4YNEA

(r)-2-phenylpyrrolidine substitute imidazopyridazines: a new class of potent and selective pan-trk inhibitors
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
297
structure length
281
Chain Sequence
GSGIRVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPDKMLVAVKALKERQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSTDYYRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords High affinity nerve growth factor receptor
publication title (R)-2-Phenylpyrrolidine Substituted Imidazopyridazines: A New Class of Potent and Selective Pan-TRK Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 281
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yneA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yneA01
3AD4A 1YDSE 2E9VA 2ITNA 5CU2A 5K9IA 4GH2A 4X2GA 1MRUA 3NW6A 3WF7A 3L9PA 3FXXA 3P0MA 4FICA 3RK9A 1QPCA 3DXQA 3IKAA 4MCVA 5KCVA 5E90A 3ZLYA 4F0FA 3MPMA 4G9RA 5IF1A 2XK4A 4NJ3A 2PUPA 4O0SA 3QQFA 5CLPA 2W7XA 2YN8A 3BYOA 3OWPA 4QMWA 2OO8X 4RGJA 3WILA 4M15A 3VUGA 3AGLA 4CXAA 1T45A 1GNGA 3FMKA 3CSVA 4FL2A 3R9NA 4ACHA 4ZSEA 4J7BA 4AA4A 2NP8A 4L68A 4EOLA 5GIPE 4NTSA 2WELA 5LVOA 2IW6A 2X0GA 3QTSA 4FUXA 1WVXA 3VQHA 3S3IA 3FYJX 3VUMA 4AXAA 4S30A 4IZ7A 4FR4A 2O2UA 2W5HA 2REIA 5L2IA 3LCDA 4JRNA 3R9RA 3UQFA 4FIIA 5AUZA 1U4DA 4YC6A 3MJ1A 1A9UA 3NUSA 5EM7A 2XK7A 4AP7A 1H26A 2VN9A 3PSBA 4FSZA 5L2QA 3R7VA 4USFA 3K2LA 4JBQA 4C61A 4BKZA 4L6QA 4IANA 4RJ8A 4Q2AA 5HO7A 1OECA 4ZEGA 2C4GA 4TW9A 4E5WA 5FGKA 1VEBA 4FV9A 2W05A 4U3ZA 1OIQA 4FGBA 3FC1X 5B2MA 4F99A 5I3RA 4O81A 4J52A 3SX9A 3C50A 5FUTA 5CT7A 3KVWA 3OMVA 1UNLA 3A62A 2J90A 4O0WA 3VHEA 3SC1A 3BLQA 3DBCA 3K5UA 5TT7A 4W9XA 5ETIA 4BDIA 3QXPA 3CY2A 2ERKA 2GMXA 3OXTA 5CSHA 2H6DA 3COHA 2QD9A 2HAKA 2VTMA 4EZ5A 5JFXA 2WU7A 3I5ZA 4PDSA 2CN8A 3UZPA 4Q9SA 3LFQA 4GG7A 5EHLA 3N4UA 3DBDA 4FV8A 3WYXA 3BGQA 3VUKA 1ZRZA 2GNIA 3QD4A 1U59A 3P4KA 3P7CA 5D41A 3S00A 2QG7A 2WO6A 3FZRA 5LQFA 4TXCA 3BLHA 4BCNA 3QA0A 2JDVA 3FV8A 4MD7E 5HLPA 3QL8A 2CGXA 3R1NA 5I4NA 4EWHA 1CKIA 2ITUA 3FAAA 4CT2A 3OXZA 4KA3A 1F0QA 1Q97A 4HYHA 5EG3A 2B9JA 3W32A 3WF9A 2QI8A 4N4SA 4BBEA 5L6WL 5AV4A 3IW7A 5BVDA 2CSNA 3Q4CA 3A7HA 4M13A 4WD5A 3SXSA 4FKLA 4I0RA 4DT9A 3IOKA 4IWQA 1YWNA 3QZGA 5TKDA 2CNUA 3DTWA 1H25A 1PKDA 4ZMFA 3IGGA 3LQ3A 5DNRA 4KB8A 4V0GB 3GCUA 2EXEA 3DLZA 4TYIA 2YHVA 4I41A 2XEZA 2XK3A 3I79A 4FTCA 4RA4A 2WOTA 3LKMA 5EW9A 3OY3A 4AFJA 4OGRA 2G9XA 3OT8A 2JBPA 5ACBC 3Q52A 1WBTA 2WGJA 3DT1A 4OTFA 4FEUA 4K33A 4TWCA 3TG1A 4DEDA 5KHWA 2PVKA 5AP3A 4L3PA 2B1PA 4B8MA 5AA8A 5EH0A 3QCXA 3TM0A 1AQ1A 3GT8A 3M11A 3AC2A 3C4EA 4DG2E 4M97A 4EKKA 4P5ZA 3AT2A 5E9EA 4C4JA 3ANRA 4EL9A 5IMXA 2VO3A 4XG2A 3H9RA 1PXOA 1Q8ZA 4X6RA 3UIBA 5BVEA 1OI9A 3QCSA 3RHKA 4U79A 3OROA 5FP6A 1OM1A 2E9NA 2V55A 3QUDA 3RJCA 4BWXA 4ZJIA 1XH7A 3O71A 4R1YA 4I24A 3HV6A 4CLIA 5J87A 5CF4A 3R28A 1OL6A 4AU8A 5EYMA 2HW6A 1PW2A 4J97A 4E1ZA 4M8TA 4V0GA 4A7CA 5CAQA 2Y7JA 5HVJA 2Y6MA 1V1KA 4RZWA 4GJ3A 1L3RE 2NRYA 4A4LA 4HZSA 4KS8A 2J50A 3O7LD 3QC9A 3D7TB 4QPSA 3O8UA 3EH9A 3PJ2A 2ITPA 4JDJA 5C4KA 2C6DA 4CZYB 5CVFA 3SAYA 4AX8A 5H2UA 2Y8OA 4EQMA 4CNHA 3EL8A 4ZTQA 4P90A 3HV4A 4K11A 5GZ9A 3R1YA 3PY0A 4U0IA 3E93A 3QD3A 5A4TA 3QWJA 1J1CA 2R3PA 3PA5A 4JBVA 4IX4A 2QKRA 1O6YA 3B2TA 2R7IA 4HNFA 4L8MA 5IQFA 5KO1A 3LVPA 4FL3A 5M4CA 3NAXA 1FBNA 5AX3A 2RFSA 2VGOA 4YC3A 5L3AA 5EQEA 4FT9A 1ZOEA 4ZK5A 2XYUA 2QKWB 4QP6A 2OGVA 3G6HA 2E9UA 2C5YA 5EYCA 4Y8DA 2O0UA 4A4OA 3C5IA 4EOIA 4S33A 4S32A 2Z02A 4JXFA 1JKLA 2QR7A 4YHJA 2A4LA 2F7ZE 3OW4A 4ZTNA 1FINA 2B4SB 3QFVA 5EKNA 3BE9A 3ULZA 3D7TA 3Q2MA 3SRVA 2HELA 4WSYA 5HU9A 2UW5A 2YWPA 4B9DA 4BKJA 1TQPA 2VWIA 5I9YA 3HV3A 4MK0A 4RWKA 4FTTA 3ETAA 4NM5A 5IH5A 4E4LA 3FXZA 2ETKA 1UU9A 3HP5A 3D5XA 3PSCA 3NRMA 3DZOA 4HVHA 4XP3A 1E9HA 1ZZ2A 4IAIA 2IN6A 5G1XA 3IW5A 4QQCA 4IAKA 4EORA 2GHGA 2PE1A 4L52A 3NX8A 3DXPA 5CXZA 5E1EA 4DITA 1Y6BA 3R2BA 3HGKA 3PWYA 3R02A 3UG2A 3PRIA 2XBAA 4ARKA 4IAYA 4AFEA 4FSMA 2BRGA 2P33A 2X8DA 2WQMA 5EI6A 3LFAA 4IVDA 1SNUA 1S9JA 1OKVA 3MFRA 4DFNA 2OJIA 3Q5IA 3CQUA 3PIZA 1OUYA 3MY5A 5GJFA 5L6PA 4O7LA 1WBOA 4HGEA 4X0MA 2BILB 4P7EA 1OMWA 1ND4A 4G31A 5FG8A 4CQGA 4DAWA 3DAEA 3QTXA 5IPJA 5EK7A 3E92A 1OKZA 4QQJA 3FLNC 2QHMA 4R7BA 2ZMDA 2RKUA 4GFGA 5E91A 4D9TA 5HX8A 3U55A 2JAVA 1NT2A 3UOKA 2R3OA 2NO3A 5BPYA 4MBJA 2VGPA 2X8IA 4DHFA 3BRBA 4YO6A 3EFWA 4TYJA 5BUEA 4NK9A 2YM6A 3JY9A 4BKYA 5DOSA 1ZMVA 4I5CA 1W0XC 4JL9A 4Y73A 2ZV2A 3TI1A 3L9MA 4DTBA 4YJSA 5IUHA 3EFKA 4FG8A 3MSSA 4BCMA 3UVRA 4FSUA 2PUIA 3IDCA 2Z7LA 5T6KA 3GU5A 5GJGA 3DQXA 2VTHA 4RQKA 1REJA 4CYIA 2XYNA 4JG6A 4W8EA 3AMYA 3RAHA 5H9BA 5BVFA 1OIRA 2YIXA 3G9LX 4ZAUA 2J0JA 3TT0A 2PTKA 3EN7A 3DA6A 4LI5A 4NWMA 2WMRA 5HESA 5CS6A 4QNAA 1OZ1A 4FBXA 1CMKE 3EQCA 3FMNA 3FY2A 3UNKA 5GIOE 4YBJA 4S31A 5IA2A 4RWLA 4F7LA 4MEDA 4KWPA 2WU6A 4FEXA 2QU6A 3LMGA 2A0CX 1GY3A 1IAJA 3VVHA 3C9WA 2FUMA 4FV0A 2UV2A 5CT0A 4OBQA 5AR2A 2DWBA 3T9IA 2O8YA 4IX6A 3F3ZA 4IW0A 4MWIA 3R7EA 4FF8A 5ETFA 2C6EA 4EZ7A 5AAEA 4L7SA 3Q4ZA 5HG9A 1OL1A 3E8DA 2Z60A 3F5GA 4O2PA 2W06A 3RZBA 4F0IA 4S2ZA 4MD8E 4LQMA 3V5JA 4F0GA 2QCSA 2GFCA 2EXMA 3UIXA 4U81A 3LFEA 