2XM8A

Co-crystal structure of a small molecule inhibitor bound to the kinase domain of chk2
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
293
structure length
265
Chain Sequence
VYPKALRDEYIMSKTLGEVKLAFERKTCKKVAIKINVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Structure-Based Design of Potent and Selective 2-(Quinazolin-2-Yl)Phenol Inhibitors of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 58
structure length 265
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xm8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xm8A01
4UZDA 2WTDA 2HZIA 4YJRA 3Q4UA 5D9HA 3VRYA 4O7TA 3PXFA 4NM0A 2UVXA 1OM1A 1W83A 2FSOX 4XNEA 4NUSA 4MWIA 5FEDA 4RZWA 3FBVA 3I7BA 4D5HA 3RNYA 1ZYDA 2EVAA 2R7IA 2GS2A 3EIDA 5BYYA 4LGDA 2PU8A 2H96A 2ONLC 3QLGA 3FMMA 3ZFMA 5KMNA 4MKCA 2ITOA 4FNZA 3DKCA 3BYVA 5AP6A 5JGBA 1E1VA 2XNMA 4DH8A 3CQEA 1WZYA 2ZVAA 3FLQA 2XIZA 3P79A 3VBWA 4U3YA 3QZHA 4BCHA 4TYHB 1Y6AA 5GZ8A 1OL7A 4I0RA 4ANNA 3RZFA 1A48A 3W1FA 4I0TA 4A7CA 3FLWA 4ZLZA 3SXSA 3COKA 3MY0A 4E73A 3VS7A 5I4NA 5EQYA 2VX0A 1GIHA 2OZAA 2JD5A 5CF5A 5J9YA 3TACA 5IA1A 5KHWA 1KE5A 2WOTA 4C3PA 1J3HA 2OJFE 4LOQA 4X2KA 5EHYA 2YITA 4MH7A 4IQ6A 2FSMX 2HENA 3ALNA 5L2QA 3U8WA 2ZM3A 1NXKA 1SZMA 4I92A 4P90A 3GU4A 2WQOA 5AV1A 3D15A 4FI1A 3QQHA 4BI0A 4DITA 1WFCA 5G6VA 1WBWA 3EMGA 4L3LA 3DXQA 5HIDA 4NCTC 2O5KA 4EK6A 2J0IA 3C51A 3R28A 4KS7A 4ZTLA 2ZJWA 3FMLA 2EB3A 2IO6A 3MY1A 3DB6A 4ITJA 3RHKA 2YLEA 2W1HA 3A2CA 3LFEA 1J7LA 3AGMA 3SOAA 4L52A 4XG8A 1MQBA 2UW3A 2PSQA 5C8NA 4O84A 4ONAA 3EYGA 2C5VA 2UZBA 2J7TA 3VUGA 3DKOA 3TKHA 4B9DA 4LGHA 4DLIA 3FZSA 3R8ZA 4O91A 2BTRA 3DY7A 3R63A 2GU8A 3AOXA 3WARA 3EWHA 4IBMA 3R2BA 1FGIA 1JVPP 4M69B 1NW1A 1Q3WA 2V55A 3EZVA 3MTFA 4QQJA 1E9HA 4YBKA 5AAFA 4YHFA 3DCVA 3KFAA 5AFVA 2QU5A 4MXCA 2EU9A 2VO0A 1Q8UA 4X3FA 3VF9A 4RRVA 4C4FA 5HO6A 3LMGA 3GXLA 4FNWA 1YWVA 5HORA 3HECA 3GC7A 3I0QA 4L8MA 3MIYA 4Y5HA 4ZS4A 2ERKA 4XS2A 5CVHA 5CEQA 3BLQA 3NCZA 3Q9YA 2ITPA 3U87A 3FUPA 2HCKA 3ELJA 5L2WA 4F63A 2A4LA 2RFNA 3E8DA 4N57A 1OPKA 2BKKA 2Y6OA 5KMIA 4QRCA 3V51A 5E1SA 5CVFA 4UWBA 3D83A 4B0GA 5A46A 4FT7A 1PYEA 2ZM4A 5KMOA 4DHFA 1X8BA 1WBNA 1ZYJA 2FO0A 3POZA 3RBWA 2V62A 2ZYBA 4RWIA 1WVXA 1B39A 3W2RA 1YKRA 4D28A 3FC2A 3POOA 2PYWA 4ENXA 2E9NA 3P9JA 5FEQA 4ZOGA 4NFMA 5AUZA 4EHEA 3G9LX 4Y83A 5JH6A 4I6BA 4H3BA 4KKGA 3DT1A 3L9LA 1H26A 2W1GA 1OUYA 2B7AA 3QYZA 1KUTA 4CEGA 2HZ0A 2PVMA 2CKPA 5JSMA 3IW5A 3MIAA 2X6EA 2ZV9A 5HG7A 3ZXTA 3R71A 4K18A 5DBXA 1BYGA 4O7WA 3NRMA 3SOCA 3GCVA 3F5UA 3FLYA 4YJUA 5M08A 2QU6A 1FINA 3CKXA 3PFQA 3R9OA 4F0FA 3KXMA 4FEQA 4G9RA 4MWHA 4XP0A 4F9WA 5HKMA 1YQJA 2DYLA 4TW9A 4WIHA 2R3MA 5C27A 3TI1A 2X9EA 5CLPA 4BYIA 2NRYA 3Q5ZA 4HYHA 1T45A 5EKOA 4CMOA 4DEHA 5LMBA 3ZO4A 2VTNA 1YDTE 4IFCA 4TYEA 4DEGA 2OKRA 3ORTA 1UWJA 4ITIA 4KABA 4YPDA 4A9YA 2YJRA 3NDMA 3NCGA 3ORZA 4EUTA 4C38A 3EN6A 5HIBA 3VUHA 4BCFA 2GTNA 1W8CA 2R4BA 2OBJA 4ZIMA 4U97A 5IISA 1P14A 2Z02A 4M97A 4GG5A 5CENA 5GINE 5GHVA 3DLSA 3PVBA 4LRKA 4M3QA 2ESMA 3UG2A 3CJGA 4QP8A 2Y4PA 4B8MA 3S3IA 5IQGA 4K1BA 4CCUA 3JY0A 4KRDA 4Y95A 2Z7LA 4E6CA 4UBAA 4C33A 4DEEA 3HNGA 3BYUA 4IFGA 3S2PA 3G15A 3U4WA 2ITUA 3LZBA 2G2HA 5IH4A 4RJ8A 4YLJA 3RI1A 5FGKA 2JDSA 4BDIA 1PXPA 1Q62A 2V22A 4BBEA 4E5AX 1H01A 3R83A 5I0BA 3VHEA 4QQ5A 3BU5A 4FVQA 4NIFA 3OY3A 4BDAA 5FP5A 4JJRA 4E4NA 5JFWA 2OICA 4MX9A 4GRBA 2OG8A 4IH8A 4EK8A 3CY3A 4FIFA 5CY3A 2R3NA 2C47A 5FBOA 3UYSA 5C03A 4K6ZA 1OIQA 3TG1A 3GFWA 4QPSA 3TV7A 5HE3A 1Q8YA 2HWPA 2JDRA 2PVLA 4OUCA 4GU9A 4FSTA 2W7XA 4MBJA 4LI5A 5FRIA 3ZC6A 3DBDA 2JFMA 3FYJX 4I24A 5M07A 2YDIA 5HTCA 2XS0A 2YM8A 1XJDA 4AN3A 4RX7A 3T9TA 2B4SB 2PHKA 2WMWA 3BELA 2VO3A 4RMZA 3VS4A 5E8VA 2ITTA 3AGLA 3F2RA 2C3LA 3FMNA 3MTLA 5KMJA 4FMQA 3GBZA 3SA0A 3TNQB 5LMKC 3LJ2A 3T3UA 3U6HA 2X2LA 4EL9A 2CKOA 4WO5A 4RSSA 3IK3A 4LUEA 4EZ7A 5BVOA 3BPRA 1W82A 4TZRA 2QO7A 3BIZA 4AP7A 4USDA 4ANOA 3Q32A 1T46A 3C9WA 3LFBA 3S00A 2OXXA 4WKQA 2WMTA 5LJJA 4GK4A 3OF0A 4BI1A 5L6OA 1FVTA 4BR3A 3KC3A 4DGLC 3ZTXA 2X8DA 4EH7A 5IEVA 4EZ5A 3AD5A 3UG1A 1HOWA 4CD0A 5KMLA 3BKBA 5HNBA 3VULA 4EK5A 5BVDA 2GQSA 4ZTQA 2O3PA 4QP7A 2P4IA 3DK3A 3R0TA 1ZYSA 4HGEA 4N6YA 4D1SA 2XK7A 3Q52A 4CFMA 1JAMA 2FYSA 2R3KA 2W1EA 4IM3A 4ALUA 1QPCA 1VYZA 3ZRLA 3G2FA 2BALA 3SV0A 4YMJA 3H9OA 5KKRB 2OJGA 5CT0A 4PDYA 2ETKA 3VQUA 2EXMA 4BCQA 4ENYA 3RMFA 1QCFA 2BROA 3KN5A 3EFKA 3R7UA 1VZOA 3NEWA 1P4FA 4GYIA 3A7IA 3ZEPA 4E8AA 3EL7A 3MDYA 1XQZA 3O8PA 1RJBA 4KIKB 4WNOA 3VUKA 4DCEA 5M06A 3QCSA 2VRXA 2J2IB 4ZMFA 1Z57A 4WSQA 4BTFA 2XIKA 3OT8A 4BDBA 5KNJA 4LFIA 2VTQA 3RALA 1OBGA 4NKSA 3UNZA 2CPKE 5L6WL 4S34A 3N51A 3WILA 3DPKA 2IVSA 1ZMWA 2QG5A 3BI6A 2VD5A 3VBVA 1ZRZA 3R8LA 5HBJA 4DEBA 3HLLA 4YR8A 4AW5A 1OKWA 4ZJIA 3K3IA 5AUYA 3HV5A 2HY81 4GT4A 3F3VA 1Q97A 3RP9A 1YHVA 3IOKA 2OLCA 3AT3A 4C61A 3F66A 4QO9A 3ZU7A 1HCKA 3MA6A 3WZEA 2E9OA 2CDZA 2XK6A 3QD0A 4IM2A 4YP8A 3QZGA 4CMUA 2XYNA 3A62A 2VWWA 3ZLSA 2W4KA 5AV0A 3OXZA 5JT2A 3HUBA 2F49A 3BHHA 3DGKA 2QOBA 4D1XA 4F7LA 1QPDA 1YOMA 4FG8A 4GUEA 1I44A 4EWHA 1GOLA 3L8XA 4JG8A 3LKMA 5KHXA 3OUKA 4QMQA 4QD6A 4FSNA 5JQ8A 3KB7A 