4QMOA

Mst3 in complex with imidazolo-oxindole pkr inhibitor c16
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
289
structure length
288
Chain Sequence
GLPGMQNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREILKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKFILRNAKKTSYLTELIDRYKRWKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase 24
publication title Discovery of Diverse Small-Molecule Inhibitors of Mammalian Sterile20-like Kinase 3 (MST3).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 92
structure length 288
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4qmoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4qmoA01
1Q3DA 3IDPA 2JFMA 3EKNA 1QPCA 4M97A 4QPMA 4R78A 3RM6A 4C4JA 4ALWA 3UIBA 4L6QA 5AR5A 4H36A 4C3PA 2OIQA 5M51A 1PMUA 2W06A 4GK4A 5ANIA 3UO6A 4FSUA 3UVPA 4P5ZA 3NW6A 1NT2A 1Y57A 3FZRA 3B8RA 3GC8A 5G1XA 3CQUA 1B38A 3EFKA 2JGZA 4YBJA 2C68A 4JDJA 4J71A 4L01A 3TIZA 3NNVA 4JIKA 4O0YA 3HMMA 3RNIA 4F4PA 5JRQA 3NNWA 4X2NA 2ESMA 3FLZA 5EI8A 1SMHA 5AR4A 4J7BA 4U43A 3M2WA 3BWJA 4WT6A 2OJFE 2ZAZA 3MSSA 5L6OA 2I0VA 4FL1A 2VTTA 4UBAA 1OPKA 2HOGA 3QF9A 2OZAA 3OOMA 5BVWA 4TTHB 4F9WA 5H3QA 4CFVA 3BE9A 2UZWE 3SG9A 3UG1A 1GZOA 1TQIA 4U41A 4ZS0A 5HBHA 3ZM4A 5DT3A 4BDEA 1E1VA 4TYEA 2Y4PA 3TNIA 4H1MA 3RAKA 3EIDA 2V62A 4RFZA 2VWIA 3FSKA 1SVEA 1QL6A 3KU2A 2C6TA 1H28A 3FHRA 1QMZA 2QC6A 1ZYDA 4TL0A 4MVFA 3VBXA 3R7GA 4XG9A 3ZC5A 2UZTA 3D9VA 4BDBA 4UMTA 3ZHPC 3K3JA 2FSMX 3LMHA 5JFVA 2GFSA 3VS4A 1DI8A 2EUFB 2H96A 3VUMA 4NWMA 4F7JA 3R8PA 2PMLX 3DAKA 2OI4X 3G15A 2YZAA 1XH5A 2QNJA 4DA5A 5CU3A 3B8QA 3CE3A 4Y5QA 2GNJA 1L3RE 2R0IA 4ZP5A 4O7TA 4JR7A 2O65A 3TL8A 3FKLA 4GG5A 4ACHA 1BL7A 5HCZA 3L8SA 1OL7A 4XV3A 4ACDA 1GOLA 2YA9A 2R5TA 3MA3A 5D9HA 3QFVA 1OKYA 3V01A 2XCHA 3SQQA 2W1ZA 2WMTA 