4QMOA

Mst3 in complex with imidazolo-oxindole pkr inhibitor c16
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
289
structure length
288
Chain Sequence
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 288
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmoA01
1BI7A 1OL1A 4CFNA 3M1SA 4RC2A 4YHTA 3R9OA 2XEZA 2UZUE 4Y5HA 4BBEA 2UW3A 4CFMA 4FGRA 4X3FB 2YZLA 3NGAA 3V5JA 4J1RA 1LPUA 4FT5A 3RI1A 4TL0A 4O0YA 1TQMA 1B38A 3DBQA 4C33A 3WF5A 4CQGA 4D9TA 2QODA 1OIRA 3IGOA 4IIRA 5JFSA 2ITZA 3A7HA 5EHOA 4X3JA 5HHWA 3VHKA 4FV1A 1OPKA 1Y8YA 4QP4A 3GNIB 5EQEA 2GNJA 5EI8A 3I79A 3HRBA 5AR7A 5M4FA 1J7IA 1V0PA 2BRBA 3U51A 4OAVB 1QPEA 2E2BA 3L8SA 2F7ZE 4YO4A 4M0YA 3Q2JA 3R1YA 4IE9A 3GFWA 1KE8A 4LMNA 5L2TA 4N4SA 4ONAA 2ZM4A 2OIDA 4FSZA 3A4PA 4A4OA 2FA2A 3MWUA 3JY0A 3QKMA 2FSLX 2GTMA 3O17A 4L6QA 4Y85A 5CWZA 4BVUA 4IANA 3EQBA 1KUTA 5HO7A 2I0YA 1ZYJA 4L43A 5DE2A 2ETKA 4ERWA 3QU0A 4DH3A 4DCEA 4FTOA 4YJTA 1Q8ZA 5E92A 3HECA 4F1OA 2HIWA 2QVSE 4NKSA 3Q9YA 4RQKA 4IXPA 2B55A 2V5QA 4IX3A 2BAKA 3EKNA 4ZSAA 3A61A 5B2LA 4H58A 4CFWA 3IO7A 4JI9A 4QMTA 1E1VA 5A4CA 2FO0A 2WU6A 2VU3A 3PJ8A 4APCA 4O7WA 4HOKA 1H0WA 2HCKA 3W10A 4CZYB 4EJ7A 5DEWA 3EQDA 3FLQA 3C7QA 4YHJA 3Q3BA 2XS0A 4O0UA 3FEGA 4WNKA 3D5VA 5I9VA 1ZLTA 2OSCA 5ACKA 3T9TA 4AZTA 2HXQA 3GCUA 3UNJA 2Z2WA 4OBOA 3DJ7A 3HUCA 4XLIA 5DRBA 3VUIA 3HV3A 4PV0A 3Q9WA 4AZSA 3ZSHA 3V04A 3OWLA 3QX2A 3GU6A 4V04A 3ZOSA 4F1TA 1PXPA 2WELA 4QTDA 4R5YA 2XNEA 3RAKA 1J91A 3HMIA 3ZCLA 4ZY6A 2CDZA 4GT3A 3EYGA 2OK1A 3QCSA 3ORTA 1MQBA 2X4FA 2ITQA 4CSVA 4DFLA 3OT8A 4BDFA 2G2FA 4ZTSA 4FTUA 5TF9A 3ZO2A 4BKYA 4F09A 3GOPA 5DYJA 4J98A 1J7LA 4XG4A 1AQ1A 3W16A 1WBNA 2JDTA 1GY3A 3C0HA 5DLSA 4CG9A 2X2MA 2BMCA 4IZ7A 4GYIA 1UKHA 2OH0E 3PVWA 2YM5A 2WEIA 2QG7A 2ACXA 2WMAA 5B0XA 5CEPA 4DH1A 3HUBA 2YN8A 2EXEA 3DU8A 5C26A 4E6QA 3QD4A 4II5A 5EYCA 3QQUA 2YJRA 3CTJA 2Y4IB 2X7FA 2X39A 2YERA 4XV2A 5BQ0A 5L8LA 5IISA 4MWIA 5HNBA 4OT6A 4BIBA 5AP6A 3JVSA 5IQIA 1AD5A 2CKOA 4RJ6A 5CQUA 2R3HA 4E3CA 4U41A 1GIHA 2C6LA 3UJGA 4C0TA 5BYLA 2BUJA 4EHGA 2GNIA 3H0ZA 4Q9SA 1GZNA 5CSWA 5HG5A 1JKKA 3ZLWA 3HAVA 4O7YA 4PF4A 4NTSA 5BVOA 3DLZA 3BHYA 1XH9A 4NEUA 1M17A 3G6GA 4KBCA 3V8SA 1PHKA 3PJCA 4IMYA 4G2FA 4IZYA 3TCPA 1OKYA 3QQGA 4IDTA 4EYMA 5A54A 1Q5KA 5IDNA 1XH4A 5C01A 4AFEA 4CKJA 4FSQA 2CCHA 2XUUA 1WAKA 2PZIA 3NS9A 4MH7A 3TJDA 3D15A 3KKVA 2UZBA 3O71A 5CSHA 5LMBA 3MYGA 2VD5A 5IUHA 5AFVA 2GNFA 1G8SA 2IVVA 3DK7A 3K5UA 3PSDA 3TZ7A 2YWVA 4R7BA 5GJDA 1R0EA 4BCMA 2R0UA 1NVRA 4DH7A 4DEIA 4KIOA 2YM6A 4S34A 3PVBA 2HXLA 4B9DA 4LGDA 4R7IA 4O0WA 4NJDA 1YDRE 2WTWA 2PZPA 3FXXA 2YZAA 3RTPA 1MQ4A 1YW2A 2R4BA 4DAWA 4YSJA 2J9MA 5IA5A 3UQGA 3P7AA 3HMMA 4OW8A 3UIUA 3QCQA 3OOMA 2JFLA 1YXUA 3AC5A 4PTCA 1IASA 3SV0A 3CQEA 4YTIA 3ZO1A 3PPZA 4EYJA 3Q4CA 4FKPA 5KBRA 2R3LA 5IQHA 5A3XA 1WVYA 4AZEA 3C5UA 3F82A 2PTKA 2YM7A 5HIDA 5L2QA 3UP2A 2VTNA 4YC3A 4L3PA 2VWWA 2RG6A 2B9FA 3BYOA 3BYSA 2OJ9A 1XBBA 3QGYA 4GIHA 4GJ3A 5IH5A 5LWMA 4GT4A 1AGWA 5DT0A 2XBAA 4TYIA 5FD2A 2XJ1A 5AP4A 4RJ5A 2C1BA 4EOKA 4ZJVA 2VNYA 1OIUA 1REKA 2XMYA 3P23A 4EZ5A 2Q83A 4QTAA 3UYTA 1OPJA 4FMQA 4WNMA 2C30A 3HDNA 4P5ZA 3ZH8A 4BTFA 4D28A 3BEAA 4Y83A 1H25A 1IRKA 3AQVA 4FICA 4IB3A 4NM0A 2UW0A 3VAPA 4AT4A 4BWKA 2FSMX 4XV9A 1JPAA 5E90A 3WYXA 4YJQA 2PY3A 2HAKA 5IEXA 2BIKB 3QFVA 1OECA 3H0YA 4HGEA 5E9EA 3C4EA 3FDNA 4RBLA 4LOOA 4I6BA 3CJGA 4DEGA 1PMNA 1ZRZA 4PMTA 2W1ZA 1Y6AA 4QPSA 1VZOA 1H01A 2VO0A 3QLFA 5CU4A 3T8OA 1OITA 4PNKA 4G17A 4XV3A 3PTGA 2ITPA 4JDHA 4RLKA 4X2FA 4XBRA 4FYOA 1ZAOA 5JSMA 4FTTA 2B4SB 3PXRA 5DT4A 3OUNB 3D4QA 4GU6A 4TN6A 4NK9A 4H39A 1NVQA 2HZNA 1E9HA 2HW6A 4C7TA 5GZ8A 4EL9A 3K2LA 5M4CA 2HW7A 3G33A 3UNZA 4DT9A 1OUKA 4G3FA 4HGSA 2PE1A 3O8UA 3QKLA 2PPQA 5H3QA 4LRKA 4FI1A 5J95A 3PXZA 4NM7A 2WTDA 4HYUA 5K5XA 4QYHA 4BHNA 3N9XA 4I5HA 1UKIA 5H9BA 3R1SA 4AZFA 4FEWA 2WMQA 2W05A 3PSBA 3VUMA 2ESMA 2VTAA 3D94A 3KXNA 3MY0A 4I0TA 5AADA 4IB5A 3PJ2A 3R7IA 1IAJA 3C50A 3JYAA 4TWOA 3KF4A 2YM8A 2F2UA 3C51A 3RCJA 3MIYA 3PJ1A 4FIFA 2O64A 4O82A 2QR7A 2QNJA 2WOTA 3R00A 3VBTA 4BCFA 4FV5A 3LFEA 2FVDA 3P7BA 4KRDA 3BELA 4K18A 4DT8A 3PXKA 4TPTA 5LVMA 2OLCA 3OD6X 3JY9A 4KSQA 2W7XA 3PPJA 2VTSA 4FV8A 3WZDA 3CD8A 3KXXA 2YCQA 3NRMA 4FKTA 3A8XA 2UZVA 1QPJA 4YC8A 4LGGA 4ZEGA 5LVLA 3TNHA 4TWNA 1PKGA 3BBWA 3IQ7A 2FH9A 4BDAA 3F5UA 3GU4A 3LQ8A 2OZAB 2OBJA 3O51A 4WG3A 1GAGA 3OROA 3OT3A 5IQCA 3DY7A 4AT5A 3ANQA 3AGMA 4U79A 3HP5A 4BTMA 4LRJA 1HOWA 3ZRMA 1URCA 1ZMWA 3LKMA 3VS3A 4BY9E 3TIYA 2B1PA 3EQFA 4WKQA 2E9NA 4GW8A 3ENHA 5HG7A 4ZY4A 2YCSA 2OXYA 2OWBA 3F2NA 3FQSA 3VULA 3S0OA 3VRYA 5CI6A 1P2AA 4XG8A 3COMA 4ARKA 4GCJA 4EOSA 5GIPE 2BDJA 4PDOA 2VAGA 3AOXA 2CPKE 3PY1A 4C02A 4L3JA 5ANIA 4CXAA 4ZLZA 1J3HA 4YLKA 3KF7A 3GCVA 3IONA 4GMYA 5FM3A 2ONLC 5G1XA 5JFXA 2ITVA 5CZHA 4E20A 4AN3A 4WA9A 2VRXA 2CNQA 2W99B 4H3QA 3L9LA 4QYYA 2VTPA 4E4MA 4OR5A 3FV8A 4YNEA 3R1NA 3NPCA 4RIWA 5FTOA 3COIA 2UV2A 5AUZA 5CSXA 3SRVA 2JFMA 3RAWA 5KUPA 1FQ1B 1MRUA 2JIIA 2VX0A 3C4CA 3OCGA 4NM3A 3WIKA 2RFSA 1CKPA 3CTQA 2Z7QA 3MY1A 4ZJJA 4AP7A 5CTPA 3TG1A 2CMWA 