4YNEA

(r)-2-phenylpyrrolidine substitute imidazopyridazines: a new class of potent and selective pan-trk inhibitors
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
297
structure length
281
Chain Sequence
b'GSGIRVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPDKMLVAVKALKERQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSTDYYRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords High affinity nerve growth factor receptor
publication title (R)-2-Phenylpyrrolidine Substituted Imidazopyridazines: A New Class of Potent and Selective Pan-TRK Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 281
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yneA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yneA01
4J7BA 2ZB1A 3WZJA 4ARKA 3GU8A 1FVTA 3RM7A 4RFMA 3LIJA 4NUSA 3ZSGA 4PNKA 3DTCA 5J9LA 3MV5A 1XO2B 2IVSA 2XNGA 3HAMA 5DFPA 3F2AA 4O1PA 3C13A 5E90A 1W82A 5HI2A 4FV5A 3DB8A 1ZMWA 3Q5ZA 1OZ1A 2Z7SA 3ULZA 5L2IA 2OU7A 3EZRA 4WNKA 4X3FB 3ZU7A 4CGAA 5ANOA 4R7HA 4QMQA 5AP2A 3P08A 3DU8A 4L46A 3FXZA 3FI8A 2W06A 1ZYLA 2XNOA 3ZXZA 4U42A 3O2MA 1P4OA 4CMOA 3KL8A 1IAJA 3HMMA 4LRJA 1F5QA 1O9UA 3CTJA 4I5PA 1OMWA 4Q9ZA 4NJ3A 3D7TA 4PDSA 1TQMA 4X3JA 3AMBA 3FZSA 4IWDA 1M2RA 2YM5A 3EN7A 5J5SA 1CKIA 3TI1A 2PUPA 1H0WA 1RDQE 2IZTA 2OZAA 3CD8A 5AX9A 5L6PA 2C6LA 3D5XA 3OHTA 4ONAA 4QYFA 1NXKA 5I9ZA 2Z02A 5DHJA 1XBBA 1P4FA 1WBVA 5BPYA 5M09A 3PA5A 1YI4A 3FSFA 1UA2A 3MY0A 4GYIA 4RZVA 4EH9A 5IF1A 4RVKA 2X2KA 5C03A 4WKQA 3RNYA 4CFNA 3QTXA 4FKPA 1KE6A 1XH9A 5CZHA 3N4UA 3BBWA 2ZM3A 3VHKA 3TJCA 3VBTA 5IPJA 1YXTA 2XEYA 3ODYX 4UEUA 4ANSA 5EFQA 2XM9A 4LOQA 3JR1A 3A4OX 1MUOA 4HGSA 4GK4A 5HCXA 5EOBA 3ZBXA 4KWPA 2IZUA 3QCQA 4FSWA 4HCVA 4M69B 4AGDA 4DINA 5JGBA 3T9TA 4FMQA 3F3TA 4E4XA 2HZNA 5ANKA 4O7WA 3I6WA 4I22A 2UZUE 1AQ1A 3R8PA 2WMVA 1H26A 2EU9A 3KMUA 5AX3A 3V8WA 5AP3A 3GCPA 3H9OA 2VTMA 3EFKA 3CKWA 2YACA 3QC9A 4JX7A 3HMPA 3C1XA 4AGUA 2O5KA 5BMSA 1H27A 3PXZA 4ZIMA 4A9RA 5IDNA 4TXCA 3QD2B 3FMJA 3IOKA 4JJRA 3C4XA 3Q32A 2HW6A 2J4ZA 4FTAA 5DT0A 4YJRA 2CHLA 4USEA 4ORKA 4HVHA 2VTPA 5E8XA 2J6MA 2Q0BA 4D2PA 4MQ1A 2XEZA 5E8SA 4S31A 5GHVA 4DGOA 3FLQA 2A0CX 3I79A 4FKVA 4P5ZA 3PVGA 3QD4A 4F0GA 5J7BA 5FXQA 1KWPA 3BWJA 2RFDA 3QUDA 3HV7A 4AG8A 1XH4A 3QCXA 4LGDA 3KB7A 4FTTA 4J96A 5ETAA 4MEDA 4EH6A 2OJGA 4GU9A 2VZ6A 3NGAA 3V01A 1JLUE 2VO3A 4FZDB 3RTPA 5EKOA 4O0TA 3ZC6A 2I0YA 3NUYA 5HE0A 2PE0A 3A8WA 2JKQA 4RJ3A 2I0HA 1B6CB 2PHKA 4OTGA 3NWWA 5IZFA 4YC3A 1FMOE 1MRYA 4AE6A 1J91A 3C4EA 2PUIA 2DS1A 2YIRA 3GU7A 3QKMA 2WZJA 3FL4A 3R21A 4AN3A 2QG5A 5FDPA 1H00A 3DJ7A 3AQVA 3PY1A 5GZ9A 5HX6A 3OCSA 3FKNA 4F08A 1OL5A 2BDWA 3FZPA 2NNWB 5DLSA 4ANBA 4C4HA 5FXSA 2XKDA 3CQUA 4JRVA 4Y5HA 5C4LA 4BWXA 4V05A 4ZZMA 4RIXB 2ZOQA 5DNRA 4JI9A 3FQSA 2WTVA 4KIQA 1EH4A 4IAYA 2C1BA 4IVDA 4K0YA 4NSTA 3VS3A 5AWMA 2R5TA 2VTRA 3QTRA 5AR3A 3AC3A 4HPTE 4BKYA 3ATTA 2NRYA 2E2BA 1T46A 2WMRA 3U4UA 2XCHA 5LMAA 3U4WA 2ITVA 1YHVA 2YCQA 3ZYAA 5IUHA 3ORMA 1Z57A 4U44A 4ERWA 1OIUA 4JDIA 4D2WA 4F9YA 3I0QA 4M14A 1H1QA 2PVLA 3F3UA 3VS2A 4EHVA 3ZM9A 1GY3A 4WSYA 4FTCA 2WU6A 4CZYB 1R3CA 4E26A 4BCHA 4CG9A 4BIDA 3EJ1A 4NM0A 5CU0A 2OG8A 3FC1X 2JAVA 4W4XA 3ODZX 5IQBA 5HNGA 4EOJA 3F3WA 5CAPA 3E88A 2JKOA 4G3CA 2X7GA 2Z7RA 4FTNA 5IH4A 1Q3WA 2HZ4A 2VTQA 3ZHPC 4FOCA 3NNVA 2XK9A 4RT7A 4EOOA 1LEWA 3R02A 2F57A 4X2KA 3R63A 4XRLA 1QPJA 4FSUA 4IH8A 4L3LA 3WBLA 3A4PA 2OZAB 4E73A 3HV3A 2I40A 2XVDA 4LI5A 3FMNA 3FYKX 3O8UA 3D5VA 4RWLA 4X6RA 3UE4A 4D9TA 3BRBA 2W1DA 3PPZA 4ASZA 2R0UA 2R7BA 3PRIA 5C8NA 5CAOA 4AS0A 5KMMA 2VGPA 5F20A 2BILB 4BI1A 3W33A 4RFZA 4UMTA 1OKZA 4GIHA 3GC7A 5EI8A 5HD4A 3UODA 3TDWA 1YDTE 3Q04A 4ZJIA 3QKLA 1UVRA 3NX8A 5KMJA 3CTQA 2J5EA 3JYAA 4GFMA 5FLFA 2QR7A 4C36A 3R2YA 4DF3A 3BYSA 2J0KA 4RIYB 5CENA 1F3MC 2YIXA 3H9RA 3ATSA 4FL2A 1YXXA 2X4FA 3QTUA 3VUIA 4N57A 4NFNA 3RJCA 1WAKA 3IS5A 5EI2A 4TY1A 4C4EA 4KIKA 4RMZA 2XKEA 3P5KA 5BVWA 2BRBA 5HE2A 3LXLA 3R22A 5CU2A 5KMOA 2Y4IB 3BPRA 2W7XA 4P4CA 4MBLA 2OH0E 4L7FA 4BKZA 2VTSA 5HIDA 3CY2A 5EQYA 3OD6X 4BIEA 4D5KA 3PY0A 4I5HA 2UZOA 3EFLA 3TL8A 4I41A 4RZWA 3UO4A 3QU0A 3CEKA 2UUEA 1Q8UA 2PE1A 1Q8WA 3C7QA 3IG7A 4EK6A 3TZ9A 3I4BA 5KHWA 5BUEA 3ZLYA 2R3KA 3PY3A 2ZV2A 3CQEA 4PL5A 4PV0A 4JBVA 3LQ8A 2R3QA 4QRCA 2HK5A 3SAYA 5IA2A 3GI3A 2R3LA 3QL8A 4C58A 1Y8YA 4F1TA 5GIPE 4FSQA 5DEYA 3Q5IA 5JZJA 3OWLA 4GUBA 1GIIA 3AD5A 4WHZA 4RG0A 3MIAA 3FE3A 4L9IA 4F6SA 5M55A 2C47A 4YGAA 2IG7A 3PXQA 3GOPA 2XKCA 5HU9A 3GU6A 2RFEA 4XG3A 5K5NA 2R4BA 4ZJVA 3HP2A 3OP5A 3UIUA 3VULA 4L6QA 4BR3A 2ITTA 2GS2A 4I6HA 1Q61A 4XOZA 3UZRA 5IQDA 2GNHA 4JR3A 2IN6A 3BHTA 4UYAA 4ACGA 4CQGA 3HA8A 1H8FA 2WTCA 4RX7A 4UV0A 3OS3A 3KMMA 3CXWA 5AP1A 1W8CA 5CX9A 5CAQA 4WRSA 3BKBA 3F7ZA 2JDSA 3FYJX 4JXFA 3BGZA 3PE2A 4N0SA 4ALVA 2YLFA 1QPDA 4FEWA 3TNHA 1I44A 2ZM4A 3H10A 3C5UA 3IK3A 5E1EA 4EH7A 1M52A 4FSRA 4JS8A 5L2TA 4F9WA 4FX3A 4Q2AA 2GS6A 4O22A 5LARA 4EKLA 3MFRA 4QMSA 4UY9A 3BQRA 4FIJA 4IXPA 2QCSA 4IM2A 4V0GB 2WQBA 5FXRA 2BTSA 3WYYA 2BHHA 2JBPA 3R7GA 4Z7GA 3HRBA 3G0FA 4N70A 5I5ZA 2PSQA 4G3GA 5J79A 2WTKC 1WBWA 4ZSEA 3U87A 4ASDA 4C57A 4DH7A 3MVHA 4U43A 4ZP5A 4BTMA 