3H9FA 4JDKA 2VRXA 5AUVA 3LKMA 1UVRA 3HVCA 1BX6A 3TTJA 2HY81 2Q0BA 3TIYA 3EQRA 4YO4A 4JAIA 4EH3A 5J9YA 4C59A 3HL7A 4EL9A 4RC3A 4GL9A 5K4JA 1YXVA 2E9PA 4AWIA 3QZIA 4ANNA 5BYLA 4OW8A 2NNWB 5HIBA 4N0SA 1JKKA 3K3IA 4R3RA 1ZOGA 4EZ5A 3HDMA 4AA0A 1GIHA 2CGUA 4U5JA 2RFEA 3CTHA 3I7BA 4U44A 5EI6A 3LQ5A 4AX8A 4FIHA 4IX4A 3TN8A 2P4IA 4E5AX 4J95A 1FVTA 1MQBA 5IMXA 5EHLA 3RWQA 2HW6A 3VF9A 3LJ1A 3JY9A 1GZKA 3F6XA 4FV7A 2BDFA 5CENA 5C26A 2VTJA 4CD0A 2CGXA 2W0JA 3NX8A 3PY3A 3TACA 2R9SA 3LXPA 4FV6A 1VYZA 3EN5A 5CLPA 5CT7A 5ANEA 3Q3BA 5DVRA 4YP8A 3ZU7A 3U6HA 4ITJA 4XOZA 3GU7A 1OECA 3LXNA 5E8WA 4L00A 3KRRA 1RDQE 3IKAA 3W2RA 1M2PA 1G3NA 2YIXA 3FMEA 1H1WA 5CEOA 2VO6A 4XHKB 4NT4A 5HCYA 3F82A 4BCPA 3LCOA 3BYUA 1LP4A 3VUTA 3IDCA 2B4SB 3EHAA 4YNOA 1Q4LA 3UGCA 5IA0A 4I3ZA 4K1BA 3ZO1A 4KKHA 2PMNX 1NW1A 2OJJA 2PK9A 3QHRA 2B9JA 4E6QA 2GNGA 3D7TA 3IDBA 5DRDA 4EHVA 3TZ7A 5AM6A 2ITYA 4XV1A 5TF9A 3PRIA 3FLSA 3WF9A 4M0YA 2X39A 3BPRA 3H30A 2CGVA 4U81A 3ETAA 3NMUF 2C1AA 3I81A 4NCTC 4DH1A 5C9CA 3V6RA 4D4RA 5DT0A 5HLNA 3KXXA 1Q61A 4Y85A 3REPA 5JQ8A 4FGBA 4B8LA 3NUXA 5A54A 2WEIA 3MIYA 4OTRA 3ZH8A 5IQAA 5HNIX 2QOIA 2PZIA 2W5HA 2XNMA 3FZOA 2IZTA 3GU6A 3LPBA 3BLHA 4FSZA 5C8NA 3UZRA 1Q41A 4I22A 4R5SA 3TV4A 3VBYA 3H9RA 4ZTMA 2V55A 5CASA 2XIYA 4M13A 3R22A 4HYSA 4AP7A 4UWYA 4CG9A 3HUBA 4BCKA 5L8JA 4BIEA 1UWJA 4KRDA 1JSUA 5EK7A 3O7LB 4NUSA 4EK5A 4BWPA 2EXEA 5A4LA 3AT3A 4WG5A 4RJ8A 1Q8WA 4BCFA 1Q8YA 3S1HA 3CS9A 3C4FA 2WMRA 3ATSA 4AZVA 5ANDA 3TG1A 4KIOA 1PMEA 4CEGA 5KMNA 4RWJA 2XNOA 4BB4A 5FP5A 4ITHA 2W1FA 3ODYX 4QMYA 4RJ3A 1OPLA 2J0KA 3FSFA 4AN9A 3VUHA 5IEVA 1WFCA 4Q5EA 3KXHA 3NIZA 4DEIA 4D4YA 3SXFA 3EL7A 2CDZA 3VBQA 3R8UA 3PE2A 4BN1A 5CNNA 2F9GA 2QURA 2QHMA 1KSWA 5GIOE 4ZLYA 3C5UA 3ORNA 4FTAA 1F3MC 3BU3A 3GXLA 4M0ZA 4BGHA 3QL8A 2YM8A 4UWBA 4HNFA 