB 4QYHA 3FUPA 2YJRA 3UOKA 1JVPP 4GUBA 4D1XA 2X1NA 1B38A 5CY3A 3ZRLA 5CEKA 1CSNA 5AR8A 3QKKA 4CCBA 4CV8A 5F20A 3LFSA 4CYIA 3FDNA 5HKMA 3AC2A 1UKHA 5KBQA 4IQ6A 5EYCA 2PTKA 4K18A 3TM0A 2Q83A 3NRMA 2BIYA 1PYXA 4IWQA 2ZJWA 2VZ6A 2PMLX 4ID7A 4X2JA 4A9RA 4AZTA 3SA0A 3EMGA 3SG8A 4QMVA 3WILA 4RBLA 3PDTA 3LCDA 4C58A 5A4QA 3F5UA 4ZEGA 2XNEA 4HGSA 4I23A 5CWZA 3EN4A 3OF0A 1JKKA 3GQLA 3QRJA 4WRSA 5A4LA 1YXUA 1NY3A 4JQ8A 5LCKA 3WIGA 1PHKA 5CYIA 2WQOA 1YI3A 4FSUA 4FIGA 4IIRA 4AN9A 2J7TA 3FAAA 4Z7GA 3LCTA 4AFEA 4M8TA 2R3IA 4A4LA 1H8FA 2UZUE 4KB8A 1ZMWA 4IDVA 4PL3A 4I6FA 1Z5MA 4UBAA 4BRXA 3KRWA 2ZM1A 2WEVA 5LWNA 1KWPA 5HEZA 3R9DA 3DDQA 3KRJA 4ZAUA 4RRVA 3PUPA 4FVRA 3D5UA 2P55A 4U3YA 3N9XA 3V5LA 3PPKA 4IC8A 2YERA 4OTIA 4X2NA 3VUDA 5IG1A 2PVYA 3L8XA 3KGAA 4FGRA 3PY1A 2JFMA 5LVLA 2XKDA 2UZWE 2Z7QA 3HP2A 1L3RE 3OOMA 4JL9A 4UWCA 1UWHA 2ZM3A 3MN3A 5B2LA 1TQPA 3PY3A 2JDRA 2ONLC 3BPRA 3MFRA 1H1RA 4NUSA 4QMNA 2PVMA 4W4YA 5G6VA 1CKPA 3ZLXA 2OKRA 4Q9SA 5BYLA 1XH5A 4NU1A 5HTBA 2HY81 1YW2A 4YJUA 5DBXA 4BTJA 3EQHA 1H00A 4ZS0A 4EORA 4EYJA 2O3PA 4RFZA 4O7RA 5AV3A 3QYWA 3ZS5A 4O84A 5BQ0A 2W1FA 3AMAA 4FTLA 4WUAA 4GT5A 3DJ5A 2GQGA 5I9WA 3UYTA 3DKCA 4M68A 4YHFA 3UIMA 1J1CA 5B7VA 4QP2A 1VZOA 3PSDA 5HE1A 5DOSA 1H26A 2QOHA 3GFEA 3GU5A 5E1EA 4YP8A 4A07A 2GHGA 4B4LA 4XNEA 3TACA 2R64A 5K0XA 3UVPA 2P2HA 4YO4A 3MVLA 3ZSHA 3R28A 4FV8A 5E8ZA 3VW6A 4NW5A 4EH6A 3II5A 4EKKA 3MV5A 2WMSA 4C4JA 2HZNA 4K1BA 3QQLA 3Q32A 4LGGA 3G51A 3TNIA 2XCHA 5BYYA 1ZZLA 3NYXA 2UZNA 1ZOGA 3DB8A 4YURA 2JDOA 3RPYA 4R1VA 2UZDA 4UALA 2ZVAA 5HZNA 3B2WA 1PYEA 2JKOA 3HP5A 4IDTA 4ZTNA 3BLQA 3ETAA 2OH0E 4MH7A 1FGKA 2OLCA 3QUEA 4EK4A 4FV7A 3K5VA 4MF0A 4OLIA 4BY9E 4HGEA 2X7OA 2BZIB 4O0TA 4X2KA 5L8JA 5GZ8A 3OXZA 4KBAA 3L9PA 5FDXA 2CGWA 2JKMA 3QCXA 4YBKA 2I40A 2A4LA 5HO6A 3UOHA 3AD5A 3LM0A 2Z02A 3UVRA 3O96A 3V5JA 3D5XA 4LFIA 3ORZA 4A06A 2ZAZA 4BIDA 3RNIA 4FTUA 5EDQA 4IJ9A 1ND4A 3R8LA 4ASZA 4IFGA
