5HD4A

Dissecting therapeutic resistance to erk inhibition rat wild type sch772984 in complex with (3r)-1-(2-oxo-2-{4-[4-(pyrimidin-2-yl)phenyl]piperazin-1-yl}ethyl)-n-[3-(pyridin-4-yl)-2h-indazol-5-yl]pyrrolidine-3-carboxamide
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
347
structure length
347
Chain Sequence
PEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Dissecting Therapeutic Resistance to ERK Inhibition.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 117
structure length 347
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2016-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5hd4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5hd4A01
3DLZA 5HVKA 4MWIA 5AWMA 1XH4A 2JDVA 4J53A 5AR2A 4BICA 3LM0A 3FI4A 2OLCA 1W7HA 2E9NA 5AV1A 5CF4A 2FUMA 3SDJA 3PVUA 4CV8A 1XO2B 4AFJA 4O27B 2FSTX 2OWBA 2B9JA 5JK3A 3AMYA 4ZY4A 3W2OA 4F7NA 3KMUA 2XK9A 3HP5A 3KRJA 4NTTA 4WG3A 3T3VA 2V55A 4FV9A 4Y73A 5AUWA 4FNWA 5BUIA 3KVWA 3NSZA 2QO7A 4C38A 5ETAA 3FXXA 2BIYA 3QTUA 3SLSA 5IU2A 2WOUA 3VJOA 3U6HA 5A4TA 4QQTA 4PL3A 3UVQA 3QC4A 4ALWA 1R3CA 3GU6A 2PMNX 2YFXA 4TKSA 4FT7A 4F9AA 4CFNA 5L2IA 1B38A 2FGIA 5M44A 5TT7A 4ASDA 2OU7A 4BDCA 2Y4IC 5DNRA 4GT5A 4J97A 4EK5A 2Z7QA 3P08A 5HVYA 4G6LA 3R2YA 3ZU7A 5JT2A 3UG1A 1XH8A 4DH7A 4FEXA 5L6OA 3ZSGA 4ZSLA 4FV6A 2A2AA 4BCHA 2B4SB 4AZFA 3VBWA 3PG1A 4JR7A 2GHLA 4G9RA 3SRVA 3DBCA 3EQCA 5JN2A 3EQHA 2C5VA 3W2QA 2JFLA 4KB8A 5DT3A 2JAVA 4P5QA 5ANEA 2X39A 2BTRA 4IM2A 3MB7A 3VBYA 3F61A 4AA0A 4KSPA 4CTBA 4F0IA 3OFMA 4I5CA 4KAOA 2EVAA 4D5KA 2X7FA 2FVDA 5ITAA 5M08A 2ZMCA 3QZFA 3UPXA 1RW8A 4XCUA 5CEMA 2YLFA 3AG9A 5D1JA 4DFUA 3FYJX 1A9UA 3TWJA 3FMKA 3ZO1A 4JDKA 1H01A 4TYHA 5A9UA 3VQUA 4O6LA 3N4UA 2WHBA 3PXZA 4QP9A 4NYEA 4RFYA 4JXFA 3CCNA 4X2KA 3MGYA 4O7LA 5FXQA 3L8SA 1KE5A 1Q97A 3A4OX 3A99A 3PIZA 2PZIA 5F1ZA 4BF2A 1G8AA 3NYNA 4U79A 3P78A 3NGAA 2HY0A 4YZMA 3R2BA 4LG4A 5M4IA 5JFXA 4MXYA 2QNJA 3CY2A 2BFXA 3FZOA 4MF0A 4WRSA 3VS3A 2IG7A 2XCHA 5HE2A 4PX6A 1U54A 2RG5A 3V8WA 3V8TA 5IQCA 4G3GA 3FJQE 3HAVA 4EZ5A 1KE6A 3QTRA 2WTJA 3LKMA 5AX9A 3V5JA 4P90A 3QA0A 4YZ9A 4PNKA 3HECA 3DLSA 3D7ZA 2BZHB 4L00A 2XM9A 3F3WA 4L9IA 2R0IA 1BL7A 2R0UA 3A7IA 4QMWA 4QP2A 1GZKA 5J8IA 4F0FA 5HESA 3PFQA 4L7SA 2WTKB 1JKKA 2PY3A 4FIIA 1W83A 5E92A 1CM8A 4PL4A 3D83A 3AXWA 3FMJA 4JVGA 4XG6A 2BKZA 3BPRA 4C4GA 3CGOA 1CDKA 2JIVA 5E8SA 2IW8A 3H30A 4TYGA 4M84A 3BGZA 3N4TA 3MY1A 2X6DA 1URWA 3AT4A 1PKDA 2O63A 3V51A 3QQGA 1SVGA 3W16A 4PDYA 1IA8A 4X2GA 4JBOA 2DUVA 3KXGA 3Q4ZA 4O0UA 5IA3A 4DE4A 1AGWA 1Y57A 3ZONA 4NL0A 4MQ1A 1BL6A 3UBDA 1W82A 3LFQA 3A62A 1F0QA 4Y46A 2WXVA 3DTCA 4ZMFA 1ZYLA 2XJ2A 3GCSA 4TWPA 4BCMA 3PXFA 4HGLA 5M4FA 2V5QA 2WIHA 2UUEA 5CASA 1KOBA 1H08A 1OL7A 3R30A 1VYZA 4M66A 2GNHA 2PVHA 4GVJA 1ZOEA 4CVAA 3UO5A 1CKIA 2XKCA 4CEGA 4L8MA 2WMBA 3IKAA 4XOZA 3FQEA 3I0OA 5HHWA 1BLXA 2KULA 4FK3A 1ATPE 5LMKC 1FGKA 3OY3A 3Q3BA 3P5KA 3ZRKA 1TQIA 1W0XC 1DS5A 2O5KA 3G6HA 3L1SA 3R7GA 3VNTA 3MSSA 4XG2A 4HPUE 5I4NA 1PXPA 2F7XE 4FT0A 4IVCA 2R7BA 2BR1A 5FEQA 4Y72A 3TTJA 2PVJA 4UYNA 1SMHA 2C1AA 5AP7A 1YXXA 3G2FA 4FTCA 4S33A 2CJMA 4XJ0A 3TDWA 3TNQB 3AC8A 2WTWA 4PWNA 3UYTA 4UXQA 4ZXTA 4N0SA 4MBJA 4ZS4A 2F49A 4QT1A 4Z16A 3MS9A 3QX4A 4YJPA 4X3FA 3ZLWA 5LWMA 3O96A 2YM7A 2W1IA 5EYMA 3LQ5A 5H8GA 4BDFA 2WEVA 4E1ZA 3UZTA 3QUEA 5HLWA 2VWBA 2BVAA 2VWYA 3GBZA 4BKZA 4CYIA 3LCOA 2J2IB 4K9YA 4S2ZA 3NUAA 2R3MA 2JBOA 5EOBA 3IQ7A 5EI6A 2UZDA 4FOBA 4I20A 4O1OA 5AP2A 3UC4A 3PP0A 3NW6A 4B8MA 4C3PA 5DT4A 4ANBA 3P7CA 4AA4A 4CFXA 3FI3A 4I6QA 4RFZA 5ICPA 5CY3A 1ZY4A 3GGFA 4ZTSA 5C4LA 4BFMA 5HG5A 3HV5A 3DCVA 1FPUA 4L7FA 3HRFA 3ZFXA 3O8TA 3U87A 2UW4A 2XYNA 3F3ZA 3PP1A 4NFMA 3ORLA 2CPKE 3SA0A 3HMPA 3AD4A 5J9LA 3KK8A 4QMTA 2VTSA 4UYAA 1PXIA 4A7CA 4D9TA 2O2UA 3QD2B 4RT7A 4ZZNA 2J4ZA 5IA0A 3B8QA 5J9YA 3R9RA 2PYWA 2ZM1A 2G01A 3B2TA 4QMMA 3ZFMA 4FKVA 2F7ZE 3VJNA 4E20A 5EKOA 3SXRA 4DG0E 3QCSA 4IACA 4LL0A 4GRBA 4XV1A 4C3RA 2EXMA 3QC9A 4QP6A 3UQCA 4Z9LA 3Q04A 3FLYA 4BCNA 1DI8A 4KKEA 4ZSJA 4CKIA 2J51A 3BBWA 5IQHA 4I0RA 4KIKB 3QA8A 4L45A 1ZAOA 2PPQA 4O0YA 2YITA 3RALA 3SVVA 4FNXA 3RTPA 4YZNA 2J0LA 2QO9A 3HYHA 3DB8A 3JYAA 3IW5A 2X4ZA 3NNXA 1YW2A 2WPAA 3GFWA 1ZYDA 3Q2MA 4PDOA 5AA8A 5I9VA 5IQDA 1ZYSA 5AR5A 3FV8A 4D0XA 4LQMA 1OPKA 3RWPA 4MF1A 4L44A 3UQGA 4RIYB 3DKGA 5AV0A 3VF9A 2V62A 2OW3A 3L9LA 1Y8GA 2P3GX 2WELA 1H28A 4QYFA 4D1XA 5BUJA 4FV8A 2WMWA 3CE3A 3U51A 3V8SA 2XRWA 3ALNA 4TPTA 2O3PA 4I23A 4YTFA 4RLKA 4FKPA 3VUTA 1UNLA 3QU0A 5IA5A 3KREA 4BZDA 2R3LA 2WMQA 3RKBA 5BYYA 3O17A 4RJ6A 2AC5A 5CU0A 4RPVA 3KRXA 5AUZA 3CGFA 3GCPA 1VYWA 4YURA 4WT6A 3H3CA 4O7NA 1WBSA 1G5SA 3W33A 4FYNA 1YDTE 5E9EA 3OZ6A 3W32A 3IW7A 5CQWA 4B4LA 1PYEA 3H9FA 1BYGA 3AC2A 3FMMA 4XEYA 5AR4A 3LMGA 3LM5A 4BYJA 3HUBA 3OCTA 1BI7A 4DC2A 4AZSA 3FXZA 4BKJA 4BGHA 3UIBA 2X8EA 3KN6A 4G31A 3MESA 3SC1A 5HTIA 4IX5A 5CAVA 5AM7A 4FI1A 3QHWA 3VF8A 3HL7A 4HNIA 1Q3WA 4LGHA 5GJDA 1Y6BA 3IS5A 4XNEA 5KMKA 5JFSA 2J50A 2B7AA 4I4FA 3ORPA 1KUTA 1GY3A 4OGRA 1XH9A 4R5YA 3L9MA 1WAKA 1M7QA 3KU2A 3KKVA 3KVXA 2GPHA 4M97A 4RVKA 1A06A 4HOKA 4KWPA 3RHXA 3ZBXA 4CXAA 