3QD0A 1UV5A 4R3PA 4EH9A 2OZOA 4W8EA 5ACKA 2YM4A 4FSWA 3F5GA 2VTQA 2VD5A 2ZOQA 4LRMA 3G5DA 2V5QA 3PXZA 2XYNA 2ZB0A 4IJ9A 4UMQA 3RBWA 5L8KA 3TUDA 4F64A 4I93A 4OUCA 4Z9LA 4I21A 4BGGA 3DAEA 4N57A 3ZEPA 5IQDA 4DH8A 2X2KA 3U9NA 4HVIA 4YZBA 2NO3A 5AV4A 2PU8A 3KRJA 4UALA 2XVDA 2ZV7A 3QQUA 2X6EA 3OCSA 2J6MA 3DKFA 4RVLA 2A4LA 2VWBA 3U9CA 1IRKA 1VYWA 1T46A 4I24A 1FVRA 4F9AA 4E6AA 3R7YA 3V6SA 2X2LA 4O7WA 3PJ2A 4BDJA 4ZTNA 3EWHA 4D2SA 4DAWA 3D5WA 5C1QB 4RPVA 3QCYA 4GIIA 4E73A 4MQ2A 3COMA 2A27A 1STCE 3RAIA 3RPSA 4DEHA 1E9HA 1WZYA 5F1ZA 2R3OA 4F63A 4CRSA 4OR5A 5E1SA 1K9AA 2YEXA 3RPRA 3ODZX 2XKEA 1DAWA 2WD1A 3IS5A 4GK3A 4PL3A 3DBEA 4WKQA 3Q9YA 3ORZA 3O51A 4O21A 2GNLA 2VGOA 4PP7A 4H3QA 2XA4A 4NL0A 3AQVA 3OXIA 1LEZA 4OBQA 4FV0A 4FEQA 5E8VA 4FTQA 3BQRA 5HTIA 3PG3A 4QP8A 2J51A 4OTHA 1ERKA 2CKOA 4DBNA 3CY3A 4WRSA 2IVVA 2J50A 2VWUA 2YIYA 4FKWA 4P4CA 1OITA 3VULA 5HO8A 3SGCA 3QKMA 2OWBA 2C5NA 5E9EA 4YTFA 2P55A 4KRCA 4C33A 2HZ0A 1OIYA 1H0WA 3QUEA 4X3FC 5EQYA 4H39A 3FLWA 3FLYA 1R0EA 3OY3A 3E7VA 3A7IA 4FTLA 4P90A 4V01A 5A4TA 5I9XA 2YWVA 3RALA 4RIXA 1H26A 2G2HA 2W1EA 2W17A 5GZAA 2WMXA 3F66A 2ZV9A 1OL2A 4PTCA 1XHAA 1IEPA 4J1RA 5J1WA 3KULA 3OEFX 3V5JA 5AA8A 3EN9A 3IK3A 4FMQA 4MQ1A 3ZFYA 5DE2A 5HX6A 2VWZA 4EJ7A 4G3DA 3TEIA 1DM2A 3L9PA 3GU5A 3QRKA 3QRTA 4NM7A 5E7RA 3EQBA 3OT3A 3R8LA 5DIAA 1V0OA 5HIDA 4RX9A 4AGWA 3COIA 1P14A 3Q32A 1DI9A 4F1TA 5FG8A 3QX2A 4G2FA 5LARA 5GINE 4IAFA 1YDSE 2YIQA 1P2AA 5JMSA 3BQCA 2QKWB 2PPQA 4ZLOA 5EQEA 1OL1A 2QU6A 5M08A 3OHTA 4I20A 5CTPA 2XF0A 3FYJX 3LFEA 3LLTA 2G2FA 1YOLA 3ZRMA 4IVAA 3ACKA 4DLIA 2ITOA 4I0TA 4G6NA 4OTIA 4ZY5A 4C36A 4TXCA 4CFWA 3RINA 3AMAA 3G0FA 3MB6A 4AUAA 4MWIA 2Y6MA 4I5PA 2GCDA 2PVMA 4M7IA 2R7BA 3QBNA 2PUUA 1PKGA 4BYJA 3BBWA 5AIKA 2VTRA 1JNKA 3ELJA 4RC2A 4C0TA 5HNGA 4HPUE 3QTIA 4YGAA 