2XM8A

Co-crystal structure of a small molecule inhibitor bound to the kinase domain of chk2
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
293
structure length
265
Chain Sequence
VYPKALRDEYIMSKTLGEVKLAFERKTCKKVAIKINVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Structure-Based Design of Potent and Selective 2-(Quinazolin-2-Yl)Phenol Inhibitors of Checkpoint Kinase 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 58
structure length 265
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xm8A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xm8A01
4QYYA 4S2ZA 1ZYJA 3F82A 1FVTA 3R6XA 4OTHA 3C1XA 4UEUA 3AC4A 3DU8A 4I5PA 4JL9A 3UPXA 3A7JA 5DNRA 2R3IA 3V8SA 5HE3A 4DH3A 5EM5A 4DFNA 4KKGA 3A4PA 3GC8A 5D1JA 3TI1A 4MAOA 3DKOA 4DEAA 1BUHA 2XNBA 2ZB0A 4KWPA 4YSMA 3RJCA 3DBEA 3ZSHA 2JIIA 3LAUA 3DB8A 4WG5A 2YDJA 1MP8A 4LI5A 3FXXA 2JKOA 5CZIA 4USFA 3LE6A 5I9XA 2HZ4A 2J50A 4B7TA 3ROCA 3KK9A 2V0DA 3DQXA 1FMOE 3BLQA 3MVHA 3ZLXA 1OUYA 4CYIA 4ITIA 3OUNB 2BUJA 4MHAA 4M66A 5LOHA 4M7IA 3VJNA 5KX8A 3DJ6A 3JPVA 4UZHA 5HKMA 1P4OA 2QOOA 4V05A 3KF4A 3L9MA 4FMQA 4M15A 3VS3A 1FBNA 2XIYA 5EHOA 5EK7A 2Q83A 3PY1A 4HCVA 4RFMA 4DGGA 5BNJA 3A8XA 3MY0A 5CAOA 2GQGA 4HZSA 4JT3A 3EWHA 1YXVA 2ZV9A 2FSLX 3REPA 4JNWA 4MNFA 4TYIA 4NCTC 2PE2A 5CAQA 2NRUA 2GU8A 2NRYA 3GU8A 3OTVA 5DWRA 4C58A 5M4IA 1O6LA 3PPJA 3PG1A 2RFEA 2XIXA 1WVXA 1OL6A 3EFJA 3MESA 1J1CA 3EFKA 2XK8A 5E8TA 3KRXA 2UZLA 1FPUA 2OWBA 2O2UA 3FMJA 4FTUA 1NVSA 1U46A 4HCTA 1Q8ZA 4ITJA 1ZLTA 2J6MA 3HX4A 4PDOA 3IONA 2XNNA 5CYIA 2F49A 3OY3A 1U59A 2XUUA 2IZUA 1JKKA 2H6DA 3QUPA 3SDJA 1SVEA 1Y8YA 2VX1A 4D55A 4TNBA 3VUMA 3FMLA 4YURA 1QPJA 5CF8A 3PJCA 5F4NA 5HIBA 2OIQA 3GCSA 3ZLYA 3D5XA 4EUUA 3Q3BA 3H9RA 4YU2A 4IC8A 2OXDA 2HY81 4RG0A 4ARKA 3QQLA 2WTDA 4NFMA 1OKZA 2A1AB 2UZOA 2V62A 5FBNC 3K5UA 3BRBA 4MH7A 4FV5A 4ANLA 2FH9A 3OG7A 4FL3A 5I9WA 1Y6BA 5DVRA 5IDNA 3OXTA 4EK4A 4JG6A 3KA0A 5C4LA 5M09A 4FT7A 5GZAA 3TM0A 2W1CA 4CFVA 2GS7A 3NZ0A 4FTOA 4P2KA 3QX2A 5IG1A 4KNBA 2VWZA 4HVHA 3FEGA 3DK6A 3PFQA 3Q2MA 4A9UA 2VO3A 5HCXA 3FDNA 4DTBA 1GJOA 3G9LX 2Y6OA 1Q3DA 3HECA 5KKRC 2DQ7X 3JYAA 3NIZA 4GEOA 3LJ0A 4MNEB 4JVGA 4D5KA 3NW7A 4QQCA 2XJ2A 3SOCA 4DG3E 3C4CA 2XBJA 3P0MA 2VTPA 4QMLA 5GIOE 2PZRA 4GCJA 3IG7A 4GUBA 4MBLA 1TVOA 3W1FA 4DLJA 2NO3A 1URCA 4O7NA 4BY9E 2OH4A 4I21A 4U79A 5DR2A 4ONAA 3AC5A 5I0BA 2PMNX 3NW6A 5L2IA 1OM1A 3R73A 5CZHA 3GUBA 3LFAA 4XJ0A 2I0YA 4IE9A 4C2VA 3SVVA 2W7XA 3BZ3A 1VR2A 4DH1A 3PE1A 4ALUA 4NM5A 3GCPA 3S3IA 4E7WA 2I7QA 4L68A 2XP2A 5CALA 3S00A 3UQFA 5J7HA 2J90A 3PA5A 1WMKA 2QHMA 3MGYA 2BIKB 2OF2A 2QQ7A 2QURA 2PL0A 4QTCA 3SRVA 4O2ZA 4B0GA 3LVPA 4CFXA 1YHSA 3CGFA 1V0OA 1DI9A 3A99A 4EH7A 3UYTA 4EHZA 3WF8A 3WE8A 5A4EA 3SA0A 4RWIA 1GZKA 4D4YA 4DH8A 2ZM4A 5CEMA 4CV9A 4XHKB 2UW4A 2W9FB 3WILA 2O0UA 3I6UA 3DDPA 1MRUA 3OCSA 4F0GA 3OC1A 5C8KA 1MQ4A 3WOWA 4V0GA 3FKLA 4AACA 3DCVA 3ORXA 5JSMA 4PNIA 3E8CA 4JI9A 2IW6A 5EM7A 4AT3A 4CFFA 4E4XA 4OBOA 2VD5A 2VWUA 2R3NA 4M3QA 3DAJA 2UZNA 4PPBA 1PJKA 2C6EA 2P55A 3WBLA 2XKCA 2ZB1A 1OIUA 1PMUA 3EN4A 3LXLA 5E92A 2YZLA 4O0YA 3QTWA 4FSYA 4EHVA 5IISA 4M12A 5JH6A 5AIRA 4DT9A 5EDPA 4UMPA 2R0IA 1PF8A 3GBZA 3NUPA 3DJ7A 2W5BA 5IA5A 4BIEA 1PYXA 5CAPA 4MCVA 5KBRA 3IDCA 5D7AA 4EOPA 4A9TA 4Y83A 4FSUA 1QCFA 4QMWA 5J5SA 3RGFA 3D2IA 2BFYA 3D7TB 4ZP5A 4D2VA 5TKDA 2XIKA 1LR4A 3BYVA 5GZ9A 5BVNA 1W83A 4AFJA 2G1TA 2CGUA 3QKLA 4Y72A 4Z55A 2IVTA 4LUEA 3BEGA 5M53A 4DTKA 5AFVA 3CPCA 5AV4A 1BYGA 3OVVA 5LWNA 3AT3A 1M2PA 4AT5A 2J4ZA 5LJJA 5DT0A 3RHXA 5ANKA 4OBQA 2QOIA 1NT2A 1I09A 3E3PA 2QG7A 3UDBA 4N57A 3D5UA 4W4YA 2JFLA 4FV3A 1U5RA 2WMVA 4NM3A 4RLKA 3DLSA 3E93A 2O64A 3F61A 3HV4A 4OLIA 4MXCA 3R04A 2HW6A 4QOXA 5EDQA 4W8DA 2QOCA 2XH5A 3EIDA 4ANOA 4QP1A 3E87A 4XG6A 2YCQA 2QCSA 5FQDC 1KV2A 5A4TA 3O7LD 3ELJA 3QAME 5HD7A 2C3JA 2YM5A 4E5BA 3QL8A 3I0QA 4FKVA 4ZTHA 5HEZA 1BI7A 3DJ5A 5FTGA 4QQ5A 3FZ1A 3NNXA 4EKKA 1MUOA 1J7LA 3GU6A 2H8HA 2DUVA 3G5DA 1KUTA 2OBJA 3QD4A 4LM5A 1GZOA 3HV3A 3EFWA 1U54B 4FV6A 1ND4A 2QLUA 2WMBA 3KRRA 4CSVA 1Z57A 5AUWA 4O6LA 2CDZA 4MTAA 1JAMA 4TZRA 4F1OA 3OROA 4DEDA 2VN9A 4O7ZA 4EOQA 1F0QA 5C01A 1OBDA 4C02A 1YOMA 1NVRA 4HYUA 1K3AA 3MIAA 4GUEA 4WNMA 5HG7A 4C0TA 4MYGA 3F88A 2F7EE 3HMIA 3R8PA 2CNUA 4BWKA 4YMJA 4ZZNA 4AOIA 2C0TA 3DBDA 3DNEA 4IHPA 4UWYA 2CHLA 2HZNA 3DLZA 4D1ZA 3QQJA 3UMWA 4IAYA 4RT7A 3VJOA 1J7UA 5JN2A 2VX3A 2V22A 4RWJA 4L6QA 2BDJA 2VGPA 4RMZA 4XMOA 4EJ7A 2QONA 3ORZA 5B0XA 5TT7A 2XCKA 3DXPA 4L44A 3ATTA 2VO6A 4R5YA 3KXXA 5IA0A 4O84A 2ETKA 3II5A 5M4UA 2ZMCA 5FBOA 1MRVA 2DWBA 2HY0A 2I40A 1YHVA 1WBWA 3NS9A 3MFSA 4KSQA 3K3JA 4EK8A 5DRBA 5GNKA 3CKXA 4O83A 3CGOA 4GFGA 2GPHA 2WTVA 2J9MA 1BX6A 3MTFA 4BHNA 2GNLA 2J0LA 3PJ1A 3L9NA 5EM6A 3TTJA 2Q0NA 1OIRA 2Y4IB 4EK3A 4YR8A 3BGQA 2YIYA 4FVQA 5HHWA 2W06A 3PSCA 4IX4A 2WMUA 1JKTA 3CP9A 2VX0A 4A06A 4K77A 2CKQA 3VS1A 4BDKA 4C35A 3ZBFA 3Q2JA 2W4JA 4XBUA 5D7VA 2IZSA 3BX5A 5CU0A 2OJGA 4YLLA 3MH1A 2JDTA 1Q99A 4CTBA 2YISA 3B8RA 3FLYA 5C4KA 1YRPA 3F6XA 5CQWA 4R6VA 5CAVA 5JFVA 4RLLA 2R7IA 3UQGA 5IDPA 2BROA 3FLSA 4ENYA 5HBJA 5HVYA 3P7BA 3ULIA 