2HELA 2XJ2A 3V5QA 4DBNA 5ANKA 1PJKA 1PF8A 3LFFA 3FMEA 3ORMA 3RM7A 2BIKB 1OPJA 1PY5A 5E8UA 4D2SA 1KSWA 4HYUA 3FLSA 3P1AA 3QALE 4FKOA 5HLPA 2PY3A 1GZOA 1H0WA 1V0BA 4L7FA 4BKZA 3BYSA 4DBXA 5FEEA 4FL2A 4KWPA 2GQRA 3D7ZA 5M57A 4AA4A 4RLKA 4IWDA 3DBCA 2WMSA 4QMUA 3FSFA 4FODA 1P5EA 3L9MA 1XH9A 3UJGA 2ZDUA 2BKZA 4ZTHA 3RK5A 2PUPA 4BDGA 4W4XA 3UDBA 4UXLA 2WQMA 2X81A 4LOPA 3MPMA 4UMQA 5I9XA 4AU8A 4PY1A 1IA9A 4ERWA 4O81A 4QMMA 1QPJA 4LUDA 3TV4A 4I1ZA 4L45A 4ITHA 5IEYA 3CC6A 2CGXA 5AAEA 3KRLA 3LM5A 3W16A 2FUMA 1U54B 1ZWSA 2GS7A 3DBEA 4BBFA 2WMBA 4FTRA 3VIDA 4J1RA 4MCVA 5I9WA 3VS1A 3CXWA 3LFAA 1R78A 2IZTA 2WMAA 3DLZA 3ZH8A 3MFRA 5I9UA 4WRGA 4HVIA 2H8HA 2WEIA 4FKPA 2OIBA 1JKSA 2W06A 1PXMA 4DFZE 5IQAA 4XG7A 4KRCA 4YBJA 3TWJA 3S0OA 5M51A 2PVJA 3UZTA 4JRVA 3V5TA 3C4CA 1CM8A 3A61A 3S95A 3D5UA 1SMHA 4KUJA 2OH0E 4B6LA 2XM8A 3TIYA 1WBOA 4GUBA 4BHZA 4GT3A 4DTKA 3Q53A 4E20A 4X0MA 4UEUA 2J6MA 2ZM1A 4TYGA 2VX3A 5AR8A 5HBEA 3TN8A 3IDBA 2WQBA 4FZDB 5BMMA 4ASEA 5M44A 2UW8A 4YLLA 5DR6A 3UP7A 3QZFA 3JVSA 4MD7E 4ZZNA 5CF8A 4G2FA 3EQHA 3Q4TA 4C4IA 1OKYA 2BHEA 3I4BA 5CEKA 3OCGA 3BU6A 1YOLA 3D4QA 5K4JA 2JLDA 4UB7A 4ZSAA 3LXLA 1MRYA 5L2SA 1LUFA 4DAWA 3UQCA 4FR4A 3R01A 4FUYA 4F64A 1H27A 4BCOA 3UYTA 3RAHA 2CKEA 2UZEA 3UZRA 1M2PA 2OZOA 4HOKA 4LG4A 2AC3A 4NTTA 4XUFA 5EM8A 4EOPA 1GAGA 3CGFA 4G3DA 4OTQA 3CCNA 2W99B 3QTUA 1UA2A 4PWNA 3KKVA 4BCIA 5HTIA 4LV8A 3GP0A 3EQIA 4N6ZA 4CZYB 5BVNA 2ITNA 3ZO2A 3A60A 3SGCA 2DWBA 4P4CA 4WUAA 3WZUA 1FPUA 4GFMA 3TEIA 2VTPA 3UE4A 5EM6A 3KL8A 3JY9A 2PMLX 2DS1A 4P5ZA 3HRCA 3QCXA 4L00A 4JI9A 3WE8A 2IVVA 5AV4A 3VN9A 2I0YA 4ZAUA 1IASA 2GQGA 2Y4IB 3MVLA 3CGOA 3UOHA 4QMTA 2B0QA 3WOWA 4ZEGA 4ZY4A 4IX3A 5HGIA 1Z5MA 4APCA 2RFSA 1ZOHA 4E6AA 4IEBA 2W1FA 4X2GA 4CRSA 4X6QC 4BTMA 4TTHB 2WMRA 3L1SA 4QP4A 3A7HA 4Z7GA 2GHGA 4DEDA 2PZIA 3PJ8A 4QP1A 4AOTA 5KBRA 5FXRA 3CD3A 1OUKA 1XBBA 4K2RA 3HMOA 4IAYA 5IH6A 5LVNA 4EH6A 4UX9A 4M0ZA 4RIXA 2QOQA 5JFVA 3DTWA 4RIYA 1YHSA 4EOMA 4F6SA 2B1PA 4XP3A 5HG5A 5EQPA 4FSQA 4ANMA 3PJ3A 3QTIA 3D14A 4W9WA 5B0XA 5BQ0A 4CG8A 3F88A 4BCPA 5D41A 2OJIA 4LL5A 4DH1A 5IA3A 4IB5A 3D7TA 1XH4A 3HKOA 4ZLOA 4GK2A 2C4GA 5JKGA 4FKGA 4A4LA 3THBA 3FZOA 2QO9A 1U5RA 1G3NA 2XUUA 4NH1A 5CXHA 3ZLXA 4CGAA 2C1BA 3IDPA 2V7OA 3QX2A 4HNIA 2XBJA 5CTPA 3P4KA 3DK7A 3UO4A 3ZUTA 4AT5A 4UMPA 4FTKA 2Y7JA 4UZHA 3O50A 1IAHA 2XJ0A 4A06A 4BDHA 4DE4A 5C26A 4L43A 3BV3A 2XJ1A 1BI8A 4L9IA 2X7FA 4D4SA 2BAJA 3SRVB 4DH5A 5HESA 4ZMEA 4KKHA 3V8SA 3QTZA 5M56A 4PQNA 3ANRA 4V0GA 3V5WA 2C30A 2BAKA 3DB8A 4JAJA 4Y5QA 3RPRA 3W18A 4M12A 3IW8A 5EW9A 1KOBA 3GOKA 4BFMA 4C57A 4EH2A 3NMUF 3HV7A 1FMKA 4DA5A 4C37A 5CEOA 4K0YA 5LARA 3RGFA 3FYKX 4D4VA 2VTOA 3JVRA 4I21A 3HRFA 3ZRMA 2BHHA 2GFSA 3CJFA 4FTLA 4AGUA 4EHZA 3F3WA 3RTPA 1GZNA 3V6SA 3LW0A 5F95A 4FV4A 4QTDA 4BGQA 4KB8A 1FMOE 2P33A 4BI2A 3NSZA 1SNXA 4FNXA 5CAVA 3N4VA 2NP8A 3HX4A 3F3TA 3VBTA 4W4VA 4EQMA 2CNVA 3QC9A 2Z60A 3BCEA 3MV5A 5H3QA 4O27B 3DDPA 2WEVA 3CTJA 2OF4A 3PRFA 3WI6A 3HV6A 5L8JA 3W32A 2YJSA 5E1EA 2YIXA 3KEXA 4C3FA 4BDCA 5B7VA 4DYMA 2PVFA 2HWOA 4YNOA 1RE8A 4JVGA 2YHVA 2I1MA 4IWOA 3C0IA 2FB8A 4D55A 3E8NA 4O7ZA 2XKDA 2WZJA 3NAYA 5HVYA 3SDJA 4CKJA 4PPCA 3C5IA 4EQCA 4JL9A 1UU8A 4CRLA 4F1OA 3MFTA 3TZ9A 2QC6A 4FKWA 3HDNA 4GW8A 3DFAA 3UVPA 3R2YA 4B4LA 3RJCA 3GC0A 3LCKA 4UXQA 4U7ZA 3ZM4A 3UZPA 3KMMA 5L2IA 2O64A 4FYOA 3R1NA 4IWQA 5AJQA 3VS6A 4O83A 3FQHA 4DG2E 4H58A 5AX3A 3VBYA 2C5NA 5DN3A 3ZUVA 1OECA 3V5JA 5L4QA 2ACXA 5E7RA 4YTIA 3LCTA 3NAXA 5M4UA 1JQHA 4J96A 4MNEA 3ZRKA 4B8LA 3FMHA 4FIHA 5AA8A 4NFNA 2G01A 3B8QA 3PG3A 3F9NA 2CLQA 2EB2A 3G90X 4ANLA 4G17A 4XYFA 2ZV7A 5HCYA 3A4OX 5H8EA 1PYXA 2NNWB 3FI4A 4AOIA 3DJ7A 2FGIA 3UO6A 4BZNA 2V7AA 1W7HA 1SNUA 2AUHA 4WNPA 2W0JA 4F6WA 3UMWA 3RINA 2Y9QA 4JDKA 2UW4A 4U8ZA 5JFXA 2I6LA 3O71A 2Z7RA 3TNPC 4D0WA 4E4LA 1LPUA 4MD9E 2VTLA 4DFLA 1OIUA 4EQUA 4QT1A 5CSWA 2R3JA 3H9RA 4LMUA 1BL7A 3Q5IA 5AX9A 1BLXA 3ZSGA 3CQUA 3ACJA 2GCDA 4D9TA 1Q8TA 3LQ8A 3MYGA 2PL0A 3UOJA 4I5CA 5J95A 5HE0A 3QTSA 3R7YA 2GPHA 3GEQA 3W33A 1UU9A 1V1KA 1ZMUA 2P2IA 3I81A 3MSSA 2HW6A 3QQFA 4PV0A 2SRCA 3KULB 2C0TA 4O0WA 4U0IA 3TZMA 4C34A 4FSRA 1GY3A 1YWRA 4F9AA 4AE6A 3DU8A 3R7GA 4BC6A 4GH2A 5KKRC 2RF9A 3C4XA 5GJDA 3VS2A 4EOIA 4FKVA 4NCTA 4DFBA 3RVGA 4U41A 4FTUA 4TYIA 4G5PA 3PDTA 4KKEA 2R0IA 2A1AB 3O7LD 2W4OA 3E8EA 4E6QA 3LXKA 4UYAA 1U5QA 4QYGA 5EK7A 4PDOA 5BVWA 4QQCA 1CKIA 2WTCA 2PVYA 3NNVA 4OTFA 4P5QA 4AZSA 2X2MA 3FV8A 3BV2A 2FH9A 4FKRA 2VGOA 3EQGA 5IG1A 3QBNA 4FTMA 3SXFA 1OIRA 4RFZA 4WOVA 3UIXA 3ZYAA 2W4JA 2J9MA 3ACKA 3F69A 2FSLX 2W05A 5CVGA 4D4YA 5E4HA 4D4RA 4RFYA 3OP5A 3KRJA 3MFSA 4BKJA 2W9FB 3QZIA 1H00A 4ZS0A 3SX9A 3VNTA 4I41A 4IX4A 4KD1A 4E1ZA 2YZLA 2BFXA 4RIWA 5TOZA 3TM0A 5AP2A 5AP7A 1ZAOA 3R7VA 3PA5A 3DK6A 3BZ3A 4QNAA 2F9GA 4EJNA 5IQIA 4E3CA 4AAAA 4XRJA 4AZFA 2B9JA 5AA9A 5CEIA 4QP3A 3KMWA 4FSWA 5AP3A 4M8TA 3PP0A 4JIAA 2R3HA 3R1YA 4NZWB 5TR6A 2VTHA 3ENHA 3AC3A 4MEDA 1SVEA 3MY5A 3B8RA 2JBOA 4IAIA 2B9IA 2XKFA 3Q4CA 3CKWA 4PTGA 4TXCA 4I5HA 5AUWA 1JPAA 3I1AA 2C6MA 4IJPA 3WZKA 5CSVA 4AQCA 3PXRA 3R7IA 4ZTMA 3PPJA 1JBPE 4Q5HA 1JSVA 