chains in the Genus database with same CATH superfamily
1SVGA 2XEYA 3QLGA 1YHSA 2R3NA 3BE2A 3CGOA 3I5NA 4HCUA 1OB3A 4L00A 3QTXA 4XEYA 5DH3A 2QD9A 4E20A 2WQEA 3HRBA 4FT9A 3SAYA 3G6HA 4F7NA 4MXCA 4LQMA 4ALVA 5CF5A 2WTIA 2XARA 5HG8A 2W5AA 5HHWA 1G5SA 4FC0A 2I6LA 3JVRA 4DE4A 2XA4A 4IWDA 1J7IA 1OZ1A 2WOUA 1YOMA 2X0QA 5A14A 5JEBA 3CLYA 4LM5A 3PE1A 2XK9A 4J99A 4BI2A 4A7CA 2ERKA 3SG9A 2XF0A 3A8XA 4RIOA 5HVYA 3CCNA 2ZB0A 2YLFA 4CFUA 4PNKA 1P5EA 3ALNA 3LFQA 5IUIA 3H30A 3HMPA 5FWKK 4HYUA 4FTRA 1PXKA 2HCKA 3NW7A 3ZC6A 2W4OA 3VS7A 3BL7A 2PU8A 1OL6A 1ZYDA 4PUZA 1F3MC 1GY3A 4G6OA 5CQUA 5AP3A 4BTMA 5FEEA 3MPTA 4FE2A 3ERKA 1FGIA 3C0HA 4TN6A 5AAGA 2V0DA 4QTAA 4CQEA 3O8PA 4M66A 5EG3A 5FM2A 2ZDTA 2PVJA 4H3QA 3I7BA 4UZHA 3E64A 4EWQA 5LMKA 4C3PA 3M1SA 2YIYA 5HESA 3TNHA 4CSVA 3UMXA 5LMAA 5A3XA 5EQPA 2H6DA 4GRBA 4S34A 3BYSA 3UBDA 5DGZA 3G15A 3D2KA 4EQUA 4L52A 3PWDA 4FKLA 4TYIA 4YC8A 4L68A 3TNQB 4D2SA 3NYNA 2XAMA 3EKNA 3GCUA 4ANSA 1XH9A 3DFCB 4J96A 3VUMA 5IZFA 4I5HA 3A7JA 5H9BA 2GCDA 3UMWA 5AAEA 4ACHA 1WBVA 3ZM4A 4LUEA 4AWIA 4IVCA 3QUPA 4GG5A 3GP0A 4YLLA 4AGDA 2J51A 5AV1A 2W06A 1H4LA 3QTIA 4N0SA 4DEEA 1SYKA 4J97A 3LE6A 2VTLA 2YABA 3EHAA 3H0YA 3O0GA 4QMXA 2W1DA 4D2VA 5CF8A 3ZBFA 2J0MB 4PF4A 5IU2A 3BV2A 3BX5A 5AAFA 2NRUA 4ENYA 3MY5A 2XKCA 4GIHA 5DIAA 1UWJA 2QLUA 5CANA 3DPKA 4L67A 3E5AA 4ZTHA 4FL1A 2WQNA 4HGTA 4PTEA 4OTFA 4QQCA 4DFXE 1SVHA 2VTAA 2WXVA 4I20A 3UE4A 4KKEA 5J1WA 4GCJA 3FZTA 4KS8A 4F70A 3ENHA 1GZNA 5GJGA 4ANLA 4FIFA 1OPJA 2ZOQA 3RCJA 2I0VA 4TY1A 5JFSA 3TTIA 3P7CA 3BYOA 3HGKA 3Q6UA 2OGVA 3M2WA 4AS0A 3ZSGA 2OJ9A 2YDKA 5AR3A 3LPBA 2B9IA 2OF4A 2F7EE 4BYIA 3O23A 3ZXZA 4KIQA 3ROCA 2WU7A 4AN2A 5HVJA 4ZSLA 2VWUA 4WSQA 5TR6A 3ET7A 2DUVA 1GIIA 3M42A 4ZTQA 4NKAA 4RLLA 1SMHA 4EEVA 2X9FA 3GB2A 1O6KA 1T45A 4TTHB 4D58A 5AUTA 4J71A 1H24A 2X8EA 4YLJA 5C8NA 2VU3A 3V6SA 3R73A 4F1TA 2GQSA 3Q4TA 4RVKA 3FXZA 4QMYA 3QGYA 2Y9QA 4F1MA 4JT3A 4Z55A 4M84A 4D0WA 1WBTA 2CLQA 4JDKA 4L3LA 