2X6DA 3DB8A 2W96B 3PPZA 4MX9A 1I44A 1KE5A 2C1AA 3I5NA 3G2FA 4BICA 3ZC5A 4CQEA 4DBNA 5LMBA 2WTVA 4F9WA 3IPHA 3ZXTA 2VWXA 4G1WA 4OBOA 4N57A 4CFXA 1WMKA 5EM8A 3R01A 3U6IA 4DCEA 4DFYA 1P14A 4Z3VA 1K3AA 3F88A 2P55A 4IM0A 5K4IA 3PTGA 4QRCA 2X7FA 2X2KA 2UVZA 4B8LA 3QYZA 4UMUA 3TCPA 3S4QA 1H8FA 3BU6A 3V6RA 5HLNA 5FEDA 4KINA 2C5OA 3AG9A 4GT5A 4H3QA 2C3LA 2ZVAA 2XJ0A 4Y5QA 1M7QA 3R0TA 2IJMA 4A9YA 4APPA 1BL6A 4U97A 2RSVA 5CANA 3RWPA 5D10A 4CKIA 4D9UA 3D7ZA 2HZ4A 3AQVA 5IA0A 1G3NA 2HY81 3ZXZA 4DFBA 4TKSA 2OJGA 3DFAA 3C51A 3FI4A 4MYGA 3MPTA 4N70A 5HOAA 3T9TA 4NYEA 4CT1A 4QMZA 4JNWA 3WF5A 5DN3A 3MVLA 4D1ZA 4C37A 3FHRA 5DI1A 4HVGA 4DGOA 5F9EA 1GIHA 3N4VA 1MUOA 4ANLA 1BX6A 1UVRA 1HCKA 2KULA 4RVLA 3BHYA 4BC6A 4K18A 2E9OA 4O0TA 1H28A 2Y0AA 4GEOA 1VR2A 4AA0A 5CQWA 1PF8A 4AUAA 3EZRA 3PPJA 2BUJA 2WMAA 3OW3A 4PL4A 1R1WA 3FBVA 5TF9A 3ZC6A 1H1SA 4KD1A 3G0EA 4W9WA 3JPVA 3ZOSA 3GGFA 5DEWA 3K54A 4OLIA 2WTJA 5HO6A 2FH9A 2ZB0A 4UWCA 3LJ0A 1UNHA 3LOKA 1QCFA 5CAOA 1ZXEA 5AR8A 1AD5A 3UC4A 5IQIA 1KE6A 2XUUA 4JAIA 4AZFA 2WMWA 3ZYAA 2W5BA 3LM5A 4PTGA 1JOWB 2XKEA 5EM6A 3L9LA 3CBLA 5IQHA 1BKXA 4PY1A 4YSJA 5ACKA 3VF8A 4F6WA 2X7GA 1OGUA 3F3TA 3D9VA 3OCSA 2IPXA 3H4JA 3UOJA 2FYSA 2XIYA 2VTRA 3DB6A 3UGCA 4FV2A 5K0XA 4YPSA 3A4OX 2R5TA 4O22A 4FSNA 3S1HA 3FPQA 3PJ1A 1H1QA 3DK7A 2ZM4A 2JGZA 4HGSA 1ZYSA 3QQLA 4KUJA 2R3HA 3PE1A 2B9FA 4NFNA 4FKPA 4QO9A 4ACMA 5C8KA 4L46A 5CY3A 4FIHA 4ITIA 4EZ3A 5CX9A 4PTEA 3NSZA 2W17A 5LARA 1XH8A 4D4SA 3L8XA 4ZY5A 1XBAA 2ITWA 1FGKA 3B2WA 2C3IB 1XJDA 4C3RA 3ATTA 4O2ZA 4BYJA 1T46A 4FIFA 4FNXA 3ZUTA 4V05A 2XM9A 3R00A 2IZTA 5DGZA 5CEQA 3P5KA 4JBPA 4MNEB 5JZJA 3HUCA 4CFFA 3NYXA 4BDAA 2W1HA 5JFVA 3DK3A 5L8KA 5EDQA 5F4NA 1OPLA 3R8MA 1Q24A 2GNHA 2XM8A 4LUDA 4QMYA 4J1RA 4JG7A 3BQCA 4KNBA 3DS6A 3WF8A 4O7TA 5LOHA 4E6DA 2FSLX 4RJ5A 5HTBA 5DFPA 5HNGA 4LFIA 4RG0A 3LFBA 2J51A 4D58A 5KZIA 2O5KA 4OTIA 3R9DA 3JXWA 5IDPA 3NGAA 3ERKA 5DH3A 1U5RA 4L53A 2W1CA 5AMNA 3TN8A 3ZSGA 4QMQA 3KGAA 1YVJA 1YQJA 5AR3A 2JKMA 1Q8WA 3BV3A 5FWKK 3R9HA 5J9LA 3ORTA 4JQ7A 3U9CA 3E7VA 2WMXA 3ODYX 3L9NA 5DA3A 4C2WA 2BRNA 2G2IA 4KIOA 1Z5MA 3WZEA 4XRLA 4OAUC 2NNWB 3LMHA 4JQEA 3IW4A 4C3FA 4EOSA 3EQRA 4MF1A 4MNEA 3FHIA 3MVJA 5JEBA 5JK3A 3H0ZA 4R5YA 4E5AX 3KF4A 4GYGA 2FSTX 3KA0A 4IM2A 3UQCA 5DBXA 3BYUA 5CNNA 2BAJA 2FSOX 3ZBXA 3ATSA 2FGIA 2BFXA 5DHJA 1VYZA 1KV2A 5CU3A 5BVOA 5TOZA 3KREA 4PTCA 4WT6A 3G5DA 3TUBA 2C1BA 2YZAA 3I7CA 4F9CA 3PVWA 3TZ8A 3NUUA 1H01A 5I3OA 2A2AA 3QKKA 2ITTA 4FG7A 4JQ8A 4MQ1A 3RM6A 4G6NA 4BR3A 5CU0A 5CALA 5IG1A 3D83A 3KU2A 4FMQA 4RVKA 2XNBA 4ZJJA 4X2KA 2HXLA 3SKCA 2JAMA 3BBWA 4JDHA 4YC8A 3GC8A 4F9AA 3O17A 1LPUA 1XWSA 4EQUA 2YM3A 2F7EE 3OY1A 3ZO4A 5M55A 4LRKA 1JSUA 3KMUA 4RC3A 4XLIA 5HG8A 3Q5ZA 4D28A 4MNFA 4FSRA 5FM2A 4CKJA 2X8EA 3WARA 1ZOHA 5AAFA 4LL5A 2XK9A 2OF4A 3TDVA 1H1WA 4DEBA 3NWWA 4O7VA 4IC8A 4FSYA 3R8UA 2C5NA 2OXDA 3QTZA 3RCJA 4YJNA 3Q9WA 3W55A 4EOMA 5A4QA 4ZTMA 4FYOA 5DVRA 4D2WA 4L3JA 3NNUA 3O23A 3R1SA 3VRYA 4C02A 1W8CA 4I4EA 5C1QB 3UO5A 4C0TA 4GU6A 3ZFXA 3FZ1A 4I23A 1SNXA 4HGTA 3OHTA 3U4UA 2J0KA 3FUPA 4ANNA 4MXXA 4DN5A 2C68A 4M84A 2JD5A 3UMXA 3WZDA 1YOMA 2WMBA 1H1RA 1PJKA 2OJ9A 4TNBA 4XEYA 5A4EA 4UWYA 2C3JA 4FTMA 2YA9A 4WIHA 5DPVA 2HIWA 5KZ0A 3CKWA 4ZS4A 4Z9LA 2Y6OA 3CIKA 3RZFA 3C4XA 5DE2A 4WNOA 4ANMA 3KXHA 4G3DA 4YTCA 4WO5A 2R3JA 4C38A 3RMFA 2UW0A 3F61A 4PPBA 4EHEA 3ORXA 2EXCX 2WKMA 3QWKA 4QMOA 1J7UA 3GENA 3E87A 4FGRA 2P2HA 5C01A 4W4YA 3W2OA 4F08A 3HVCA 5AP7A 1OB3A 2UZEA 2ZDUA 3ZDUA 2QOOA 3MFSA 4TTHB 4GK3A 2WAJA 4AT3A 4H58A 5CU6A 4QMXA 3ZO3A 2YJSA 4GCJA 3F5UA 4GSBA 4DA5A 4XV3A 3BPRA 3FQHA 2PZPA 4IDTA 3T3UA 3NW5A 5M07A 4QMSA 5E8ZA 2NPQA 2YM7A 3U4WA 1YXTA 3FPMA 2HZ0A 3FKLA 3FI2A 3I6WA 5A46A 5A6NA 5LWMA 3D0EA 3THBA 3F2AA 3W18A 3RBWA 4EBVA 4E7WA 5JKGA 4TYGA 3A7GA 4DH3A 4I6BA 2BDJA 3F66A 4ANOA 4ZTSA 4M0ZA 3QCYA 1Q99A 3CTHA 3AT4A 4OTWA 2GNJA 2HENA 3PXZA 2J2IB 3FLYA 3NS9A 3BV2A 3QBNA 5J7HA 3EQFA 1WVWA 4RIOA 5C27A 4FZ7A 3ACJA 3Q6UA 3RAIA 5AR4A 3FYKX 3OUKA 3QC4A 2BTSA 2ITYA 3A8XA 4F1TA 1WBSA 3G15A 2GQGA 3I60A 3R21A 4PWNA 4QTBA 2XIKA 5TR6A 4CD0A 2WEIA 2CKEA 2YITA 5CNOA 4E93A 4IX3A 4HCVA 5HLWA 2WMSA 2B54A 2C0OA 1F5QA 3QHRA 3E63A 5F95A 4EK8A 4ZLYA 2IW9A 3NUXA 3OOMA 1YWRA 3VN9A 2W99B 3ORIA 1PXNA 4JVGA 2YWVA 3TJDA 2WMVA 1ZOGA 3M2WA 3F82A 5D9HA 2GHLA 4W4XA 4QP1A 3LJ1A 3W10A 4GT4A 4E4NA 5A14A 4RIXB 4MQ2A 4GKHA 4ZY6A 3FC2A 5CWZA 1O6KA 3M1SA 4YPDA 5HG5A 3N51A 4G17A 4BI0A 4EH5A 2YLFA 3O50A 3AMBA 1ATPE 2PMOX 4LGDA 1OBGA 4FC0A 3Q4TA 3QRJA 2B53A 3PP1A 1Z57A 4I4FA 4RIWB 4XBUA 2BMCA 5EW8A 3CQWA 4FTRA 3ZFYA 3UOHA 3UBDA 4D1SA 4E20A 4M12A 2IZUA 3DJ5A 1RW8A 4ZY4A 2BZIB 5CI7A 2C6TA 2CN5A 5D7VA 5KMOA 4WA9A 4OTGA 4XJ0A 3KRWA 1H27A 5AA9A 3R8LA 3P78A 3HP2A 1DAYA 2PUUA 3E8CA 4QMPA 3ORMA 5F1ZA 4QP9A 3BCEA 3UYTA 3CD3A 4JDKA 4EH7A 1FGIA 3IW8A 1UKHA 2HZIA 2CKQA 5BUJA 1KWPA 3KY2A 3U87A 1UA2A 3W2RA 3AGMA 4U44A 1H00A 3DKFA 3DNEA 5HGIA 2WTDA 5IQCA 4WHZA 4AN9A 4RIXA 1R0EA 4TPTA 4MF0A 1Q4LA 4AE9A 3QQKA 4V01A 2VAGA 1H08A 3E62A 4XYFA 3WYYA 1URCA 4HPTE 5LVPA 4F09A 3HMPA 4UZDA 3KC3A 2QLQA 2SRCA 4O6EA 3EN9A 4BGHA 4RIWA 3KL8A 3MTFA 5EOLA 