4W4VA 2C5YA 4ERWA 4U3ZA 3KF7A 3V04A 1ZY5A 2WNTA 1E1VA 1YXSA 2X2LA 3DAKA 5AP5A 2ACXA 3CEKA 2VTMA 3QYZA 5HE2A 3BLHA 3R71A 5JGBA 2X1NA 4DBNA 1P2AA 3K54A 3NUXA 3QRTA 4DHFA 3A8WA 2CKOA 4F9AA 3TNPC 4BWPA 3Q4UA 4TW9A 5K5XA 4BFMA 5J1VA 2EXEA 1XR1A 3Q9YA 3LFQA 2WQEA 4ZTLA 3FV8A 3WF5A 4EOIA 3FLWA 4ITHA 5KNJA 2JIUA 3N4VA 2X7GA 2I6LA 4C3PA 5L8KA 2VO0A 5CT0A 4WNOA 3NYOA 4YJRA 4S30A 4PMMA 3TDVA 2QKWB 3LFCA 4X2FA 5I4NA 5D11A 4D1XA 2YWVA 3C50A 3FZOA 4QMTA 5FG8A 5AP6A 2WTJA 2WQNA 3LCSA 2QODA 3VRZA 3R83A 1OITA 4LGDA 1A48A 2YIWA 4QP8A 2XKEA 2EB2A 3CQWA 3TV4A 3F66A 5IPJA 3RAKA 3ZO4A 5AUZA 4DGLC 2OJIA 5LVMA 2RF9A 1UVRA 3PVGA 3DKCA 4UY9A 3W32A 4C8BA 4BCKA 5HO7A 3KXHA 4IM3A 2J0MB 1W82A 3ZUTA 3M2WA 4A7CA 1PYEA 5L2TA 1ZYDA 3FLZA 4CT1A 5FEQA 3MH0A 2YACA 5AAEA 2AYPA 4TXCA 1J7IA 4UBAA 2VGOA 4DH7A 3R8LA 4D9TA 3OTUA 1UWHA 4J53A 4EHGA 3JY0A 4MNEA 3KULB 3BV3A 5M55A 4D58A 2C1BA 2XRWA 4D5HA 3QGWA 1Q8UA 2VWYA 2OW3A 5IEVA 2C6TA 4N6ZA 3VUKA 4AXAA 4IH8A 3P23A 2W1DA 5HTIA 2GTMA 4S32A 4WRGA 5LCKA 2C47A 5CQUA 3QC9A 2DYLA 4S33A 5K0XA 2YCFA 3E8NA 1AGWA 1GAGA 2IWIA 3LFBA 5JQ8A 2UZBA 1LUFA 3HGKA 2R3GA 3IGOA 4OBPA 2PVLA 4YBKA 3S0OA 5F94A 4GYGA 2EWAA 2OSCA 2WTIA 3QX4A 4FSNA 3DY7A 1SNXA 4JBVA 4C59A 5KMLA 4OTPA 4AUAA 3GU5A 3RHKA 1TQMA 5IUHA 3BPRA 5KMMA 3D0EA 3SOAA 4FEXA 1FVRA 2X6EA 4X2NA 4IMYA 1YOLA 2WO6A 2EXCX 4RWKA 1APME 2R3PA 4FKTA 5CXHA 3P9JA 4OTIA 3WZDA 3PSBA 2QG5A 3CQEA 4FZFB 4GV1A 4UXQA 2B9JA 3ALNA 4YTIA 2B9HA 4FICA 3PDTA 4J8NA 3UOHA 3VUTA 3FXZA 4GFMA 3P08A 3DA6A 2FUMA 3R7OA 4BB4A 3PIYA 5I9VA 4JQ7A 1SMHA 1UNLA 3KMMA 3DBCA 1OI9A 3ZSIA 4NKAA 1JVPP 2G9XA 3PWYA 4I93A 1SYKA 1KE7A 3MFTA 3RM7A 4FOCA 3R2BA 5KKRB 4IZYA 4D2RA 3WARA 3R2YA 2W1ZA 3LMIA 4JAIA 4YJPA 4BYIA 4U40A 1JSVA 2ZV7A 3FLNC 4RJ4A 3UIMA 5J5TA 2QO7A 4FIEA 1B6CB 4RJ3A 4YTHA 5FM2A 1YDRE 3UC3A 4IM0A 3Q9WA 2X81A 1H00A 4OGRA 3OBJA 3N4UA 4ZTQA 2Z60A 4C34A 2CLXA 4CMOA 5C8NA 4CGAA 2QOBA 4X2JA 4FL1A 4ZTSA 1PXIA 1ZOGA 2VWBA 3AGMA 3PXYA 4LOQA 1WFCA 5FTOA 4PDYA 2CGWA 4JAJA 4GJ2A 3EQIA 4RVTA 2VWWA 3A2CA 4O2PA 5LWMA 5CTPA 2ZYBA 1WBTA 1XHAA 3MJ2A 3UO5A 3A4OX 4XS2A 4O27B 2AC5A 2PVKA 4TT7A 3F2NA 4RJ5A 4F7JA 4C4FA 5LXMA 4JOAA 3TKIA 5CAUA 1OL2A 2PK9A 4RIXB 3GP0A 4FV9A 3A62A 3ZXZA 4DFYA 5JGDA 4PP7A 3MB6A 2ESMA 1NXKA 2C5NA 4DBXA 4MWHA 4O22A 4AZEA 5AP0A 5H8EA 3NYNA 5IEXA 4BTMA 1OL5A 2BVAA 4IWPA 4OTDA 4DF3A 3CJGA 4AGCA 2QD9A 5CWZA 3Q53A 1UNHA 5A54A 4QNAA 3GC0A 4KABA 2UZEA 3OF0A 3OS3A 3UNZA 3FL5A 5E8SA 2WMQA 4GSBA 3R9DA 4L8MA 4RX9A 3UTOA 1H4LA 1H08A 1K2PA 3EOCA 3UIXA 3T9TA 1P5EA 1PXPA 1SVHA 1SM2A 3BHHA 4FIIA 3OOMA 4XP2A 5KHWA 4O7RA 3VBYA 3O23A 2UW5A 4RQKA 4XLIA 3U51A 3IDPA 4HGSA 1U54A 3CS9A 4V04A 3QRKA 4I20A 4QMVA 4EQCA 5HLWA 3I81A 3OCGA 3F9NA 3QZFA 4FC0A 4HYSA 3M42A 4W9XA 4U43A 5HBHA 3TUBA 4R3CA 4WKQA 3KEXA 3UOJA 4OUCA 2P4IA 1JQHA 3OZ6A 2X7OA 3DS6A 3LQ5A 3PRFA 4FK3A 2GS2A 4KBKA 3UO4A 4D2TA 3ACKA 3SRVB 4E6AA 4WHZA 3CBLA 1IASA 4AE6A 3BBWA 2UW6A 3ZC6A 3FSKA 2ZDUA 1Y91A 5IMXA 2JDSA 1PXOA 4IIRA 2HW7A 2GTNA 2OICA 4FA2A 2V5QA 2B55A 3OCBA 2ITPA 3F3WA 3TTIA 4RJ7A 1XBAA 4WG4A 3T3VA 3GC9A 1YQJA 5FD2A 5D10A 4WA9A 4E8AA 5A6OA 1T46A 4EZ3A 2CNVA 4ZS4A 4V0GB 1OUKA 1J91A 5JRQA 3VS7A 4M0ZA 2XYUA 4AN9A 3DAEA 3LCDA 3ZFYA 3UZPA 4X0MA 1M7NA 2F57A 4TYHA 4LGGA 3ZYAA 4FYOA 1OL7A 1OPKA 3QC4A 3V51A 2OJJA 3ENMA 3QCXA 4XX9A 5TO8A 3V5PA 3U4WA 5LMKA 4FODA 2Z7LA 2UUEA 2YIXA 4QP3A 4FGBA 3NUAA 2VO7A 3L1SA 5FDXA 3WI6A 3HVCA 3K5VA 4XNEA 1V0PA 3TN8A 3QZHA 4D9UA 3CIKA 2GQRA 4F0FA 3G6HA 2FYSA 5KMIA 4MXAA 4CQEA 3D14A 3ODZX 2IN6A 3WZEA 3R9HA 2W1EA 2DS1A 2BILB 5DN3A 3ZO3A 3DKGA 4BC6A 1JBPE 4WSQA 2ITWA 3H30A 4EH6A 2R3LA 3JY9A 4YSJA 3C4XA 1IA8A 4Y46A 5LMAA 1MQBA 3HYHA 4HZRA 5K9IA 2J5EA 2ITQA 4YJSA 5K3YA 4EHEA 5BUJA 1BMKA 4BKZA 5JFXA 4GRBA 5LQFA 4RC2A 2CCHA 4YTFA 3UIUA 5L8LA 4HJOA 3RKBA 3EFLA 4OW8A 3KFAA 3PRIA 2Z7QA 5DR9A 2RG5A 3MA6A 4J8MA 3R8UA 4BRXA 4MF1A 4R8QA 4H3QA 3PIZA 4IAZA 4ZY6A 2WMSA 2XNEA 2CN8A 4K11A 3C4FA 2PYWA 3LQ3A 2IVUA 3EQFA 4PTCA 2XIZA 3LFSA 4UXLA 4W4WA 1Q5KA 5CU2A 5KE0A 3HMOA 4MXOA 4LGHA 2BMCA 2WAJA 3FMEA 5L6WL 3GI3A 4ZS0A 4I24A 5IA2A 1IRKA 2C5VA 3UZRA 3FL4A 3RINA 4OT5A 2EVAA 2XJ1A 3G9NA 2IPXA 3QLGA 1YDTE 3KGAA 3NRMA 4GU6A 2ITOA 2BFXA 4WNKA 4FKGA 3QWJA 3Q9ZA 4IB1A 3NWWA 3ZZEA 2GNJA 2QU5A 4YJUA 4IXPA 3E88A 5IMEA 3HEGA 5BVOA 3DZQA 4FVRA 2WU7A 3IKAA 3PZHA 3W55A 4QP7A 4DEIA 3OUKA 2R3MA 2AC3A 3C5IA 2YJSA 3DGKA 3UE4A 3OWPA 2OGVA 2WHBA 1H01A 4O0UA 5G6VA 4EZ7A 4EKLA 5D41A 4YJTA 3ZC5A 1STCE 5HE1A 3TEIA 4NCTA 4LYNA 5F9EA 1QMZA 4BN1A 1H1QA 4BGGA 1XO2B 3FUPA 4IDTA 3LQ8A 4WO5A 3TZ8A 3PXRA 4AA5A 4MVFA 4HW7A 3W33A 5A4LA 3F2RA 2WMAA 3EYHA 3KULA 5BVWA 3UOKA 2P2HA 4JBPA 4NSTA 2HAKA 3QCQA 4BIDA 3COMA 4CG8A 4ACDA 2YJRA 5C26A 4IX5A 2BDWA 2UVYA 4JQ8A 3R63A 4M0YA 3DB6A 3MFUA 4GS6A 4QTBA 4MQ1A 1UU7A 2YAKA 2VTLA 2W5HA 3OOGA 3NYXA 2BKKA 4FTAA 3V5TA 1DAYA 1DAWA 2WXVA 4BCFA 2E2BA 4EOKA 4DN5A 1M17A 2QC6A 4FG8A 2A19B 4MBIA 3DV3A 2PMOX 1FMKA 5HO8A 1UU9A 2NNWB 3Q04A 4AZWA 2VTOA 1KWPA 1OZ1A 3VS4A 2VTSA 1V1KA 4E73A 2PWLA 2B52A 4LG4A 4BCHA 4JR3A 4AFEA 3R01A 3CC6A 4XRLA 4CG9A 1OBGA 3MFRA 4AF3A 2BZIB 