1O6YA 4OTDA 3SQQA 4EK6A 5A4LA 4FTIA 3SHEA 3W2RA 5ETIA 3RGFA 3TKUA 4YSMA 4FYNA 3NNVA 4IWQA 4GIIA 3ZZEA 4IEBA 1NVSA 2GNHA 1WFCA 2OXXA 3G2FA 2W17A 4DG0E 1QMZA 1BUHA 3RZBA 2VTHA 3PY3A 3QRIA 3MA3A 3F3TA 4MTAA 3KREA 2OF2A 4E8AA 2WXVA 4MNFA 3HL7A 4EH7A 2I6LA 3UZRA 2C0OA 3WARA 3RPOA 3BWJA 1H28A 2QU6A 2YIXA 3LXNA 4O0VA 4ZSLA 1UWJA 4IAKA 3W2PA 4D5HA 1PXLA 3CE3A 1Q8UA 3O7LD 5D10A 4AOIA 5DFPA 2ZV2A 2AYPA 1P5EA 2IZUA 2WTKB 3HMOA 4YZNA 5EM6A 3K54A 3SD0A 4DLIA 4F9AA 2ZDTA 4EZ7A 2BRHA 3BE9A 2RL5A 3VO3A 4RC3A 3LMHA 4U45A 5HE0A 3CQUA 3E5AA 4BTKA 3VJOA 5EYMA 4C4EA 3FY2A 3Q96A 4CFUA 2OJIA 4KINA 4TYGA 2OH4A 3CIKA 3H3CA 4AS0A 4CKRA 5H8BA 2ZOQA 4XP3A 4E7WA 1JQHA 3QQLA 2BZJA 2I1MA 3B8RA 5IA4A 4TZRA 1Q24A 4KAOA 4MXOA 4KKHA 2C6TA 3ACJA 3LFSA 5BYYA 1H1QA 1PYXA 3HEGA 4Z3VA 5M44A 4JRNA 2FGIA 3IPHA 1XH5A 5AP7A 2NRUA 4QMOA 1FVRA 1PW2A 3P79A 3D5UA 1ZY4A 2VTTA 4R1VA 3I81A 3UC4A 1WBVA 4I23A 1PXNA 3ZFXA 1UVRA 5KCVA 3U9NA 3QTRA 4FIEA 2J2IB 3QQFA 5DEYA 4CYJA 4Z55A 4WUAA 5AUWA 5IKWA 1DI9A 4X6RA 3A7GA 3NZ0A 1U5QA 5DWRA 5E8ZA 3EN5A 1L8TA 4UWYA 2EB3A 3KRRA 3EFLA 4UB7A 5AP5A 5CF8A 4CG8A 1L3RE 3OS3A 4NJ3A 4CRSA 4DEDA 1STCE 4FTCA 4UMPA 2VN9A 3FAAA 3AT4A 3TDWA 5K0KA 4E5AX 3F7ZA 4FNYA 3VUKA 1IA8A 2B9IA 2BR1A 1KSWA 2XIZA 3ELJA 3ORLA 2KTYA 1H1PA 2PVLA 1S9IA 3FPMA 2X8DA 5HO6A 3DKOA 4MHAA 2C5XA 3QD2B 2SRCA 4L46A 3R7OA 3UIXA 4FBXA 5CF5A 3NMUF 1Q62A 2H9VA 3OFMA 5AX3A 2QONA 2CCIA 4P90A 2XNPA 3KRWA 1ZXEA 5G6VA 4BCHA 1YHWA 2E9PA 3C1XA 3L8VA 3K3IA 3U6JA 2WU7A 1FMKA 2QR8A 3DNDA 3ORIA 1GOLA 2J0KA 2VO6A 4BB4A 4CQEA 4EOQA 4DEBA 3TUCA 4FL2A 4RPVA 2QLUA 4P2KA 5BX0A 5IQAA 5E8XA 1YI4A 4KKEA 2W1EA 1Q61A 2BFXA 3H30A 4YJSA 5EOLA 4BGGA 2YCRA 1UU9A 2GMXA 3Q4ZA 3NCGA 4FK3A 4LOQA 4EHVA 4EOLA 4M14A 1R78A 3CBLA 4L8MA 5F1ZA 2X8EA 4BN1A 4O83A 1ZZ2A 3OXIA 5ACBC 3VBXA 2C6IA 3G51A 4KBKA 5LARA 4D1XA 2XJ0A 4HGTA 2YABA 3BV3A 1LR4A 1JVPP 1YHSA 3IGGA 1H1WA 3CY2A 3LFCA 4RZVA 4IC7A 5I3RA 4GKHA 5L8JA 4L3LA 5KZ0A 1XKKA 5J8IA 4MBLA 4C8BA 2WMSA 2UUEA 3PP1A 3VBYA 5L8KA 3NVMB 4FV7A 3OBGA 1H26A 3OXTA 3QTIA 4L9IA 5KNJA 2P3GX 4ZY5A 2PE0A 2X6EA 3PZEA 5AJQA 4LL5A 4BI2A 4M68A 4EC9A 3ZM9A 1M2QA 4F65A 2VUWA 3B2TA 4I20A 5M57A 3QHWA 4I94A 3ZM4A 4XJ0A 4C37A 4BR3A 3BHTA 4FG7A 2WQNA 5JRSA 3UMWA 4MEDA 5L3AA 3D7TB 4QP6A 2WFYA 2JDRA 2JAMA 2PSQA 2UZTA 5CT7A 1CM8A 3A7FA 2DQ7X 2NPQA 2PZ5A 1EH4A 4I5MA 2CLXA 3AT2A 4G6NA 5CVFA 1DAWA 1R3CA 3Q4TA 4OTPA 3R8MA 4D4SA 5CEOA 2ETRA 2ZV7A 4RIXA 1FGKA 2BROA 4YP8A 4I4FA 2PUUA 2R3NA 3OG7A 4FV9A 2CLQA 1Z9XA 4QNYA 4IX6A 4NT4A 3TL8A 2ZMDA 4ZZMA 5JGDA 5F20A 1Q3WA 2B9JA 2XBJA 3NR9A 3FQEA 5E4HA 3DGKA 3R8VA 3V5TA 4L45A 4AACA 2YWPA 4FGBA 4BZOA 2VTJA 2VV9A 3B8QA 3P1AA 3U55A 4QOXA 4EK3A 4HCTA 3SXFA 4W8EA 3FYJX 4FVPA 4MXXA 4Y72A 3RPRA 5E8VA 4X2JA 4XG3A 4EOOA 4RGJA 4BDBA 4C62A 4UALA 3UDBA 5HBEA 4DHFA 4J71A 4YC6A 1TQIA 2P2HA 3OZ6A 3R9NA 1F5QA 3FI4A 2VWVA 2W5AA 2YM4A 4ACGA 4I5CA 4NCTC 5AIKA 4BZDA 4CNHA 5LJJA 2W1GA 4ZOGA 1UU3A 4LOPA 3QTQA 3CGOA 5AV0A 3PDTA 2ITTA 2IWIA 3QA0A 4EH4A 4O2PA 3ODYX 4A4LA 3MVLA 4ZAUA 3QTXA 3W18A 4C61A 3EN6A 4WRSA 3U54A 2YDIA 2JEDA 3PFQA 4JG6A 3ANRA 4RWKA 4X2NA 4BBFA 3HGKA 4IJ9A 3BYMA 1TQPA 4AW1A 1PF8A 5I9XA 1PXJA 2BZKB 3G6HA 4NFNA 4GK4A 4BCNA 4U43A 3WF6A 3W33A 5IEYA 1GNGA 1ZMVA 4RRVA 5FGKA 3FPQA 4N6ZA 4EBVA 4IW0A 3N4VA 4RX9A 5H2UA 2OJFE 4YPDA 5HG8A 2XB7A 3ZEWA 4QMUA 4M3QA 4PY1A 5HD4A 3GQIA 3FI8A 1FVVA 3DK3A 3ZDUA 3C5IA 1A06A 4YBKA 1SM2A 3EZVA 4YZDA 4BYJA 3DKCA 4YJNA 4EQMA 4C2VA 4L53A 4G1WA 2XRWA 3P9JA 3HKOA 3TNPC 1XH8A 3D2IA 3PP0A 2KULA 2BTRA 3R02A 4WHZA 3VUDA 4BYIA 2R64A 5AUYA 2FB8A 3KN5A 4MNEA 4JX3A 4F7NA 4M67A 3SKCA 4GFOA 2R3RA 2BHHA 2XH5A 2QD9A 3G5DA 3RP9A 4MWHA 4PDYA 5AV1A 4FEXA 2OXDA 4UXLA 2R3OA 3BHVA 3UGCA 4ZZOA 2UW9A 2C6MA 2GQSA 1NY3A 4AA0A 4FTLA 4NTTA 3BKBA 3NUNA 3REPA 5E8UA 3ZC6A 4APPA 5C8KA 2YIRA 3BGQA 4D4YA 2IVSA 2QG5A 4MCVA 2R3FA 5FTQA 2QOHA 3IDCA 5FM2A 3KRLA 4BWXA 2JDSA 3BPRA 3EL7A 3KL8A 4H3PA 4K33A 4E6DA 4TYHA 3P5KA 3W55A 4WUNA 5M06A 3GU5A 3V6SA 4BKJA 3IECA 4FTNA 1I09A 1IG1A 5AWMA 3CLYA 1U59A 3KVXA 5J1WA 3QXPA 2GNLA 2VZ6A 3UE4A 4L67A 1ZYDA 4XG7A 5AA8A 3D5XA 1V1KA 3VN9A 4EOJA 2XP2A 2Y9QA 4I24A 2P55A 2HK5A 1SVHA 5CSPA 2PMNX 3E87A 5HCZA 4DF3A 3LM0A 4FKLA 3MI9A 2HOGA 4NCTA 2WAJA 2F57A 2A1AB 1PRYA 4LI5A 2QKRA 4FT9A 4D0XA 3V8WA 4EK8A 5KBQA 4G6OA 4CD0A 2REIA 4MQ2A 5HESA 5CLPA 4ALVA 1YI6A 4RX7A 1GJOA 1H1RA 4BKZA 4YMJA 3F88A 2PVKA 3ETAA 4J96A 4C3PA 5IQFA 3GVUA 4GSBA 1WVXA 2F7XE 3COHA 3DZOA 3VUGA 3RM6A 3W8QA 3DKFA 4DE4A 4FEQA 3LOKA 4XRLA 3DBEA 1W84A 3FL5A 5B2KA 4C38A 3OP5A 4QMXA 2V7OA 4IFGA 3PXQA 2IJMA 4DH8A 3KQ7A 5HLWA 3PA3A 4M69A 2WGJA 4TKSA 4E1ZA 5FDPA 1WBWA 4M69B 3P7CA 4QTBA 5I9ZA 5KX8A 4XG6A 4YTCA 4AW0A 4KSPA 3F5XA 4O2ZA 3ZSIA 5GZ9A 4IX5A 1BKXA 5D41A 5JGBA 4YBJA 5F9EA 5JKGA 4DLJA 4QT1A 3D83A 5M08A 3LCSA 4JL9A 4RX8A 5FEEA 3RKBA 2WMTA 1T45A 3CTHA 2F2CB 4EONA 4JBPA 4DITA 4XHKB 3FI3A 4HCUA 3VBVA 4AQCA 2PVRA 3E8DA 4EH6A 2Y6OA 4QD6A 5A6NA 5TR6A 2FUMA 4ASEA 4ZSEA 4XOYA 3UVRA 3ERKA 4J53A 4DYMA 4DA5A 2UZOA 5EM7A 5E8WA 2VX1A 4J8MA 4FUYA 1PMUA 4B4LA 1R1WA 