4C2VA 2XB7A 2Y8OA 3OT3A 5F94A 2BFXA 3DAJA 4O7SA 2PL0A 4LUDA 3M2WA 3QQHA 4IHPA 5BVEA 3C50A 4PPCA 1KV2A 3GVUA 5EYKA 1ND4A 2JFMA 1Q97A 2CCIA 3LCSA 2NO3A 4NCTC 5K4IA 3LFFA 4O96A 3OCBA 4BCPA 1VJYA 3S95A 1REKA 1PJKA 1ZZLA 4QMNA 4ZS4A 3QRUA 4RPVA 3ZTXA 5M07A 3IPHA 2VU3A 3NNWA 4Y8DA 3PG1A 4LG4A 3BYVA 4E6AA 3PJ2A 3LFEA 3EHAA 5E8YA 5HKMA 4EH5A 3DXNA 3OXTA 4U79A 1UWJA 1FGKA 4DG3E 1JVPP 2Z7LA 3VUTA 3FZ1A 4FTQA 5TE0A 2FSTX 1SZMA 5B2LA 1WMKA 3OWKA 1PXJA 2LAVA 1SVHA 3WE8A 5D11A 2WU7A 1PW2A 2Y9QA 3REPA 4DGNA 2CN5A 2GS7A 3A7HA 4MXXA 1WVWA 2CMWA 4MNEA 2GMXA 5CSHA 3W1FA 4AW2A 4PY1A 4O0VA 4H05A 2AC3A 3WOWA 1K2PA 4FTRA 3FPMA 4L42A 3I6UA 3K54A 3MPMA 4F65A 5IMEA 3Q4TA 4WT6A 3PXRA 3G9LX 4L45A 3COMA 4FT9A 1FVRA 1YDRE 2YM6A 1CTPE 3F3ZA 3HA6A 4QNYA 4ZLOA 4RVTA 3VS0A 3F82A 5H9BA 3OY3A 5EW3A 3VAPA 3I7CA 5GJFA 3RAKA 2X8IA 4YTIA 2PVKA 5BMMA 2P3GX 3UZPA 4KUJA 4FKUA 5E91A 3DOGA 3EH9A 4O82A 3HUBA 3TUCA 4KKEA 3V3VA 3Q6UA 2W1ZA 4FKJA 4KIKB 4W4YA 3RK7A 2F2UA 3RMFA 1QL6A 3FUPA 4FG9A 1WVXA 3F3VA 3JY0A 3OW3A 5CWZA 1E9HA 3MH2A 5JSMA 4A9TA 2A4LA 5J9YA 4NK9A 2GFSA 4ZSJA 3UG2A 4DEAA 3Q9XA 1HCKA 3FKLA 3LFCA 4DBXA 3QZGA 2JLDA 4YTCA 2WGJA 3HEGA 5T3QA 3BWFA 4OTQA 5EM5A 3II5A 5BYYA 2QLUA 2WOTA 2Z60A 4R7BA 2I6LA 2XK6A 3PLSA 3LCOA 1GZ8A 3LJ2A 2VTHA 3PIZA 3R04A 4P90A 1P5EA 3ELJA 1UWHA 2GNGA 4NCTA 5CI6A 5H8EA 4QTEA 5LMBA 5IQCA 3QZFA 4KSPA 4FT0A 4MK0A 4MNFA 4X2NA 4ZOGA 4B6LA 2OK1A 3HDMA 3ACKA 3UMXA 1M17A 2EUFB 1H01A 2WEIA 3AT2A 4ZEGA 5CANA 3OF0A 2CKQA 4G3FA 3ZH8A 3K2LA 5AA8A 2VUWA 3C4CA 4GT4A 3R6XA 4R3CA 3WZEA 4AZWA 4C3PA 4C62A 4YHFA 4ZLYA 5IH5A 1UKIA 5AP6A 3DJ6A 5TO8A 3VBVA 3MH1A 3MB6A 4J8NA 2G2HA 2R3JA 4BHNA 4EOIA 3V5JA 4FA2A 4QTBA 3UYTA 4E6QA 2VTLA 1YHWA 4DT9A 4M84A 2G2FA 4HPUE 3C51A 4RJ6A 4E6DA 3QUEA 4H3PA 3WF8A 4DFUA 2PY3A 3BLRA 4A9UA 4X21A 4ZMEA 1KE7A 3FSKA 3KRRA 2YEXA 3FXXA 5EOLA 2QNJA 5F1ZA 4AN2A 5KMKA 5BYLA 3MI9A 1OGUA 3E62A 1SMHA 2VWIA 3VS1A 4USDA 2PPQA 4IB0A 3D0EA 3O50A 4PF4A 3CLYA 4M15A 3RHKA 1CDKA 2QU5A 4QP8A 5DPVA 5GZ8A 1VYWA 3MGYA 3P7CA 4PWNA 4O7ZA 4WD5A 1GNGA 2UW7A 3IECA 4DTKA 5EDQA 5IEVA 2R0IA 3TV6A 3KXXA 4BZDA 5I3OA 3NSZA 2Z7QA 3LOKA 4JDHA 4PP7A 4O7NA 1UNLA 5IG1A 3KVXA 3QFVA 4XBRA 3W2PA 3KF4A 4F99A 3EKKA 3BU3A 4U3ZA 1ATPE 2X2LA 3NAYA 4JR7A 2X7FA 1VYZA 4NH1A 2QHNA 4PTGA 3E87A 5CY3A 4BDCA 3DAKA 5DMZA 4E4LA 4QYEA 3U9NA 1UNHA 3NVMB 3L9PA 2O64A 2V22A 3BLQA 4MYGA 2VTTA 2VX1A 2VO7A 4B9DA 1MRVA 2OF2A 4CZUA 2RG5A 4ZZNA 5EM7A 4PMPA 1YWRA 2XK3A 5BVKA 1ZRZA 5KMIA 2XRUA 3NDMA 4BL1A 4YURA 4DFBA 1PXMA 4ITIA 3UO6A 4I3ZA 5EHOA 1YXVA 3ALNA 4C7TA 1O6YA 4O83A 4FG8A 2CNVA 2JEDA 4IM3A 4KINA 2XJ2A 3M11A 3CP9A 1J7LA 3FBVA 4LOPA 4OGRA 3A99A 4LQMA 5I9YA 4IJ9A 2UZEA 2WMSA 5FGKA 2ITNA 2OJJA 1OL1A 4Q5EA 2XNMA 3GUBA 1H1PA 1ZYCA 1STCE 4FSNA 3QLFA 4MNEB 2X0GA 5CI7A 3SV0A 2VX0A 1CMKE 4HVSA 5CF8A 2FB8A 4O0WA 3ZRMA 4G6LA 4FIGA 3VNTA 4EL9A 3IW6A 4L68A 3HAVA 1OB3A 4KAOA 3BZ3A 3GT8A 5AP5A 2PYWA 3RPSA 3U6JA 4JBOA 1UKHA 3R8MA 5HTIA 1DM2A 1LR4A 1KV1A 4BCMA 3ENHA 4ITHA 4UWBA 2WTWA 2WMUA 3LM5A 4YJUA 1CKPA 4QPAA 2CGXA 3ZFMA 2J90A 2ZB0A 3A7GA 4ACDA 4ZY4A 3SX9A 4JDJA 4CFFA 3UNKA 3NVKI 4N4SA 4YSMA 4U9AA 3R83A 1TKIA 2QLQA 2A27A 5HD7A 3RCJA 4IANA 3Q6WA 2DYLA 3EZVA 3FI4A 4KBAA 5GIOE 1URWA 2RFNA 2B9JA 3CY3A 3QRTA 5DGZA 4C38A 4EH2A 2WTKB 3SLSA 5JFSA 3UIBA 3V51A 3L9NA 3PIYA 4I1ZA 4RBLA 5C9CA 2C6MA 1H1SA 5CTPA 3QRKA 4E5WA 3KXGA 4CCUA 4JRNA 4C61A 4FEVA 2IVTA 2XK7A 2PZPA 4BB4A 4N6ZA 2Q83A 2BDFA 3KK9A 3RK5A 4FL1A 5EQEA 2PVFA 5DT4A 5M57A 5JMSA 4YBJA 3L9MA 3QA0A 4AOTA 2HYYA 3ZLXA 4DH1A 2YM3A 1DAWA 5CSVA 3TKIA 4D58A 4ZSLA 4M0YA 4AOIA 2YN8A 2BRHA 3KGAA 5D10A 3D9VA 2QOCA 2R9SA 3P7BA 3PSCA 5FQDC 3UC3A 5FTQA 4DTBA 3GQLA 3QCSA 3O0GA 4IC7A 1JQHA 2ZAZA 5KO1A 3DTWA 2O0UA 4AZFA 2GQSA 4OLIA 3KN5A 3CTHA 5C01A 3TZMA 4ALWA 4BDFA 2QKWB 3F5PA 4RFYA 3LKMA 5EG3A 2W4OA 5ACKA 4HVDA 2UZVA 4O0SA 5K4JA 4HYUA 3NEWA 5CVFA 5AMNA 2E9UA 2C6EA 2IVUA 4MTAA 3U54A 3PP0A 4FV6A 5CF6A 4LGGA 4GT5A 4FV0A 4WRGA 4IZAA 4K77A 2ETKA 5HVJA 4X2JA 5IEYA 2PULA 2P0CA 3W8QA 4FV7A 5HCZA 5KCVA 1OIRA 1PMNA 3EIDA 4JDKA 2C6TA 3AOXA 5EQPA 2JDVA 2W96B 3KK8A 4GH2A 3W2RA 5AFVA 3D2KA 4PTEA 4NTTA 4FKOA 4YSJA 2O3PA 3QRJA 3L8XA 4JAJA 4AZVA 4MXZA 4UN0C 2F7EE 2Y6MA 1YXSA 5CAVA 4EWHA 4J52A 4AZSA 3RPOA 3MN3A 4EZ3A 3QUPA 4BDJA 3ULIA 3NUAA 4C8BA 3EQGA 1JKKA 2ZV8A 4G34A 4IVCA 4YC6A 4C4IA 3ET7A 5EH0A 5AUTA 3N9XA 5IH6A 3Q3BA 3LFBA 5L8JA 4M0ZA 4PRJA 2VNWA 3KEXA 4NIFB 4X0MA 3T8OA 4EHGA 5H8BA 1KSWA 2IWIA 2UZTA 2PMLX 4HW7A 5DVRA 1GIHA 3Q53A 4FTKA 4KABA 2O8YA 5CAUA 1FINA 3LHJA 3SXFA 3OOGA 4GEOA 4YNEA 4Z7HA 4QP3A 4S34A 4GVAA 5AUWA 3P78A 2BVAA 1OUKA 5KKRC 3TKHA 3PSDA 5AADA 2CGWA 3IW5A 3EFWA 3P7AA 3TWJA 2CGVA 3MS9A 4H1MA 4A07A 4YO4A 5IU2A 1SNXA 4XLVA 2F7XE 1PMUA 5CU6A 4EQMA 5EM6A 3DAEA 5FRIA 4LMUA 3HVCA 3MSSA 1OECA 4I6QA 4CT1A 2BMCA 5ICPA 2WKMA 1VR2A 4E5AX 3VUDA 4QYHA 3LLAA 4M97A 4YJQA 4CTCA 5CEQA 1PXNA 3OBGA 1P14A 2VO6A 3PVBA 4EOMA 5I9VA 3S3IA 3HUCA 4CEGA 2C30A 4EK8A 4QQJA 3GU5A 4IB5A 4RIYA 4S33A 2XNPA 5CXZA 3FL5A 1Z9XA 3E3BX 4GFGA 4TRLA 3OOMA 4FIHA 4MKCA 2XNNA 4CFUA 3LAUA 3GCUA 5FP6A 4FZFB 3V8TA 4I92A 5FEEA 2WMTA 5FD2A 5L8KA 