2VWUA 2Q0BA 1FMOE 3GFWA 3MYGA 1SMHA 4DGNA 4ZLZA 2Q83A 1P5EA 3C0IA 3G6GA 4G3GA 1JBPE 2WQBA 3DKGA 3UC3A 3NNWA 4YJQA 2FSMX 3IQ7A 3QQGA 4PMSA 1PMNA 2VTIA 5I9VA 3OC1A 2I0HA 3TIZA 4QTEA 3E3BX 5JH6A 4BFMA 4R8QA 2GQRA 3ZUVA 1Y6AA 2R3IA 2J6MA 4ID7A 2RFEA 4DBXA 4TWPA 3HMOA 3MFTA 3MPAA 3SD0A 3LW0A 3PXQA 4YJPA 5KKRC 4O7RA 3BWJA 5CZIA 2CCIA 3GC0A 1Q8YA 4E5BA 4AW1A 3BYMA 4BYIA 5C9CA 4JT3A 4RMZA 4DLIA 4F7NA 2IVSA 2UZUE 5BMMA 4RSSA 1OBDA 4K9YA 1H24A 3DDPA 3VS5A 3ZH8A 5EDPA 4ALUA 3FMMA 2BRMA 3OVVA 2O63A 4F63A 4TYHB 5CASA 5HTCA 1LR4A 1XBBA 5DRBA 1YOJA 1IASA 2WFYA 4DTAA 4FKOA 5BX0A 2CKOA 3QQJA 4O84A 2QO2A 4DFUA 3RVGA 3EN6A 3QRIA 4XNEA 4QQ5A 3LXKA 2C0TA 4IC7A 5EI8A 3OXIA 3O7LB 4ALVA 3LQ8A 3V51A 1ZMUA 3O51A 3MB6A 5ANGA 3RAWA 4CFUA 2JKOA 4QYYA 5I9XA 2GNLA 1MQBA 3VW6A 5JT2A 5KMNA 3UZRA 3PPKA 3OT3A 4GVAA 5EW3A 4AF3A 4I5PA 1A06A 1V0PA 1NVQA 2JBOA 3D94A 4A9UA 2XA4A 2OZOA 4UMRA 4EJ7A 3D5WA 4IM3A 4KBAA 2R3MA 1CTPE 4XG4A 3QGWA 4IJPA 3U6HA 4EK4A 3SDJA 4B4LA 2B9IA 3TNIA 2UZVA 4G3CA 4FVPA 2YLEA 1WAKA 1YDTE 2OH0E 4FV6A 4AOIA 4ZZOA 4NEUA 3SG9A 4EEVA 1WZYA 1XO2B 2E2BA 3BE2A 5HD4A 1PY5A 3GFEA 2OXXA 4PPAA 4TYHA 3V5WA 4EHVA 3Q9XA 4ASEA 2XIZA 3DCVA 4DFXE 3JS2A 3GQLA 2XB7A 4AG8A 5KHXA 2BVAA 3DBFA 4G16A 3RPYA 3ZDIA 4MXCA 5HE1A 4DFLA 2J0MB 5AUUA 1W83A 4EH6A 2HW7A 2BIYA 4ANSA 3ZLSA 2HXQA 3A7JA 1UU3A 3JR1A 2DUVA 4RX8A 4YHFA 5EDRA 2EUFB 3TL8A 4Q5HA 3F3WA 2ZMCA 4FODA 5CEOA 2YISA 4QP4A 1PXMA 3MN3A 4HZRA 4ITHA 1PXPA 4I6HA 1KSWA 4BCIA 2QO7A 2IO6A 3GU6A 3M42A 5TO8A 1OIYA 2ZV9A 2XNEA 1J1BA 4MXAA 1U5QA 2GS7A 2GCDA 4EH8A 5F94A 3VJNA 5ANEA 2BZHB 2YIYA 1Q62A 2WMQA 3NW7A 3IW6A 3R83A 1ZMWA 2YZLA 3Q53A 5HI2A 3TNWA 4PL5A 5AP1A 4CMTA 2WIPA 4PDPA 3R30A 3A61A 4U43A 5EHYA 5HCZA 5AUVA 3VIDA 4ZJVA 1B39A 5J7BA 4RWIA 3WZUA 4BL1A 4N0SA 2ITOA 3FQSA 4D5HA 2C6MA 4EI4A 2I6LA 4H39A 5BYLA 3DK6A 2W1IA 4IAAA 3VHKA 3UPZA 2PYWA 3R7GA 3ZSIA 3RM7A 2Y4IB 3OOGA 1PXLA 4GFMA 4KBKA 3OEFX 2XS0A 2X2LA 2J9MA 3R8PA 4UYNA 4DH7A 4NIFB 3LLAA 2X1NA 3CS9A 5JMSA 4EONA 4J96A 4FIEA 4BCKA 2PVJA 2ERZE 3LLTA 4EUUA 3PDTA 3QF9A 2BKZA 4I93A 4ONAA 4U45A 3A7IA 3C0HA 2JFLA 4KKHA 1YHVA 3ZRKA 3OWJA 2XMYA 4YZBA 3MW1A 3VBWA 3GB2A 3HRFA 3SV0A 4KSQA 4JDIA 5IUIA 3VRZA 4XG8A 3D2KA 4D2PA 2F9GA 4EK5A 3S95A 1GIIA 5H8EA 5IEVA 2I0VA 1ZAOA 2UZBA 3NLBA 4LMUA 4AW0A 2JLDA 4I6FA 3KN5A 4XOYA 3UNJA 4NCTA 2ZV7A 3CY3A 3PLAE 2P0CA 4CFWA 4YJTA 4AQCA 5IQGA 4XBRA 3MA3A 4CEGA 2UW9A 4XP0A 3TEIA 4ASDA 3QZHA 5DT3A 1PRYA 4QP3A 3DXNA 2F57A 2GPHA 2XNMA 1WBVA 3MIAA 4O1OA 4RBLA 4TZRA 1Q3WA 4OR5A 5HCYA 3QUPA 4NIFA 4D55A 4WUNA 4OAVB 4U42A 3W2QA 3DZQA 4R3CA 2A19B 3DPKA 3OS3A 2W1GA 4IEBA 4BHNA 3VS1A 4C8BA 3OTVA 1XR1A 3RINA 5JFSA 2PVFA 5EYKA 2UVYA 3SG8A 4H36A 4TN6A 3EKNA 4FV3A 3ZM9A 3LFNA 3DBEA 4R7IA 3R6XA 4ACCA 5GJDA 3TDWA 4RJ3A 5J9YA 3VS2A 5IU2A 3WZJA 3MI9A 4RLLA 5EI2A 1M17A 1QPDA 1PMEA 4GFOA 3EQGA 4JBOA 3ZLXA 4BDHA 3GI3A 2P4IA 4GV1A 5BVNA 2IG7A 2VD5A 3BLRA 2Y4PA 3I0OA 2FO0A 3UP7A 4QMNA 2I40A 4RX7A 4FTOA 3Q9YA 4X6QC 2G2FA 2VTNA 3PUPA 4U40A 4Y83A 4UMTA 4X7QA 5A4LA 2X9EA 3EYHA 5HICA 2CKPA 4IVCA 3VBXA 3TUDA 5HIEA 4FKRA 3R7OA 4DGLC 4X3FC 2Z7QA 4FKGA 4FZFB 4XV1A 1ZLTA 1KE8A 3QXOA 4UB7A 4H05A 4RZVA 2VX1A 3W16A 2KTYA 1GZOA 2YCRA 3COKA 5M08A 1JKKA 2RG6A 4RA5A 4BCFA 4BCJA 3RPOA 3KRRA 2WQEA 1NW1A 4OTDA 4J8NA 3ODZX 4P5QA 4GU9A 4UBAA 4WBOA 5FBNC 2VO6A 2I0EA 4ZXTA 5FXSA 2QHNA 3PE2A 5CENA 2OBJA 4HW7A 4DYMA 2E9PA 4IQ6A 1JVPP 3UG1A 4IFGA 3NEWA 3K5VA 2YACA 4FKJA 4A06A 3Q9ZA 4RJ6A 2IVUA 3NAYA 4CRSA 2W9ZB 2AC3A 4FV7A 4G3FA 3UE4A 4BCQA 4EH4A 2HCKA 1FPUA 2XEYA 1ZZLA 4C4IA 4FKTA 3PLSA 2JIIA 5AUTA 3GOPA 1G8AA 3SVVA 1MRYA 2W4OA 4BRXA 3TNQB 2DS1A 4IHPA 3TJCA 3DAJA 4WKQA 2V62A 5B7VA 3JVRA 1WFCA 1P4OA 4DH5A 1JWHA 2BZJA 3EWHA 3P79A 3QGYA 4OTRA 3V3VA 4AT5A 3I6UA 2WQOA 3KK9A 4M66A 4AGUA 5ICPA 3OG7A 3P7BA 5IEXA 3S2PA 3QRTA 3ROCA 2OI4X 4G5PA 4BDBA 3LMIA 3UTOA 4YGAA 3CJFA 4C58A 4DH1A 1CKJA 4UXLA 4DEGA 1UV5A 2B0QA 4PX6A 1R0PA 3P9JA 2UW6A 3UDBA 4C3PA 2ETMA 2OG8A 4FIGA 4EK3A 1RJBA 4F64A 4HVSA 4DGMA 4M67A 2JKKA 3RPVA 4W4WA 1IEPA 4QT1A 4Z7GA 4YURA 4ITJA 5KMJA 3PSDA 1Y57A 2QR8A 4FZAB 3JUHA 5JRQA 1V0OA 4OTHA 4PL3A 4B99A 3CD8A 4J99A 4FI1A 4CGAA 5GNKA 3BEAA 3ALNA 4F1OA 3HEGA 1TKIA 3D2IA 4IFCA 4FTQA 4IX5A 4J95A 4Q5EA 3QLFA 5AUYA 3ELJA 4Z55A 4I0SA 2VTSA 1XH6A 2B7AA 3GQIA 4APCA 3BHTA 4AGDA 3CEKA 3A99A 4YTFA 4PDYA 3LPBA 4YHTA 5HIDA 2IWIA 4MXOA 4FK6A 4OT5A 4QYFA 2X7OA 3DDQA 5DLSA 4L45A 3RTPA 4EOOA 3KRLA 4E8AA 3AC5A 3DFCB 4PPCA 5AV1A 4BTJA 5FD2A 5JZNA 3FI3A 4ZSJA 4RPVA 4RX9A 2HZNA 1FOTA 2H34A 4FT7A 3PXFA 5LVLA 3UPXA 5IQEA 2PE0A 4JR7A 5E8VA 2C0IA 3VNTA 3HA8A 4L00A 4XLVA 1YKRA 2BKKA 2J5EA 3PJ8A 1JSVA 3PIYA 2UZLA 2XNNA 3TNPC 5DEYA 3ROYA 1HOWA 1WCCA 3BYVA 1Q3DA 4IADA 5ANKA 3IDBA 4LOPA 3PWDA 4ZTLA 3W2SA 4D2SA 1KOBA 5H3QA 3VULA 4F70A 2Z7SA 3QTRA 4PP7A 2I7QA 4J98A 1BL7A 2RFDA 4CKRA 1YHWA 3KMWA 3OZ6A 2QNJA 3SLSA 3UIMA 3LAUA 4FL1A 5ANDA 1H07A 3OCBA 3D5VA 4BCGA 4EC8A 5IKWA 4OTPA 3ZO1A 4AZWA 4FV4A 4IZ5A 3NZ0A 3PRFA 3QRKA 4AT4A 3W8QA 4LOQA 1HCLA 3BQRA 2F4JA 3QHWA 3ZEPA 5KBRA 2VWBA 4XG6A 3KEXA 5HE2A 5FLFA 3H9OA 2HYYA 4S34A 1OKYA 3H30A 3D14A 5DT4A 3R9OA 2W1FA 4KSPA 