5CQUA 5DRDA 2UZUE 3QRKA 4DGLC 3FLZA 2C5XA 2C6TA 2UZBA 5E91A 1I09A 3P9JA 4IWOA 5GJGA 5BVWA 4KIOA 3ZS5A 2XUUA 4YTHA 2YIQA 4JT3A 4U6RA 1U5QA 5I9XA 2Z8CA 1Q8UA 1ZWSA 3VS4A 4MBLA 4YHFA 2CGWA 4D58A 4DEAA 2VO7A 4BI2A 4G3DA 2OH0E 5CU2A 4ZSEA 3A60A 1IASA 1XJDA 1JLUE 1Q41A 3FHRA 4FOCA 5AADA 4IJPA 5JQ8A 2XP2A 3BLRA 4MNFA 4NJDA 4PQNA 5CAOA 5HZNA 4AT5A 3F88A 4LL5A 3W1FA 1JOWB 2JLDA 3HMNA 4KABA 4DH5A 3RCJA 2GHMA 5EHYA 2XS0A 3FXWA 5EW9A 3VS2A 4EQCA 3RPRA 4HJOA 2W1FA 4IHPA 4DTBA 3BV3A 3C4FA 4FKJA 4GJ3A 4R5SA 4XG3A 5FDPA 4D28A 2OKRA 2VWZA 5BVEA 2RG6A 4FNZA 4D55A 4KD1A 2C3JA 4JQ7A 5JZJA 2JDSA 3NW5A 1URCA 4GVAA 4N6YA 4FTTA 5JRQA 1ZOGA 4GJ2A 3EN9A 3V5TA 1H26A 1NVRA 3Q60A 5G6VA 3ZO4A 2JITA 4GT4A 5FD2A 3CKWA 4QTEA 4FX3A 2JGZA 3NCGA 4R3RA 2HWOA 3BEAA 4TWNA 4RFMA 2P0CA 1PXKA 4BCJA 4GMYA 4EC9A 1S9IA 4L53A 5C26A 3OCGA 4XLVA 3PA3A 4EHZA 3NUYA 4AZWA 1WZYA 3JVSA 2ZMDA 3UNJA 2CLXA 4V0GB 2YIXA 2R3OA 3R28A 4FGBA 4MXOA 4N70A 3ZDUA 3RI1A 1J7UA 2PMIA 3QTIA 5HNGA 4H3PA 3HP2A 3KF4A 3TL8A 3NVKI 5D11A 3CKXA 1GZNA 4WD5A 4ASEA 4FGRA 4FZDB 3VIDA 3R8PA 4XP3A 4FIEA 4OBPA 5ETFA 4WRGA 4YSMA 5IQFA 4BWPA 5HI2A 4BHZA 3AGLA 3H0ZA 1U4DA 4JI9A 4M15A 3TG1A 4M8TA 4C61A 2ZDUA 3Q6WA 4EH9A 3KB7A 3HZTA 5F95A 3G9NA 4GS6A 3JY9A 3UVRA 5BMSA 3E3PA 4J8MA 2WFYA 3WZJA 3ZO2A 5A4LA 3QALE 3I81A 4FVRA 5CXHA 3UC3A 5IQAA 4W4YA 4MD9E 1OKZA 2PUNA 1Q8TA 2OSCA 1IAHA 5K4IA 5ETIA 3NR9A 3ZFYA 5C4KA 3TI1A 3KXXA 4I0TA 2GQGA 4ANLA 4BGGA 1RDQE 5J7BA 4HCVA 4F70A 3QBNA 4I6HA 3WOWA 5TF9A 4C4JA 3QRIA 3DKFA 2BDWA 3PRIA 3SXSA 2F57A 3NX8A 2WTVA 5CEIA 2GDOA 2X8IA 4YJTA 2CGUA 3PXRA 4ANQA 1J91A 5AV2A 2R3RA 3QRTA 4APPA 3E5AA 4L68A 1SYKA 3MH3A 3R04A 1XWSA 2YEXA 5H3QA 2E9PA 4JIKA 3DK7A 4K11A 2IVTA 4E5WA 1XBBA 3RPSA 3LPBA 3BCEA 3OY1A 4PTEA 3ULIA 4AX8A 4MD8E 3I60A 3S95A 2J0JA 1BUHA 4CG9A 3FMLA 3RNIA 2YZLA 1UKHA 1Y6AA 4IH8A 4FEQA 3E8EA 3BEGA 1WVYA 3PE2A 3HA6A 4XBRA 3ZH8A 4IDTA 2XNGA 4JBVA 4R78A 4I6BA 4QTAA 4UV0A 3OP5A 3PSCA 3MV5A 1V0PA 3VRYA 3CQUA 2Z60A 5HCZA 2WQBA 4R7BA 1WBPA 4H39A 5EHLA 1E9HA 2J7TA 3QHRA 2WAJA 2E9OA 4IAAA 4ITJA 5DG5A 4C2WA 3D94A 3DU8A 3O7LD 1PXLA 2C68A 4D2VA 1YOMA 2VV9A 4QP4A 2XIRA 4PTGA 4IAZA 2E9VA 4K33A 4PL5A 1UWHA 3Q5ZA 4GK4A 4AUAA 3V5PA 4DEDA 4LV5A 5L2WA 2H96A 3PE1A 4C3FA 2OI4X 1AQ1A 2WMXA 2YERA 1H1WA 1X8BA 5DIAA 5ANOA 3C7QA 3PVGA 3IDBA 3TZ7A 4JDHA 4IM0A 5AUVA 4EOSA 4FVQA 5J5TA 5CI6A 5L2TA 1JKSA 2YCFA 5EW3A 3VS0A 1M2PA 1H1SA 4HGSA 5GIOE 2G15A 2Q0BA 3PYYA 3QTWA 3Q6UA 4L3PA 1OBGA 1R78A 5CTPA 1LP4A 2VTAA 3LQ3A 3DV3A 3QWJA 3BGQA 3BHYA 4V04A 2H6DA 5KBQA 5FXSA 5A6OA 1KSWA 3PXYA 4CZTA 1Y91A 2HZ0A 3DXPA 3HDMA 2Y4PA 3QF9A 4FV0A 4ZTLA 4OT6A 4U45A 4ACHA 3HDNA 4EH5A 4HYHA 3FMEA 4M68A 3TXOA 2WTCA 4BCOA 2JIIA 3QQHA 3OW4A 2H9VA 4UY9A 3ORMA 5LCJA 3O50A 5LMKA 1LUFA 3QCXA 4WHZA 1J3HA 3F3VA 2VWXA 4BDAA 4O2PA 1CKPA 4FKUA 3PSDA 3R02A 2HZIA 2YJRA 5FEDA 4CFMA 3UOJA 2FSOX 3TNIA 4RIYA 2BIKB 3PJ8A 4X7QA 4UZDA 2HOGA 3CR0A 4CRSA 5LJJA 4YJNA 5GHVA 2XEZA 2C4GA 2RL5A 3RHKA 4FKQA 3MPMA 2BAJA 3VUDA 4FSZA 3EFJA 4ZZOA 4G5PA 4W4WA 3VS1A 4CYJA 4QMNA 2XM8A 2C6DA 4AZEA 3GU7A 3WF7A 3QL8A 3HRBA 4FSYA 2CKEA 1PYXA 3GFEA 3EL7A 2VTJA 3ROYA 4EJ7A 2IN6A 5HE0A 3UP7A 4EL9A 3KQ7A 1PHKA 3NUXA 2RFNA 1CTPE 2YA9A 5E8XA 3L9NA 3NLBA 4CKRA 3GOKA 3DT1A 3L8VA 2ZJWA 4FODA 3FPQA 4BR3A 4ENXA 2QOKA 3PWYA 3C5UA 5L2QA 3UO4A 3SV0A 4D2TA 2YM8A 4C02A 2IVVA 3OT3A 4B8LA 4FL3A 3FHIA 4CT2A 5IISA 4JRNA 2R3HA 3RK5A 2W1EA 3U9CA 4BDDA 4F4PA 5H8BA 3MTLA 3EQPA 4U80A 4OTPA 4PF4A 2C0IA 2CMWA 2OXDA 3V01A 3ACKA 4J71A 3ATTA 3O51A 2VTIA 4IQ6A 3KCFA 2C6EA 4I22A 2GS6A 3Q9XA 1IEPA 5CLPA 3UODA 5J1VA 5E8WA 3RAWA 2BAKA 4AN9A 2Y7JA 4RX9A 1XHAA 1KV1A 2W1ZA 4YO6A 2PUPA 3LMHA 3RAKA 3SGCA 2R64A 2WMVA 1H0VA 5JQ5A 2ESMA 3LJ0A 3QTSA 4TT7A 1HOWA 1YHWA 2WB8A 2UZEA 5DR6A 4F9YA 3AMBA 2XBJA 4ENYA 3FKLA 2GNLA 3W2CA 4O2ZA 4J98A 3NCZA 4AG8A 4CMUA 4A4XA 4I1ZA 3LFFA 3TIZA 4IFGA 4EH6A 2WD1A 3K3JA 4D1ZA 2WQEA 2GS2A 2Z7LA 4F64A 4WBOA 1IR3A 4ACDA 4ERKA 3MJ1A 5KMLA 2C3KA 3QWKA 5CU3A 4RSSA 2UZOA 5FRIA 3TJCA 2W4OA 3W2RA 4AQCA 2YIWA 1UU8A 3MFUA 4I0SA 4EBWA 3A2CA 5JGDA 3ROCA 1VEBA 3P0MA 4UBAA 4OTIA 4IC7A 3U8WA 5JKGA 4R1VA 4DCAA 2C0TA 1ZZ2A 3L9PA 3F7WA 4IAFA 5DLSA 4Z7GA 3NUUA 4O0XA 4BDGA 2PUUA 2OK1A 3VWAA 4AFEA 3R21A 2HYYA 3R7OA 3E7VA 2CGVA 4AW5A 3CY3A 2J0KA 2C5OA 3BYVA 3ZO3A 1JPAA 3NIEA 5JMSA 1IG1A 1ZARA 1BKXA 3Q53A 4MWHA 2BRMA 5I5ZA 3UOLA 3UMWA 4PY1A 4KS7A 4K8AA 4RQKA 3KRRA 1W98A 4R7IA 4BTJA 3TJDA 4MYGA 3CP9A 3KN5A 4N4SA 3BHHA 4F7LA 3OBGA 2ZB1A 2PVFA 5A3XA 4QMPA 4Q9SA 4D1SA 3A7JA 1B39A 2AUHA 4FC0A 1H25A 4OW8A 3QLFA 3K5UA 5DN3A 4BDKA 3Q5IA 2PZRA 4H36A 3BQRA 5F94A 3TACA 2EXEA 4BCQA 2W1DA 2WTKC 3T9IA 3AC3A 5ANDA 3NNUA 4FEVA 5EFQA 2E9UA 4YO4A 3QGYA 4I21A 3V6SA 4GG5A 1JSVA 4GU9A 2XNEA 4NW6A 1GNGA 4NT4A 2GCDA 3EQIA 3FC1X 4DLJA 5A4QA 1OUKA 2QHNA 4YJUA 2HAKA 4WUAA 5B2MA 5DHJA 4L52A 4NTSA 5CSVA 3R9OA 4DFYA 2ONLC 3C0HA 4AXAA 3DBDA 4RJ5A 2X1NA 4FSRA 3VBVA 2ITVA 3DBFA 3W2SA 5DRBA 2FO0A 5JFWA 4EKKA 3OS3A 5CF6A 5HCXA 4XOYA 4YZDA 1FMKA 5JZNA 4F08A 5L3AA 4KINA 5EYDA 1OIRA 1FMOE 5FBNC 4IAIA 3P7AA 5T3QA 3M42A 5TKDA 4E3CA 5LVPA 2BHHA 3FL5A 5C1QB 2WOTA 