1CTPE 3UO6A 4BGHA 2BAJA 3MH3A 5BQ0A 5H8BA 5ACBC 2ERKA 4PRJA 5FP5A 4ZOGA 1RJBA 3BYMA 3I60A 4YHJA 5EH0A 3TUCA 5HCZA 1YXUA 2F2CB 4G3DA 3W8QA 5C27A 3TJDA 2QOHA 2XF0A 4RGJA 4FYNA 5CS6A 5L8JA 4YZDA 3MPMA 1KOBA 3E92A 3UP2A 5CEKA 2WGJA 3OWJA 2CJMA 3SW4A 3AMAA 5LMBA 1XH6A 1XKKA 3NYVA 4FBXA 5E7RA 4U80A 1SZMA 5L2SA 5K5NA 5IZFA 4LUDA 2WD1A 3SXSA 3UVPA 2RSVA 2PY3A 3BGPA 2WEIA 3IO7A 5J1WA 4RPVA 5IQAA 4YHTA 4WG3A 4EQMA 4YJOA 4EUTA 2XNPA 3W2PA 3SGCA 4G1WA 3QF9A 5AMNA 3O8PA 4KS8A 4JG7A 3PVWA 3T3UA 1PXJA 5H8GA 4X3FC 3PXQA 3SV0A 3HUCA 4BYJA 4F1TA 2YDIA 3QKMA 3NSZA 3V3VA 2V7OA 1Q3WA 3ZO1A 3I6WA 5A4CA 3SG8A 1W8CA 3QCSA 1Q61A 4ACMA 4F64A 3NDMA 3QQUA 4PDPA 3H0ZA 4XP0A 2UW0A 4FK6A 2W1FA 4JS8A 2PVYA 4RIXA 5HG5A 5AA9A 5EQPA 2WQOA 3DZOA 4OR5A 1WBSA 1YXXA 1Q41A 1ZOHA 4F9CA 4XG8A 1QPDA 1AD5A 2E9VA 3BGZA 2HXLA 4K1BA 4NW6A 3ITZA 3RVGA 2FVDA 3AOXA 3KN6A 3OMVA 4FX3A 3G51A 4F0IA 5AAGA 4F6UA 3DNDA 4TYJA 4HPUE 3BYSA 3WYXA 3HZTA 4W4XA 2XA4A 4KIKB 5JEBA 4LFIA 4O7LA 2YIRA 4L3JA 4LV5A 5D9HA 4XG9A 2Y4PA 2OKRA 4XBRA 2X39A 3ZH8A 4A4LA 2JAVA 4CMUA 1MRYA 2VZ6A 5J8IA 1ZWSA 4B6LA 2BRHA 3ZFXA 5J87A 3FZTA 4PX6A 1AQ1A 3MA3A 2ITUA 2P2IA 4I0RA 4BDDA 4A4XA 3MY5A 1M7QA 1R78A 3OCTA 4ZJIA 2GFSA 5BYYA 2J7TA 4E5AX 5HE0A 1KE6A 3B8QA 4FKSA 4GW8A 2Z7SA 3VNTA 4EH9A 2XRUA 2R9SA 2FO0A 3HA8A 3UPZA 4HVDA 3O51A 2R3KA 4HVIA 3KL8A 2BAKA 3CE3A 3NGAA 1NW1A 3UVQA 2HWPA 3MSSA 5EQEA 3ZTXA 3FJQE 2VTTA 3KCKA 2YHVA 2HELA 1DS5A 2NPQA 3LXPA 3SG9A 3ZMMA 2BALA 2XCHA 4H1JA 4C62A 3W2CA 3SHEA 5FXQA 1Q62A 4PL5A 2IO6A 4YC8A 4X7QA 2G2HA 3PWDA 3BYOA 3V5JA 3SLSA 3HDMA 4F7LA 2R0UA 4KRCA 2WB8A 3DK7A 1XH9A 3K3IA 3PY3A 1PXLA 4N70A 5I9UA 4BHZA 5HTCA 2H96A 2A2AA 5HORA 2I0VA 5LVNA 3OWLA 4RIYB 3DXNA 3BCEA 5HI2A 3QQKA 3PIXA 3RNYA 5CSXA 2PVHA 4U41A 3Q52A 1KE8A 4IJPA 3VAPA 3BHTA 3ORMA 4K18A 5JZJA 5KMJA 3D9VA 4DA5A 1R0PA 2ZAZA 4ERKA 2BRBA 3U6IA 4K33A 3ZEWA 4KAOA 1QL6A 4APPA 4E1ZA 3AMYA 4RBLA 3VVHA 3SKCA 5AR4A 1SNUA 3FMDA 5AEPA 2CPKE 4BGQA 2CKPA 3Q5IA 2C6KA 5AR7A 4DFZE 4AW1A 3AQVA 3CQUA 3E64A 5IQGA 4FZ7A 4ZZOA 5L6PA 2XM9A 4PWNA 1DM2A 1JSUA 2GDOA 5IH6A 3UBDA 3VUHA 3AGLA 4L45A 3C51A 2EB3A 3ZDIA 4FKOA 3FI4A 5H2UA 4CFMA 3OT8A 1RQQA 2YCSA 3QD3A 3W8LA 3O2MA 4IX6A 4R3RA 3RNIA 5FTQA 3UG1A 3P5KA 2QVSE 3ZFMA 2B1PA 2XK9A 4BDEA 2CN5A 2QO9A 2RKUA 4FEQA 3O7LB 2C6IA 4FNXA 5HLPA 4DC2A 3H9FA 5DOSA 5CI6A 2Q0BA 4J99A 5F20A 4JDKA 4CV8A 3FE3A 4U81A 5GIPE 2YM3A 1DI8A 2ZOQA 3TKUA 3OBGA 3DBQA 3OWKA 4FEVA 4FTLA 2CGVA 3NIEA 3Q9XA 2JBOA 4EH4A 3GOKA 5HGIA 2C6MA 3RCDA 4A9SA 3I5ZA 4WUAA 5LARA 4W9WA 5EW9A 3FI3A 3PPZA 4A4OA 4BI0A 2VAGA 1WCCA 5JFWA 3E3BX 2C6DA 1H0WA 3R9NA 2CMWA 2E9UA 3LHJA 4UYNA 4Q5HA 5ETFA 3R1YA 4MXXA 3VHKA 2XVDA 1Q4LA 3R30A 5CI7A 4CEGA 3FSFA 5BPYA 5HTBA 2OZOA 4YNEA 4EK5A 3ZM9A 5AX9A 4EOSA 2ITZA 3GFWA 3CCNA 3I1AA 5CENA 3LKMA 4CFUA 5KHXA 2X4FA 4MEDA 3I0OA 5HCYA 3EQRA 5CSVA 1R1WA 3R9OA 2PU8A 4FZDB 4IZAA 3OXZA 4Q9SA 3O71A 3UVRA 3QD2B 4C36A 2GFCA 3SX9A 3PXFA 2FB8A 3T8OA 4IB5A 1J1BA 4I6FA 2OU7A 1UU3A 4AZSA 2YM4A 2IG7A 3DXQA 1KV1A 3WZUA 4E3CA 3LIJA 1O6YA 4OTQA 5AR8A 4DINA 4RC3A 4WSYA 4F6WA 2PHKA 1H27A 3E62A 3Q32A 5E9EA 2E9NA 3MPTA 2JKQA 3VUDA 4NM7A 5J7BA 4DEEA 3F5PA 5CEIA 3LM5A 3OXIA 4L9IA 4CYJA 5M4FA 3GEQA 4A9RA 2PUUA 4IVAA 3LZBA 1FINA 3CLYA 5C9CA 4AA0A 2G2FA 5T3QA 3FY2A 2Z2WA 3U54A 1FVVA 2ERZE 5AA8A 2ONLA 2UW9A 2XK7A 4U44A 3VRYA 2VWXA 4FOBA 5DT3A 4TYHB 4YJVA 2R3JA 5A4QA 1OECA 2B7AA 3DDQA 4F7NA 4OTRA 4CFWA 5IA1A 2WTKC 3KQ7A 4O91A 3SD0A 3HAMA 4LOPA 2C6LA 4DE4A 3GOPA 4XUFA 3VBQA 4QMQA 1CMKE 3D2KA 4LRJA 4AE9A 5CF4A 4O7YA 3TNHA 4IB3A 2VTNA 1FQ1B 1WZYA 3F5UA 1OPLA 1ZYSA 3BBTB 4DGNA 5JMSA 2IVSA 3DTWA 3RMFA 3VBVA 2OK1A 5I3OA 4A9YA 4JJRA 2XZSA 4L52A 4BF2A 4FGRA 3AT2A 4CVAA 3MVLA 5CLPA 3EL7A 3LFNA 4H58A 2O5KA 3HV5A 2GS6A 3TZMA 2VTRA 2C1AA 2EXMA 4ASXA 5AV2A 4E4LA 2QKRA 3ZRLA 4J7BA 1ZYLA 4HNIA 4USEA 2XNMA 1OL1A 3DK3A 3NR9A 4AZTA 5FUTA 4GU9A 5CVGA 2WMWA 2G15A 2BZHB 4IQ6A 4DG0E 1M14A 5T68A 3CSVA 2REIA 3NNUA 1JWHA 5AJQA 3BHUA 4Z9LA 2PZPA 5FEDA 2ONLC 3NAYA 1GIIA 2W4KA 4JQEA 3AC1A 5IQCA 3MH2A 4DFBA 2JKKA 2YN8A 2VTIA 3CTJA 3RPRA 3VS6A 4CXAA 1YWRA 2P33A 3PPKA 4IAKA 4S34A 3EQGA 3UGCA 5HG8A 4IM2A 2O8YA 3A60A 4O0TA 3RAHA 2X4ZA 3UNKA 5EFQA 3RP9A 1E9HA 4DFXE 2BAQA 3B2WA 3ZZWA 3KXNA 2ETMA 4YZMA 1G3NA 1GY3A 2I0HA 5HIDA 4AT4A 4BKYA 4H05A 3Q5ZA 2CGXA 1BI8A 2UZDA 4DH5A 2FA2A 4O0VA 4QYHA 4PMPA 4UMTA 3UIBA 2W1HA 4K0YA 2OXYA 5ETAA 3F3ZA 3VO3A 1WVYA 5ICPA 4QTEA 4NZWB 3R7VA 3RPOA 4CKIA 3EHAA 3AC3A 4JDJA 2PMIA 3PLSA 3A7FA 3EYGA 4YBJA 5CSHA 4FIJA 4IVDA 3V6RA 4F99A 1KE9A 5ANOA 4DFLA 4OTWA 2HENA 3LXKA 3SXFA 3U8WA 3V8WA 2F7ZE 3JVRA 3VF9A 3KXMA 4HGTA 5B2KA 1IAJA 2WMXA 4U5JA 5AM7A 5DFPA 4EOMA 4BL1A 3BHYA 4JLCA 2X2MA 5FM3A 5GZ8A 1XH4A 4L53A 5DYJA 2RL5A 5M06A 1YI3A 3AD4A 5HO6A 4EH3A 5CEPA 2XKFA 3L8PA 4KIKA 5BYZA 4C33A 2QNJA 3KXZA 3OFMA 5ANIA 2O65A 4MD9E 2IW8A 3HP2A 5M51A 3Q6WA 1W84A 3GCUA 4FTJA 3V5WA 4XG4A 5AP2A 4O0SA 1BKXA 3HDNA 3TXOA 4ASZA 2JLDA 4AGDA 4G6LA 4RSSA 4I5HA 4YZ9A 5CX9A 4E6CA 2AUHA 2ZJWA 1Y57A 3CY2A 4E4NA 2HOGA 2R5TA 2P0CA 4BCIA 5EOLA 1XH7A 4DG2E 5F95A 3NCZA 5EDRA 2R2PA 3R8VA 4FTMA 