2F2UA 2JC6A 3MY1A 4DEAA 1PXIA 2OKRA 4PUZA 4O7YA 3FSFA 1R78A 4JJRA 2VUWA 4TNDA 4AZVA 3AC8A 3AD6A 4BY9E 2OJFE 3UQGA 3ZU7A 3ZEWA 4DEEA 4QPMA 3NNVA 3D4QA 4E6QA 2R64A 4MBLA 5CVGA 5LMAA 3NUYA 2JDRA 3OTUA 5HNBA 4AOJA 4QQTA 3PY3A 4E3CA 5AAGA 1G8SA 4L01A 1V0BA 1IR3A 4FG9A 4QMTA 4HYUA 5A54A 1GIJA 5DIAA 3AT3A 3KN6A 3VS6A 5M53A 2JKQA 2ETRA 2WTKB 5AM6A 2XNGA 3OBJA 4YJRA 5HG7A 2OF2A 2ITQA 3QQHA 3G90X 3SHEA 2YABA 4QTAA 5EKOA 3Q4UA 5HIBA 3RKBA 5CSVA 4GG5A 2BR1A 1SVHA 3MS9A 4KKGA 3I1AA 2V22A 3GBZA 4KKEA 4MKCA 3GOKA 3HZTA 4GJ2A 5BYYA 3I81A 3NIEA 4OW8A 2G15A 4WRGA 4FEQA 3PYYA 1BYGA 4I20A 2JEDA 3KCFA 4FTLA 1JNKA 3KVXA 4J53A 3UODA 1CM8A 2FVDA 3F3UA 1OPJA 4XMOA 1SZMA 4F6UA 4ZLOA 1W82A 2PK9A 3G0FA 3LIJA 5DR6A 3ID6C 4IMYA 3NIZA 3JYAA 4MBIA 2PVHA 5A3XA 4BTMA 4O0VA 4M0YA 4EYMA 2XIXA 4TY1A 5AIKA 4II5A 2VO0A 2YJRA 3CXWA 4AS0A 5M4UA 3UP2A 4JRVA 4IB5A 4NTTA 5HTIA 4QMLA 3CKXA 1YHSA 3F2RA 5M09A 4C59A 2YM8A 3ORNA 5B2LA 3DV3A 4YZNA 3GCSA 4KRDA 3KB7A 3H9FA 4YSMA 5CEMA 5CEPA 5IH6A 2VWZA 4F4PA 5HEZA 1J7LA 1TQMA 1M2PA 3FLZA 4O1PA 3PVBA 4GRBA 3CGFA 5AWMA 3BYSA 3OF0A 4FV1A 4I5MA 2HK5A 5IQDA 2PPQA 2R3RA 1OIUA 3QKMA 5K4JA 4GYIA 4K6ZA 5J79A 4FNZA 2BHEA 4XRJA 4FZ6A 5AP6A 3WI6A 1W98A 3MESA 5FRIA 3EFJA 3EFLA 5B0XA 3SQQA 4PNKA 1UNGA 3ZZWA 4G2FA 4ASZA 3FKNA 2XIRA 3NPCA 3EQBA 4DEHA 3F9NA 2OK1A 3TKHA 3ZBFA 4USEA 5DMZA 1GZNA 4EQCA 2ZV8A 3A60A 3Q96A 4HCTA 4UX9A 3SGCA 3VUIA 4IH8A 3KRXA 3ET7A 1XBCA 4L42A 3TACA 5GZ8A 2GSFA 3DKOA 3TKIA 2GTNA 4DG3E 1L8TA 4FEVA 4MH7A 2PZRA 3L1SA 4W8DA 2BIKB 5AV2A 5T3QA 4QTCA 2BDWA 2OLCA 4CMUA 2YAKA 3OFMA 4DTKA 2QOKA 4C4EA 3FE3A 4RQVA 4XHKB 5CSPA 2R3NA 1Q41A 2BTRA 3L8PA 4R3PA 4EH9A 5HO8A 3C0GA 3MH2A 1NA7A 1Y91A 4Z7HA 2QOFA 4BTFA 2LGCA 3NCZA 3HDMA 4N6YA 4BCPA 5G6VA 5IH4A 1SM2A 2UW4A 4F9YA 5AUWA 2OWBA 2R4BA 2OIQA 4BDDA 3CR0A 1DI9A 4I21A 3GU7A 4QPAA 5D12A 3TZMA 5AIRA 3WZKA 4B6LA 4FEWA 3KXNA 4LRJA 3ULIA 2XKFA 2CJMA 4NH1A 4CRLA 3IO7A 3QRUA 4DF3A 2R3FA 2YAAA 2EWAA 3Q3BA 5I9WA 2X4FA 4AA5A 1Z9XA 3HRCA 4B0GA 4RFYA 4PMMA 5IQBA 4IZYA 1RDQE 4EHZA 3BX5A 1IG1A 1NVRA 2QURA 3A4PA 3D15A 2LAVA 1MRVA 3O96A 3PVGA 5LMKA 1CSNA 2W1ZA 3RAKA 1PYXA 3E64A 3R04A 5I0BA 5BYZA 3FL4A 2O65A 2IVTA 3PG1A 3VUTA 4AN2A 3QQUA 4KIQA 4PDOA 4IAFA 4XS2A 2CMWA 4G3EA 4O38A 4Y46A 1M14A 5J5TA 3KMMA 2R9SA 4GK4A 4JOAA 3VQUA 3HV5A 1XKKA 3MB7A 4D0XA 1O9UA 2EU9A 2W1DA 3EN4A 2PSQA 3LQ5A 4IBMA 2ZYBA 4D1XA 3LHJA 1OUKA 4G6LA 4MD9E 4XUFA 2JIVA 4A9SA 2PVYA 4BCHA 3GEQA 3OWKA 2GU8A 4RJ4A 4K0YA 2VTLA 1Y8YA 2HOGA 1OL2A 5IA5A 4A4XA 4K8AA 4QOXA 3AMAA 2YCSA 3DJ6A 2OU7A 4CLJA 1OPKA 3VS0A 4M68A 4XP2A 3QLGA 3U54A 4F7SA 2VNWA 1WVYA 5JQ5A 2UW7A 2PUNA 2FB8A 1GZKA 5LXMA 3TZ9A 3VS7A 4JX7A 4CV8A 4JIAA 3RPRA 5BNJA 5FXRA 4E26A 4IE9A 4FTUA 4IJ9A 2Z8CA 4MTAA 1H1PA 3W33A 5A9UA 4C4GA 2ITXA 2JIUA 2OFVA 5HVYA 4I94A 4MAOA 2PMLX 2OZAB 3CC6A 4QP7A 2BHHA 3EQPA 3V5TA 4QTDA 5C8NA 4HJOA 2I0YA 3V6SA 2PVRA 4D4YA 1RE8A 3ORPA 2WTWA 2H9VA 3LCOA 2GFSA 2X6EA 3HNGA 3O0GA 3CPCA 3PZHA 3ZTXA 4BB4A 2W9FB 1XQZA 3QZFA 5AP0A 4IDVA 3EIDA 3ZRMA 1YXVA 3ACKA 5J5SA 1NXKA 4M3QA 4RWJA 3ZSHA 4E4XA 3EQIA 4ZP5A 3RWQA 3VWAA 5KMLA 4I3ZA 4ZSLA 4FA2A 5IISA 4JLCA 5IEYA 1VYWA 4WG4A 2OIDA 4XX9A 4U9AA 2QOLA 1PXKA 4FUYA 3PFQA 4DG0E 3V8TA 5GZAA 2ITVA 2XK6A 4ZZMA 5HQ0A 3MWUA 2YIWA 4BI2A 3HAMA 4RT7A 5AV0A 2WHBA 3QA8A 3MDYA 1ZY5A 2OXYA 3CTQA 4RJ7A 4WNKA 5KX8A 3QTUA 3T8OA 2UW3A 2W0JA 4C4HA 5L2WA 4ERWA 3NCGA 5E8XA 2OZAA 1B38A 1RQQA 4CMOA 4FTNA 2O3PA 3FZTA 2R0UA 2VTQA 4GIHA 5CI6A 5CZHA 4C36A 1J7IA 5I9ZA 3MVMA 2VV9A 4HGLA 5C26A 3VJOA 2GQSA 2IVVA 3R22A 4HYSA 3LXLA 2ZM3A 5L8JA 3SXRA 2G2HA 4R5SA 1J91A 4KABA 4RC4A 4YMJA 2ONLA 4YZCA 1I09A 4G34A 2ZAZA 3IOPA 4MVFA 4ZS0A 3VS3A 4IWDA 1H0WA 4AZSA 4R77A 4UWBA 3R7UA 3FQEA 4ZSGA 4FV5A 3OUNB 1DI8A 1ZYJA 5CVHA 4ASXA 4BZNA 1Q5KA 4BZOA 5CF8A 4NW6A 4C62A 3UNZA 4NKSA 3UO6A 2YERA 5DYJA 4C4FA 1PMVA 3ZO2A 2PE2A 4NSTA 3NYVA 4H3PA 1JKSA 4XV2A 5EFQA 3DU8A 5HCXA 4BIBA 5ITAA 5AEPA 1JAMA 2GDOA 4NCTC 4EC9A 2X2MA 3BELA 3VBVA 1KE9A 2R3GA 4PV0A 3ENMA 3FLQA 3KQ7A 5HBEA 3WF6A 4D2RA 1YWVA 4C2VA 4C33A 3ZFMA 2V0DA 3TKUA 4BBMA 3QAME 2Y4IC 4MWHA 4C7TA 5M57A 4D4RA 4LGHA 3NYOA 3G9NA 4CFMA 2VTTA 3DLSA 1Q61A 4AZTA 3OWLA 2VX0A 4I5HA 2VU3A 4EBWA 3L8VA 3P23A 3MH0A 4YZMA 3I7BA 4XV9A 4NUSA 2ZJWA 3BU5A 1GJOA 4DEIA 3HL7A 4EKLA 4EWQA 4UYAA 2A27A 2O64A 5M51A 3ZM4A 3DAKA 2DQ7X 2Z2WA 2QOQA 3UZTA 5JQ8A 3HA6A 2OSCA 2UUEA 4AN3A 4D4VA 5I5ZA 3HDNA 2CNQA 3F69A 3HECA 3V5PA 5LMKC 2YDKA 1UU7A 3HV7A 4FZDB 2YFXA 4YJUA 4O86A 3AC3A 1PXJA 1S9IA 2YDJA 3LJ2A 4FSWA 3GVUA 3CTJA 4LUEA 3SA0A 3V5QA 4NKAA 1REKA 4EOKA 4I6QA 4CVAA 3DKCA 3C1XA 5HVKA 2XCKA 3RPSA 5JRSA 3EMGA 2WMUA 4O0RA 2AUHA 3W2PA 4AE6A 2C5XA 4GUEA 2NRUA 3SOCA 2BZKB 2F49A 2QOBA 3EHAA 2F7XE 4FNWA 4PP9A 3CPBA 1IA8A 4PF4A 3GXLA 4IB0A 1ZWSA 2JITA 3KKVA 5J8IA 3PXKA 4U3YA 4CTCA 1KE7A 1ZYDA 3HX4A 4KBCA 1YI4A 4GT3A 2A1AB 4YLKA 4ACDA 4JX3A 3DJ7A 3GU4A 4LL0A 2YM5A 4OT6A 4C34A 2XKDA 3OCTA 4BDKA 3A7FA 3COIA 3N9XA 4LG4A 5CSXA 4YNEA 4AAAA 3I0QA 5IUGA 4MXZA 4WSQA 3MTLA 3RNYA 4RLKA 3TTIA 4EOQA 4PQNA 1PKGA 4QYEA 3OCGA 3Q60A 5ANJA 4QD6A 5KUPA 3RNIA 2W4JA 4CFVA 2R3LA 5E4HA 3V8WA 5M4IA 3NMUF 