3V5TA 4NYEA 5BYZA 3EQHA 3JY0A 4ACGA 3D5XA 1GJOA 3WI6A 2BKKA 4D58A 3RAWA 4DCAA 4C34A 3IOPA 5HO6A 3GCUA 2PZRA 3PP1A 5JRSA 4O0SA 4U0IA 4NTSA 2OKRA 3PP0A 3TZMA 1J1BA 5L3AA 4FKUA 4FTCA 3S3IA 4MD9E 4O0VA 5AR7A 3VBVA 2UW0A 2JKMA 2WMQA 4OTDA 4XRLA 3OY1A 4QQ5A 5IQIA 2GFCA 1PXIA 4PDOA 3DOGA 3ITZA 4LQMA 1U54B 4LM5A 3UOLA 3UOJA 3E92A 2W5AA 5B0XA 1LPUA 2C69A 2WOUA 2WU7A 2WMUA 4XG6A 5CEIA 4RJ4A 4X3FB 3U8WA 2BROA 4J8MA 3C51A 4ENYA 2ACXA 4QYFA 4BBMA 3W33A 1U4DA 2OF4A 2A19B 4BDIA 3GC7A 4CZTA 4IX5A 2OLCA 5JGBA 1PMNA 4G34A 3CP9A 3NCZA 3R7VA 4J99A 4BWKA 4RQKA 3PY1A 2FSOX 2JLDA 2QOBA 3I5ZA 3P86A 2C3KA 5TKDA 2BAQA 3FMMA 4QMXA 3R2YA 5IQBA 2GQRA 4FX3A 3E8NA 3W8LA 4WNMA 3ZO3A 3FMHA 4Y83A 2R4BA 2BCJA 2WTKB 4RBLA 1UKHA 4L3LA 4E7WA 3DNDA 3MY0A 4IEBA 3PWDA 4S31A 1FPUA 3GFWA 4WUAA 5ICPA 3FLNC 1DAYA 4FUXA 4XG2A 4BC6A 1H4LA 3KKVA 2REIA 4DLJA 4FZFB 4F1MA 3ULIA 4DHFA 2PVLA 1OVEA 2ITQA 3EKKA 2I6LA 3ORTA 3V5WA 3WF8A 1R39A 1OIRA 3NRMA 5D7VA 4IX6A 4Z16A 2J90A 3BELA 3UOKA 4YLLA 2CNVA 3MN3A 4FTJA 5D11A 2IPXA 5AP7A 4FV1A 4FODA 3QTQA 4LOOA 3QX4A 4EUTA 2ZV8A 3KMMA 1WBNA 4GW8A 4AT3A 3UZTA 4JL9A 2O64A 4S30A 3T3VA 4R7IA 2XK3A 4JOAA 1J7LA 4QQJA 2QVSE 3MH2A 4L45A 3R1SA 2EB3A 4II5A 4XX9A 5EM6A 3D4QA 3MPTA 3D15A 4F7SA 5A14A 5JEBA 1PXKA 4QYEA 4EZ7A 2X2MA 3R02A 4IVCA 2YM5A 3ZLWA 4GKIA 4QMNA 3GB2A 5CANA 4MEDA 1W8CA 5LMKC 1AD5A 2VO7A 4O6EA 2RKUA 4O91A 4HCVA 3RHKA 1XJDA 4DH7A 1ZZLA 2QD9A 3NZ0A 4BIBA 2UUEA 2WZJA 4FG9A 2HK5A 3EQIA 3IG7A 4FUYA 1IA9A 2UV2A 2QO2A 4ZIMA 5KCVA 4DT8A 1ZY5A 1Q24A 4FC0A 1WBSA 2XKFA 3D5VA 2GSFA 5DNRA 5AADA 4ALVA 4LMNA 3DT1A 4FKVA 1U5RA 5JN2A 5TOZA 4DGLC 3ANQA 3AOXA 4FV3A 3K5UA 3Q2JA 4QPSA 4UZDA 2VTMA 4TYJA 4QD6A 4QTEA 3NUAA 4GFGA 4O38A 3F61A 3QHWA 2GMXA 3IW6A 1GNGA 2PUNA 1RW8A 3S2PA 3ZDUA 4D9UA 4EI4A 4QMQA 2WMWA 4Y8DA 3LCKA 4KBCA 