4UXLA 4WO5A 4W9WA 3Q4CA 2QCSA 4G16A 3R22A 3FLNC 4W4WA 3KFAA 4UYAA 3F7ZA 4TXCA 3AC1A 4QPMA 3SXRA 3TTJA 1H27A 4FUXA 1ZY4A 1URWA 2WHBA 3FL5A 3W2SA 5GIOE 3BEAA 4QO9A 5KX8A 1OKZA 4WSYA 3N4TA 5JZNA 3AXWA 2JC6A 3AGLA 3MDYA 3ZUUA 4FG8A 3WBLA 3UQGA 2Y4IB 3R7EA 3EKKA 1UA2A 4Z16A 2JAMA 3VBTA 2B1PA 2JKQA 5I4NA 4IAKA 5HBHA 2RFNA 4JIKA 3CY3A 4D4YA 2XRUA 5AR7A 5I9UA 4QRCA 2JGZA 2V7OA 4YPDA 2JLDA 4CNHA 3W0MA 4X6RA 3CEKA 3OY1A 3TMOA 1LEZA 1WAKA 3BU6A 3TKUA 3ZEPA 1KV1A 3FC1X 3LCSA 4IACA 4ARKA 3NAXA 3ZC5A 4OAUC 2XRWA 2I0YA 1A9UA 3HNGA 3W2QA 2NP8A 3G2FA 3R71A 1QPDA 5ETCA 4I5CA 3RM6A 3QWJA 1J7UA 4LRJA 4NT4A 2IVTA 3LLTA 4CKIA 5KKRC 2XKFA 4BIBA 3BYUA 3OWLA 3R01A 4E5AX 2CSNA 2C6IA 2QO2A 4FICA 2AC5A 1OGUA 4PMMA 3LFCA 5EI2A 3POZA 5C4KA 5CSWA 4UMUA 1XJDA 4C3RA 2YCFA 4QP6A 5C9CA 1ZY5A 3UNZA 1H07A 4RQKA 3QD0A 2UW6A 3MH1A 5J7BA 4YO6A 4FOCA 3EQRA 4O22A 1VEBA 1UU8A 4FVQA 2WU6A 4FKPA 2YAAA 5GJDA 4ZJVA 4HCVA 3ORKA 3AQVA 1AQ1A 3U51A 4JG8A 2VO0A 5CEQA 2V7AA 2VUWA 2OWBA 3HRCA 3K3IA 5BVOA 3AMYA 3W0NA 3V3VA 2CN5A 4GU9A 2YM6A 3C13A 4QQ5A 5TO8A 2Y0AA 4X2GA 5JH6A 4LI5A 2PWLA 2QHMA 4FSNA 3QX4A 4KKHA 3PXRA 3SV0A 4XUFA 5AP1A 1X8BA 4QTCA 2UW0A 4YBJA 4CRSA 2B53A 3O7LB 3KRXA 2P2IA 2PUUA 3RBWA 4HZRA 5HD4A 4R77A 5IQFA 5FM3A 3O17A 2BRNA 3NR9A 3R63A 3UG1A 1OL5A 3ORTA 4YTIA 2PUNA 3CS9A 2KULA 2QOOA 5FUTA 4C4EA 3WF9A 3VQUA 4K2RA 3PLAE 5CU4A 1U5RA 2CN8A 5K9IA 4JMQA 4XLIA 3BGPA 1G3NA 1R1WA 3P7AA 3A7GA 2YLEA 3NUYA 4G2FA 4UWBA 3W0RA 2HZIA 3GCVA 4YNOA 2B0QA 4IZ7A 2C6LA 4FT3A 4PY1A 4AFJA 4G31A 4M13A 4B8MA 2PMNX 5KNJA 4L8MA 3I1AA 5F95A 2JDTA 3FC2A 1BI7A 3QCSA 3P23A 3QHRA 3DQXA 1ZAOA 4RWIA 5IQDA 1M17A 5M06A 3NCGA 3OWKA 4XV3A 1EH4A 4G3DA 3S0OA 4FTNA 5CAQA 2BROA 1SNXA 2JFLA 3MH2A 5IQAA 1DI8A 1OUKA 3PXQA 2IW9A 3SHEA 2UZVA 4ZK5A 3TV7A 3O8TA 5GIPE 3IDCA 3GU4A 3HKOA 3ZUTA 2BKZA 2YDIA 5DA3A 3LMHA 3D15A 3HMOA 1JNKA 4BICA 1HCLA 3SOAA 4ALUA 3A2CA 3KMUA 2XH5A 4WG5A 3RMFA 4PTCA 4ERWA 5L6PA 3U6HA 3WE8A 