4MF0A 4F08A 2UVXA 3LCOA 1V0OA 3QXOA 4NZWB 4U0IA 5ITAA 2YHVA 3V5WA 5EQPA 4L52A 2OFVA 3HP2A 4IAIA 3RK7A 3OHTA 4BCKA 1KV1A 4LMUA 2BRGA 2JIVA 4NFMA 5EDRA 1JOWB 4U9AA 4NW5A 2ZAZA 3PSCA 3FMJA 2JBPA 3DAEA 1OM1A 3QTUA 4C59A 4MXAA 1Z5MA 3E63A 3KGAA 5CU2A 5DRDA 3GB2A 4O1OA 3EB0A 2I7QA 2X6DA 4K9YA 3BCEA 1J1CA 1OL2A 3L1SA 4FSWA 4HVGA 3EQIA 4M8TA 2PVFA 3E62A 5J9LA 4FKVA 4G9CA 3V51A 5M09A 4WRGA 2NP8A 4F9YA 1WCCA 3O23A 3MBLA 3TKIA 3UZPA 5FUTA 3ZO4A 4AW2A 3BLRA 1UA2A 3TZ9A 4PQNA 4QP9A 4U7ZA 5C8NA 4J7BA 3D2KA 3MB6A 4FG8A 4YLLA 3ZLXA 3VUHA 4EH9A 2XK7A 4XP2A 2DS1A 2UZDA 2IN6A 3EQPA 4Y8DA 5A14A 5KHWA 2WMRA 2X2KA 4I4EA 4ITIA 5EK7A 1YXVA 3PIYA 4RVMA 3F3UA 1KOAA 3QWJA 3PG1A 4PTGA 5HICA 5L6PA 3W8LA 5KKRC 4G6LA 5HO8A 2WMXA 2HZIA 3VS7A 2CGUA 3KMUA 4IWOA 5CEIA 4QMYA 3L9MA 3KRJA 2GPHA 4HYIA 4BI0A 3LIJA 3LJ0A 1YRPA 3PXYA 5CNOA 3V01A 3F5PA 3TN8A 3OVVA 2ZVAA 2BRNA 2PVNA 3IDPA 2B0QA 3Q6WA 2WQEA 3PG3A 5CSVA 4O7VA 3GC8A 3BBTB 2C3KA 3NYXA 3LCKA 3W32A 1UNHA 2YA9A 4JBVA 3M11A 5D9HA 3P4KA 3Q53A 2XNGA 4FUXA 3D7ZA 3DAJA 4K11A 2CHLA 2UW4A 4WOVA 2I0EA 3BGZA 2JAVA 3RJCA 4FIIA 3NUSA 4BL1A 4JQ7A 5E91A 1OBDA 3KEXA 4DFUA 1SNUA 1H27A 5HU3A 3OTVA 4B8MA 5LWNA 3GQLA 5GHVA 1SNXA 2CSNA 1JKTA 4FKJA 2Z7SA 4UBAA 1ZYLA 4FF8A 5CU0A 5EH0A 2E9VA 5LMKC 2ZDUA 1JWHA 4FOCA 5IA1A 2ZYBA 4R3CA 1JSUA 4OBQA 3VWAA 3SXRA 3PLAE 5DG5A 5HVYA 3GCPA 3UG2A 2BVAA 4PDPA 1O9UA 3NUXA 3LMIA 4MYGA 3W2CA 3DTWA 3ORMA 4GH2A 3DFCB 3EKKA 4WNPA 1Y8GA 3HV4A 2VGPA 3MH3A 3ZMMA 4QTEA 2ZV8A 3ZHPC 4AA4A 3JXWA 4L42A 4AOJA 4NYEA 5C1QB 2HELA 5A46A 5B7VA 3SGCA 3QC4A 1KWPA 2X9FA 3CS9A 3PUPA 3QC9A 2P0CA 4IZAA 4C4IA 4DG2E 4QMNA 2V0DA 3V6RA 2F4JA 4USDA 5BUEA 2I0VA 4F0IA 4PL5A 2YJSA 3OWKA 3W2QA 3JVRA 3QCYA 4BWPA 4D4VA 3HMNA 1DM2A 2CNUA 3ZSGA 4I5PA 2G15A 4ZSGA 4AW5A 2H34A 2XEYA 4PPBA 3BX5A 4L7SA 2QOFA 3MIAA 3WZUA 5A6OA 3EFKA 3FMHA 4F99A 3LXLA 4D2WA 2C1AA 2R7IA 4AGUA 4RVKA 2VTQA 4AGDA 5DVRA 4DGOA 3CEKA 2XCHA 3QTZA 1APME 1VEBA 5AUTA 3LAUA 4IDVA 4GUBA 2C0IA 4K8AA 2PK9A 3FZPA 2WTJA 3ORNA 4IM2A 2OGVA 5EM5A 3ZRKA 4PPAA 4IAZA 4EWQA 3F2RA 4RFZA 3GFEA 3SC1A 4DC2A 2BALA 4IAYA 4EORA 4UV0A 3ORZA 5EDPA 3R9DA 2PWLA 4CT2A 4D1ZA 4BDHA 4A06A 2G9XA 5ANGA 4BFMA 2PVHA 5J7BA 4O0SA 4AF3A 4FOBA 3TI1A 3WIGA 4IB0A 2J0IA 4DGMA 4AOTA 2UZEA 4IAAA 4DFZE 1P14A 2C68A 3TUDA 4EOMA 5IUGA 4EWHA 3QZFA 5KE0A 4K1BA 1OKVA 4JOAA 3ZLYA 3FLWA 5KMNA 4GKIA 1GIJA 5K5NA 5DI1A 4XMOA 5BYZA 2C6KA 3WZKA 4Z7HA 5KMKA 4F9BA 5IMEA 4FSRA 4OTFA 4R7HA 5LMKA 2DWBA 3TKHA 1VYWA 2WMUA 3KXMA 3P78A 5AP3A 4JX7A 4QQTA 1B6CB 2PULA 2W9FB 2P4IA 3NAXA 2J4ZA 1U54A 4AU8A 3BWFA 1U54B 2H8HA 1E1XA 4S31A 4XG9A 4HNFA 3QF9A 5C8MA 4GFMA 3R7EA 1WBTA 4U8ZA 4LGHA 2VTLA 4Y95A 3LFDA 4IBMA 4JS8A 5AAGA 3FKLA 1URWA 3VVHA 5CEMA 3AC2A 2YIQA 4FC0A 4PUZA 5C4LA 3HMPA 3FI2A 2QOKA 5HE1A 3CXWA 1TVOA 3WZJA 2WIHA 4E6AA 3DK6A 5HVKA 3BU3A 3DPKA 3TEIA 3OWPA 4A9TA 3HDMA 3WI6A 5IQEA 4FL3A 4HGLA 3SG9A 2CKQA 3OXZA 1RW8A 2Z60A 3DJ5A 5J5TA 4Z9LA 4HW7A 5AUXA 2UVZA 1MRVA 2YISA 3Q4UA 3E3BX 2H6DA 2OW3A 3EN4A 2B7AA 1M7QA 2WTKC 5AIRA 3LQ5A 4EHZA 3O7LB 2WQBA 3I60A 3GBZA 4QQ5A 4E93A 1QL6A 2EVAA 2YDKA 3MJ2A 3MY5A 5HBHA 5HLNA 5CF4A 1OL6A 4Z16A 2X7GA 3OCBA 3Q52A 3GU7A 3R7YA 3HRCA 2ITYA 2AUHA 3KB7A 3FZTA 4C3RA 5CASA 5JRQA 1P4OA 1UNLA 4CFXA 5HORA 4JQ8A 4YLJA 2CGXA 4YR8A 4O96A 4RFYA 2EUFB 3UP7A 3GP0A 4RIWB 3SRVB 5BUIA 4WNOA 1OIYA 4B0GA 5KMMA 2RFEA 5AV4A 4BDGA 4ZP5A 3FSKA 2QC6A 4RJ8A 2ITNA 4ZLOA 4AZVA 3U87A 4YJVA 4G3EA 4JAIA 5FXRA 4GT5A 5BUJA 4DEAA 4J97A 2HY0A 3QLGA 2HWPA 4MBJA 2R3IA 3BGPA 3LFFA 4G16A 1F3MC 5LVPA 3ZFMA 3TNIA 1BLXA 2VO3A 4QP2A 3RBWA 3QHRA 3UO4A 3D5WA 4JT3A 4Z7GA 1ZOHA 3POOA 2PU8A 1PXMA 1WMKA 3K5VA 3ORXA 5C03A 4HCVA 3QUPA 4O0TA 3R04A 2IW6A 4ID7A 3RZFA 3AMYA 3KULA 4BBMA 3BU5A 3GXLA 4DGLC 4ANLA 4TY1A 4FV6A 1YDSE 2J7TA 4D5KA 5AM6A 2B54A 3GCQA 3IKAA 3C0GA 4KD1A 4N70A 4ACMA 1NW1A 4OTWA 2BKKA 3A99A 3FBVA 3FXZA 4UMQA 4A7CA 5H8GA 2W1FA 3UIMA 4CTCA 4GK3A 5JFVA 4OTIA 2R3KA 5B2MA 3KFAA 3ZXZA 5EG3A 3BU6A 4AWIA 3U4WA 5I9UA 4Q5HA 3UVPA 2ETMA 5DR2A 4G5PA 2LAVA 4GUEA 1DI8A 4O81A 3NCZA 4C4HA 4FVQA 3RPSA 4E4XA 5E7RA 3ZLSA 3QQKA 3ZO3A 3UMXA 4E4NA 5TE0A 4OUCA 4FVRA 4TTHB 3NW7A 2ITOA 4NKAA 4EBWA 3EQHA 3S1HA 3GT8A 3ACKA 3HZTA 1H24A 4BIEA 3I5NA 4U97A 1JKSA 4IM0A 3LJ2A 4HVHA 3R8PA 3QCXA 3QRTA 5AR5A 2WMBA 1LUFA 3DQXA 5EHLA 4I21A 3LE6A 4N0SA 4H05A 4QMSA 3SX9A 4H36A 5DOSA 2ONLA 2WHBA 4YPSA 5HIEA 1BI8A 1XWSA 5HCYA 3HLLA 2E9UA 4CVAA 4L01A 2OIBA 5J9YA 5HTBA 2PUNA 2O3PA 3R2BA 5J79A 5JQ5A 1LEZA 5BVDA 1YWRA 4HYSA 2W06A 4ENYA 1K9AA 4XEYA 1V0BA 2R3QA 4IZ5A 2O2UA 3P0MA 4RFMA 5AV2A 3ROCA 2GQGA 3NNXA 1MUOA 2GQRA 4FKWA 4DINA 1PMEA 4MVFA 4U40A 1IEPA 2WZJA 4ZTRA 4YUQA 3DCVA 3WYYA 2IO6A 2R2PA 2WPAA 3QRKA 4GU9A 4XCUA 5AP0A 3ZBXA 3O2MA 3CJFA 4X7QA 4IWDA 4RG0A 3N51A 1OI9A 3OBJA 2PZYA 4KS7A 3KCKA 4DEHA 4ZMEA 5E8TA 1KV2A 3FLSA 4BIDA 2XNBA 1OPLA 2Q0BA 3Q9ZA 2J90A 3MW1A 3QRUA 4QO9A 4S33A 4MXYA 5CAQA 5AUUA 3HV6A 3C4ZA 3U6HA 3ITZA 3PZHA 3LM5A 3UNKA 3R0TA 4BDKA 3V5PA 4EH2A 3DQWA 2W1DA 4XBUA 3T9IA 1W98A 2PZRA 2VX3A 3UPZA 3R01A 4YJRA 4D1SA 4FNWA 5BNJA 