5HCYA 1XHAA 2UZBA 4Y5QA 4IFCA 4HYIA 4RLLA 1Q8ZA 3ZRLA 3NUNA 2E9NA 4DITA 4CKRA 3W8LA 3OEFX 4QMWA 2BALA 4G16A 4QP2A 5LVLA 2JDRA 2J51A 2XMYA 4ZTRA 4BDHA 3EQBA 4WUNA 1DS5A 5EYMA 4ZS0A 1M2PA 3NIZA 3WZUA 4FTLA 4IFGA 4QQTA 2UZWE 4F09A 4CKJA 1ZY4A 3ZLSA 3OUKA 3C0GA 4FVQA 3OY1A 3PPJA 4CMTA 5D7VA 3VO3A 3GU4A 3MDYA 3Q96A 4TYHB 5CALA 2NP8A 3TZ8A 2F49A 3QX4A 4LUEA 4HCUA 5T6KA 1IEPA 3VUKA 2CNQA 4O1OA 3UBDA 4HZSA 1Q4LA 4H58A 3F9NA 4U80A 3CS9A 4OTIA 4QD6A 5ITAA 3VUHA 3FI2A 5DT3A 3WIKA 1OPKA 3UPXA 1K3AA 3MVLA 3W2CA 3HYHA 4IWOA 1XH6A 5HIBA 4USFA 1L3RE 3GFEA 5AA9A 4K33A 5AP0A 3BHYA 2I1MA 3ORXA 3Q4ZA 5FP5A 3RBWA 3UQGA 5HTCA 2UW3A 2X6DA 3FI3A 4ZTLA 2H34A 4NW5A 2W1IA 2PVMA 4FE2A 3Q2JA 3R1SA 3MA3A 3Q52A 2RGPA 2WAJA 4IM0A 3MW1A 5EDRA 3U6IA 5HICA 4FYOA 4RX9A 3QGYA 2WFYA 4YJPA 3TM0A 5HTBA 5F95A 4AOJA 2QOOA 2J9MA 3F61A 4TWNA 4WBBB 2W1CA 5HOAA 2J2IB 3UOHA 3ZBFA 4JG6A 4RLKA 3FAAA 4N6YA 3OFMA 1FMKA 3KRXA 4F6WA 4AE9A 3SA0A 1IA8A 4MXCA 4YZNA 2ZV9A 2Z8CA 4UYNA 4R1VA 4MXAA 3V5WA 2GTNA 4V0GA 1W0XC 3HV5A 4RC4A 2J0MB 2JD5A 1ZYSA 5DWRA 4YPSA 5BVDA 5JK3A 4QT1A 4O27B 4E8AA 4CLIA 1Q8YA 4WG4A 2UW5A 4RJ4A 3OTUA 3MTFA 3B2TA 4AW0A 4Y46A 3AC8A 4ZSGA 2UW8A 4C2WA 4AA5A 4A4XA 4F7LA 1KE8A 2GHMA 2VD5A 3A61A 1DI8A 2OXDA 3HRFA 3WF7A 5E8VA 2CKEA 4FYNA 4XG6A 4OAVB 4I93A 2VAGA 2IJMA 4TL0A 4XG8A 2C4GA 4QTAA 4FEXA 4AZTA 3AC4A 4AT4A 3AMYA 5TOZA 4F7NA 4KKHA 4BDEA 5AV2A 1JPAA 1UU8A 4IZ5A 1A06A 3NPCA 4QQ5A 3QF9A 4AGWA 4CMUA 2RF9A 5FM3A 2P55A 1RJBA 3KKVA 4C37A 3GEQA 3C9WA 2JC6A 3TIZA 3G51A 4YZCA 4X2FA 2JGZA 2RL5A 2C69A 3I60A 2R3MA 5J1VA 1HOWA 2JDOA 3JXWA 3DS6A 2W05A 4HZRA 2C3IB 4R5YA 3VBWA 5C26A 4O0XA 5DR6A 3DBCA 5BX0A 3WF9A 3ZSIA 4XP3A 3I0OA 4GJ3A 4MF1A 4XYFA 3FPQA 3CKXA 4I23A 3OMVA 5DI1A 3IW8A 4WA9A 3EYHA 4ZTMA 4JBQA 3PG3A 2B0QA 1Q5KA 3DBDA 3H3CA 3V5LA 3VRZA 5I9WA 4WNMA 3RAHA 4IADA 3BE9A 1NA7A 2AUHA 4TW9A 2QOQA 2IW6A 2CGUA 4G9RA 1PF8A 4TTHB 5A4CA 3BX5A 3LMGA 3EN6A 3QQFA 4I6FA 2Y7JA 4WG3A 4CRSA 3NYXA 2XZSA 3ZEPA 3LXNA 4FF8A 3D15A 2IZRA 4FICA 4F0IA 1UV5A 4XP2A 5G6VA 1GIJA 3OEZA 4WG5A 3QQJA 4FV3A 3R8LA 3VF9A 4EUUA 1H08A 4WNPA 2OJ9A 4FEQA 3S4QA 1WVYA 2QO7A 1ZYJA 5IA5A 1W84A 4FNYA 1OBDA 4HNIA 2QR8A 2XYUA 3DQXA 3O96A 5DG5A 3W2QA 1IG1A 3GCQA 3BU5A 4BCGA 2UW0A 4RQVA 1G5SA 2BZIB 4IZ7A 2UW6A 3MTLA 5EYDA 5L2QA 5CU4A 2BKKA 3HL7A 1R1WA 3FLSA 3R9DA 3UNJA 4FGRA 4R77A 4XJ0A 3ZSHA 5AR2A 3GENA 4YBKA 3TCPA 4HVGA 4E1ZA 3SG9A 2UW9A 3CE3A 2ZYBA 4BBEA 5AIRA 4MQ2A 4WSQA 3IGGA 3UGCA 2W4KA 2WTDA 2XF0A 3B8QA 3OWPA 5ACBC 4EH8A 4OUCA 1BUHA 3U9CA 3OCTA 1BL7A 3R73A 2CDZA 1BLXA 4RQKA 3DGKA 4QP7A 3Q9ZA 2OJIA 3BEGA 4NKAA 5L6OA 3MPAA 4MH7A 5IUIA 3D2IA 2QI8A 3BBTB 4O7YA 3Q9WA 3LLTA 3WF5A 5AM6A 2PZIA 2W1FA 4NEUA 2UW4A 3UIXA 5A4LA 4BZOA 5LVPA 4ANQA 2QOBA 4GG7A 5T68A 2I0EA 1BYGA 2WQNA 3DZOA 3QQUA 4XEYA 5K3YA 4KBCA 5IA1A 3F66A 3KC3A 5HO7A 3KXMA 4FVPA 2W5AA 1IAHA 5K0KA 4RVLA 3NW7A 4XNEA 4PMSA 4FI1A 4U0IA 3R7UA 4FZAB 3SDJA 4CQEA 2O63A 4AA0A 5EW9A 3DBFA 3KCKA 4R3RA 3LZBA 2W0JA 5LMKC 2J0JA 4KBKA 5JQ5A 2O65A 3RI1A 3UC4A 3FY0A 4A9SA 3EWHA 2F2CB 2YM7A 2QG7A 3G90X 1OL7A 3BHHA 4Y95A 5AJQA 1OM1A 3EMGA 4IX3A 3GCSA 5IDPA 2V7AA 3QXPA 4JNWA 2P2IA 4RRVA 3RGFA 2B54A 4NW6A 2IPXA 3RM6A 3M1SA 4LL0A 4TPTA 2F4JA 3DDPA 3RZFA 3KRWA 4TWPA 3KVWA 4GT3A 3TNQB 3V6SA 3V5PA 4KKGA 3ORKA 3GC9A 5I0BA 2CLXA 4M12A 2WXVA 2UVXA 4GL9A 4GSBA 4YZBA 2FVDA 3KULA 4O0RA 3HZTA 4BDDA 3PDTA 4DCEA 5E8UA 3A7FA 3NIEA 4J95A 4W9XA 5CQUA 4BWKA 2YAAA 3DBEA 4TZRA 4AN9A 1PYXA 4BIBA 3FWQA 1UU7A 3QTWA 4YU2A 3AC2A 2QOKA 3FXWA 3IDCA 2R3OA 5HG7A 3QRIA 3WI6A 3PJ3A 2BKZA 3FV8A 3QHRA 5LWNA 4U5JA 4Y72A 4OTWA 3LM0A 3R71A 2WHBA 1SNUA 4AFEA 3IOPA 1X8BA 4NTSA 4AW1A 5IA3A 4BYJA 2QC6A 1QMZA 3ROYA 4NU1A 5BUIA 4ACCA 3V5TA 4DA5A 4YJVA 3ORZA 3QD3A 4D1ZA 4O2PA 3G15A 5LCKA 5AP4A 2ITWA 4G31A 3AD6A 4UXLA 4HGTA 2WIHA 5KMNA 3O7LD 4ZTNA 4MHAA 1Q8TA 4Z55A 3QWKA 1YOJA 2PVNA 5B2MA 4E20A 1QCFA 3OXIA 4FSYA 4J1RA 4CKIA 5BVNA 3VBXA 1JSUA 2X81A 3RP9A 3EL8A 1IRKA 3PYYA 4P7EA 3ZM4A 5HLPA 2F9GA 2VWVA 5J7HA 3KRLA 3UVRA 3WILA 2HWPA 4EBWA 2BAJA 4OAUC 3VC4A 2XIKA 3EQPA 4YP8A 4EJNA 4F4PA 3HGKA 3P0MA 2YABA 5CSWA 4I5CA 5LMKA 3FMDA 5LOHA 3Q4CA 3ENMA 2GNIA 3NRMA 4BCQA 3BCEA 2YIQA 5CVGA 4HYSA 5E92A 4D28A 4DE4A 4MXOA 1MQBA 3KCFA 4IVBA 2CCHA 4AF3A 3UPZA 5DYJA 2X6EA 2XNEA 3COHA 3EQDA 1REJA 3DK7A 5IA4A 2ITUA 3ZMMA 4MWHA 3NUPA 3RAIA 3F2RA 1R0PA 1BKXA 3DZQA 5CSXA 5CXHA 2REIA 3VJOA 2FSOX 3LE6A 3GFWA 3DCVA 3RVGA 2BZJA 2DWBA 4NFMA 4DBNA 4ZMFA 4C3RA 1H07A 3CR0A 3I81A 3V6RA 4Z9LA 4O7LA 5D12A 1J1BA 4RWIA 4A9YA 3PXYA 3SOCA 3ORTA 3MY5A 3IDBA 3UNZA 4AZEA 4CVAA 5K0XA 4TNDA 1BI8A 4XG9A 3EQRA 4CRLA 4HGLA 2IW9A 5JGDA 2VTAA 3EYGA 3UO5A 4G3EA 3UQCA 3OCGA 1ZOEA 3GQIA 4YLJA 3RINA 5D9HA 1S9JA 4H3QA 3WYXA 4HJOA 3TV4A 4IB3A 2JIIA 2G2IA 4U41A 3W10A 2XS0A 4XX9A 4W9WA 4F7SA 5CZIA 1NT2A 5KBQA 3ZONA 2XIZA 4FGBA 1R39A 4BCKA 2KULA 4IW0A 1PKDA 4LV5A 3LJ0A 4IZYA 4DC2A 4DEIA 4EONA 4NM5A 2HAKA 4QYYA 2JDTA 4BF2A 3GP0A 4H36A 4AU8A 3ZXTA 2GFCA 4E3CA 5CQWA 2ONLC 2PMIA 4I4EA 5DOSA 4JG8A 4L43A 4QMUA 4EOPA 5M4FA 4QP9A 3ZO3A 5ANJA 5A6OA 3R1QA 4TNBA 3TIYA 2QO9A 2I7QA 2BAKA 1OUYA 1LEZA 3EKNA 4V01A 5KUPA 