3PVGA 4M66A 4O0UA 3UPZA 4I94A 4C61A 5LVLA 4ASXA 4AZWA 2IN6A 3TNPC 4DH5A 3W16A 1IA8A 3TJCA 1YXSA 4Y5HA 3HYHA 3MI9A 4E4NA 3GNIB 4I5CA 3SOCA 4FEXA 3OT8A 2IZSA 5AP5A 5ITAA 1PYEA 5IPJA 3PPJA 3F2NA 1REKA 4N4SA 4CXAA 1V0BA 3A61A 3NAYA 4G5PA 1KUTA 1REJA 4YHTA 5FEQA 4FTKA 3R9HA 3DZQA 4XP3A 4CSVA 4KIKA 4ACCA 2VX1A 2GDOA 3CCNA 3L1SA 3MIAA 2R3HA 2WEVA 5CY3A 3W10A 2BAJA 4LRKA 4F7NA 5BX0A 4P7EA 4IWDA 1B6CB 2B53A 2ITPA 4QMMA 3QD2B 2QOCA 3C50A 4GMYA 4FVQA 1H24A 3P5KA 4LGDA 4RGJA 2Z02A 4FYNA 1XWSA 5AIRA 4C37A 4Z7GA 3PXKA 2HWOA 1YKRA 4C02A 4ZMFA 2X8EA 3GQLA 4EH5A 3ZXZA 4M14A 4QQTA 2ZV2A 4GYIA 4BDAA 5CU2A 2GNIA 3FC2A 3NDMA 3PXYA 1ZMVA 4Y95A 3FBVA 4OT6A 5FM2A 4DITA 2F49A 4L7FA 1W7HA 4L46A 4PWNA 4BI1A 2YDIA 3KXGA 4DFYA 1UNLA 4MTAA 1J3HA 4XS2A 4X7QA 2YJSA 2C47A 3VRYA 5K0KA 2UZDA 5L6WL 4IVBA 4JQEA 4K18A 2JIVA 2O63A 5CSXA 4ZMEA 2HXLA 2IZRA 3VVHA 2VZ6A 1OUKA 2LAVA 4UXLA 4CLJA 4MBJA 4EONA 2YAAA 4ASEA 1JQHA 3PE1A 4YPDA 3NCGA 4U3YA 3R9NA 3R71A 5KMLA 4JI9A 5KZ0A 4G6OA 2B55A 4DN5A 3PYYA 2IVSA 2J7TA 4X6RA 2E9NA 4G9CA 4V04A 5ETAA 3WE4A 4CZUA 4NSTA 3F3UA 4IX3A 2WOTA 4O2ZA 5FRIA 1RQQA 4FNZA 5AAFA 2UZNA 3V3VA 3P7CA 3VQHA 2GQSA 2GHMA 4BDCA 3BGZA 4TZRA 2Y0AA 3PLAE 3QXPA 3P9JA 4RIYA 5J7HA 2HZIA 3CXWA 2R3RA 2YCQA 5DR2A 5EW8A 4NM0A 4NIFA 2C1BA 4BL1A 3NW5A 2ZDUA 3KB7A 2PE2A 2JD5A 4IANA 4KNBA 4HCUA 1XH7A 2RFSA 3DKOA 4CNHA 3OMVA 4YJVA 5JT2A 3NAXA 4YHFA 3BV3A 4ANMA 3HMIA 4IWQA 4QTAA 3WZUA 3GP0A 4YSJA 5E8ZA 2VTIA 4UV0A 1PXPA 2GTNA 2YCFA 3MA6A 3E93A 3O50A 3LQ3A 4BGQA 2JFLA 3PVBA 4IFGA 1JVPP 5I3OA 3JUHA 5LQFA 3DU8A 1XO2B 4M67A 3UQFA 4J8NA 2WTVA 5B2MA 2V0DA 4JX3A 4RX8A 3TCPA 3HX4A 5IZFA 4MNEA 3CKXA 4I6QA 2GNHA 1FVVA 3E8CA 4EK3A 1PF8A 5JH6A 5M4FA 3KRWA 4DF3A 3L9NA 3TZ8A 4CYIA 3LOKA 4OBOA 5IUGA 2ITVA 1PHKA 3PXFA 2WHBA 3PZHA 5DH3A 5HBEA 1AGWA 3VS5A 