4IVDA 1G5SA 3AC1A 3BHUA 1O6LA 4DFNA 3S00A 2EB2A 4ZIMA 2WTCA 4EEVA 3VS4A 4JQEA 3SOCA 3MGYA 4ZTNA 3PWDA 3NUPA 4L68A 3EHAA 2ZV9A 2QQ7A 2XYUA 5CAVA 2XF0A 3MFUA 4FT0A 4EZ3A 4BICA 1M52A 1Q8YA 4PRJA 4CKIA 3NIZA 3E92A 4GEOA 3PE1A 5L6WL 4F63A 4E5WA 2PL0A 2GHGA 2Y8OA 5HZNA 3MSSA 5LXMA 3KCFA 4FSMA 4V01A 3KC3A 1YXXA 3FMEA 4WG4A 3JR1A 4UX9A 4D58A 1H07A 3QD0A 3VBWA 4CRLA 3LCDA 3DDPA 4BI1A 3L8XA 5HU9A 3THBA 4QMQA 4M84A 3CP9A 4QTCA 3TACA 2JKKA 2YIWA 4ANBA 4XG2A 2CGVA 3QAME 4HPTE 3MFTA 2BAJA 4GL9A 2HWOA 4E6CA 5BPYA 4KIKA 4I92A 5E8YA 5AR3A 5HNGA 2FYSA 4FTMA 4BGHA 5D7AA 2BHEA 2C4GA 4FIHA 4FR4A 4OLIA 2R9SA 4RJ4A 4PP9A 4W8DA 4YZBA 3M42A 3T3UA 4EQUA 2YAKA 3AG9A 5M07A 2ZJWA 1PMVA 5HOAA 4HVIA 5CVGA 4LM5A 5K3YA 5J7HA 5KMJA 2F9GA 2GNGA 3VS0A 2J0JA 2OICA 1TKIA 1FGIA 2QCSA 3OEFX 5BVEA 2F49A 2R0IA 1IA9A 2ITUA 2W4JA 3O96A 4RVLA 4RIXB 5DT3A 2XIYA 4RSSA 4A9YA 4R78A 1Q97A 5CI7A 3FZRA 2XIRA 3TUBA 2YDJA 3U9CA 2YM3A 4KABA 4DBXA 4WT6A 4PMPA 3R7UA 4EQCA 3G15A 1YWVA 2XKFA 2ZB0A 2RSVA 5DA3A 4G34A 2JKMA 3UYSA 1FVTA 3QWKA 3PVUA 1YQJA 1GZ8A 2W1CA 2OZOA 2C47A 3ZONA 4YTFA 3KVWA 2R3PA 4C36A 4L7FA 1K3AA 3HX4A 5IDPA 1W83A 4YZCA 4ASZA 2PVMA 3WILA 3ZXTA 3N4TA 5AAFA 2I0HA 4KS8A 3II5A 4C58A 4CFFA 2XZSA 5AP1A 3AC4A 3S95A 3LVPA 2XK4A 4JVGA 2PUPA 2RIOA 5EKOA 4D2VA 1BMKA 4K0YA 4OBPA 3NDMA 4V05A 2QOBA 3D0EA 4LUEA 1YDTE 4W9XA 1PJKA 3R6XA 4NW6A 4FV0A 5CAPA 4X3FC 3VQHA 4GYGA 3LQ3A 2X8IA 3CR0A 5ANOA 4X6QC 2IZSA 3TV6A 4A9SA 4NUSA 4F1MA 4QP1A 5I9YA 4FE2A 4JXFA 4AE9A 1ZOGA 2XNNA 3IK3A 1H4LA 4BHZA 4EK4A 4NL0A 5IG1A 2GS6A 2QKWB 3VUTA 3ORPA 4ITJA 1KE6A 4NWMA 4IVCA 2GS2A 4MD7E 4AG8A 5FRIA 1WBOA 4KIQA 5L2SA 4QMMA 3KMWA 3ZUTA 2WMWA 5IZFA 2GTNA 3F3WA 4FSNA 4ZS4A 2XIXA 1G3NA 5JZJA 3EWHA 3FC1X 2QI8A 3FMLA 4EJNA 3MESA 3A62A 1U46A 4JDJA 3VS6A 4F6SA 2PUIA 5DGZA 4MNEB 4BZNA 3UVQA 4EK5A 2G2HA 3SW7A 3P86A 4FL1A 1WZYA 5ANJA 4RA4A 1JSTA 1OMWA 3BZ3A 3FMMA 1FINA 4FK6A 3SOAA 2R3JA 4IC8A 4ZTQA 5AX9A 4EH3A 5IPJA 4CCUA 3FE3A 4UWCA 3RPYA 5IU2A 4BCJA 1XQZA 3WF8A 4O7SA 1ZARA 2AC3A 1IR3A 3RK5A 3WF7A 1VJYA 4MQ1A 3LCTA 4D2PA 4RWLA 3DBDA 3ALNA 2ITXA 4GRBA 2J0LA 3JUHA 4TYHB 1W8CA 4FIGA 4M97A 4QPMA 3KU2A 5CT0A 3R7VA 2VTIA 5FEDA 3R9RA 1YXSA 2WB8A 5D12A 2VWXA 3FMNA 1VYZA 3PJ3A 3ZZWA 4ZMFA 4LV8A 5FBOA 3VQUA 1SVEA 5AP2A 2C6OA 2BCJA 4CMOA 2A2AA 2VWYA 4U80A 3F5GA 2CN8A 2BDWA 4FTRA 5CY3A 5GNKA 3A60A 2Z8CA 5FP5A 4ZTMA 3MB7A 2W5BA 5HTIA 4WG5A 5JK3A 2FSOX 3R1QA 2EWAA 4YJOA 1LEWA 2JDVA 3I4BA 3UTOA 4FIJA 3E8CA 5KO1A 5CQWA 3FJQE 2V22A 2YCFA 5TT7A 1PXOA 3I1AA 3RHXA 2VWZA 1QPCA 4DTKA 3MH2A 2G2IA 3UZTA 4QMZA 4X3FA 4MBIA 4PNIA 3GUBA 3DAKA 4FZFB 4U3YA 2V55A 4OTHA 3CCNA 2OJGA 3BQCA 3KMMA 1WVWA 3R8UA 2PVJA 3NNUA 3TV7A 3DJ6A 4JDKA 3RALA 4M0ZA 5CENA 3OCSA 3VBQA 4RT7A 2Y4IC 2QU5A 3E93A 2DUVA 3OC1A 4JBQA 4UY9A 3R71A 5A4EA 1KOBA 3MTFA 5HE2A 3JS2A 3ZFYA 2GHMA 4CMTA 1WBSA 4UZHA 2R3GA 4ANOA 5AAEA 1OIQA 4CGAA 1HCKA 3R22A 1YOJA 2JD5A 3IW4A 4ANQA 4C3FA 3Q5IA 4P7EA 4XP0A 3FWQA 4QMPA 3HAMA 4H1MA 3BYUA 3UQFA 4HNIA 4U6RA 4PMSA 5DN3A 3KK8A 4EH5A 3E8EA 1GZKA 2ERKA 2OG8A 3WF9A 3CPBA 2HENA 1B39A 3QX4A 4HPUE 5DBXA 3RK9A 2XKEA 3FC2A 1BL7A 5EQYA 2RG5A 2XK6A 2YFXA 3EH9A 1U4DA 2ZB1A 5FTGA 5JT2A 3VF8A 4C4JA 3F3ZA 5BMMA 3O0GA 3R8ZA 3V5LA 3A4OX 5HG9A 3DTCA 4AE6A 4DFXE 2WKMA 3WZEA 4EH8A 1H8FA 2P2IA 3CKWA 3TZ8A 3BE2A 4DTBA 5HE3A 3GU8A 4A07A 2J6MA 4F9WA 2OU7A 5K4IA 3O8TA 5LVNA 5EI2A 3PXFA 2YLEA 4C57A 4MX9A 3QL8A 1JLUE 4FZ7A 4WD5A 3C13A 2GFSA 5M4IA 5GJFA 2X81A 3KRXA 5IQBA 3HA8A 1F0QA 3LXKA 4GVAA 3NYNA 2VGOA 4WBBB 4R3RA 5LVOA 1JNKA 3HYHA 3VS5A 4XUFA 4B99A 3BLHA 2YIYA 3QZHA 2QOIA 1ZYSA 2Q0NA 4FNXA 5J5SA 3QZGA 4O7NA 2JITA 1CKIA 3UC3A 5I4NA 4GG7A 3TNQB 4JLCA 4O21A 4QRCA 4O0XA 4RVTA 4TYEA 5FBNC 2IW8A 5CEQA 3TWJA 2Y7JA 1KE5A 3K3JA 4AN9A 3U4UA 1W82A 2PYWA 1H0VA 4HYHA 4JDIA 2VWBA 3ZUVA 5GINE 4IH8A 4EKKA 3DB6A 4BCPA 4FX3A 3WE4A 2A19B 4GJ2A 3DOGA 3ZUUA 3BV2A 4JAJA 4TT7A 2XIKA 4M7IA 2XVDA 2BZHB 2PVYA 2LGCA 3I6UA 3FHRA 4WBOA 3F61A 3QUDA 5LQFA 3ALOA 2OI4X 3SA0A 5D11A 3A8WA 4FKQA 1XHAA 4QP8A 1K2PA 2VTOA 3LFBA 5TO8A 3R8LA 4BCOA 3OY3A 5LMAA 3V5QA 2B53A 2VWUA 1SVGA 4A9RA 1J7UA 5DHJA 1FBNA 4O86A 3DXPA 3AC8A 3G0EA 3WE8A 3COKA 1Q41A 2A27A 2PMOX 2YEXA 3E88A 3E8NA 3QUEA 4ITHA 4F6WA 5CF6A 3ID6C 4DFBA 1PY5A 4ERKA 3DA6A 1OKZA 5DNRA 2XRUA 4I41A 4DBNA 2O63A 3RMFA 4D55A 4IVAA 4DN5A 4QNAA 4UMRA 3W2SA 4Q2AA 1JKLA 1NA7A 4S2ZA 3RINA 2IG7A 3F7WA 4LRMA 2UZNA 3FYKX 4DGGA 2BILB 4FG9A 3GC9A 5AA9A 3DBCA 4FKRA 5JEBA 4XV1A 2RFNA 4IQ6A 4O38A 1J1BA 3RCDA 1OUYA 3ATSA 1RDQE 4ZJIA 4F70A 4CZTA 4Q9ZA 3S3IA 3ZYAA 5D7VA 3VS1A 4GS6A 4EHEA 2JBOA 3LW0A 3LXPA 4TRLA 3V3VA 4O7LA 3RNIA 4F9CA 5EKNA 1A9UA 5HBJA 5BVFA 4YU2A 3AD5A 1YI3A 1RQQA 4FSYA 1BX6A 2PHKA 5IA3A 3W1FA 3OY1A 3H4JA 3UO6A 5KMOA 4LL0A 2Z7RA 3HRFA 4J52A 4KA3A 2QURA 3W2OA 3PIZA 5EOBA 1T46A 4AFJA 5DIAA 3VW8A 3ZBFA 5FWKK 5DMZA 3MS9A 2BKZA 2XNOA 4GK2A 4ASXA 1VR2A 5AR4A 4JJRA 4KWPA 1UV5A 3WOWA 4G9RA 3SLSA 3LJ1A 1Y57A 3Q32A 3ET7A 3FKOA 3LZBA 3NUAA 2NRYA 1CDKA 3TZMA 4EUTA 3EFWA 5TOZA 3QYWA 3RAHA 3TNWA 4E4LA 3KXZA 1LP4A 2WOUA 1X8BA 1Y6BA 