3CC6A 4IJ9A 3TNWA 5IH5A 1WVWA 3B8RA 4Q5EA 5IEVA 1H00A 5HEZA 4FTOA 5KO1A 2R7IA 4MK0A 3KULA 2UW8A 2VO0A 5IUHA 4OTDA 1JVPP 5JSMA 3QGWA 3MH1A 3A7HA 1NXKA 5L8LA 5DMZA 3UIMA 4EH7A 5LXMA 2QQ7A 3ACJA 1GZOA 1OL1A 1Q8ZA 2VNYA 5E1EA 3ZEWA 5B7VA 4IX3A 3UQFA 4CQEA 2QU5A 2W05A 2W9FB 4I3ZA 5CNNA 3TUBA 2H34A 4AN2A 3DB6A 3TUDA 4QP8A 2HZNA 3PPZA 3R1QA 4O7RA 3NUSA 4G5JA 4RC3A 4LRJA 5CXZA 4AA5A 3ALOA 3DS6A 3FYKX 4O0WA 2X81A 4C35A 2J90A 5C8MA 2OJJA 3EB0A 3R8VA 3LQ8A 4EHVA 1ZMWA 3FI2A 2P33A 2XRUA 2C6IA 3KRWA 4U7ZA 4W9XA 2OXXA 3EIDA 4V01A 4W8DA 4AOTA 3T8OA 4O7TA 4HZSA 5DGZA 4NZWB 4USEA 5CWZA 2X7OA 2JAMA 1Q62A 1IAJA 5FUTA 3LJ2A 3OD6X 4H1MA 4K1BA 2R2PA 4YJQA 1PY5A 2P4IA 4LI5A 3AT3A 4G2FA 2GFSA 3D14A 2VTOA 2P2HA 4YNOA 4EK8A 4II5A 1WBNA 5E90A 3GC9A 3RM6A 1OKVA 5HD4A 2R3FA 4OAVB 3S00A 4L42A 4YMJA 1YXUA 3OEZA 3FBVA 4GK3A 3AT2A 5BYZA 4AW1A 1GZ8A 5HU3A 5KHWA 5M4CA 1WCCA 3PIXA 4L43A 5H8EA 3RCDA 1QCFA 4H3QA 4Y85A 4QMZA 4RQVA 4X6RA 2WGJA 4YC8A 2LGCA 3AC5A 3F2NA 1MUOA 4ACGA 5EKNA 2PUIA 2IZUA 3DA6A 4N6ZA 3LXLA 4FTMA 2O8YA 4IIRA 5FTGA 2B53A 3FZ1A 2ZM3A 3NUPA 4L6QA 1YI3A 2VNWA 4QQ5A 4KKGA 1BX6A 4PPBA 3DFAA 3RPOA 4NIFB 4C8BA 2IZTA 3EN5A 3UZPA 4GKHA 3OWPA 3G6GA 1P5EA 4A9RA 2P55A 1YXVA 5IQEA 4LM5A 3R9HA 2PHKA 4M7IA 1OBDA 3CEKA 5FTOA 4FMQA 3TNHA 5HG8A 4E5BA 3GC0A 4EOQA 3BZ3A 2QKRA 2A19B 3HV3A 3C4XA 3R63A 3DAKA 3GCQA 4F7SA 2WZJA 1NW1A 2PK9A 5IA2A 4FTNA 2XK7A 1J1CA 3PA4A 4MD7E 4NFNA 4UALA 4HYUA 4FKOA 3VS5A 3BLQA 4D2SA 3GOPA 4J99A 4MNEB 2ITXA 4M0YA 5BQ0A 4E26A 1O9UA 2QR7A 3F5UA 3M11A 4L46A 4C7TA 1RE8A 1JSUA 3I5ZA 4NK9A 4TY1A 2O65A 3PVWA 1H0WA 3RWQA 3QRUA 5CF8A 1GIHA 3DFCB 3E87A 3QYZA 3CS9A 4W9WA 5IA4A 4O7VA 5T6KA 3EH9A 1Q24A 1VZOA 2B55A 5FGKA 3DAJA 4M14A 4UX9A 3DQXA 3NAXA 5HE1A 4Q2AA 3MJ2A 2C3LA 3FQSA 4KIQA 4GH2A 1UNHA 3DJ5A 4DH8A 4IB5A 4H58A 2JDTA 1K9AA 3BX5A 4PMTA 2RGPA 4OLIA 4LOPA 3ATSA 1HCKA 1R0PA 3FZSA 3G90X 1JSTA 4QPSA 3VUGA 4JBQA 3LXKA 4F9BA 2O64A 2QHMA 3QKLA 2B0QA 4GIIA 5I3RA 1OUYA 3O2MA 4QQCA 4IX6A 4R6VA 1YDSE 4Y5QA 4O83A 2HIWA 3IONA 1YQJA 4U8ZA 4GK2A 3EQDA 4TWOA 1XH5A 3P23A 3PWDA 4MAOA 3WF8A 4O7YA 4O81A 1DI9A 2OFVA 4EK6A 1R39A 3IOKA 4QTBA 1O6LA 2I0VA 4I4EA 5CT0A 4I5MA 4B7TA 4EH3A 4RWLA 5EM5A 2BILB 1M52A 3LLAA 2WO6A 3FLWA 2EWAA 4FTAA 4IZYA 5DWRA 4JX3A 3MW1A 3GQIA 2OH4A 2AC3A 3E63A 4XLIA 1F5QA 1T45A 2HXQA 2GTNA 2PTKA 4A9SA 3WIKA 5HU9A 3GVUA 4TYEA 3QX2A 4EKLA 4EWQA 3SAYA 1Y8YA 2R3IA 3QXPA 4FL1A 4FBXA 4DT8A 5DA3A 4EJNA 3C4ZA 4DTKA 5L2SA 2GHGA 4EH2A 2BZIB 2YCRA 4DHFA 3GUBA 2XJ1A 4FG7A 4GIHA 3D5UA 3KEXA 3O0GA 4AW0A 3GNIB 4IDVA 4FTJA 5CZHA 3ULZA 3DNDA 5K5XA 4DBXA 3ORZA 3TZ8A 4GCJA 4JRVA 4V05A 3RAHA 3CIKA 3QCQA 4F6SA 3R71A 5IUGA 3GU5A 2O0UA 3UJGA 3LXNA 4H3BA 4XX9A 5F9EA 4BDHA 3JR1A 4FKSA 3LLTA 4ZJIA 4BI1A 3MB6A 3IOPA 1FINA 3PSBA 4Y95A 3REPA 4EBVA 2PE0A 3IO7A 3QAME 4QMVA 4MXCA 3DY7A 4A07A 3O71A 1KE9A 3II5A 4PV0A 4TNDA 4ITIA 4UWCA 3WYXA 4N57A 5JFVA 3OW3A 1PKGA 1SNUA 4F1OA 5C8KA 3PY3A 1UNGA 4O1PA 1PMUA 3EL8A 4ITHA 4RJ3A 3W8QA 4TXCA 2RKUA 3ZTXA 4AACA 5IH6A 4EHGA 3G5DA 4CKJA 4FIJA 4QMXA 3A8XA 4IW0A 5K5NA 3ZSIA 2WTDA 4G6NA 1FGIA 3EWHA 5H2UA 4CZUA 1YKRA 3WILA 4RJ4A 3MVMA 2R3NA 3CPCA 5KMMA 2C30A 4O0RA 3I5NA 3NWWA 4CGAA 3V3VA 3EN7A 1S9JA 3C0GA 5HIEA 4G17A 4H1JA 2HWPA 3MPTA 2HW6A 1GIIA 3DXNA 5T68A 3ZLSA 4C62A 3K54A 4BDEA 4I24A 2OJGA 4KRDA 5HE3A 5CVHA 5DE2A 3W2PA 4A4LA 3PDTA 3IGGA 4DH3A 4PDPA 3HGKA 4FSQA 3TZMA 1UVRA 2YDIA 3UP2A 2YWVA 4ZLYA 4ZAUA 2HZ4A 4EOJA 2XK6A 3OXTA 4FKWA 4TTHB 4BL1A 5HQ0A 4AOIA 4LOQA 4DEHA 3UPZA 4U42A 4RVTA 2X2LA 4AF3A 4ANOA 5K0KA 5FWKK 3CJGA 1TKIA 5CANA 5EQYA 3DBQA 4G9CA 4RIWB 3LFBA 5IH4A 2CNUA 4HYSA 3FDNA 5L8KA 3DXQA 3P4KA 5KMJA 3R8ZA 2B9FA 5EK7A 3U55A 4JG7A 3RM7A 4HVDA 4JAIA 4EQMA 4IZ5A 4ALUA 4HVIA 4FV1A 4A4OA 4K0YA 4KKHA 3OOGA 4E4XA 3RK7A 3CD3A 4R77A 3I7CA 3FLQA 1G8SA 2YM3A 3IW8A 3S3IA 4OT5A 1NA7A 5EG3A 3F2AA 4GW8A 1REJA 3ORNA 4ZP5A 3R0TA 3OTUA 2B9HA 4LUDA 4JDIA 2RFSA 1ZOHA 2QR8A 4DGNA 5IDPA 1OB3A 1A48A 4U40A 5HICA 2X8DA 4LMUA 5K3YA 1HCLA 3SKCA 3UE4A 1PF8A 3V5QA 4OAUC 5I3OA 5EQEA 3DDQA 4IZAA 4TW9A 1LR4A 4NU1A 3H0YA 2YDKA 3WYYA 3I4BA 3QZHA 4EH4A 5HO8A 4J52A 3ZRLA 1M7NA 1MQ4A 3WZKA 4BCFA 3D5WA 4U0IA 4EK4A 3N9XA 2Z7SA 1PMEA 5HD7A 4F1MA 2GS7A 3LFEA 5G1XA 3OBJA 3GU8A 4GUBA 1FQ1B 4QRCA 2J9MA 4YJSA 3DJ6A 2OZAB 5BNJA 1PXNA 2R3JA 2JD5A 3G9LX 3MY5A 5CI7A 1WBOA 4FT3A 4G34A 2BZKB 3HMOA 2OO8X 1Z57A 2CGXA 1BI8A 5AUXA 4GL9A 1OKWA 1Q8YA 3QQJA 4FKLA 4LRKA 5FBOA 5GZ8A 2YABA 1GAGA 1KWPA 3FWQA 2Y9QA 5KUPA 4JQEA 4D0WA 4IFCA 4F6UA 3COIA 4ZY6A 3NRMA 3BHTA 1B6CB 4AN3A 4RVLA 4Y83A 3GENA 4C4IA 1SM2A 4RC2A 4ZTMA 3NAYA 3FMDA 2ONLA 2QVSE 2XNMA 3D2IA 3HUCA 4PPAA 5FQDC 4AE9A 2VTNA 3D15A 1OZ1A 2UV2A 3Q9WA 5HG7A 3VW8A 4B99A 2ITZA 5KZ0A 2I0HA 2IWIA 4BTFA 5HORA 4J7BA 2IZSA 3CQEA 4DFXE 3R7YA 3S4QA 5TO8A 4F63A 1QPCA 2C5NA 4YP8A 5I0BA 4IXPA 3W8LA 3WF5A 3EMGA 2F9GA 4MQ2A 4S34A 3ZOSA 5AAFA 4FT5A 4UMTA 5M09A 2CDZA 2IW6A 2YN8A 2IPXA 1ZLTA 4DGOA 5JH6A 1H8FA 3RINA 4BBMA 2FSMX 4O96A 2XK8A 4PMSA 5K9IA 3RAIA 2PL0A 3JPVA 2BDJA 3DNEA 3LW0A 5A54A 3UO6A 4X21A 4BZOA 3BU5A 2ITWA 3NEWA 4FV2A 4FT9A 5EDQA 2WQNA 4BIBA 2IO6A 