4C2VA 2AC5A 3QCYA 4O7NA 3E8CA 4WG4A 3LXNA 4W8DA 5HOAA 4OBOA 3ODZX 4NK9A 1MQ4A 2Q0BA 3F6XA 3NX8A 5DHJA 4A9SA 3TUBA 5GIPE 1UV5A 4H1JA 4O22A 3ZMMA 4BWPA 3FC1X 5CSXA 3QQUA 4PL4A 3ETAA 3OUNB 3NNXA 1O9UA 4NYEA 4IB0A 4O1OA 3UVQA 3GGFA 3E64A 4YSJA 2VWBA 2XKEA 5IDNA 3EQRA 3LXPA 2C68A 4AA5A 3F5XA 5A9UA 2BFYA 1XHAA 4IZ5A 5J8IA 2UZOA 3AC5A 4OW8A 4DFNA 2UW5A 3ZEWA 3EQPA 1MP8A 3MW1A 4YC3A 3WIKA 4YUQA 4CLJA 2XZSA 4UY9A 1TVOA 4ZSLA 4C59A 3FHIA 2R2PA 4AG8A 4IDTA 3KF4A 4G1WA 3GCUA 2QURA 1NVRA 3OXTA 4N0SA 2I0HA 4WHZA 4XMOA 4IHPA 4AZVA 1F5QA 4IJ9A 1NA7A 4EWQA 2EXCX 2UW0A 1M7NA 2OU7A 4APPA 2OJ9A 4MVFA 4R5YA 3HEGA 5CS6A 4FV2A 5HIEA 2IG7A 2YAAA 3V8TA 4CXAA 4FKUA 2JDTA 4PX6A 3QWJA 3LCSA 4AZTA 2YIWA 1ZMVA 4PTEA 4I6FA 4RX9A 5DPVA 1IRKA 4H39A 4CYJA 2XNBA 3AMBA 3H9FA 4S2ZA 4DF3A 5ITAA 5T3QA 3DAKA 3NW7A 2WTVA 4J8NA 3K5VA 1PMUA 4OTGA 5AP5A 3ZM9A 1Y6BA 2OFUA 5HCZA 1MRVA 4NW6A 3PE2A 4L53A 2ITXA 3KCKA 4C4EA 5IH5A 3W2OA 5K5NA 2C1AA 5L8LA 1OKVA 3EB0A 3EKKA 3NNUA 4BKYA 2G15A 4GU6A 4F7JA 1H1QA 4JS8A 3EQCA 2OXDA 2RFDA 2UZUE 3FZRA 3PTGA 4CFUA 5FM2A 5LMAA 2QKRA 2FVDA 2VGPA 4OTPA 4F70A 2J0JA 3BHYA 1PHKA 4GG7A 4AGWA 1K2PA 5F9EA 2O63A 2YLFA 4ZSGA 4CNHA 4YTCA 4XG4A 3BGQA 3QL8A 3H0YA 4D1ZA 3PVUA 3ZXZA 2XH5A 2VTSA 4R3RA 5E8ZA 5C8MA 2AYPA 4FIGA 1CSNA 4IAAA 4L7SA 4U43A 5CNNA 5E8YA 3TKIA 3OW3A 3PPKA 1SVHA 5LMKA 3VUIA 4FT0A 3WZDA 4MBLA 4YZBA 5FWKK 3ORNA 3QD4A 1DM2A 3OBJA 3K2LA 3QU0A 3PPZA 1UKIA 2PVRA 2HXLA 2X4FA 2Y4IC 4IANA 4D2TA 5BX0A 4ORKA 2BRNA 3DQWA 2BIYA 3R8PA 5F20A 3ZDIA 4IB3A 5HO8A 4PF4A 5CF4A 1K9AA 3FKOA 2GNLA 2CN5A 4FV1A 1RW8A 2PWLA 4CQGA 4PMPA 5HD4A 3BGPA 2Z7SA 2OSCA 3FZ1A 3VBXA 4XLIA 4OR5A 4DINA 5J87A 4K11A 5B2LA 1BX6A 5EM7A 1BL6A 4JBOA 4YJNA 2XNPA 2RGPA 4DCAA 1LP4A 1CKPA 3LVPA 3LQ5A 4XEYA 4O0SA 4YSMA 5G1XA 5JRSA 4S33A 4TL0A 4I93A 3IGGA 5BVEA 3ODYX 3P86A 4AN9A 2P3GX 3F3ZA 4O6LA 5DOSA 3CY2A 5EW8A 5IQEA 3HUCA 3SXRA 5HTBA 4FL1A 4GSBA 3EH9A 5DVRA 3T3VA 4EKKA 3GU6A 3RHXA 4F09A 5I9ZA 3FSKA 2X6DA 5GZAA 4MXZA 4YO4A 5HG8A 3W2CA 3C50A 2WTWA 1YXXA 2XMYA 3M42A 3NUNA 4JOAA 2WTKB 3BBWA 4TY1A 3VJOA 4O7LA 3II5A 4PNIA 3D9VA 1B38A 4JDHA 3W2QA 4F65A 5CYIA 4FZFB 2IZSA 3PJCA 4LGGA 3FQSA 2JIIA 1LEZA 2W5BA 2WD1A 3AXWA 3BE2A 3RAWA 5HX8A 4BWKA 4EBWA 4AGCA 4K33A 4WD5A 4OTIA 4XG9A 3RM6A 3UVRA 3COMA 4KSPA 2QOOA 3PLSA 3I5ZA 3FJQE 5IUGA 3AG9A 5FDPA 2ITYA 3WBLA 4NU1A 3VS5A 4HYIA 1KWPA 3PSBA 2UZVA 4IZ7A 4G3GA 1PKGA 3PZEA 4MTAA 3EHAA 4MBIA 3MESA 3AT4A 4MAOA 2IVTA 5EKNA 1OPLA 3PUPA 2YM6A 2B54A 4I5MA 2BRHA 1KE9A 4FGBA 4FA2A 4DLJA 3KCFA 3DJ5A 3U9CA 5JN2A 4E5WA 5KMMA 3BQCA 4PMTA 5AV2A 5I3OA 4XLVA 1JOWB 4EH4A 1SVGA 4HW7A 3TTIA 3E93A 3AMYA 4DTBA 5JZNA 4QMZA 3LPBA 2IZRA 3UIBA 5JMSA 5DE2A 4IDVA 3FMKA 2C0OA 4FL3A 1RDQE 4XG3A 4A9UA 4D2VA 2PPQA 2VX1A 3AMAA 5LQFA 1TQMA 5DT4A 2ITQA 4L46A 4PL3A 5HLWA 4HVDA 3FY0A 2R64A 4DT8A 4USEA 2QOFA 5TKDA 2PMNX 2RFEA 2H6DA 3NUAA 3F3UA 4PP9A 4MXXA 2WMXA 4J52A 3QFVA 5DLSA 2PMOX 4FKQA 2YM7A 4IVAA 4XV2A 5F4NA 4FEUA 5GIOE 4WG3A 5CSHA 3I6UA 4CKIA 5KCVA 1YXUA 2IN6A 3IOPA 3RKBA 5EOBA 2YEXA 2ZV2A 3FAAA 4YTHA 5C8KA 5C01A 4KBKA 5M4CA 1ERKA 2UZWE 4NKAA 3BWFA 4FIJA 3TL8A 1J91A 2PMIA 4HVGA 2ERZE 4XOZA 1GZKA 3LFSA 3ZHPC 4AW1A 3HP5A 3E87A 4RVLA 3UC4A 3IDCA 3G0EA 3HRBA 4FTOA 5KO1A 3FL4A 4BIDA 4FTQA 5J9ZA 4QP2A 3TZ7A 3LOKA 3B2WA 4YZMA 1ZY5A 1W0XC 2GS6A 2PE1A 3HL7A 2GFCA 2BCJA 2PZRA 4IM0A 5E8WA 3ZO3A 1GJOA 5DRDA 5J1WA 4N70A 3CE3A 4J53A 4QYEA 3ZLWA 4FG9A 3KXNA 4E26A 4FIIA 4DFYA 3R02A 4EOJA 3G0FA 4C3RA 2VAGA 3DA6A 4F08A 4RPVA 5ETAA 1H24A 1Q8WA 4IAFA 1Q41A 1MUOA 3N9XA 4O0RA 3DKGA 3R8MA 5GZ9A 5ANDA 1ZOEA 2ZOQA 4BN1A 3HMIA 1YXTA 5CNOA 4YHJA 4UMTA 4IADA 2CKQA 2Y8OA 3QHWA 3T9IA 1XBCA 3KRRA 4K8AA 1VEBA 2CGVA 2VWIA 3P08A 5EHLA 4RVKA 4TYHA 3U6JA 3EN7A 1QPEA 3QUDA 1XKKA 4ZTSA 1R0EA 1JKTA 1QMZA 5AR2A 3OS3A 5ACKA 4QP6A 1JKLA 3LMHA 3OT3A 3PE1A 5FD2A 4DFXE 3O2MA 3Q9XA 2Z8CA 1DAYA 2OK1A 4EBVA 3PXQA 5IF1A 3ITZA 1PW2A 3F2AA 1R0PA 5EI8A 4TPTA 5EI2A 3C4EA 4D2RA 1NT2A 3KXXA 1XWSA 2A19B 4CFFA 5CEMA 3R30A 1YI4A 3CLYA 3OCTA 1R39A 2C6IA 2OZAB 3LE6A 3NGAA 3TNHA 2BAQA 3D2KA 2YAKA 5C9CA 4JQEA 2CCHA 4S30A 3OG7A 5IMEA 5KBQA 4HCUA 4OTWA 4TWPA 1XH6A 3HV4A 4TKSA 3VW6A 5HCXA 5E8TA 1XR1A 4AZWA 4EC9A 3PLAE 4JBVA 4HVHA 3KREA 2X4ZA 3DKFA 2UV2A 2V5QA 2GNHA 5DT0A 3E3PA 2J0MB 5IA5A 2FA2A 1UU7A 5GJGA 5HZNA 5AP0A 3A8WA 3MB7A 1PMVA 4HGTA 3MGYA 4CCBA 2Z2WA 4JR3A 4IX6A 4RC3A 3U54A 5T68A 1YRPA 2KULA 5TE0A 3D2IA 1PMEA 4O6EA 4RVTA 5IKWA 2UZTA 3OTVA 1BKXA 4M69A 2QO2A 3BE9A 1WAKA 3E3BX 5EHOA 2C6OA 3CEKA 4FF8A 4RG0A 3DS6A 4JBPA 3LM0A 4GV1A 1H8FA 5HO7A 3FXXA 4KNBA 3FQEA 4RWJA 3ROCA 3TIZA 3FEGA 3DZQA 1J7IA 5K0XA 2GDOA 4EC8A 3GCQA 4EEVA 3NW6A 4FSMA 1LR4A 4Q5EA 4CSVA 3TZ8A 4NJ3A 3UIUA 3FMJA 3KGAA 3NR9A 3ORPA 3V3VA 4JQ8A 3SAYA 4I23A 2YN8A 5EW3A 1STCE 3H4JA 4LQMA 2BZKB 2XRUA 4TNBA 5IDPA 2QNJA 4IWPA 3SG9A 4O0YA 3QRUA 3G9NA 3KN6A 4X3FB 2YIRA 2HY0A 3F5GA 3NVMB 1NY3A 3PSDA 4MXYA 4J7BA 3D0EA 5BUEA 3KK8A 2XB7A 3KVXA 4Y8DA 4KBCA 3TDWA 4A07A 2OJJA 4RC2A 5J9LA 5DYJA 4HVSA 3U55A 3U9NA 4UWYA 4D2PA 4FOCA 3ET7A 5I5ZA 5JGDA 4XBUA 2WU6A 4ZXTA 4Y46A 5KMKA 3GUBA 5HU9A 