4M15A 3AXWA 4TXCA 4QP7A 2W4OA 3HA6A 4FNZA 3R21A 3LPBA 3ULZA 1PXIA 3ROYA 4UWBA 1ATPE 3PA4A 2CGWA 4O84A 3R7GA 3PE2A 4G5JA 2BZIB 5I9WA 4KRCA 3FKNA 1MRYA 5IH4A 3BEGA 4JR7A 4MD8E 5EHYA 4NIFA 4Y46A 3E3PA 5T6KA 4NIFB 4DCAA 3MPMA 4ZLYA 4USEA 2P33A 3DV3A 5AV3A 4CV8A 5A4QA 5CNNA 3TIZA 4AT3A 3QBNA 3CQWA 2JKOA 3QTWA 4C4GA 4CEGA 3UIBA 2ERZE 4TYJA 5AR2A 4CLJA 3MPTA 2WD1A 4MKCA 4QPAA 4UEUA 4CZUA 3KXHA 4PL3A 1OZ1A 4YURA 2XCKA 5DR6A 2W9ZB 4U42A 5KKRB 1RE8A 5HKMA 4ASDA 2WMVA 3CD3A 3I7CA 2R3MA 2QO7A 4GVJA 4PX6A 4D2SA 3QYZA 1PYEA 1PXKA 2BRMA 4OTGA 5AMNA 1CSNA 5FXSA 2I40A 4TWCA 4XOZA 2GCDA 4FV4A 3IOPA 3NW6A 3FQHA 5M53A 3NNWA 3DXNA 3Q60A 5HI2A 5EW9A 3ZRLA 2C6DA 3R83A 2OIQA 2W0JA 5FXQA 2QOLA 3NW5A 4KB8A 5CZIA 1Z57A 5DR9A 1DS5A 1GIIA 3ZTXA 5LCJA 4FTQA 4CMUA 1ZY5A 3FY0A 5IA2A 4MXCA 5A9UA 2QO9A 2PMIA 2JGZA 4MAOA 4JIKA 3NSZA 4EI4A 1Q8WA 3SVVA 4OTQA 3G0FA 5T3QA 4W4YA 3LHJA 5IQGA 2DYLA 2BFYA 4YO6A 2QOCA 2OKRA 3KN6A 2XK9A 3AC3A 5ETFA 4BF2A 4FEVA 4OTRA 3QQHA 4IB1A 5KZIA 4I6HA 4BDEA 3HV5A 3MTLA 4PWNA 3PRFA 3H9RA 3UQCA 4QQCA 5HX8A 5L2IA 1XJDA 4I3ZA 2XKDA 4EOPA 1W0XC 5K0XA 3FLZA 3ZEPA 2GHLA 2J51A 1H08A 2EU9A 4PPCA 3DDQA 4GG5A 4FV2A 4XS2A 4ZK5A 3VS2A 2JDOA 5HQ0A 4OAUC 4OT5A 2C0TA 1QCFA 5CAUA 5ETCA 2WQOA 3CKXA 1ND4A 2C5OA 2W1IA 3S2PA 4HZSA 4EUUA 4XNEA 4A4XA 3LLAA 5CEKA 1YOMA 4H1JA 3BLQA 4Q5EA 2X9EA 1W7HA 2C5YA 4I6QA 5CX9A 5F4NA 2R7BA 4JR3A 4LG4A 4MD9E 3D9VA 5I5ZA 3L8PA 2CNVA 1YKRA 4IX4A 4R77A 4JIAA 1P4FA 4CTBA 3EN7A 3ZC5A 3PVGA 4RWIA 4NU1A 2WTIA 3L9NA 4KKGA 5EFQA 2OZAA 2X1NA 2YITA 4ZTHA 1OGUA 2WO6A 2XKCA 2OJJA 3FXWA 4IFCA 4O91A 4FTAA 3FZSA 3QKKA 5EM8A 3C0IA 1ZOEA 2CKEA 3I5ZA 4L44A 3TJCA 3FLNC 3QTSA 3QRJA 4HVSA 2QHNA 5CXZA 4N57A 3EFJA 4D4RA 4E26A 5AEPA 2C3IB 2OFUA 3EZRA 3EL8A 4O6LA 4B7TA 2NNWB 2WIPA 3NAYA 4IVBA 5J87A 1Q3DA 3RWQA 4FTJA 5K9IA 2V62A 5LCKA 5M56A 3E64A 5T68A 4J8NA 4QYFA 2R5TA 3RVGA 3UOLA 3UOHA 5FQDC 4O27B 3AD6A 1SMHA 3QALE 2QOQA 4OGRA 3SDJA 3AMBA 1M14A 4TNDA 2RF9A 3OMVA 1JAMA 3DNEA 1OKWA 3PA5A 4IADA 5EYKA 4L00A 5CS6A 4FA2A 2VO7A 1Q99A 2C5NA 3OCTA 4DEEA 5ICPA 2XA4A 4XLVA 4M66A 4G3CA 2QOOA 4AXAA 4UYNA 4XRJA 2A4LA 3R28A 2GS7A 4U44A 4UMTA 4C4FA 3NYVA 2UW8A 3C4FA 4F7JA 5L6OA 4MK0A 4G31A 1NXKA 2A0CX 3VNTA 1ZYCA 5E8SA 4DGNA 3BRBA 3E7OA 5CAOA 4O0RA 2IVTA 2J0MB 4AN2A 1R0PA 3MA6A 5ANEA 4F6UA 3C4XA 2EXCX 3KULB 4X0MA 2ZMCA 4X2GA 2J5EA 2BDFA 2WQMA 4TWPA 5HCXA 3FSFA 4FKOA 2B9HA 5C9CA 4ANNA 4JBOA 4BGQA 3AMAA 1YXTA 4CCBA 3FL4A 4ZSJA 4FSUA 2C3LA 3MV5A 3H10A 3GCSA 1YVJA 4W4VA 2C69A 5JMSA 4AX8A 3ZS5A 4UYAA 3IS5A 2XK3A 4HVDA 2XYNA 3O50A 5F94A 2X7OA 3MDYA 5HLPA 3OTUA 3ZU7A 2ZM3A 3IDBA 3TXOA 2HYYA 5HD7A 5CXHA 4ACDA 3TV4A 3MFRA 5IEVA 4FKGA 3RNYA 3BYVA 4NSTA 4R3PA 5J9ZA 2RFDA 5K4JA 1I44A 5M51A 3MH1A 2Y4PA 4MXZA 5FDXA 4ALUA 3H9OA 4ACCA 4B8LA 2BAQA 3F69A 1ZZLA 4O7ZA 3EJ1A 4R5SA 3EQCA 1KE7A 4U3ZA 5BVKA 4ANSA 4WO5A 4K77A 3ORKA 3QQJA 4R1YA 2Z02A 2AC5A 3FLYA 5IH6A 5IUIA 2UVYA 3NUYA 5I3OA 4QYEA 4DG3E 3G90X 3EN9A 3NUUA 2E9OA 3B2WA 3EQRA 3R63A 3F66A 4ORKA 3PPKA 3PWYA 4BTJA 3BHHA 4F7LA 1XO2B 4USFA 2IZRA 3PY0A 2HY81 3GC0A 4ZZNA 2IZTA 3R30A 3Q5ZA 4AA5A 3I0QA 4YHFA 4U5JA 4CFVA 3TM0A 4D0WA 5BVNA 3NLBA 3OEZA 3F3VA 5JN2A 3FMDA 3RAIA 2UW5A 4ALWA 3QGWA 3ENMA 4E5BA 2O65A 1ZWSA 2WTVA 2UW7A 2WNTA 4RIYA 2GSFA 4RIYB 2NO3A 3C9WA 3Q6UA 3UPXA 5JGAA 3EOCA 3GEQA 5EDQA 4X21A 4P4CA 5EW3A 4BDCA 5TKDA 3ULIA 5L4QA 4I6FA 4JG7A 4I93A 5M55A 5HX6A 4X2KA 4KNBA 2JLDA 2RGPA 3RWPA 4UN0C 5E1SA 5H8EA 2BTSA 4S32A 5EW8A 4PDSA 5HGIA 4FT3A 5CVHA 2JC6A 5IF1A 4J95A 4JNWA 4QMVA 4FTKA 4QYGA 2F7EE 1REJA 3ATTA 4N6YA 1QPDA 4FT7A 4F64A 1H00A 2VWIA 3FHIA 3NIEA 3AT3A 4G3DA 4LV5A 4LYNA 4FKSA 3L9PA 5AR8A 4K6ZA 4JRVA 4O22A 4RJ3A 3Q04A 4F0FA 5CALA 1XH7A 2G1TA 4KBAA 2Z7LA 4W4WA 3VIDA 3C4WA 5F95A 4LFIA 1M2RA 3VJNA 3BQRA 1Q4LA 4KUJA 3GGFA 4IACA 4XYFA 4EKLA 3G9NA 2Y0AA 3KY2A 3F9NA 4UMUA 4AAAA 4YJPA 2W5HA 2VTMA 4IHPA 3P08A 3HVCA 4O6EA 4FODA 1JSVA 4I1ZA 2W1HA 3MJ1A 3MVMA 3EIDA 5BVWA 2IW9A 4D9UA 1KE9A 2PE2A 4WSQA 4ACHA 3JPVA 1ERKA 2X0GA 3DFAA 3KA0A 4BDJA 5A4TA 2IPXA 5E1EA 4D2TA 3IG7A 3MFSA 1U5RA 4RQVA 5FP6A 3OOGA 4AGWA 1M2PA 1XH6A 3UOJA 4RZWA 4RA5A 3E7VA 5I0BA 5C4KA 3QA8A 4ZXTA 3DB8A 4IAFA 4YNOA 5CU3A 4ANMA 5JZNA 4C2WA 3NEWA 3OW3A 4DTAA 4IWPA 3A7IA 3SW4A 3DZQA 2J5FA 3FZOA 5EYDA 4RX5A 4YGAA 4B6LA 3RM7A 3AGLA 2XM8A 1SZMA 3DLSA 4UZDA 3OF0A 4MF1A 2H96A 2OO8X 4KIKB 5DPVA 4E73A 3CGFA 3DXQA 1YOLA 2GDOA 5CANA 4EC8A 2PMLX 3KXGA 3LFAA 5GIOE 1OL7A 1PKDA 4GFGA 3G9LX 4M13A 4QMWA 3U8WA 2XM9A 4FV3A 2O5KA 2OF4A 4UXQA 2X4ZA 4H3BA 3LFNA 3UODA 4CV9A 3M2WA 2HZ4A 3F2AA 3QD3A 3FUPA 5EI6A 4W4XA 4XH6A 2XJ2A 4C34A 5M4UA 1MP8A 3MN3A 4M12A 5HTCA 1RJBA 5AM7A 4AGCA 1A48A 1S9JA 3DS6A 3BIZA 1DAYA 4S30A 3N4UA 5DH3A 4FZAB 1ZMUA 3LFQA 3NYOA 4Y73A 3SAYA 4AUAA 4PP7A 3IOKA 2UZWE 3OUKA 1XBCA 2QLQA 5LOHA 1G8AA 3U6IA 2YLFA 3H9FA 3ODZX 1OB3A 4HZRA 3VHEA 3I6WA 3GOKA 1FOTA 3MH0A 2VNWA 3D7TA 1UU7A 4O7RA 4HJOA 1WBPA 3VF9A 4FKIA 2O8YA 4RIOA 2C5VA 1CTPE 4J99A 5CYIA 1R39A 2C3JA 4DFYA 3I7BA 4GV1A 5JFWA 4TNBA 5HNIX 3Q2MA 3A2CA 4ZTLA 4ENXA 3CSVA 4EOIA 