5AP4A 3FY0A 3QCYA 3ZCLA 4QTCA 4DBNA 5KCVA 4JS8A 3OCBA 3SRVB 5JEBA 5CNOA 2GQRA 2BTSA 3NYVA 3IW4A 1YWVA 4FIGA 4D2PA 1XH7A 4FEUA 4NWMA 2VD5A 4A9UA 1JQHA 4MNEA 4PTCA 3SX9A 2BHEA 1YWRA 2W96B 3IDPA 3K3IA 2UZWE 3LOKA 2CKPA 2C6OA 3E92A 2KTYA 2CHLA 3M2WA 2JIUA 3H9RA 4LV8A 2QI8A 1OECA 2BRNA 3UNKA 3HEGA 4DAWA 4J95A 4FL2A 3F66A 4WIHA 4KUJA 2QG5A 3CTJA 3CXWA 4M12A 4IWPA 5CSHA 3GB2A 5AA9A 1ZYCA 5GNKA 3GP0A 5GINE 4JAJA 5J5SA 2X0GA 4YSJA 1P14A 2J0MB 3K5VA 1WMKA 3POOA 4C37A 4IWDA 5AR8A 3SD0A 3HVCA 3S1HA 2OF2A 4RG0A 3EOCA 5D7VA 3DAEA 3LXPA 2QOQA 2R3KA 4HGTA 2G2IA 3AD5A 3WE4A 1QL6A 5J95A 3R83A 3MA3A 4U44A 1PMNA 4F65A 5CYIA 2QG7A 2W5HA 4LRMA 3NDMA 3S0OA 3R1NA 3AGMA 1DAWA 2VWVA 5ANKA 5E8VA 3DTWA 4O7ZA 2WMSA 5KMIA 5EHOA 3BGPA 1UV5A 5KX8A 5EI8A 4E6DA 4NKAA 1YOLA 4YR8A 1AD5A 3BRBA 5EM8A 5L6PA 3FE3A 4QYHA 5DBXA 4JNWA 3BU3A 5AX3A 2A4LA 3S2PA 3BLHA 5D41A 4FF8A 4F1TA 1Q99A 3LCDA 4BDJA 1UU7A 2C1BA 3OC1A 4TL0A 2G2HA 2WNTA 2XH5A 4MBIA 2FB8A 4BIEA 5DEWA 3MH0A 3WI6A 5AIKA 4CFVA 3UNZA 2BAQA 4M0ZA 2REIA 5B2KA 3L8PA 4KIKA 5LCKA 1P4FA 2VTQA 4USFA 2VGOA 3OWLA 2IVSA 3MVHA 4H05A 2VWIA 3MH2A 3GCUA 1FVVA 3COMA 4GEOA 3ENMA 5KMOA 3ZM9A 4M69B 1YXSA 3PRFA 3DJ7A 4G3CA 2V7OA 3K2LA 3QD0A 3ZBFA 2PU8A 4YTCA 1OIUA 2I0YA 2G9XA 3BBTB 4XG9A 2ETRA 3Q52A 4EOIA 3TKHA 2XCKA 4WKQA 3LHJA 3MFSA 2B52A 4APCA 4U81A 3WE8A 5TE0A 4DG3E 1DAYA 1E1XA 5IPJA 3U54A 3VUIA 4AE6A 4ARKA 3CLYA 4PRJA 3GI3A 5LWNA 3CSVA 4FIFA 5H9BA 2QD9A 1KE7A 5E8UA 2QOFA 3EFLA 1OVEA 1XBCA 1JWHA 2W5BA 3SHEA 5I9ZA 1XQZA 4CT1A 4WNMA 4QD6A 3E8CA 1LEZA 4MVFA 4O91A 1MRYA 5AIRA 3QTXA 3DK6A 5E8ZA 4FTRA 3EJ1A 2OGVA 4EK3A 2SRCA 3IGOA 3LFCA 3KMMA 3BIZA 2BALA 2ITNA 1IRKA 3DBEA 5BVKA 5IA1A 3VULA 3MBLA 2GTMA 2OFUA 3JUHA 3PXKA 3O23A 2PE2A 5DFPA 2W4JA 5TR6A 2UW9A 5EQPA 3LMIA 2YACA 3G15A 2WQOA 5AFVA 2XNBA 4X3FB 3BHVA 2PZYA 1YDRE 2W5AA 1SZMA 2IJMA 4Q9ZA 3FPMA 4O86A 2UVXA 5L4QA 2I40A 2YZAA 3C13A 2UW3A 4EYJA 1YWNA 5FEEA 1VJYA 2YIYA 2XK4A 2ZV7A 5IEYA 5CVFA 5M51A 3COHA 5ACBC 1M2QA 3P7BA 2XNOA 3ZM4A 3EFWA 3BELA 2FA2A 3FKOA 3QZIA 3OVVA 5FDXA 5CENA 4L01A 3TKUA 1QPDA 2ZV9A 4W4XA 3FY2A 3MFTA 4YC3A 3LCKA 4EYMA 3QUPA 4QMLA 4ACMA 4BCIA 2FH9A 3MYGA 1BMKA 2CN5A 2JBPA 4IB1A 4RIWA 5EM6A 4AGDA 1U46A 3OMVA 3FUPA 3LVPA 4HW7A 4DEGA 3R6XA 1UU9A 2C6KA 4BCPA 2WMTA 1Z5MA 1GJOA 3F5PA 2C3IB 3Q9YA 4XMOA 5HVJA 3EKKA 1PXMA 3ODYX 3TUCA 4M67A 4ONAA 4WSQA 1MP8A 4IANA 4WOVA 3EQBA 1OIQA 5DI1A 5EOLA 4DLIA 4EH8A 5A46A 2W1HA 4MX9A 4P4CA 4ACCA 4EZ3A 5JGBA 3LCSA 4HVHA 2BFYA 1TQMA 2YIRA 3QQLA 4XS2A 3R01A 3PLSA 4NW5A 4XV2A 4KS8A 2R4BA 1OITA 3D5VA 3MTFA 4FV7A 3EQRA 2NO3A 4C59A 4DEEA 3HRCA 4K6ZA 4FKGA 1OGUA 4IB0A 3ZC6A 3H10A 4HVGA 2OXYA 3UTOA 4GUEA 5GIPE 4O38A 2VTRA 2IW9A 3SXFA 4FSUA 4W4VA 3R7IA 5M57A 1JKLA 3C51A 4Z3VA 1K2PA 3GQLA 4ZTRA 3CBLA 4OTGA 5AR7A 2V22A 3QXOA 5J9ZA 1CSNA 3F3TA 3FC2A 3FLSA 2ITPA 1E1VA 5ETCA 3V5WA 4IC8A 3ZEPA 3R7UA 2DS1A 5BVOA 4V0GA 3DOGA 4TYIA 2EU9A 3B2WA 3ZZWA 2ITTA 4EI4A 4Q5HA 3CTQA 4UZHA 3ANQA 2OZAA 3I1AA 3WZDA 5M4UA 4MTAA 3BI6A 2WTIA 4FUYA 4EORA 3EQFA 4BDIA 3GCVA 5AP1A 1TQPA 1WBVA 3HV4A 2QLQA 4BN1A 3WARA 4G3EA 2Y6MA 3D9VA 3H9OA 4WG4A 2P2IA 3KFAA 4B0GA 5AM6A 3E93A 3EHAA 3ZHPC 4BDBA 5CF5A 3R73A 2UW0A 2XMYA 4TN6A 5M53A 3N4VA 2HELA 3GXLA 1U59A 3AOXA 2CNQA 3ZUUA 2OG8A 4FSNA 2QU6A 4O7SA 5FM2A 2ZOQA 1FOTA 4F99A 3F5XA 4FTKA 2F2CB 4YLKA 1P4OA 5LVMA 4CMOA 3MFRA 3BYMA 3I7BA 3I6UA 4YJRA 1KOAA 3ZRMA 5D10A 3E8NA 4QMYA 2YM4A 4QP1A 3QZGA 4RIXB 3R1SA 1UA2A 4ZJVA 5DH3A 5IZFA 4XP0A 5AAGA 2ERKA 1PXJA 4FIHA 4QMUA 5IKWA 2UZVA 4YPSA 3UYSA 2B1PA 2J0IA 4EQUA 5LVNA 1M17A 3ZUVA 5HNBA 4AGUA 5HBEA 2R3QA 5KZIA 5EDRA 5C03A 1P2AA 2VZ6A 2YM5A 3O8PA 3RVGA 2XNPA 4DGMA 3OWKA 4DCEA 4BWKA 3OF0A 3RZBA 4LYNA 3ZUTA 2YM6A 4IMYA 2ETKA 4FNYA 4IAYA 4MXAA 3R8UA 2Q0NA 3NYXA 2ITOA 2XKFA 4U5JA 3VW6A 3LCTA 3LIJA 2ITUA 5AUYA 4E93A 3PPJA 2ITQA 2JKOA 3CPBA 4PUZA 3F82A 4LUEA 4OR5A 4X0MA 1G3NA 1R0EA 2G1TA 3JVRA 4UMPA 5C9CA 4MHAA 3ITZA 4JG6A 1STCE 5AP6A 2UW5A 2PMOX 4JG8A 5FP5A 2GNFA 4XG7A 2CN8A 2OIBA 4M13A 4MXXA 1GOLA 2ZYBA 4IM3A 4WA9A 4FG9A 3FSKA 3D2KA 2RIOA 3VN9A 4UEUA 1WBWA 5BYLA 3HMMA 4UMUA 3KXZA 5M07A 4BY9E 4JIAA 5D12A 3EYGA 3MVLA 3OROA 4X3JA 5CAUA 3MY0A 4P7EA 4I92A 2ETMA 3L8XA 4YJOA 3NZ0A 4ANNA 3MIYA 4USDA 4AWIA 4G1WA 1GIJA 5CALA 3TM0A 3TDVA 2BRHA 4QYYA 2VX3A 1ZZLA 5AUTA 4TNBA 2XIYA 2XB7A 3F3UA 5LARA 1OMWA 1QPEA 4C2VA 2W7XA 3EN6A 4KA3A 4DINA 2W9ZB 3W55A 4DN5A 3RGFA 5KNJA 5I9YA 2AYPA 2HCKA 4CZYB 5IQBA 4QMSA 3TTIA 4LGDA 2GNGA 3PY1A 4RGJA 5EM7A 2YLEA 2QOHA 3ELJA 4XP2A 4BKYA 4EOOA 3CJFA 4GFGA 3ORXA 3EKNA 4QYGA 2JKQA 5HLNA 4GKIA 5HNIX 2XIXA 2G2FA 4AGCA 3U6JA 2X4FA 3AD6A 3UOHA 4FZ7A 2WMUA 1M2RA 4BVUA 3PIYA 1M14A 3M1SA 2ZAZA 3LAUA 2PSQA 4RMZA 5AV4A 5K0XA 3VUMA 4ORKA 1XKKA 2GSFA 5LQFA 3NMUF 3Q9ZA 3SQQA 2XEYA 3UIXA 3BYOA 2BRBA 5BVDA 4JBPA 3PG3A 2XKDA 3P79A 4F7JA 2ZM4A 5IEXA 2NNWB 2Z7RA 4X6QC 4FE2A 5IQIA 3R8LA 3D4QA 3DQWA 5GJFA 2X2KA 2Y4IB 4S30A 1FVTA 5J87A 3U9NA 1KE8A 3VHEA 3R7EA 4F9CA 2VX0A 5L6WL 5EH0A 1ZMVA 3QD4A 2XJ0A 2PZ5A 3ENHA 4XYFA 5EYCA 2Z02A 4KBAA 2I1MA 5E1SA 3U4UA 4E5AX 2PVRA 2XZSA 3KF7A 3OHTA 2J5EA 3PJ2A 4AGWA 4CCUA 