4PWNA 2BFYA 3OBGA 1Q8TA 3R1QA 1MRVA 4XP2A 4EUTA 2XM8A 3PPJA 4FSTA 3JYAA 5CSHA 5ANKA 1TVOA 3S1HA 4O81A 3E88A 3I4BA 2J2IB 1YRPA 5L6OA 2WQBA 4FEWA 4FSRA 2JIVA 5IDPA 3C7QA 4BZOA 2FH9A 4MX9A 1P4FA 3UO6A 4BKZA 4MQ1A 3BQCA 3Q4ZA 4E4NA 3EYGA 3QX2A 5M4IA 5AP4A 3DXPA 4YMJA 4RJ6A 3UDZA 4BBEA 2R3JA 4FBXA 4C62A 4Z7HA 2H34A 4JQEA 1R0PA 3HVCA 3FI4A 5K4JA 5KHXA 2F2CB 2VTOA 3LCOA 3NYVA 3R04A 5M44A 4XP0A 4DFLA 1J91A 4U43A 3R2YA 4E26A 5JFWA 2XAOA 4IB3A 2YDJA 3F3WA 4DC2A 4W9XA 4JBVA 4KINA 5L8KA 2VWWA 2IN6A 4YTCA 1QCFA 3LMIA 3VC4A 4FUYA 2UZTA 3HV3A 3VULA 3CD3A 4WBBB 3CE3A 4UB7A 3EFWA 3QD2B 2CHLA 3D83A 5TKDA 4E3CA 3GXLA 3UQCA 4RT7A 3HEGA 4EONA 5HE2A 2ITTA 4P5ZA 4C4FA 4K11A 1J7LA 2R4BA 4OT5A 5BX0A 4YNEA 4M14A 5E8YA 4IFCA 3ZYAA 4A4OA 4AZEA 4UZDA 4PTGA 4HPTE 4E8AA 2PULA 2CGVA 2VTQA 4F6WA 4AT4A 4CFWA 1IR3A 4XS2A 5AUUA 3A60A 3NFGB 4JR3A 3DTCA 5ANEA 2GNIA 2OU7A 5IISA 3PA3A 4M97A 4B99A 2ITXA 3BU3A 4YJPA 2OIDA 3ZHPC 2ZM4A 3AC8A 4F0GA 2QOBA 3MVHA 1AGWA 1J3HA 1YVJA 2BAJA 1Y8YA 4YPSA 4O0YA 1DM2A 5C8MA 1YI4A 4IXPA 1CMKE 5A6NA 3DTWA 3LXKA 5JQ8A 1KUTA 2YM8A 5K3YA 2BKKA 4R5YA 4RWLA 1GNGA 3RWPA 4FT0A 3NUXA 5E8XA 3BHYA 2EB2A 2R2PA 2ZV8A 4L3PA 2J6MA 2WTDA 3BGZA 3Q4UA 4O21A 3NLBA 3FKOA 5HD7A 4F9BA 4WUNA 3UIUA 3MVJA 2PE2A 2VTSA 5CS6A 4NEUA 3EFKA 2PVFA 2EUFB 1XR1A 2VWVA 3EFLA 3NFFB 4O7ZA 4BDEA 5IQBA 2AUHA 2BRHA 5DMZA 4CVAA 3FLQA 2FSLX 4U41A 1OITA 3UPXA 4YJSA 3DNDA 3HA8A 3QZGA 5ANIA 4BGHA 4C2WA 3KULB 2SRCA 3D9VA 3K3JA 4KA3A 3IECA 4PDSA 5CT7A 4XG9A 3KULA 3QA0A 5AIKA 4HYIA 1U54B 4IBMA 5EDPA 3V8TA 4YZDA 2GTMA 2JIIA 2GNHA 1U54A 2ACXA 2QHNA 3GU6A 3FMJA 4FF8A 5DHJA 3O5AA 3WF7A 4LL5A 1ZZ2A 3COHA 2J50A 2JITA 4EL9A 3LFNA 3A8WA 3FJQE 4CLJA 3LHJA 3H0ZA 4EHEA 5EYDA 4PP9A 4F99A 4R78A 2X7GA 3BYMA 3AC5A 3F9NA 3HL7A 3JVSA 3MI9A 2WTCA 3JY9A 4QNYA 3V6RA 4ZY5A 3UOJA 1Q97A 4DLIA 2HZ4A 4N6YA 3ZUVA 3L9LA 4CGAA 1FINA 2YA9A 1P4OA 4LOOA 4X0MA 2ITOA 4DG2E 4EOQA 2A98A 4ZS4A 3IW7A 4QP4A 2OXDA 4BDBA 