4YNEA

(r)-2-phenylpyrrolidine substitute imidazopyridazines: a new class of potent and selective pan-trk inhibitors
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
297
structure length
281
Chain Sequence
GSGIRVHHIKRRDIVLKWELGEGAFGKVFLAECHNLLPDKMLVAVKALKERQDFQREAELLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLAGGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMSTDYYRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIDCITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords High affinity nerve growth factor receptor
publication title (R)-2-Phenylpyrrolidine Substituted Imidazopyridazines: A New Class of Potent and Selective Pan-TRK Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 281
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yneA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yneA01
4CGAA 3DZOA 1FMOE 4PDOA 3F3ZA 3RPOA 2QOOA 3DDQA 3UO6A 4BBEA 4TKSA 3QZFA 2XCKA 4P7EA 4FGRA 3LMGA 3KCKA 5DMZA 2E9NA 3PRIA 1BUHA 2Z02A 3MH2A 2WMTA 4B99A 3SAYA 3OXIA 4FG9A 1FQ1B 3C51A 4BCJA 3OCBA 1W98A 5CSXA 3UMXA 2WTKC 1FVRA 2GDOA 1Q41A 4DG2E 2RFEA 4IXPA 2ZMDA 4OTPA 3FLWA 3MWUA 5E8UA 2ETRA 5J1WA 4IVCA 2JDRA 5HLWA 4O1PA 2XYUA 4NYEA 2YDKA 4QYHA 3IOKA 2XMYA 5HE0A 3GU7A 4I1ZA 4USDA 5C9CA 4C8BA 1JKKA 2R3QA 3KN6A 5IA3A 2BDJA 4JVGA 3Q9WA 4HGLA 4UWCA 3KEXA 3DKCA 4I6HA 4ALWA 4JDIA 4ZJVA 1ZOHA 2IVVA 2WMQA 4JBQA 3TM0A 3OWPA 3ZBFA 3NW5A 4R6VA 1PXPA 4J99A 5H8BA 2X8DA 5HLNA 2A27A 3KRRA 1RW8A 3P86A 4P2KA 5T68A 4FV3A 4G3DA 4IVBA 3IW8A 3KF4A 5DPVA 4ACMA 4O7SA 3C1XA 2CN5A 4G2FA 4ZSGA 3W2PA 1Q61A 3G33A 5J5SA 2JAMA 4FEVA 3AC2A 3HUBA 4BF2A 3QTWA 4M7IA 4ANSA 3TUBA 1J91A 4ZOGA 3RAWA 3VBTA 3KF7A 1K9AA 2J0JA 5ANGA 3LPBA 5L4QA 2R7IA 5IQGA 5CANA 4BDCA 4J7BA 1ZY4A 4NFMA 1Q62A 3OOMA 1V0PA 4M0ZA 5AM6A 3E3BX 3MA3A 1YHWA 3ACJA 4NTSA 4FTJA 4U7ZA 4X2FA 5EDPA 4JDHA 2HIWA 2O5KA 2OIBA 1CM8A 1T45A 2B1PA 2C6LA 2ZM4A 4EYJA 3QZIA 2JBOA 5AR2A 3WI6A 1IAJA 3TZ9A 3PVUA 3W2RA 3V51A 3TTJA 2QG5A 4UX9A 2VWZA 4FK6A 2IZTA 3ZO1A 3FMNA 1O6LA 4ENYA 4Q5HA 4QTEA 4Y8DA 2I0YA 2B9FA 4EWQA 3G9NA 2EWAA 4S32A 1RE8A 5TR6A 2PMLX 5EW9A 3WZUA 4F0IA 1LEZA 4IM3A 5M08A 2XNMA 3KGAA 4XLVA 2I40A 3OW3A 4CKIA 3UZTA 3PA5A 2ITUA 3GGFA 2C5OA 4MXZA 2H96A 2WTCA 5LVLA 5TOZA 3A8WA 3QX4A 5CX9A 3TNPC 4E5BA 2UVXA 3LQ5A 4I6BA 2BALA 1STCE 3BHYA 2Y0AA 3UNKA 4DG3E 3RHKA 4BDKA 3M1SA 4NH1A 1GIJA 3TZMA 1BMKA 4BDIA 2CSNA 5EQYA 1OKWA 4BCNA 1KE7A 4IQ6A 4IAFA 4ZZMA 3PWYA 2IG7A 4YTFA 4C4FA 5AP6A 3ZTXA 3V5PA 4RIWA 3RWPA 4DITA 4NU1A 1ZZ2A 4Z3VA 4BIEA 4X3JA 5E9EA 3GVUA 5L8KA 4R78A 4FI1A 1M14A 5BUIA 3LQ8A 5HX6A 1KE9A 2QI8A 3QA8A 1PMUA 3R73A 4RQKA 3KULA 5JN2A 5ANEA 1QPJA 3PVWA 2Q83A 4GS6A 3EQIA 3SD0A 2XM9A 5ACBC 1IAHA 3UDBA 4QNYA 3IW5A 4W9WA 3MFSA 4XS2A 3UNZA 2YDIA 2E9UA 4CV8A 4M69B 2X4FA 4L9IA 2HWPA 4FVQA 5IQHA 3R28A 2I0EA 3LKMA 3CEKA 3RAIA 2OH4A 4YJVA 3AC4A 3PIZA 2R4BA 5M56A 4F1MA 3A99A 3KY2A 4CSVA 4YPSA 2WD1A 3L9LA 4D2VA 3ZHPC 3MFTA 1R0PA 3UOLA 3OY3A 2IZSA 4FTOA 5HCZA 3UYSA 1DI8A 3VW8A 4C38A 2I7QA 1GZOA 5BPYA 4JRVA 4CFWA 4I0RA 4OTQA 4TNDA 4N0SA 4AT5A 2W96B 3F69A 4FEUA 3UZRA 1KSWA 4EZ5A 4WUAA 3ERKA 2A4LA 2PPQA 4NWMA 3PDTA 4EOQA 4AQCA 4GT3A 4GVAA 3O23A 4DTKA 3GCUA 4L67A 5AUVA 2QVSE 3FMEA 3KVXA 3OW4A 4MAOA 5F4NA 4XG2A 5H3QA 3VRZA 5H8GA 3MVMA 3MH0A 4PP7A 1KE8A 1AD5A 4C62A 2R0IA 3SRVB 3VUTA 4DEBA 5L2IA 3HMIA 4FTUA 2V22A 4A4XA 3FHIA 4CTCA 1H27A 2QODA 5LOHA 3CR0A 3DBQA 2JKQA 3GU5A 3QZHA 1W8CA 4IDTA 4S31A 4L01A 4W8EA 3RWQA 1Z9XA 2J5EA 4L3JA 3S4QA 3PPZA 2VTJA 3R9NA 2J50A 1YHVA 3QQGA 4FR4A 4FSMA 4FV8A 2PVRA 4GMYA 2H34A 3BLQA 5JQ5A 3NAYA 4IAIA 4C3FA 4EOSA 4DBNA 5G6VA 3CCNA 3I5NA 5EW8A 3JUHA 4MXXA 3GUBA 3OUKA 2BKZA 4WOVA 3UE4A 5L2WA 3DJ6A 2XNEA 4BCQA 3EWHA 4RSSA 3HEGA 4AT3A 2WPAA 4DEIA 4APPA 3MY1A 2XKFA 2WOTA 5LJJA 2F49A 3K2LA 2XB7A 3COMA 3LFNA 3ORPA 4ZY4A 4BDHA 4U40A 4V01A 5EI6A 4AG8A 4QP4A 1LPUA 2C6IA 3HVCA 3FXXA 2H6DA 3P4KA 4DH1A 1Q8ZA 5IDPA 4YNOA 2QOLA 5L3AA 1YOLA 3G51A 2W4JA 3AGMA 5GJGA 1FBNA 1OL7A 1PJKA 5E1EA 3NUUA 2YLEA 4X6RA 1KV2A 3P23A 2PTKA 3ORTA 4L3PA 4FKSA 3EHAA 4WKQA 5BUJA 4O22A 4QO9A 4BHZA 4TY1A 4EH8A 4HZSA 5CEPA 4C3PA 2ZDTA 3EKKA 4LGHA 2IVSA 3HMOA 3CGFA 5IQCA 4FF8A 2BVAA 3OT3A 4RG0A 5HD4A 4XRJA 3CGOA 3LXLA 4K6ZA 3MN3A 3HDMA 3W2QA 2R9SA 3NW7A 3NNVA 3PP0A 3ZYAA 3QTIA 3O8UA 3Q60A 4I93A 4WNPA 3DKOA 3C7QA 1R39A 3ZMMA 5E8VA 5CEKA 3ODZX 1G8AA 5J87A 4PQNA 4L68A 4CT1A 4RC4A 5IF1A 5GZ8A 1SZMA 4LL0A 4FKPA 1APME 3MGYA 3BV3A 3EIDA 2IW6A 1J7LA 4JAIA 2J9MA 3GFEA 4AUAA 4EH2A 3Q9YA 4OBOA 4BYJA 3EMGA 4YJQA 5AUTA 4GK2A 4PMMA 3TDVA 3EQFA 4DCEA 1M7QA 1U5QA 2YISA 5LQFA 5DT0A 4DC2A 3SKCA 3HP2A 1F3MC 2V7AA 4FIIA 3PZHA 5L8LA 1Q4LA 3NX8A 2PVMA 3EN4A 2YM5A 4OTDA 3IW6A 4K9YA 3VS2A 2OWBA 3RCJA 3EQGA 1CSNA 2WTWA 2C5YA 2HOGA 4BZNA 2HW7A 4Y73A 4FIFA 3E93A 3FPMA 3S2PA 3R9HA 4RX7A 5CF6A 1G5SA 3L9MA 4R5SA 2JD5A 3TUCA 4WG4A 4FKQA 5IG1A 5BYLA 3PFQA 3FKOA 3AOXA 5DRDA 4QNAA 4R1YA 2CMWA 3RMFA 3PJ3A 3CBLA 5ICPA 4BIBA 3RCDA 3A7GA 3ZRMA 3DKGA 4ZK5A 4C4IA 2FO0A 4ITIA 1QCFA 5A6NA 4HPUE 4DGOA 4A7CA 2IVUA 2VTQA 4WBOA 2HYYA 4RWJA 4S33A 5TE0A 4BCOA 4HW7A 3C50A 4O38A 2DUVA 4YHJA 1PHKA 5HO6A 