1J1BA 4M69A 5CZIA 1YI4A 2UVZA 3TIYA 3T3UA 4YJVA 4GV1A 2R3PA 1O6YA 3DZOA 4FSMA 3DPKA 4MXZA 3EN4A 4JLCA 1JAMA 3PXQA 5EI2A 4CNHA 3PUPA 2ZV2A 5HLPA 1W84A 4E7WA 2OJ9A 4GFOA 4IX4A 4UXLA 4LMNA 4GFMA 4PMMA 3WBLA 5AEPA 5K4JA 1L3RE 4F0GA 2GU8A 2ZB0A 2QODA 3LFDA 3DKOA 3G0EA 3A7GA 2NRYA 3G33A 2J6MA 4KIPA 2QOLA 4YHTA 3CQWA 3D0EA 5CU6A 3V6RA 4P5ZA 2FSLX 2VRXA 1OL5A 3D5XA 1MRVA 3P86A 3ZLXA 3G0FA 4FTUA 2XKEA 4KBCA 4KBKA 4YBKA 4YGAA 4G16A 4IWQA 4NCTC 2UVYA 4MKCA 2PULA 3VBXA 4CCBA 4S31A 2QLUA 2OIQA 1EH4A 3PJ3A 3TV4A 4ID7A 4QTDA 5DR2A 3R00A 4RJ8A 4YLJA 1OM1A 1YRPA 3PZHA 3QTQA 1YHSA 2W1CA 4DA5A 5EYKA 2R3GA 4C33A 1Q61A 4L3LA 4FSWA 3W18A 5BMMA 4K77A 1LEWA 3A7FA 4FTQA 4IBMA 5GZAA 4KNBA 5IG1A 5CX9A 1ZYJA 5HX8A 2A27A 3HAMA 5FM3A 2F7EE 3NVMB 3FSFA 3RP9A 2XYUA 4ZSAA 2XVDA 4PP7A 4U3ZA 2QKWB 3VQHA 3ZZEA 5TOZA 1Q3DA 3KMWA 4BRXA 1V1KA 5HO6A 3GT8A 5FXRA 5IMXA 3ZXZA 3RZFA 2YJSA 3R22A 4BBFA 4U3YA 1R1WA 5HOAA 1YXTA 3QKMA 5M55A 4NM3A 5FTQA 2E2BA 3HKOA 4ZLOA 1ZXEA 4QYEA 4WNPA 3ZXTA 5JGAA 4CLIA 4ERWA 1I44A 2UW7A 3EZRA 4AW2A 5LMAA 4DGGA 3BYSA 3Q96A 5CAQA 4RZVA 2QURA 2VTHA 4QPAA 1SNXA 3C5IA 1DM2A 2QONA 2B54A 5ANJA 2VGPA 2ZV8A 4CRLA 4OTHA 3VC4A 3AMAA 4R8QA 3E7OA 3UVPA 2HXLA 2LAVA 3QUDA 5E4HA 3ODZX 4E8AA 3DGKA 3TT0A 4HCUA 5CT7A 4A06A 5A4CA 1ZY5A 4XBUA 4YHJA 2C6MA 4KSQA 1YHVA 3LJ1A 4ZK5A 2Q83A 3V04A 2NPQA 4I41A 4BTKA 4F6WA 2HENA 3PLAE 4M3QA 1REKA 2EXCX 3HX4A 4JR3A 3Q4TA 4FV5A 3N51A 3WF9A 5ACKA 4FZFB 3W10A 4F09A 4XRJA 1Q5KA 2CKOA 2BUJA 3UOKA 3RJCA 2WEIA 5C01A 3OUKA 3KA0A 5IMEA 4WO5A 2C6LA 4QP7A 2JEDA 3RK9A 1ND4A 2JDOA 5JRSA 3MPAA 3POZA 4L67A 1V0BA 2VWUA 4JL9A 5GZ9A 4WG5A 2QOIA 2WMAA 3R1YA 4CLJA 5F20A 3MA6A 2R5TA 5D9HA 1IA9A 4Y5HA 2X6EA 2ZVAA 4C0TA 3F69A 4I94A 3G51A 2CKQA 4FZ6A 5C8NA 3VUKA 4L3JA 3LZBA 3UIUA 4CTCA 3UG2A 1Q4LA 5AMNA 4WUNA 5HIDA 2YCSA 1QMZA 1WBTA 3KCKA 4C4FA 5CAPA 2VU3A 4XV3A 2OJFE 3WIGA 3HMIA 3FI8A 4EHEA 3FZRA 4PDSA 5BX0A 4U41A 4D4RA 4O21A 3BYUA 4RZWA 3TV7A 5CVGA 3MN3A 3E64A 3LFNA 5E7RA 3VO3A 4AP7A 2I7QA 3HLLA 1ZMUA 2EB3A 1ERKA 3TZ9A 4TWCA 4LFIA 1Q8WA 3QRJA 3MI9A 5J7HA 2XIZA 2RF9A 3SW7A 4RIXA 4ZTNA 4HCTA 4C57A 5ANIA 4C36A 3F2RA 4BB4A 2Y6OA 4FG8A 2EUFB 4DFZE 4FYOA 2CNVA 3EZVA 4CFWA 4HPTE 2VUWA 5DT0A 2UZNA 3E62A 3QD3A 4BCKA 1VR2A 4YBJA 3AC1A 3MVJA 4BCGA 5BVNA 3AC4A 4PP9A 3F6XA 3JY0A 1WFCA 4WNOA 4RX5A 5FLFA 3PVBA 3D7TB 3R8MA 4BC6A 4OUCA 4RX8A 5IUIA 4E4MA 1PXOA 5HG9A 4FKIA 3R9NA 4EC8A 3SOAA 3NPCA 4OTFA 4NJ3A 3F5GA 5DOSA 4HGEA 4OBQA 4CFUA 4O6EA 2XNNA 1ZRZA 2ERZE 1H07A 2DQ7X 2VTTA 3NIZA 3ET7A 5A6NA 4PNIA 3C4EA 2IZRA 4YUQA 2H8HA 4JQ8A 4E73A 4TZRA 2JDRA 4EUTA 3BV2A 2QCSA 3VUHA 2X9FA 1APME 2DYLA 5CEKA 4GYIA 5DPVA 4BTMA 5HO7A 3EFKA 4UMQA 1PRYA 2C0OA 3OCSA 2W1GA 4FK6A 2ACXA 3LFSA 3PPKA 4AS0A 4E6AA 4UMRA 3O7LB 4TYJA 4O0TA 4D4SA 2YCQA 2BRGA 3HA8A 3HNGA 4BGQA 4GSBA 2XIKA 2YAAA 3QTZA 3WF6A 5BUEA 3C9WA 2YHVA 3NNVA 1K3AA 1YI6A 3NS9A 4AAAA 2RFDA 3I79A 4IE9A 2OJIA 1H1QA 1SVHA 1U5RA 4CD0A 4EUUA 5CEQA 3TN8A 3QYWA 1PJKA 5LVOA 4I5PA 4QO9A 3IK3A 4AOJA 3C1XA 3FMHA 5DR9A 4QQJA 4OTWA 4DG2E 2B9IA 4FV4A 5EW8A 4ALVA 3DDPA 4I93A 2A0CX 3NW7A 4BIDA 5HTBA 2HY81 4O84A 4E6QA 2VWWA 4U9AA 2VTPA 5ANGA 4CV9A 4E4NA 4YU2A 3VBQA 5FG8A 2WMRA 3DKCA 3HV7A 5EDPA 5I9UA 3ZDIA 5BVFA 4ZZMA 3F9NA 5HTCA 3AQVA 2VX1A 4K2RA 2RSVA 2WQMA 5J1WA 2CCIA 1CKJA 4I5HA 4HVSA 5HBJA 1JBPE 1F3MC 2OIDA 1NVQA 4NUSA 2XBAA 4AU8A 5KHXA 3C4WA 2QC6A 4WBBB 4RVMA 2UZLA 3ZMMA 2XA4A 3BE2A 4NM7A 3O8UA 3UGCA 2GNJA 4CQGA 3R9DA 3OOMA 4W8EA 4AZVA 1H24A 4NEUA 2UZTA 4NIFA 5CEOA 2VTMA 3BE9A 4U43A 4FKTA 3VHKA 2VAGA 4BWXA 3KXMA 5BPYA 3SW4A 2W4KA 2BCJA 5CEPA 4XUFA 3WZUA 1RJBA 2GQSA 4FR4A 4B6LA 4XG4A 5F4NA 4ZS0A 3BU6A 1FVRA 1O6KA 3OUNB 4C58A 1TVOA 1PW2A 3OXIA 3ZYAA 4DH1A 4E4LA 4FZAB 3EQGA 1H1RA 2V0DA 3CD8A 4HYIA 3UDBA 2F2UA 3FZTA 1OPLA 3EYHA 3ZC5A 1YOJA 4UB7A 2GMXA 2PVYA 1NY3A 5HCYA 4CG8A 4J1RA 3RPVA 3ANRA 5KKRC 2QOCA 3I6WA 3FL4A 3SG8A 4QMOA 4E6CA 3GU4A 4NM0A 3KRLA 4NKSA 5AP3A 3QLGA 4ZEGA 3VAPA 2PVNA 5KMNA 4ANMA 5KBRA 5CS6A 1YVJA 5M06A 3KULB 4UWYA 2HK5A 4TYHB 3LFAA 4MEDA 5C27A 3TKIA 4ZJJA 1KV2A 3PTGA 4OTRA 4CMTA 5HGIA 4IEBA 4ZSGA 3QQKA 4R7HA 4YNEA 1LPUA 5I9WA 2J5FA 3KY2A 5B0XA 3ZLYA 4DYMA 4JJRA 4BI0A 1XBAA 4YTIA 4J8NA 2VTLA 3VS6A 5HX6A 4C4EA 2ITYA 3FMNA 2PMLX 1U54B 4GT3A 3RPYA 2CLQA 3ORTA 4G3FA 4Z7HA 4IVDA 2NRUA 1MRUA 4NM5A 4X3FC 4G6OA 5HIBA 4RWJA 2WKMA 3GC7A 3PZEA 2HW7A 4IZ7A 3SOCA 4ZTQA 4FTLA 1XR1A 3OTVA 1OIYA 4P2KA 3THBA 2W99B 3ID6C 1NVSA 3PJ1A 5KE0A 4QP3A 4J96A 5CSPA 2JKMA 4AT4A 1RQQA 4YPDA 1XH6A 2X7GA 5IDNA 2XK3A 3OEFX 1J7IA 3I0QA 3ORIA 3FKNA 2OF4A 4IADA 4RWKA 3RMFA 3VS7A 2I0EA 3KL8A 4D4YA 5LMBA 4AZTA 2PVKA 3QQUA 4EOMA 3Q4CA 2RFEA 3DK3A 3DZQA 3OT8A 4XHKB 3ETAA 1WVXA 3VVHA 2IVUA 2QO2A 2BROA 3JXWA 4C34A 3BWJA 2VO6A 2PVLA 3BKBA 4RRVA 4ZLZA 1CMKE 2UW6A 3CTHA 5HKMA 4WSYA 4DTAA 1H4LA 2ZDTA 5AJQA 4RX7A 4D9UA 4IVBA 4HZRA 3IPHA 4O0VA 4DFNA 2CCHA 5A14A 2FYSA 3FAAA 5IF1A 4JDJA 4RC4A 1H1PA 4X2FA 4RA5A 1UU3A 2C5YA 4YZCA 2V7AA 4DFLA 4FVPA 3QQFA 1J7LA 2GNIA 3OXZA 4XG8A 4GU6A 2BMCA 4JX7A 4DEBA 2W0JA 3KGAA 5KKRB 4AT3A 1JNKA 2OBJA 4DEIA 4GG7A 4BHNA 1OL6A 3MWUA 3TEIA 3FQHA 