4O84A 2JBOA 3ZUTA 5HIEA 3ZLWA 2J5FA 2R3NA 3G6HA 3OTVA 2QOHA 4WOVA 5EI6A 4D2RA 1XH5A 4XOYA 4GG5A 2ETRA 5FM2A 5JRSA 5GINE 4TYGA 4PDYA 2EWAA 2EB2A 3MY1A 1OI9A 2WMWA 4D1SA 4KS7A 2ESMA 5ANGA 5HZNA 4AW5A 1W98A 3P79A 2YCSA 3DJ5A 3POZA 4FTIA 4XHKB 3WARA 1OVEA 4A06A 4IAFA 3R7EA 2OH4A 4OT6A 2F7ZE 4ZTQA 1PRYA 3DLSA 3HRCA 5CNNA 3VS6A 4DEDA 4NL0A 2QO2A 2YISA 3QWJA 4B8MA 3ACJA 2ZVAA 3AGLA 1OL6A 4HGEA 4I0TA 1R78A 2YCFA 5FG8A 4TYIA 4QPSA 3KULB 2GHLA 4GS6A 3QYWA 4IWPA 5ETIA 3O7LB 4JG7A 3G0EA 3ZZWA 3LFSA 4FIEA 4FV2A 2FSLX 4Q9SA 3C0IA 4EOSA 3ALOA 1YWNA 2YIWA 3EN4A 3FMEA 1TQIA 3UVQA 3W2OA 4UMRA 3F69A 4EJ7A 2W17A 3M42A 5IMXA 4HCTA 3OWJA 5LVNA 3FJQE 4YJSA 3D5WA 3LXPA 5KHXA 2XJ0A 2CN8A 1Q62A 4QOXA 4YZ9A 3FEGA 2QQ7A 4NIFA 3CJFA 3R30A 4QMLA 4BFMA 3OZ6A 3DA6A 4O86A 1OKWA 1SVEA 2WNTA 4YLKA 4UX9A 3QTIA 1Q41A 4ENYA 4EQUA 2OXYA 3TKUA 5CT0A 5K5XA 4O7VA 3B2WA 4YC8A 1P2AA 2FGIA 5BUJA 2YA9A 2W5BA 4YZMA 2HWOA 3R8VA 3RPYA 2EXCX 4I24A 3SRVA 3PUPA 4DAWA 5JH6A 3BIZA 2PWLA 4LYNA 2YITA 1O6LA 3IW4A 3VJNA 3EQFA 3DBQA 4Y73A 1GZOA 3DXPA 4ZSAA 1RW8A 4UB7A 1PMVA 5H2UA 3VBQA 4D2TA 4F1OA 4ANNA 2XM8A 2C6KA 2PE2A 3S1HA 4XBUA 2ONLA 2ETMA 5M4IA 3HV6A 3UG1A 4A7CA 5KX8A 1MRUA 5CYIA 4FT5A 4DEEA 4J71A 4CYJA 5HE1A 5AV1A 3EL7A 5CF4A 4IAZA 5GZAA 4APPA 2B9FA 3TXOA 2BAQA 3E8DA 3LCDA 4FBXA 3JPVA 1U54A 2J0IA 4QMZA 5AV4A 4ALUA 4EI4A 4IAKA 3QTQA 1Z5MA 3MYGA 3NAXA 5CVHA 5IQEA 3G5DA 1IASA 1I09A 1VEBA 2BUJA 1J3HA 4NWMA 2XIRA 5LVMA 2YZLA 1UU9A 3R8UA 5CEOA 2W9FB 2PZYA 4UBAA 4ZY5A 2J7TA 4XS2A 3KXNA 5AV3A 3K3IA 4KRCA 1E1XA 4BTFA 2V7OA 4PL3A 1KOAA 3LFAA 5JQ8A 2QOFA 1Y6BA 3UIMA 1YQJA 2X8DA 4FTOA 3R8ZA 3RWPA 4CFXA 2PZ5A 1ZLTA 2A19B 1BMKA 4UZHA 1YHSA 4IWQA 5C8MA 5KE0A 2OWBA 4WNOA 4DGMA 2H6DA 4Q5HA 3QQKA 4TYHA 2FO0A 5H8GA 4FT7A 4XCUA 4AX8A 2X9EA 2X8EA 4RIOA 4YHTA 3BGQA 5HNBA 3VRYA 4XH6A 3L8VA 5LQFA 3KREA 1QPEA 2FSMX 3R7IA 4ANMA 3EB0A 3BELA 3NYVA 5HO8A 3D14A 1B39A 3D4QA 4AT3A 3JVRA 4EK3A 5KZIA 4RGJA 5F9EA 4Z3VA 4B7TA 3KU2A 4C4JA 4FVRA 3BI6A 3R9NA 5JGAA 3L8SA 2GNJA 3R9HA 5E9EA 1NY3A 4ZLZA 2H8HA 3E8CA 4HNFA 4UWYA 3VW6A 3JY9A 4FNZA 2HW7A 3EOCA 3BU6A 4K9YA 4M7IA 3FC2A 3VW8A 5IQFA 1U5RA 3V04A 2YHVA 3QA8A 4IQ6A 4EK4A 4S30A 3C0HA 4GVJA 2QODA 4YJOA 1V0BA 1XBAA 2CPKE 3V5QA 4RJ8A 4ANLA 2C6OA 3HMOA 5CS6A 3ZO4A 4GFOA 3UJGA 4OTHA 3RPVA 3E5AA 2VTOA 3LPBA 5KBRA 4NM3A 3VIDA 2HOGA 1DI9A 3VWAA 5AR7A 2CJMA 3MWUA 2VTJA 5JEBA 4OBOA 1CM8A 3ORPA 3TN8A 3FY2A 5L2WA 2ERZE 3E93A 4K2RA 4WBOA 2Q0NA 5LCJA 4GMYA 2XUUA 4F9BA 3CC6A 3GBZA 3NS9A 1JKSA 4KD1A 4D5HA 1QPCA 4D2SA 3E3PA 3OVVA 3ORNA 4QMOA 3B8RA 3GXLA 4DLJA 4YR8A 3A60A 4CXAA 4S32A 3BV2A 4AXAA 4G6OA 4BDIA 1H24A 4LMNA 3F5XA 3DY7A 5AAEA 5AUVA 4ZZOA 5L4QA 4FTUA 1UU3A 3HMIA 5ETCA 1OPJA 4PX6A 3EQCA 5J87A 2Y6OA 3UYSA 3U6HA 2X4ZA 3AXWA 4FV8A 3WZKA 5M06A 1W7HA 4BBFA 5FEQA 2Y4IC 2BIYA 3QBNA 2WOUA 5JKGA 1LUFA 3SKCA 3A2CA 5DR2A 3FLWA 1FVVA 4DGLC 4DG0E 5LVOA 5M4UA 1H0VA 3R01A 3ZUUA 4BRXA 5HESA 3CPCA 2SRCA 4M13A 3CIKA 5F4NA 4LRMA 3VN9A 3SRVB 3DQWA 1YVJA 2J0LA 4Y83A 4C4GA 2HENA 3PSBA 3QGWA 4XG7A 4CFVA 2LGCA 2GQRA 2BR1A 3U55A 2Z2WA 3L9LA 5EDPA 4F9CA 3PXFA 4CSVA 2C6IA 5AAGA 3PLAE 3UZTA 2B53A 3N4TA 2QKRA 3MIYA 4UMPA 4FV9A 4EC8A 2HELA 4D4RA 4CTBA 2FA2A 4IC8A 4O21A 1FGIA 3OW4A 3PXKA 4IX6A 4XV3A 4EC9A 3UOKA 2ZDUA 3FLZA 3VBYA 4YO6A 3GB2A 1PXPA 3TV7A 5A9UA 5KZ0A 3LFNA 4LRKA 3RZBA 1PYEA 2ZM1A 3MJ2A 4P2KA 3TNWA 4BCOA 4APCA 5AIKA 2C6DA 4YLLA 1JBPE 1U54B 3GNIB 5J8IA 4CV9A 2W4JA 5KMLA 5D41A 3QTSA 3UOLA 4I0RA 3HMNA 3BEAA 3PVUA 1J1CA 2VWYA 4I94A 4LOOA 1IR3A 3S0OA 2ITOA 2WMXA 4HOKA 1O6KA 1M7QA 2XIYA 2C5OA 4XG4A 2AYPA 4I21A 3NYNA 2WQEA 4S2ZA 3UDBA 3TT0A 3ANQA 3PZEA 4F70A 2V0DA 2YAKA 3NW5A 4BDBA 3HV4A 2PTKA 2ITYA 3FDNA 2C1AA 3JUHA 4BCNA 3ZC5A 4FKLA 1YW2A 3HNGA 5DA3A 5FDXA 3G9NA 4OBQA 4J53A 4BI0A 5BQ0A 2YM4A 4YTHA 4ACMA 2XKFA 3DDQA 3RALA 5D7AA 1IA9A 2VX3A 3QKKA 2VWXA 3Q60A 2VN9A 4G1WA 3ITZA 5A14A 3MFSA 2G1TA 3OUNB 4W8EA 3ZFYA 4DH8A 3D83A 5AEPA 3PJ8A 2XH5A 4PDOA 3ZOSA 4FTMA 3QXOA 3SW4A 2GPHA 4I0SA 4M66A 5JN2A 2ZDTA 2JFLA 2XA4A 3MH0A 5FTOA 3VS4A 3MJ1A 2QURA 1CKJA 2OF4A 3OROA 3BYMA 4W8DA 3E8NA 4FUXA 1M2QA 3AG9A 5IEXA 2BTRA 5HORA 4YNOA 4QYGA 3IW7A 3U51A 5K9IA 2A2AA 3IO7A 3KMWA 1B38A 3LCKA 5ANDA 5J1WA 4OR5A 4C34A 2CSNA 4EORA 5GJDA 3ZDIA 1U4DA 2OJFE 4OTPA 3FMMA 4RA5A 5BVFA 1XBCA 1YDSE 1XR1A 4CV8A 4X2GA 3RPRA 5C1QB 4CZTA 3UOJA 4FT3A 2XNBA 4BDAA 2B9HA 4ZAUA 4FK3A 4F9AA 3ZS5A 4G9CA 3R7YA 5AV0A 4OTRA 1RQQA 1M7NA 2VV9A 2OSCA 2OXXA 3D5UA 3QZIA 3EFJA 2ZMDA 3UVPA 3A62A 2VWBA 3O23A 4XMOA 1YOMA 5HBEA 2UVYA 4AAAA 4AA4A 5C8KA 5FUTA 3PRFA 2V5QA 4Z16A 5L3AA 5M56A 3LQ3A 2YDKA 3LMIA 5FBNC 5CEPA 4OW8A 2PU8A 3P1AA 1U46A 2BZHB 2ZMCA 4MBJA 4R3PA 3D7ZA 4UWCA 4IACA 4QP6A 1PHKA 5TT7A 2OICA 2E9VA 2JAMA 2WO6A 3NMUF 1YRPA 1ZXEA 3N4VA 4K8AA 3DB6A 2OLCA 4NYEA 4DG2E 2R3GA 5M08A 2ERKA 1OIQA 3O51A 3TACA 4E6CA 2CKPA 3EQHA 3W18A 4DLIA 5CEMA 2YLEA 2AC5A 2JKMA 3MBLA 3GOKA 4JX3A 3RWQA 4JOAA 5IA0A 2OGVA 3PJCA 5GNKA 2W99B 3T3VA 3OG7A 4IAIA 5E1SA 3VQHA 4DFXE 4G3DA 1RE8A 1YWVA 4EH3A 4D0XA 4U8ZA 2RFSA 3F5GA 2OFUA 1WBSA 4IAAA 3K3JA 4U45A 3MH3A 4AT5A 4EYJA 2EXEA 5FWKK 1YOLA 3A7IA 3PA4A 3GC0A 4FIFA 