3IKAA 4YZCA 3ZO1A 5L6PA 5H9BA 2O2UA 1U59A 2GNJA 4XCUA 2G9XA 2IZUA 2WAJA 4FX3A 2J0KA 3DAEA 3QQGA 1H08A 2EWAA 4M66A 3SC1A 5I9YA 4FE2A 3E5AA 4U81A 3BBTB 5CU6A 4PL5A 5AIKA 3ZSIA 4ASDA 4EOLA 3OOMA 4QMOA 5DT3A 5CANA 2ZMCA 4XV3A 4PPBA 4RC4A 2JDOA 3FKLA 2JAVA 3ZZWA 2X1NA 1PKDA 2GMXA 4C7TA 4GK3A 4FIEA 4TT7A 1ZZ2A 3F7WA 4L67A 3HAMA 5IQCA 4IZAA 5HHWA 3T8OA 4DT9A 4AN2A 4L01A 2PUUA 5EYDA 3R9RA 5A6NA 2YM3A 4R8QA 3CIKA 4X2NA 5M4FA 3BYOA 3FXWA 4MYGA 3TXOA 5J1VA 2WMQA 3HDMA 2WELA 3NPCA 2JITA 3ERKA 2X39A 2PZ5A 4JDIA 4XV1A 5EOLA 3F82A 3HA8A 3LLTA 4NEUA 1UKHA 3NYXA 3ZFXA 2JKKA 4JAIA 4O38A 4TNDA 3R9DA 1A9UA 1IR3A 2IJMA 3G6GA 3L9PA 4HZSA 3DV3A 3P7BA 4OAUC 4XP2A 3FL5A 3FI3A 3DNDA 1OZ1A 1XH5A 3HA6A 5K0KA 1F0QA 4Z16A 2LAVA 1OL2A 3QX4A 3PP1A 3ULZA 4EHVA 1UWHA 4C0TA 3ORLA 5ACBC 4AT4A 3FLZA 3MFUA 2W1CA 3BHTA 4L3PA 1PXIA 3ZCLA 3A7JA 1H1SA 3GU5A 3PIYA 4P7EA 4WA9A 1Q99A 3QA0A 4S32A 3WIGA 2VU3A 4MQ1A 2QLQA 2XA4A 3PJ2A 3EN9A 4LRJA 2FSTX 3DXNA 3P7AA 3EZRA 3OD6X 3QKKA 3UMXA 2CLXA 3FZPA 4WSYA 4DGOA 4GYGA 3UPZA 2ETMA 3IG7A 5J7HA 4H05A 2G1TA 5KZIA 3NS9A 5ANJA 5KUPA 1KE8A 4YPSA 2I7QA 2X2KA 3QCQA 4BZDA 4NIFB 2BMCA 3L9NA 5BMSA 2W17A 5DWRA 4QMYA 2A27A 4M68A 5ICPA 4E7WA 4WNMA 3NYNA 2W5AA 4MXOA 3E92A 4XOYA 3BWJA 3GC8A 3PXYA 4EH8A 4F9CA 4FT5A 1WVWA 2ITVA 2ZV8A 3DOGA 4OGRA 4U3ZA 1Y8YA 5CI7A 3SD0A 4DN5A 2J5EA 3PVGA 2QD9A 5AR5A 2YERA 3C1XA 4CQEA 1REKA 1G8AA 2R3FA 1UNLA 1IG1A 1Q8ZA 5HVKA 4DH7A 4DFUA 4QP9A 4RJ6A 4A4OA 2C5YA 2VTAA 4D2WA 2W5HA 3MJ1A 4FICA 2RG6A 4FV9A 2GTMA 5FXQA 4O86A 4UYNA 3A99A 5EYCA 3BLHA 4ZP5A 2C6KA 3MPTA 2J50A 2R5TA 5AAGA 1FVRA 3WF7A 4XV9A 4DG0E 4Z3VA 4RJ3A 5AUUA 3SHEA 4JQ7A 5EH0A 4YTFA 4AFJA 2C5OA 3U6IA 5IQFA 5E8XA 2JAMA 4CZTA 5CWZA 2QR8A 1AQ1A 3MI9A 4L68A 5D10A 2GHLA 4ZSEA 1KOAA 3TCPA 1G5SA 1U46A 2UZDA 4N4SA 3NUXA 3VS0A 4L44A 4Y72A 4RJ4A 1CMKE 1XH8A 3EFWA 3LFNA 1GNGA 3QQJA 4FYNA 5CX9A 3LFCA 4ZSJA 3Q4ZA 5A3XA 3W55A 3WF8A 4QOXA 4D58A 1OL6A 3V8WA 4IIRA 4YZDA 3M1SA 4O2PA 3COIA 3A7GA 2NRUA 3ZBXA 3MJ2A 4RFMA 4XG2A 3DAJA 4FV6A 3C4ZA 4IAKA 3NUSA 2YDJA 4ALVA 4C8BA 4MHAA 4KIKA 2WTKC 2GNGA 3CTHA 2C6DA 3RPSA 2PUIA 2R3PA 4V04A 1OMWA 1ATPE 2V0DA 4NWMA 3VS3A 5IEXA 5EG3A 4YJSA 3RPYA 3GU7A 3KA0A 4G3FA 5HE1A 3R22A 3UNKA 4M15A 3AQVA 3S4QA 2J0LA 3OROA 4AX8A 5J5SA 3QKLA 4BDJA 4HYSA 1I09A 1Q5KA 3VUTA 2JIUA 4XX9A 4OBQA 2J5FA 2QI8A 3C7QA 2XCKA 4E4MA 3DDQA 1HCLA 3HZTA 4FTTA 2PTKA 2XEYA 3FE3A 4PTCA 4B99A 4HCVA 3ORXA 1BI7A 1YDRE 2W9ZB 4H36A 2BILB 4W8EA 2QLUA 3IQ7A 4TWOA 5DFPA 2IW9A 4QQTA 4PNKA 4GFGA 5CQWA 3ATSA 4MD8E 1UNHA 4ACGA 4WNKA 5A6OA 3JR1A 3IW4A 2HOGA 4ANBA 3OEFX 4IZYA 1H28A 1O6LA 4OTHA 5IMXA 5CXZA 3R9HA 2H9VA 4JLCA 4WBBB 4AFEA 2WQNA 4BHNA 1G8SA 4IACA 2BRBA 4DEIA 5BUJA 2QODA 4PMMA 3RAKA 2HK5A 4YHTA 4C4HA 2REIA 3IGOA 3FLNC 5D12A 3V6RA 1R1WA 4KBAA 4RGJA 4EK3A 2XNEA 3EFJA 4ZJVA 4ACHA 1B6CB 1Q24A 4IB1A 2C6TA 3MH3A 2JFLA 4GL9A 5B2KA 4W4WA 2B55A 3ALOA 4YC8A 1OL1A 4MF0A 1XO2B 3LFDA 2F2CB 4BCKA 5C4KA 3IPHA 3UPXA 5BNJA 1DI8A 3MVMA 3Q04A 3ULIA 4G3EA 4YJOA 3G51A 3RK7A 2QR7A 3O51A 2RG5A 3GT8A 3PRIA 4QYFA 1P4OA 3F7ZA 5J7BA 2W1DA 1L3RE 1ZYLA 5A54A 2WNTA 3DZOA 3W10A 1IAJA 4ASZA 4U42A 1WBTA 4OTRA 4O7SA 2IW6A 3SG8A 4R3CA 1J1BA 2XIYA 4G5JA 4W9XA 3PIXA 4XBRA 3R7OA 5A4EA 4UV0A 4D9UA 3QQLA 4X2JA 2X0GA 4EZ3A 2J90A 2CN8A 3QLFA 3Q2JA 2VWXA 4EYMA 5C4LA 1OB3A 3C0HA 4GEOA 5ANEA 4BCJA 4KAOA 2UW7A 2UZLA 4M14A 4C36A 3E7VA 4ACCA 4A4XA 1TQPA 3OCSA 3TUCA 1YWNA 1U54A 4Z9LA 1JWHA 1ZLTA 2E9VA 2VZ6A 4I20A 4LYNA 3Q6WA 5AP4A 2YZAA 4BDKA 3U51A 5J79A 4YJQA 4BDDA 3V01A 2YISA 4FGRA 3VC4A 3R9NA 3W2SA 5CZIA 3PA4A 3PG1A 4BL1A 4AUAA 4I94A 5J5TA 5LWMA 1L8TA 3NUPA 4HPUE 3QHRA 4E93A 2PUNA 4HGSA 4BCGA 2I0EA 3FWQA 3QXPA 3KQ7A 2OH4A 2WHBA 3HVCA 2PVKA 3R04A 4FTCA 2P2HA 3VAPA 3MVJA 4AW2A 4IVBA 3AT2A 3F5PA 4BCNA 5I9VA 5FDXA 3TUDA 3A8XA 5FTQA 3UOLA 2ETRA 4FTAA 1FGKA 4MF1A 5TT7A 3HMMA 4H1MA 1NVQA 3EYHA 2CCIA 3H30A 1OL5A 3PY3A 3W8LA 2UVZA 4CT2A 4C4GA 2VNYA 1U4DA 2RKUA 2C69A 4L42A 2CGWA 2VTRA 4H3PA 4NM3A 4R3PA 3BEAA 2ZAZA 2WTJA 1Y57A 3OZ6A 3R21A 2WPAA 4FKSA 5JFSA 1ZZLA 4O7YA 2JIVA 4I0SA 3PIZA 4FKTA 2WOUA 1IA8A 4MNFA 1VJYA 1DS5A 3FI2A 3RPVA 3L8PA 1TQIA 4YO6A 3ORIA 4O0TA 4YZ9A 5DR9A 3TJCA 3LMIA 2QVSE 2A0CX 1RQQA 4J98A 5LWNA 4QMLA 4G16A 1IEPA 2R3IA 3OWKA 3TDVA 2BRMA 4BIEA 5LVOA 3RWQA 5FM3A 3IS5A 1UVRA 1V0PA 3UBDA 5FTOA 4BDEA 4C35A 4EKLA 4F9BA 2C3KA 4MK0A 4YZNA 5CSPA 2JBPA 3H0ZA 3OFMA 3QAME 4G34A 5HLNA 4R78A 2X8IA 4LL0A 3E62A 1ZYCA 1Q61A 3NIEA 1GZ8A 3DBFA 4FVPA 3OCBA 5LVMA 5ETIA 3R6XA 4FG7A 4AACA 3AC1A 1AD5A 2QOIA 4NSTA 2X8EA 5CQUA 3TNWA 3EQBA 4O0VA 3Q6UA 3UO5A 4J71A 1ZARA 4PMSA 3CPCA 4ANSA 3OWPA 4FC0A 2R9SA 4QTAA 2WMUA 1H0VA 3JYAA 3R7EA 3P7CA 5IQHA 4GJ3A 4JT3A 4FKLA 3VUMA 3LAUA 4E5BA 1V0OA 2ITWA 4BF2A 3UQGA 3UIMA 5CF6A 5EDPA 4WBOA 5F1ZA 1ND4A 2PZYA 3M11A 4FV5A 4WRSA 3CS9A 4G6LA 5DGZA 5L2TA 2W1ZA 2QONA 3QGYA 3QRJA 5HNIX 1OKZA 3A4PA 4H3QA 5ETCA 4S31A 3KXHA 4DC2A 4LRMA 5A14A 5A4CA 1M2RA 3QTRA 3E7OA 4AOJA 3Q96A 3WYYA 2F2UA 3MBLA 4YNEA 5HEZA 4LM5A 2YCQA 4C4JA 3VQHA 4EOOA 5CU2A 2QOKA 4YJVA 3NYOA 4X3FC 4CV9A 2B9HA 5KZ0A 1E1XA 2LGCA 3GQLA 3ZBFA 