1O6KA 3BYUA 3I7BA 1UNGA 1FGIA 2PE0A 2WFYA 3G33A 3GCQA 3O50A 4HGEA 4FV4A 4L42A 2XIRA 4X3FB 5EW3A 5IH4A 5M56A 3VBTA 4DCAA 4FKQA 4ZJVA 4FKIA 3E7VA 4LL0A 1J3HA 4IJ9A 3QGYA 4RIWA 4B9DA 1GZNA 1ATPE 4TWNA 3LM0A 1PY5A 4GKIA 3OEZA 3FXWA 3COIA 3Q4CA 4Y73A 4BICA 2UW7A 4I22A 3GFEA 4H36A 5EKNA 2A4LA 4KINA 4QQJA 4TYGA 3WE4A 1H1RA 3BQCA 4NM0A 3WF6A 5IQHA 4EH5A 2PUPA 4EBVA 3BEAA 3AXWA 3BE2A 4FSWA 5JK3A 3SXRA 4IBMA 3QZIA 4BDAA 1KSWA 2PZ5A 4GK3A 2A0CX 4CZTA 2X9FA 4RIYA 2B4SB 4BDBA 3PJ2A 4O1OA 2B0QA 3U55A 1ERKA 3BE9A 2VWIA 4U45A 3ERKA 2UVZA 4KKEA 3ZUVA 4AP7A 4BBMA 5J9LA 3U4UA 2W1GA 4B4LA 1QPCA 4L67A 4AW5A 3KXGA 3PA3A 2OXXA 2XK4A 3HRCA 1GIJA 2H9VA 3PVUA 5E90A 3C9WA 4CRLA 2IZTA 5BX0A 4FV1A 3EL8A 4X2GA 4YLJA 2PULA 4RA5A 1UU8A 3EB0A 4ENXA 1QPEA 3P1AA 3RZBA 4AQCA 4AGUA 3VBWA 2OH0E 5CU4A 4G2FA 4N6YA 5JFSA 2FSOX 5HNBA 5DIAA 5GINE 4NEUA 2GNIA 5EHLA 4CCUA 2XNOA 4EWHA 4R1YA 3V8TA 4RX7A 4L3LA 4BCJA 4L43A 3MN3A 2PVRA 1PMNA 4ANSA 3DKFA 4M97A 4O82A 3QTQA 3IS5A 5CT7A 3D94A 4ACGA 5FWKK 3GT8A 5ANDA 3ZS5A 4AA4A 4DTAA 3QHRA 2YEXA 4FG7A 4I6QA 3RALA 4B99A 4H1MA 4FTCA 2CKEA 4MQ2A 4RVLA 5I5ZA 2VV9A 3LLAA 3NCGA 4I94A 1B39A 1GNGA 3QYWA 5D12A 1NA7A 4MD8E 4L7FA 4J1RA 4X6QC 4XV9A 1ZXEA 3FZRA 3QRUA 4H3PA 5CNNA 3ZBXA 3ZEPA 3U9CA 3EMGA 4JRVA 3WF9A 2VU3A 4CKJA 2BRNA 1OIYA 4QMOA 4UB7A 4ID7A 4JIAA 2WZJA 4FI1A 3CPBA 3R7IA 2R3HA 1WBPA 4EK6A 4G3EA 2QOFA 1Q24A 3A61A 5E8ZA 4TWPA 4ZIMA 3MDYA 4ANNA 4OAUC 3TCPA 3DTCA 3O8UA 1PW2A 3FAAA 3PJ8A 3KREA 3RAIA 4U7ZA 1TQIA 5L3AA 2VNYA 4TRLA 3C4EA 3UOLA 4G3GA 3IOPA 3R22A 4F9WA 3H0YA 3VQHA 3FI8A 4AU8A 3KMWA 5FDPA 3CJFA 3Q4TA 4PDSA 4E93A 3TIYA 4KSPA 3ZLWA 1JPAA 3SAYA 3CD8A 4FV8A 2GHMA 3MI9A 3QTZA 2ETRA 4MX9A 4C3FA 5C8MA 1CKJA 1ZYCA 4AZVA 5AP7A 4HPTE 4ALWA 5JT2A 4BZNA 5L6OA 4TPTA 1IR3A 1CSNA 1UWJA 1VZOA 1H25A 1H8FA 4F6SA 3FMKA 1P14A 4XV2A 3TIZA 1XWSA 1G5SA 3FPMA 4J71A 3EH9A 4L01A 5LVLA 4EOJA 4IW0A 4WIHA 2LAVA 4EZ5A 4UYAA 3WZKA 5ANEA 4XV1A 3D5VA 2QI8A 4XCUA 2W96B 1BLXA 3ODYX 3FPQA 4ACCA 1V0BA 4IAFA 3VBXA 2OLCA 4M84A 3H9OA 5E4HA 3CKWA 3D7ZA 4PQNA 4RZVA 4UMUA 5B7VA 5HIEA 1TKIA 4PMSA 3N4TA 4O0WA 3EN7A 4P7EA 4AGWA 4EJNA 2JDOA 1YXTA 2R64A 5DG5A 4RIOA 5I3RA 4G3FA 4YGAA 4G5JA 3FYJX 5CF5A 1CKIA 4AW0A 2YM7A 3BU3A 2OFVA 3FQHA 4C4EA 3LFEA 4UX9A 3GQLA 4GT5A 4C57A 3C5UA 4WBOA 4TKSA 5AR2A 4CMTA 3HLLA 3M11A 4FSMA 3FZSA 4JIKA 5AADA 2Z02A 1Q8WA 4U97A 3EN9A 4QP6A 2OG8A 2UW8A 4S31A 4PUZA 5GHVA 4C4HA 1Y8GA 4HGLA 2R7BA 2W17A 4J95A 2I1MA 4G5PA 5TOZA 4QQTA 4U0IA 4APCA 3GENA 3DT1A 4IX3A 4Q2AA 2R3QA 3FLQA 4U3YA 5BVKA 5LVOA 1OGUA 4LRMA 4EH2A 4Z7GA 2Y7JA 5AX3A 5EYKA 2QHNA 2C4GA 4KA3A 4Y85A 3AMBA 3C4ZA 4KS7A 5HICA 5BVEA 4Y8DA 3HMNA 4M68A 5DBXA 3TJCA 3PLAE 3QTXA 4I0TA 4BBEA 4BCOA 2YCRA 2RIOA 4F7SA 1L8TA 3P79A 5M08A 3LPBA 3OP5A 4MXZA 3ET7A 4RWLA 4RA4A 4HYIA 3WIKA 2XKDA 3P78A 4L7SA 5DGZA 5AUYA 2VTQA 2XEYA 4X6RA 3EKKA 3VS2A 1GIHA 2B9FA 1CDKA 3ZRMA 2BR1A 1ZMUA 2WTKB 4YUQA 1YHWA 1YVJA 2KULA 2UZTA 2OF4A 3FC2A 3FQSA 2C0IA 3KY2A 3ORTA 4F08A 3C4WA 4M14A 4QMNA 5AUUA 4PTGA 4IWOA 4F1MA 3KB7A 4D4RA 3MBLA 5H3QA 4F65A 2V7AA 5TE0A 3HL7A 4JDIA 5HLNA 3MWUA 5HZNA 3HMPA 4LV8A 5ITAA 3QQGA 3KRLA 3TV7A 5HG9A 3ZOSA 5I9ZA 5IKWA 2XYNA 3DQWA 1JOWB 4NH1A 2CNQA 2J2IB 4DFUA 3F3TA 2C3IB 1XH5A 1BL6A 1M52A 3QUDA 4Q5EA 4UMQA 4J98A 1IAHA 3KRJA 3GGFA 4XG3A 5CEOA 5CY3A 2PVFA 2C3LA 3LLTA 4XOYA 4YZCA 3CR0A 3F2AA 3GB2A 3TKHA 2NP8A 2W4OA 3LCOA 4I1ZA 5M44A 2PUIA 2QOKA 4QP4A 4KUJA 5HOAA 2YABA 2ZM1A 3QCYA 3MJ1A 4FTKA 5CEQA 3GVUA 5DEWA 1VEBA 1HCLA 4O1PA 1S9IA 3FI2A 4RFZA 3Q4ZA 5BMSA 2BHEA 2JD5A 3RI1A 2WQMA 4R7IA 5E1SA 2GHLA 4LQMA 5EHYA 4QYGA 3VWAA 4CRSA 5AUTA 4R77A 4EOOA 4X3FA 2HXQA 2OJ9A 5FP6A 4J96A 1CKPA 4C4GA 4GYIA 2YLFA 4C38A 1H28A 3CY3A 5CXZA 4LMNA 5KUPA 3EQPA 3I4BA 4XH6A 2WIPA 4EH8A 1JNKA 4FL2A 3R8ZA 4EBWA 3NVMB 4FZ6A 2X0GA 3NEWA 4BVUA 3U6HA 3R9RA 1R3CA 4U6RA 3SC1A 4MD7E 4AOJA 3A7GA 5F1ZA 2QO2A 2J0KA 3VW6A 3FBVA 3R00A 4AS0A 5M4CA 5KZ0A 3HMMA 3HKOA 2RFSA 2QU6A 4YPDA 1PMEA 4FSZA 3PUPA 3EQBA 3R28A 1LP4A 4K6ZA 5EYMA 4O7VA 3RWQA 4QP2A 5DHJA 5AV1A 3KVXA 4QMSA 1WBNA 4EC9A 2YWPA 5JKGA 3R7YA 5AP4A 5E8WA 4CLJA 5FXRA 5HU9A 3JXWA 5EI8A 4QTDA 4TL0A 1T45A 3NNVA 5J95A 2PMLX 4L00A 3MV5A 4FUYA 1OMWA 3OHTA 4WRSA 3Q96A 3PVBA 4IFCA 5J79A 1LPUA 3RAWA 4EWQA 3EQCA 3F7ZA 4X21A 3O8TA 4BDGA 5HNIX 5HX6A 3IGGA 3HV6A 3KCFA 2QLQA 4NUSA 4M69A 3R7UA 4I4FA 4CD0A 2BKZA 3IW8A 4JX7A 1F5QA 4F09A 4ZLOA 3ALOA 3QUEA 4QT1A 4L46A 5JRSA 2F7XE 5L2QA 4FKWA 1XBBA 2KTYA 3QHWA 3RK5A 4BDFA 2W5AA 4I92A 1ZARA 2ZV2A 5ETIA 3VW8A 4U42A 5CU6A 4UV0A 4BTFA 1VYWA 4W8EA 4BCNA 5IU2A 4D1SA 4ZTMA 4NK9A 4R3PA 4ZTRA 3CXWA 3VHEA 5LCJA 4IACA 3SQQA 1P4FA 3R21A 4C37A 4H3BA 1X8BA 3DBFA 3L9PA 4NJDA 2VTJA 1ZZLA 4ZJJA 3TV6A 1OPJA 5BMMA 2HIWA 2WEVA 4FSQA 4GT3A 3TL8A 4GVAA 4ZMEA 3NMUF 3U87A 4I41A 5ETCA 5AV0A 4RJ6A 3CTHA 1I44A 3L8XA 4BDJA 4E26A 4EYJA 4IDVA 3LFFA 4BIBA 1PHKA 5EOBA 1OVEA 2PVMA 2HZIA 3PJ3A 2OI4X 4AWIA 1FOTA 1OIQA 1Q8TA 5TR6A 5IH5A 4QPSA 5DE2A 1PXKA 3F5GA 4RZWA 5KCVA 5G1XA 3ORPA 4IAIA 4E4MA 5HNGA 5CSPA 2X9EA 4JRNA 3NW5A 3TNQB 5BVFA 2HCKA 2W9ZB 1ZMVA 3EN5A 4QMUA 1R39A 1H26A 2ZDTA 