3VS1A 4JT3A 1URWA 4D58A 2J5FA 2P2IA 1ZYDA 3ULZA 2X2KA 4G1WA 5LVPA 3R00A 3D2IA 4AN9A 3N4UA 2YIYA 4QYGA 4D4VA 2ZJWA 5AFVA 2J4ZA 4QP6A 4ANMA 2VO0A 4PDYA 4LOPA 2UUEA 4QP7A 5L6OA 4DH7A 5IA2A 2IZUA 4HGSA 4KS8A 1HOWA 5CU3A 4CV9A 3H0ZA 2AC3A 2GNFA 3CJGA 5E4HA 3WF7A 4O7WA 4IC8A 3ORZA 1UNHA 4G17A 4O1OA 4EH6A 3EN9A 4RFYA 1SNXA 2XNPA 2XNNA 4OTIA 4AW1A 4O7ZA 4F09A 3GEQA 2ZB0A 2VWIA 4D55A 3POZA 2PE0A 1H08A 3GI3A 2RF9A 2BZIB 3BHHA 4Q2AA 1TKIA 3K54A 3OBGA 4EZ3A 4FL2A 4FTTA 5DIAA 2J0IA 4E7WA 1DAYA 5I3OA 2PVFA 4AGDA 5LWNA 5FEQA 3I5ZA 2HWOA 5D9HA 3ZOSA 5J9ZA 3UIUA 4BCHA 3GCSA 5HLPA 3A2CA 4ACGA 1FVVA 2XK8A 3EOCA 5K4IA 2B7AA 2YEXA 4IX6A 4FKRA 3R1YA 2DQ7X 4I24A 2C6TA 4PL5A 5IA0A 3RTPA 5AUZA 2QHMA 5EHOA 4BDBA 4EI4A 4M12A 2IZRA 3UMWA 3PSBA 5J7BA 5HE3A 2X4ZA 3D9VA 5M53A 3NPCA 4GK3A 3SG8A 2C1AA 1J1BA 4AN3A 3MW1A 2HK5A 4U42A 3KRWA 4XX9A 1SVEA 1F0QA 3OBJA 5G1XA 3KFAA 4BTKA 1UNLA 4YZCA 5E8XA 1FVTA 4NKSA 5DFPA 3HYHA 2PULA 3QC4A 2X7GA 2ITOA 4FV4A 2NP8A 3KXNA 4IFGA 3QFVA 2J6MA 4IIRA 3GBZA 4HGTA 5CLPA 4FIGA 3W18A 5IQAA 4W4YA 4CD0A 2W99B 3FKNA 2B53A 2YDJA 4M69A 4IBMA 4LQMA 3FZRA 3MB6A 3FQSA 4QP3A 1FPUA 4CZUA 4YO4A 4ZSLA 4BB4A 5IA4A 3ZC6A 4E5AX 4RQVA 3DAKA 3NUPA 5M4FA 3QQLA 1XBBA 4FNXA 1Y91A 2V55A 3IONA 4IE9A 1JNKA 3R22A 4IVDA 3FXWA 5CI7A 3V8WA 2QNJA 5CAUA 3LFEA 4UMTA 3VF9A 4WNMA 2VWWA 4DH8A 4L52A 4CCBA 4UXLA 4RX8A 3SDJA 2VTNA 3RPSA 3A61A 4YZ9A 4DHFA 1DS5A 3MY0A 3HV4A 1YXUA 3M42A 4GEOA 5L8JA 4EH9A 2PYWA 5HORA 1YKRA 3FV8A 2QOHA 5JRQA 2IW8A 1KE6A 3FL5A 3CC6A 2PE1A 4BICA 4FOBA 2OO8X 2RG6A 2BHHA 1O6KA 2F9GA 2Z60A 2UW4A 3SRVA 5KMJA 4BTMA 3BLHA 4ANNA 3QHWA 2H8HA 3KB7A 3Q6UA 3QL8A 4XBUA 3OG7A 2J90A 3R7YA 5HVYA 3E3PA 3GT8A 2HZNA 5GZAA 2GU8A 3EFKA 3VO3A 3QRJA 4TYEA 3KK9A 2OI4X 2J0KA 4MXAA 2GQSA 3P7AA 3KRXA 3SC1A 4EJNA 3W2CA 4ITHA 4UALA 5BMMA 5C27A 3CKXA 5DYJA 3W8LA 3F6XA 2Z8CA 4YLKA 4GVJA 2Y4IB 2KTYA 4HOKA 2UW6A 4K8AA 5FM2A 4QMUA 4AZVA 4YMJA 1PF8A 4GUBA 2G9XA 3Q3BA 3CQEA 1J3HA 2RL5A 2XRWA 2R3HA 1A06A 4IH8A 3WF6A 1YXSA 2YLFA 4JOAA 4BGHA 4E20A 4WBBB 4BR3A 4ZLOA 4BWXA 4K2RA 3V01A 3SA0A 2EXEA 2I6LA 2ITQA 3G5DA 3DXNA 4A06A 4L8MA 4D2RA 4D4SA 3NS9A 5F20A 3UQGA 4PTCA 1GIHA 2OJJA 4CFVA 4CYIA 3DK7A 4FEWA 2OK1A 2R7BA 2Z2WA 4OBPA 3ETAA 4QD6A 3W32A 4I0SA 4UY9A 4AS0A 2HAKA 3O50A 3F3WA 4RIYB 5HG8A 2YCQA 4JDJA 4YJOA 3ZLXA 5DG5A 4C58A 4QOXA 1JSVA 2HZIA 1OL2A 3NCGA 4FYOA 4RA5A 2BUJA 1GY3A 3IECA 2WQBA 3IK3A 2QLUA 5K5NA 2X8EA 4RVLA 5CZHA 4ZTLA 2ZM3A 3VS0A 2GNGA 5M07A 2PMOX 3OVVA 2QOQA 3AC5A 2UW5A 4R3PA 4A4LA 4A07A 4JL9A 3S1HA 3ZO3A 3GC9A 3VNTA 4AGCA 3IDCA 4NEUA 5GZ9A 3HP5A 3JY0A 5CAQA 4C37A 4LV5A 2IWIA 4E6CA 4AA0A 2ITPA 5KMOA 4FUXA 4WNOA 1PKDA 2UW9A 3RK5A 4HYSA 4PV0A 4XHKB 4Y5QA 2VTMA 1KWPA 1FGKA 4F0GA 3A7FA 4EJ7A 2P4IA 3G0FA 4RVMA 1M2RA 3G0EA 2E2BA 3E8EA 4C61A 3O0GA 4Q5EA 4KIQA 4F0FA 1XWSA 1YQJA 3UO4A 2BAKA 1PYEA 4DA5A 4QMSA 1A48A 3LFBA 3MPTA 1UNGA 4BZOA 2IO6A 1V1KA 3NUAA 1K3AA 3FXZA 2XIXA 3LFFA 4AZEA 4PNKA 1H07A 4WNKA 3EQPA 3RBWA 2GQRA 2FUMA 2GSFA 1M2QA 4HYIA 4FSUA 3H30A 4H58A 4PMTA 1JAMA 2V5QA 4XH6A 5FDXA 2PMNX 4B8MA 4EZ7A 4EH4A 3KK8A 3TDWA 4CEGA 5EOBA 5EYKA 2XZSA 5FG8A 3CP9A 4O82A 2JBPA 2CNUA 5FQDC 3AGLA 3AQVA 4KINA 2XS0A 4QTBA 5DGZA 3HLLA 4Z7HA 5FXRA 3BWJA 3FPQA 1GZNA 2F2CB 3MH3A 2C30A 5IUGA 2FH9A 1YI3A 5KUPA 4YZBA 3Q9ZA 1H0WA 2BFYA 1W0XC 3O8PA 4HPTE 2X8IA 4FV5A 5IPJA 3F7WA 5FTOA 3SXRA 5AUUA 2FSLX 2R3PA 1KOBA 3AD4A 3HRFA 3ZRLA 1YI4A 2WTJA 3FMDA 4E4MA 4O7VA 3ZUVA 1BKXA 2G2HA 4BDEA 1SVGA 5I9YA 2Y9QA 2REIA 5JGAA 3V5TA 1BX6A 2PZPA 1GNGA 3HMPA 4RWKA 5A46A 5B2LA 2OF4A 2QCSA 3SHEA 3EN5A 2BZJA 3NMUF 4G6OA 3QTUA 5J5TA 4MXOA 3R1NA 1YDRE 3KXMA 3TUDA 4R3CA 3UOHA 5FLFA 3AD6A 3DNEA 2R64A 3GXLA 3OOGA 4GG7A 4IC7A 1QL6A 2GHLA 2Y4PA 4ZTSA 5HHWA 4QP9A 1REJA 1UA2A 4JG7A 5DR6A 1R1WA 1QPEA 3QU0A 4KSQA 4RRVA 4BI0A 2HZ4A 3OXTA 2BAJA 4TXCA 3ZZEA 3ZO4A 3GC8A 4M84A 1GAGA 4KKEA 4QMMA 4WSQA 4OLIA 1PXMA 4IB1A 1NVQA 2ZV8A 4IAZA 3OS3A 2KULA 3D2KA 3FQHA 3I4BA 2B9HA 4FMQA 2VTTA 2FSTX 3L9NA 2XVDA 2C6KA 2ZMCA 3WIGA 3HA6A 4CRLA 2PUNA 4EHEA 2WO6A 2VZ6A 2O3PA 3AT3A 4CFUA 4K0YA 3RZFA 4I5MA 2UVYA 4QRCA 2QLQA 2PSQA 1KV1A 4IX3A 4XOZA 4ACDA 4O0UA 2VWYA 5ETFA 4M14A 3WE4A 5HE2A 4OR5A 4L00A 4UN0C 4Z55A 4MD7E 2VTHA 2HW6A 2X7OA 3TZ8A 4AX8A 4TYHB 3HV5A 2G2FA 5CXHA 4G3EA 4NKAA 4PDSA 3FUPA 4YLJA 4RC3A 5HGIA 4BKJA 4P90A 4C36A 4E1ZA 3GNIB 4EHGA 3DB6A 1JVPP 4OTRA 4QMZA 3V5LA 4MD8E 5HIBA 1MQ4A 4ZXTA 4DN5A 3DLSA 4JNWA 2OFUA 5B2KA 3HGKA 2GQGA 2Y7JA 4IJPA 2BDWA 3ZLSA 4QMPA 5IU2A 2HY0A 4R3RA 4RPVA 4F1OA 2WQNA 3R21A 4IW0A 5EM5A 3R71A 4FSNA 3BGQA 4OUCA 3RPVA 5M06A 5AIKA 5JMSA 2CN8A 3TIZA 4PPBA 4JJRA 4R7IA 3U9NA 4FUYA 4G31A 5B7VA 1OPJA 4O86A 4M8TA 4RJ3A 1NA7A 2GNHA 3NUNA 5TKDA 5CEOA 3MH1A 5FUTA 3NUXA 4CCUA 4FTIA 4C7TA 3FY0A 3L1SA 3ODYX 3HL7A 2GS6A 2P55A 3OXZA 4I20A 2WMWA 4XP0A 4CMOA 5HQ0A 4N57A 1PXIA 3R7IA 3DJ5A 4AOJA 4D9UA 4MXCA 2C6DA 2W05A 3TXOA 4DEEA 4DFUA 3FLYA 5HCYA 3OHTA 4EHVA 5A9UA 3RJCA 5CVHA 1P4OA 2UVZA 2ITWA 5HICA 4UXQA 5DE2A 1R0EA 2GCDA 4D2TA 4QMVA 2WEIA 4F9BA 4CRSA 4ZZOA 4Z9LA 2ITVA 4G9RA 3Q4TA 2VO7A 3QD3A 4FZAB 3VWAA 1ZRZA 4C4EA 4KD1A 4E93A 4AE9A 1XH9A 4G9CA 4RZWA 1OZ1A 4IM0A 3F5GA 