3GC9A 2VTRA 5M51A 3EQBA 2UW5A 3VBVA 5F4NA 3CKXA 4C38A 4I0SA 2WEIA 1JKTA 3QFVA 4C4GA 3IW6A 3WF5A 3UVQA 3MIAA 4E5BA 4HVHA 4O38A 3TZ9A 2X39A 3WYXA 4C4HA 1Q41A 1APME 5H3QA 5BYZA 2W1EA 2XJ1A 1E9HA 1UU9A 4NWMA 1GIHA 1IG1A 3P78A 3MPAA 2VO3A 5JRSA 2AEGA 5L2SA 2WTWA 3NEWA 4I0TA 4XRJA 5HG5A 1BLXA 3B2TA 4EUUA 1W0XC 2HZ0A 3QKLA 3VBWA 1WBSA 4WT6A 5DYJA 1YXXA 3UO5A 2BDWA 4WOVA 3PLSA 4F0IA 2GS2A 4RJ3A 4RPVA 3R02A 4RIWB 2Z7SA 3HUCA 5AP6A 3RPSA 1REJA 5I9YA 1BMKA 3PA5A 4RIWA 3UQFA 4BZDA 4RIXB 4HVGA 4V04A 2LGCA 5IF1A 5KMOA 4Q9ZA 2VNWA 3Q9ZA 4RIXA 5AM6A 5DT3A 2FO0A 1OIYA 3WI6A 3QA8A 3DJ7A 4ZLZA 4YLKA 3NZ0A 4DG0E 5LMBA 3FYKX 4LV8A 4Q5HA 3D14A 4BL1A 3L8VA 4GG7A 4GV1A 3P0MA 3HRFA 4XCUA 1A06A 3ZDIA 1Q99A 4JDJA 4NJ3A 3KCKA 3PP1A 4M3QA 4DTBA 4RC4A 4XV1A 5LMKC 4ZSGA 5FTGA 3ZONA 1ZYCA 2G9XA 3I6WA 3FZOA 3QQHA 3UP2A 5D7AA 4RWKA 2DS1A 2P3GX 5B0XA 4EH3A 2QR7A 4MYGA 3FMLA 3L1SA 4PQNA 4II5A 2BVAA 4F7JA 2YIRA 2BRGA 2O0UA 3NUPA 4TRLA 4YJRA 4J8NA 3VS2A 2GFSA 3DJ6A 2C6TA 5DWRA 4PP7A 2IEWA 1YXSA 3G6GA 3A61A 4FKSA 1S9JA 3QKMA 4IWOA 4FSMA 3T9IA 2HK5A 4FA2A 3MFSA 3AG9A 2XNOA 3HLLA 5AA8A 4MWHA 5TE0A 4FSYA 4KWPA 4D5HA 4C0TA 2OZOA 5AV4A 1OGYA 2QU5A 4DHJA 2IJMA 3H9RA 1TZDA 2F9GA 3A7IA 4QP1A 4R5SA 4E6AA 4USFA 3KVWA 4O1PA 2IF8A 3WF8A 5JKGA 2Z2WA 4L7FA 5AX9A 3EOCA 4Y85A 3OZ6A 5BV3A 4BDHA 2XNGA 3C4XA 3F61A 4LL0A 3RINA 5AEPA 2B9FA 4O7WA 4ZOGA 3UIBA 4NCTA 3BV3A 3PYYA 3V04A 4BWXA 2FGIA 3WIKA 4FG9A 5IA5A 4CZTA 4F9YA 2YACA 3OG7A 2O5KA 3IOKA 5HIDA 2QONA 2XIXA 2R7BA 3VAPA 4UMRA 2FA2A 4Q2AA 3DOGA 4NH1A 4ZY6A 3OXTA 2C68A 4DTKA 2XANA 3KMWA 3C1XA 2KTYA 3RHXA 3O2MA 3W55A 5FDPA 1YOLA 1YDSE 1YOJA 3IGOA 4WNPA 4X2FA 3AD6A 4MXZA 5BMMA 4AG8A 1IAJA 4E73A 3PJ3A 3KF4A 3MA6A 4EOSA 2HENA 2PSQA 2WD1A 3QTUA 1ZMUA 1DAYA 2OO8X 4V05A 4TWPA 3QRKA 2C3LA 5E7RA 5ANJA 2QR8A 2CNVA 3AKJA 4KABA 2HW6A 5CXZA 2QG5A 2W0JA 3DBFA 4N4SA 2VWXA 1IAHA 3DU8A 1R78A 5BVNA 5AMNA 5F94A 2IZUA 4NM5A 4V01A 5J5SA 4GS6A 4JRNA 