1H27A 3LE6A 4D4VA 4MH7A 4FA2A 3RNYA 2QOBA 2YISA 4GYGA 2JC6A 4YC6A 3PA5A 3OWJA 3Q4UA 3C4CA 1UWJA 5CSXA 5CSWA 4LGGA 4NCTA 2BZJA 4ZIMA 3TCPA 2VN9A 4LOOA 2DWBA 4WNKA 4PPCA 5AR3A 3A61A 5L8JA 3R7VA 3TV6A 4NSTA 4X2JA 4EOPA 5LOHA 4QMQA 5AAEA 3F7ZA 4UWBA 5A4EA 1NT2A 1OL2A 3NUNA 2PE1A 3IG7A 4TRLA 5B2LA 1V0OA 4EZ7A 3HV6A 4RIOA 2PZPA 5CU4A 2PWLA 1W8CA 3KK9A 2NP8A 5D7AA 5DEYA 3C50A 4RBLA 3VRZA 4Z55A 5LVLA 5M56A 5J79A 2I6LA 3OG7A 3E8DA 3FEGA 3COKA 4QNAA 2PVMA 3IW6A 2JFMA 2CSNA 3A4PA 4C4HA 4D5HA 1MQBA 5AV3A 3TNPC 2C47A 3MIAA 2EB2A 2QOOA 5AP0A 3RBWA 5IQGA 4A9YA 2YWPA 2JKKA 3KC3A 4XRLA 4FEWA 3NYOA 4BBEA 5DYJA 4O22A 4O0SA 4U97A 4DF3A 4FSTA 4DFBA 4EOLA 4JOAA 2YDJA 4QPMA 4NH1A 4ZTHA 4B9DA 4KRCA 5AP5A 5AUUA 4ZY5A 5E8TA 3E3BX 4I6FA 1T46A 3GC8A 3NNWA 3P1AA 4ASZA 4EEVA 4QNYA 4EONA 2Y0AA 4S32A 5DVRA 1OI9A 4FV3A 2BPMA 2WIPA 2X2MA 3PJCA 2GFCA 4ZOGA 2Z2WA 3D7TA 3JS2A 3UMXA 2XF0A 3QKKA 2F4JA 2OZOA 4A9TA 2W06A 3ZSHA 4O82A 4YZBA 4DT9A 4OBOA 2BKKA 1JKTA 4OTQA 5FP6A 4R3CA 3WZEA 4FUXA 1FBNA 3KXNA 3IDCA 3H4JA 4FTIA 4CFFA 3PY0A 4DITA 2C69A 3SG9A 3Q2JA 4R3PA 4ASXA 4K18A 2W17A 4X2NA 4BZNA 4PMPA 2X9EA 4IB3A 5E8YA 3A8WA 4HNFA 4EWHA 3KXHA 1OKYA 4CSVA 4BYIA 3BQCA 2Y8OA 3GEQA 1OPJA 1Z9XA 3Q32A 4R1YA 3ORKA 2OICA 4FKRA 4MCVA 2A1AB 4F9WA 4ANSA 4XV9A 4UN0C 4RLLA 3C0IA 3E88A 1QPJA 2R9SA 3IECA 3MDYA 3UZRA 3BWFA 3FLNC 1UKIA 5HBHA 3U6IA 2BDFA 2WU6A 2YAKA 3BHUA 4YLLA 4D2WA 4FICA 4RJ7A 1L8TA 4IVAA 4Y8DA 3VBTA 4RWIA 1SVEA 3ERKA 2VO3A 1PMVA 4XH6A 3T9TA 3U4WA 4EOKA 2WU7A 4O7WA 4ZMEA 3QFVA 3FZPA 3V5LA 4D2RA 4RA4A 4IAKA 4QOXA
chains in the Genus database with same CATH superfamily
3DLZA 5HVKA 4MWIA 5AWMA 3AKLA 1XH4A 2JDVA 4J53A 5AR2A 4BICA 3LM0A 3FI4A 2OLCA 1W7HA 2E9NA 5AV1A 5CF4A 2FUMA 3SDJA 3PVUA 4CV8A 1XO2B 4AFJA 4O27B 2FSTX 2OWBA 2B9JA 5JK3A 3AMYA 4ZY4A 3W2OA 4F7NA 3KMUA 2XK9A 3HP5A 3KRJA 4NTTA 4WG3A 3T3VA 2V55A 4FV9A 4Y73A 5AUWA 4FNWA 5BUIA 3KVWA 3NSZA 2QO7A 4C38A 5ETAA 3FXXA 2BIYA 3QTUA 3SLSA 5IU2A 2WOUA 3VJOA 3U6HA 5A4TA 4QQTA 4PL3A 3UVQA 3QC4A 4ALWA 1R3CA 3GU6A 2PMNX 2YFXA 4TKSA 4FT7A 4F9AA 4CFNA 5L2IA 1B38A 2FGIA 5M44A 5TT7A 2XAMA 4ASDA 2OU7A 4BDCA 2Y4IC 5DNRA 4GT5A 4J97A 4EK5A 2Z7QA 3P08A 5HVYA 4G6LA 3R2YA 3ZU7A 5JT2A 3UG1A 1XH8A 4DH7A 4FEXA 5L6OA 3ZSGA 4ZSLA 4FV6A 2A2AA 4BCHA 2B4SB 4AZFA 3VBWA 3PG1A 4JR7A 2GHLA 4G9RA 3SRVA 3DBCA 3EQCA 5JN2A 2IF8A 2C5VA 3EQHA 2JFLA 4KB8A 5DT3A 2JAVA 4P5QA 5ANEA 3W2QA 2X39A 2BTRA 4IM2A 3MB7A 3VBYA 3F61A 4AA0A 4KSPA 4CTBA 4F0IA 3OFMA 2XANA 4I5CA 4KAOA 2EVAA 4D5KA 2X7FA 2FVDA 5ITAA 5M08A 2ZMCA 3QZFA 3UPXA 1RW8A 4XCUA 5CEMA 2YLFA 3AG9A 5D1JA 4DFUA 3FYJX 1A9UA 3TWJA 3FMKA 3ZO1A 4JDKA 1H01A 4TYHA 5A9UA 3VQUA 4O6LA 3N4UA 2WHBA 3PXZA 4QP9A 4NYEA 4RFYA 4JXFA 3CCNA 4X2KA 3MGYA 4O7LA 5FXQA 3L8SA 1KE5A 1Q97A 3A4OX 3A99A 3PIZA 2PZIA 5F1ZA 4BF2A 1G8AA 3NYNA 4U79A 3P78A 3NGAA 2HY0A 4YZMA 3R2BA 4LG4A 5M4IA 5JFXA 4MXYA 2QNJA 3CY2A 2BFXA 3FZOA 4MF0A 4WRSA 3VS3A 2IG7A 2XCHA 5HE2A 4PX6A 1U54A 2RG5A 3V8WA 3V8TA 5IQCA 4G3GA 3FJQE 3HAVA 4EZ5A 1KE6A 3QTRA 2WTJA 3LKMA 5AX9A 3V5JA 4P90A 3QA0A 4YZ9A 4PNKA 3HECA 3DLSA 3D7ZA 2BZHB 4L00A 2XM9A 3F3WA 4L9IA 2R0IA 1BL7A 2R0UA 3A7IA 4QMWA 4QP2A 1GZKA 5J8IA 4F0FA 5HESA 3PFQA 4L7SA 2WTKB 1JKKA 2PY3A 4FIIA 1W83A 5E92A 1CM8A 4PL4A 3D83A 3AXWA 3FMJA 4JVGA 4XG6A 2BKZA 3BPRA 4C4GA 3CGOA 1CDKA 2JIVA 5E8SA 2IW8A 3H30A 4TYGA 4M84A 3BGZA 3N4TA 3MY1A 2X6DA 1URWA 3AT4A 1PKDA 2O63A 3V51A 3QQGA 1SVGA 3W16A 4PDYA 1IA8A 4X2GA 4JBOA 2DUVA 3KXGA 3Q4ZA 4O0UA 5IA3A 4DE4A 1AGWA 1Y57A 3ZONA 4NL0A 4MQ1A 1BL6A 3UBDA 1W82A 3LFQA 3A62A 1F0QA 4Y46A 2WXVA 3DTCA 4ZMFA 1ZYLA 2XJ2A 3GCSA 4TWPA 4BCMA 1OGYA 3PXFA 4HGLA 5M4FA 2V5QA 2WIHA 2UUEA 5CASA 1KOBA 1H08A 1OL7A 3R30A 1VYZA 4M66A 2GNHA 2PVHA 4GVJA 1ZOEA 4CVAA 3UO5A 1CKIA 2XKCA 4CEGA 4L8MA 2WMBA 3IKAA 4XOZA 3FQEA 3I0OA 5HHWA 1BLXA 2KULA 4FK3A 1ATPE 5LMKC 1FGKA 3OY3A 3Q3BA 3P5KA 3ZRKA 1TQIA 1W0XC 1DS5A 2O5KA 3G6HA 3L1SA 3R7GA 3VNTA 3MSSA 4XG2A 4HPUE 5I4NA 1PXPA 2F7XE 4FT0A 4IVCA 2R7BA 2BR1A 5FEQA 4Y72A 3TTJA 2PVJA 4UYNA 1SMHA 2C1AA 5AP7A 1YXXA 3G2FA 4FTCA 4S33A 2CJMA 4XJ0A 3TDWA 3TNQB 3AC8A 2WTWA 4PWNA 3UYTA 4UXQA 4ZXTA 4N0SA 4MBJA 4ZS4A 1VLRA 2F49A 4QT1A 4Z16A 3MS9A 3QX4A 4YJPA 4X3FA 3ZLWA 5LWMA 3O96A 2YM7A 2W1IA 5EYMA 3LQ5A 5H8GA 4BDFA 2WEVA 4E1ZA 3UZTA 3QUEA 5HLWA 2VWBA 2BVAA 2VWYA 3GBZA 4BKZA 4CYIA 3LCOA 2J2IB 4K9YA 4S2ZA 3NUAA 2R3MA 2JBOA 5EOBA 3IQ7A 5EI6A 2UZDA 4FOBA 4I20A 4O1OA 5AP2A 3UC4A 3PP0A 3NW6A 4B8MA 4C3PA 5DT4A 4ANBA 3P7CA 4AA4A 4CFXA 3FI3A 4I6QA 4RFZA 5ICPA 5CY3A 1ZY4A 3GGFA 4ZTSA 5C4LA 4BFMA 5HG5A 3HV5A 3DCVA 1FPUA 4L7FA 3HRFA 3ZFXA 3O8TA 3U87A 2UW4A 2XYNA 4O4CA 3F3ZA 3PP1A 4NFMA 3ORLA 2CPKE 3SA0A 3HMPA 3AD4A 5J9LA 3KK8A 4QMTA 2VTSA 4UYAA 1PXIA 4A7CA 4D9TA 2O2UA 3QD2B 4RT7A 4ZZNA 2J4ZA 5IA0A 3B8QA 5J9YA 3R9RA 2PYWA 2ZM1A 2G01A 3B2TA 4QMMA 2NYAA 3ZFMA 1XMMA 4FKVA 2F7ZE 3VJNA 4E20A 3P5JC 5EKOA 3SXRA 4DHIB 3VONA 4DG0E 3QCSA 4IACA 4LL0A 4GRBA 4XV1A 4C3RA 2EXMA 3QC9A 4QP6A 3UQCA 4Z9LA 3Q04A 3FLYA 4BCNA 1DI8A 4KKEA 4ZSJA 4CKIA 2J51A 3BBWA 5IQHA 4I0RA 4KIKB 3QA8A 4L45A 1ZAOA 2PPQA 4O0YA 2YITA 3RALA 3SVVA 4FNXA 