1ZXEA 4IE9A 5EI6A 1BMKA 3BX5A 3SKCA 2ITZA 3I7CA 3QA8A 5IQBA 3OWLA 1H1RA 2HIWA 1KE7A 3JUHA 3C5UA 2YWPA 4JR7A 2XNGA 4OT5A 5AADA 1ZY4A 4O82A 3ID6C 3REPA 5HX6A 4RIXB 2O8YA 2Y0AA 3LQ3A 3F2NA 4NL0A 4GT5A 4RIYB 2QHNA 2XIXA 3VRZA 4GMYA 3KY2A 5D1JA 3ZFYA 1YHWA 3MS9A 3B2TA 3O23A 4G6OA 4Q9SA 4TRLA 4PP7A 1AGWA 4X2FA 3MH1A 1H1PA 3FXZA 3SW4A 3D7TB 1DAWA 5A4TA 2VV9A 3OC1A 4Y85A 3SRVA 2XP2A 4XH6A 3ZLYA 4KIQA 3OHTA 5DA3A 5CASA 2B52A 3O96A 2RSVA 5M55A 2QQ7A 3BU3A 4FSZA 3IECA 3PA3A 5ANIA 4I4EA 1PXOA 4V01A 2C6LA 5E90A 3G6HA 5TF9A 4HJOA 4XG6A 3MH2A 3W8QA 4YGAA 4EJ7A 4CVAA 1JSTA 3KXGA 3HMPA 4BCMA 4BBMA 5I3RA 4CFWA 4GKHA 3TNIA 5JQ5A 4MXAA 4U40A 4O96A 3LLAA 3DJ6A 3G5DA 3EFLA 3VBQA 4V0GB 5AIRA 3JS2A 4RA4A 5IA0A 3QTQA 2PE2A 1OBDA 4EYJA 1PXKA 4KA3A 5HE2A 4FKIA 5KE0A 3V5PA 5AM6A 2JC6A 4FT9A 3HP2A 4QMPA 4RWKA 4IC8A 1YI3A 3DQXA 3IO7A 4GIHA 5FLFA 2JEDA 2XVDA 3EJ1A 4M67A 4BGGA 3TTJA 4CTCA 2C6EA 4PUZA 5L3AA 2VTMA 4FZAB 4YLKA 5JRQA 2PVHA 4R5SA 4C62A 4L6QA 2R3GA 2VN9A 4QTCA 3O7LB 4GVAA 5HU3A 3DXPA 4P2KA 1H1WA 2I0VA 2VTJA 4ANQA 4F0IA 4IX5A 2IPXA 3HMNA 3FMDA 3VWAA 4ACDA 5L8KA 3BEGA 3OY1A 5LVPA 3AC8A 5AUXA 4DGGA 4R1VA 1UNGA 3RNIA 4I3ZA 1URCA 3EQFA 3VJNA 5AR3A 3FZTA 4DG3E 2XM9A 3BHUA 3DBQA 4D0XA 5FBNC 2Q83A 3PY1A 5CU3A 5AR7A 3RWPA 3UNJA 1WCCA 2X9FA 3CQWA 3P0MA 4GFOA 3QTXA 5BVKA 2UVYA 3Q60A 3V04A 3WE4A 2E9PA 2JKMA 2F7ZE 4QMWA 3O8TA 4ZY5A 5LCKA 5ANGA 2BUJA 2ZB1A 2XKCA 3RCJA 3TJDA 4F1MA 2HZNA 4ID7A 1M7QA 3QTWA 4FV0A 2OW3A 2VWYA 4AGDA 4FUXA 5M09A 4HCTA 4EHGA 4RZVA 4DEAA 1Q3DA 1W98A 3GOPA 5LOHA 2XIRA 2J4ZA 4AT3A 4BTJA 3SW7A 2XK9A 4PRJA 4F9YA 4LOOA 4RVMA 4R7BA 4Z7HA 2BTSA 1K3AA 2WO6A 4LMNA 1Y91A 2BR1A 4R7HA 5H8BA 2JDVA 4MNEB 1J1CA 4FT3A 1PXLA 5E91A 4O7VA 5IQDA 5CEPA 4CTBA 5CU0A 3GENA 2WU7A 1M17A 2OWBA 4OAVB 3I60A 3QXOA 2UW9A 1YXVA 2ZDTA 2EUFB 5IUHA 4JBQA 1PMNA 4CLIA 5IA2A 1OI9A 2R0UA 2R3RA 3ZS5A 3KULA 4I22A 4USFA 4E6DA 3QQKA 3NZ0A 3QRTA 5ANOA 4O7RA 5H2UA 4HNFA 3NW5A 4I6QA 4AW0A 4CMTA 4K77A 4RLLA 5T6KA 5BVFA 5FP6A 4FEWA 4OTDA 1ZOGA 3ZZEA 2J51A 2XBAA 3GNIB 4RX5A 4I4FA 3BQRA 4GVJA 2JGZA 2R3LA 3GI3A 2X7OA 3FKNA 5CI6A 1PRYA 5LCJA 3F61A 3RPOA 5LXMA 4JXFA 3OBGA 2R3QA 2UUEA 3BGZA 3DTCA 3FHRA 4J95A 3R73A 5JK3A 5AMNA 2VWVA 2R3OA 2IW8A 5CZHA 2VWUA 2YM5A 1JSUA 2QOHA 3NLBA 3ZOSA 1J7UA 4ZZMA 3QRKA 2BZIB 4AF3A 2W96B 5D11A 4EONA 2YDKA 3GCSA 1JKKA 3K5UA 1H4LA 1M2QA 4DH3A 4KINA 2G2IA 4EORA 2WIHA 4XRLA 1FBNA 4IVCA 3I79A 4G31A 3S1HA 2CMWA 2PE0A 3VW8A 5EYMA 1H25A 1WVYA 2YIYA 3TV6A 3SLSA 5IPJA 4YJPA 1APME 2OIQA 3FPMA 3PSCA 4AWIA 5K9IA 4FZ7A 5BPYA 3N4UA 4KIOA 2F4JA 2YCFA 3M2WA 4UALA 3UP2A 3D5VA 3G33A 3R8UA 3CR0A 4EH3A 4BICA 1S9IA 3MPAA 4RT7A 4G3CA 4RX8A 4EUUA 4ZJJA 3RZBA 4ZK5A 3VHKA 3WF5A 3PJ1A 5A4LA 4F7NA 4FZ6A 4QPMA 5DH3A 3KK9A 2PULA 3HAVA 5FUTA 4R7IA 3C4FA 3Q2MA 2IWIA 4JDJA 4RIWB 4FTJA 4RWLA 2GNFA 3OWJA 4JIKA 2F57A 4FVRA 2QOLA 4NW5A 2X7GA 5IA4A 5DI1A 1QL6A 3NUYA 3QWKA 4QMVA 3ATTA 4OT6A 2YABA 4BVUA 2YA9A 3IW7A 4W4YA 3BRBA 4QPAA 5AUVA 3DNEA 4QTBA 5CAUA 4J8MA 3VO3A 2QOCA 5K3YA 3IW6A 4CG9A 2XNNA 3LCDA 4RQKA 4ZLYA 2WB8A 3RAIA 3UGCA 4DGMA 1P2AA 4YURA 2OO8X 2OF2A 1REJA 3R00A 5AR4A 4QYYA 2PZPA 4JX7A 1CDKA 3NYVA 3MH0A 4M84A 5AM7A 3PWYA 3FPQA 4QYHA 2BPMA 4C2WA 2CNUA 2ZMDA 3KVWA 4BB4A 4MQ2A 4FV3A 2VO6A 4F4PA 3KRWA 3PXKA 3D5XA 3R8VA 2I40A 4QMNA 3V5LA 2A2AA 1M14A 4PDSA 1F3MC 4E4XA 1TKIA 5HNGA 2BZJA 3OW4A 5DRBA 4J99A 3AD6A 4U80A 1SM2A 2HYYA 5AWMA 4ZY6A 3EKNA 4BTKA 4CFVA 3WF6A 1W84A 1A06A 2R7BA 4F7SA 4AXAA 2EXEA 2RIOA 3K3JA 3UQFA 3PWDA 5DG5A 3N4TA 4RJ7A 4FEXA 1KV2A 2WQEA 3I0OA 2CGUA 4FK3A 3COHA 1O6KA 4IW0A 5A4QA 2HW7A 3GC9A 5FTGA 5BUIA 1FVVA 2PK9A 2B53A 2JKQA 4BDFA 2VO7A 5FG8A 2YIQA 4GJ2A 2XK8A 4CT1A 3FY2A 5JZJA 4HGLA 3OEZA 4F0GA 2JKOA 5F94A 2XK3A 1OVEA 3CD8A 4EOQA 4F1TA 3BLRA 4M13A 3KRXA 5JGAA 3OMVA 4CZUA 2HZ4A 4V05A 1VR2A 2DUVA 4FTIA 3CSVA 4UMRA 3VVHA 3Q3BA 4G9CA 4BY9E 2BRGA 2BZHB 2RL5A 2VWZA 3NUUA 2G2FA 4J97A 3P23A 4IXPA 4KIPA 2XF0A 3KF7A 4Y73A 4LV5A 5HBHA 4DTAA 5HICA 5JEBA 2CJMA 3QC4A 2CSNA 4BWXA 3E88A 1PXNA 4CFXA 3ANQA 1OGUA 4TWNA 4NM5A 4FEVA 5BYZA 4NM7A 2NPQA 5AV3A 4EH5A 2OFVA 5AP1A 5LVLA 3UODA 2XK4A 2XYUA 1Y8GA 2YCRA 5IZFA 2VNWA 3AC4A 3FDNA 1KE6A 4QTEA 2H34A 3WZJA 2YACA 4XHKB 4JG7A 4IC7A 2XCHA 2NO3A 1PXJA 2F7XE 4ERKA 5H8GA 2WKMA 1NVSA 1VYWA 4U5JA 4AA0A 1CTPE 5KX8A 2XRWA 4DGNA 4JX3A 3KMUA 3QYWA 4TWCA 2Q0NA 2QCSA 4JNWA 3E63A 5TO8A 4PDPA 4UN0C 4WT6A 5EDQA 3R1QA 3LFQA 4FOBA 3CP9A 4O21A 5EQEA 4KS8A 2GNIA 1XH7A 4EOKA 3Q9ZA 5GNKA 1WMKA 2BDJA 4UWCA 3Q9WA 4EH9A 4O1PA 3D5WA 5DEYA 2Z7QA 3KU2A 3K54A 2C0IA 2WMVA 2XNOA 2B9FA 2DQ7X 4AS0A 5CAQA 3OOGA 5HI2A 1BUHA 4JG6A 1FQ1B 2E2BA 4K9YA 4EK4A 4RIOA 3PVWA 2PVNA 3HYHA 3EL8A 4R1YA 4B7TA 4QMXA 4CFNA 3ZC5A 2QG7A 2OI4X 2WTIA 3OVVA 3UTOA 5AUTA 4R77A 4EI4A 2P55A 3C0GA 2YCSA 3CPBA 2OIDA 3QD3A 3TKUA 2VTTA 4FTNA 2F7EE 1URWA 5E92A 1EH4A 3RCDA 4GS6A 4BGHA 3KXZA 1H07A 3PXZA 3P5KA 4TYJA 5EFQA 5DMZA 3H3CA 4Q2AA 5HQ0A 2QHMA 4QMSA 1UU3A 4BZOA 5C1QB 3QUPA 2WXVA 4BYJA 3ORKA 3JPVA 1O6YA 3D94A 3MWUA 3CTQA 4OBPA 1KV1A 4Z55A 5EYKA 4GKIA 2P0CA 3O8UA 2YFXA 1YW2A 3HGKA 1JNKA 3L8VA 3R1SA 1OIYA 