1S9IA 3JVSA 1WFCA 3ZSIA 2IJMA 2XKEA 4QMNA 2Y4IC 3F88A 3HV7A 2GNLA 2QOFA 1YXTA 2C0TA 1YDSE 2HELA 3E62A 3IKAA 4I5CA 5HTIA 2PVYA 4O7YA 2CKPA 4ORKA 2NRYA 3T3UA 2ETKA 4U45A 1GJOA 1JKLA 3ULIA 4C33A 4YO6A 3R8ZA 3I1AA 4QQTA 4O0XA 3KXGA 1JKSA 2WMRA 3PLSA 4ZS0A 3UO5A 4WO5A 4GFOA 3VS5A 4LRKA 2V0DA 4WG5A 3BLRA 4KWPA 3QGYA 4A9SA 2JC6A 5IZFA 4ASXA 1YHSA 2BCJA 2HXLA 2VTLA 3PIYA 4QP2A 3C4FA 4ASDA 3PA4A 3BX5A 2RGPA 4FT9A 3RNYA 3DTWA 5HD7A 3H9RA 1E1XA 4O0VA 2PUIA 2Z7SA 5AP3A 2VTOA 2B0QA 4ZY5A 4FKGA 2R3RA 4IWQA 3BCEA 3RAKA 1XH6A 3DS6A 4NK9A 3ZFYA 4MBIA 3Q4ZA 3G90X 1Q3DA 3HV6A 3LZBA 3ROYA 3FYKX 4PRJA 3OF0A 4IJ9A 4QTCA 4MK0A 5FM3A 4PF4A 1IASA 2YIXA 5DNRA 4O81A 4DLJA 5D41A 1Y8GA 2RFDA 3PYYA 4I4EA 3U8WA 2QD9A 2A19B 5CS6A 4AGUA 1OKYA 4E26A 3BU3A 3G6HA 4D9TA 4FZDB 3FAAA 4J52A 3HMMA 3FMKA 2NO3A 2W1HA 3LAUA 2R3OA 3NNWA 3PP1A 2GHMA 5L6PA 3EYHA 2C69A 4FSTA 4ZLZA 3PXRA 5DEYA 3I79A 3I7BA 5GJDA 5M57A 3WARA 3NRMA 1XH7A 3DT1A 4WA9A 3OEFX 4HVSA 3WBLA 2DS1A 2JIUA 4QP8A 3JPVA 2YHVA 2PY3A 4GL9A 4P5QA 2YIQA 4J98A 4WUNA 3ZU7A 4RIYA 3Q6WA 4HGEA 3BHVA 5M51A 5CASA 1OECA 1WBNA 5HEZA 1ZYCA 4ZTRA 1OGUA 4Y85A 3OC1A 1U59A 1TQMA 3F66A 3QTZA 5J1VA 4YZNA 5HO8A 3SLSA 5C4LA 4R1VA 4IHPA 2GTMA 5EI8A 3ZUTA 4CFXA 4FKWA 4FSWA 1IEPA 1LP4A 5AADA 3VJOA 3NW6A 1P14A 5HESA 3HZTA 5AIRA 4IB3A 3P79A 2XYNA 2ITNA 3E5AA 4M13A 3LJ1A 1OIUA 2UZUE 3CTQA 3U6IA 1YDTE 2C6OA 3R6XA 4I23A 4C35A 3UG2A 2O0UA 3PY1A 3B8RA 3DFAA 2UW0A 5IQIA 3Q5IA 4GRBA 2W1FA 3PRFA 4XYFA 3FZOA 3UYTA 4K33A 3PZEA 3N4TA 3VUGA 4RIXB 2OW3A 4DFLA 2XK9A 3D7TB 4C0TA 2OFVA 1ATPE 1JOWB 4GU6A 5HU3A 5AP4A 4ANLA 1AQ1A 1AGWA 4JG6A 4OTHA 4PPCA 1PMEA 3FZTA 3QLGA 4FZ7A 4CLJA 3WZKA 2RSVA 4FC0A 3OEZA 3R9RA 4J53A 1UKIA 4UEUA 2JDSA 3AMYA 2WEVA 3MI9A 3NNUA 3R8MA 4FODA 2C6MA 2OKRA 3FI2A 2GNJA 4AA4A 3KCFA 4FX3A 3MFUA 4H36A 4Y46A 2R3KA 5HI2A 2CJMA 2ZAZA 3P7CA 3QTXA 4MD9E 3UIMA 5AAGA 3BU6A 1IA9A 3SXSA 5FTGA 5AAFA 3PJ1A 4B8LA 4EOJA 3R8UA 3VULA 2BDFA 1OUYA 4UBAA 2F57A 1H1RA 2Z7LA 3QD0A 5IEXA 5ETCA 2YACA 2XF0A 2WIHA 3DJ7A 5A4QA 2YWVA 4ZJIA 3DCVA 4F9YA 3ZCLA 2YZLA 4EK4A 4DTAA 2VV9A 3MB7A 3WZJA 4X2GA 4FV0A 4NCTC 2C1BA 3ZM4A 5KBQA 4J8MA 5JZJA 3DBDA 5EG3A 4CTBA 3FLQA 1H4LA 4C2WA 5CAVA 5IQFA 2HXQA 4P4CA 1B38A 1RJBA 2XA4A 4DE4A 1VR2A 2F2UA 2A0CX 2YCRA 4BN1A 4FV2A 3QYWA 4UYAA 2WELA 3D15A 5HIDA 3EQRA 2WU6A 3QQUA 3AC3A 3OP5A 3MFRA 3QGWA 4O6LA 4A9TA 4UMUA 1WBVA 5EH0A 4M68A 4LMNA 4GJ2A 5LCKA 2PHKA 3EQDA 2B54A 1DAWA 2CGUA 4GIHA 4AAAA 4X2JA 4AWIA 1UU3A 3FLNC 4DCAA 3O96A 2YM3A 3CIKA 3MYGA 4GT4A 4I21A 4FKUA 4JR3A 5CZIA 3T9IA 3TWJA 4ZLYA 5LWMA 3P7BA 3D4QA 4ERKA 4XMOA 4R8QA 4X0MA 3MIAA 4FKLA 4FV7A 5AP0A 3AC1A 5IA1A 1JWHA 3G2FA 5KKRB 5FBOA 4JBOA 5FEDA 4NCTA 3NZ0A 1P4FA 4H3PA 4XG7A 3EL8A 3FDNA 4MF1A 3SOAA 3EL7A 3TTIA 5KHWA 3FC2A 5H2UA 3KKVA 5FRIA 2W4OA 5DHJA 4RC2A 2W1DA 2W9FB 3LFSA 4WRSA 2B9JA 4LMUA 3ZO2A 4I41A 2W1ZA 4TYHA 1FGIA 3BELA 2C3LA 1P2AA 4F7LA 4U97A 5A3XA 4GIIA 1H1WA 3VC4A 3MIYA 1I09A 1NXKA 4I5HA 4YBKA 3QAME 3PJ2A 3VBXA 5ANJA 4BKZA 4NIFB 1ZY5A 4BDGA 2VU3A 3FY2A 4N6ZA 4EKLA 3UOKA 2NRUA 2X6DA 4FIJA 3E8NA 4AA5A 4QMQA 5IMEA 4EOOA 4AN2A 1UU8A 1H0VA 3LJ2A 4AACA 4USEA 4RX5A 5E92A 1HCLA 2ZV2A 1ZMWA 2X81A 3BYSA 4YJNA 3UQCA 4F7JA 5K4JA 4YTIA 5CF5A 1Q3WA 2XM8A 3R02A 4W4XA 4ZJJA 3GOKA 4TZRA 3VBYA 2ZDUA 3PJ8A 3FYJX 5AWMA 4YLLA 4EONA 4RX9A 4ZAUA 3LLAA 2CHLA 4DEDA 5CU2A 4HYUA 3D5XA 4XJ0A 1Z57A 2ZM1A 4OTFA 3SOCA 2X39A 2XP2A 3CS9A 2QKRA 3LFCA 5L2SA 4BWPA 2RFSA 4ID7A 4FSRA 3E8CA 2C47A 1WVYA 3QUDA 3OD6X 3E88A 3KQ7A 4BCFA 2VRXA 3MA6A 1B39A 2WQEA 2ETMA 2C3KA 4FIHA 3DV3A 3FMLA 4BI2A 2JKKA 3CD3A 5LVMA 4ASZA 1JLUE 4DG0E 3G9LX 2JIVA 1OUKA 1WZYA 2BIYA 4YR8A 4CYJA 4FKVA 5KMLA 5CVFA 4BDFA 3ZZWA 5L2TA 5DBXA 1H1PA 3UPZA 3NYXA 3DKFA 5LARA 5A4CA 3DU8A 1OPKA 4AGWA 4IWDA 3Q2JA 3O51A 3VBWA 5CY3A 3F2RA 5A4EA 5T6KA 1CKJA 3AC8A 2OH0E 4F99A 3R30A 3PPJA 2UZTA 3TCPA 1Z5MA 2PVNA 3QUEA 4QMYA 4KIPA 2X9FA 2Y6MA 3PWDA 4YUQA 2C5NA 1YI6A 5AUYA 3TV4A 4NM5A 2VWVA 2XBAA 5F94A 5AV0A 5C8KA 2GTNA 4RMZA 3FJQE 4TRLA 5BVKA 4LL5A 4RLKA 5ANKA 5E8YA 2IW9A 3QKMA 3RALA 1MQBA 3IPHA 3ZXZA 4LRMA 4TWNA 3ENMA 3UJGA 4KIKB 4APCA 2CPKE 5DLSA 4GKIA 4YGAA 4KBCA 4ZY6A 3RGFA 3WIKA 2CNQA 4YJSA 4D2WA 4H3QA 3Q4CA 3U6JA 5GIOE 3GC7A 4RBLA 4NM7A 4EOIA 3F5UA 2G2IA 4ZSEA 4F4PA 4EHZA 4MQ2A 4NSTA 3CTJA 3C0GA 5EW3A 3LMHA 4FVRA 3W33A 1OI9A 3E64A 4QMWA 3VF8A 4O84A 4FOCA 4PWNA 4IAAA 2C3JA 2QO7A 2BKKA 2O8YA 2EVAA 3BEGA 4KAOA 4MF0A 4ZZNA 2CGVA 3PVBA 4W8DA 4E73A 3C13A 2UZBA 2XIYA 3F9NA 4II5A 2QO2A 1BI7A 3CQUA 1XJDA 4DTBA 2VX0A 4N6YA 5CAPA 5D10A 4BKYA 2PVKA 5AMNA 4O0TA 5AR5A 1PYXA 2VTRA 4NT4A 5AV1A 3CTHA 3IQ7A 5D11A 4AE6A 3ZXTA 3HRCA 3BWFA 2XIKA 4DF3A 3QKLA 3PLAE 1L8TA 5ETAA 5TT7A 4BYIA 1OIQA 2QOCA 2Z7RA 4HNFA 1Q8TA 1H00A 1QPCA 4FG8A 2BAQA 4FKOA 1BI8A 2H9VA 3BBWA 3PXYA 4KABA 1OVEA 5EM8A 2WNTA 3QKKA 4FTLA 4B6LA 3EH9A 4GK4A 1YOMA 2R5TA 2YCFA 3DPKA 3ORNA 1JSTA 1KUTA 5D7VA 3VUKA 3C0IA 5LMAA 2C0IA 3I0OA 5AEPA 5EKNA 3FMMA 5KMKA 2ITYA 3HECA 4AOTA 3PSDA 3HAVA 3QUPA 3LCKA 4RIXA 5KMMA 4GT5A 4FL1A 2W0JA 5DEWA 4D1XA 3EKNA 3D7TA 1M7NA 3ACKA 5ACKA 1F5QA 3OT8A 4USFA 1DI9A 4CQGA 4XV9A 4DLIA 3BEAA 3OCTA 5EYDA 5FP6A 