3ZONA 4AOTA 4G9RA 4O86A 2ITXA 2GMXA 3NUSA 2BRMA 2J5FA 4NIFB 4RIWB 4UWCA 3VQUA 4D0XA 4Z7HA 2F4JA 4NW5A 2XM8A 2IZRA 3VUGA 4N0SA 3HRBA 2OZAA 4FKRA 5DLSA 2OO8X 3ZDUA 4FNWA 4KB8A 1JLUE 2WIHA 3FKOA 3AC8A 3W2QA 2JC6A 4JXFA 4ASDA 3HV7A 5IUGA 2UZVA 1SVGA 4K8AA 4CFNA 2WU6A 4P5QA 3W18A 4QNYA 4C4IA 1W7HA 1PKDA 4TNDA 4ZMFA 5JQ5A 2YAAA 4GT4A 3PE2A 3ZLSA 4UN0C 4IZ7A 3ANQA 3FMHA 3QFVA 4RQVA 3G90X 4ORKA 4B8LA 1M2RA 2UV2A 2C5XA 4FZAB 5AP1A 5ANJA 4CKRA 4IC7A 4FTQA 4C7TA 2WMRA 3R02A 3SW7A 5TF9A 1U4DA 5A3XA 3NUYA 1W98A 4HVGA 4ZLZA 4ZY4A 5EQYA 4Y5HA 2Y9QA 3G0EA 4MKCA 2XJ0A 2XK3A 4XRJA 5DEYA 3WF7A 3IW6A 3COKA 5DR6A 4ZEGA 2JIVA 1OB3A 4BDIA 2ZVAA 4PPAA 1PXMA 2X8EA 5JZNA 3BWJA 1RE8A 4ZSEA 2IW9A 3E7OA 4YP8A 3TDWA 3BU5A 4CZYB 3ATSA 1HOWA 3R1QA 4XLVA 2CCIA 4EC8A 4I3ZA 1YW2A 4PTEA 3OW4A 4ZSAA 4YO4A 1R0EA 1YI6A 4ZSLA 4QMXA 2XB7A 2IJMA 5J9YA 1XH8A 2PZYA 4O96A 4P90A 1Z9XA 4YPSA 4F9BA 5BYLA 3C0GA 3DPKA 4IAAA 3UYSA 3QTUA 2R3RA 3CTQA 3NUUA 2WOTA 3QBNA 4AN2A 3QTIA 4UALA 5E8XA 2Y6MA 5ACKA 3RPYA 3QQFA 4E6DA 4NYEA 5CSWA 2YIQA 2BDFA 2HWOA 3L8SA 4KKHA 4YC3A 4GG5A 4E5WA 2YITA 5KMOA 3N51A 4FEWA 2CLQA 5KZIA 4QPMA 3JR1A 2X2KA 4RJ8A 3VC4A 3VF8A 4QD6A 5I9YA 2ZM3A 3D15A 4C4JA 4MK0A 5EM8A 2PVJA 2I0EA 4F63A 1RDQE 2J0IA 3QWKA 4ZTNA 5FRIA 3NNWA 3BV2A 4QTAA 2ITNA 2EU9A 4KBAA 3TNIA 4U9AA 3L8VA 2X8IA 4NWMA 3O0GA 3PA4A 4XV3A 2FGIA 5EYDA 4TWOA 3F7WA 4YZNA 3UC4A 4AZFA 4FSRA 4F70A 2C0OA 4ZLYA 4FV7A 4BR3A 2JKMA 4ZZMA 4G34A 3V6SA 5IEYA 3AT4A 3QZGA 4QYFA 2GQSA 5FGKA 4KRDA 2JDRA 1B38A 2FSMX 2ZV8A 4NJ3A 3TZ7A 4O0XA 3IECA 4BTJA 1WBVA 1JSTA 3KVWA 4I5MA 3TG1A 3UP7A 4ZY5A 4V01A 3O17A 3JS2A 3PSDA 4OAVB 3LCKA 4GMYA 4H39A 2BTSA 4X2KA 3LMGA 5IQEA 3P86A 1L3RE 3ZM4A 2UZWE 2PVNA 3S95A 4YTCA 4PL3A 3PXZA 4TY1A 1F3MC 2WOUA 2ITVA 2YM6A 4AX8A 5A14A 4XYFA 4G16A 4CQGA 1WAKA 1IG1A 3MTLA 3DFCB 1ZRZA 4FSTA 2B53A 3ZRKA 3GNIB 3IPHA 3PP0A 4TWCA 3BQRA 3R7GA 2RG6A 4LL5A 4MWIA 3TT0A 2Y8OA 3LW0A 4XP3A 3QU0A 4F9YA 3DFAA 2ITTA 4C61A 4QMZA 3W2RA 4I6BA 4UMRA 3S1HA 2WQBA 4I5CA 3FMMA 3QA0A 4G9CA 3BKBA 2E9OA 4EEVA 4PPCA 4CNHA 2GNGA 2OIBA 4ZSGA 1W0XC 3KN5A 4RVMA 4BCQA 5DA3A 3R7EA 4USDA 3AD5A 1OKYA 1UKIA 3FMNA 3N9XA 4DEHA 3FKNA 3RWPA 2BIYA 3MPAA 3F69A 4FVPA 3EZRA 2Z8CA 3HRFA 4DEBA 3OW3A 4PP9A 5EI2A 2RFNA 4KD1A 4GH2A 3H3CA 2SRCA 1IA9A 4FTRA 4FTNA 5H9BA 5HQ0A 3C0IA 3E63A 4Y95A 2JGZA 2UVXA 4RFYA 3FC1X 4Q9ZA 4KBCA 5K0KA 5C1QB 5DPVA 3VUIA 4WBBB 3BI6A 2W99B 2QOLA 4JR7A 3ORKA 3PYYA 4YJQA 4ZK5A 4JDHA 4AN3A 3LXNA 4G17A 4FNYA 2VUWA 2C5OA 5DRDA 3TUDA 4KIPA 4FT5A 4NKSA 4IVBA 2GSFA 1Z5MA 4CLIA 4IWDA 2YDKA 2C6OA 4U8ZA 3HAVA 4GL9A 1XBCA 3UNJA 5ANGA 4GK4A 5GJDA 4IFGA 4N4SA 1YI4A 5K4IA 3QQHA 3MW1A 4ACHA 2A27A 3BHVA 4AG8A 5DH3A 4EYMA 5C03A 4WUNA 4Y5QA 5AV3A 4R5SA 4XOZA 4DGMA 4ZAUA 3GU4A 4MBJA 5M57A 4IWQA 2JFMA 2Z7RA 4AAAA 4OT6A 1H07A 5GJFA 3UZTA 2E9PA 1K9AA 3A7IA 3CD3A 4K9YA 4NTTA 3WYYA 1U5QA 4BDCA 2JDVA 3NVKI 3BELA 5IA4A 4LRKA 3QLFA 4JBOA 4BI1A 4DAWA 3LOKA 2BHHA 2XMYA 2YA9A 3ORLA 4GKHA 1H1WA 3BWFA 3A7HA 5IF1A 1Y6AA 1JKLA 4G31A 3ROYA 4J52A 1ZOEA 2PTKA 4HYHA 4M8TA 4C3RA 3MB7A 3ZXTA 3JUHA 1A06A 3NLBA 4FKPA 5BUIA 3UODA 5KO1A 4EOLA 4B8MA 2GCDA 1KE5A 4F4PA 3B2TA 3WZJA 4BZDA 4PL4A 3TACA 4FF8A 5AP3A 4D4VA 4YC6A 1NY3A 4CT2A 3MS9A 5E8UA 4E20A 5A6NA 5J9ZA 3FY0A 2GHGA 2R3FA 4D2PA 5AUVA 3POZA 2RFDA 4OTFA 4UWBA 3UJGA 4D2WA 1ZZ2A 2YFXA 4R7HA 4PMTA 2X8DA 4JBQA 3L9LA 4FEUA 3ZO2A 2P3GX 2YERA 4DGOA 5FLFA 3ORNA 3WIGA 4C2WA 3E5AA 2C68A 1ZY4A 4NIFA 4O0RA 1WBOA 4LOOA 5DI1A 5E91A 4R78A 3VIDA 5EW8A 3H10A 5A46A 4BCGA 3G6GA 2G01A 4DCEA 3W2OA 1ZMWA 5HESA 3V01A 4O7TA 1RW8A 4KIQA 3ZCLA 5HU3A 3ORIA 1LEWA 5BVDA 4MXYA 4YHFA 3ZHPC 2HZ0A 4BTKA 3E8EA 4CZUA 2G2IA 4K2RA 4ANQA 4MF0A 2BTRA 3RM6A 3E8DA 4FT9A 5AR5A 4D0WA 4O21A 4QMPA 4GIIA 3EQDA 3ZU7A 3EKNA 4IANA 2BZJA 3O96A 4RX8A 1YWNA 5KBQA 3RPSA 2XEZA 4ASEA 5AM6A 3ANRA 3QRIA 1O9UA 3W10A 2YM8A 2WELA 1BL7A 3H4JA 2IVVA 5EI6A 4BCPA 3ETAA 4FV0A 5CASA 1PKGA 1Q8YA 1GZ8A 3QKKA 5HX8A 4DEGA 3D83A 3AG9A 3GC7A 4GG7A 4EONA 3MYGA 2V55A 2XS0A 2X7FA 1YOJA 4FV2A 1G8AA 5E8VA 3ULZA 5FEEA 4G3CA 3KRWA 2GNHA 2VTAA 5EKOA 2UZUE 4TYEA 3VN9A 1UKHA 4M69B 2EUFB 3V5QA 4BCMA 1REKA 4DYMA 4RVKA 4YLKA 4XG2A 3W2SA 5L2WA 3I5NA 3QTSA 1IEPA 4FT3A 3QXPA 4TN6A 4I0SA 2H34A 4KIOA 3POOA 4E6QA 2W0JA 2WTWA 3OT3A 1UA2A 4O7WA 3HNGA 2PSQA 3FQEA 2J51A 3LFDA 3RPVA 4TTHB 1EH4A 2ZMDA 3UG2A 4EL9A 3OY1A 5CNOA 3C7QA 3PG3A 4QYEA 2OIDA 2BPMA 4GFOA 3D7TA 3R0TA 3F3VA 3R1NA 4NT4A 5CU3A 4FR4A 3BLRA 3IDBA 4I23A 4YJNA 4O81A 3LJ1A 1WVWA 4PNKA 3AD6A 5HVJA 2QR8A 4ALVA 2PUNA 3HA6A 4D2SA 2PPQA 4OTGA 3TWJA 3GXLA 4PF4A 2WMTA 5HBEA 4M13A 3Q6UA 3FWQA 3I79A 1OKWA 3RK7A 3EZVA 2XK6A 4P5ZA 2PZIA 4JX3A 2XNGA 4RC4A 4GJ3A 4R7BA 4XG7A 4FUXA 2WPAA 4JG8A 2VTHA 4QMMA 4UZDA 3VS0A 4HOKA 4YZBA 4WT6A 3GQIA 4X3JA 4RX5A 2QOQA 4O6EA 3T9IA 2PE1A 4GIHA 5IA3A 1G8SA 2O3PA 5IQBA 2WKMA 5KMNA 3QTRA 4CTCA 1REJA 2JAMA 3IOKA 3BU6A 3C13A 3W16A 5LVPA 2J0JA 3ACJA 3GU7A 2WTCA 3NPCA 4FE2A 1HCKA 3QXOA 4IB0A 3ZUUA 2B9IA 2OZAB 4NL0A 3R1SA 2C69A 3IW4A 3RTPA 4BI2A 4QPAA 4LMUA 3KC3A 1H1SA 2R4BA 3EJ1A 4WNPA 3VULA 4Z16A 3KU2A 3ENHA 3VS5A 5HD4A 