3AKKA 3RTPA 4YZNA 2J0LA 2QO9A 3HYHA 3DB8A 3JYAA 3IW5A 2X4ZA 3NNXA 1YW2A 2WPAA 3GFWA 1ZYDA 3Q2MA 4PDOA 5AA8A 5I9VA 5IQDA 1ZYSA 5AR5A 3FV8A 4D0XA 4LQMA 1OPKA 3RWPA 4MF1A 4L44A 3UQGA 4RIYB 3DKGA 5AV0A 3VF9A 2V62A 2OW3A 3L9LA 1Y8GA 2P3GX 2WELA 1H28A 4QYFA 4D1XA 5BUJA 4FV8A 2WMWA 3CE3A 3U51A 3V8SA 2XRWA 3ALNA 4TPTA 2O3PA 4I23A 4YTFA 4RLKA 4FKPA 3VUTA 1UNLA 3QU0A 5IA5A 3KREA 4BZDA 2R3LA 2WMQA 3RKBA 5BYYA 3O17A 4RJ6A 2AC5A 5CU0A 1TZDA 3KRXA 4RPVA 5AUZA 3CGFA 3GCPA 1VYWA 4YURA 1W2CA 4WT6A 3H3CA 4O7NA 1WBSA 1G5SA 3W33A 4FYNA 1YDTE 5E9EA 3OZ6A 3W32A 3IW7A 5CQWA 4B4LA 1PYEA 3H9FA 1BYGA 3AC2A 3FMMA 4XEYA 5AR4A 3LMGA 3LM5A 4BYJA 3HUBA 3OCTA 1BI7A 4DC2A 4AZSA 3FXZA 4BKJA 4BGHA 3UIBA 2X8EA 3KN6A 4G31A 3MESA 3SC1A 5HTIA 4IX5A 5CAVA 5AM7A 4FI1A 3QHWA 3VF8A 3HL7A 4HNIA 1Q3WA 4LGHA 5GJDA 1Y6BA 3IS5A 4XNEA 5KMKA 5JFSA 2J50A 2B7AA 4I4FA 3ORPA 1KUTA 1GY3A 4OGRA 1XH9A 4R5YA 3L9MA 1WAKA 1M7QA 3KU2A 3KKVA 3KVXA 2GPHA 4M97A 4RVKA 1A06A 4HOKA 4KWPA 3RHXA 3ZBXA 4CXAA 5CQUA 5DRDA 2UZUE 3QRKA 4DGLC 3FLZA 2C5XA 2C6TA 2UZBA 5E91A 1I09A 3P9JA 4IWOA 5GJGA 5BVWA 4KIOA 3ZS5A 2XUUA 4YTHA 2YIQA 4JT3A 4U6RA 1U5QA 5I9XA 2Z8CA 1Q8UA 1ZWSA 3VS4A 4MBLA 4YHFA 2CGWA 4D58A 4DEAA 4LDTA 2VO7A 4BI2A 4G3DA 2OH0E 5CU2A 4ZSEA 3A60A 1IASA 1XJDA 1JLUE 1Q41A 3FHRA 4FOCA 5AADA 4IJPA 5JQ8A 2XP2A 3BLRA 4MNFA 4NJDA 4PQNA 5CAOA 5HZNA 4AT5A 3F88A 4LL5A 3W1FA 1JOWB 2JLDA 3HMNA 4KABA 4DH5A 3RCJA 2GHMA 5EHYA 2XS0A 3FXWA 5EW9A 3VS2A 4EQCA 3RPRA 4HJOA 2W1FA 4IHPA 4DTBA 3BV3A 3C4FA 4FKJA 4GJ3A 4R5SA 4XG3A 5FDPA 4D28A 2OKRA 2VWZA 5BVEA 2RG6A 4FNZA 4D55A 4KD1A 1XMLA 2C3JA 4JQ7A 5JZJA 2JDSA 3NW5A 1URCA 4GVAA 4N6YA 4FTTA 5JRQA 1ZOGA 4GJ2A 3EN9A 3V5TA 1H26A 1NVRA 3Q60A 5G6VA 3ZO4A 2JITA 4GT4A 5FD2A 3CKWA 4QTEA 4FX3A 2JGZA 3NCGA 4R3RA 2HWOA 3BEAA 4TWNA 4RFMA 2P0CA 1PXKA 4BCJA 4GMYA 4EC9A 1S9IA 4L53A 5C26A 3OCGA 4XLVA 3PA3A 4EHZA 3NUYA 4AZWA 1WZYA 3JVSA 2ZMDA 3UNJA 2CLXA 4V0GB 2YIXA 2R3OA 3R28A 4FGBA 4MXOA 4N70A 3ZDUA 3RI1A 1J7UA 2PMIA 3QTIA 5HNGA 4H3PA 3HP2A 3KF4A 3TL8A 3NVKI 5D11A 3CKXA 1GZNA 4WD5A 4ASEA 4FGRA 4FZDB 3VIDA 3R8PA 4XP3A 4FIEA 4OBPA 1G8JA 5ETFA 4WRGA 4YSMA 5IQFA 4BWPA 5HI2A 4BHZA 3AGLA 3H0ZA 1U4DA 4JI9A 4M15A 3TG1A 4M8TA 4C61A 2ZDUA 3Q6WA 4EH9A 3ML1A 3KB7A 3W0NA 3HZTA 5F95A 3G9NA 4GS6A 3JY9A 3UVRA 5BMSA 3E3PA 4J8MA 2WFYA 3WZJA 3TYKA 3ZO2A 5A4LA 3QALE 3I81A 4FVRA 5CXHA 3UC3A 5IQAA 4W4YA 4MD9E 1OKZA 2PUNA 1Q8TA 2OSCA 1IAHA 5K4IA 5ETIA 3NR9A 3ZFYA 5C4KA 3TI1A 3KXXA 4I0TA 2GQGA 4ANLA 4BGGA 1RDQE 5J7BA 4HCVA 4F70A 3QBNA 4I6HA 3WOWA 5TF9A 4C4JA 3QRIA 4DHZA 3DKFA 2BDWA 3PRIA 3SXSA 2F57A 3NX8A 2WTVA 5CEIA 2GDOA 2X8IA 4YJTA 2CGUA 3PXRA 4ANQA 1J91A 5AV2A 2R3RA 3QRTA 4APPA 3E5AA 4L68A 1SYKA 3MH3A 3R04A 1XWSA 2YEXA 5H3QA 2E9PA 4JIKA 3DK7A 4K11A 2IVTA 4E5WA 1XBBA 3RPSA 3LPBA 3BCEA 3OY1A 4PTEA 3ULIA 4AX8A 4MD8E 3I60A 3S95A 2J0JA 1BUHA 4CG9A 3FMLA 3RNIA 2YZLA 1UKHA 1Y6AA 4IH8A 4FEQA 3E8EA 3BEGA 4O4FA 1WVYA 3PE2A 3HA6A 4XBRA 3ZH8A 4IDTA 2XNGA 4JBVA 4R78A 4I6BA 4QTAA 4UV0A 3OP5A 3PSCA 3MV5A 1V0PA 3VRYA 3CQUA 2Z60A 5HCZA 2WQBA 4R7BA 1WBPA 4H39A 5EHLA 1E9HA 2J7TA 3QHRA 2WAJA 2E9OA 4IAAA 4ITJA 5DG5A 4C2WA 3D94A 3DU8A 3O7LD 1PXLA 2C68A 4D2VA 1YOMA 2VV9A 4QP4A 2XIRA 4PTGA 4IAZA 2E9VA 4K33A 4PL5A 1UWHA 3Q5ZA 4GK4A 4AUAA 3V5PA 4DEDA 4LV5A 5L2WA 2H96A 3PE1A 4C3FA 2OI4X 1AQ1A 2WMXA 2YERA 1H1WA 1X8BA 5DIAA 5ANOA 3C7QA 3PVGA 3IDBA 3TZ7A 4JDHA 4IM0A 5AUVA 4EOSA 4FVQA 5J5TA 5CI6A 5L2TA 1JKSA 2YCFA 5EW3A 3VS0A 1M2PA 1H1SA 4HGSA 5GIOE 2G15A 2Q0BA 3PYYA 3QTWA 3Q6UA 4L3PA 1OBGA 1R78A 5CTPA 1LP4A 2VTAA 3LQ3A 3DV3A 3QWJA 3BGQA 3BHYA 4V04A 2H6DA 5KBQA 5FXSA 5A6OA 1KSWA 3PXYA 4CZTA 1Y91A 2HZ0A 3DXPA 3HDMA 2Y4PA 1TFFA 3QF9A 4FV0A 4ZTLA 4OT6A 4U45A 4ACHA 3HDNA 4EH5A 4HYHA 3FMEA 4M68A 3TXOA 2WTCA 4BCOA 2JIIA 3QQHA 3OW4A 2H9VA 4UY9A 3ORMA 5LCJA 3O50A 5LMKA 1LUFA 3QCXA 4WHZA 1J3HA 3F3VA 2VWXA 4BDAA 4O2PA 1CKPA 4FKUA 3PSDA 3R02A 2HZIA 2YJRA 5FEDA 4CFMA 3UOJA 2FSOX 3TNIA 4RIYA 2BIKB 3PJ8A 4X7QA 4UZDA 2HOGA 3CR0A 4CRSA 5LJJA 4YJNA 5GHVA 2XEZA 2C4GA 2RL5A 3RHKA 4FKQA 3MPMA 2BAJA 3VUDA 4FSZA 3EFJA 4ZZOA 4G5PA 4W4WA 3VS1A 4CYJA 4QMNA 2XM8A 2C6DA 4AZEA 3GU7A 3WF7A 3QL8A 3HRBA 4FSYA 2CKEA 1PYXA 3GFEA 3W0PA 3EL7A 2VTJA 3ROYA 4EJ7A 2IN6A 5HE0A 3UP7A 4EL9A 3KQ7A 1PHKA 3NUXA 2RFNA 1CTPE 2YA9A 5E8XA 3L9NA 3NLBA 4CKRA 3GOKA 3DT1A 3L8VA 2ZJWA 4FODA 3FPQA 4BR3A 4ENXA 2QOKA 3PWYA 3C5UA 5L2QA 3UO4A 3SV0A 4D2TA 3PUFC 2YM8A 4C02A 2IVVA 3OT3A 4B8LA 4FL3A 3FHIA 4CT2A 5IISA 4AXFA 4JRNA 2R3HA 3RK5A 2W1EA 3U9CA 4BDDA 4F4PA 5H8BA 3MTLA 3EQPA 4U80A 4OTPA 4PF4A 2C0IA 2CMWA 2OXDA 3V01A 3ACKA 4J71A 3ATTA 3O51A 2VTIA 4IQ6A 3KCFA 2C6EA 4I22A 2GS6A 3Q9XA 1IEPA 5CLPA 3UODA 5J1VA 5E8WA 3RAWA 2BAKA 4AN9A 2Y7JA 4RX9A 1XHAA 1KV1A 4O4DA 2W1ZA 4YO6A 2PUPA 3LMHA 3RAKA 3SGCA 2R64A 2WMVA 1H0VA 5JQ5A 2ESMA 3LJ0A 3QTSA 4TT7A 1HOWA 1YHWA 2WB8A 2UZEA 5DR6A 4F9YA 3AMBA 2XBJA 4ENYA 3FKLA 2GNLA 3W2CA 4O2ZA 4J98A 3BL7A 3AKJA 2XARA 3NCZA 4AG8A 4CMUA 4A4XA 4I1ZA 3LFFA 3TIZA 4IFGA 4EH6A 2WD1A 3K3JA 4D1ZA 2WQEA 2GS2A 2Z7LA 4F64A 4WBOA 1IR3A 4ACDA 4ERKA 3MJ1A 5KMLA 2C3KA 3QWKA 5CU3A 4RSSA 2UZOA 5FRIA 