3LKMA 3KK9A 2W4JA 4HVSA 5AV2A 4F63A 5EYKA 3HV4A 2IZSA 1M2QA 4FIHA 3GU7A 4L7SA 3VUIA 4F08A 4RG0A 5CZHA 3V51A 4AAYA 5IDNA 1WCCA 3KB7A 4D1ZA 3TZ8A 3TDWA 2WTVA 2C0OA 4RLKA 5HORA 5E91A 3UZPA 5CSVA 2BRBA 4B9DA 1UVRA 2C0IA 3OCGA 3VRYA 1QPJA 4BF2A 1PXNA 4UMPA 5LJJA 4I6QA 3C4WA 4UV0A 4YTHA 4FTOA 5DT4A 1M14A 2Y4IC 4QP9A 3ACJA 3VF8A 4G3EA 5CQWA 3W2RA 3OW3A 2HY0A 2E9OA 2WMTA 3P5JC 3RCDA 4ORKA 4OTGA 3VW8A 2R3GA 3KCFA 4WKQA 2BPMA 4CMOA 4D4RA 5K5NA 1FQ1B 3QL8A 1I44A 1OPKA 1FVTA 4WG3A 3TJCA 4ZSEA 2Y7JA 4EH4A 3RK5A 3W2PA 3H9FA 4AZSA 3W0SA 4RA5A 2VTTA 2O2UA 3QBNA 3JR1A 4CZUA 3TUDA 4BKJA 3QGWA 5BUEA 2CNQA 4QTEA 2QU6A 3WZDA 2YWVA 2ITUA 3HZTA 2EXCX 4EQCA 1V0BA 3RAWA 4EOMA 3POOA 4F64A 4ZTLA 3E8DA 2ZYBA 3AC3A 4FKOA 1Y91A 4I6BA 1A48A 2VGPA 1Y8GA 4MQ2A 1SZMA 5DR9A 1MRUA 1Q3DA 3R9NA 3OUNB 2WELA 3BWFA 2C1BA 1ZYJA 3VUHA 4NM7A 3ZZEA 3T8OA 5C4LA 2VTJA 3GC8A 1TFFA 3E3PA 5HLWA 3KKVA 4O27B 2UZBA 4ITIA 1M2PA 3MTLA 2NYAA 3V5TA 4OTQA 4JBOA 3FLZA 1JAMA 4H36A 2OH4A 5AV0A 4PDYA 4MTAA 4MK0A 1UNGA 2J5FA 5EHOA 2X2MA 2PYWA 2BZJA 2GDOA 5JT2A 2YZAA 3C0GA 3CQWA 3PFQA 2QO9A 3GT8A 4YZ9A 3R00A 2Y6MA 5FP5A 4EBWA 1OIUA 2RSVA 1WBOA 4KD1A 5IMXA 5CU2A 4EI4A 5HX8A 3HAMA 4C02A 4N70A 4KAOA 5HCYA 2JIUA 5GJFA 4TYJA 1OKVA 5H8BA 4YZBA 2RFSA 1ZXEA 3FQHA 4G17A 2C3KA 5I3RA 4D2TA 4XG3A 3NVKI 3FLYA 3FI8A 3FZPA 2R3FA 1NVQA 4CT2A 3U6JA 3K5UA 2PE0A 2W9ZB 2QOLA 2PVKA 4ZZOA 5AADA 3NX8A 1XHAA 2BTRA 5DPVA 1REKA 3PIZA 3UTOA 3D4QA 5IA1A 4AA0A 5EHYA 4RQVA 3VO3A 1YXTA 4C4IA 1PXLA 2JDVA 4LGHA 4S2ZA 3ZLYA 4ZLOA 3F2NA 2Q0NA 3KC3A 3QF9A 5T68A 4CTBA 5ANGA 4EHGA 2BAQA 3PP0A 1H1SA 2RIOA 4MAOA 4FV5A 4YSJA 3MY1A 4BDIA 4ZZMA 3W0OA 3W2OA 3E63A 3FV8A 1CKIA 2VO6A 4XJ0A 4MKCA 3O51A 1LR4A 5CSXA 3R1NA 2Q0BA 5DEYA 1QPEA 4XBUA 2QNJA 1U5QA 2J90A 3EL8A 4CKJA 3OT3A 3E3BX 4GVAA 2XM9A 2UW4A 3U87A 3ZLWA 4GH2A 3CKWA 3TNWA 4AA4A 3PXZA 4EJNA 1HCKA 2J0LA 2A19B 3G9NA 4GK3A 2CNUA 2H96A 1PRYA 4GKIA 3ULZA 2ZV9A 3WF6A 3MWUA 5DLSA 3NSZA 