3EJ1A 4AOTA 2QU5A 3NUNA 3C5UA 4NT4A 5J95A 3R7YA 3ZHPC 4U80A 3ENHA 3HKOA 1YI6A 2YCFA 3F7ZA 4FKQA 4OUCA 2QLUA 4TWNA 4ANQA 4B7TA 1ZYCA 4DINA 4O83A 2I1MA 3FI8A 2PWLA 3F5XA 3KK8A 3NYNA 4FTIA 4ZZNA 2ITZA 2OFUA 3SRVB 1OKWA 5C03A 3E8NA 5EHOA 3OP5A 4O21A 4U8ZA 1JSTA 2PMIA 3LCKA 3GP0A 3PXRA 3Q6WA 2GHMA 4R3RA 4BF2A 2ZM1A 3K3JA 4CG9A 4UEUA 2XZSA 3U51A 3WE4A 3CP9A 4O7WA 4HYIA 3D5UA 5KMIA 4XG3A 4XCUA 4BDGA 2AC5A 2VWYA 3W1FA 2PY3A 3C13A 3C4FA 4G5JA 5CTPA 5AUXA 1EH4A 3FWQA 3VBTA 3FLSA 4O0YA 4ENXA 5HX6A 4KRCA 5M56A 3FMJA 4YU2A 3O8TA 4CG8A 4YJOA 2B52A 5KKRB 1OITA 3FY0A 4BN1A 4DLJA 5I9UA 4UMQA 4BIDA 3H10A 2C3KA 4XG7A 2J7TA 4J71A 4Z16A 3NNXA 5FP5A 2UZOA 3GUBA 3TZ7A 2VO7A 2VRXA 3SW7A 4L9IA 4Y72A 3TV7A 2QO9A 4IAZA 4PNIA 5HORA 1H0VA 3SOAA 5A4CA 1FVTA 1BUHA 3IONA 4YP8A 4BTKA 4DC2A 4KIKB 3MJ2A 2XNPA 4GK2A 3FXWA 4LRMA 1URWA 4O7NA 4DH8A 3GU8A 4U5JA 3KCKA 4RX5A 5E8TA 4O7ZA 2IZSA 3PG3A 3BIZA 3DTCA 3MGYA 3B8RA 3C7QA 5E1SA 3TIYA 2X39A 3PY1A 3OEZA 1QL6A 3ZCLA 3VO3A 4EOJA 1KOAA 1YW2A 2V5QA 2F2CB 2XCHA 5KMMA 2CNVA 1YXUA 1OVEA 4K2RA 3DGKA 4NM7A 4H3BA 5FDXA 3UOLA 3FMEA 2VTOA 4FT5A 4FNYA 3RGFA 2GS2A 4Y5HA 5EOBA 5AR5A 4E6CA 1O6LA 3AOXA 4FSTA 2ACXA 3QD2B 3DQWA 4IVBA 4M14A 3ZLWA 5LCKA 4CYJA 2X81A 4O91A 5IZFA 4O82A 1BI7A 3N4TA 3TV6A 3WIGA 5C4LA 3KXMA 5L2TA 5LVMA 3R8ZA 4R6VA 2CGWA 3LFCA 4BCOA 4FKIA 4KIKA 4YTIA 4L43A 1GAGA 1W7HA 3CLYA 2DYLA 1QPEA 3HMNA 4GS6A 4V04A 3PIXA 1SVEA 1YOLA 3R2YA 4CZTA 4BVUA 5E92A 3R8VA 4AW2A 5CAPA 5CAVA 3FZOA 1NVSA 2YM4A 3II5A 3QZIA 3VW8A 1KUTA 3TNHA 4TWOA 5BMSA 5JSMA 4C57A 3KRJA 3DY7A 2XRWA 3AD5A 2BROA 3NDMA 4GKIA 3POZA 3F3VA 3KXXA 4OTQA 1A48A 1FQ1B 5LVNA 1F3MC 1FMKA 3ITZA 3HMIA 5H8GA 2PZ5A 2WTIA 4MXYA 2BPMA 1YXSA 4FOBA 4RVTA 3UVQA 3TV4A 3V04A 4BHZA 3QYWA 2YIRA 4X2FA 3BBTB 2OJJA 4X21A 4Y95A 4YLLA 5E8SA 3W2CA 4ACGA 3UJGA 5A6OA 5LCJA 5L8LA 2G01A 2CLQA 4BGQA 4YUQA 3FLWA 3PJ3A 4TYEA 3K3IA 5DRDA 3IK3A 5FDPA 4D2VA 3V01A 3EL7A 3V5LA 2RL5A 4K1BA 5KNJA 3DOGA 4WUAA 3UYSA 2VTAA 3FEGA 4QMVA 5L2SA 2X9FA 2OICA 3FSKA 3RHXA 1G5SA 2C69A 2W1EA 3P86A 2JFMA 4G9CA 4P4CA 5DR2A 2WNTA 3DBQA 3FMLA 5CYIA 3A2CA 4TL0A 4FIJA 2GS6A 2WTKC 4YTHA 4PMPA 1LP4A 1UKIA 3WE8A 1LEWA 5LJJA 5FTGA 3QUEA 4O27B 4EYJA 4GW8A 1BMKA 1MQ4A 4UN0C 4RIYB 2HWPA 1BLXA 4EUTA 3BHHA 4E6AA 5HE3A 5FXQA 3R63A 3WBLA 2BALA 2C6LA 2P3GX 2WXVA 3R73A 5FTOA 3VC4A 2Z7RA 4EJNA 1JKTA 2XK8A 4QYGA 2RF9A 2W5AA 3COMA 4ALWA 1K9AA 1APME 2XKCA 5AFVA 3ORKA 3BZ3A 4RVMA 2CDZA 1XH9A 3H3CA 1AGWA 3NR9A 1IA9A 1UWHA 4EH2A 4Q9ZA 2JDOA 4PRJA 3CQEA 3JVSA 3LCSA 3MVHA 4GIIA 4O0XA 3CCNA 4YBKA 5KBQA 4USDA 4KS7A 3QCQA 5ANIA 1UU8A 4WRSA 4AWIA 4DT8A 1TVOA 3O8PA 4UALA 3ZZEA 1CDKA 4YZDA 1JLUE 3EYGA 4LGGA 5FQDC 4W4VA 5M06A 1GOLA 1LUFA 2IZRA 2RGPA 2WOUA 4IZAA 3EQDA 4QYHA 4E4MA 4RFMA 3LXNA 3NVKI 3F7WA 3PA4A 3EN5A 5K3YA 4RIYA 2W4KA 5E8WA 1WBPA 4F1MA 1UWJA 2JDTA 1PHKA 2CPKE 4H1MA 3FMHA 4FKUA 4XG9A 5HU3A 3O2MA 1Q8UA 1E1XA 4L44A 4AZEA 4CZUA 5J1WA 3VUHA 2XBJA 4NM3A 2BFYA 4WG3A 5AP5A 2UVXA 2XP2A 5EM5A 3S0OA 1WBNA 1JQHA 1MP8A 2VX3A 3EOCA 4ORKA 2XNOA 3FDNA 3AC1A 2C6OA 4FKVA 3QTQA 4WNMA 4TT7A 3VBQA 2V7AA 4F9BA 4BIEA 3VF9A 5D7AA 4BBFA 4X3FB 4UZHA 3Q04A 4JS8A 3WIKA 3QX2A 3P08A 1STCE 3AC4A 4FX3A 3V8SA 4ZSAA 2PL0A 4R1VA 4NM0A 4IACA 4HCUA 4C35A 4HVIA 5HZNA 5M44A 4X2NA 5K0KA 5EQYA 3GNIB 2UZWE 2X4ZA 5AADA 3GCVA 4NW5A 4QP8A 2OW3A 2WQNA 3HRBA 2WTCA 4WBBB 3ORZA 4K77A 3C4ZA 2ZDTA 5BVWA 4JAJA 3UVPA 4L7FA 2UW8A 4DE4A 4FT0A 3KULB 4CFNA 5T68A 3KXZA 3LXPA 4J8MA 3FMDA 1TQIA 3R7IA 3U8WA 1J3HA 2CHLA 2BAQA 4ZTRA 5IQAA 3POOA 4BI1A 2UZDA 1ERKA 2BDFA 4JI9A 5FEEA 2J5FA 4G6OA 4H1JA 2BCJA 4FVQA 1PYEA 3GCPA 1M2RA 2RIOA 4XOZA 5TE0A 4UMPA 1KV1A 2R3QA 3F2NA 5IMEA 1JPAA 4D5KA 2ESMA 5K5XA 4GUBA 3KXGA 3T3VA 4R7HA 4O7SA 1DAWA 5BVKA 4IWPA 3WOWA 4JR3A 3NVMB 3LFFA 1DS5A 3ZMMA 4N6ZA 2H8HA 4NU1A 1M52A 2QVSE 4X3FA 3R71A 2J4ZA 3ORLA 3MA6A 4BGGA 3BU3A 5J1VA 5ETCA 1XH4A 4FTAA 4ERKA 3E88A 3BEGA 3E5AA 4LV8A 2PULA 4CSVA 2CLXA 1GZ8A 3CJGA 1QPJA 3PA3A 5GINE 4KIPA 3LZBA 4FKWA 5CF6A 2G1TA 4FSQA 3EZVA 5AP2A 4YZ9A 5JFWA 1X8BA 2UZNA 4JG8A 1OL7A 4IIRA 4HVDA 5FM3A 4QNYA 5KMKA 2UZTA 3KULA 5JGDA 5H8BA 1XHAA 3CE3A 1R3CA 4D0WA 2BRHA 2C5VA 2OIBA 3FL5A 3IS5A 4P2KA 4AW5A 4I0TA 4LV5A 4NFMA 3I4BA 5DT0A 4CCBA 1DM2A 5HNIX 2B55A 5CEIA 4GL9A 5AR7A 2WIHA 2XJ1A 1ZY4A 3P7AA 2YCQA 4ZTHA 4EHGA 2H96A 2WMTA 2WB8A 5D11A 4YLJA 5FBOA 2V7OA 2VTJA 5L6OA 3QD0A 5HHWA 4AGCA 3FKOA 3MFUA 2VTPA 1YI3A 3PJCA 1Y8GA 3ZRLA 3L8SA 1CKPA 1VZOA 3RP9A 5E8UA 3F5PA 3EKKA 4LM5A 1ZYLA 4IWOA 1QMZA 3LFSA 5AP4A 4AGWA 5AX9A 3E7OA 5ETAA 4A9TA 1WBWA 3VBYA 4WNPA 3VS4A 3ZUUA 1IAHA 2P2IA 5B2KA 3TWJA 3FZSA 5DWRA 2HY0A 3OD6X 1ZARA 2XRUA 3B8QA 3R1QA 4RC2A 3TUCA 2B9HA 3QTWA 3Q32A 4L3LA 2PZYA 2C6KA 3LE6A 2FA2A 4KAOA 4UV0A 4IB3A 3HLLA 4DGGA 1Q8TA 2PVLA 4GMYA 4NJDA 4BDEA 4LMNA 5HBHA 2J0LA 3LCTA 3U9NA 4QMUA 2BAKA 3LFDA 4ZMEA 3TTJA 4BDFA 2RG5A 3ALOA 2CGUA 4X2JA 5F20A 4F6SA 3UIUA 5K5NA 5EYDA 4FK3A 5GHVA 2IW8A 5DR9A 5ANOA 5CXHA 3U6JA 2ONLC 4ANBA 1H4LA 2WPAA 4BWPA 4ENYA 3ZONA 2CGVA 2QOCA 3BHVA 3G51A 1LEZA 2XJ2A 3HYHA 3NUPA 3GC9A 4FOCA 2VNYA 4HOKA 3W8LA 3EB0A 3G33A 3QKLA 4CTBA 3ZS5A 2EVAA 3E3PA 4BWKA 