3TJCA 2W4OA 3W2RA 4AQCA 2YIWA 1UU8A 3MFUA 4I0SA 4EBWA 3A2CA 5JGDA 3ROCA 1VEBA 3P0MA 4UBAA 4OTIA 4IC7A 3U8WA 5JKGA 4R1VA 4DCAA 2C0TA 1ZZ2A 3L9PA 3F7WA 4IAFA 5DLSA 4Z7GA 3NUUA 4O0XA 4BDGA 2PUUA 2OK1A 3VWAA 4AFEA 3R21A 2HYYA 3R7OA 3E7VA 2CGVA 4AW5A 3CY3A 2J0KA 2C5OA 3BYVA 3ZO3A 1JPAA 3NIEA 5JMSA 1IG1A 1ZARA 1BKXA 3Q53A 4MWHA 2BRMA 5I5ZA 3UOLA 3UMWA 4PY1A 2AQXA 4K8AA 4KS7A 4RQKA 3KRRA 1W98A 4R7IA 4BTJA 3TJDA 4MYGA 3CP9A 3KN5A 4N4SA 3BHHA 4F7LA 2XAOA 3OBGA 2ZB1A 2PVFA 5A3XA 4QMPA 4Q9SA 4D1SA 3A7JA 1B39A 2AUHA 4FC0A 1H25A 4OW8A 3QLFA 3K5UA 5DN3A 4BDKA 3Q5IA 2PZRA 4H36A 3BQRA 5F94A 3TACA 2EXEA 4BCQA 2W1DA 2WTKC 3T9IA 3AC3A 5ANDA 3NNUA 4FEVA 5EFQA 2E9UA 4YO4A 3QGYA 4I21A 3V6SA 4GG5A 1JSVA 4GU9A 2XNEA 4NW6A 1GNGA 4NT4A 2GCDA 3EQIA 3FC1X 4DLJA 5A4QA 1OUKA 2QHNA 4YJUA 2HAKA 4WUAA 5B2MA 5DHJA 4L52A 4NTSA 5CSVA 3R9OA 4DFYA 2ONLC 3C0HA 4AXAA 3DBDA 4RJ5A 2X1NA 4FSRA 3VBVA 2ITVA 3DBFA 3W2SA 5DRBA 2FO0A 5JFWA 4EKKA 3OS3A 5CF6A 5HCXA 4XOYA 4YZDA 1FMKA 5JZNA 4F08A 5L3AA 4KINA 5EYDA 1OIRA 1FMOE 5FBNC 4IAIA 3P7AA 5T3QA 3M42A 5TKDA 4E3CA 5LVPA 2BHHA 3FL5A 5C1QB 2WOTA 3CC6A 4IJ9A 3TNWA 5IH5A 1WVWA 3B8RA 4Q5EA 5IEVA 1H00A 5HEZA 4FTOA 5KO1A 2R7IA 4MK0A 3KULA 2UW8A 2VO0A 5IUHA 4OTDA 1JVPP 5JSMA 3QGWA 3MH1A 3A7HA 1NXKA 5L8LA 5DMZA 3UIMA 4EH7A 5LXMA 2QQ7A 3ACJA 1GZOA 1OL1A 1Q8ZA 2VNYA 5E1EA 3ZEWA 5B7VA 4IX3A 3UQFA 4CQEA 2QU5A 2W05A 2W9FB 4I3ZA 5CNNA 3O5AA 3TUBA 2H34A 4AN2A 2A98A 3DB6A 3TUDA 4QP8A 2HZNA 3PPZA 3R1QA 4O7RA 3NUSA 4G5JA 4RC3A 4LRJA 5CXZA 4AA5A 3ALOA 3DS6A 3FYKX 4O0WA 2X81A 4C35A 2J90A 5C8MA 2OJJA 3EB0A 3R8VA 3LQ8A 4EHVA 1ZMWA 3FI2A 2P33A 2XRUA 2C6IA 3KRWA 4U7ZA 4W9XA 2OXXA 3EIDA 4V01A 4W8DA 4AOTA 3T8OA 4O7TA 4HZSA 5DGZA 4NZWB 4USEA 5CWZA 4DDIA 2X7OA 2JAMA 1Q62A 1IAJA 5FUTA 3LJ2A 3OD6X 4H1MA 4K1BA 2R2PA 4YJQA 1PY5A 2P4IA 4LI5A 3AT3A 4G2FA 2GFSA 3D14A 2VTOA 2P2HA 4YNOA 4EK8A 4II5A 1WBNA 5E90A 3GC9A 3RM6A 1OKVA 5HD4A 2R3FA 4OAVB 3S00A 4L42A 4YMJA 1YXUA 3OEZA 3FBVA 4GK3A 3AT2A 5BYZA 4AW1A 1GZ8A 5HU3A 5KHWA 5M4CA 1WCCA 3PIXA 4L43A 5H8EA 3RCDA 1QCFA 4H3QA 4Y85A 4QMZA 4RQVA 4X6RA 2WGJA 4YC8A 2LGCA 3AC5A 3F2NA 1MUOA 4ACGA 5EKNA 2PUIA 2IZUA 3DA6A 4N6ZA 3LXLA 4FTMA 2O8YA 4IIRA 5FTGA 2B53A 3FZ1A 2ZM3A 3NUPA 4L6QA 1YI3A 2VNWA 4QQ5A 4KKGA 1BX6A 4PPBA 3DFAA 3RPOA 4NIFB 4C8BA 2IZTA 3EN5A 3UZPA 4GKHA 2X0PA 3OWPA 3G6GA 1P5EA 4A9RA 2P55A 1YXVA 5IQEA 4LM5A 3R9HA 2PHKA 4M7IA 1OBDA 3CEKA 5FTOA 4FMQA 3TNHA 5HG8A 4JMQA 4E5BA 3GC0A 4EOQA 3BZ3A 2QKRA 2A19B 3HV3A 3C4XA 3R63A 3DAKA 3GCQA 4F7SA 2WZJA 1NW1A 2PK9A 5IA2A 4FTNA 2XK7A 1J1CA 3PA4A 4MD7E 4NFNA 4UALA 4HYUA 4FKOA 3VS5A 3BLQA 4D2SA 3GOPA 4J99A 4MNEB 2ITXA 4M0YA 5BQ0A 4E26A 1O9UA 2QR7A 3F5UA 3M11A 4L46A 4C7TA 1RE8A 1JSUA 3I5ZA 4NK9A 4TY1A 2O65A 3PVWA 1H0WA 3RWQA 3QRUA 5CF8A 1GIHA 3DFCB 3E87A 3QYZA 3CS9A 4W9WA 5IA4A 4O7VA 5T6KA 3EH9A 1Q24A 1VZOA 2B55A 5FGKA 3DAJA 4M14A 4UX9A 3DQXA 3NAXA 5HE1A 4Q2AA 3MJ2A 2C3LA 3FQSA 4KIQA 4GH2A 1UNHA 3DJ5A 4DH8A 4IB5A 4H58A 2JDTA 1K9AA 3BX5A 4PMTA 2RGPA 4OLIA 4LOPA 3ATSA 1HCKA 1R0PA 3FZSA 3G90X 1JSTA 4QPSA 3VUGA 4JBQA 3LXKA 4F9BA 2O64A 2QHMA 3QKLA 2B0QA 4GIIA 5I3RA 1OUYA 3O2MA 4QQCA 4IX6A 4R6VA 1YDSE 4Y5QA 4O83A 2HIWA 3IONA 1YQJA 4U8ZA 4GK2A 3EQDA 4TWOA 1XH5A 3P23A 3PWDA 4MAOA 3WF8A 4O7YA 4O81A 1DI9A 2OFVA 4EK6A 1R39A 3IOKA 4QTBA 1O6LA 2I0VA 4I4EA 5CT0A 4I5MA 4B7TA 4EH3A 4RWLA 5EM5A 2BILB 1M52A 3LLAA 2WO6A 3FLWA 2EWAA 4FTAA 4IZYA 5DWRA 4JX3A 3MW1A 3GQIA 2OH4A 2AC3A 3E63A 4XLIA 1F5QA 1T45A 2HXQA 2GTNA 2PTKA 4A9SA 3WIKA 5HU9A 3GVUA 4TYEA 3QX2A 4EKLA 4EWQA 3SAYA 1Y8YA 2R3IA 3QXPA 4FL1A 4FBXA 4DT8A 5DA3A 4EJNA 3C4ZA 4DTKA 5L2SA 2GHGA 4EH2A 2BZIB 2YCRA 4DHFA 3GUBA 2XJ1A 4FG7A 4GIHA 3D5UA 3KEXA 3O0GA 4AW0A 3GNIB 4IDVA 4FTJA 5CZHA 3ULZA 3DNDA 5K5XA 2AEGA 4DBXA 3ORZA 3TZ8A 4GCJA 4JRVA 4V05A 3RAHA 3CIKA 3QCQA 4F6SA 3R71A 5IUGA 3GU5A 2O0UA 3UJGA 3LXNA 4H3BA 4XX9A 5F9EA 4BDHA 3JR1A 4FKSA 3W0MA 3LLTA 4ZJIA 4BI1A 3MB6A 3IOPA 1FINA 3PSBA 4Y95A 3REPA 4EBVA 2PE0A 3IO7A 3QAME 4QMVA 4MXCA 3DY7A 4A07A 3O71A 1KE9A 3II5A 4PV0A 4TNDA 4ITIA 4UWCA 3WYXA 4N57A 5JFVA 3OW3A 1PKGA 1SNUA 4F1OA 5C8KA 3PY3A 1UNGA 4O1PA 1PMUA 3EL8A 4ITHA 4RJ3A 3W8QA 4TXCA 2RKUA 3ZTXA 4AACA 5IH6A 4EHGA 3G5DA 4CKJA 4FIJA 4QMXA 3A8XA 4IW0A 5K5NA 3ZSIA 2WTDA 4G6NA 1FGIA 3EWHA 5H2UA 4CZUA 1YKRA 3WILA 4RJ4A 3MVMA 2R3NA 3CPCA 5KMMA 2C30A 4O0RA 3I5NA 3NWWA 4O4BB 4CGAA 3V3VA 3EN7A 1S9JA 3C0GA 5HIEA 4G17A 4H1JA 2HWPA 3MPTA 2HW6A 1GIIA 3DXNA 5T68A 3ZLSA 4C62A 3K54A 4BDEA 4I24A 2OJGA 4KRDA 5HE3A 5CVHA 5DE2A 3W2PA 4A4LA 3PDTA 3IGGA 4DH3A 4PDPA 3HGKA 4FSQA 3TZMA 1UVRA 2YDIA 3UP2A 2YWVA 4ZLYA 4ZAUA 2HZ4A 4EOJA 2XK6A 3OXTA 4FKWA 4TTHB 4BL1A 5HQ0A 4AOIA 4LOQA 4DEHA 3UPZA 4U42A 3W0SA 4RVTA 2X2LA 4AF3A 4ANOA 5K0KA 5FWKK 3CJGA 1TKIA 5CANA 5EQYA 3DBQA 4G9CA 4RIWB 3LFBA 5IH4A 2CNUA 4HYSA 3FDNA 5L8KA 3DXQA 3P4KA 5KMJA 3R8ZA 2B9FA 5EK7A 3U55A 3W0RA 4JG7A 3RM7A 4HVDA 4JAIA 4EQMA 4IZ5A 4ALUA 4HVIA 4FV1A 4A4OA 4K0YA 4KKHA 4FJVA 3OOGA 4E4XA 3RK7A 3CD3A 4R77A 3I7CA 3FLQA 1G8SA 2YM3A 3IW8A 3S3IA 4OT5A 1NA7A 5EG3A 3F2AA 4GW8A 1REJA 3ORNA 4ZP5A 3R0TA 3OTUA 2B9HA 4LUDA 4JDIA