3MVHA 5CALA 3OTUA 3PY0A 5CU4A 3AD4A 3QGWA 4XJ0A 4U9AA 1XBAA 3ENMA 2VUWA 3UC3A 3LIJA 3P78A 3C13A 4JRNA 1CKJA 4GIIA 4YU2A 2O65A 4NTSA 4I5PA 2C3JA 4GCJA 3NIZA 3VF8A 4X21A 4F6UA 3DFCB 4FKJA 4IAZA 3MA3A 3EN4A 4FNYA 4ZTNA 3GVUA 4IMYA 1YXSA 3OXIA 4L3JA 4R6VA 5EDRA 5K4IA 4QNYA 4X7QA 4D5KA 1M52A 2CNQA 2UZNA 3TT0A 2W1IA 3UOKA 4WUNA 5BYLA 3QKMA 4UMUA 3BHVA 4U79A 3LJ0A 1S9JA 5HG9A 4Q9ZA 4O0UA 2C3IB 3AC2A 4C02A 4YC6A 4ZZOA 3IONA 3NNWA 3WYXA 2GSFA 3QUEA 5AEPA 4O2ZA 4NT4A 3MB6A 2E9UA 4FK6A 1GIIA 3QRIA 3C4WA 4FV8A 4CKRA 4II5A 2C5XA 3BYMA 4IVDA 3W2PA 5E9EA 4C58A 3LHJA 4OLIA 3QD2B 5CT7A 1WBVA 4M0YA 4CYIA 4G6NA 4RQVA 1GIJA 3RK9A 4F99A 1SYKA 5B2MA 3WF9A 4FSUA 4U6RA 5DR2A 5E8SA 4RJ5A 5IU2A 2Y6MA 1Z9XA 5ETFA 5M4IA 1YDSE 4O0XA 4X6RA 5IUIA 5CAPA 4U44A 4M7IA 3NWWA 2GHMA 3ROYA 4NJDA 2KTYA 5DIAA 2HAKA 4A9RA 3ZUUA 2QKWB 1YVJA 1WBPA 3A7FA 3CBLA 3ZDUA 1DI9A 3H10A 4ZTRA 5GJFA 2WIPA 3LJ1A 3O0GA 4ALWA 2BVAA 1LEWA 2IVUA 1YOJA 2ONLA 4U45A 5EM5A 4YJTA 1JLUE 3GB2A 5FQDC 3GCPA 2VTIA 3ZSHA 4AZEA 1MRUA 5DNRA 3EQDA 3L8SA 4HPTE 2O0UA 1OITA 2WFYA 2HXQA 2BDFA 3PYYA 5HD7A 1YI6A 4A9TA 2OXYA 1Q4LA 3I6WA 4BRXA 3EOCA 3PZHA 4WG5A 5HVJA 3LCOA 3SVVA 3MN3A 4PPAA 2CHLA 3GU8A 3JXWA 3GQIA 1FOTA 3O17A 2XEZA 3I5NA 4I6HA 5D7AA 3EN5A 3NVKI 4RA5A 4FBXA 3GFEA 5DEWA 1R3CA 3QF9A 3ZONA 4FV7A 5FXSA 5D7VA 2OGVA 4X3JA 3U4UA 4EOSA 4RBLA 5K5XA 2YWVA 5M53A 4ARKA 4ACMA 4AE9A 4ASXA 4FSYA 5CAOA 4HZRA 3FI8A 2ZB0A 3HV3A 3SQQA 2UW6A 2WGJA 3VUDA 1WBSA 4TN6A 4BIBA 2BDWA 4KSQA 2YM4A 4CV8A
chains in the Genus database with same CATH superfamily
4UZDA 2WTDA 2HZIA 4YJRA 3Q4UA 5D9HA 3VRYA 4O7TA 3PXFA 4NM0A 2UVXA 1OM1A 1W83A 2FSOX 4XNEA 4NUSA 4MWIA 5FEDA 4RZWA 3FBVA 3I7BA 4D5HA 3RNYA 1ZYDA 2EVAA 2R7IA 2GS2A 3EIDA 5BYYA 4LGDA 2PU8A 2H96A 2ONLC 3QLGA 3FMMA 3ZFMA 5KMNA 3W0QA 4MKCA 2ITOA 4FNZA 3DKCA 3BYVA 5AP6A 5JGBA 1E1VA 2XNMA 4DH8A 3CQEA 1WZYA 2ZVAA 3FLQA 2XIZA 3P79A 3VBWA 4U3YA 3QZHA 4BCHA 4TYHB 1Y6AA 5GZ8A 1OL7A 4I0RA 4ANNA 3RZFA 1A48A 3W1FA 4I0TA 4A7CA 3FLWA 4ZLZA 3SXSA 3COKA 4MUQA 3MY0A 4E73A 3VS7A 5I4NA 5EQYA 2VX0A 1GIHA 2OZAA 2JD5A 5CF5A 5J9YA 3TACA 5IA1A 5KHWA 1KE5A 2WOTA 4C3PA 1J3HA 2OJFE 4LOQA 4X2KA 5EHYA 2YITA 4MH7A 4IQ6A 2FSMX 2HENA 3ALNA 5L2QA 3U8WA 2ZM3A 1NXKA 1SZMA 4I92A 4P90A 3GU4A 2WQOA 5AV1A 3D15A 4FI1A 3QQHA 4BI0A 4DITA 1WFCA 5G6VA 1WBWA 3EMGA 4L3LA 3DXQA 5HIDA 4NCTC 2O5KA 4EK6A 2J0IA 3C51A 3R28A 4KS7A 4ZTLA 2ZJWA 3FMLA 2EB3A 2IO6A 3MY1A 3DB6A 4ITJA 3RHKA 2YLEA 2W1HA 3A2CA 3LFEA 1J7LA 3AGMA 3SOAA 4L52A 4XG8A 1MQBA 2UW3A 2PSQA 5C8NA 4O84A 4ONAA 3EYGA 2C5VA 2UZBA 2J7TA 3VUGA 3DKOA 3TKHA 4B9DA 3PUFC 4LGHA 4DLIA 3FZSA 3R8ZA 4O91A 2BTRA 3DY7A 3R63A 2GU8A 3AOXA 3WARA 3EWHA 4IBMA 3R2BA 3AKKA 1FGIA 1JVPP 4M69B 1NW1A 1Q3WA 2V55A 3EZVA 3MTFA 4QQJA 1E9HA 4YBKA 5AAFA 4YHFA 3DCVA 3KFAA 5AFVA 2QU5A 4MXCA 2EU9A 2VO0A 1Q8UA 4X3FA 3VF9A 4RRVA 4C4FA 5HO6A 3LMGA 3GXLA 4FNWA 1YWVA 5HORA 3HECA 3GC7A 3I0QA 4L8MA 3MIYA 4Y5HA 4ZS4A 1VLRA 2ERKA 4XS2A 5CVHA 5CEQA 3BLQA 3NCZA 3Q9YA 2ITPA 3U87A 3FUPA 2HCKA 3ELJA 5L2WA 4F63A 2A4LA 2RFNA 3E8DA 4N57A 1OPKA 2BKKA 2Y6OA 5KMIA 4QRCA 3V51A 5E1SA 5CVFA 4UWBA 3D83A 4B0GA 5A46A 4FT7A 1PYEA 2ZM4A 5KMOA 4DHFA 1X8BA 1WBNA 1ZYJA 2FO0A 3POZA 3RBWA 2V62A 2ZYBA 4RWIA 1WVXA 1B39A 3W2RA 1YKRA 4D28A 3FC2A 3POOA 2PYWA 4ENXA 2E9NA 3P9JA 5FEQA 4ZOGA 4NFMA 5AUZA 4EHEA 3G9LX 4Y83A 5JH6A 4I6BA 4H3BA 4KKGA 3DT1A 3L9LA 1H26A 2W1GA 1OUYA 2B7AA 3QYZA 1KUTA 4CEGA 2HZ0A 2PVMA 2CKPA 5JSMA 3IW5A 3MIAA 2X6EA 2ZV9A 5HG7A 3ZXTA 3R71A 3UDTA 4K18A 5DBXA 1BYGA 4O7WA 3NRMA 3SOCA 3GCVA 3F5UA 3FLYA 4YJUA 5M08A 2QU6A 1FINA 3CKXA 3PFQA 3R9OA 4F0FA 3KXMA 4FEQA 4G9RA 4MWHA 4XP0A 4F9WA 5HKMA 1YQJA 2DYLA 4TW9A 4WIHA 2R3MA 5C27A 3TI1A 2X9EA 5CLPA 4BYIA 2NRYA 3Q5ZA 4HYHA 1T45A 5EKOA 4CMOA 4DEHA 5LMBA 3ZO4A 2VTNA 1YDTE 4IFCA 4TYEA 4DEGA 2OKRA 3ORTA 1UWJA 4ITIA 4KABA 4YPDA 4A9YA 2YJRA 3NDMA 3NCGA 3ORZA 4EUTA 4C38A 3EN6A 5HIBA 3VUHA 4BCFA 2GTNA 1W8CA 2R4BA 2OBJA 4ZIMA 4U97A 5IISA 1P14A 2Z02A 4M97A 4GG5A 5CENA 5GINE 5GHVA 2XAMA 3DLSA 3PVBA 4LRKA 4M3QA 2ESMA 3UG2A 3CJGA 4QP8A 2Y4PA 4B8MA 3S3IA 5IQGA 4K1BA 4CCUA 3JY0A 4KRDA 4Y95A 2Z7LA 4E6CA 4UBAA 4C33A 4DEEA 3HNGA 3BYUA 4IFGA 3S2PA 3G15A 3U4WA 2ITUA 3LZBA 2G2HA 5IH4A 4RJ8A 4YLJA 3RI1A 5FGKA 2JDSA 4BDIA 1PXPA 1Q62A 2V22A 4BBEA 4E5AX 1H01A 3R83A 3W0MA 5I0BA 3VHEA 4QQ5A 3BU5A 4FVQA 4NIFA 3OY3A 4BDAA 5FP5A 4JJRA 4E4NA 5JFWA 2OICA 4MX9A 4GRBA 2OG8A 4IH8A 4EK8A 3CY3A 4FIFA 5CY3A 2R3NA 2C47A 5FBOA 3UYSA 5C03A 4K6ZA 1OIQA 3TG1A 3GFWA 4QPSA 3TV7A 5HE3A 1Q8YA 2HWPA 2JDRA 2PVLA 4OUCA 4GU9A 4FSTA 2W7XA 4MBJA 4LI5A 5FRIA 3ZC6A 3DBDA 2JFMA 3FYJX 4I24A 5M07A 2YDIA 5HTCA 2XS0A 2YM8A 1XJDA 4AN3A 4DHJA 4RX7A 3T9TA 2B4SB 2PHKA 2WMWA 3BELA 2VO3A 4RMZA 3VS4A 5E8VA 2ITTA 3AGLA 3F2RA 2C3LA 3FMNA 3MTLA 5KMJA 4FMQA 3W0NA 3GBZA 3SA0A 3TNQB 5LMKC 3LJ2A 3T3UA 3U6HA 2X2LA 4EL9A 2CKOA 4WO5A 4RSSA 3IK3A 4LUEA 4EZ7A 5BVOA 3BPRA 1W82A 4TZRA 2QO7A 3BIZA 4AP7A 4AXCA 4USDA 4ANOA 3Q32A 1T46A 3C9WA 3LFBA 3S00A 2OXXA 4WKQA 2WMTA 5LJJA 4GK4A 3OF0A 4BI1A 5L6OA 1FVTA 4BR3A 3KC3A 4DGLC 3ZTXA 2X8DA 4EH7A 5IEVA 4EZ5A 