5BQ0A 2ZOQA 4I92A 1M7NA 4A9RA 3UMWA 1NY3A 3IGOA 4AACA 4BDJA 2GTMA 3GC7A 1P4FA 2AYPA 3SW4A 5IA4A 1YRPA 3BHUA 2JDSA 5L4QA 4JIKA 2R0IA 3KF7A 2XH5A 3VAPA 2PU8A 3BWFA 1U54B 2EB3A 3BI6A 4U7ZA 5BUIA 2QC6A 3KFAA 2C47A 3UO4A 3EQHA 4RFZA 1PMUA 2R3KA 3MH1A 4FVRA 3JY0A 3IG7A 4BZDA 2XVDA 2Y9QA 4FTKA 2WD1A 5CSWA 5CF5A 4BDCA 4O6LA 1B6CB 5CAUA 4LOOA 3BGZA 1VJYA 5JN2A 2YDIA 4GVJA 4O0UA 2C30A 4D2TA 2PVMA 3HUBA 2YEXA 4ZIMA 4YR8A 4UY9A 5CU4A 5E8YA 3PVUA 3PXYA 2C6IA 2VWVA 1K2PA 3PP0A 4MHAA 1FVRA 2QOIA 2OH4A 2PMNX 2WEVA 4A07A 1W84A 3P1AA 4I22A 5D1JA 1R39A 4M69B 5JGBA 4X3JA 4FT3A 2QG5A 3RCDA 1OL5A 4IVAA 3BGPA 4QMMA 3MBLA 1M2QA 4RRVA 3AXWA 4EOPA 1BI8A 4Y85A 2GNGA 3A8WA 4OBPA 3NUAA 3RI1A 5CQUA 4WOVA 3IDPA 1P2AA 3C4CA 2YIQA 4CV9A 2CCHA 4HPUE 4ZOGA 4EH3A 4E73A 1FVVA 4NL0A 5AM7A 3F6XA 2PZIA 1U54A 3RK7A 3Q2JA 5JGAA 4HNIA 4IXPA 2Q0NA 1SVGA 4NZWB 3REPA 3HMMA 1SYKA 1YXXA 2PVNA 3TXOA 3GCQA 2QOHA 5AV3A 3FZPA 4F65A 4FTJA 4EK6A 3HAVA 4XH6A 3RALA 2R2PA 4YNOA 3QTIA 4R78A 2VZ6A 2XF0A 5J9ZA 2GNFA 5HBJA 1U46A 4QP2A 3H0YA 4DFZE 3MH3A 4U41A 3DNDA 3MV5A 2PHKA 2RFNA 5FTQA 4M69A 4PMTA 4O96A 5FEQA 3IECA 4LYNA 4TRLA 4M7IA 3PZEA 2BRBA 2HWOA 4U6RA 5IA3A 3OBGA 2ZB1A 5LWNA 3FJQE 4UXQA 3QU0A 2QONA 1YDRE 5CEKA 5IA1A 2QQ7A 3E8EA 5EQPA 4DCAA 5AJQA 2R7BA 4YO4A 3QALE 4I1ZA 3RK5A 4FKSA 3VUDA 2VWWA 5IDNA 3LM0A 4F7JA 2EB2A 3QX4A 2J0IA 4L67A 5E7RA 4CCUA 4WG5A 3CGOA 4YJVA 2WZJA 5HE0A 1XH5A 3BKBA 4IB1A 3SXFA 1IRKA 2QODA 3C4WA 4FYNA 5HKMA 1E1VA 5DG5A 5C8MA 5KE0A 5M4FA 4FE2A 3MIYA 3ANQA 5HD7A 3MY0A
chains in the Genus database with same CATH superfamily
3AD4A 1YDSE 2E9VA 2ITNA 5CU2A 5K9IA 4GH2A 4X2GA 1MRUA 3NW6A 3WF7A 3L9PA 3FXXA 3P0MA 4FICA 3RK9A 1QPCA 3DXQA 3IKAA 4MCVA 5KCVA 5E90A 3ZLYA 4F0FA 3MPMA 4G9RA 5IF1A 2XK4A 4NJ3A 2PUPA 4O0SA 3QQFA 5CLPA 2W7XA 2YN8A 3BYOA 3OWPA 4QMWA 2OO8X 4RGJA 3WILA 4M15A 3VUGA 3AGLA 4CXAA 1T45A 1GNGA 3FMKA 3CSVA 4FL2A 3R9NA 4ACHA 4ZSEA 4J7BA 4AA4A 2NP8A 4L68A 4EOLA 5GIPE 4NTSA 2WELA 5LVOA 2IW6A 2X0GA 3QTSA 4FUXA 1WVXA 3VQHA 3S3IA 3FYJX 3VUMA 4AXAA 4S30A 4IZ7A 4FR4A 2O2UA 2W5HA 2REIA 5L2IA 3LCDA 4JRNA 3R9RA 3UQFA 4FIIA 5AUZA 1U4DA 4YC6A 3MJ1A 1A9UA 3NUSA 2XAMA 5EM7A 2XK7A 4AP7A 1H26A 2VN9A 3PSBA 4FSZA 5L2QA 3R7VA 4USFA 3K2LA 4JBQA 4C61A 4BKZA 4L6QA 4IANA 4RJ8A 4Q2AA 5HO7A 1OECA 4ZEGA 2C4GA 4TW9A 4E5WA 5FGKA 1VEBA 4FV9A 2W05A 4U3ZA 1OIQA 4FGBA 3FC1X 5B2MA 4F99A 5I3RA 4O81A 4J52A 3SX9A 3C50A 5FUTA 5CT7A 3KVWA 3OMVA 1UNLA 3A62A 2J90A 4O0WA 1VLRA 3VHEA 3SC1A 3BLQA 3DBCA 3K5UA 5TT7A 4W9XA 5ETIA 4BDIA 3QXPA 3CY2A 2ERKA 2GMXA 3OXTA 5CSHA 2H6DA 3COHA 2QD9A 2HAKA 2VTMA 4EZ5A 5JFXA 2WU7A 3I5ZA 4PDSA 2CN8A 3UZPA 4Q9SA 3LFQA 1ST0A 4GG7A 5EHLA 3N4UA 3DBDA 4FV8A 3WYXA 3BGQA 3VUKA 1ZRZA 2GNIA 3QD4A 1U59A 3P4KA 3P7CA 5D41A 3S00A 2QG7A 2WO6A 3FZRA 5LQFA 4TXCA 3BLHA 4BCNA 3QA0A 2JDVA 3FV8A 4MD7E 5HLPA 3QL8A 2CGXA 3R1NA 5I4NA 4EWHA 1CKIA 2ITUA 3FAAA 4CT2A 3OXZA 4KA3A 1F0QA 1Q97A 4HYHA 5EG3A 2B9JA 3W32A 3WF9A 2QI8A 4N4SA 3W0MA 4BBEA 5L6WL 5AV4A 3IW7A 5BVDA 2CSNA 3Q4CA 3A7HA 4M13A 4WD5A 3SXSA 4FKLA 4I0RA 4DT9A 3IOKA 4IWQA 1YWNA 3QZGA 5TKDA 2CNUA 3DTWA 1H25A 1PKDA 4ZMFA 3IGGA 3LQ3A 5DNRA 4KB8A 4V0GB 3GCUA 2EXEA 3DLZA 4TYIA 2YHVA 4I41A 2XEZA 2XK3A 3I79A 4FTCA 4RA4A 2WOTA 3LKMA 5EW9A 3OY3A 4AFJA 4OGRA 2G9XA 3OT8A 2JBPA 5ACBC 3Q52A 1WBTA 2WGJA 3DT1A 4OTFA 4FEUA 4K33A 4TWCA 3TG1A 4DEDA 5KHWA 2PVKA 5AP3A 4L3PA 2B1PA 4B8MA 5AA8A 5EH0A 3QCXA 3TM0A 1AQ1A 3GT8A 3M11A 3AC2A 3C4EA 4DG2E 4M97A 4EKKA 4P5ZA 3AT2A 5E9EA 4C4JA 3ANRA 4EL9A 4LV7A 5IMXA 2VO3A 4XG2A 3H9RA 1PXOA 1Q8ZA 4X6RA 3UIBA 5BVEA 1OI9A 3QCSA 3RHKA 4U79A 3OROA 5FP6A 1OM1A 2E9NA 2V55A 3QUDA 3RJCA 4BWXA 4ZJIA 1XH7A 3O71A 4R1YA 4I24A 3HV6A 4CLIA 5J87A 5CF4A 3R28A 1OL6A 4AU8A 5EYMA 2HW6A 1PW2A 4J97A 4E1ZA 4M8TA 4V0GA 4A7CA 5CAQA 2Y7JA 5HVJA 2Y6MA 1V1KA 4RZWA 4GJ3A 1L3RE 2NRYA 4A4LA 4HZSA 4KS8A 2J50A 3O7LD 3QC9A 3D7TB 4QPSA 3O8UA 3EH9A 3PJ2A 2ITPA 4JDJA 5C4KA 2C6DA 4CZYB 5CVFA 3SAYA 4AX8A 1W2DA 5H2UA 2Y8OA 4EQMA 4CNHA 3EL8A 4ZTQA 4P90A 3HV4A 4K11A 5GZ9A 3R1YA 3PY0A 4U0IA 3E93A 3QD3A 5A4TA 3QWJA 1J1CA 2R3PA 3PA5A 4JBVA 4IX4A 2QKRA 1O6YA 3B2TA 2R7IA 4HNFA 4L8MA 5IQFA 5KO1A 3LVPA 4FL3A 5M4CA 3NAXA 1FBNA 5AX3A 2RFSA 2VGOA 4YC3A 5L3AA 5EQEA 4FT9A 1ZOEA 4ZK5A 2XYUA 2QKWB 4QP6A 2OGVA 3G6HA 2E9UA 2C5YA 5EYCA 4Y8DA 2O0UA 4A4OA 3C5IA 4EOIA 4S33A 4S32A 2Z02A 4JXFA 1JKLA 2QR7A 4YHJA 2A4LA 2F7ZE 3OW4A 4ZTNA 1FINA 2B4SB 3QFVA 5EKNA 3BE9A 3ULZA 3D7TA 3Q2MA 3SRVA 2HELA 4WSYA 5HU9A 2UW5A 2YWPA 4B9DA 4BKJA 1TQPA 2VWIA 5I9YA 3HV3A 4MK0A 4RWKA 4FTTA 3ETAA 4NM5A 5IH5A 4E4LA 3FXZA 2ETKA 1UU9A 3HP5A 3D5XA 3PSCA 3NRMA 3DZOA 4HVHA 4XP3A 1E9HA 1ZZ2A 4IAIA 2IN6A 5G1XA 3IW5A 4QQCA 4IAKA 4EORA 2GHGA 2PE1A 4L52A 3NX8A 3DXPA 5CXZA 5E1EA 4DITA 1Y6BA 3R2BA 3HGKA 3PWYA 3R02A 3UG2A 3PRIA 2XBAA 4ARKA 4IAYA 3UDZA 4AFEA 4FSMA 2BRGA 2P33A 2X8DA 2WQMA 5EI6A 3LFAA 4IVDA 1SNUA 1S9JA 1OKVA 3MFRA 4DFNA 2OJIA 3Q5IA 3CQUA 3PIZA 1OUYA 3MY5A 5GJFA 5L6PA 3ML1A 4O7LA 1WBOA 4HGEA 4X0MA 2BILB 4P7EA 1OMWA 1ND4A 4G31A 5FG8A 4CQGA 4DAWA 3DAEA 3QTXA 5IPJA 5EK7A 3E92A 1OKZA 4QQJA 3FLNC 2QHMA 4R7BA 2ZMDA 2RKUA 4GFGA 5E91A 4D9TA 