5J79A 3KL8A 4ZZNA 5K0XA 3WARA 4JIAA 3VS0A 3OC1A 3PIZA 3EZRA 5K3YA 2GS2A 4ZY6A 3VUDA 5CU0A 2R3PA 4ZTSA 3BV2A 3PPKA 2JKKA 2XNNA 3WIGA 2ZMDA 4TPTA 4D28A 4X2JA 2G01A 4A06A 4ENXA 2P0CA 5K9IA 1OL6A 1Y8YA 2BZJA 3P0MA 4QP9A 2C30A 3FV8A 2X7GA 2QHNA 4N6YA 5IUIA 5M53A 3BYSA 3VNTA 4LGGA 2J5EA 1VJYA 4ZOGA 3QZFA 4C3FA 4BDHA 1MRVA 2BIYA 3OD6X 3W2PA 5J7BA 4HGTA 1PXMA 3MVMA 5EI2A 2CSNA 4O7LA 2C5OA 3R63A 1H1RA 5G6VA 1V1KA 3O96A 4FIEA 4O0XA 5AP1A 5DBXA 4ZS4A 1UU7A 4D2PA 4ASDA 2BRBA 5LCKA 4AA4A 4D1XA 3ZSHA 1O6LA 5AUZA 1P4OA 3SV0A 5FBNC 5ANKA 2PL0A 3ZLYA 3AT4A 4CFFA 4IM0A 4BTMA 4K0YA 3F5PA 4F7LA 5D7AA 3GUBA 4BY9E 3UODA 4K11A 3F5UA 4LI5A 5BPYA 3GU8A 3DA6A 3BEGA 4R5YA 5LVNA 3ZYAA 4MAOA 5TE0A 4KABA 3KF7A 4FKJA 1H1QA 3CY2A 4G3EA 3E63A 3ZBFA 4FR4A 2XEYA 4K9YA 2XKDA 3I4BA 4BCHA 1W84A 3G6HA 3I6UA 4DT9A 2WNTA 4GYGA 3JPVA 4RFMA 4H58A 1YWNA 4LGHA 4RMZA 4AXAA 4K33A 4EOPA 4KAOA 2VWWA 4BI0A 2CCHA 1URWA 4RJ7A 1W83A 1YDRE 4FG8A 3C4EA 4BFMA 3D94A 3SAYA 5H2UA 5J95A 5BVKA 2C6KA 2Q0NA 3O71A 5AEPA 3K5VA 4B99A 3MDYA 3R00A 2VNWA 4QO9A 1CTPE 5C03A 1Q8UA 5I0BA 1VZOA 3OWLA 4OTPA 4PTGA 3TWJA 3HP2A 4YJTA 3HAMA 4TYIA 3MY5A 4V0GB 1YQJA 4IJPA 3V5LA 2C6OA 3CD3A 5HNBA 4YTCA 2IW6A 5I9VA 3GCQA 3ZOSA 5F95A 1YHSA 4U7ZA 3H0YA 3TNWA 4ZAUA 1O6YA 4OT5A 5I9WA 5L2SA 4RX5A 2OF2A 1PXLA 3FMDA 4D5HA 3TUCA 2PUIA 4PF4A 5HG5A 3V8WA 2GS7A 4W4VA 4DG2E 3HDNA 4G17A 5HORA 4KS8A 4UZHA 5FM3A 2QO9A 4ONAA 4Q2AA 4CQEA 5A46A 1Q99A 3NYNA 3FAAA 4NFMA 3EFLA 4G1WA 4EOLA 3M1SA 3AGMA 1Q5KA 3A62A 4PRJA 5HE3A 5I4NA 3S00A 5HHWA 1PXOA 3KA0A 3F69A 2GHGA 3POZA 2XK9A 4JLCA 5AA9A 2X4ZA 1YWRA 3JR1A 3MFRA 3NYVA 3QYZA 2WIHA 4XYFA 5FXRA 3Q4CA 3LFAA 3SD0A 3DJ5A 4UMUA 4FKGA 4TRLA 3U54A 2WXVA 2WU6A 3KEXA 3HP5A 3AD6A 1TKIA 4PMMA 3K54A 5FD2A 3NVMB 3OWKA 3RK7A 2ZM4A 3BZ3A 3RP9A 4AE9A 3LM5A 4E20A 2HENA 