3EQGA 1M7NA 4F7SA 3VC4A 1Y91A 1YWNA 1BL6A 1FPUA 1H1SA 2XK8A 3O8PA 2WEVA 1BYGA 5GJGA 1Q8TA 3GC7A 4G3GA 3CC6A 3QZIA 5HVJA 3GI3A 4CLIA 2X2LA 2BIYA 2BPMA 4BCIA 1OBGA 2ZM1A 3WBLA 2QHMA 4IJPA 4K2RA 4F4PA 4RWJA 5GZAA 5IMXA 3SG8A 4CYIA 2QO2A 4FZ6A 4V0GA 3MPAA 3AD4A 4V0GB 4WSYA 1GZOA 5FG8A 3RHKA 4NM5A 2VTRA 3ZDIA 1SYKA 2J50A 1JBPE 5KMIA 4ZS0A 1FMOE 3KK9A 4RJ7A 3IW8A 3A7JA 3TT0A 1CMKE 2GU8A 4YJUA 5FEQA 5D1JA 4O7TA 3UO5A 3POZA 4FSTA 2FSTX 4I0RA 3VW6A 4RMZA 3UG1A 2JIUA 4YTHA 4QP3A 4JG8A 2Y6MA 4RLLA 2V7AA 2EXMA 3BI6A 5ANDA 4A9UA 1CKJA 5JQ8A 4QMLA 2IVUA 4YZ9A 3LMGA 5ETAA 4NH1A 4QQJA 2CJMA 2CN5A 4O1PA 2YACA 2ITWA 3UOKA 4BCGA 5L2WA 2C6EA 5KHXA 3PRIA 1YHVA 1OVEA 3CPCA 4R6VA 3D14A 3OW4A 3S4QA 2O0UA 5IQDA 5AUVA 3PLSA 3R73A 4RC4A 3UBDA 3PIXA 1HCLA 3NX8A 3HV7A 4PMMA 5BMSA 5JH6A 3PYYA 3TTJA 3RPVA 3FZ1A 3SXSA 2G01A 1OL5A 4IM3A 4I0SA 4FEUA 3HNGA 4TW9A 4WIHA 4AZWA 4DH5A 3DKGA 4R8QA 3MVHA 2RKUA 4XX9A 4F0GA 5ANKA 3V8TA 3R9HA 4BRXA 3EYHA 4FKUA 2YAAA 1NT2A 4PL4A 3DT1A 4LQMA 5CU6A 1UWHA 4P5QA 2GFCA 2W96B 5FLFA 4CT1A 4LUDA 2XNMA 4BC6A 3GENA 2CKPA 2W4KA 3IW5A 3Q9XA 2B52A 3F6XA 3T3VA 4PTEA 3TDVA 1O6KA 4BCQA 3EMGA 5HIBA 5IA0A 2HZ0A 3FMKA 3VRZA 4W9WA 3CY3A 4U81A 3OWJA 4BDDA 3LLTA 4BDIA 1XR1A 5KMLA 3NVKI 2JKQA 5J1VA 4YZMA 1UU8A 3R2YA 1UNGA 3IW7A 3NWWA 4KIPA 3TTIA 4D2RA 2UZLA 3DBFA 3I0OA 3IW6A 1IAHA 2UW6A 4FZDB 1XBAA 4I22A 4C35A 4Y5QA 3MVJA 5HEZA 5C27A
chains in the Genus database with same CATH superfamily
1BI7A 1OL1A 4CFNA 3M1SA 4RC2A 4YHTA 3R9OA 2XEZA 2UZUE 4Y5HA 4BBEA 2UW3A 4CFMA 4FGRA 4X3FB 2YZLA 3NGAA 3V5JA 4J1RA 1LPUA 4FT5A 3RI1A 4TL0A 4O0YA 1TQMA 1B38A 3DBQA 4C33A 3WF5A 4CQGA 4D9TA 2QODA 1OIRA 3IGOA 4IIRA 5JFSA 2ITZA 3A7HA 5EHOA 4X3JA 5HHWA 3VHKA 4FV1A 1OPKA 1Y8YA 4QP4A 3GNIB 5EQEA 2GNJA 5EI8A 3I79A 3HRBA 5AR7A 5M4FA 1J7IA 1V0PA 2BRBA 3U51A 4OAVB 1QPEA 2E2BA 3L8SA 2F7ZE 4YO4A 4M0YA 3Q2JA 3R1YA 4IE9A 3GFWA 1KE8A 4LMNA 5L2TA 4N4SA 4ONAA 2ZM4A 2OIDA 4FSZA 3A4PA 4A4OA 2FA2A 3MWUA 3JY0A 3QKMA 2FSLX 2GTMA 3O17A 4L6QA 4Y85A 5CWZA 4BVUA 4IANA 3EQBA 1KUTA 5HO7A 2I0YA 1ZYJA 4L43A 5DE2A 2ETKA 4ERWA 3QU0A 4DH3A 4DCEA 4FTOA 4YJTA 1Q8ZA 5E92A 3HECA 4F1OA 2HIWA 2QVSE 4NKSA 3Q9YA 4RQKA 4JMQA 4IXPA 2B55A 2V5QA 4IX3A 2BAKA 3EKNA 4ZSAA 3A61A 5B2LA 4H58A 4CFWA 3IO7A 4JI9A 4QMTA 1E1VA 5A4CA 2FO0A 2WU6A 2VU3A 3PJ8A 4APCA 4O7WA 4HOKA 1H0WA 2HCKA 3W10A 4CZYB 4EJ7A 5DEWA 3EQDA 3FLQA 3C7QA 4YHJA 3Q3BA 2XS0A 4O0UA 3FEGA 4WNKA 3D5VA 5I9VA 1ZLTA 2OSCA 5ACKA 3T9TA 4AZTA 2HXQA 3GCUA 3UNJA 2Z2WA 4OBOA 3W0MA 3DJ7A 3HUCA 4XLIA 5DRBA 3VUIA 3HV3A 4PV0A 3Q9WA 4AZSA 3ZSHA 3V04A 3OWLA 3QX2A 3GU6A 4V04A 3ZOSA 4F1TA 1PXPA 2WELA 4QTDA 4R5YA 2XNEA 3RAKA 1J91A 3HMIA 3ZCLA 4ZY6A 2CDZA 4GT3A 3EYGA 2OK1A 3QCSA 3ORTA 1MQBA 2X4FA 2ITQA 4CSVA 4DFLA 3OT8A 4BDFA 2G2FA 4ZTSA 4FTUA 5TF9A 3ZO2A 4BKYA 4F09A 3GOPA 5DYJA 4J98A 1J7LA 4XG4A 1AQ1A 3W16A 1WBNA 2JDTA 1GY3A 3C0HA 5DLSA 4CG9A 2X2MA 2BMCA 4IZ7A 4GYIA 1UKHA 2OH0E 3PVWA 2YM5A 2WEIA 2QG7A 2ACXA 2WMAA 5B0XA 5CEPA 4DH1A 3HUBA 2YN8A 2EXEA 3DU8A 5C26A 4E6QA 3QD4A 4II5A 5EYCA 3QQUA 2YJRA 3CTJA 2Y4IB 2X7FA 2X39A 2YERA 4XV2A 5BQ0A 5L8LA 5IISA 4MWIA 5HNBA 4OT6A 4BIBA 5AP6A 3JVSA 5IQIA 1AD5A 2CKOA 4RJ6A 5CQUA 2R3HA 4E3CA 4U41A 1GIHA 2C6LA 3UJGA 4C0TA 5BYLA 2BUJA 4EHGA 2GNIA 3H0ZA 4Q9SA 1GZNA 5CSWA 5HG5A 1JKKA 3ZLWA 3HAVA 4O7YA 4PF4A 4NTSA 5BVOA 3DLZA 3BHYA 1XH9A 4NEUA 4AQKA 1M17A 3G6GA 4KBCA 3V8SA 1PHKA 3PJCA 4IMYA 4G2FA 4IZYA 3TCPA 1OKYA 3QQGA 4IDTA 4EYMA 5A54A 1Q5KA 5IDNA 1XH4A 5C01A 4AFEA 4CKJA 4FSQA 2CCHA 2XUUA 1WAKA 2PZIA 3NS9A 4MH7A 3TJDA 3D15A 3KKVA 2UZBA 3O71A 4DDIA 5CSHA 5LMBA 3MYGA 2VD5A 5IUHA 5AFVA 2GNFA 1G8SA 2IVVA 3DK7A 3K5UA 3PSDA 3TZ7A 2YWVA 4R7BA 5GJDA 1R0EA 4BCMA 2R0UA 1NVRA 4DH7A 4DEIA 4KIOA 2YM6A 4S34A 3PVBA 2HXLA 4B9DA 4LGDA 4R7IA 4O0WA 4NJDA 1YDRE 2WTWA 2PZPA 3FXXA 2YZAA 3RTPA 1MQ4A 2XAMA 1YW2A 2R4BA 4DAWA 4YSJA 2J9MA 5IA5A 3UQGA 3P7AA 3HMMA 4OW8A 3UIUA 3QCQA 3OOMA 2JFLA 1YXUA 3AC5A 4PTCA 1IASA 3SV0A 3CQEA 4YTIA 3ZO1A 3PPZA 4EYJA 3Q4CA 4FKPA 5KBRA 2R3LA 5IQHA 5A3XA 1WVYA 4AZEA 3C5UA 3F82A 2PTKA 2YM7A 5HIDA 5L2QA 3UP2A 2VTNA 4YC3A 4L3PA 2VWWA 2RG6A 2B9FA 3BYOA 3BYSA 2OJ9A 1XBBA 3QGYA 4GIHA 4GJ3A 5IH5A 5LWMA 4GT4A 1AGWA 5DT0A 2XBAA 4TYIA 5FD2A 2XJ1A 5AP4A 4RJ5A 2C1BA 4EOKA 4ZJVA 2VNYA 1OIUA 1REKA 2XMYA 3P23A 4EZ5A 2Q83A 4QTAA 3UYTA 1OPJA 4FMQA 4WNMA 2C30A 3HDNA 4P5ZA 3ZH8A 4BTFA 4D28A 3BEAA 4O4EA 4Y83A 1H25A 1IRKA 3AQVA 4FICA 4IB3A 4NM0A 2UW0A 3VAPA 4AT4A 4BWKA 2FSMX 4XV9A 1JPAA 5E90A 3WYXA 4YJQA 2PY3A 2HAKA 5IEXA 2BIKB 3QFVA 1OECA 3H0YA 4HGEA 5E9EA 3C4EA 3FDNA 4RBLA 4LOOA 4I6BA 3CJGA 4DEGA 1PMNA 1ZRZA 4PMTA 2W1ZA 1Y6AA 4QPSA 1VZOA 1H01A 2VO0A 3QLFA 5CU4A 3T8OA 1OITA 4PNKA 4G17A 4XV3A 3AKJA 3PTGA 2ITPA 4JDHA 4RLKA 4X2FA 4XBRA 4FYOA 1ZAOA 5JSMA 4FTTA 2B4SB 3PXRA 5DT4A 3OUNB 3D4QA 4GU6A 4TN6A 4NK9A 4H39A 1NVQA 2HZNA 1E9HA 2HW6A 4C7TA 5GZ8A 4EL9A 3K2LA 5M4CA 2HW7A 3G33A 3UNZA 4DT9A 1OUKA 4G3FA 4HGSA 2PE1A 3O8UA 3QKLA 2PPQA 3TMOA 5H3QA 4LRKA 4FI1A 5J95A 3PXZA 4NM7A 4LV7A 2WTDA 4HYUA 5K5XA 4QYHA 4BHNA 3N9XA 4I5HA 1UKIA 