3TDVA 5J9ZA 5DEWA 4RWKA 4EOKA 2WMAA 1VZOA 3ERKA 3CPBA 4FKTA 3W55A 2HZ0A 4O6EA 3LW0A 3MFTA 4I4FA 3D94A 4XP0A 2WB8A 5DN3A 4EZ7A 1LPUA 3R1YA 4GW8A 5A54A 1SYKA 3AMAA 4QMMA 5FBOA 3P9JA 4QP1A 2YDIA 4IJPA 4V04A 4E7WA 3LJ1A 3PJ1A 4NKSA 5HBHA 3O8PA 5AR8A 2C3JA 3S2PA 4CFWA 3E92A 1ERKA 5TKDA 3TUDA 1BX6A 1WBPA 1XKKA 5AUZA 4JQ8A 4H3BA 5E8ZA 2XJ1A 4BTKA 5DBXA 3R9RA 1W83A 3HECA 5ETFA 4CD0A 2PZRA 3THBA 4R8QA 2EXMA 4II5A 1OPLA 4U6RA 3T3UA 4KB8A 2CKOA 3OC1A 5JFWA 4O2ZA 3C5IA 2PVJA 3DT1A 3D7TB 4BDKA 2RKUA 4E93A 1Q24A 4M68A 4U40A 2R7IA 4O6LA 4PMTA 3BYUA 4DH5A 3PZHA 4GJ2A 3LMHA 5HHWA 4JIKA 2VTIA 2GSFA 4D4YA 5AAFA 2OI4X 4JT3A 3UTOA 3WE4A 4BZNA 4YPDA 5A46A 2ITPA 2GNLA 4M3QA 2VRXA 4EOQA 1ZWSA 2OIDA 4MD8E 2IVVA 2JITA 3CD3A 3SG8A 4NZWB 4DEBA 1WFCA 5EYCA 4LL5A 4C3FA 2QU6A 4IEBA 4QNAA 1XH8A 3KN6A 3HX4A 4U3YA 5IQIA 1NVRA 2BCJA 3FMHA 3MVMA 3PWYA 4GRBA 4U97A 4ID7A 5M51A 4CYIA 3QZHA 4H1JA 1JSTA 4IVAA 4DFNA 1J7UA 2C3KA 2R3PA 3RAWA 3OXZA 2E9PA 2OKRA 2XYNA 2X2MA 3TNIA 3V8SA 3DLZA 3L1SA 3F5UA 5C27A 2GQGA 2HIWA 4BYIA 4BCJA 3PPKA 5E4HA 2BDJA 3QQLA 4JL9A 5FTGA 4EUTA 4I5MA 4U7ZA 1JNKA 1G3NA 1JWHA 2ZV7A 3DNEA 4DEHA 4AP7A 1GAGA 4X7QA 3PE1A 4FSMA 4RX8A 3PTGA 2GU8A 4ASXA 3SVVA 4QP4A 2FYSA 2O2UA 1GZNA 2YDJA 3PIXA 3UMWA 2WQOA 3VF8A 3NLBA 4GU6A 5M53A 1Q99A 4BI2A 5A6NA 1T45A 2C0OA 2PMNX 3MB7A 3DKCA 4FNXA 4PPBA 4BICA 3OT8A 4RIWA 3BLHA 5AP7A 2ITXA 4FSZA 3E63A 5KKRB 4FL3A 2WMBA 3DFCB 3SQQA 4C0TA 5KNJA 3VS7A 3MVJA 4WIHA 2BRMA 5HGIA 2HXQA 2JIVA 3UP7A 3AD4A 2RIOA 1PY5A 3SXRA 4B8LA 2BRGA 5I4NA 1A9UA 2WELA 3NCZA 3QHWA 4EK5A 2EVAA 4G5JA 3R2BA 2XCKA 1H4LA 2OIBA 2WIPA 4C59A 4FKQA 4L67A 1J7IA 5I9UA 2G15A 3AGMA 4DHFA 4EH4A 4FTJA 2IO6A 3H9FA 4YHJA 4QMTA 5CEKA 2A1AB 4DCAA 2PMOX 2WPAA 5BNJA 4BKJA 4PTCA 3TEIA 3N51A 4EYMA 4R1YA 1OKVA 4YJTA 4LGHA 3SOAA 3NZ0A 1S9IA 5GJGA 4WO5A 2C5NA 4FG7A 4FODA 4GYGA 5E8WA 5J5TA 5JT2A 4CT2A 4UMUA 1GOLA 4LV8A 4IX5A 4D4VA 4PQNA 4QO9A 1XWSA 3POOA 1BL6A 2C0IA 2IW8A 4D2VA 4F1MA 5IQAA 4O7TA 4EZ5A 4B99A 3JVSA 4KA3A 1V1KA 1YI3A 2R3HA 1H28A 2UZDA 4L00A 3NCGA 4QMYA 2PUNA 3R0TA 4ANOA 1PXKA 3K5VA 3FLYA 4FKGA 5EHLA 4BCIA 5I3RA 2ITQA 2VWZA 1YXUA 4K6ZA 4LFIA 4QTDA 3LQ5A 5EM8A 3P4KA 4XUFA 4W4WA 5D1JA 5BVOA 2PK9A 4M67A 5G1XA 2PVYA 4BHZA 3G2FA 3F7WA 2X7OA 1YKRA 3O17A 2JKKA 2R3FA 3TG1A 3A8XA 2I0VA 3R9OA 5IQHA 4I6BA 3DKGA 1ZYDA 4F0FA 4P5QA 5HE3A 3RCDA 1GJOA 3H0YA 4H39A 3ZUVA 3COIA 3QTZA 4DN5A 5CASA 4J97A 4OT5A 1KE5A 2WEVA 4EOLA 3FQEA 4RX5A 5A3XA 4TKSA 5LXMA 4EHZA 1BI7A 3I1AA 4C02A 5HBJA 4U81A 4KSQA 2PUUA 3KQ7A 4QMVA 4RJ7A 2YJSA 2OBJA 4BC6A 5DRDA 2YWVA 4DYMA 2YM8A 4JAIA 4E4MA 1URCA 1Y6AA 2W1GA 1Y8GA 1G8SA 5IQGA 5A4EA 3GCVA 3F88A 5IKWA 3EN9A 2GNFA 1KUTA 1JAMA 3PVWA 4G5PA 1OITA 5B7VA 3ZCLA 3KXHA 4IBMA 2XP2A 4MAOA 4EQCA 4CNHA 3W16A 2HCKA 2QOIA 3HDNA 4K18A 1A48A 3MESA 5DE2A 4J98A 3COKA 3ORLA 4HYHA 3W32A 2G9XA 2E9OA 3A7JA 4L3JA 5HNIX 3NNXA 4FZ7A 4DFLA 1APME 1WZYA 5H3QA 5EHYA 4A4OA 4QQCA 2EB3A 4E4NA 1HCLA 5AM7A 3LFQA 5AUYA 4BDGA 2OW3A 2BRNA 3HKOA 4FV4A 1FOTA 2C3LA 3QAME 4F7JA 4YUQA 3HLLA 1V0OA 3H30A 2FUMA 2XK4A 1YI6A 4BY9E 4XV1A 3IGOA 3IONA 3Q4UA 4DTAA 4E5BA 2VTNA 5B2KA 1TVOA 4ACHA 1V0PA 2V55A 2HZIA 3NUSA 3G6GA 4I20A 3OBJA 2W1EA 4YZDA 4AFJA 1ZOHA 3FMKA 4R5SA 5EK7A 5E7RA 3G33A 4DGGA 3NUUA 1SM2A 3QLGA 3I7BA 4FNWA 3RNIA 3SD0A 1H1RA 1UNGA 5A4QA 5HG5A 1L8TA 3LVPA 1NW1A 3LFDA 1ZOGA 3QCYA 3TNPC 5TF9A 3AC5A 4X3FC 2XBAA 3PFQA 3BV3A 3TZ7A 3VS5A 1K9AA 2BZKB 2UV2A 3I5NA 4AWIA 3WF6A 4RIWB 3W2SA 3C4WA 3E8EA 2OO8X 1ZZ2A 3NYOA 3VUMA 4IMYA 3IDPA 4CG8A 2GTMA 4RA4A 3DK3A 1PXLA 1H25A 3AT3A 3QQGA 4KRDA 4MD9E 1KE9A 4GIIA 4ZTHA 5JZNA 2JIUA 4TT7A 5DRBA 4TYJA 1Y91A 4TYEA 4CFMA 4Y85A 5CSPA 2P33A 1U5QA 1AD5A 1WBNA 3NW6A 1F0QA 5C4KA 3PA3A 1OKYA 2W5HA 4L44A 5M4CA 3VHEA 4GK3A 4K11A 4MVFA 3UP2A 5IUGA 4MWIA 1MQ4A 4PMMA 2J50A 2YCRA 4QMXA 3WIGA 4BBMA 4DH3A 2DQ7X 2YIYA 3MPTA 3ZO2A 2GHGA 4XV9A 1JOWB 3KA0A 4GKHA 4O7RA 3QX2A 2QD9A 3Q9YA 3R28A 1WBOA 2FH9A 3GC8A 4IB1A 2WQMA 4BTJA 4EBVA 2X1NA 4ITJA 2PVRA 5LJJA 4AUAA 3AT4A 4FKIA 2KTYA 3MA6A 4C33A 2OZOA 2XK8A 1Y57A 3Q2MA 2RG6A 1TQPA 4GV1A 2G01A 2R2PA 2B55A 3PWDA 4ZY6A 1JKTA 2OFVA 5CNOA 4NJDA 4FKWA 2YERA 2BIKB 1E1VA 2XRWA 3KY2A 4K1BA 4KIPA 5AR4A 5AR5A 4HVIA 5IISA 3RK9A 2WD1A 3QYZA 4BVUA 3ANRA 4RJ5A 3BYOA 1OBGA 4FR4A 2B7AA 3O8TA 4IE9A 3H4JA 1G8AA 3KF7A 4DFYA 5HO6A 1AGWA 2W9ZB 2YJRA 2R3RA 4UMQA 3UQFA 3RHXA 1WBTA 5CT7A 2ITZA 2YZAA 1PXOA 4JIAA 4ERKA 2R64A 1Q3DA 3KRJA 1U59A 3R1NA 4FKRA 5HU3A 3FZRA 2C0TA 5M44A 2H96A 3ZFXA 3FHIA 3LCTA 4UXQA 4PP9A 3GGFA 4ZTSA 5CU3A 4J99A 4B4LA 2CLQA 5DIAA 3R7OA 4NM7A 2NPQA 4EEVA 3MFUA 4L7SA 5L6WL 2B52A 4OBPA 1GZKA 4D9UA 2XBJA 4YJNA 1R0EA 4GKIA 1PXIA 5B0XA 2BPMA 4FOBA 4F64A 3R00A 5HX8A 4X3FA 1MP8A 1KOBA 2WTIA 3NR9A 4PL4A 1FBNA 3ZZEA 3PP1A 5HVYA 3ID6C 1NVQA 3ZEWA 4GUEA 4JBPA 4WUAA 2YFXA 4XV2A 2HXLA 5TR6A 2BROA 3DNDA 4MF0A 1ZARA 1SVGA 3ZO1A 4CLJA 3DXQA 3SGCA 4IX4A 5ANEA 5CEIA 4JVGA 4KS8A 4F63A 5I9XA 3DPKA 2VNYA 3L8PA 4FC0A 1JKLA 4RWJA 4M8TA 2B4SB 4MD7E 2W1HA 4PDPA 4J8MA 3O71A 5CLPA 4IDTA 3FZTA 4A4LA 2NRUA 3FZOA 4FIIA 4F6UA 4AGCA 3SW7A 1XJDA 4R6VA 4XLIA 4FK6A 4R78A 4FV1A 4RVMA 2C5VA 3SHEA 