3D2IA 1DS5A 3NEWA 4KINA 1OL5A 3TDVA 5J8IA 3O17A 3SOAA 2EVAA 3NUUA 4LG4A 4M69A 1GIIA 1FOTA 3S0OA 4PUZA 4YZMA 4IH8A 1PKDA 3R28A 4CLIA 3FEGA 4F0GA 4FZDB 1U46A 3PWYA 5AR2A 5CXZA 4DGMA 4D2VA 1ZMUA 2CHLA 2J9MA 4DE4A 3R7EA 4ZSGA 3EL8A 2OBJA 3BX5A 3E8DA 4YBKA 3THBA 4C38A 3G9NA 1H0VA 5KBQA 1OI9A 4KUJA 4O7YA 4DG0E 2BKZA 1ZYJA 1OZ1A 3HRFA 1JSVA 4I1ZA 4XBUA 3UDBA 3MW1A 3NUNA 3DPKA 3QU0A 3AC1A 4TY1A 3PA5A 2YJRA 2XZSA 3HNGA 3LE6A 4MCVA 2O5KA 3MYGA 4JQ8A 4O22A 5B2KA 4A4LA 1G8AA 2BDWA 4AZEA 3BWFA 2DQ7X 5CVFA 5GHVA 3LIJA 2PE0A 3LCSA 4ERWA 3UQGA 5DGZA 4YPSA 4ZJJA 3H10A 2I40A 4NU1A 4HZRA 2PZPA 2QKRA 3D7ZA 5ETIA 3O23A 2XJ2A 3FZSA 3PA4A 4XG4A 5CEQA 1ZYSA 1XBCA 4JBVA 3DV3A 1TQPA 3TKHA 3OTVA 2GS6A 5FEDA 3MFUA 4BTKA 4O86A 5F94A 1P4FA 3A99A 3E88A 2PUPA 3BU6A 1A9UA 4GV1A 1YW2A 3ZMMA 4EJNA 1YOJA 5IH5A 4FSRA 2I1MA 4R8QA 2WQMA 3LXLA 4N70A 3R83A 2BZKB 5C4LA 5CEMA 2BTRA 3Q5ZA 1QPDA 4C4FA 3F88A 4DYMA 5M09A 4XBRA 5BUEA 3QTSA 4IXPA 3E64A 4ZTQA 3PIYA 4AZSA 4AN3A 4CFNA 4DFLA 4C7TA 1WCCA 3CTJA 4RVTA 1UU9A 3FMNA 4FK3A 3I1AA 3DQWA 1UNGA 4JNWA 4JR3A 4QP3A 4TYHB 5AV1A 1P5EA 2C4GA 3FPQA 4GT5A 4CYJA 4E4LA 4ZSJA 2F2CB 3BGQA 5DLSA 3O8TA 3E7OA 2I0EA 4WO5A 5I9ZA 2XNGA 5CVHA 3LW0A 1TVOA 3TZ9A 4RLLA 4EK8A 3AT2A 3M11A 3VS1A 3GT8A 1ZLTA 2UZUE 4TWNA 5JSMA 1CM8A 2QOOA 3RNYA 1NA7A 3C7QA 2BRNA 2HW7A 2OXDA 4IAKA 1ZAOA 2WTJA 3BRBA 4ZSLA 2XRWA 1YXTA 2YISA 2XNBA 3UNJA 2J2IB 2OXXA 1YI3A 4W9XA 1I44A 2CN8A 2PVKA 3A8WA 2QCSA 3HRCA 2WELA 5EKOA 3V5PA 3FDNA 2Y9QA 3L9LA 2X9EA 3QD4A 3G6GA 4QMSA 4CFMA 5BVOA 3K2LA 2PVHA 4LL0A 4S34A 3W32A 3Q6UA 1ZXEA 4E4XA 4I41A 3ID6C 3H4JA 4QMZA 2W4KA 4PMSA 1KV2A 4U40A 4EORA 4RX7A 2ERZE 2X8DA 1WBVA 5CAPA 2ONLC 3EYGA 1U59A 2VV9A 2WMAA 2WO6A 3EN4A 3IW8A 4FKRA 3UO4A 4AW0A 2BALA 4WD5A 3PSCA 4EWQA 3UE4A 5IEXA 1OKWA 2F7ZE 2XK8A 3ET7A 3CEKA 