1R78A 3LE6A 4BTFA 3EJ1A 4BCIA 3MVJA 2ZV9A 2GMXA 4MCVA 3KA0A 2BRHA 3LFQA 3MJ2A 4ZIMA 2OZAB 1NVRA 5A14A 2GS7A 4EOPA 1I44A 3VN9A 2C6EA 4QYFA 3I60A 3R7EA 3BHUA 4IB0A 4DEGA 4EOLA 4JQ8A 1Q5KA 5AM7A 2GS2A 3TKUA 4JS8A 2FB8A 3QXOA 3QXPA 5KE0A 2X2LA 4ERWA 2XIZA 5CSVA 3COHA 3ORXA 5JFVA 1URCA 4N70A 4XG9A 2O65A 4DGLC 2WKMA 3B2WA 4YC3A 2J51A 3I6UA 5HIEA 5JKGA 2EUFB 5KKRC 4BDDA 1P5EA 2RG5A 3ROCA 1WBOA 3BGPA 4I3ZA 1QMZA 1SM2A 3CY3A 1LR4A 1OITA 2X1NA 3BPRA 3II5A 4IADA 4XG3A 5FXSA 3U87A 3BV2A 3EFWA 4XP2A 3KL8A 3HKOA 5A6OA 1VZOA 2DWBA 2PK9A 2QONA 4FBXA 3RVGA 4BWKA 2YIRA 2EU9A 3A4OX 3KU2A 4F65A 2O2UA 3F5XA 2UW7A 5CNOA 3V5JA 4AZFA 4R77A 3RZBA 5ANIA 4DFNA 1GZKA 4XOYA 3NVKI 4XG4A 4XCUA 2OJ9A 2GNIA 4BRXA 4TW9A 3E8DA 5HTCA 3R04A 4FT3A 4HJOA 2VX3A 3QCSA 4JXFA 1H24A 4P5ZA 3TEIA 4M3QA 3NNXA 3JR1A 5KZ0A 3MVLA 2G15A 1NW1A 1REKA 4U5JA 5CU0A 3VUMA 3QD2B 1U54B 4C02A 4EBVA 2W5BA 4XG8A 5DT3A 4D28A 4BHNA 3HMNA 3IG7A 4D2PA 3LCTA 4IACA 4KB8A 5GHVA 3QCQA 3SG9A 3L8SA 2VTSA 3VHEA 3VAPA 4MVFA 5AX3A 2BRGA 2C0OA 3GCPA 4GYGA 4CMTA 2EB2A 4I6FA 2IVTA 2OIQA 5CWZA 5CAOA 1OM1A 1UU9A 2GHGA 1W7HA 4MH7A 3W2SA 3HX4A 3MDYA 3QQJA 3TACA 4DGNA 4K77A 3EZRA 2PZ5A 2SRCA 4X3FB 3ORMA 3F3UA 2ZV7A 3N9XA 1G8SA 5EDQA 3PY0A 2UZOA 4F6UA 4FE2A 5IUHA 4HZRA 5JK3A 4YNEA 2PVHA 2W06A 4ZS4A 2OJFE 2VWUA 3NVMB 2YERA 3SW4A 4U80A 3MS9A 5A4TA 2JAVA 3GU6A 2JGZA 5FBNC 3MTLA 3A4PA 4IEBA 2C5VA 3CY2A 4FTMA 4O0YA 5A4LA 4C4JA 5C26A 1H01A 4EC8A 4CVAA 4FV9A 5HX8A 2B52A 2OLCA 4WT6A 2XK7A 5AJQA 4PP9A 4JDKA 4RJ7A 5EYCA 3UG1A 4A9YA 2VWXA 5CVGA 4D4RA 4KA3A 4A9UA 2OGVA 2WQOA 4FSZA 2UV2A 5AR4A 3AXWA 4TWOA 3A7IA 5AV4A 3CXWA 2YABA 3CJFA 2AUHA 4Y72A 2W1GA 4B0GA 4EORA 2XH5A 4B9DA 4PDPA 4Y83A 5T3QA 4BGGA 5CALA 2BZKB 5C8MA 4M15A 2PZIA 2JITA 2JKMA 4X7QA 4E6AA 5DRBA 4EUUA 4PPAA 4O7NA 5CT0A 3P1AA 1YRPA 2R3IA 4IAKA 1WCCA 2AYPA 2ZYBA 3DGKA 3GU4A 5BUEA 1NVSA 3POOA 3QZGA 3IDPA 4G6LA 4RIOA 1K2PA 1NY3A 1OKZA 4ACCA 1ZMUA 3U4UA 4CFMA 3QC9A 2F4JA 3I81A 4AFEA 4HVDA 5IH5A 1VJYA 1MUOA 1WMKA 3NSZA 3TT0A 4PUZA 3QWJA 4LOOA 5LMKC 3BE2A 3ATSA 4TT7A 4RVKA 3ID6C 3S95A 3ZSHA 2WHBA 4XV1A 1JKTA 1H8FA 1BL6A 3Q52A 4J97A 4X21A 4EK5A 4IWOA 4IFCA 4CG9A 3PA3A 5HNBA 3M2WA 4NJDA 1OPLA 5JGDA 1Q24A 3GQIA 2EXMA 2VGOA 3KXXA 3RK7A 2JKOA 3UP7A 4CG8A 2PUPA 5JH6A 4KIKA 3KXHA 4ZMEA 5JFWA 3VUDA 3Q5ZA 3Q9XA 3H9FA 3DZQA 2QHNA 4UB7A 4D2SA 3QRTA 1PKGA 1Y6BA 2PUUA 3HNGA 4I94A 4J95A 4EWHA 5E7RA 3BU5A 1U5RA 4NZWB 5AV3A 4AF3A 2GPHA 5GINE 4RT7A 4V0GB 5BMSA 1W83A 3L8XA 4WD5A 5HVKA 3NCZA 3UIXA 2XK6A 4XP3A 1ZYJA 3UVPA 3ELJA 4OAUC 3W1FA 4MHAA 3GCQA 1Q8YA 5M09A 3FBVA 4TYIA 5GJFA 2BRNA 2VGPA 2YM7A 4QPMA 4YZMA 4ZTHA 5IEVA 5LMKA 4OT5A 4GKHA 4C4GA 4EK8A 4CFFA 1FOTA 4ARKA 2VTAA 1PXNA 2WMVA 4FEQA 3LW0A 3BQRA 3ORIA 4Q9ZA 2JEDA 4NM0A 1OBDA 3CLYA 1YW2A 2B4SB 3QTSA 4FVPA 2WB8A 4FTCA 2UW3A 4JR7A 4LG4A 4MBLA 4OGRA 4UMQA 1TQPA 4UMRA 2EXCX 3P08A 5KHXA 1BL7A 2WTIA 5JT2A 4DFBA 4UZDA 2BR1A 5AP1A 4N4SA 2BIKB 5TF9A 1MRUA 4EYMA 3O71A 4U9AA 2RFNA 1UWJA 2R3FA 5FWKK 5J8IA 4PL3A 4FNZA 4G34A 4FTKA 4FEXA 3BYMA 3VVHA 3ALOA 4GUEA 3PXKA 3V8TA 3V8SA 5JGBA 3ORLA 2CNVA 1KOAA 1SNUA 5TO8A 1UKHA 3Q4UA 3D14A 3R8LA 1H1SA 3LFAA 5CSWA 4XLIA 5CTPA 1B6CB 1FMKA 2OSCA 3F2AA 3NYNA 4EKKA 3NYOA 3P0MA 4BCGA 5CSPA 3S00A 1ZMVA 2FVDA 3BKBA 2VWBA 4L7FA 4C57A 3W2OA 5LVNA 2C5XA 2QU6A 2P2HA 4RJ8A 5FP5A 4ZTMA 5IDNA 2ITXA 4U79A 1OL5A 4GCJA 4C59A 3BGZA 5EK7A 4FV6A 3A8XA 2ONLC 1MRYA 2CKEA 3LCOA 1L3RE 3PXZA 4OBQA 1OBGA 3LFDA 3TL8A 4G3FA 3ANRA 3C5UA 4S34A 2VD5A 1G3NA 4U8ZA 5IA5A 3ZLYA 2HCKA 4YC6A 3V6RA 4J8NA 1YXVA 3CQWA 3LCSA 5FXQA 2WXVA 2XJ1A 3ZDIA 3MPMA 4L42A 4O2PA 2BFXA 2OZAA 3FC1X 4OW8A 3KMUA 4O7TA 2R3JA 4FTAA 2X9EA 4YJTA 3TNWA 1DM2A 2R0UA 3WILA 3VQUA 4MXYA 1CTPE 3S3IA 2XNBA 3DFCB 3FZSA 5M4IA 4XV2A 3H9OA 2OJIA 4E6DA 3RM6A 4I92A 4IANA 2PU8A 2OIDA 3LLTA 4TNBA 3EQBA 3NUSA 3LQ3A 1XH8A 3BYVA 2PVLA 4RFZA 2XNGA 5BVEA 2GFSA 3ZDUA 4EUTA 2ONLA 3QRKA 3FLZA 4AFJA 1H1QA 3VS3A 5EI2A 4IX4A 5BYZA 2IPXA 2W5AA 2XEYA 3TKIA 2YM8A 4DEAA 2R3GA 2WTDA 3GB2A 2B55A 4NW6A 2IN6A 2XJ2A 5AP2A 2UW8A 4IAYA 4JIKA 5IUIA 4LUDA 5E8TA 3OTUA 3QCYA 4IZYA 4OTGA 2JFLA 3MVHA 4X3FC 1OMWA 3HDNA 4QPAA 2ACXA 5J95A 3IW4A 5HBHA 3RPYA 3F2NA 4D0WA 4YJRA 3E63A 4QYYA 2VN9A 4WIHA 1J7IA 1VYWA 3SQQA 4H3BA 2XK3A 5AR8A 3TG1A 3MPAA 4RZVA 5JFSA 2RKUA 2YJSA 3DLZA 3VS7A 3OCSA 2HY81 4QYEA 5M4CA 4XRLA 3BBTB 3UC3A 5C4KA 4IZAA 1U54A 4HCUA 2X7FA 4AP7A 3K5VA 3FZ1A 3Q04A 5HZNA 3UIBA 5FDPA 1ND4A 3FMHA 4ZTNA 3C4CA 4G3CA 3LMIA 2Q0NA 2BROA 2C68A 3ET7A 4GYIA 4HYHA 4QMTA 2WFYA 4G16A 5EDRA 2WMSA 5L6WL 2E9PA 4BDAA 2WMBA 3PXQA 5I0BA 4DFXE 2P3GX 3U4WA 3FHRA 4CNHA 3SVVA 4J96A 2W4KA 4GFGA 1UV5A 3RI1A 2W5HA 4A4OA 3D5WA 3U54A 4X3FA 3PJCA 4U81A 1Q97A 2G1TA 3T3VA 3UVQA 3QCXA 5I9XA 5EQEA 2OJGA 3D5VA 3PPKA 2OXDA 4IMYA 4LOQA 1GZ8A 2QURA 2VTPA 3PIXA 4RVTA 3THBA 3QRIA 1E1VA 4K18A 4L6QA 3R8PA 4DGMA 3KC3A 2W9ZB 4LRJA 4CKRA 4DT9A 4RWIA 2J2IB 3RK9A 3PSCA 4FT0A 4LFIA 4U0IA 4HVIA 2R3MA 3AD5A 5BYYA 4XBRA 2I0HA 3VUHA 4BFMA 4QQJA 4NL0A 3D0EA 4EOMA 4AT4A 2E9VA 3BIZA 4LV8A 2LAVA 3UNJA 2G01A 3UQFA 2V7OA 4MEDA 4Y95A 5ETIA 3U6HA 4C3RA 4RJ6A 3MJ1A 3AG9A 4KRCA 4IM2A 3L8PA 5E8WA 5HOAA 