5H9BA 3R1SA 4AZFA 4FEWA 2WMQA 2W05A 3PSBA 3VUMA 2ESMA 2VTAA 3D94A 3KXNA 3MY0A 4I0TA 5AADA 4IB5A 3PJ2A 3R7IA 1IAJA 3C50A 3JYAA 4TWOA 3KF4A 2YM8A 2F2UA 3C51A 3RCJA 3MIYA 3PJ1A 4FIFA 2O64A 4O82A 2QR7A 2QNJA 2WOTA 3R00A 3VBTA 4BCFA 3W0PA 4FV5A 3LFEA 2FVDA 3P7BA 4KRDA 3BELA 4K18A 4DT8A 3PXKA 4TPTA 5LVMA 2OLCA 3OD6X 3JY9A 4KSQA 2W7XA 3PPJA 2VTSA 4FV8A 3WZDA 3CD8A 1G8JA 3KXXA 2YCQA 3NRMA 4FKTA 3A8XA 2UZVA 1QPJA 4YC8A 4LGGA 4ZEGA 5LVLA 3TNHA 4TWNA 1PKGA 3BBWA 3IQ7A 2FH9A 4BDAA 3F5UA 3GU4A 3LQ8A 2OZAB 2OBJA 3O51A 4WG3A 1GAGA 3OROA 3OT3A 5IQCA 3DY7A 4AT5A 3ANQA 3AGMA 4U79A 3HP5A 4BTMA 4LRJA 1HOWA 3ZRMA 1URCA 1ZMWA 3LKMA 3VS3A 4BY9E 3TIYA 2B1PA 3EQFA 4WKQA 2E9NA 4GW8A 3ENHA 5HG7A 4ZY4A 2YCSA 2OXYA 2OWBA 3F2NA 3FQSA 3VULA 3S0OA 3VRYA 5CI6A 1P2AA 4XG8A 3COMA 4ARKA 4GCJA 4EOSA 5GIPE 2BDJA 4PDOA 2VAGA 3AOXA 2CPKE 3PY1A 4C02A 4L3JA 5ANIA 4CXAA 4ZLZA 1J3HA 4YLKA 3KF7A 3GCVA 3IONA 4GMYA 5FM3A 2ONLC 5G1XA 5JFXA 2ITVA 5CZHA 4E20A 4AN3A 4WA9A 2VRXA 2CNQA 2W99B 4H3QA 3L9LA 4QYYA 2VTPA 4E4MA 4OR5A 3FV8A 4YNEA 3R1NA 3NPCA 4AXCA 4RIWA 5FTOA 3COIA 2UV2A 5AUZA 5CSXA 3SRVA 2JFMA 3RAWA 5KUPA 1FQ1B 1MRUA 2JIIA 2VX0A 3C4CA 3OCGA 4NM3A 3WIKA 2RFSA 1CKPA 3CTQA 2Z7QA 3MY1A 4ZJJA 4AP7A 5CTPA 3TG1A 2CMWA 1O6YA 4OTDA 3SQQA 4EK6A 5A4LA 4FTIA 3SHEA 3W2RA 5ETIA 3RGFA 3TKUA 4YSMA 4FYNA 3NNVA 4IWQA 4GIIA 3ZZEA 4IEBA 1NVSA 2GNHA 1WFCA 2OXXA 3G2FA 2W17A 4DG0E 1QMZA 1BUHA 3RZBA 2VTHA 3PY3A 3QRIA 3MA3A 3F3TA 4MTAA 3KREA 2OF2A 4E8AA 2WXVA 4MNFA 3HL7A 4EH7A 2I6LA 3UZRA 2C0OA 3WARA 3RPOA 3BWJA 2YIXA 1H28A 2QU6A 3LXNA 4O0VA 4ZSLA 1UWJA 4IAKA 3W2PA 4D5HA 1PXLA 3CE3A 1Q8UA 3O7LD 5D10A 4AOIA 5DFPA 2ZV2A 2AYPA 1P5EA 2IZUA 2WTKB 3HMOA 4YZNA 5EM6A 3K54A 3SD0A 4DLIA 4F9AA 2ZDTA 4EZ7A 2BRHA 3BE9A 2RL5A 3VO3A 4RC3A 3LMHA 4U45A 5HE0A 3CQUA 3E5AA 4BTKA 3VJOA 5EYMA 4C4EA 3FY2A 3Q96A 4CFUA 2OJIA 4KINA 4TYGA 2OH4A 3CIKA 3H3CA 4AS0A 4CKRA 5H8BA 2ZOQA 4XP3A 4E7WA 1JQHA 3QQLA 2BZJA 2I1MA 3B8RA 5IA4A 4TZRA 1Q24A 4KAOA 4MXOA 4KKHA 2C6TA 3ACJA 3LFSA 5BYYA 1H1QA 1PYXA 3HEGA 4Z3VA 5M44A 4JRNA 2FGIA 3IPHA 1XH5A 5AP7A 2NRUA 3W0NA 4QMOA 1FVRA 1PW2A 3P79A 3D5UA 1ZY4A 2VTTA 4R1VA 3I81A 3UC4A 1WBVA 4QDEA 4I23A 1PXNA 3ZFXA 1UVRA 5KCVA 3U9NA 3QTRA 4FIEA 2J2IB 3QQFA 5DEYA 4CYJA 4Z55A 4WUAA 5AUWA 5IKWA 1DI9A 4X6RA 3A7GA 3NZ0A 1U5QA 5DWRA 5E8ZA 3EN5A 1L8TA 3W0QA 4UWYA 2EB3A 3KRRA 3EFLA 4UB7A 5AP5A 5CF8A 4CG8A 1L3RE 3OS3A 4NJ3A 4CRSA 4DEDA 1STCE 4FTCA 4UMPA 2VN9A 3FAAA 3AT4A 3TDWA 5K0KA 4E5AX 3F7ZA 4FNYA 3VUKA 1IA8A 2B9IA 2BR1A 1KSWA 2XIZA 3ELJA 3ORLA 2KTYA 1H1PA 2PVLA 1S9IA 3FPMA 4O4FA 2X8DA 5HO6A 3DKOA 4MHAA 2C5XA 3QD2B 2SRCA 4L46A 3R7OA 3UIXA 4FBXA 5CF5A 3NMUF 1Q62A 2H9VA 3OFMA 5AX3A 2QONA 2CCIA 4P90A 2XNPA 3KRWA 1ZXEA 5G6VA 4BCHA 1YHWA 2E9PA 3C1XA 3L8VA 3K3IA 4QDVA 3U6JA 2WU7A 1FMKA 2QR8A 3DNDA 3ORIA 1GOLA 2J0KA 2VO6A 4BB4A 4CQEA 4EOQA 4DEBA 4AXEA 3TUCA 4FL2A 4RPVA 3NFFB 2QLUA 4P2KA 5BX0A 5IQAA 5E8XA 1YI4A 4KKEA 2W1EA 1Q61A 2BFXA 3H30A 4YJSA 5EOLA 4BGGA 2YCRA 1VLRA 1UU9A 2GMXA 3Q4ZA 3NCGA 4FK3A 4LOQA 4EHVA 4EOLA 4M14A 1R78A 3CBLA 4L8MA 5F1ZA 2X8EA 4BN1A 4O83A 1ZZ2A 4DHZA 3OXIA 5ACBC 3VBXA 2C6IA 3G51A 4KBKA 5LARA 4D1XA 2XJ0A 4HGTA 2YABA 3BV3A 1LR4A 1JVPP 1YHSA 3IGGA 1H1WA 3CY2A 3LFCA 4RZVA 4IC7A 5I3RA 4GKHA 5L8JA 4L3LA 5KZ0A 1XKKA 5J8IA 4MBLA 4C8BA 2WMSA 2UUEA 3PP1A 3VBYA 5L8KA 3NVMB 4AAYA 4FV7A 3OBGA 1H26A 3OXTA 3QTIA 4L9IA 5KNJA 2P3GX 4ZY5A 2PE0A 2X6EA 3PZEA 5AJQA 4LL5A 4BI2A 4M68A 4EC9A 3ZM9A 1M2QA 4F65A 2VUWA 3B2TA 4I20A 5M57A 3QHWA 4I94A 3ZM4A 4XJ0A 4C37A 4BR3A 3BHTA 4FG7A 2WQNA 5JRSA 3UMWA 4MEDA 5L3AA 3D7TB 4QP6A 2WFYA 2JDRA 2JAMA 2PSQA 2UZTA 5CT7A 1CM8A 3A7FA 2DQ7X 2NPQA 2PZ5A 1EH4A 4I5MA 2CLXA 3AT2A 4G6NA 5CVFA 1DAWA 1R3CA 3Q4TA 4OTPA 3R8MA 4D4SA 5CEOA 2ETRA 2ZV7A 4RIXA 1FGKA 3UDSA 2BROA 4YP8A 4I4FA 2PUUA 2R3NA 3OG7A 4FV9A 1XMMA 2CLQA 1Z9XA 4QNYA 4IX6A 4NT4A 3TL8A 2ZMDA 4ZZMA 5JGDA 5F20A 1Q3WA 2B9JA 2XBJA 3NR9A 3FQEA 5E4HA 3DGKA 3R8VA 3V5TA 4L45A 4AACA 2YWPA 4FGBA 4BZOA 2VTJA 2VV9A 3B8QA 3P1AA 3U55A 4QOXA 4EK3A 4HCTA 3SXFA 4W8EA 3FYJX 4FVPA 4MXXA 4Y72A 3RPRA 5E8VA 4X2JA 4XG3A 4EOOA 4RGJA 4BDBA 4C62A 4UALA 3UDBA 5HBEA 4DHFA 4J71A 4YC6A 1TQIA 2P2HA 3OZ6A 3R9NA 1F5QA 3FI4A 2VWVA 2W5AA 2YM4A 4ACGA 4I5CA 4NCTC 5AIKA 4BZDA 4CNHA 5LJJA 2W1GA 4ZOGA 1UU3A 4LOPA 3QTQA 3CGOA 5AV0A 3PDTA 2ITTA 2IWIA 3QA0A 4EH4A 4O2PA 3ODYX 4A4LA 3MVLA 4ZAUA 3QTXA 3W18A 4C61A 3EN6A 4WRSA 3U54A 2YDIA 2JEDA 3PFQA 4JG6A 3ANRA 4RWKA 4X2NA 4BBFA 4BJJA 3HGKA 4IJ9A 3BYMA 1TQPA 4AW1A 1PF8A 5I9XA 1PXJA 2BZKB 3G6HA 4NFNA 4GK4A 4BCNA 4U43A 3WF6A 3W33A 5IEYA 1GNGA 1ZMVA 4RRVA 5FGKA 3FPQA 4N6ZA 4EBVA 4IW0A 3N4VA 4RX9A 5H2UA 2OJFE 4YPDA 5HG8A 2XB7A 3ZEWA 4QMUA 4M3QA 4PY1A 5HD4A 3GQIA 3FI8A 1FVVA 3DK3A 3ZDUA 3C5IA 1A06A 4YBKA 1SM2A 3EZVA 4YZDA 4BYJA 3DKCA 4YJNA 4EQMA 4C2VA 4L53A 4G1WA 2XRWA 3P9JA 4BJJB 3HKOA 3TNPC 1XH8A 3D2IA 3PP0A 2KULA 2BTRA 3R02A 4WHZA 3VUDA 4BYIA 2R64A 5AUYA 2FB8A 3KN5A 4MNEA 4JX3A 4F7NA 4M67A 3SKCA 4GFOA 2R3RA 2BHHA 2XH5A 2QD9A 3G5DA 3RP9A 4MWHA 4PDYA 5AV1A 4FEXA 2OXDA 4UXLA 2R3OA 3BHVA 