2BCJA 5CVFA 3G15A 3HUBA 4QO9A 4GK2A 5GJGA 3D5WA 4FTTA 2OFUA 1E1XA 3NUNA 2FSTX 5IUIA 4WOVA 1PRYA 5FXSA 3NAXA 1FGKA 4IZ5A 2RGPA 4DITA 5K4JA 4O7SA 2YLEA 2F2UA 3OEFX 4YO6A 5AAFA 3P7AA 3ID6C 5M07A 4QP9A 4QRCA 2VRXA 3PY0A 1OKVA 3GCVA 3FYKX 3PXKA 3AC2A 3Q60A 4IEBA 1S9JA 2GNFA 3EN6A 3PTGA 4FKJA 4DT8A 5B2MA 4WD5A 1YDSE 2JBPA 4D4SA 5BUEA 3TZ9A 5JGAA 3V5LA 3G2FA 3K2LA 4I4EA 3RZFA 3FHIA 4G6OA 5AUXA 3IQ7A 3U9NA 1KOAA 1VYZA 3DOGA 1LEZA 5CVHA 1JKSA 4FG9A 3F3UA 3THBA 2QR7A 4EORA 3BIZA 4Z3VA 3G0FA 4FTIA 4NTSA 4IADA 4O38A 4ZSJA 4M67A 3MIYA 4QMYA 4BWXA 4EQUA 1PMVA 5IQIA 3IW7A 4EI4A 1NVQA 5E8YA 3P4KA 1CM8A 1Q97A 2ITYA 3R8MA 3UMXA 4FT0A 4G6NA 4BBFA 3S4QA 3FHRA 2X6DA 3MY1A 2BRGA 3PP1A 1GOLA 2R3OA 3I7CA 4HCUA 4NU1A 3QD0A 4FKLA 4BKJA 5DMZA 2VWVA 3QA8A 4XEYA 1M2QA 3UQCA 5EG3A 2W1IA 4BZOA 3P7CA 4I6HA 4A07A 1TQPA 4FIHA 5KMKA 1URWA 4R1VA 3NX8A 3LJ2A 4HVSA 2C3KA 2XBAA 4YNOA 5HVKA 3ZSGA 5CANA 4II5A 3MVJA 1YWVA 4FNZA 4RRVA 4PV0A 4BDHA 3FZPA 3EQHA 2HK5A 1H0VA 3JVSA 4ANMA 3KKVA 5L4QA 3QRJA 1XQZA 1ZAOA 3RBWA 3RCJA 2OJFE 5AWMA 1H24A 5A9UA 5IQDA 3PZEA 5DT4A 2W05A 5AIKA 3LCTA 2CSNA 4IVCA 2BZKB 2JEDA 2JITA 4PY1A 4NFNA 4P4CA 3HP5A 3QALE 4ZXTA 4AW2A 2LGCA 3COHA 5IQFA 5B2LA 2O63A 4FIGA 3RK9A 5CF6A 4FIFA 5AR3A 1XJDA 3S2PA 5LMKC 3KMUA 5E1EA 3LMHA 3IW5A 3D4QA 3TNWA 3M1SA 3OD6X 2Y4IC 1UV5A 4FKUA 3F5XA 3KK8A 2VNWA 3IK3A 1YKRA 1PXNA 2HYYA 4DLIA 4J97A 4L3PA 3C0HA 4D28A 5T6KA 4GVJA 5EYCA 4CCBA 1VJYA 1H1PA 4HNFA 3MVMA 2F9GA 2Y0AA 2UW3A 2YZAA 3U6JA 4ANBA 2C30A 2B54A 1A9UA
chains in the Genus database with same CATH superfamily
4QYYA 4S2ZA 1ZYJA 3F82A 1FVTA 3R6XA 4OTHA 3C1XA 4UEUA 3AC4A 3DU8A 4I5PA 4JL9A 3UPXA 3A7JA 5DNRA 2R3IA 3V8SA 5HE3A 4DH3A 5EM5A 4DFNA 4KKGA 3A4PA 3GC8A 5D1JA 3TI1A 4MAOA 3DKOA 4DEAA 4AXCA 1BUHA 2XNBA 2ZB0A 4KWPA 4YSMA 3RJCA 3DBEA 3ZSHA 2JIIA 3LAUA 3DB8A 4WG5A 2YDJA 1MP8A 4LI5A 3FXXA 2JKOA 5CZIA 4USFA 3LE6A 5I9XA 2HZ4A 2J50A 4B7TA 3ROCA 3KK9A 2V0DA 3DQXA 1FMOE 3BLQA 3MVHA 3ZLXA 1OUYA 4CYIA 4ITIA 3OUNB 2BUJA 4MHAA 4M66A 5LOHA 4AAYA 4M7IA 3VJNA 5KX8A 3DJ6A 3JPVA 4UZHA 5HKMA 1P4OA 2QOOA 4V05A 3KF4A 3L9MA 4FMQA 4M15A 3VS3A 1FBNA 2XIYA 5EHOA 5EK7A 2Q83A 3PY1A 4HCVA 4RFMA 4DGGA 5BNJA 3A8XA 3MY0A 5CAOA 2GQGA 4HZSA 4JT3A 3EWHA 1YXVA 2ZV9A 2FSLX 3REPA 4JNWA 4MNFA 4TYIA 4NCTC 2PE2A 5CAQA 2NRUA 2GU8A 2NRYA 3GU8A 3OTVA 5DWRA 4C58A 5M4IA 1O6LA 3PPJA 3PG1A 2RFEA 2XIXA 1WVXA 1OL6A 3EFJA 3MESA 1J1CA 3EFKA 2XK8A 5E8TA 3KRXA 2UZLA 1FPUA 2OWBA 2O2UA 3FMJA 4FTUA 1NVSA 1U46A 4HCTA 1Q8ZA 4ITJA 1ZLTA 2J6MA 3HX4A 4PDOA 3IONA 2XNNA 5CYIA 2F49A 3OY3A 1U59A 3W0RA 2XUUA 2IZUA 1JKKA 2H6DA 3QUPA 3SDJA 1SVEA 1Y8YA 2VX1A 4D55A 4TNBA 3VUMA 3FMLA 4YURA 1QPJA 5CF8A 3PJCA 5F4NA 5HIBA 2OIQA 3GCSA 2ZFYA 3ZLYA 3D5XA 4EUUA 3Q3BA 3H9RA 4YU2A 4IC8A 2OXDA 2HY81 4RG0A 4ARKA 3QQLA 2WTDA 4NFMA 1OKZA 2A1AB 2UZOA 2V62A 5FBNC 3K5UA 3BRBA 4MH7A 4FV5A 4ANLA 2FH9A 3OG7A 4FL3A 5I9WA 1Y6BA 5DVRA 5IDNA 3OXTA 4EK4A 4JG6A 3KA0A 5C4LA 5M09A 4FT7A 5GZAA 3TM0A 2W1CA 4CFVA 2GS7A 3NZ0A 4FTOA 4P2KA 3QX2A 5IG1A 4KNBA 2VWZA 4HVHA 3FEGA 3DK6A 3PFQA 3Q2MA 4A9UA 2VO3A 5HCXA 3FDNA 4DTBA 1GJOA 3G9LX 2Y6OA 1Q3DA 3HECA 5KKRC 2DQ7X 3JYAA 3NIZA 4GEOA 2X0PA 3LJ0A 4MNEB 4JVGA 4D5KA 3NW7A 4QQCA 2XJ2A 3SOCA 4DG3E 3C4CA 2XBJA 3P0MA 2VTPA 4QMLA 5GIOE 2PZRA 4GCJA 3IG7A 4GUBA 4MBLA 1TVOA 3W1FA 4DLJA 2NO3A 1URCA 4O7NA 4BY9E 2OH4A 4I21A 4U79A 5DR2A 4ONAA 3UDSA 3AC5A 5I0BA 2PMNX 3NW6A 5L2IA 1OM1A 3R73A 5CZHA 3GUBA 3LFAA 4XJ0A 2I0YA 4IE9A 4C2VA 3SVVA 2W7XA 3BZ3A 1VR2A 4DH1A 3PE1A 4ALUA 4NM5A 3GCPA 3S3IA 4E7WA 2I7QA 4L68A 2XP2A 5CALA 3S00A 3UQFA 5J7HA 2J90A 3PA5A 1WMKA 2QHMA 3MGYA 2BIKB 2OF2A 2QQ7A 2QURA 2PL0A 4QTCA 3SRVA 4O2ZA 4B0GA 3LVPA 4CFXA 1YHSA 3CGFA 1V0OA 1DI9A 3A99A 4EH7A 3UYTA 4EHZA 3BL9A 3WF8A 3WE8A 5A4EA 3SA0A 4RWIA 1GZKA 4D4YA 4DH8A 2ZM4A 5CEMA 4CV9A 4XHKB 2UW4A 2W9FB 3WILA 2O0UA 3I6UA 3DDPA 1MRUA 3OCSA 4F0GA 3OC1A 5C8KA 1MQ4A 3WOWA 4V0GA 3FKLA 4AACA 3DCVA 3ORXA 5JSMA 4PNIA 3E8CA 4JI9A 2IW6A 5EM7A 4AT3A 4CFFA 4E4XA 4OBOA 2VD5A 2VWUA 2R3NA 4M3QA 3DAJA 2UZNA 4PPBA 1PJKA 2C6EA 2P55A 3WBLA 2XKCA 2ZB1A 1OIUA 1PMUA 3EN4A 3LXLA 5E92A 2YZLA 4O0YA 3QTWA 4FSYA 4EHVA 5IISA 4M12A 5JH6A 5AIRA 4DT9A 5EDPA 4UMPA 2R0IA 1PF8A 3GBZA 3NUPA 3DJ7A 2W5BA 5IA5A 4BIEA 1PYXA 5CAPA 4MCVA 5KBRA 3IDCA 5D7AA 4EOPA 4A9TA 4Y83A 4FSUA 1QCFA 4QMWA 5J5SA 3RGFA 3D2IA 2BFYA 3D7TB 4ZP5A 4D2VA 5TKDA 2XIKA 1LR4A 3BYVA 5GZ9A 5BVNA 1W83A 4AFJA 2G1TA 2CGUA 3QKLA 4Y72A 4Z55A 2IVTA 4LUEA 3BEGA 5M53A 4DTKA 5AFVA 3CPCA 5AV4A 1BYGA 3OVVA 5LWNA 3AT3A 1M2PA 4AT5A 2J4ZA 5LJJA 5DT0A 3RHXA 5ANKA 4OBQA 2QOIA 1NT2A 1I09A 3E3PA 2QG7A 3UDBA 4N57A 3D5UA 4W4YA 2JFLA 4FV3A 1U5RA 2WMVA 4NM3A 4RLKA 3DLSA 3E93A 2O64A 3F61A 3HV4A 4OLIA 4MXCA 3R04A 2HW6A 4QOXA 5EDQA 4W8DA 2QOCA 2XH5A 3EIDA 4ANOA 4QP1A 3E87A 4XG6A 2YCQA 2QCSA 5FQDC 1KV2A 5A4TA 3O7LD 3ELJA 3QAME 5HD7A 2C3JA 2YM5A 4E5BA 3QL8A 3I0QA 4FKVA 4ZTHA 5HEZA 1BI7A 3DJ5A 5FTGA 4QQ5A 3FZ1A 3NNXA 4EKKA 1MUOA 1J7LA 3GU6A 2H8HA 2DUVA 3G5DA 1KUTA 2OBJA 3QD4A 4LM5A 1GZOA 3HV3A 3EFWA 1U54B 4FV6A 1ND4A 2QLUA 2WMBA 3KRRA 4CSVA 1Z57A 5AUWA 4O6LA 2CDZA 