4E6QA 3U51A 4TWPA 3R9DA 4DFZE 1Y8YA 1PMVA 4LYNA 3EFJA 3FEGA 3Q53A 4BC6A 3QD4A 1OKVA 4K11A 1O6YA 4PY1A 4GFMA 4TTHB 3REPA 5F95A 4ASEA 2XK4A 3FL4A 3B2TA 3ZH8A 4MWIA 1FINA 3V6SA 4O96A 1W82A 3BZ3A 4TN6A 4ZTQA 4D5HA 5EOLA 2WMXA 2QKWB 3EQHA 4KIOA 3DQXA 5CEMA 2QR8A 4QTDA 3OY1A 3F3TA 3P9JA 4MBJA 4JI9A 4CZTA 5B2MA 3F82A 3BRBA 3AT2A 2F7EE 1IR3A 1SYKA 3DXPA 2XEZA 1U46A 3NIEA 3PG1A 3QX2A 4GSBA 4PTEA 4TYJA 4RFMA 2ZVAA 1IRKA 5HTBA 1S9JA 3CPBA 5DR9A 4FT7A 5GNKA 5BVDA 4O83A 2J0MB 5EM6A 3OZ6A 3AMBA 4AW2A 3R83A 2EB3A 4J71A 4H05A 5GIPE 4O6EA 5IH4A 4QMLA 3TZ7A 1Q8UA 2O63A 4KSPA 3T8OA 1ZYSA 5IMXA 5IEYA 2OXYA 4BY9E 5CYIA 5E90A 1WBSA 3CPCA 2OG8A 4IVAA 2XCHA 4F6WA 5KNJA 4OAVB 4PX6A 3SW7A 4JX7A 2BZHB 4FKJA 1V0BA 4DAWA 2WZJA 4CMUA 3LXKA 3VHKA 4FTRA 2VO6A 4ANBA 1SVHA 2I0VA 4FSYA 2FYSA 1UVRA 3DB8A 4G5PA 4RWLA 4V04A 5JFXA 3A62A 2X2MA 4CXAA 2BHEA 2VUWA 3GC0A 3UPXA 5JQ8A 1XKKA 4W4WA 1PXLA 2JIIA 3UZPA 4ANOA 5I9UA 1O9UA 2QOIA 4JX3A 5AV2A 5HNGA 2XUUA 4D4YA 4YBJA 4PL4A 4V0GA 1PXOA 3OMVA 4UV0A 3DQWA 4MNFA 5CNNA 5AX9A 1OB3A 5FTQA 5M55A 1WAKA 4FV1A 4BCPA 4BI1A 4M97A 5HBJA 3AT4A 5CT7A 5AR7A 4HVHA 4EEVA 5F9EA 4H1JA 3C4XA 1OL1A 3VQHA 2XRUA 4G6NA 4D1ZA 4R7HA 3QF9A 1PMNA 4EL9A 1XH4A 3TIYA 3ANQA 4AU8A 3F5PA 1RDQE 3R1SA 3V5WA 3JVRA 2YITA 2LGCA 3FMJA 3ZS5A 2ITTA 4ALUA 1HCKA 3UTOA 3NWWA 3WZEA 4YPDA 4DEHA 2ITZA 4NW5A 3T9TA 3ALNA 3RAHA 3HUCA 1YWVA 2Q0BA 4Y5HA 4KKGA 4O91A 5CI6A 4RJ5A 3O7LD 3SXFA 4R5YA 5CEIA 4X2KA 3BQCA 2O64A 3O2MA 3O8TA 5LCJA 5C03A 5I9WA 5J9LA 2QQ7A 4BCKA 4EH7A 4IWPA 3WYXA 3O17A 4O21A 2CDZA 3TV7A 3C5IA 4WRGA 3DAEA 5CSHA 3FSFA 5KX8A 4L45A 3UC4A 1PXKA 1QPDA 1J7UA 3DXQA 4R7BA 2P33A 5AP7A 3JY9A 4TPTA 4F9CA 3JXWA 4FICA 4XNEA 2FSMX 4YTCA 1H25A 4JBVA 4K1BA 3DAJA 2FGIA 2WTVA 2OU7A 2HZ0A 5DN3A 1W84A 3NEWA 4YJPA 4I22A 4Q9SA 3LHJA 5LXMA 3ZFMA 2UZDA 3R2BA 3FWQA 2UZEA 3G6GA 3KRJA 3KXZA 4U3ZA 4YHTA 5H9BA 4HNIA 3TNIA 4CFNA 3RM7A 2BRBA 3DA6A 3QLFA 4X6QC 3EB0A 2BPMA 2XKCA 2XNOA 5J9YA 2JLDA 4JG8A 4E8AA 2GFCA 5IQBA 2OZOA 2PWLA 3RP9A 3IOPA 4ZEGA 3P5KA 1EH4A 4PMSA 4AOIA 4F7SA 5J79A 5I3RA 5H8EA 4XV3A 4DYMA 5D7AA 3L8VA 4I6QA 4DH3A 1XH5A 5D1JA 4AXAA 4NJ3A 1BLXA 3D5UA 1XBAA 4JIAA 3OFMA 4GG5A 3NYVA 3DBCA 2FA2A 2WQMA 4QMXA 2V62A 4TWCA 3N4VA 5I4NA 4F9AA 3VRYA 3K3JA 4ALVA 2CLQA 3GFWA 2FSOX 4OT6A 3BYUA 3OCGA 3I7CA 3SV0A 2VX1A 3FQEA 1ZXEA 3PVGA 3TKHA 3CKWA 4ZP5A 3PE2A 3GU8A 4L7SA 3H4JA 4KUJA 4B7TA 3V04A 5E1SA 3FI3A 1XQZA 1PY5A 4ENXA 3TV6A 3H3CA 2YWPA 4DINA 3A7HA 2ESMA 4KKHA 5CQUA 2VNYA 4EQCA 4UMPA 4ZSAA 2W1IA 3M11A 4JQEA 4PNIA 2BMCA 3LJ0A 4O7RA 3PE1A 5ANDA 5KCVA 1CKPA 2W1CA 4NM3A 1JPAA 2QR7A 5AA8A 5KMNA 4M0YA 4ONAA 2CCHA 4FYNA 3CE3A 4QQCA 4JBPA 5L2QA 1M2PA 1ZWSA 4RGJA 2J7TA 2JFMA 5C1QB 4NUSA 5E8ZA 2QC6A 3LM5A 4UWBA 4YC8A 1CMKE 4BIDA 3ZM9A 3QBNA 4M66A 3LXNA 3BHTA 3FE3A 3LXPA 3MTFA 2ERZE 2OXXA 1PW2A 1ZOEA 2UZWE 3EQCA 5K3YA 4CLIA 5C8NA 1JQHA 3JS2A 5JRSA 3RPRA 1UWHA 4HVGA 4E4NA 4FIEA 3NGAA 3DY7A 3P78A 5EFQA 4LGDA 3W10A 1Q8WA 5K0XA 3NLBA 4GJ3A 4QTAA 4D1SA 4FZFB 3HV3A 4ZMFA 5EHLA 4MNEB 4C2VA 4F63A 3C0HA 1ZLTA 4YP8A 4XUFA 4YSMA 3R8VA 4O0WA 2WGJA 4BDJA 2JDOA 4NTTA 1YWRA 3W16A 4D0XA 1E9HA 5I9ZA 4U3YA 1Y57A 3QTRA 5HBEA 3OWLA 3JYAA 5KZIA 3RINA 5HO7A 2A2AA 3QALE 1Q99A 5B0XA 2A1AB 4GH2A 3LM0A 4TYGA 4RLLA 1H26A 1XO2B 2UZVA 3KN5A 3SX9A 2PZYA 3VW6A 3KREA 3V5QA 4KS7A 1T46A 3ZUUA 5K5XA 4F64A 5C01A 1GIIA 3C4WA 3KMMA 3RKBA 4FSQA 3DBEA 2HENA 5EM7A 4GV1A 4UZHA 5HNIX 3UVRA 3W8QA 4E4XA 3EYGA 3DDPA 3ZSGA 5AAEA 4QPSA 1WVWA 3R7GA 3K3IA 4ZSJA 3AMAA 3DNDA 4IZ5A 1UU7A 3LCDA 2Y8OA 5DI1A 4MYGA 5EQPA 1VEBA 1WBTA 4DT8A 5AUXA 1M52A 1ZYLA 5CU6A 4O2ZA 2J0LA 3QHRA 3UBDA 5BQ0A 5CXZA 1YOJA 3DK6A 3NR9A 4BVUA 3UOJA 3COIA 4YZDA 4BBMA 3CSVA 3NDMA 3R01A 2VO3A 4MKCA 5EYMA 4D5KA 3Q32A 4EBWA 4EOKA 4M67A 1R3CA 2JDTA 3VBVA 4EK6A 4YURA 5LVOA 4KBAA 3QQKA 4LGGA 4Z7GA 4H39A 2QO9A 3FZPA 2NPQA 2W1EA 5HVJA 5JZNA 2PVJA 2CKQA 3DTCA 2Y6OA 4CT2A 3N51A 4W9XA 2WTKB 2YM4A 3D94A 4FTNA 4KNBA 3BE9A 3F61A 3F3VA 2ERKA 3WF8A 4C4HA 2YM6A 4J1RA 2XIRA 4U41A 3OWKA 4AZTA 4A9RA 3A60A 5DT4A 2XJ0A 3VBQA 2QU5A 4YTHA 4DFYA 4QQ5A 2QG7A 4O7LA 4V05A 5IQEA 1PRYA 2E9OA 5HG9A 3DBFA 4EK3A 3MBLA 4OTWA 4RJ4A 5HG7A 4FT5A 1MP8A 3GOPA 2QOKA 3ITZA 4UYNA 4EH5A 5JSMA 2YIWA 2XBJA 4QMOA 4S2ZA 2YN8A 5EHYA 3TNHA 3C4EA 4AW0A 2BILB 1LEWA 2X6EA 2R3LA 1ZOGA 3FKLA 3IGOA 5DOSA 2CGXA 4WHZA 5AR3A 5HE1A 5IISA 3DOGA 4MWHA 3FI4A 4FG7A 4X2NA 4DBXA 5BVWA 4G3GA 3TI1A 4PTGA 3QYZA 1RQQA 3H0YA 3R63A 3ZEWA 3GP0A 3LVPA 4ANQA 4F7NA 3G15A 1KE5A 4MTAA 4L43A 4ACHA 2QOBA 2I1MA 3E7OA 4YHFA 4QT1A 5ITAA 3OTVA 3QA0A 3VJNA 2VTIA 2C4GA 1WBWA 2P0CA 3QQHA 4AW5A 3UGCA 3R1QA 5KMIA 5DH3A 3ORKA 4AZWA 1X8BA 3QQFA 4L46A 5CU4A 2BRMA 3U9CA 1JBPE 3EFLA 2YCSA 3E92A 3ATTA 4KBKA 4FNYA 2W7XA 2Z7QA 3IGGA 3PXFA 4I4FA 1IG1A 3A7JA 4NIFA 4O0SA 2UZLA 1SMHA 4FNWA 5CQWA 4IDVA 4F08A 4HCTA 3BYOA 4LI5A 1OIRA 3I0QA 3VUIA 4E4LA 3VIDA 3KVWA 3HAMA 4RIWB 2DYLA 4LUEA 3TN8A 3BI6A 4MQ1A 1CDKA 4L53A 5HG5A 2WIPA 4F70A 4IZ7A 5BVFA 5A54A 3ZLWA 4FK3A 2OBJA 5CEQA 4TL0A 4E5WA 3KULB 4FL3A 3B8QA 3D7ZA 4Z16A 5M44A 4UWYA 3PTGA 2JDVA 1ZAOA 4O27B 4PMPA 1IA8A 3COKA 3EN7A 4H1MA 3DK3A 4HCVA 4YSJA 3R7VA 4U44A 4DGGA 