3FLNC 4D4SA 4EHEA 1LP4A 4FUYA 3ORIA 2WTJA 3VUGA 5EKNA 3LXKA 4JQEA 4O81A 4NT4A 3DKOA 3FKOA 2CNUA 2GCDA 2WMQA 3ROCA 4L8MA 1CSNA 3K5UA 4FZ6A 4KNBA 3SXSA 2VWUA 5LWMA 5HLWA 4XG2A 2QHMA 4MBIA 5BYZA 4MX9A 4O0UA 4TWCA 4AQCA 4M69A 4FEUA 3H0ZA 3DKFA 4KIOA 4L52A 4RC3A 2B9IA 4EKKA 5CF5A 3JS2A 3P23A 3NNUA 4FSTA 3DK6A 3IKAA 3KXZA 4CCBA 4DFZE 1PMEA 4R7IA 4PNIA 3CGFA 4C35A 1ZMUA 4C4FA 2P4IA 4ENXA 2HY0A 5E8TA 3DFAA 4YMJA 4RC2A 4FKSA 3I5ZA 2QONA 4RSSA 1PKGA 3SC1A 1XQZA 2BFYA 3E7OA 5HG9A 2YWPA 5HVKA 2X9FA 2Y4PA 1DAYA 3BHVA 3BQCA 3CJGA 4QTCA 4D0WA 4UZDA 3NUXA 3BGPA 3QALE 3ZRKA 2H9VA 3S00A 2C68A 3E7VA 1ZAOA 1M14A 4DEGA 4ASEA 2XIXA 3VVHA 1H1WA 1OL2A 5ANIA 4MXYA 3FMLA 3KFAA 4ZXTA 2UZLA 4BGGA 2P2HA 2B1PA 4L01A 2VO0A 1FPUA 4PPAA 4X6QC 5AUXA 3RKBA 4BWPA 1WCCA 3T9IA 3U8WA 4BCFA 4O38A 2Y0AA 4TN6A 2DUVA 4EWQA 3BE2A 1XH7A 3CCNA 4OTFA 2RSVA 2OIQA 2V62A 4AACA 4MCVA 2BHEA 4IDVA 1JSVA 5HEZA 4BGQA 2UZNA 4L3PA 3CGOA 2VGOA 3QC4A 4D55A 3F6XA 4G17A 3AC1A 2PVHA 2HY81 3C4FA 4PUZA 4BGHA 4DT8A 4O91A 4XRJA 3CBLA 1NVSA 3VQUA 5FEDA 3C4ZA 3P86A 3TTJA 4QMPA 3TTIA 3HP5A 2X39A 2QVSE 4G6NA 5A4TA 5DH3A 2QOLA 2C5XA 4JLCA 3QD0A 3CQWA 4D1XA 2R3IA 2VWWA 4B0GA 5JRQA 3F2NA 1OIYA 5J95A 3R7VA 5DR9A 5AUUA 2ACXA 2GDOA 2UVZA 4GCJA 4UALA 5JFXA 4TWOA 5JFVA 3E64A 3FQHA 3FHRA 4G2FA 4LM5A 4W4VA 3EQIA 2IZSA 2ZJWA 3TUBA 3BHUA 3ZDUA 4RIXA 1FQ1B 3DV3A 4OTDA 4ZK5A 3TJDA 1ZY5A 4JQ7A 5L2SA 3EN5A 2C5YA 4IIRA 4QPMA 3CSVA 5HG8A 4GK2A 5EW8A 5HLNA 4O0YA 1ZMVA 4BN1A 5HQ0A 3ETAA 3WZDA 3IQ7A 4ZJJA 4YTFA 4L53A 5L8LA
chains in the Genus database with same CATH superfamily
4J7BA 2ZB1A 3WZJA 4AXCA 4ARKA 3GU8A 1FVTA 3RM7A 4RFMA 3LIJA 4NUSA 3ZSGA 4PNKA 3DTCA 5J9LA 3MV5A 1XO2B 2IVSA 2XNGA 3HAMA 5DFPA 3F2AA 4O1PA 3C13A 5E90A 1W82A 5HI2A 4FV5A 3DB8A 1ZMWA 3Q5ZA 1OZ1A 2Z7SA 3ULZA 5L2IA 2OU7A 3EZRA 4WNKA 4X3FB 3ZU7A 4CGAA 5ANOA 4R7HA 4QMQA 5AP2A 3P08A 3DU8A 4L46A 3FXZA 3FI8A 2W06A 1ZYLA 2XNOA 3ZXZA 4U42A 3O2MA 1P4OA 4CMOA 3KL8A 1IAJA 3HMMA 4LRJA 1F5QA 1O9UA 3CTJA 4I5PA 1OMWA 4Q9ZA 4NJ3A 3D7TA 4PDSA 1TQMA 4X3JA 3AMBA 3FZSA 4IWDA 1M2RA 2YM5A 3EN7A 5J5SA 1CKIA 3TI1A 2PUPA 1H0WA 1RDQE 2IZTA 2OZAA 3CD8A 5AX9A 5L6PA 2C6LA 3D5XA 3OHTA 4ONAA 4QYFA 1NXKA 5I9ZA 2Z02A 5DHJA 1XBBA 1P4FA 1WBVA 5BPYA 5M09A 3PA5A 1YI4A 3FSFA 1UA2A 3MY0A 4GYIA 4RZVA 4EH9A 5IF1A 4RVKA 2X2KA 5C03A 4WKQA 3RNYA 4CFNA 3QTXA 4FKPA 1KE6A 1XH9A 5CZHA 3N4UA 3BBWA 2ZM3A 3VHKA 3TJCA 3VBTA 5IPJA 1YXTA 2XEYA 3ODYX 4UEUA 4ANSA 1W2FA 5EFQA 2XM9A 4LOQA 3JR1A 3A4OX 1MUOA 4HGSA 4GK4A 5HCXA 5EOBA 3ZBXA 4KWPA 2IZUA 3QCQA 4FSWA 4HCVA 4M69B 4AGDA 4DINA 5JGBA 3T9TA 4FMQA 3F3TA 4E4XA 2HZNA 5ANKA 4O7WA 3I6WA 4I22A 2UZUE 1AQ1A 3R8PA 2WMVA 1H26A 2EU9A 3KMUA 5AX3A 3V8WA 5AP3A 3GCPA 3H9OA 2VTMA 3EFKA 3CKWA 2YACA 3QC9A 4JX7A 3HMPA 3C1XA 4AGUA 4AXDA 2O5KA 5BMSA 1H27A 3PXZA 4ZIMA 4A9RA 5IDNA 4TXCA 3QD2B 3FMJA 3IOKA 4JJRA 3C4XA 3Q32A 2HW6A 2J4ZA 4FTAA 5DT0A 4YJRA 2CHLA 4USEA 4ORKA 4HVHA 2VTPA 5E8XA 2J6MA 2Q0BA 4D2PA 4MQ1A 2XEZA 5E8SA 4S31A 5GHVA 4DGOA 3FLQA 2A0CX 3I79A 1W2DA 4FKVA 3PVGA 3QD4A 4P5ZA 4F0GA 5J7BA 5FXQA 1KWPA 3BWJA 2RFDA 3QUDA 3HV7A 4AG8A 1XH4A 3QCXA 4LGDA 3KB7A 4FTTA 4J96A 5ETAA 4MEDA 4EH6A 2OJGA 4GU9A 2VZ6A 3NGAA 3V01A 1JLUE 2VO3A 4FZDB 3RTPA 5EKOA 4O0TA 3ZC6A 2I0YA 3NUYA 5HE0A 2PE0A 3A8WA 2JKQA 4RJ3A 2I0HA 2X0PA 1B6CB 2PHKA 4OTGA 3NWWA 5IZFA 4YC3A 1FMOE 1MRYA 4AE6A 1J91A 3C4EA 2PUIA 2DS1A 2YIRA 3GU7A 3QKMA 2WZJA 3FL4A 3R21A 4AN3A 2QG5A 5FDPA 1H00A 3DJ7A 3AQVA 3NFGB 3PY1A 5GZ9A 5HX6A 3OCSA 3FKNA 4F08A 4QEBA 1OL5A 2BDWA 3FZPA 2NNWB 5DLSA 4ANBA 4C4HA 5FXSA 2XKDA 3CQUA 4JRVA 4Y5HA 5C4LA 4BWXA 4V05A 4ZZMA 4RIXB 2ZOQA 5DNRA 4JI9A 3FQSA 2WTVA 4KIQA 1EH4A 4IAYA 2C1BA 4IVDA 4K0YA 4NSTA 3VS3A 5AWMA 2R5TA 2VTRA 3QTRA 5AR3A 3AC3A 4HPTE 4BKYA 3ATTA 2NRYA 2E2BA 1T46A 2WMRA 3U4UA 2XCHA 5LMAA 3U4WA 2ITVA 1YHVA 2YCQA 3ZYAA 5IUHA 3ORMA 3AKJA 1Z57A 4U44A 4ERWA 1OIUA 4JDIA 4D2WA 4F9YA 3I0QA 4M14A 1H1QA 2PVLA 3F3UA 3VS2A 4EHVA 3ZM9A 1GY3A 4WSYA 4FTCA 2WU6A 4CZYB 1R3CA 4E26A 4BCHA 4CG9A 4BIDA 3EJ1A 4NM0A 5CU0A 2OG8A 3FC1X 2JAVA 4W4XA 4O4CA 3ODZX 5IQBA 5HNGA 4EOJA 3F3WA 5CAPA 3E88A 2JKOA 4G3CA 3VONA 2X7GA 2Z7RA 4FTNA 5IH4A 1Q3WA 2HZ4A 2VTQA 3ZHPC 4FOCA 3NNVA 2XK9A 4RT7A 4EOOA 1LEWA 3R02A 2F57A 4X2KA 3R63A 4XRLA 4F78A 1QPJA 4FSUA 4IH8A 4L3LA 3WBLA 3A4PA 2OZAB 4E73A 3HV3A 2I40A 2XVDA 4LI5A 3FMNA 3FYKX 3O8UA 3D5VA 4RWLA 4X6RA 3UE4A 4D9TA 3BRBA 2W1DA 3PPZA 4ASZA 2R0UA 2R7BA 3PRIA 5C8NA 5CAOA 4AS0A 5KMMA 2VGPA 5F20A 2BILB 4BI1A 3W33A 4RFZA 4UMTA 1OKZA 4GIHA 3GC7A 5EI8A 5HD4A 3UODA 3TDWA 1YDTE 3Q04A 4ZJIA 3QKLA 1UVRA 3NX8A 5KMJA 3CTQA 2J5EA 3JYAA 4GFMA 5FLFA 2QR7A 4C36A 3R2YA 4DF3A 3BYSA 2J0KA 4RIYB 5CENA 1F3MC 2YIXA 3H9RA 3ATSA 4FL2A 1YXXA 2X4FA 3QTUA 3VUIA 4N57A 4NFNA 3RJCA 1WAKA 3IS5A 5EI2A 4TY1A 4C4EA 4KIKA 4RMZA 2XKEA 3P5KA 5BVWA 2BRBA 5HE2A 3LXLA 3R22A 5CU2A 5KMOA 2Y4IB 3BPRA 2W7XA 4P4CA 4MBLA 2OH0E 4L7FA 4BKZA 2VTSA 5HIDA 3CY2A 5EQYA 3OD6X 4BIEA 4D5KA 3PY0A 4I5HA 2UZOA 3EFLA 3TL8A 4I41A 4RZWA 3UO4A 3QU0A 4AQKA 3CEKA 2UUEA 1Q8UA 2PE1A 1Q8WA 3C7QA 3IG7A 4EK6A 3TZ9A 3I4BA 5KHWA 4DHIB 5BUEA 3ZLYA 2R3KA 3PY3A 2ZV2A 3CQEA 4PL5A 