4MTAA 1JAMA 4TZRA 4F1OA 3OROA 4DEDA 2VN9A 4O7ZA 4EOQA 1F0QA 5C01A 1OBDA 4C02A 1YOMA 1NVRA 4HYUA 1K3AA 3MIAA 4GUEA 4WNMA 5HG7A 4C0TA 4MYGA 3F88A 2F7EE 3HMIA 3R8PA 2CNUA 4BWKA 4YMJA 4ZZNA 4AOIA 2C0TA 3DBDA 3DNEA 4IHPA 4UWYA 2CHLA 2HZNA 3DLZA 4D1ZA 3QQJA 3UMWA 4IAYA 4RT7A 3VJOA 1J7UA 5JN2A 4DDGA 2VX3A 2V22A 4RWJA 4L6QA 2BDJA 2VGPA 4RMZA 4XMOA 4EJ7A 2QONA 3ORZA 5B0XA 5TT7A 2XCKA 3DXPA 4L44A 3ATTA 2VO6A 4R5YA 3KXXA 5IA0A 4O84A 2ETKA 3II5A 5M4UA 2ZMCA 5FBOA 1MRVA 1W2FA 2DWBA 2HY0A 2I40A 1YHVA 1WBWA 3NS9A 3MFSA 4KSQA 3K3JA 4EK8A 5DRBA 5GNKA 3CKXA 4O83A 3CGOA 4GFGA 2GPHA 2WTVA 2J9MA 1BX6A 3MTFA 4BHNA 2GNLA 2J0LA 3PJ1A 3L9NA 5EM6A 3TTJA 2Q0NA 1OIRA 2Y4IB 4EK3A 4YR8A 3BGQA 2YIYA 4FVQA 5HHWA 2W06A 3PSCA 4IX4A 2WMUA 2XALA 1JKTA 3CP9A 2VX0A 4A06A 4K77A 2CKQA 3VS1A 4BDKA 4C35A 3ZBFA 3Q2JA 2W4JA 4XBUA 5D7VA 2IZSA 3BX5A 5CU0A 2OJGA 4YLLA 3MH1A 2JDTA 1Q99A 4CTBA 2YISA 3B8RA 3FLYA 5C4KA 1YRPA 3F6XA 5CQWA 4R6VA 5CAVA 5JFVA 4RLLA 2R7IA 3UQGA 5IDPA 2BROA 3FLSA 4ENYA 5HBJA 5HVYA 3P7BA 3ULIA 4W4VA 2C5YA 4ERWA 4U3ZA 3KF7A 3V04A 1ZY5A 2WNTA 1E1VA 1YXSA 2X2LA 3DAKA 5AP5A 2ACXA 3CEKA 2VTMA 3QYZA 5HE2A 3BLHA 3R71A 5JGBA 2X1NA 4DBNA 1P2AA 3K54A 3NUXA 3QRTA 4DHFA 3A8WA 2CKOA 4F9AA 3TNPC 4BWPA 3Q4UA 4TW9A 5K5XA 4BFMA 5J1VA 2EXEA 1XR1A 3Q9YA 3LFQA 2WQEA 4ZTLA 3FV8A 3WF5A 4EOIA 3FLWA 4ITHA 5KNJA 2JIUA 3N4VA 2X7GA 2I6LA 4C3PA 5L8KA 2VO0A 5CT0A 4WNOA 3NYOA 4YJRA 4S30A 4PMMA 3TDVA 2QKWB 3LFCA 4X2FA 5I4NA 5D11A 4D1XA 2YWVA 3C50A 3FZOA 4QMTA 5FG8A 5AP6A 2WTJA 2WQNA 3LCSA 2QODA 3VRZA 3R83A 1OITA 4LGDA 1A48A 2YIWA 4QP8A 2XKEA 2EB2A 3CQWA 3TV4A 3F66A 5IPJA 3RAKA 3ZO4A 5AUZA 4DGLC 2OJIA 5LVMA 2RF9A 1UVRA 3PVGA 3DKCA 4UY9A 3W32A 4C8BA 4BCKA 5HO7A 3KXHA 4IM3A 2J0MB 1W82A 3ZUTA 3M2WA 4A7CA 1PYEA 5L2TA 1ZYDA 3FLZA 4CT1A 5FEQA 3MH0A 2YACA 5AAEA 2AYPA 4TXCA 1J7IA 4UBAA 2VGOA 4DH7A 3R8LA 4D9TA 3OTUA 1UWHA 4J53A 4EHGA 3JY0A 4MNEA 3KULB 3BV3A 5M55A 4D58A 2C1BA 2XRWA 4D5HA 3QGWA 1Q8UA 2VWYA 2OW3A 5IEVA 2C6TA 4N6ZA 3VUKA 4AXAA 4IH8A 3P23A 2W1DA 5HTIA 2GTMA 4S32A 4WRGA 5LCKA 2C47A 5CQUA 3QC9A 2DYLA 4S33A 5K0XA 2YCFA 3E8NA 1AGWA 1GAGA 2IWIA 3LFBA 5JQ8A 4F78A 2UZBA 1LUFA 3HGKA 2R3GA 3IGOA 4OBPA 2PVLA 4YBKA 3S0OA 5F94A 4GYGA 2EWAA 2OSCA 2WTIA 3QX4A 4FSNA 3DY7A 1SNXA 4JBVA 4C59A 5KMLA 4OTPA 4AUAA 3GU5A 3RHKA 1TQMA 5IUHA 4BJJB 3BPRA 5KMMA 3D0EA 3SOAA 4FEXA 1FVRA 2X6EA 4X2NA 4IMYA 1YOLA 2WO6A 3VONA 2EXCX 4RWKA 1APME 2R3PA 4FKTA 5CXHA 3P9JA 4OTIA 3WZDA 3PSBA 2QG5A 3CQEA 4FZFB 4GV1A 4UXQA 2B9JA 3ALNA 4YTIA 2B9HA 4FICA 3PDTA 4J8NA 3UOHA 3VUTA 3FXZA 4GFMA 3P08A 3DA6A 2FUMA 3R7OA 4BB4A 3PIYA 5I9VA 4JQ7A 1SMHA 1UNLA 3KMMA 3DBCA 1OI9A 3ZSIA 4NKAA 1JVPP 2G9XA 3PWYA 4I93A 1SYKA 1KE7A 3MFTA 3RM7A 4FOCA 3R2BA 5KKRB 4IZYA 4D2RA 3WARA 3R2YA 2W1ZA 3LMIA 4JAIA 4YJPA 4BYIA 4U40A 1JSVA 2ZV7A 3FLNC 4RJ4A 3UIMA 5J5TA 2QO7A 4FIEA 1B6CB 4RJ3A 4YTHA 5FM2A 1YDRE 3UC3A 4IM0A 3Q9WA 2X81A 1H00A 4OGRA 3OBJA 3N4UA 4ZTQA 2Z60A 4C34A 2CLXA 4CMOA 5C8NA 4CGAA 2QOBA 4X2JA 4FL1A 4ZTSA 1PXIA 1ZOGA 2VWBA 3AGMA 3PXYA 4LOQA 1WFCA 5FTOA 4PDYA 2CGWA 4JAJA 4GJ2A 3EQIA 4RVTA 2VWWA 3A2CA 4O2PA 5LWMA 5CTPA 2ZYBA 1WBTA 1XHAA 3MJ2A 3UO5A 3A4OX 4XS2A 4O27B 2AC5A 2PVKA 4TT7A 3F2NA 4RJ5A 4F7JA 4C4FA 5LXMA 4JOAA 3TKIA 5CAUA 1OL2A 2PK9A 4RIXB 3GP0A 4FV9A 3A62A 3ZXZA 4DFYA 5JGDA 4PP7A 3MB6A 2ESMA 1NXKA 2C5NA 4DBXA 4MWHA 4O22A 4AZEA 3KIOC 5AP0A 5H8EA 3NYNA 5IEXA 4BTMA 1OL5A 2BVAA 4IWPA 4OTDA 4DF3A 3CJGA 4AGCA 2QD9A 5CWZA 3Q53A 1UNHA 5A54A 4QNAA 3GC0A 4KABA 2UZEA 3OF0A 3OS3A 3UNZA 3FL5A 5E8SA 2WMQA 4GSBA 3R9DA 4L8MA 4RX9A 3UTOA 1H4LA 1H08A 1K2PA 3EOCA 3UIXA 3T9TA 1P5EA 1PXPA 1SVHA 1SM2A 3BHHA 4FIIA 3OOMA 4XP2A 5KHWA 4O7RA 3VBYA 3O23A 2UW5A 4RQKA 4XLIA 3U51A 3IDPA 4HGSA 1U54A 3CS9A 3PFYA 4V04A 3QRKA 4I20A 4QMVA 4EQCA 5HLWA 3I81A 3OCGA 3F9NA 3QZFA 4FC0A 4HYSA 3M42A 4W9XA 4U43A 5HBHA 3TUBA 4R3CA 4WKQA 3KEXA 3UOJA 4OUCA 2P4IA 1JQHA 3OZ6A 2X7OA 3DS6A 3LQ5A 3PRFA 4FK3A 2GS2A 4KBKA 3UO4A 4D2TA 3ACKA 3SRVB 4E6AA 4WHZA 3CBLA 1IASA 4AE6A 3BBWA 2UW6A 3ZC6A 3FSKA 2ZDUA 4O4DA 1Y91A 5IMXA 2JDSA 1PXOA 4IIRA 2HW7A 2GTNA 2OICA 4FA2A 2V5QA 2B55A 3OCBA 2ITPA 3F3WA 3TTIA 4RJ7A 1XBAA 4WG4A 3T3VA 3GC9A 1YQJA 5FD2A 5D10A 4WA9A 4E8AA 5A6OA 1T46A 4EZ3A 2CNVA 3TYKA 4ZS4A 4V0GB 1OUKA 1J91A 5JRQA 3VS7A 4M0ZA 2XYUA 4AN9A 3DAEA 3LCDA 3ZFYA 3UZPA 4X0MA 1M7NA 2F57A 4TYHA 4LGGA 3ZYAA 4FYOA 1OL7A 1OPKA 3QC4A 3V51A 2OJJA 3ENMA 3QCXA 4XX9A 5TO8A 3V5PA 2AQXA 3U4WA 5LMKA 4FODA 2Z7LA 2UUEA 2YIXA 4QP3A 4FGBA 3NUAA 2VO7A 3L1SA 5FDXA 3WI6A 3HVCA 3K5VA 4XNEA 1V0PA 3TN8A 3QZHA 4D9UA 3CIKA 2GQRA 4F0FA 3G6HA 2FYSA 5KMIA 4MXAA 4CQEA 3D14A 3ODZX 2IN6A 3WZEA 3R9HA 2W1EA 2DS1A 2BILB 5DN3A 3ZO3A 3DKGA 4BC6A 1JBPE 4WSQA 2ITWA 3H30A 4EH6A 2R3LA 3JY9A 4YSJA 3C4XA 1IA8A 4Y46A 5LMAA 1MQBA 3HYHA 4HZRA 5K9IA 2J5EA 1TZDA 2ITQA 4YJSA 5K3YA 4EHEA 5BUJA 1BMKA 4BKZA 5JFXA 4GRBA 5LQFA 4RC2A 2CCHA 4YTFA 3UIUA 5L8LA 4HJOA 3RKBA 3EFLA 4OW8A 3KFAA 3PRIA 2Z7QA 5DR9A 2RG5A 3MA6A 4J8MA 3R8UA 4BRXA 4MF1A 4R8QA 4H3QA 3PIZA 4IAZA 4ZY6A 2WMSA 2XNEA 2CN8A 4K11A 3C4FA 2PYWA 3LQ3A 2IVUA 3EQFA 4PTCA 2XIZA 3LFSA 4UXLA 