4G5JA 3GQLA 1J1CA 3NIZA 3NAXA 5HKMA 4CZYB 3NUYA 5EKOA 3I6WA 3EN6A 3ZFXA 1H28A 2CGWA 5FGKA 5HU9A 3IO7A 3KRLA 5KO1A 3CD8A 4L44A 4YU2A 4I0TA 4JLCA 5DWRA 2YJRA 5DVRA 2X0GA 3UP2A 2F7ZE 3ENHA 5JEBA 3TNQB 4XEYA 4BTJA 1XBCA 1XHAA 3LIJA 5AP5A 2WOUA 3WYYA 3ZRKA 2YAKA 3VS6A 4WG3A 4CKJA 3OWJA 1VYZA 3R7UA 2WU7A 5DA3A 4W4VA 3QWKA 4EC9A 3GCVA 3E87A 3KMWA 2YA9A 4I5PA 4ITJA 3V3VA 5I5ZA 3IDBA 3OROA 3ZONA 1JSUA 5J7HA 1MRVA 3PG3A 5LMBA 2WMAA 4F6SA 3W55A 4FA2A 3SGCA 1WVXA 5CF8A 4AZSA 2RIOA 2B9IA 4NFNA 3WOWA 2PE2A 3MSSA 1OL6A 2ZB1A 1WBPA 2R3NA 3IW7A 3QRUA 4JRNA 1XR1A 4XG6A 5F1ZA 5I9VA 2CLXA 1TQIA 3H10A 5AUWA 3WZDA 4O0RA 2XKDA 3O7LB 4FKIA 4FGBA 2OF2A 4FZ6A 4QP1A 4BZDA 3Q2MA 1Y6AA 5ANOA 5KBRA 3TJDA 3MV5A 3HRBA 5DR2A 3TJCA 3U55A 2R2PA 2YFXA 3ZBXA 2CCIA 4EQUA 4F1TA 5AA9A 4C34A 3R9OA 2CKOA 2NNWB 1TVOA 2ZOQA 3MY5A 5BVOA 1A9UA 2F7XE 3C9WA 4L3LA 4EH3A 4GU9A 4EQMA 3E7VA 3R2YA 5BNJA 2BTSA 3LOKA 2W17A 3FSKA 2VAGA 4FKTA 3WF5A 2AC5A 5E8SA 1NT2A 1BYGA 4U43A 3R0TA 5E91A 5M4UA 3R7OA 1ERKA 1M17A 2PL0A 4BBFA 4B4LA 4KRDA 5FD2A 3C4ZA 4E3CA 4IX5A 3S0OA 1V0OA 4S30A 2WAJA 2WMUA 4IB5A 2OICA 3IS5A 3WF9A 4BGQA 4BL1A 5FEEA 3OUNB 3PY3A 4YJUA 3EZVA 4MX9A 2PMIA 5CENA 5BX0A 2YZAA 1YVJA 3D83A 4WSYA 4F9WA 1GOLA 3ZEPA 4GW8A 5K0KA 4JQ7A 5BVNA 3MESA 4FTQA 1OIYA 1U4DA 5K9IA 3K5UA 3L9PA 5D12A 3RNIA 3ZC5A 3RHXA 3PUPA 5IKWA 3VS4A 4U6RA 5CF4A 4RA4A 2YAAA 3QTQA 3FLSA 4LM5A 1YXXA 5HCXA 3UODA 4BCMA 4DH5A 2BTRA 1ZZLA 2UZNA 1ZARA 3GENA 1LUFA 3Q96A 4MNEA 1CKIA 3HA8A 2C3IB 4CQEA 1YWNA 5IH6A 5IQDA 3WE8A 3FI8A 3F7ZA 2VNWA 2PZRA 4JAJA 1PXJA
chains in the Genus database with same CATH superfamily
4CGAA 3DZOA 1FMOE 4PDOA 3F3ZA 3RPOA 2QOOA 3DDQA 3UO6A 4BBEA 4TKSA 3QZFA 2XCKA 4P7EA 4FGRA 3LMGA 3KCKA 5DMZA 2E9NA 3PRIA 1BUHA 2Z02A 3MH2A 2WMTA 4B99A 3SAYA 3OXIA 4FG9A 1FQ1B 3C51A 4BCJA 3OCBA 1W98A 5CSXA 3UMXA 2WTKC 1FVRA 2GDOA 1Q41A 4DG2E 2RFEA 4IXPA 2ZMDA 4OTPA 3FLWA 3MWUA 5E8UA 2ETRA 5J1WA 4IVCA 2JDRA 5HLWA 4O1PA 2XYUA 4NYEA 2YDKA 4QYHA 3IOKA 2XMYA 5HE0A 3GU7A 4I1ZA 4USDA 5C9CA 4C8BA 1JKKA 2R3QA 3KN6A 5IA3A 2BDJA 4JVGA 3Q9WA 4HGLA 4UWCA 3KEXA 3DKCA 4I6HA 4ALWA 4JDIA 4ZJVA 1ZOHA 2IVVA 2WMQA 4JBQA 3TM0A 3OWPA 3ZBFA 3NW5A 4R6VA 1PXPA 4J99A 5H8BA 2X8DA 5HLNA 2A27A 3KRRA 1RW8A 3P86A 4P2KA 5T68A 4FV3A 4G3DA 4IVBA 3IW8A 3KF4A 5DPVA 4ACMA 4O7SA 3C1XA 2CN5A 4G2FA 4ZSGA 3W2PA 1Q61A 3G33A 2XALA 5J5SA 2JAMA 4FEVA 3AC2A 3HUBA 4BF2A 3QTWA 4M7IA 4ANSA 3TUBA 1J91A 4ZOGA 3RAWA 3VBTA 3KF7A 1K9AA 2J0JA 5ANGA 3LPBA 5L4QA 2R7IA 5IQGA 5CANA 4BDCA 4J7BA 1ZY4A 4NFMA 1Q62A 3OOMA 1V0PA 4M0ZA 5AM6A 3E3BX 3MA3A 4BJJB 1YHWA 3ACJA 4NTSA 4FTJA 4U7ZA 4X2FA 5EDPA 4JDHA 2HIWA 2O5KA 2OIBA 1CM8A 1T45A 2B1PA 2C6LA 2ZM4A 4EYJA 3QZIA 2JBOA 5AR2A 3WI6A 1IAJA 3TZ9A 3PVUA 3W2RA 3V51A 3TTJA 2QG5A 4UX9A 2VWZA 4FK6A 2IZTA 3ZO1A 1W2FA 1O6LA 3FMNA 4Q5HA 4ENYA 4QTEA 4Y8DA 2I0YA 2B9FA 4EWQA 3G9NA 3NFFB 2EWAA 4S32A 1RE8A 5TR6A 2PMLX 5EW9A 3WZUA 4F0IA 1LEZA 4IM3A 5M08A 3AKKA 2XNMA 3KGAA 4XLVA 2I40A 3OW3A 4CKIA 3UZTA 3PA5A 2ITUA 3GGFA 2C5OA 4MXZA 2H96A 2WTCA 5LVLA 5TOZA 3A8WA 3QX4A 5CX9A 3TNPC 4E5BA 2UVXA 3LQ5A 4I6BA 2BALA 1STCE 3BHYA 2Y0AA 3UNKA 4DG3E 3RHKA 4BDKA 3M1SA 4NH1A 1GIJA 3TZMA 1BMKA 4BDIA 2CSNA 5EQYA 1OKWA 4BCNA 1KE7A 4IQ6A 4IAFA 4ZZMA 3PWYA 2IG7A 4YTFA 4C4FA 5AP6A 3ZTXA 3V5PA 4RIWA 3RWPA 4DITA 4NU1A 1ZZ2A 4Z3VA 4BIEA 4X3JA 5E9EA 3GVUA 5L8KA 4R78A 4FI1A 1M14A 5BUIA 3LQ8A 5HX6A 1KE9A 2QI8A 3QA8A 1PMUA 3R73A 4RQKA 3KULA 5JN2A 5ANEA 1QPJA 3PVWA 2Q83A 4GS6A 3EQIA 3SD0A 2XM9A 5ACBC 1IAHA 3UDBA 4QNYA 3IW5A 4W9WA 3MFSA 4XS2A 3UNZA 2YDIA 2E9UA 4CV8A 3P5JC 4M69B 2X4FA 4L9IA 2HWPA 4FVQA 5IQHA 3R28A 2I0EA 3LKMA 3CEKA 3RAIA 2OH4A 4YJVA 3AC4A 3PIZA 2R4BA 5M56A 4F1MA 3A99A 3KY2A 4CSVA 4YPSA 2WD1A 3L9LA 4D2VA 3ZHPC 3MFTA 1R0PA 3UOLA 3OY3A 2IZSA 4FTOA 5HCZA 3UYSA 1DI8A 3VW8A 4C38A 2I7QA 1GZOA 5BPYA 4JRVA 4CFWA 4I0RA 4OTQA 4TNDA 4N0SA 4AT5A 2W96B 3F69A 4FEUA 3UZRA 1KSWA 4EZ5A 4WUAA 3ERKA 2A4LA 2PPQA 4NWMA 3PDTA 4EOQA 4AQCA 4GT3A 4GVAA 3W0PA 3O23A 4DTKA 3GCUA 4L67A 5AUVA 2QVSE 3FMEA 3KVXA 3OW4A 4MAOA 5F4NA 4XG2A 5H3QA 3VRZA 5H8GA 3MVMA 3MH0A 4PP7A 1KE8A 1AD5A 4C62A 2R0IA 3SRVB 3VUTA 4DEBA 5L2IA 3HMIA 4FTUA 2V22A 4A4XA 3FHIA 4CTCA 1H27A 2QODA 5LOHA 3CR0A 3DBQA 2JKQA 3GU5A 4MUQA 3QZHA 1W8CA 4IDTA 4S31A 4L01A 4W8EA 3RWQA 1Z9XA 2J5EA 4L3JA 3S4QA 3PPZA 2VTJA 3R9NA 2J50A 1YHVA 3QQGA 4FR4A 4FSMA 4FV8A 2PVRA 4GMYA 2H34A 3BLQA 5JQ5A 3NAYA 4IAIA 4C3FA 4EOSA 4DBNA 5G6VA 3CCNA 3I5NA 5EW8A 3JUHA 4MXXA 3GUBA 3OUKA 2BKZA 4WOVA 3UE4A 5L2WA 3DJ6A 2XNEA 4BCQA 3EWHA 4RSSA 3HEGA 1TFFA 4AT3A 2WPAA 4DEIA 4APPA 3MY1A 2IEWA 2WOTA 2XKFA 5LJJA 2F49A 3K2LA 2XB7A 3COMA 3LFNA 3ORPA 4ZY4A 4BDHA 4U40A 4V01A 5EI6A 4AG8A 4QP4A 1LPUA 2C6IA 3HVCA 3FXXA 2H6DA 3P4KA 4DH1A 1Q8ZA 5IDPA 4YNOA 2QOLA 5L3AA 1YOLA 3G51A 2W4JA 3AGMA 5GJGA 1FBNA 1OL7A 1PJKA 5E1EA 3NUUA 2YLEA 4X6RA 1KV2A 3P23A 2PTKA 3ORTA 4L3PA 4FKSA 3EHAA 4WKQA 5BUJA 4O22A 4QO9A 4BHZA 4TY1A 4EH8A 4HZSA 5CEPA 4C3PA 2ZDTA 3EKKA 4LGHA 2IVSA 3HMOA 3CGFA 5IQCA 4FF8A 2BVAA 3OT3A 4RG0A 5HD4A 4XRJA 3CGOA 3LXLA 4K6ZA 3MN3A 3HDMA 3W2QA 2R9SA 3NW7A 3NNVA 3PP0A 3ZYAA 3QTIA 3O8UA 3Q60A 4I93A 4WNPA 