4PV0A 4JBVA 3LQ8A 2R3QA 4QRCA 2HK5A 3SAYA 5IA2A 2AEGA 3GI3A 2R3LA 3QL8A 4C58A 1Y8YA 4F1TA 3P5JC 5GIPE 4FSQA 5DEYA 3Q5IA 5JZJA 3OWLA 4GUBA 1GIIA 3AD5A 4WHZA 4RG0A 3MIAA 3FE3A 4L9IA 4F6SA 5M55A 2C47A 4YGAA 2IG7A 3PXQA 3GOPA 2XKCA 5HU9A 3GU6A 2RFEA 4XG3A 5K5NA 2R4BA 4ZJVA 3HP2A 3OP5A 3UIUA 3VULA 4L6QA 4BR3A 2ITTA 2GS2A 4I6HA 1Q61A 4XOZA 3UZRA 5IQDA 2GNHA 4JR3A 2IN6A 3BHTA 4UYAA 4ACGA 4CQGA 3HA8A 1H8FA 2WTCA 4RX7A 4UV0A 3OS3A 3KMMA 3CXWA 5AP1A 1W2CA 1W8CA 5CX9A 5CAQA 4WRSA 3BKBA 3F7ZA 2JDSA 3FYJX 4JXFA 3BGZA 3PE2A 4N0SA 4ALVA 3W0SA 2YLFA 1QPDA 4FEWA 3TNHA 1I44A 2ZM4A 3H10A 3C5UA 3IK3A 5E1EA 4EH7A 1M52A 4FSRA 4JS8A 5L2TA 4F9WA 4FX3A 4Q2AA 2GS6A 4O22A 5LARA 4EKLA 3MFRA 4QMSA 4UY9A 2X0OA 3BQRA 4FIJA 4IXPA 2QCSA 4IM2A 4V0GB 2WQBA 5FXRA 2BTSA 3WYYA 2BHHA 2JBPA 3R7GA 4Z7GA 3HRBA 3G0FA 4N70A 5I5ZA 2PSQA 4G3GA 5J79A 2WTKC 1WBWA 4ZSEA 3U87A 4ASDA 4C57A 4DH7A 3MVHA 4U43A 4ZP5A 4BTMA 4C2VA 2XB7A 2Y8OA 3OT3A 5F94A 2BFXA 3DAJA 4O7SA 2PL0A 4LUDA 3M2WA 3QQHA 4IHPA 5BVEA 3C50A 4PPCA 1KV2A 3GVUA 5EYKA 1ND4A 2JFMA 1Q97A 2CCIA 3LCSA 2NO3A 4NCTC 5K4IA 3LFFA 4O96A 3W0OA 3OCBA 4BCPA 1VJYA 3S95A 1REKA 1PJKA 1ZZLA 4QMNA 4ZS4A 3QRUA 4RPVA 3ZTXA 5M07A 3IPHA 2VU3A 3NNWA 4Y8DA 3PG1A 4LG4A 3BYVA 4E6AA 3PJ2A 3LFEA 3EHAA 5E8YA 5HKMA 4EH5A 3DXNA 3OXTA 4U79A 1UWJA 1FGKA 4DG3E 1JVPP 2Z7LA 3VUTA 3FZ1A 4FTQA 5TE0A 2FSTX 1SZMA 5B2LA 1WMKA 3OWKA 1PXJA 2LAVA 1SVHA 3WE8A 5D11A 2WU7A 1PW2A 2Y9QA 3REPA 4DGNA 2CN5A 2GS7A 3A7HA 4MXXA 1WVWA 2CMWA 4MNEA 2GMXA 5CSHA 3W1FA 4AW2A 4PY1A 4O0VA 4H05A 2AC3A 3WOWA 1K2PA 4FTRA 3FPMA 4L42A 3I6UA 3K54A 3MPMA 4F65A 5IMEA 3Q4TA 4WT6A 3PXRA 3G9LX 4L45A 3COMA 4FT9A 1FVRA 1YDRE 2YM6A 1CTPE 3F3ZA 3HA6A 4QNYA 4ZLOA 4RVTA 3VS0A 3F82A 5H9BA 3OY3A 5EW3A 3VAPA 3I7CA 5GJFA 3RAKA 2X8IA 4YTIA 2PVKA 5BMMA 2P3GX 3UZPA 4KUJA 4FKUA 5E91A 3DOGA 3EH9A 4O82A 3HUBA 3TUCA 4KKEA 3V3VA 3Q6UA 2W1ZA 4FKJA 4KIKB 4W4YA 3RK7A 2F2UA 3RMFA 1QL6A 3FUPA 4FG9A 1WVXA 3F3VA 3JY0A 3OW3A 5CWZA 1E9HA 3MH2A 5JSMA 4A9TA 2A4LA 5J9YA 4NK9A 2GFSA 4ZSJA 3UG2A 4DEAA 4LV7A 3Q9XA 1HCKA 3FKLA 3LFCA 4DBXA 3QZGA 2JLDA 4YTCA 2WGJA 3HEGA 5T3QA 3BWFA 4OTQA 5EM5A 3II5A 5BYYA 2QLUA 2WOTA 2Z60A 4R7BA 2I6LA 2XK6A 3PLSA 3LCOA 1GZ8A 3LJ2A 2VTHA 3PIZA 3R04A 4P90A 1P5EA 3AKLA 3ELJA 1UWHA 2GNGA 4NCTA 5CI6A 5H8EA 4QTEA 5LMBA 5IQCA 3QZFA 4KSPA 4FT0A 4MK0A 4MNFA 4X2NA 4ZOGA 4B6LA 2OK1A 3HDMA 3ACKA 3UMXA 1M17A 2EUFB 1H01A 2WEIA 3AT2A 4ZEGA 5CANA 4I6LA 3OF0A 2CKQA 4G3FA 3ZH8A 3K2LA 5AA8A 2VUWA 3C4CA 4GT4A 3R6XA 4R3CA 3WZEA 4AZWA 4C3PA 4C62A 4YHFA 4ZLYA 5IH5A 1UKIA 5AP6A 3DJ6A 5TO8A 3VBVA 3MH1A 3MB6A 4J8NA 2G2HA 2R3JA 4BHNA 4EOIA 3V5JA 4FA2A 4QTBA 3UYTA 4E6QA 2VTLA 1YHWA 4DT9A 4M84A 2G2FA 4HPUE 3C51A 4RJ6A 4E6DA 3QUEA 4H3PA 4O4FA 3WF8A 3W0PA 4DFUA 2PY3A 3BLRA 4A9UA 4X21A 4ZMEA 1KE7A 3FSKA 3KRRA 2YEXA 3FXXA 5EOLA 2QNJA 5F1ZA 4AN2A 5KMKA 5BYLA 3MI9A 1OGUA 3E62A 1SMHA 2VWIA 3VS1A 4USDA 2PPQA 4IB0A 3D0EA 3O50A 4PF4A 3CLYA 4M15A 3RHKA 1CDKA 2QU5A 4QP8A 5DPVA 5GZ8A 1VYWA 3MGYA 3P7CA 3KIOC 4MUQA 4PWNA 4O7ZA 4WD5A 1GNGA 2UW7A 3IECA 4DTKA 4QDEA 5EDQA 5IEVA 2R0IA 3TV6A 3KXXA 4BZDA 5I3OA 3NSZA 2Z7QA 3LOKA 4JDHA 4PP7A 4O7NA 1UNLA 5IG1A 3KVXA 3QFVA 4XBRA 3W2PA 3KF4A 4F99A 3EKKA 3BU3A 4U3ZA 1ATPE 2X2LA 3NAYA 4JR7A 2X7FA 1VYZA 4NH1A 2QHNA 4PTGA 3E87A 5CY3A 4BDCA 3DAKA 5DMZA 4E4LA 4QYEA 3U9NA 1UNHA 3NVMB 3L9PA 2O64A 2V22A 3BLQA 4MYGA 2VTTA 2VX1A 2VO7A 4B9DA 1MRVA 2OF2A 4CZUA 2RG5A 4ZZNA 5EM7A 4PMPA 1YWRA 2XK3A 5BVKA 1ZRZA 5KMIA 2XRUA 3NDMA 4BL1A 4YURA 4DFBA 1PXMA 4ITIA 3UO6A 4I3ZA 5EHOA 1YXVA 3ALNA 4C7TA 1O6YA 4O83A 4FG8A 2CNVA 2JEDA 4IM3A 4KINA 2XJ2A 3M11A 3CP9A 1J7LA 3FBVA 4LOPA 4OGRA 3A99A 4LQMA 5I9YA 4O4DA 4IJ9A 2UZEA 2WMSA 5FGKA 2ITNA 2OJJA 1OL1A 4Q5EA 2XNMA 3GUBA 1H1PA 1ZYCA 1STCE 4FSNA 3QLFA 4MNEB 2X0GA 5CI7A 3SV0A 2VX0A 1CMKE 4HVSA 5CF8A 2FB8A 4O0WA 3ZRMA 4G6LA 4FIGA 3VNTA 4EL9A 3IW6A 4L68A 3HAVA 1OB3A 4KAOA 3BZ3A 3GT8A 5AP5A 2PYWA 3RPSA 3U6JA 4JBOA 1UKHA 3R8MA 5HTIA 1DM2A 1LR4A 1KV1A 4BCMA 3ENHA 4ITHA 4UWBA 2WTWA 2WMUA 3LM5A 4YJUA 1CKPA 4QPAA 2CGXA 3ZFMA 2J90A 2ZB0A 3A7GA 4ACDA 4ZY4A 3SX9A 4JDJA 4CFFA 3UNKA 3NVKI 4N4SA 4YSMA 4U9AA 3R83A 1TKIA 2QLQA 2A27A 5HD7A 3RCJA 4IANA 3Q6WA 2DYLA 3EZVA 3FI4A 4KBAA 5GIOE 1URWA 2RFNA 2B9JA 3CY3A 3QRTA 5DGZA 4C38A 4EH2A 2WTKB 3SLSA 5JFSA 3UIBA 3V51A 3L9NA 3PIYA 4I1ZA 4RBLA 5C9CA 2C6MA 1H1SA 5CTPA 3QRKA 4E5WA 3KXGA 4CCUA 4JRNA 4C61A 4FEVA 2IVTA 2XK7A 2PZPA 4BB4A 4N6ZA 2Q83A 2BDFA 3KK9A 3RK5A 4FL1A 5EQEA 2PVFA 5DT4A 5M57A 5JMSA 4YBJA 3L9MA 3QA0A 4AOTA 2HYYA 3ZLXA 4DH1A 2YM3A 1DAWA 5CSVA 3TKIA 4D58A 4ZSLA 4M0YA 4AOIA 2YN8A 2BRHA 3KGAA 5D10A 3D9VA 2QOCA 2R9SA 3P7BA 3PSCA 5FQDC 3UC3A 5FTQA 4DTBA 3GQLA 3QCSA 3O0GA 4IC7A 1JQHA 2ZAZA 5KO1A 3DTWA 2O0UA 4AZFA 2GQSA 4OLIA 3KN5A 3CTHA 5C01A 3TZMA 4ALWA 4BDFA 2QKWB 3F5PA 4RFYA 2A98A 3LKMA 5EG3A 2W4OA 5ACKA 4HVDA 2UZVA 4O0SA 5K4JA 4HYUA 3NEWA 5CVFA 5AMNA 3W0RA 2E9UA 2C6EA 2IVUA 4MTAA 1ST4A 3U54A 3PP0A 4FV6A 5CF6A 4LGGA 4GT5A 4FV0A 4WRGA 4IZAA 4K77A 2ETKA 5HVJA 4X2JA 5IEYA 2PULA 2P0CA 3W8QA 4FV7A 5HCZA 5KCVA 1OIRA 1PMNA 3EIDA 4JDKA 2C6TA 3AOXA 5EQPA 2JDVA 2W96B 3KK8A 4GH2A 