3AD5A 3UG1A 1HOWA 4CD0A 5KMLA 3BKBA 5HNBA 3VULA 4EK5A 5BVDA 2GQSA 4ZTQA 3ML1A 2O3PA 4QP7A 2P4IA 3DK3A 3R0TA 1ZYSA 4HGEA 4N6YA 4D1SA 2XK7A 3Q52A 4CFMA 1JAMA 2FYSA 2R3KA 2W1EA 4IM3A 4ALUA 1QPCA 1VYZA 3ZRLA 3G2FA 2BALA 3SV0A 4YMJA 3H9OA 5KKRB 3BL9A 2OJGA 5CT0A 4PDYA 2ETKA 3VQUA 2EXMA 4BCQA 4ENYA 3RMFA 1QCFA 2BROA 3KN5A 3EFKA 3R7UA 1VZOA 3NEWA 1P4FA 4GYIA 3A7IA 3ZEPA 4E8AA 3EL7A 3MDYA 1XQZA 3O8PA 1RJBA 4KIKB 4WNOA 3VUKA 4DCEA 5M06A 3QCSA 2VRXA 2J2IB 4ZMFA 1Z57A 4WSQA 4BTFA 2XIKA 3OT8A 4BDBA 5KNJA 4LFIA 2VTQA 3RALA 1OBGA 3NFFB 4NKSA 3UNZA 2CPKE 5L6WL 4S34A 3N51A 3WILA 4QDEA 3DPKA 2IVSA 1ZMWA 2QG5A 3BI6A 2VD5A 3VBVA 1ZRZA 3R8LA 5HBJA 2XANA 4DEBA 3HLLA 4YR8A 4AW5A 1OKWA 4ZJIA 3K3IA 5AUYA 3HV5A 2HY81 4GT4A 3F3VA 1Q97A 3RP9A 1YHVA 3IOKA 2OLCA 3AT3A 4C61A 3F66A 4QO9A 3ZU7A 1HCKA 3MA6A 3WZEA 2E9OA 2CDZA 2XK6A 3QD0A 4IM2A 4YP8A 3QZGA 4CMUA 2XYNA 3A62A 2VWWA 3ZLSA 2W4KA 5AV0A 3OXZA 5JT2A 3HUBA 2F49A 3BHHA 3DGKA 2QOBA 4D1XA 4F7LA 1QPDA 1YOMA 4FG8A 4GUEA 1I44A 4EWHA 1GOLA 3L8XA 4JG8A 3LKMA 5KHXA 3OUKA 4QMQA 4QD6A 4FSNA 5JQ8A 3KB7A 2HELA 2XJ2A 3V5QA 4DBNA 5ANKA 1PJKA 1PF8A 3LFFA 3FMEA 3ORMA 3RM7A 2BIKB 1OPJA 1PY5A 5E8UA 4D2SA 1KSWA 4HYUA 3FLSA 3P1AA 3QALE 4FKOA 5HLPA 2PY3A 1GZOA 1H0WA 1V0BA 4L7FA 4BKZA 3BYSA 4DBXA 5FEEA 4FL2A 4KWPA 2GQRA 3D7ZA 5M57A 4AA4A 4RLKA 4IWDA 3DBCA 2WMSA 4QMUA 3FSFA 4FODA 1P5EA 3L9MA 1XH9A 3UJGA 2ZDUA 2BKZA 4ZTHA 3RK5A 2PUPA 4BDGA 4W4XA 3UDBA 4UXLA 2WQMA 2X81A 4LOPA 3MPMA 4UMQA 5I9XA 4AU8A 4PY1A 1IA9A 4ERWA 4O81A 4QMMA 1QPJA 4LUDA 3TV4A 4I1ZA 4L45A 4ITHA 5IEYA 3CC6A 2CGXA 5AAEA 3KRLA 3LM5A 3W16A 2FUMA 1U54B 1ZWSA 2GS7A 3DBEA 4BBFA 2WMBA 4FTRA 3VIDA 4J1RA 4MCVA 5I9WA 3VS1A 3CXWA 3LFAA 1R78A 2IZTA 2WMAA 3DLZA 3ZH8A 3MFRA 5I9UA 4WRGA 4HVIA 2H8HA 2WEIA 4FKPA 2OIBA 1JKSA 2W06A 1PXMA 4DFZE 5IQAA 4XG7A 4KRCA 4YBJA 3TWJA 3S0OA 5M51A 2PVJA 3UZTA 4JRVA 3V5TA 3C4CA 1CM8A 3A61A 3S95A 3D5UA 1SMHA 4KUJA 2OH0E 4B6LA 2XM8A 3TIYA 1WBOA 4GUBA 4BHZA 4GT3A 4DTKA 3Q53A 4E20A 4X0MA 4UEUA 2J6MA 2ZM1A 4TYGA 2VX3A 5AR8A 5HBEA 3TN8A 3IDBA 2WQBA 4FZDB 5BMMA 4ASEA 5M44A 2UW8A 4YLLA 5DR6A 3UP7A 3QZFA 3JVSA 4MD7E 4ZZNA 5CF8A 4G2FA 3EQHA 3Q4TA 4C4IA 1OKYA 2BHEA 3I4BA 5CEKA 3OCGA 2AQXA 3BU6A 1YOLA 3D4QA 5K4JA 2JLDA 4UB7A 4ZSAA 3LXLA 1MRYA 5L2SA 1LUFA 4DAWA 3UQCA 4FR4A 3R01A 4FUYA 4F64A 1H27A 4BCOA 3UYTA 3RAHA 2CKEA 2UZEA 3UZRA 1M2PA 2OZOA 4HOKA 4LG4A 2AC3A 4NTTA 4XUFA 5EM8A 4EOPA 1GAGA 3CGFA 4G3DA 4OTQA 3CCNA 2W99B 3QTUA 1UA2A 4PWNA 3KKVA 4BCIA 5HTIA 4LV8A 3GP0A 3EQIA 4N6ZA 4CZYB 5BVNA 2ITNA 3ZO2A 3A60A 3SGCA 2DWBA 4P4CA 4WUAA 3WZUA 1XMMA 1FPUA 4GFMA 3TEIA 2VTPA 3UE4A 5EM6A 3KL8A 3JY9A 2PMLX 2DS1A 4P5ZA 3HRCA 3QCXA 4L00A 2XAOA 4JI9A 3WE8A 2IVVA 5AV4A 3VN9A 4BJJA 2I0YA 4ZAUA 1IASA 2GQGA 2Y4IB 3MVLA 3CGOA 3UOHA 4QMTA 2B0QA 3WOWA 4ZEGA 4ZY4A 4IX3A 5HGIA 1Z5MA 3TMOA 4APCA 2RFSA 1ZOHA 2X0OA 4IEBA 4E6AA 2W1FA 4X2GA 4CRSA 4X6QC 4BTMA 4TTHB 2WMRA 3L1SA 4QP4A 3A7HA 4Z7GA 2GHGA 4DEDA 2PZIA 3PJ8A 4QP1A 4AOTA 5KBRA 5FXRA 3CD3A 1OUKA 1XBBA 4K2RA 3HMOA 4IAYA 5IH6A 5LVNA 4EH6A 4UX9A 4M0ZA 4RIXA 2QOQA 5JFVA 3DTWA 4RIYA 4AAYA 1YHSA 4EOMA 4F6SA 2B1PA 4XP3A 5HG5A 5EQPA 4FSQA 4ANMA 3PJ3A 3QTIA 3D14A 4W9WA 5B0XA 5BQ0A 4CG8A 3F88A 4BCPA 5D41A 2OJIA 4LL5A 4DH1A 5IA3A 4IB5A 3D7TA 1XH4A 3HKOA 4ZLOA 4GK2A 2C4GA 5JKGA 4FKGA 4A4LA 3THBA 3FZOA 2QO9A 1U5RA 1G3NA 2XUUA 4NH1A 5CXHA 3ZLXA 4CGAA 2C1BA 3IDPA 2V7OA 3QX2A 4HNIA 2XBJA 5CTPA 3P4KA 3DK7A 3UO4A 3ZUTA 4AT5A 4UMPA 4FTKA 2Y7JA 4UZHA 3O50A 1IAHA 2XJ0A 4A06A 4BDHA 4DE4A 5C26A 4L43A 3BV3A 2XJ1A 1BI8A 4L9IA 2X7FA 4D4SA 2BAJA 3SRVB 4DH5A 5HESA 4ZMEA 4KKHA 3V8SA 3QTZA 5M56A 4PQNA 3ANRA 4V0GA 3UDZA 3V5WA 2C30A 2BAKA 3DB8A 4JAJA 4Y5QA 3RPRA 3W18A 4M12A 3IW8A 5EW9A 1KOBA 3GOKA 4BFMA 4C57A 4EH2A 3NMUF 3HV7A 1FMKA 4DA5A 4C37A 5CEOA 4K0YA 5LARA 3RGFA 3FYKX 4D4VA 2VTOA 3JVRA 4I21A 3HRFA 3ZRMA 2BHHA 2GFSA 3CJFA 4FTLA 4AGUA 4EHZA 3F3WA 3RTPA 1GZNA 3V6SA 3LW0A 5F95A 4FV4A 4QTDA 4BGQA 4KB8A 1FMOE 2P33A 4BI2A 3NSZA 1SNXA 4FNXA 5CAVA 3N4VA 2NP8A 3HX4A 3F3TA 3VBTA 4W4VA 4EQMA 2CNVA 3QC9A 2Z60A 3BCEA 3MV5A 5H3QA 4O27B 3DDPA 2WEVA 3CTJA 2OF4A 3PRFA 3WI6A 3HV6A 5L8JA 3W32A 2YJSA 5E1EA 2YIXA 3KEXA 4C3FA 4BDCA 5B7VA 4DYMA 2PVFA 2ZFYA 2HWOA 4YNOA 1RE8A 4JVGA 2YHVA 2I1MA 4IWOA 3C0IA 2FB8A 4D55A 3E8NA 4O7ZA 2XKDA 2WZJA 3NAYA 5HVYA 3SDJA 4CKJA 4PPCA 3C5IA 4EQCA 4JL9A 4DDIA 1UU8A 4QEBA 4CRLA 4F1OA 3MFTA 3TZ9A 2QC6A 4FKWA 3HDNA 4GW8A 3DFAA 3UVPA 3R2YA 4B4LA 5BV3A 3RJCA 3GC0A 3LCKA 4UXQA 4U7ZA 3ZM4A 3UZPA 3KMMA 5L2IA 2O64A 4FYOA 3R1NA 4IWQA 5AJQA 3VS6A 4O83A 3FQHA 4DG2E 4H58A 5AX3A 3VBYA 2C5NA 5DN3A 3ZUVA 1OECA 3V5JA 5L4QA 2ACXA 5E7RA 4YTIA 3LCTA 3NAXA 5M4UA 1JQHA 4J96A 4MNEA 3ZRKA 4B8LA 3FMHA 4FIHA 5AA8A 4NFNA 2G01A 3B8QA 3PG3A 3F9NA 2CLQA 2EB2A 3G90X 4ANLA 4G17A 4XYFA 2ZV7A 5HCYA 3A4OX 5H8EA 1PYXA 2NNWB 3FI4A 4AOIA 3DJ7A 2FGIA 3UO6A 4BZNA 2V7AA 1W7HA 1SNUA 2AUHA 4WNPA 2W0JA 4F6WA 3UMWA 3RINA 2Y9QA 4JDKA 2UW4A 4U8ZA 5JFXA 2I6LA 3O71A 2Z7RA 3TNPC 4D0WA 4E4LA 1LPUA 4MD9E 2VTLA 4DFLA 1OIUA 4EQUA 4QT1A 5CSWA 2R3JA 3H9RA 4LMUA 1BL7A 3Q5IA 5AX9A 1BLXA 3ZSGA 3CQUA 