3AT3A 3S2PA 4AU8A 3W0QA 4XP3A 4QEBA 3L8PA 3KL8A 4EHVA 3DB6A 4USDA 5BPYA 3PVGA 3U9NA 2VNYA 2VTIA 3DNEA 4IVBA 3Q04A 4AOIA 4IWPA 3HV6A 5CTPA 4G9CA 2IW8A 3REPA 5E4HA 4QYYA 3O50A 5HNIX 2HIWA 3OCBA 4CV9A 2GHLA 2XEZA 3CTQA 3CXWA 4O7LA 2H9VA 4ACGA 4EK8A 1LEWA 2ZFYA 1NT2A 2VX0A 2XK3A 4D2WA 3TIZA 2X7FA 3IW8A 5CI6A 3MB7A 4O4EA 2X0GA 3EZRA 4ZY4A 2YCRA 4HYHA 4ZTRA 3SX9A 4BCNA 4ZSAA 3PXYA 4D4SA 4DCEA 5JGAA 3ORIA 3QRIA 4AF3A 4L3JA 3RHKA 1W98A 4ZP5A 3FE3A 3UNJA 4WD5A 1B6CB 5C26A 4M0ZA 3BHVA 4RA4A 4E7WA 5E8WA 4CYJA 3TEIA 5DRBA 1BUHA 4F9WA 3TG1A 4FX3A 4F0FA 3ENMA 5L8LA 5AUZA 3LJ0A 3PZHA 4DF3A 1YI6A 4DT9A 4MVFA 3R1SA 4MBLA 4IAAA 4RWJA 4CFFA 4EK3A 4BR3A 1RJBA 3OMVA 4WG4A 5ETAA 4EC9A 4AT3A 4HW7A 3ODYX 4AP7A 1SNUA 3VJOA 3PSCA 3PRIA 4C7TA 5LOHA 1CKJA 4MXAA 4CFVA 4EJ7A 5HBJA 5CU3A 3DLSA 5AP0A 3BE9A 1Q8ZA 5EM7A 1LUFA 3GQIA 3FWQA 2JEDA 3FSKA 1YHVA 3BYVA 4P5QA 5E8SA 2A0CX 4KNBA 3NNXA 3SKCA 3LQ3A 2ITWA 2YCQA 3LMGA 3KXXA 4QMMA 1BKXA 2ONLA 4DLJA 4DINA 5IQCA 2CKPA 2PZPA 3VHEA 5EHLA 5CAPA 3FZ1A 1XWSA 1V1KA 4UXQA 2IVUA 4AX8A 4YU2A 1Q61A 2FB8A 2R3RA 3CTHA 5BNJA 2BHEA 2VN9A 4ALWA 1IA8A 1GOLA 1BL7A 4Q5EA 5D7VA 5M4CA 3TL8A 2IW6A 1VYZA 3S95A 3FBVA 4ENXA 2J5EA 4IE9A 3UDTA 3DKGA 5A4EA 3IDBA 5C03A 3FLWA 3GCPA 5CU0A 2ZDUA 1WBNA 1OL2A 4EC8A 2EVAA 4ACMA 4AUAA 4Y95A 3CC6A 2X4FA 3DK6A 4JG6A 3OFMA 2C6KA 4BCFA 4C57A 4QTDA 2QKRA 1BX6A 1K3AA 3QAME 2ZV7A 2JD5A 2OXYA 4DITA 4ASXA 5AP2A 3C4EA 2C5NA 5K4IA 3H9OA 2C47A 2Z7RA 4FKWA 3KIOC 3CTJA 3EZVA 4OUCA 4ANNA 4DHZA 3NIEA 2ETMA 5J87A 3THBA 4PPBA 4BDGA 3VJNA 3D2IA 4NM0A 5M57A 3ZM9A 2WPAA 4BGGA 4NZWB 4TWNA 5EM5A 2XYUA 2BALA 2DQ7X 2ITNA 3ACKA 4JR7A 5EM8A 4U45A 5EKNA 2OIBA 4ZMFA 2BHHA 1YDRE 3F6XA 2LAVA 3GFWA 4TW9A 5FD2A 3RK7A 2WIPA 1WVWA 4NL0A 5CASA 3MYGA 4L44A 2WTKB 3ORMA 3DBDA 3MSSA 1K2PA 4J98A 3OEZA 4NW6A 3VS6A 4YHJA 5GHVA 5FXRA 5IEXA 5IQEA 2BDJA 2R7IA 4E93A 1G8SA 4R8QA 3CJFA 3JPVA 4X3FB 2Z7LA 2YITA 2BR1A 2P4IA 3N51A 2R3KA 3QZFA 4EZ7A 