3W2RA 5AFVA 3D2KA 4PTEA 4NTTA 4FKOA 4YSJA 2O3PA 3QRJA 3L8XA 4JAJA 4AZVA 4MXZA 4UN0C 2F7EE 2Y6MA 1YXSA 5CAVA 4EWHA 4J52A 4AZSA 3RPOA 3MN3A 4EZ3A 3QUPA 4BDJA 3ULIA 3NUAA 4C8BA 3EQGA 1JKKA 2ZV8A 4G34A 4IVCA 4YC6A 4C4IA 3ET7A 5EH0A 5AUTA 3N9XA 5IH6A 3Q3BA 3LFBA 5L8JA 4M0ZA 4PRJA 2VNWA 3KEXA 4NIFB 4X0MA 3T8OA 4EHGA 5H8BA 1KSWA 2IWIA 4AXFA 2UZTA 2PMLX 4HW7A 5DVRA 1GIHA 3Q53A 4FTKA 4KABA 2O8YA 5CAUA 1FINA 3LHJA 3SXFA 3OOGA 4GEOA 4YNEA 4Z7HA 4QP3A 4S34A 4GVAA 5AUWA 3P78A 2BVAA 1OUKA 5KKRC 3TKHA 3PSDA 5AADA 2CGWA 3IW5A 3EFWA 3P7AA 3TWJA 2CGVA 3MS9A 4H1MA 4A07A 4YO4A 5IU2A 1SNXA 4XLVA 2F7XE 1PMUA 5CU6A 4EQMA 5EM6A 3DAEA 5FRIA 4LMUA 3HVCA 3MSSA 1OECA 4I6QA 4CT1A 2BMCA 5ICPA 2WKMA 1VR2A 4E5AX 3VUDA 4QYHA 3LLAA 4M97A 4YJQA 4CTCA 5CEQA 1PXNA 3OBGA 1P14A 2VO6A 3PVBA 4EOMA 5I9VA 3S3IA 3HUCA 4CEGA 2C30A 4EK8A 4QQJA 3GU5A 4IB5A 4RIYA 4S33A 2XNPA 5CXZA 3FL5A 1Z9XA 3E3BX 4GFGA 4TRLA 3OOMA 4FIHA 4MKCA 2XNNA 4CFUA 3LAUA 3GCUA 3W0MA 5FP6A 4FZFB 3V8TA 4JMQA 4I92A 5FEEA 2WMTA 5FD2A 5L8KA 5HCYA 1XHAA 2UZBA 4Y5QA 4IFCA 4HYIA 4RLLA 1Q8ZA 3ZRLA 3NUNA 2E9NA 4DITA 4CKRA 3W8LA 3OEFX 4QMWA 2BALA 4G16A 4QP2A 5LVLA 2JDRA 2J51A 2XMYA 4ZTRA 4BDHA 3EQBA 4WUNA 1DS5A 5EYMA 4ZS0A 1M2PA 3NIZA 3WZUA 4FTLA 4IFGA 4QQTA 2UZWE 4F09A 4CKJA 1ZY4A 3ZLSA 3OUKA 3C0GA 4FVQA 3OY1A 3PPJA 2X0QA 4CMTA 5D7VA 3VO3A 3GU4A 3MDYA 3Q96A 4TYHB 5CALA 2NP8A 3TZ8A 2F49A 3QX4A 4LUEA 4HCUA 5T6KA 1IEPA 3VUKA 2CNQA 4O1OA 3UBDA 4HZSA 1Q4LA 4H58A 3F9NA 4U80A 3CS9A 4OTIA 4QD6A 5ITAA 3VUHA 3FI2A 5DT3A 3WIKA 1OPKA 3UPXA 1K3AA 3MVLA 3W2CA 3HYHA 4IWOA 1XH6A 5HIBA 4USFA 1L3RE 3GFEA 5AA9A 4K33A 5AP0A 3BHYA 2I1MA 3ORXA 3Q4ZA 5FP5A 3RBWA 3UQGA 5HTCA 2UW3A 2XALA 2X6DA 3FI3A 4ZTLA 2H34A 4NW5A 2W1IA 2PVMA 4FE2A 3Q2JA 3R1SA 3MA3A 3Q52A 2RGPA 2WAJA 4IM0A 3MW1A 5EDRA 3U6IA 5HICA 4FYOA 4RX9A 3QGYA 2WFYA 4YJPA 3TM0A 5HTBA 5F95A 4AOJA 2QOOA 2J9MA 3F61A 4TWNA 4WBBB 2W1CA 5HOAA 2J2IB 3UOHA 3ZBFA 4JG6A 4RLKA 3FAAA 4N6YA 3OFMA 1FMKA 3KRXA 4F6WA 4AE9A 3SA0A 1IA8A 4FRFA 4MXCA 4YZNA 2ZV9A 2Z8CA 4UYNA 4R1VA 4MXAA 3V5WA 2GTNA 4V0GA 1W0XC 3HV5A 4RC4A 2J0MB 2JD5A 1ZYSA 5DWRA 4YPSA 5BVDA 5JK3A 4QT1A 4O27B 4E8AA 4CLIA 1Q8YA 4WG4A 2UW5A 4RJ4A 3OTUA 3MTFA 3B2TA 4AW0A 4Y46A 3AC8A 4ZSGA 2UW8A 4C2WA 4AA5A 4A4XA 4F7LA 1KE8A 2GHMA 2VD5A 3A61A 1DI8A 2OXDA 3HRFA 3WF7A 5E8VA 2CKEA 4FYNA 4XG6A 4OAVB 4I93A 2VAGA 2IJMA 5BV3A 4TL0A 4XG8A 2C4GA 4QTAA 4FEXA 4AZTA 3AC4A 4AT4A 3AMYA 5TOZA 4F7NA 4KKHA 4BDEA 5AV2A 1JPAA 1UU8A 4IZ5A 1A06A 3NPCA 4QQ5A 3QF9A 4AGWA 4CMUA 2RF9A 5FM3A 1TZDA 2P55A 1RJBA 3KKVA 4C37A 3GEQA 3C9WA 2JC6A 3TIZA 3G51A 4YZCA 4X2FA 2JGZA 2RL5A 2C69A 3I60A 2R3MA 5J1VA 1HOWA 2JDOA 3JXWA 3DS6A 2W05A 4HZRA 2C3IB 4R5YA 3VBWA 5C26A 4O0XA 5DR6A 3DBCA 5BX0A 3WF9A 3ZSIA 4XP3A 3I0OA 4GJ3A 4MF1A 4XYFA 3FPQA 3CKXA 4I23A 3OMVA 5DI1A 3IW8A 4WA9A 3EYHA 4ZTMA 4JBQA 3PG3A 2B0QA 1Q5KA 3DBDA 3H3CA 3V5LA 3VRZA 5I9WA 4WNMA 3RAHA 4IADA 3BE9A 1NA7A 2AUHA 4TW9A 2QOQA 2IW6A 2CGUA 4G9RA 1PF8A 4TTHB 5A4CA 3BX5A 3LMGA 3EN6A 3QQFA 4I6FA 2Y7JA 4WG3A 4CRSA 3NYXA 2XZSA 3ZEPA 3LXNA 4FF8A 3D15A 2IZRA 4FICA 4F0IA 1UV5A 4XP2A 5G6VA 1GIJA 3OEZA 4WG5A 3QQJA 4FV3A 3R8LA 3VF9A 4EUUA 1H08A 4WNPA 2OJ9A 4FEQA 3S4QA 1WVYA 2QO7A 1ZYJA 5IA5A 3W0NA 1W84A 4FNYA 1OBDA 4HNIA 2QR8A 2XYUA 3DQXA 3O96A 5DG5A 3W2QA 1IG1A 3GCQA 3BU5A 4BCGA 2UW0A 4RQVA 1G5SA 2BZIB 4IZ7A 2UW6A 3MTLA 5EYDA 5L2QA 5CU4A 2BKKA 3HL7A 1R1WA 3FLSA 3R9DA 3UNJA 4FGRA 4R77A 4XJ0A 3ZSHA 5AR2A 3GENA 4YBKA 3TCPA 4HVGA 4E1ZA 3SG9A 2UW9A 3CE3A 2ZYBA 4BBEA 5AIRA 4MQ2A 4WSQA 3IGGA 3UGCA 2W4KA 2WTDA 2XF0A 3B8QA 3OWPA 5ACBC 4EH8A 4OUCA 1BUHA 3U9CA 3OCTA 1BL7A 3R73A 2CDZA 1BLXA 4RQKA 3DGKA 4QP7A 3Q9ZA 2OJIA 3BEGA 4NKAA 5L6OA 3MPAA 4MH7A 5IUIA 3D2IA 2QI8A 3BBTB 4O7YA 3Q9WA 3LLTA 3WF5A 5AM6A 2PZIA 2W1FA 4NEUA 2UW4A 3UIXA 5A4LA 4BZOA 5LVPA 4ANQA 2QOBA 4GG7A 5T68A 2I0EA 1BYGA 2WQNA 3DZOA 3QQUA 4XEYA 5K3YA 4KBCA 5IA1A 3F66A 3KC3A 5HO7A 3KXMA 4FVPA 2W5AA 1IAHA 5K0KA 4RVLA 3NW7A 4XNEA 4PMSA 4FI1A 4U0IA 3R7UA 4FZAB 3SDJA 4CQEA 2O63A 4AA0A 5EW9A 3DBFA 3KCKA 4R3RA 3LZBA 2W0JA 5LMKC 2J0JA 4KBKA 5JQ5A 2O65A 3RI1A 3UC4A 3FY0A 4A9SA 3EWHA 2F2CB 2YM7A 2QG7A 3G90X 1OL7A 3BHHA 4Y95A 5AJQA 1OM1A 3EMGA 4IX3A 3GCSA 5IDPA 2V7AA 3QXPA 4JNWA 2P2IA 4RRVA 3RGFA 2B54A 4NW6A 2IPXA 3RM6A 3M1SA 4LL0A 3UDZA 4TPTA 2F4JA 3DDPA 3RZFA 3KRWA 4TWPA 3KVWA 4GT3A 3TNQB 3V6SA 3V5PA 4KKGA 3ORKA 3GC9A 5I0BA 2CLXA 4M12A 2WXVA 2UVXA 4GL9A 4GSBA 4YZBA 2FVDA 3KULA 4O0RA 3HZTA 4BDDA 3PDTA 4DCEA 5E8UA 3A7FA 3NIEA 4J95A 4W9XA 5CQUA 4BWKA 2YAAA 3DBEA 4TZRA 4AN9A 1PYXA 4BIBA 4DHJA 3FWQA 1UU7A 3QTWA 4YU2A 3AC2A 2QOKA 3FXWA 3IDCA 2R3OA 5HG7A 3TYKA 3QRIA 3WI6A 3PJ3A 2BKZA 3FV8A 3NFFB 3QHRA 5LWNA 4U5JA 4Y72A 4OTWA 3LM0A 3R71A 2WHBA 1SNUA 4AFEA 3IOPA 1X8BA 4NTSA 4AW1A 5IA3A 4BYJA 2QC6A 1QMZA 3ROYA 4NU1A 5BUIA 4ACCA 3V5TA 4DA5A 4YJVA 3ORZA 3QD3A 4D1ZA 4O2PA 3G15A 5LCKA 5AP4A 2ITWA 4O4EA 4G31A 3AD6A 4UXLA 4HGTA 2WIHA 5KMNA 3UDTA 3O7LD 4ZTNA 4MHAA 1Q8TA 4Z55A 3QWKA 1YOJA 2PVNA 5B2MA 4E20A 1QCFA 3OXIA 4FSYA 4J1RA 4CKIA 5BVNA 3VBXA 1JSUA 2X81A 3RP9A 3EL8A 1IRKA 3PYYA 4P7EA 3ZM4A 5HLPA 2F9GA 2VWVA 5J7HA 3KRLA 3UVRA <