3DKOA 3C7QA 1R39A 3ZMMA 5E8VA 5CEKA 3ODZX 1G8AA 5J87A 4PQNA 4L68A 4CT1A 4RC4A 5IF1A 5GZ8A 1SZMA 4LL0A 4FKPA 1APME 3MGYA 3BV3A 3EIDA 2IW6A 1J7LA 4JAIA 2J9MA 3GFEA 4AUAA 4EH2A 3Q9YA 4OBOA 4BYJA 3EMGA 4YJQA 5AUTA 4GK2A 4PMMA 3TDVA 3EQFA 4DCEA 2A98A 1M7QA 1U5QA 2YISA 5LQFA 5DT0A 4DC2A 3SKCA 3HP2A 1F3MC 2V7AA 4FIIA 3PZHA 5L8LA 1Q4LA 3NX8A 2PVMA 3EN4A 2YM5A 4OTDA 3IW6A 4K9YA 3VS2A 3BL7A 2OWBA 3RCJA 3EQGA 1CSNA 2WTWA 2C5YA 2HOGA 4BZNA 2HW7A 4Y73A 4FIFA 3E93A 3FPMA 3S2PA 3R9HA 4RX7A 5CF6A 1G5SA 3L9MA 4R5SA 2JD5A 3TUCA 4WG4A 4FKQA 5IG1A 5BYLA 3PFQA 3FKOA 3AOXA 5DRDA 4QNAA 4R1YA 2CMWA 3RMFA 3PJ3A 3CBLA 5ICPA 4QEBA 4BIBA 3RCDA 3A7GA 3ZRMA 3DKGA 4ZK5A 4C4IA 2FO0A 4ITIA 1QCFA 5A6NA 4HPUE 4DGOA 4A7CA 2IVUA 2VTQA 4WBOA 2HYYA 4RWJA 4S33A 5TE0A 4BCOA 4HW7A 3C50A 4O38A 2DUVA 4YHJA 1PHKA 5HO6A 3VS1A 4JT3A 1URWA 4D58A 2J5FA 2P2IA 1ZYDA 3ULZA 2X2KA 4G1WA 5LVPA 3R00A 3D2IA 4AN9A 3N4UA 2YIYA 4QYGA 4D4VA 2ZJWA 5AFVA 2J4ZA 4QP6A 4ANMA 2VO0A 4PDYA 4LOPA 2UUEA 4QP7A 5L6OA 4DH7A 5IA2A 2IZUA 4HGSA 4KS8A 1HOWA 5CU3A 4CV9A 4BJJA 3H0ZA 2AC3A 3KIOC 2GNFA 3CJGA 5E4HA 3WF7A 4O7WA 4IC8A 3ORZA 1UNHA 4G17A 4O1OA 4EH6A 3EN9A 4RFYA 1SNXA 2XNPA 2XNNA 4OTIA 4AW1A 4O7ZA 4F09A 3GEQA 2ZB0A 2VWIA 4D55A 3POZA 2PE0A 1H08A 3GI3A 2RF9A 2BZIB 3BHHA 4Q2AA 1TKIA 3K54A 3OBGA 4EZ3A 4FL2A 4FTTA 5DIAA 2J0IA 4E7WA 1DAYA 5I3OA 2PVFA 4AGDA 5LWNA 5FEQA 3I5ZA 2HWOA 5D9HA 3ZOSA 5J9ZA 3UIUA 4BCHA 3GCSA 5HLPA 3A2CA 4ACGA 1FVVA 2XK8A 3EOCA 5K4IA 2B7AA 2YEXA 4IX6A 4FKRA 3R1YA 2DQ7X 4I24A 2C6TA 4PL5A 5IA0A 3RTPA 5AUZA 2QHMA 5EHOA 4BDBA 4EI4A 4M12A 2IZRA 3UMWA 3PSBA 5J7BA 5HE3A 2X4ZA 3D9VA 5M53A 3NPCA 4GK3A 3SG8A 2C1AA 1J1BA 4AN3A 3MW1A 2HK5A 4U42A 3KRWA 4XX9A 1SVEA 1F0QA 3OBJA 5G1XA 3KFAA 4BTKA 1UNLA 4YZCA 5E8XA 1FVTA 4NKSA 5DFPA 3HYHA 2PULA 3QC4A 2X7GA 2ITOA 4FV4A 2NP8A 3KXNA 4IFGA 3QFVA 2J6MA 4IIRA 3GBZA 4HGTA 5CLPA 4FIGA 3W18A 5IQAA 4W4YA 4CD0A 2W99B 3FKNA 2B53A 2YDJA 4M69A 4IBMA 4LQMA 3FZRA 3MB6A 3FQSA 4QP3A 1FPUA 4CZUA 4YO4A 4ZSLA 4BB4A 5IA4A 2X0OA 3ZC6A 4E5AX 4RQVA 3DAKA 3NUPA 5M4FA 3QQLA 1XBBA 4FNXA 1Y91A 2V55A 3IONA 4IE9A 1JNKA 3R22A 4IVDA 3FXWA 5CI7A 3V8WA 2QNJA 5CAUA 3LFEA 4UMTA 3VF9A 4WNMA 2VWWA 4DH8A 4L52A 4CCBA 4UXLA 4RX8A 3SDJA 2VTNA 3RPSA 3A61A 4YZ9A 4DHFA 1DS5A 3MY0A 3HV4A 1YXUA 3M42A 4GEOA 5L8JA 4EH9A 2PYWA 5HORA 1YKRA 3FV8A 2QOHA 5JRQA 2IW8A 1KE6A 3FL5A 3CC6A 2PE1A 4BICA 4FOBA 2OO8X 2RG6A 2BHHA 1O6KA 2F9GA 2Z60A 2UW4A 3SRVA 5KMJA 4BTMA 1XMLA 3BLHA 4ANNA 3QHWA 2H8HA 3KB7A 3Q6UA 3QL8A 4XBUA 3OG7A 2J90A 3R7YA 5HVYA 3W0QA 3E3PA 2ZFYA 3GT8A 2HZNA 5GZAA 2GU8A 3EFKA 3VO3A 3QRJA 4TYEA 3KK9A 2OI4X 2J0KA 4MXAA 2GQSA 3P7AA 3KRXA 3SC1A 4EJNA 3W2CA 4ITHA 4UALA 5BMMA 5C27A 3CKXA 5DYJA 3W8LA 3F6XA 2Z8CA 4YLKA 4GVJA 2Y4IB 2KTYA 4HOKA 2UW6A 4K8AA 5FM2A 4QMUA 4AZVA 4YMJA 1PF8A 4GUBA 2G9XA 3Q3BA 3CQEA 1J3HA 2RL5A 2XRWA 2R3HA 1A06A 4IH8A 3WF6A 1YXSA 2YLFA 4JOAA 4BGHA 4E20A 4WBBB 4BR3A 4ZLOA 4BWXA 4K2RA 3V01A 3SA0A 2EXEA 2I6LA 2ITQA 3G5DA 3DXNA 4A06A 4L8MA 4D2RA 4D4SA 3NS9A 5F20A 3UQGA 4PTCA 1GIHA 2OJJA 4CFVA 4CYIA 3DK7A 4FEWA 2OK1A 2R7BA 2Z2WA 4OBPA 3ETAA 4QD6A 3W32A 4I0SA 4UY9A 4AS0A 2HAKA 3O50A 3F3WA 4RIYB 5HG8A 4AQKA 2YCQA 4JDJA 4YJOA 3ZLXA 5DG5A 4C58A 4QOXA 1JSVA 2HZIA 4AXDA 1OL2A 3NCGA 4FYOA 4RA5A 2BUJA 1GY3A 3IECA 2WQBA 3IK3A 2QLUA 5K5NA 2X8EA 4RVLA 5CZHA 4ZTLA 2ZM3A 3VS0A 2GNGA 5M07A 2PMOX 3OVVA 2QOQA 3AC5A 2UW5A 4R3PA 4A4LA 4A07A 4JL9A 3S1HA 3ZO3A 2XANA 3GC9A 3VNTA 4AGCA 3IDCA 4NEUA 5GZ9A 3HP5A 3JY0A 5CAQA 4C37A 4LV5A 2IWIA 4E6CA 4AA0A 2ITPA 5KMOA 4FUXA 4WNOA 1PKDA 2UW9A 3RK5A 4HYSA 4PV0A 4XHKB 4Y5QA 2VTMA 1KWPA 1FGKA 4F0GA 3A7FA 4EJ7A 2P4IA 3G0FA 4RVMA 1M2RA 3G0EA 2E2BA 3E8EA 4C61A 3O0GA 4Q5EA 4KIQA 4F0FA 1XWSA 1YQJA 3UO4A 2BAKA 1PYEA 4DA5A 4QMSA 1A48A 3LFBA 3MPTA 1UNGA 4BZOA 2IO6A 1V1KA 3NUAA 1K3AA 3FXZA 2XIXA 3LFFA 4AZEA 4PNKA 1H07A 4WNKA 3EQPA 3RBWA 2GQRA 2FUMA 2GSFA 1M2QA 4HYIA 4FSUA 3H30A 4H58A 4PMTA 1JAMA 2V5QA 4XH6A 5FDXA 2PMNX 4B8MA 4EZ7A 4EH4A 3KK8A 3TDWA 4CEGA 5EOBA 5EYKA 2XZSA 5FG8A 3CP9A 4O82A 2JBPA 2CNUA 5FQDC 3AGLA 3AQVA 4KINA 2XS0A 4QTBA 5DGZA 3HLLA 4Z7HA 5FXRA 3BWJA 3FPQA 1GZNA 2F2CB 3MH3A 2C30A 5IUGA 2FH9A 1YI3A 4FRFA 5KUPA 4YZBA 3Q9ZA 1H0WA 2BFYA 1W0XC 3O8PA 4HPTE 2X8IA 4FV5A 5IPJA 3F7WA 5FTOA 3SXRA 5AUUA 2FSLX 2R3PA 1KOBA 3AD4A 3HRFA 3ZRLA 2NYAA 1YI4A 2WTJA 3FMDA 4E4MA 4O7VA 3ZUVA 1BKXA 2G2HA 4BDEA 1SVGA 5I9YA 2Y9QA 2REIA 5JGAA 3V5TA 1BX6A 2PZPA 1GNGA 3HMPA 4RWKA 5A46A 5B2LA 2OF4A 2QCSA 3SHEA 3EN5A 2BZJA 3NMUF 4G6OA 3QTUA 5J5TA 4MXOA 3R1NA 1YDRE 3KXMA 3TUDA 4R3CA 3UOHA 5FLFA 3AD6A 3DNEA 2R64A 3GXLA 3OOGA 4GG7A 4IC7A 1QL6A 2GHLA 2Y4PA 4ZTSA 5HHWA 4QP9A 1REJA 1UA2A 4JG7A 5DR6A 1R1WA 1QPEA 3QU0A 4KSQA 4RRVA 4BI0A 2HZ4A 3OXTA 2BAJA 4TXCA 3ZZEA 3ZO4A 3GC8A 4M84A 1GAGA 4KKEA 4QMMA 4WSQA 4OLIA 1PXMA 4IB1A 1NVQA 2ZV8A 4IAZA 3OS3A 2KULA 3D2KA 3FQHA 3I4BA 2B9HA 4FMQA 2VTTA 2FSTX 3L9NA 2XVDA 2C6KA 2ZMCA 3WIGA 3HA6A 4CRLA 2PUNA 4EHEA 2WO6A 2VZ6A 2O3PA 3AT3A 4CFUA 4K0YA 3RZFA 4I5MA 2UVYA 4QRCA 2QLQA 2PSQA 1KV1A 4IX3A 4XOZA 4ACDA 4O0UA 2VWYA 5ETFA 4M14A 3WE4A 5HE2A 4OR5A 4L00A 4UN0C 4Z55A 4MD7E 2VTHA 2HW6A 2X7OA 3TZ8A 4AX8A 