5CAUA 4X3FA 1PF8A 1RDQE 1U4DA 3NNWA 3PE2A 2WAJA 4K0YA 5DEWA 5AA9A 3LFDA 4PV0A 3R7YA 4DGGA 3VF9A 4WA9A 1RE8A 3D94A 4F9AA 3R7VA 3IW4A 3R7IA 1Q4LA 4QYGA 4A9YA 4BB4A 5TF9A 3N4VA 3G0FA 4RSSA 3ITZA 3BELA 4Z9LA 1PKGA 3IGGA 4L45A 3C9WA 2WMBA 2XBAA 4AA5A 1Q62A 1OKYA 3OOGA 2GHMA 2XB7A 4XG2A 4XYFA 5CI7A 1VLRA 4R1YA 4S30A 4NTSA 2GFCA 3ZBXA 3RM7A 3E8EA 4G3CA 1FBNA 4IMYA 5IEVA 5H2UA 2B9HA 1OI9A 2GMXA 3ORXA 3F3UA 4XG4A 4R7HA 4I3ZA 3DS6A 4AOTA 2GS7A 3MJ2A 3PJ8A 4JI9A 4Y83A 4BCHA 3NIZA 5ITAA 1FVRA 2A27A 3PUFC 3BI6A 2JBOA 3MS9A 4OTPA 3DZOA 1Q3WA 2CLXA 3DFAA 5EKOA 4DFBA 1E1VA 4H1MA 4F78A 4RC3A 1XKKA 2QI8A 3OP5A 3W0PA 1YWRA 3EQPA 1GIJA 4O82A 4EZ3A 3C5UA 4H1JA 4U7ZA 5E1SA 5AR2A 3RGFA 1WVYA 3PJ2A 1XBCA 2WMAA 3SC1A 2XIKA 3RWQA 3ORNA 3NNVA 2WZJA 4P7EA 3Q52A 2ZB1A 1Q5KA 3MY0A 1FMOE 1XH8A 5DE2A 4QYEA 3NPCA 4ANQA 4L46A 1JSVA 2RF9A 2UZEA 2YIQA 3DBQA 5CENA 3G90X 4K8AA 2WKMA 2G01A 2FYSA 2G15A 4QMZA 5TT7A 1Q8UA 4ITHA 1YQJA 3BZ3A 5BVWA 4EH2A 2J0IA 2ZMCA 3L8SA 5J8IA 1Q8YA 4R3CA 4HOKA 3E8NA 5KE0A 4O7SA 3BL9A 1WBPA 3BLAA 5ACBC 2VWIA 5IA4A 4ZLYA 3UZRA 3FEGA 5BVDA 1IASA 3TNPC 3VWAA 1ZLTA 5M55A 5LARA 2NO3A 3GC0A 4ACDA 1MRYA 2VGOA 3WARA 4HYSA 3EWHA 2QVSE 4FTMA 1Y6BA 3I5ZA 2HELA 4NCTC 5J9YA 3C51A 4JXFA 5CF6A 1OBDA 2PY3A 3Q9WA 3LJ1A 3ZO1A 1G8AA 5KUPA 2J9MA 5FLFA 4EH9A 4R3PA 3P4KA 5E8VA 1OMWA 5F1ZA 5C01A 5KMJA 3C5IA 3IO7A 2PL0A 5EI8A 5FXSA 3MH3A 4TYEA 2BCJA 4LYNA 5GZ9A 1E1XA 4XLVA 5JFVA 5HNBA 4QMSA 3I0QA 5FBNC 5LVNA 2F7XE 4LOPA 3BLRA 2XUUA 2PVRA 3QRUA 4DHFA 2PUIA 4XG7A 2C69A 5CVGA 4CD0A 3NUSA 4WNMA 2FSMX 4FK6A 4FV1A 4GW8A 2B9JA 4F1OA 2QLQA 4KIKB 4R7BA 2FSOX 2WTJA 3WOWA 3ZLSA 2XYNA 2G1TA 3KQ7A 3RI1A 4WNOA 4KIKA 4XBRA 4O7YA 3AMBA 4YJVA 1GZKA 4D55A 3H10A 1W83A 4RVTA 3QXPA 4ZTSA 4TYHB 3DQWA 5T3QA 1M7NA 3BHTA 4CMUA 3B8RA 1BL6A 2UW7A 5B2MA 5BUJA 5CZIA 4TYHA 2WMUA 3BRBA 4I21A 3FY2A 3LJ2A 3PIYA 1NA7A 4R6VA 1RW8A 3QC9A 4FNYA 2Z60A 4RVMA 4FVPA 5L3AA 5M08A 3ATTA 4PDPA 5JN2A 3UDSA