5HX8A 3U55A 2JAVA 1NT2A 3UOKA 2R3OA 2NO3A 5BPYA 4MBJA 2VGPA 2X8IA 4DHFA 3BRBA 4YO6A 3EFWA 4TYJA 5BUEA 4NK9A 2YM6A 3JY9A 4BKYA 5DOSA 1ZMVA 4I5CA 1W0XC 4JL9A 4Y73A 2ZV2A 3TI1A 3L9MA 4DTBA 4YJSA 5IUHA 3EFKA 4FG8A 3MSSA 4BCMA 3UVRA 4FSUA 2PUIA 3IDCA 2Z7LA 5T6KA 3GU5A 5GJGA 3DQXA 2VTHA 4RQKA 1REJA 3KIOC 4CYIA 2XYNA 4JG6A 3PUFC 4W8EA 3AMYA 3RAHA 5H9BA 5BVFA 1OIRA 2YIXA 3G9LX 1G8JA 4ZAUA 2J0JA 3TT0A 2PTKA 3EN7A 3DA6A 4LI5A 4NWMA 2WMRA 5HESA 5CS6A 4QNAA 1OZ1A 4FBXA 1CMKE 3EQCA 3FMNA 3FY2A 3UNKA 5GIOE 4YBJA 4S31A 5IA2A 4RWLA 4F7LA 4MEDA 4KWPA 2WU6A 4FEXA 2QU6A 3LMGA 2A0CX 1GY3A 1IAJA 3VVHA 3C9WA 2FUMA 4FV0A 2UV2A 5CT0A 4OBQA 5AR2A 2DWBA 3T9IA 2O8YA 4IX6A 3F3ZA 4IW0A 4MWIA 3R7EA 4FF8A 5ETFA 2C6EA 4EZ7A 5AAEA 4L7SA 3Q4ZA 5HG9A 1OL1A 3E8DA 2X0OA 2Z60A 3F5GA 2W06A 4O2PA 3RZBA 4F0IA 4S2ZA 4MD8E 4LQMA 3V5JA 4F0GA 2QCSA 2GFCA 2EXMA 3UIXA 4U81A 3LFEA 2X6DA 3DB8A 2W96B 3PPZA 4MX9A 1I44A 1KE5A 2C1AA 3I5NA 3G2FA 4BICA 3ZC5A 4CQEA 4DBNA 5LMBA 2WTVA 4F9WA 3IPHA 3ZXTA 2VWXA 4G1WA 4OBOA 4N57A 4CFXA 1WMKA 5EM8A 3R01A 3U6IA 4DCEA 4DFYA 1P14A 4Z3VA 1K3AA 3F88A 2P55A 4IM0A 5K4IA 3PTGA 4QRCA 2X7FA 2X2KA 2UVZA 4B8LA 3QYZA 4UMUA 3TCPA 3S4QA 1H8FA 3BU6A 3V6RA 5HLNA 5FEDA 4KINA 2C5OA 3AG9A 4GT5A 4H3QA 2C3LA 2ZVAA 2XJ0A 4Y5QA 1M7QA 3R0TA 2IJMA 4A9YA 4APPA 1BL6A 4U97A 2RSVA 5CANA 3RWPA 5D10A 4CKIA 4D9UA 3D7ZA 2HZ4A 3AQVA 5IA0A 1G3NA 2HY81 3ZXZA 4DFBA 4TKSA 2OJGA 3DFAA 3C51A 3FI4A 4MYGA 3MPTA 4N70A 5HOAA 3T9TA 3AKLA 4CT1A 4NYEA 4QMZA 4JNWA 3WF5A 5DN3A 3MVLA 4D1ZA 4C37A 3FHRA 5DI1A 4HVGA 4DGOA 5F9EA 1GIHA 3N4VA 1MUOA 4ANLA 1BX6A 1UVRA 1HCKA 2KULA 4RVLA 3BHYA 4BC6A 4K18A 2E9OA 4O0TA 1H28A 2Y0AA 4GEOA 1VR2A 4AA0A 5CQWA 1PF8A 4AUAA 3EZRA 3PPJA 2BUJA 2WMAA 3OW3A 4PL4A 1R1WA 3FBVA 5TF9A 3ZC6A 1H1SA 4KD1A 3G0EA 4W9WA 3JPVA 3ZOSA 3GGFA 5DEWA 3K54A 4OLIA 2WTJA 5HO6A 2FH9A 2ZB0A 4UWCA 3LJ0A 1UNHA 3LOKA 1QCFA 5CAOA 1ZXEA 5AR8A 1AD5A 3UC4A 5IQIA 1KE6A 2XUUA 4JAIA 4AZFA 2WMWA 3ZYAA 2W5BA 3LM5A 4PTGA 1JOWB 2XKEA 5EM6A 3L9LA 3CBLA 5IQHA 1BKXA 4PY1A 4YSJA 5ACKA 3VF8A 4F6WA 2X7GA 1OGUA 3F3TA 3D9VA 3OCSA 2IPXA 4BJJB 3H4JA 3UOJA 2FYSA 2XIYA 2VTRA 3DB6A 3UGCA 4FV2A 5K0XA 4YPSA 3A4OX 2R5TA 4O22A 4FSNA 3S1HA 3FPQA 3PJ1A 1H1QA 3DK7A 2ZM4A 2JGZA 4HGSA 1ZYSA 3QQLA 4KUJA 2R3HA 3PE1A 2B9FA 4NFNA 4FKPA 4QO9A 4ACMA 5C8KA 4L46A 5CY3A 4FIHA 4ITIA 4EZ3A 5CX9A 4PTEA 3NSZA 2W17A 5LARA 1XH8A 4D4SA 3L8XA 4ZY5A 1XBAA 2ITWA 1FGKA 3B2WA 2C3IB 1XJDA 4C3RA 3ATTA 4O2ZA 4BYJA 1T46A 4FIFA 4FNXA 3ZUTA 4V05A 2XM9A 3R00A 2IZTA 5DGZA 5CEQA 3P5KA 4JBPA 4MNEB 5JZJA 3HUCA 4CFFA 3NYXA 4BDAA 2W1HA 5JFVA 3DK3A 5L8KA 5EDQA 5F4NA 1OPLA 3R8MA 1Q24A 2GNHA 2XM8A 4LUDA 4QMYA 4J1RA 4JG7A 4BJJA 3BQCA 4KNBA 3DS6A 3WF8A 4O7TA 5LOHA 4E6DA 2FSLX 4RJ5A 5HTBA 5DFPA 5HNGA 4FRFA 4LFIA 4RG0A 3LFBA 2J51A 4D58A 5KZIA 2O5KA 4OTIA 3R9DA 3JXWA 5IDPA 3NGAA 3ERKA 5DH3A 1U5RA 4L53A 2W1CA 5AMNA 3TN8A 3ZSGA 4QMQA 3KGAA 1YVJA 1YQJA 5AR3A 2JKMA 1Q8WA 3BV3A 5FWKK 3R9HA 5J9LA 3NFFB 3ORTA 4JQ7A 3U9CA 3E7VA 2WMXA 3ODYX 3L9NA 5DA3A 4C2WA 2BRNA 2G2IA 4KIOA 1Z5MA 3WZEA 4XRLA 4OAUC 2NNWB 3LMHA 4JQEA 3IW4A 4C3FA 4EOSA 3EQRA 4MF1A 4MNEA 3FHIA 3MVJA 5JEBA 5JK3A 3H0ZA 2XARA 4R5YA 4E5AX 3KF4A 4GYGA 2FSTX 3KA0A 4IM2A 3BL9A 3UQCA 5DBXA 3BYUA 5CNNA 2BAJA 2FSOX 3ZBXA 3ATSA 2FGIA 2BFXA 5DHJA 1VYZA 1KV2A 5CU3A 5BVOA 5TOZA 3KREA 4PTCA 4WT6A 4DDIA 3G5DA 3TUBA 2C1BA 2YZAA 3I7CA 4F9CA 3PVWA 3TZ8A 3NUUA 1H01A 5I3OA 2A2AA 3QKKA 2ITTA 4FG7A 4JQ8A 4MQ1A 3RM6A 4G6NA 4BR3A 3UDTA 5CU0A 1TFFA 5CALA 5IG1A 3D83A 3KU2A 4FMQA 4RVKA 2XNBA 4ZJJA 4X2KA 2HXLA 3SKCA 2JAMA 3BBWA 4JDHA 4YC8A 3GC8A 4F9AA 3O17A 1LPUA 1XWSA 4EQUA 2YM3A 2F7EE 3OY1A 3ZO4A 5M55A 4LRKA 1JSUA 3KMUA 4RC3A 4XLIA 5HG8A 3Q5ZA 4D28A 4MNFA 4FSRA 5FM2A 4CKJA 2X8EA 3WARA 1ZOHA 5AAFA 4LL5A 2XK9A 2OF4A 3TDVA 1H1WA 4DEBA 3NWWA 4O7VA 4IC8A 4FSYA 3R8UA 2C5NA 2OXDA 3QTZA 3RCJA 4YJNA 3Q9WA 3W55A 4EOMA 5A4QA 4ZTMA 4FYOA 5DVRA 4D2WA 4L3JA 3NNUA 3O23A 3R1SA 3VRYA 4C02A 1W8CA 4I4EA 5C1QB 3UO5A 4C0TA 4GU6A 3ZFXA 3FZ1A 4I23A 1SNXA 4HGTA 3OHTA 3U4UA 2J0KA 3FUPA 4ANNA 4MXXA 4DN5A 2C68A 4M84A 2JD5A 3UMXA 3WZDA 1YOMA 2WMBA 1H1RA 1PJKA 2OJ9A 4TNBA 4XEYA 5A4EA 4UWYA 2C3JA 4FTMA 2YA9A 4WIHA 5DPVA 2HIWA 5KZ0A 3CKWA 4ZS4A 4Z9LA 2Y6OA 3CIKA 3RZFA 3C4XA 5DE2A 4WNOA 4ANMA 3KXHA 4G3DA 4YTCA 4WO5A 2R3JA 4C38A 3RMFA 2UW0A 3F61A 4PPBA 4EHEA 3ORXA 2EXCX 2WKMA 3QWKA 4QMOA 1J7UA 3GENA 3E87A 4FGRA 2P2HA 5C01A 4W4YA 3W2OA 4F08A 3HVCA 5AP7A 1OB3A 2UZEA 2ZDUA 3ZDUA 2QOOA 3MFSA 4TTHB 3AKJA 4GK3A 2WAJA 4AT3A 4H58A 5CU6A 4QMXA 3ZO3A 2YJSA 4GCJA 3F5UA 4GSBA 4DA5A 4XV3A 3BPRA 3FQHA 2PZPA 4IDTA 3T3UA 3NW5A 5M07A 4QMSA 5E8ZA 2NPQA 2YM7A 3U4WA 1YXTA 3FPMA 2HZ0A 3FKLA 3FI2A 3I6WA 5A46A 5A6NA 5LWMA 3D0EA 3THBA 3F2AA 3W18A 3RBWA 4EBVA 4E7WA 1TZDA 5JKGA 4TYGA 3A7GA 4DH3A 4I6BA 2BDJA 3F66A 4ANOA 4ZTSA 4M0ZA 3QCYA 1Q99A 3CTHA 3AT4A 4OTWA 2GNJA 2HENA 3PXZA 2J2IB 3FLYA 3NS9A 3BV2A 3QBNA 5J7HA 3EQFA 1WVWA 4RIOA 5C27A 4FZ7A 3ACJA 3Q6UA 3RAIA 5AR4A 2X0PA 3FYKX 3OUKA 3QC4A 2BTSA 2ITYA 3A8XA 4F1TA 1WBSA 3G15A 2GQGA 3I60A 3R21A 4PWNA 4QTBA 2XIKA 5TR6A 4CD0A 2WEIA 2CKEA 2YITA 5CNOA 4E93A 4IX3A 4HCVA 5HLWA 