4TYHB 3HV5A 2G2FA 5CXHA 4G3EA 4NKAA 4PDSA 3FUPA 4YLJA 4RC3A 5HGIA 3ML1A 4BKJA 4P90A 4C36A 4E1ZA 3GNIB 4EHGA 3DB6A 1JVPP 4OTRA 4QMZA 3V5LA 4MD8E 5HIBA 1MQ4A 4ZXTA 4DN5A 3DLSA 4JNWA 2OFUA 5B2KA 3HGKA 2GQGA 2Y7JA 4IJPA 2BDWA 3ZLSA 4QMPA 5IU2A 2HY0A 4R3RA 4RPVA 4F1OA 2WQNA 3R21A 4IW0A 5EM5A 3R71A 4FSNA 3BGQA 4OUCA 3RPVA 5M06A 5AIKA 5JMSA 2CN8A 3TIZA 4PPBA 4JJRA 4R7IA 3U9NA 4FUYA 4G31A 5B7VA 1OPJA 4O86A 4M8TA 4RJ3A 1NA7A 2GNHA 3NUNA 5TKDA 3NFGB 5CEOA 3MH1A 5FUTA 3NUXA 4CCUA 4FTIA 4C7TA 3FY0A 3L1SA 3ODYX 3HL7A 2GS6A 2P55A 3OXZA 4I20A 2WMWA 4XP0A 4CMOA 5HQ0A 4N57A 1PXIA 3R7IA 3DJ5A 4AOJA 4D9UA 4MXCA 4DHJA 2C6DA 2W05A 3TXOA 4DEEA 4DFUA 3FLYA 5HCYA 3OHTA 4EHVA 5A9UA 3RJCA 5CVHA 1P4OA 2UVZA 2ITWA 5HICA 4UXQA 5DE2A 1R0EA 2GCDA 4D2TA 4QMVA 2WEIA 4F9BA 4CRSA 4ZZOA 4Z9LA 2ITVA 4G9RA 3Q4TA 2VO7A 3QD3A 4FZAB 3VWAA 1ZRZA 4C4EA 4KD1A 4E93A 4AE9A 1XH9A 4G9CA 4RZWA 1OZ1A 4IM0A 3F5GA 1S9IA 3JVSA 1WFCA 3ZSIA 2IJMA 2XKEA 4QMNA 2Y4IC 3F88A 3HV7A 2GNLA 2QOFA 1YXTA 2C0TA 1YDSE 2HELA 3E62A 3IKAA 4I5CA 5HTIA 2PVYA 1G8JA 4O7YA 2CKPA 4ORKA 2NRYA 3T3UA 4F78A 2ETKA 4U45A 1GJOA 1JKLA 3ULIA 4C33A 4YO6A 3R8ZA 3I1AA 4QQTA 4O0XA 3KXGA 1JKSA 3TMOA 2WMRA 3PLSA 4ZS0A 3UO5A 4WO5A 4GFOA 3VS5A 4LRKA 2V0DA 4WG5A 3BLRA 4KWPA 3QGYA 4A9SA 2JC6A 5IZFA 4ASXA 1YHSA 2BCJA 2HXLA 2VTLA 3PIYA 4QP2A 3C4FA 4ASDA 3PA4A 3BX5A 2RGPA 4FT9A 3RNYA 3DTWA 5HD7A 3H9RA 1E1XA 4O0VA 2PUIA 2Z7SA 5AP3A 2VTOA 2B0QA 4ZY5A 4FKGA 2R3RA 4IWQA 3BCEA 3RAKA 1XH6A 3DS6A 4NK9A 3ZFYA 4MBIA 3Q4ZA 3G90X 1Q3DA 3HV6A 3LZBA 3ROYA 3PUFC 3FYKX 4PRJA 3OF0A 4IJ9A 4QTCA 4MK0A 5FM3A 4PF4A 1IASA 2YIXA 5DNRA 4O81A 4DLJA 5D41A 1Y8GA 2RFDA 3PYYA 4I4EA 3U8WA 2QD9A 2A19B 5CS6A 4AGUA 1OKYA 4E26A 3BU3A 3G6HA 4D9TA 4FZDB 3FAAA 4J52A 3HMMA 3FMKA 2NO3A 2W1HA 3LAUA 2R3OA 3NNWA 3PP1A 2GHMA 5L6PA 3EYHA 2C69A 4FSTA 4ZLZA 3PXRA 5DEYA 3I79A 3I7BA 5GJDA 5M57A 3WARA 3NRMA 1XH7A 4AXCA 3DT1A 4WA9A 3OEFX 4HVSA 3WBLA 2DS1A 2JIUA 4QP8A 3JPVA 2YHVA 2PY3A 4GL9A 4P5QA 2YIQA 4J98A 4WUNA 3ZU7A 4RIYA 3Q6WA 4HGEA 3BHVA 5M51A 5CASA 1OECA 1WBNA 5HEZA 1ZYCA 4ZTRA 1OGUA 4Y85A 3OC1A 1U59A 1TQMA 3F66A 3QTZA 5J1VA 4YZNA 5HO8A 3SLSA 5C4LA 4R1VA 4IHPA 2GTMA 5EI8A 3ZUTA 4CFXA 4FKWA 4FSWA 1IEPA 1LP4A 5AADA 3VJOA 3NW6A 1P14A 5HESA 3HZTA 5AIRA 4IB3A 3P79A 2XYNA 2ITNA 3E5AA 4M13A 3LJ1A 1OIUA 2UZUE 3CTQA 3U6IA 1YDTE 2C6OA 3R6XA 4I23A 4C35A 3UG2A 2O0UA 3PY1A 3B8RA 3DFAA 2UW0A 5IQIA 3Q5IA 4GRBA 2W1FA 3PRFA 4XYFA 3FZOA 3UYTA 4K33A 3PZEA 3N4TA 3VUGA 4RIXB 2OW3A 4DFLA 2XK9A 3D7TB 4C0TA 1ST0A 2OFVA 1ATPE 1JOWB 4GU6A 5HU3A 5AP4A 4ANLA 1AQ1A 1AGWA 4JG6A 4OTHA 4PPCA 1PMEA 3FZTA 3QLGA 4FZ7A 4CLJA 3WZKA 2RSVA 4FC0A 3OEZA 3R9RA 4J53A 1UKIA 4UEUA 2JDSA 3AMYA 2WEVA 3MI9A 3NNUA 3R8MA 4FODA 2C6MA 2OKRA 3FI2A 2GNJA 4AA4A 3KCFA 4FX3A 3MFUA 4H36A 4Y46A 2R3KA 5HI2A 2CJMA 2ZAZA 3P7CA 3QTXA 4MD9E 3UIMA 5AAGA 3BU6A 1IA9A 3SXSA 5FTGA 5AAFA 3PJ1A 4B8LA 4EOJA 3R8UA 3VULA 2BDFA 1OUYA 4UBAA 2F57A 1H1RA 2Z7LA 3QD0A 5IEXA 5ETCA 2YACA 2XF0A 2WIHA 3DJ7A 5A4QA 2YWVA 4ZJIA 3DCVA 4F9YA 3ZCLA 2YZLA 4EK4A 4DTAA 2VV9A 3MB7A 3WZJA 4X2GA 4FV0A 4NCTC 2C1BA 3ZM4A 5KBQA 4J8MA 5JZJA 3DBDA 5EG3A 4CTBA 3FLQA 1H4LA 4C2WA 5CAVA 5IQFA 2HXQA 4P4CA 1B38A 1RJBA 2XA4A 4DE4A 1VR2A 2F2UA 2A0CX 2YCRA 4BN1A 4FV2A 3QYWA 4UYAA 2WELA 3D15A 5HIDA 3EQRA 2WU6A 3QQUA 3AC3A 3OP5A 3MFRA 3QGWA 4O6LA 4A9TA 4UMUA 1WBVA 5EH0A 4M68A 4LMNA 4GJ2A 5LCKA 2PHKA 3EQDA 2B54A 1DAWA 2CGUA 4GIHA 4AAAA 4X2JA 4AWIA 1UU3A 3FLNC 4DCAA 3O96A 2YM3A 3CIKA 3MYGA 4GT4A 4I21A 4FKUA 4JR3A 5CZIA 3T9IA 3TWJA 4ZLYA 5LWMA 1XMMA 3P7BA 3D4QA 4ERKA 4XMOA 4R8QA 4X0MA 3MIAA 4FKLA 4FV7A 5AP0A 3AC1A 5IA1A 1JWHA 3G2FA 5KKRB 5FBOA 4JBOA 5FEDA 4NCTA 3NZ0A 1P4FA 4H3PA 4XG7A 3EL8A 3FDNA 4MF1A 3SOAA 3EL7A 3TTIA 5KHWA 3FC2A 5H2UA 3KKVA 5FRIA 2W4OA 5DHJA 4RC2A 2W1DA 2W9FB 3LFSA 4WRSA 2B9JA 4LMUA 3ZO2A 4I41A 2W1ZA 4TYHA 3UDZA 1FGIA 3BELA 2C3LA 1P2AA 4F7LA 4U97A 5A3XA 4GIIA 1H1WA 3VC4A 3MIYA 1I09A 1NXKA 4I5HA 4YBKA 3QAME 3PJ2A 3VBXA 5ANJA 4BKZA 4NIFB 1ZY5A 4BDGA 2VU3A 3FY2A 4N6ZA 4EKLA 3UOKA 2NRUA 2X6DA 4FIJA 3E8NA 4AA5A 4QMQA 5IMEA 4EOOA 4AN2A 1UU8A 1H0VA 3BLAA 3LJ2A 4AACA 4USEA 1W2CA 4RX5A 5E92A 1HCLA 2ZV2A 1ZMWA 2X81A 3BYSA 4YJNA 3UQCA 4F7JA 5K4JA 4YTIA 5CF5A 2XAMA 1Q3WA 2XM8A 3R02A 4W4XA 4ZJJA 3GOKA 4TZRA 3VBYA 2ZDUA 3PJ8A 3FYJX 5AWMA 4YLLA 4EONA 4RX9A 4ZAUA 3LLAA 2CHLA 4DEDA 5CU2A 4HYUA 3D5XA 4XJ0A 1Z57A 2ZM1A 4OTFA 3SOCA 2X39A 2XP2A 3CS9A 2QKRA 3LFCA 5L2SA 4BWPA 2RFSA 4ID7A 4FSRA 3E8CA 2C47A 1WVYA 3QUDA 3OD6X 3E88A 3KQ7A 4DHIB 4BCFA 2VRXA 3MA6A 1B39A 2WQEA 2ETMA 2C3KA 4FIHA 3DV3A 4O4DA 3FMLA 4BI2A 2JKKA 3CD3A 5LVMA 4ASZA 1JLUE 4DG0E 3G9LX 2JIVA 1OUKA 1WZYA 2BIYA 4YR8A 4CYJA 4FKVA 5KMLA 5CVFA 4BDFA 3ZZWA 5L2TA 5DBXA 1H1PA 3UPZA 3NYXA 3DKFA 5LARA 5A4CA 3DU8A 1OPKA 4AGWA 3AKJA 4IWDA 3Q2JA 3O51A 2XAOA 3VBWA 5CY3A 3F2RA 5A4EA 5T6KA 1CKJA 3AC8A 2OH0E 4F99A 3R30A 3PPJA 2UZTA 3TCPA 1Z5MA 2PVNA 3QUEA 4QMYA 4KIPA 2X9FA 2Y6MA 3PWDA 4YUQA 2C5NA 1YI6A 5AUYA 3TV4A 4NM5A 2VWVA 2XBAA 5F94A 5AV0A 5C8KA 2GTNA 4RMZA 3FJQE 4TRLA 5BVKA 4LL5A 4RLKA 5ANKA 5E8YA 2IW9A 3QKMA 3RALA 1MQBA 3IPHA 3ZXZA 4LRMA 4TWNA 3ENMA 3UJGA 4KIKB 4APCA 2CPK