4W4WA 1Q5KA 5CU2A 2A98A 5KE0A 3HMOA 4MXOA 3UDTA 4LGHA 2BMCA 2WAJA 3FMEA 5L6WL 3GI3A 4ZS0A 4I24A 5IA2A 1IRKA 2C5VA 3UZRA 3FL4A 3RINA 4OT5A 2EVAA 2XJ1A 3G9NA 2IPXA 3QLGA 1YDTE 3KGAA 3NRMA 4GU6A 2ITOA 2BFXA 4WNKA 4FKGA 3QWJA 3Q9ZA 4IB1A 3NWWA 3ZZEA 2GNJA 2QU5A 4YJUA 4IXPA 3E88A 5IMEA 3HEGA 5BVOA 3DZQA 4FVRA 2WU7A 3IKAA 3PZHA 3W55A 4QP7A 4DEIA 3OUKA 2R3MA 2AC3A 3C5IA 2YJSA 3DGKA 3UE4A 3OWPA 2OGVA 2WHBA 1H01A 4O0UA 5G6VA 4EZ7A 2IEWA 5D41A 4YJTA 4EKLA 3ZC5A 1STCE 5HE1A 3TEIA 4NCTA 4LYNA 5F9EA 1QMZA 4BN1A 1H1QA 4BGGA 1XO2B 3FUPA 4IDTA 3LQ8A 4WO5A 3TZ8A 3PXRA 4AA5A 4MVFA 4HW7A 3W33A 5A4LA 3F2RA 2WMAA 3EYHA 3KULA 5BVWA 3UOKA 2P2HA 4JBPA 4NSTA 2HAKA 3QCQA 4BIDA 3COMA 4CG8A 4ACDA 2YJRA 5C26A 4QDVA 2X0OA 4IX5A 4AXEA 2BDWA 2UVYA 4JQ8A 3R63A 4LDTA 4M0YA 3DB6A 3MFUA 4GS6A 4QTBA 4MQ1A 1UU7A 2YAKA 2VTLA 2W5HA 3OOGA 3NYXA 2BKKA 4FTAA 1ST0A 3V5TA 1DAYA 1DAWA 2WXVA 4BCFA 2E2BA 4EOKA 4DN5A 1M17A 3UDZA 2QC6A 4FG8A 2A19B 4MBIA 3DV3A 2PMOX 1FMKA 5HO8A 1UU9A 2NNWB 3Q04A 4AZWA 2VTOA 1KWPA 2XANA 1OZ1A 3VS4A 2VTSA 1V1KA 4E73A 2PWLA 4BJJA 2B52A 4LG4A 4BCHA 4JR3A 4AFEA 3R01A 3CC6A 4XRLA 4CG9A 1OBGA 3MFRA 4AF3A 2BZIB 1CTPE 3UO6A 4BGHA 2BAJA 3MH3A 5BQ0A 5H8BA 5ACBC 2ERKA 4PRJA 5FP5A 4ZOGA 1RJBA 3BYMA 3I60A 4YHJA 5EH0A 3TUCA 3W0MA 5HCZA 1YXUA 2F2CB 4G3DA 3W8QA 2XAOA 5C27A 3TJDA 2QOHA 2XF0A 4RGJA 4FYNA 5CS6A 5L8JA 4YZDA 3MPMA 1KOBA 3E92A 3UP2A 5CEKA 2WGJA 3OWJA 2CJMA 3SW4A 3AMAA 5LMBA 1XH6A 1G8JA 1XKKA 3NYVA 4FBXA 5E7RA 4U80A 3AKKA 1SZMA 5L2SA 5K5NA 5IZFA 4LUDA 2WD1A 3SXSA 3UVPA 2RSVA 2PY3A 3BGPA 2WEIA 3IO7A 5J1WA 4RPVA 5IQAA 4YHTA 4WG3A 4EQMA 4YJOA 4EUTA 2XNPA 3W2PA 3SGCA 4G1WA 3QF9A 5AMNA 3O8PA 4KS8A 4JG7A 3PVWA 3T3UA 1PXJA 5H8GA 4X3FC 3PXQA 3SV0A 3HUCA 4BYJA 4F1TA 2YDIA 3QKMA 3NSZA 3V3VA 2V7OA 1Q3WA 3ZO1A 3I6WA 5A4CA 3SG8A 1W8CA 3QCSA 1Q61A 4ACMA 4F64A 3NDMA 3QQUA 4PDPA 3H0ZA 4XP0A 2UW0A 4FK6A 2W1FA 1XMMA 4JS8A 2PVYA 4RIXA 5HG5A 5AA9A 5EQPA 2WQOA 3DZOA 4OR5A 1WBSA 1YXXA 1Q41A 1ZOHA 4F9CA 4XG8A 1QPDA 1AD5A 2E9VA 3BGZA 2HXLA 4K1BA 4NW6A 3ITZA 3RVGA 2FVDA 3AOXA 3KN6A 3OMVA 4FX3A 3G51A 4F0IA 5AAGA 4F6UA 3DNDA 4TYJA 4HPUE 3BYSA 3WYXA 3HZTA 4W4XA 2XA4A 4KIKB 5JEBA 4LFIA 4JMQA 4O7LA 2YIRA 4L3JA 4LV5A 5D9HA 4XG9A 2Y4PA 2OKRA 4XBRA 2X39A 3ZH8A 4A4LA 2JAVA 4CMUA 1MRYA 2VZ6A 5J8IA 1ZWSA 4B6LA 2BRHA 3ZFXA 5J87A 3FZTA 4PX6A 1AQ1A 3MA3A 2ITUA 2P2IA 4I0RA 4BDDA 4A4XA 3MY5A 1M7QA 1R78A 3OCTA 4ZJIA 2GFSA 5BYYA 2J7TA 4E5AX 5HE0A 1KE6A 3B8QA 4FKSA 4GW8A 2Z7SA 3VNTA 4EH9A 2XRUA 2R9SA 2FO0A 3HA8A 3UPZA 4HVDA 3O51A 3W0OA 2R3KA 4HVIA 3KL8A 2BAKA 3CE3A 3NGAA 1NW1A 3UVQA 2HWPA 3MSSA 5EQEA 3ZTXA 3FJQE 2VTTA 3KCKA 2YHVA 2HELA 1DS5A 2NPQA 3LXPA 3SG9A 3ZMMA 2BALA 2XCHA 4H1JA 4C62A 3W2CA 3SHEA 5FXQA 1Q62A 4PL5A 2IO6A 4YC8A 4X7QA 2G2HA 3PWDA 3BYOA 3V5JA 3SLSA 3HDMA 4F7LA 2R0UA 4KRCA 2WB8A 3DK7A 1XH9A 3K3IA 3PY3A 1PXLA 4N70A 5I9UA 4BHZA 5HTCA 2NYAA 2H96A 2A2AA 5HORA 2I0VA 5LVNA 3OWLA 4RIYB 3DXNA 3BCEA 5HI2A 3QQKA 3PIXA 3RNYA 5CSXA 2PVHA 4U41A 3Q52A 1KE8A 4IJPA 3VAPA 3BHTA 3ORMA 4K18A 5JZJA 5KMJA 3D9VA 4DA5A 1R0PA 2ZAZA 4ERKA 2BRBA 3U6IA 4K33A 3ZEWA 4KAOA 1QL6A 4APPA 4E1ZA 3AMYA 4RBLA 3VVHA 3SKCA 5AR4A 1SNUA 3FMDA 5AEPA 2CPKE 4BGQA 2X0QA 2CKPA 3Q5IA 2C6KA 5AR7A 4DFZE 4AW1A 3AQVA 3CQUA 3E64A 5IQGA 4FZ7A 4ZZOA 5L6PA 2XM9A 4PWNA 1DM2A 1JSUA 2GDOA 5IH6A 3UBDA 3VUHA 3AGLA 4L45A 3C51A 2EB3A 3ZDIA 4FKOA 3FI4A 5H2UA 4CFMA 3OT8A 1RQQA 2YCSA 3QD3A 3W8LA 3O2MA 4IX6A 4R3RA 3RNIA 5FTQA 3UG1A 3P5KA 2QVSE 3ZFMA 2B1PA 2XK9A 4BDEA 2CN5A 2QO9A 2RKUA 4FEQA 3O7LB 2C6IA 4FNXA 5HLPA 4DC2A 3H9FA 5DOSA 5CI6A 2Q0BA 4J99A 5F20A 4JDKA 4CV8A 3FE3A 4U81A 5GIPE 2YM3A 1DI8A 2ZOQA 3TKUA 3OBGA 3DBQA 3OWKA 4FEVA 4FTLA 2CGVA 3NIEA 3Q9XA 2JBOA 4EH4A 3GOKA 5HGIA 2C6MA 3RCDA 4A9SA 3I5ZA 4WUAA 5LARA 4W9WA 4DHJA 5EW9A 3FI3A 3PPZA 4A4OA 4BI0A 2VAGA 1WCCA 5JFWA 3E3BX 2C6DA 1H0WA 3R9NA 2CMWA 2E9UA 3LHJA 2XARA 4UYNA 4Q5HA 5ETFA 3R1YA 4MXXA 3VHKA 2XVDA 1Q4LA 3R30A 5CI7A 4CEGA 3FSFA 5BPYA 5HTBA 2OZOA 4YNEA 4EK5A 3ZM9A 5AX9A 4EOSA 2ITZA 3GFWA 3CCNA 3I1AA 5CENA 3LKMA 4CFUA 5KHXA 2X4FA 4MEDA 3I0OA 5HCYA 3EQRA 5CSVA 1R1WA 3R9OA 2PU8A 4FZDB 4IZAA 3OXZA 4Q9SA 3O71A 3UVRA 3QD2B 4C36A 2GFCA 3SX9A 3PXFA 2FB8A 3T8OA 4IB5A 1J1BA 4I6FA 2OU7A 1UU3A 4AZSA 2YM4A 2IG7A 3DXQA 1KV1A 3WZUA 4E3CA 3LIJA 1O6YA 4OTQA 5AR8A 4DINA 4RC3A 4WSYA 4F6WA 2PHKA 1H27A 3E62A 3Q32A 5E9EA 2E9NA 3MPTA 2JKQA 3VUDA 4NM7A 5J7BA 4DEEA 3F5PA 5CEIA 3LM5A 3OXIA 4L9IA 4CYJA 5M4FA 3GEQA 4A9RA 2PUUA 4IVAA 3LZBA 1FINA 3CLYA 5C9CA 4AA0A 2G2FA 5T3QA 3FY2A 2Z2WA 3U54A 1FVVA 2ERZE 5AA8A 2ONLA 2UW9A 2XK7A 4U44A 3VRYA 2VWXA 4FOBA 5DT3A 4TYHB 4YJVA 2R3JA 4O4BB 1OECA 5A4QA 2B7AA 3DDQA 4F7NA 4OTRA 4CFWA 5IA1A 2WTKC 3KQ7A 4O91A 3SD0A 3HAMA 4LOPA 2C6LA 4DE4A 3GOPA 4XUFA 3VBQA 4QMQA 1CMKE 3D2KA 4LRJA 4AE9A 5CF4A 4O7YA 3TNHA 4IB3A 2VTNA 1FQ1B 1WZYA 3F5UA 1OPLA 1ZYSA 3BBTB 4DGNA 5JMSA 4AXFA 2IVSA 3DTWA 3RMFA 3VBVA 2OK1A 5I3OA 4A9YA 4JJRA 2XZSA 4L52A 4BF2A 4FGRA 3AT2A 4CVAA 3MVLA 5CLPA 3EL7A 3LFNA 4H58A 2O5KA 3HV5A 2GS6A 3TZMA 2XAMA 2VTRA 2C1AA 2EXMA 4ASXA 5AV2A 4E4LA 4AXDA 2QKRA 3ZRLA 4J7BA 1ZYLA 4H