3UGCA 4ZZOA 2UW9A 2C6MA 2GQSA 1NY3A 4AA0A 4FTLA 4NTTA 3BKBA 3NUNA 3REPA 5E8UA 3ZC6A 4APPA 5C8KA 2YIRA 3BGQA 4D4YA 2IVSA 2QG5A 4MCVA 2R3FA 5FTQA 2QOHA 3IDCA 5FM2A 3KRLA 4BWXA 2JDSA 3BPRA 3EL7A 3KL8A 4H3PA 4K33A 4E6DA 4TYHA 3P5KA 3W55A 4WUNA 5M06A 3GU5A 3V6SA 4BKJA 3IECA 4FTNA 1I09A 1IG1A 5AWMA 3CLYA 1U59A 3KVXA 5J1WA 3QXPA 2GNLA 2VZ6A 3UE4A 4L67A 1ZYDA 4XG7A 5AA8A 3D5XA 1V1KA 3VN9A 4EOJA 2XP2A 2Y9QA 4I24A 2P55A 2HK5A 1SVHA 5CSPA 2PMNX 3E87A 5HCZA 4DF3A 3LM0A 4FKLA 3MI9A 2HOGA 4NCTA 2WAJA 2F57A 2A1AB 1PRYA 4LI5A 2QKRA 4FT9A 4D0XA 3V8WA 4EK8A 5KBQA 4G6OA 4CD0A 2REIA 4MQ2A 5HESA 5CLPA 4ALVA 1YI6A 4RX7A 1GJOA 1H1RA 4BKZA 4YMJA 3F88A 2PVKA 3ETAA 4J96A 4C3PA 5IQFA 3GVUA 4GSBA 1WVXA 2F7XE 3COHA 3DZOA 3VUGA 3RM6A 3W8QA 3DKFA 4DE4A 4FEQA 3LOKA 4XRLA 3DBEA 1W84A 3PFYA 3FL5A 5B2KA 4C38A 3OP5A 4QMXA 2V7OA 4IFGA 3PXQA 2IJMA 4DH8A 3KQ7A 5HLWA 3PA3A 4M69A 2WGJA 4TKSA 4E1ZA 5FDPA 1WBWA 4M69B 3P7CA 4QTBA 5I9ZA 5KX8A 4XG6A 4YTCA 4AW0A 4KSPA 3F5XA 4O2ZA 3ZSIA 5GZ9A 4IX5A 1BKXA 5D41A 5JGBA 3BL9A 4YBJA 5F9EA 5JKGA 4DLJA 4QT1A 3D83A 5M08A 3LCSA 4JL9A 4RX8A 5FEEA 3RKBA 2WMTA 1T45A 3CTHA 2F2CB 4EONA 4JBPA 4DITA 4XHKB 3FI3A 4HCUA 3VBVA 4AQCA 2PVRA 3E8DA 4EH6A 2Y6OA 4QD6A 5A6NA 5TR6A 2FUMA 4ASEA 4ZSEA 4XOYA 3UVRA 3ERKA 4J53A 4DYMA 4DA5A 2UZOA 5EM7A 5E8WA 2VX1A 4J8MA 4FUYA 1PMUA 4B4LA 1R1WA 4MF0A 4F08A 2UVXA 3LCOA 1V0OA 3QXOA 4NZWB 4U0IA 5ITAA 2YHVA 3V5WA 3W0SA 5EQPA 4L52A 2OFVA 3HP2A 4IAIA 3RK7A 3OHTA 4BCKA 1KV1A 4LMUA 2BRGA 2JIVA 4NFMA 5EDRA 1JOWB 4U9AA 4NW5A 2ZAZA 3PSCA 3FMJA 2JBPA 3DAEA 1OM1A 3QTUA 4C59A 4MXAA 1Z5MA 3E63A 3KGAA 5CU2A 5DRDA 3GB2A 4O1OA 3EB0A 2I7QA 2X6DA 4K9YA 3BCEA 1J1CA 1OL2A 3L1SA 2IEWA 4FSWA 3EQIA 4M8TA 2PVFA 3E62A 4HVGA 5J9LA 4FKVA 4G9CA 3V51A 5M09A 4WRGA 2NP8A 4F9YA 1WCCA 3O23A 3MBLA 3TKIA 3UZPA 5FUTA 3ZO4A 4AW2A 3BLRA 1UA2A 3TZ9A 4PQNA 4QP9A 4U7ZA 5C8NA 4J7BA 3D2KA 3MB6A 4FG8A 4YLLA 3ZLXA 3VUHA 4EH9A 2XK7A 4XP2A 2DS1A 2UZDA 2IN6A 3EQPA 4Y8DA 5A14A 5KHWA 2WMRA 2X2KA 4I4EA 4ITIA 5EK7A 1YXVA 3PIYA 4RVMA 3F3UA 1KOAA 3QWJA 3PG1A 4PTGA 5HICA 5L6PA 3W8LA 5KKRC 4G6LA 5HO8A 2WMXA 2HZIA 3VS7A 2CGUA 3KMUA 4IWOA 5CEIA 4QMYA 3L9MA 3KRJA 2GPHA 4HYIA 4BI0A 3LIJA 3LJ0A 1YRPA 3PXYA 5CNOA 3V01A 3F5PA 3TN8A 3OVVA 2ZVAA 2BRNA 2PVNA 3IDPA 2B0QA 3Q6WA 2WQEA 3PG3A 5CSVA 4O7VA 3GC8A 3BBTB 2C3KA 3NYXA 3LCKA 3W32A 1UNHA 2YA9A 4JBVA 3M11A 5D9HA 3P4KA 3Q53A 2XNGA 4FUXA 3D7ZA 3DAJA 4K11A 2CHLA 2UW4A 4WOVA 2I0EA 3BGZA 2JAVA 3RJCA 4FIIA 3NUSA 4BL1A 4JQ7A 5E91A 1OBDA 3KEXA 4DFUA 1SNUA 1H27A 5HU3A 3OTVA 4B8MA 5LWNA 3GQLA 5GHVA 1SNXA 2CSNA 1JKTA 4FKJA 2Z7SA 4UBAA 1ZYLA 4FF8A 5CU0A 5EH0A 2E9VA 5LMKC 2ZDUA 1JWHA 4FOCA 5IA1A 2ZYBA 4R3CA 1JSUA 4OBQA 3VWAA 3SXRA 3PLAE 5DG5A 5HVYA 3GCPA 3UG2A 2BVAA 4PDPA 1O9UA 3NUXA 3LMIA 4MYGA 3W2CA 3DTWA 3ORMA 4GH2A 3DFCB 3EKKA 4WNPA 1Y8GA 3HV4A 2VGPA 3MH3A 3ZMMA 4QTEA 2ZV8A 3ZHPC 4AA4A 3JXWA 4L42A 4AOJA 4NYEA 5C1QB 2HELA 5A46A 5B7VA 3SGCA 3QC4A 1KWPA 2X9FA 3CS9A 3PUPA 3QC9A 2P0CA 4IZAA 4C4IA 4DG2E 4QMNA 2V0DA 3V6RA 2F4JA 4USDA 5BUEA 2I0VA 4F0IA 4PL5A 2YJSA 3OWKA 3W2QA 3JVRA 3QCYA 4BWPA 4D4VA 3HMNA 1DM2A 2CNUA 3ZSGA 4I5PA 2G15A 4ZSGA 4AW5A 2H34A 2XEYA 4PPBA 3BX5A 4L7SA 2QOFA 3MIAA 3WZUA 5A6OA 3EFKA 3FMHA 4F99A 3LXLA 4D2WA 2C1AA 2R7IA 4AGUA 4O4CA 4RVKA 2VTQA 4AGDA 5DVRA 4DGOA 3CEKA 2XCHA 3QTZA 1APME 1VEBA 5AUTA 3LAUA 4IDVA 4GUBA 2C0IA 4K8AA 2PK9A 3FZPA 2WTJA 3ORNA 4IM2A 2OGVA 5EM5A 3ZRKA 4PPAA 4IAZA 4EWQA 3F2RA 4RFZA 3GFEA 3SC1A 4DC2A 2BALA 4IAYA 4EORA 4UV0A 3ORZA 5EDPA 3R9DA 2PWLA 4CT2A 4D1ZA 4BDHA 4A06A 2G9XA 5ANGA 4BFMA 2PVHA 5J7BA 4O0SA 4AF3A 4FOBA 3TI1A 3WIGA 4IB0A 2J0IA 4DGMA 4AOTA 2UZEA 4IAAA 4DFZE 1P14A 2C68A 3TUDA 4EOMA 5IUGA 4EWHA 3QZFA 5KE0A 4K1BA 1OKVA 4JOAA 3ZLYA 3FLWA 5KMNA 4GKIA 1GIJA 5K5NA 5DI1A 4XMOA 5BYZA 2C6KA 3WZKA 4Z7HA 5KMKA 4F9BA 5IMEA 4FSRA 4OTFA 4R7HA 5LMKA 2DWBA 3TKHA 1VYWA 2WMUA 4LDTA 3KXMA 3P78A 5AP3A 4JX7A 4QQTA 1B6CB 2PULA 2W9FB 2P4IA 3NAXA 2J4ZA 1U54A 2X0PA 4AU8A 3BWFA 1U54B 2H8HA 1E1XA 4S31A 4XG9A 4HNFA 3QF9A 5C8MA 4GFMA 3R7EA 1WBTA 4U8ZA 4LGHA 2VTLA 4Y95A 3LFDA 4IBMA 4JS8A 5AAGA 3FKLA 1URWA 4FJVA 3VVHA 5CEMA 3AC2A 2YIQA 4FC0A 4PUZA 5C4LA 3HMPA 3FI2A 2QOKA 5HE1A 3CXWA 1TVOA 3WZJA 2WIHA 4E6AA 3DK6A 5HVKA 3BU3A 3DPKA 3TEIA 3OWPA 4A9TA 3HDMA 3WI6A 5IQEA 4FL3A 4HGLA 3SG9A 2CKQA 3OXZA 1RW8A 2Z60A 3DJ5A 5J5TA 4Z9LA 4HW7A 5AUXA 2UVZA 1MRVA 2YISA 3Q4UA 3E3BX 2H6DA 2OW3A 3EN4A 2B7AA 1M7QA 2WTKC 5AIRA 3LQ5A 4EHZA 3O7LB 2WQBA 3I60A 3GBZA 4QQ5A 4E93A 1QL6A 2EVAA 2YDKA 3MJ2A 3MY5A 5HBHA 5HLNA 5CF4A 1OL6A 4Z16A 2X7GA 3OCBA 3Q52A 3GU7A 3R7YA 3HRCA 2ITYA 2AUHA 3KB7A 3FZTA 3BLAA 4C3RA 5CASA 5JRQA 1P4OA 1UNLA 4CFXA 5HORA 4JQ8A 4YLJA 2CGXA 4YR8A 4O96A 4RFYA 2EUFB 3UP7A 3GP0A 4RIWB 3SRVB 5BUIA 4WNOA 1OIYA 4B0GA 5KMMA 2RFEA 5AV4A 4BDGA 4ZP5A 3FSKA 2QC6A 4RJ8A 2ITNA 4ZLOA 4AZVA 3U87A 4YJVA 4G3EA 4JAIA 5FXRA 4GT5A 5BUJA 4DEAA 4J97A 2HY0A 3QLGA 2HWPA 4MBJA 2R3IA 3BGPA 3LFFA 4G16A 1F3MC 5LVPA 3ZFMA 3TNIA 1BLXA 2VO3A 4QP2A 3RBWA 3QHRA 3UO4A 3D5WA 4JT3A 4Z7GA 1ZOHA 3POOA 2PU8A 1PXMA 1WMKA 3K5VA