2WMSA 2B54A 2C0OA 1F5QA 3QHRA 3E63A 5F95A 4EK8A 4ZLYA 2IW9A 3NUXA 3OOMA 1YWRA 3VN9A 2W99B 3ORIA 1PXNA 4JVGA 2YWVA 3TJDA 2WMVA 1ZOGA 3M2WA 3F82A 5D9HA 2GHLA 4W4XA 4QP1A 3LJ1A 3W10A 4GT4A 4E4NA 5A14A 4RIXB 4MQ2A 4GKHA 4ZY6A 3FC2A 5CWZA 1O6KA 3M1SA 4YPDA 5HG5A 3N51A 4G17A 4BI0A 4EH5A 2YLFA 3O50A 3AMBA 1ATPE 2PMOX 4LGDA 1OBGA 4FC0A 3Q4TA 3QRJA 2B53A 3PP1A 1Z57A 4I4FA 4RIWB 4XBUA 2BMCA 5EW8A 3CQWA 4FTRA 3ZFYA 3UOHA 3UBDA 4D1SA 4E20A 4M12A 2IZUA 3DJ5A 1RW8A 4ZY4A 2BZIB 5CI7A 2C6TA 2CN5A 5D7VA 5KMOA 4WA9A 4OTGA 4XJ0A 3KRWA 1H27A 5AA9A 3R8LA 3P78A 3HP2A 1DAYA 2PUUA 3E8CA 4QMPA 3ORMA 5F1ZA 4QP9A 3BCEA 3UYTA 3CD3A 4JDKA 4EH7A 1FGIA 3IW8A 1UKHA 2HZIA 3BLAA 2CKQA 5BUJA 1KWPA 3KY2A 3U87A 1UA2A 3W2RA 3AGMA 4U44A 1H00A 3DKFA 3DNEA 5HGIA 2WTDA 5IQCA 4WHZA 4AN9A 4RIXA 1R0EA 4TPTA 4MF0A 1Q4LA 4AE9A 3QQKA 4V01A 2VAGA 1H08A 3E62A 4XYFA 3WYYA 1URCA 4HPTE 5LVPA 4F09A 3HMPA 5BV3A 4UZDA 3KC3A 2QLQA 2SRCA 4O6EA 3EN9A 4BGHA 4RIWA 3KL8A 3MTFA 5EOLA 2VWUA 2Q0BA 1FMOE 3GFWA 3MYGA 1SMHA 4DGNA 4ZLZA 2Q83A 1P5EA 3C0IA 3G6GA 4G3GA 1JBPE 2WQBA 3DKGA 3UC3A 3NNWA 4YJQA 2FSMX 3IQ7A 3QQGA 4PMSA 1PMNA 2VTIA 5I9VA 3OC1A 2I0HA 3TIZA 4QTEA 3E3BX 5JH6A 4BFMA 4R8QA 2GQRA 3ZUVA 1Y6AA 2R3IA 2J6MA 4ID7A 2RFEA 4DBXA 4TWPA 3HMOA 3MFTA 3MPAA 3SD0A 3LW0A 3PXQA 4YJPA 5KKRC 4O7RA 3BWJA 5CZIA 2CCIA 3GC0A 1Q8YA 4E5BA 4AW1A 3BYMA 4BYIA 5C9CA 4JT3A 4RMZA 4DLIA 4F7NA 2IVSA 2UZUE 5BMMA 4RSSA 1OBDA 4K9YA 1H24A 3DDPA 3VS5A 3ZH8A 5EDPA 4ALUA 3FMMA 2BRMA 3OVVA 2O63A 4F63A 4TYHB 5CASA 5HTCA 1LR4A 1XBBA 5DRBA 1YOJA 1IASA 2WFYA 4DTAA 4FKOA 5BX0A 2CKOA 3QQJA 4O84A 2QO2A 4DFUA 3RVGA 3EN6A 3QRIA 4XNEA 4QQ5A 3LXKA 2C0TA 4IC7A 5EI8A 3OXIA 3O7LB 4ALVA 3LQ8A 3V51A 1ZMUA 3O51A 3MB6A 5ANGA 3RAWA 4CFUA 2JKOA 4QYYA 5I9XA 2GNLA 1MQBA 3VW6A 5JT2A 5KMNA 3UZRA 3PPKA 3OT3A 4GVAA 5EW3A 4AF3A 4I5PA 1A06A 1V0PA 1NVQA 2JBOA 3D94A 4A9UA 2XA4A 2OZOA 4UMRA 4EJ7A 3D5WA 4IM3A 4KBAA 2R3MA 1CTPE 4XG4A 3QGWA 4IJPA 3U6HA 4EK4A 3SDJA 4B4LA 2B9IA 3TNIA 2UZVA 4G3CA 4FVPA 2YLEA 1WAKA 1YDTE 2OH0E 4FV6A 4AOIA 4ZZOA 4NEUA 3SG9A 4EEVA 1WZYA 1XO2B 2E2BA 3BE2A 5HD4A 1PY5A 3GFEA 2OXXA 4PPAA 4TYHA 3V5WA 4EHVA 3Q9XA 4ASEA 2XIZA 3DCVA 4DFXE 3JS2A 3GQLA 2XB7A 4AG8A 5KHXA 2BVAA 3DBFA 4G16A 3RPYA 3ZDIA 4MXCA 5HE1A 4DFLA 2J0MB 5AUUA 3W0RA 1W83A 4EH6A 2HW7A 2BIYA 4ANSA 3ZLSA 2HXQA 3A7JA 1UU3A 3JR1A 2DUVA 4RX8A 4YHFA 5EDRA 2EUFB 3TL8A 4Q5HA 3F3WA 2ZMCA 4FODA 5CEOA 2YISA 4QP4A 1PXMA 3MN3A 4HZRA 4ITHA 1PXPA 4FJVA 4I6HA 3VONA 1KSWA 4BCIA 2QO7A 2IO6A 3GU6A 3M42A 5TO8A 1OIYA 2ZV9A 2XNEA 1J1BA 4MXAA 1U5QA 2GS7A 2GCDA 4EH8A 5F94A 3VJNA 5ANEA 2BZHB 2YIYA 1Q62A 2WMQA 3NW7A 3IW6A 3R83A 1ZMWA 2YZLA 3Q53A 5HI2A 3TNWA 4PL5A 5AP1A 4CMTA 2WIPA 4PDPA 3R30A 3A61A 4U43A 5EHYA 5HCZA 5AUVA 3VIDA 4ZJVA 1B39A 5J7BA 4RWIA 3WZUA 4BL1A 4N0SA 2ITOA 3FQSA 4D5HA 2C6MA 4EI4A 2I6LA 4H39A 5BYLA 3DK6A 2W1IA 4IAAA 3VHKA 3UPZA 2PYWA 3R7GA 3ZSIA 3RM7A 2Y4IB 3OOGA 1PXLA 4GFMA 4KBKA 3OEFX 2XS0A 2X2LA 2J9MA 3R8PA 4UYNA 4DH7A 4NIFB 3LLAA 2X1NA 4O4BB 3CS9A 5JMSA 4EONA 4J96A 4FIEA 4BCKA 2PVJA 2ERZE 3LLTA 4EUUA 3PDTA 3QF9A 2BKZA 4I93A 4DHZA 4ONAA 4U45A 3A7IA 3C0HA 2JFLA 4KKHA 1YHVA 3ZRKA 3OWJA 2XMYA 4YZBA 3MW1A 3VBWA 3GB2A 3HRFA 3SV0A 4KSQA 4JDIA 5IUIA 3VRZA 4XG8A 3D2KA 4D2PA 2F9GA 4EK5A 3S95A 1GIIA 5H8EA 5IEVA 2I0VA 1ZAOA 2UZBA 3NLBA 4LMUA 4AW0A 2JLDA 4I6FA 3KN5A 4XOYA 3UNJA 4NCTA 2ZV7A 3CY3A 3PLAE 2P0CA 4CFWA 4YJTA 4AQCA 5IQGA 4XBRA 3MA3A 4CEGA 2UW9A 4XP0A 3TEIA 4ASDA 3QZHA 5DT3A 1PRYA 4QP3A 3DXNA 2F57A 2GPHA 2XNMA 1WBVA 3MIAA 4O1OA 4RBLA 4TZRA 1Q3WA 4OR5A 5HCYA 3QUPA 4NIFA 4D55A 4WUNA 4OAVB 4U42A 3W2QA 3DZQA 4R3CA 2A19B 3DPKA 3OS3A 2W1GA 4IEBA 4BHNA 3VS1A 4C8BA 3OTVA 1XR1A 3RINA 5JFSA 2PVFA 5EYKA 2UVYA 3SG8A 4H36A 4TN6A 3EKNA 4FV3A 3ZM9A 3LFNA 3DBEA 4R7IA 3R6XA 4ACCA 5GJDA 3TDWA 4RJ3A 5J9YA 3VS2A 5IU2A 3WZJA 3MI9A 4RLLA 5EI2A 1M17A 1QPDA 1PMEA 4GFOA 3EQGA 4JBOA 3ZLXA 4BDHA 3GI3A 2P4IA 4GV1A 5BVNA 2IG7A 2VD5A 3BLRA 2Y4PA 3I0OA 2FO0A 3UP7A 4QMNA 2I40A 4RX7A 4FTOA 3Q9YA 4X6QC 2G2FA 2VTNA 3PUPA 4U40A 4Y83A 4UMTA 4X7QA 5A4LA 2X9EA 2IEWA 3EYHA 5HICA 2CKPA 4IVCA 3VBXA 3TUDA 5HIEA 4FKRA 3R7OA 4DGLC 4X3FC 2Z7QA 4FKGA 4FZFB 4XV1A 1ZLTA 1KE8A 3QXOA 4UB7A 4H05A 4RZVA 2VX1A 3W16A 2KTYA 1GZOA 2YCRA 3COKA 5M08A 1JKKA 2RG6A 4RA5A 4BCFA 4BCJA 3RPOA 3KRRA 2WQEA 1NW1A 4OTDA 4J8NA 3ODZX 4P5QA 4GU9A 4UBAA 4WBOA 5FBNC 2VO6A 2I0EA 4ZXTA 5FXSA 2QHNA 3PE2A 5CENA 2OBJA 4HW7A 3PFYA 4DYMA 2E9PA 4IQ6A 1JVPP 3UG1A 4IFGA 3NEWA 3K5VA 2YACA 4FKJA 4A06A 3Q9ZA 4RJ6A 2IVUA 3NAYA 4CRSA 2W9ZB 2AC3A 4FV7A 4G3FA 3UE4A 4BCQA 4EH4A 2HCKA 1FPUA 2XEYA 1ZZLA 4C4IA 4FKTA 3PLSA 2JIIA 4AAYA 5AUTA 3GOPA 1G8AA 3SVVA 1MRYA 2W4OA 4BRXA 3TNQB 2DS1A 4IHPA 3TJCA 3DAJA 4WKQA 2V62A 5B7VA 3JVRA 1WFCA 1P4OA 4DH5A 1JWHA 2BZJA 3EWHA 3P79A 3QGYA 4OTRA 3V3VA 4AT5A 4QDVA 3I6UA 2WQOA 3KK9A 4M66A 4AGUA 5ICPA 3OG7A 3P7BA 5IEXA 3S2PA 3QRTA 3ROCA 2OI4X 4G5PA 4BDBA 3LMIA 3UTOA 4YGAA 3CJFA 4C58A 4DH1A 1CKJA 4UXLA 4QEBA 4DEGA 1UV5A 2B0QA 4PX6A 1R0PA 3P9JA 2UW6A 3UDBA 4C3PA 2ETMA 2OG8A 4FIGA 4EK3A 1RJBA 4F64A 4HVSA 4DGMA 4M67A 2JKKA 3RPVA 1W2FA 4W4WA 1IEPA 4QT1A 4Z7GA 4YURA 4ITJA