3ACJA 2GCDA 1W2CA 4D9TA 1Q8TA 3LQ8A 3MYGA 2PL0A 3UOJA 4I5CA 5J95A 5HE0A 3QTSA 3R7YA 2GPHA 3GEQA 3W33A 1UU9A 1V1KA 1ZMUA 2P2IA 3I81A 3MSSA 2HW6A 3QQFA 4PV0A 2SRCA 3KULB 2C0TA 4O0WA 4U0IA 3TZMA 4C34A 4FSRA 1GY3A 1YWRA 4F9AA 4AE6A 3DU8A 3R7GA 4BC6A 4GH2A 5KKRC 2RF9A 3C4XA 5GJDA 3VS2A 4EOIA 4FKVA 4NCTA 4DFBA 3RVGA 4U41A 4FTUA 4TYIA 4G5PA 3PDTA 4KKEA 2R0IA 2A1AB 3O7LD 2W4OA 3E8EA 4E6QA 3LXKA 4UYAA 1U5QA 4QYGA 5EK7A 4PDOA 5BVWA 4QQCA 1CKIA 2WTCA 2PVYA 3NNVA 4OTFA 4P5QA 4AZSA 2X2MA 3FV8A 3BV2A 2FH9A 4FKRA 2VGOA 3EQGA 1W2FA 5IG1A 3QBNA 4FTMA 3SXFA 1OIRA 4RFZA 4WOVA 3UIXA 3ZYAA 2W4JA 2J9MA 3ACKA 3F69A 2FSLX 2W05A 5CVGA 4D4YA 5E4HA 4D4RA 4RFYA 3OP5A 3KRJA 3MFSA 4BKJA 2W9FB 3QZIA 1H00A 4ZS0A 3SX9A 3VNTA 4I41A 4IX4A 4KD1A 4E1ZA 2YZLA 2BFXA 4RIWA 5TOZA 3TM0A 5AP2A 5AP7A 1ZAOA 3R7VA 3PA5A 3DK6A 3BZ3A 4QNAA 2F9GA 4EJNA 5IQIA 4E3CA 4AAAA 4XRJA 4AZFA 2B9JA 5AA9A 5CEIA 4QP3A 3KMWA 4FSWA 5AP3A 4M8TA 3PP0A 4JIAA 2R3HA 3R1YA 4NZWB 5TR6A 2VTHA 3ENHA 3AC3A 4MEDA 1SVEA 3MY5A 3B8RA 2JBOA 4IAIA 4O4DA 2B9IA 2XKFA 3Q4CA 3CKWA 4PTGA 4TXCA 4I5HA 5AUWA 1JPAA 3I1AA 2C6MA 4IJPA 3WZKA 5CSVA 4AQCA 3PXRA 3R7IA 4ZTMA 3PPJA 1JBPE 4Q5HA 1JSVA 4C2VA 2AC5A 3QCYA 4O7NA 3E8CA 4WG4A 3LXNA 4W8DA 5HOAA 4OBOA 3ODZX 4NK9A 1MQ4A 2Q0BA 3F6XA 3NX8A 5DHJA 4A9SA 3TUBA 5GIPE 1UV5A 4H1JA 4O22A 3ZMMA 4BWPA 3FC1X 5CSXA 3QQUA 4PL4A 3ETAA 3OUNB 3NNXA 1O9UA 4NYEA 4IB0A 4O1OA 3UVQA 3GGFA 3E64A 4YSJA 2VWBA 1ST4A 2XKEA 5IDNA 3EQRA 3LXPA 2C68A 4AA5A 3F5XA 5A9UA 2BFYA 1XHAA 4IZ5A 5J8IA 2UZOA 3AC5A 4OW8A 4DFNA 2UW5A 3ZEWA 3EQPA 1MP8A 3MW1A 4YC3A 3WIKA 4YUQA 4CLJA 2XZSA 4UY9A 1TVOA 4ZSLA 4C59A 3FHIA 2R2PA 4AG8A 4IDTA 3KF4A 4G1WA 3GCUA 2QURA 1NVRA 3OXTA 4N0SA 3AKJA 2I0HA 4WHZA 4XMOA 4IHPA 4AZVA 1F5QA 4IJ9A 1NA7A 4EWQA 2EXCX 2UW0A 1M7NA 2OU7A 4APPA 2OJ9A 4MVFA 4R5YA 3HEGA 5CS6A 4FV2A 5HIEA 2IG7A 2YAAA 3V8TA 4CXAA 4FKUA 2JDTA 4PX6A 3QWJA 3LCSA 4AZTA 2YIWA 1ZMVA 4PTEA 4I6FA 4RX9A 5DPVA 1IRKA 4H39A 4CYJA 2XNBA 3AMBA 3H9FA 4S2ZA 4DF3A 5ITAA 5T3QA 3DAKA 3NW7A 2WTVA 4J8NA 3K5VA 1PMUA 4OTGA 5AP5A 3ZM9A 1Y6BA 2OFUA 5HCZA 1MRVA 4NW6A 3PE2A 4L53A 2ITXA 3KCKA 4C4EA 5IH5A 3W2OA 5K5NA 2C1AA 5L8LA 1OKVA 3EB0A 3EKKA 3NNUA 4BKYA 2G15A 4GU6A 4F7JA 1H1QA 4JS8A 3EQCA 2OXDA 2RFDA 2UZUE 3FZRA 3PTGA 4CFUA 5FM2A 5LMAA 2QKRA 2FVDA 2VGPA 4OTPA 3AKLA 4F70A 2J0JA 3BHYA 1PHKA 4GG7A 4AGWA 1K2PA 5F9EA 2O63A 2YLFA 4ZSGA 4CNHA 4YTCA 4XG4A 3BGQA 3QL8A 3H0YA 4D1ZA 3PVUA 3ZXZA 2XH5A 2VTSA 4R3RA 5E8ZA 5C8MA 2AYPA 4FIGA 1CSNA 4IAAA 4L7SA 4U43A 5CNNA 5E8YA 3TKIA 3OW3A 3PPKA 1SVHA 5LMKA 3VUIA 4FT0A 3WZDA 4MBLA 4YZBA 5FWKK 3ORNA 3QD4A 1DM2A 3OBJA 3K2LA 3QU0A 3PPZA 1UKIA 2PVRA 2HXLA 2X4FA 2Y4IC 2X0PA 4IANA 4D2TA 5BX0A 2BRNA 4ORKA 3W0RA 3DQWA 2BIYA 3R8PA 5F20A 3ZDIA 4IB3A 5HO8A 4PF4A 5CF4A 1K9AA 3FKOA 2GNLA 2CN5A 4FV1A 1RW8A 2PWLA 4CQGA 4PMPA 5HD4A 3BGPA 2Z7SA 2OSCA 3FZ1A 3VBXA 4XLIA 4OR5A 4DINA 5J87A 4K11A 5B2LA 1BX6A 5EM7A 1BL6A 4JBOA 4YJNA 2XNPA 2RGPA 4DCAA 1LP4A 1CKPA 3LVPA 3LQ5A 4XEYA 4O0SA 4YSMA 5G1XA 5JRSA 4S33A 4TL0A 4I93A 3IGGA 5BVEA 3ODYX 3P86A 4AN9A 3BL7A 2P3GX 3F3ZA 4O6LA 5DOSA 3CY2A 5EW8A 5IQEA 3HUCA 3SXRA 5HTBA 4FL1A 4GSBA 3EH9A 5DVRA 3T3VA 4EKKA 4FRFA 3GU6A 3RHXA 4F09A 5I9ZA 3FSKA 2X6DA 5GZAA 4MXZA 4YO4A 5HG8A 3W2CA 3C50A 2WTWA 1YXXA 2XMYA 3M42A 3NUNA 4JOAA 2WTKB 3BBWA 4TY1A 3VJOA 4O7LA 3II5A 4PNIA 3D9VA 3TYKA 1B38A 4JDHA 3W2QA 4F65A 5CYIA 4FZFB 2IZSA 3PJCA 4LGGA 3FQSA 2JIIA 1LEZA 2W5BA 2WD1A 3AXWA 3BE2A 3RAWA 5HX8A 4BWKA 4EBWA 4AGCA 4K33A 4WD5A 4OTIA 4XG9A 3RM6A 3UVRA 3COMA 4KSPA 2QOOA 3PLSA 3I5ZA 3FJQE 5IUGA 3AG9A 5FDPA 2ITYA 3WBLA 3KIOC 4NU1A 3VS5A 4HYIA 1KWPA 3PSBA 2UZVA 4IZ7A 4G3GA 2XARA 1PKGA 3PZEA 4MTAA 3EHAA 4MBIA 3MESA 3AT4A 4MAOA 2IVTA 5EKNA 1OPLA 3PUPA 2YM6A 2B54A 4I5MA 2BRHA 1KE9A 4FGBA 4FA2A 4DLJA 3KCFA 3DJ5A 3U9CA 5JN2A 4E5WA 5KMMA 3BQCA 4PMTA 5AV2A 5I3OA 4XLVA 1JOWB 4EH4A 1SVGA 4HW7A 3TTIA 3E93A 3AMYA 4DTBA 5JZNA 4QMZA 3LPBA 2IZRA 3UIBA 5JMSA 5DE2A 4IDVA 3FMKA 2C0OA 4FL3A 1RDQE 4XG3A 4A9UA 4D2VA 2PPQA 2VX1A 3AMAA 5LQFA 1TQMA 5DT4A 2ITQA 4L46A 4PL3A 5HLWA 4HVDA 3FY0A 2R64A 4DT8A 4USEA 2QOFA 5TKDA 2PMNX 2RFEA 2H6DA 3NUAA 3F3UA 4PP9A 4MXXA 2WMXA 4J52A 3QFVA 5DLSA 2PMOX 4FKQA 2YM7A 4IVAA 4XV2A 5F4NA 4FEUA 5GIOE 4WG3A 5CSHA 3I6UA 4CKIA 5KCVA 1YXUA 2IN6A 3IOPA 3RKBA 5EOBA 2YEXA 2ZV2A 3FAAA 4YTHA 5C8KA 5C01A 4KBKA 5M4CA 1ERKA 2UZWE 4NKAA 3BWFA 4FIJA 3TL8A 1J91A 2PMIA 4HVGA 2ERZE 4XOZA 1GZKA 3LFSA 3ZHPC 4AW1A 3HP5A 3E87A 4RVLA 3UC4A 3IDCA 3G0EA 3HRBA 4FTOA 5KO1A 3FL4A 4BIDA 4FTQA 5J9ZA 4QP2A 1G8JA 3TZ7A 3LOKA 3B2WA 4YZMA 1ZY5A 1W0XC 2GS6A 2PE1A 3HL7A 2GFCA 2BCJA 2PZRA 4IM0A 5E8WA 3ZO3A 1GJOA 5DRDA 5J1WA 4N70A 3CE3A 4J53A 4QYEA 3ZLWA 4FG9A 3KXNA 4E26A 4FIIA 4DFYA 3R02A 4EOJA 3G0FA 4C3RA 3O5AA 2VAGA 3DA6A 4F08A 4RPVA 5ETAA 1H24A 1Q8WA 4IAFA 1Q41A 1MUOA 3N9XA 4O0RA 3DKGA 3R8MA 5GZ9A 5ANDA 1ZOEA 2ZOQA 4BN1A 3HMIA 1YXTA 5CNOA 4YHJA 4UMTA 4IADA 2CKQA 2Y8OA 3QHWA 3T9IA 1XBCA 2IEWA 3KRRA 4K8AA 1VEBA 2CGVA 2VWIA 3P08A 5EHLA 4RVKA 4TYHA 3U6JA 3EN7A 1QPEA 3QUDA 1XKKA 4ZTSA 1R0EA 1JKTA 1QMZA 5AR2A 3OS3A 5ACKA 4QP6A 1JKLA 3LMHA