4NEUA 5HG8A 2YZLA 4OBPA 3QZHA 4ZTHA 5JGAA 3KMUA 3ROCA 5CYIA 2VTLA 3U6IA 5CZIA 5E8XA 1W98A 1WVXA 4ARKA 3ZS5A 3QRJA 5M4UA 3WOWA 2YM6A 5L2WA 2BZIB 3KXZA 3FQEA 3FLQA 3CQEA 4S33A 3F9NA 5A9UA 1BUHA 4H1JA 4PNKA 4AGDA 2ZVAA 5C01A 4RA4A 1PYXA 2UZBA 2G1TA 2UZVA 3LFQA 4W9WA 2XB7A 3QCSA 4GU9A 2E9UA 5FQDC 4JRVA 4L3JA 4M12A 2XS0A 4EUUA 3QWJA 4DEBA 3JVSA 5M56A 4ID7A 5D1JA 4IFCA 3QA0A 4NM5A 3SA0A 3KXNA 4RVMA 4WSQA 3NUPA 5T3QA 3FZTA 4BKJA 2X7OA 2X6DA 4XV2A 3DLZA 4L3PA 2PYWA 2W1CA 3A60A 1LEWA 4IZ5A 3A8XA 4MXAA 4DEEA 2WFYA 4GS6A 3MFSA 1NVSA 4Z55A 5L6PA 1SM2A 2NPQA 4TWPA 3QQGA 3DB8A 2FYSA 4BICA 5DT4A 3JYAA 5JZNA 5B7VA 3DFCB 3FUPA 3BHYA 4YZNA 1F5QA 3AMBA 4IM3A 4FK6A 3OEZA 3ORIA 5CF5A 4QMLA 4EOOA 5AR3A 4IM2A 1NXKA 4IZYA 2XH5A 2Y8OA 1OGUA 5HKMA 2E9VA 4MF0A 2RL5A 4ZEGA 3VHEA 3BLQA 4RIWA 3R01A 3MJ2A 2KTYA 5BYYA 4QYGA 2C6LA 4TWCA 4UB7A 3LFSA 2B7AA 4RA5A 5L2TA 4G3CA 1H1PA 4CMOA 1XBBA 4YJRA 2OU7A 3MTFA 2WMSA 4FBXA 2F2UA 3C1XA 2F4JA 2W1HA 4EHGA 4QMWA 2ITNA 2OGVA 3DKCA 5GJFA 3MH1A 3VRZA 2A2AA 1M2QA 3QKLA 4GSBA 3GCVA 5CF4A 1BYGA 2XK4A 5CI7A 4E5WA 4B6LA 4EOJA 4O1OA 2WTCA 5DHJA 4ZSAA 3N4UA 2Z2WA 4I6FA 4U97A 5LMBA 2XP2A 2ITTA 2UW8A 2YM3A 4DH3A 4AQCA 2PVNA 4FKIA 2VTNA 4I5MA 3VN9A 3UBDA 3F3WA 4YC3A 5LOHA 1CSNA 4U45A 2Z8CA 2XBAA 4U8ZA 4I5HA 4EKLA 4F99A 5KMMA 5AP0A 4YR8A 3VAPA 2JDOA 2JKOA 4PPBA 3W2OA 3EQGA 4GFMA 5D10A 4USFA 1G8SA 2P33A 5HX8A 4BHZA 4EK6A 4FEUA 4XJ0A 3W8QA 4FT3A 3FI3A 4USEA 2W99B 3FKOA 3KN5A 3AG9A 4Y73A 4BCQA 5AAEA 4GJ2A 4EZ3A 5KX8A 3MGYA 1M17A 1FBNA 2I0YA 5I9UA 2X7FA 4BTFA 5A4EA 2G15A 5AJQA 3CJFA 4APCA 3R1QA 3RGFA 3UC4A 4R1VA 4GJ3A 3F5XA 3I79A 3UIUA 5C27A 2JDVA 3UQCA 3N51A 5AM7A 2UW3A 2OZAB 4QNAA 3CLYA 3HRBA 1Z5MA 5B2LA 4CCUA 3D14A 4C4HA 3EB0A 4EH6A 4FTRA 3P78A 4NJ3A 3OS3A 4EEVA 5GZ8A 3KC3A 2XK6A 4FIFA 3RCJA 3BHUA 4E4MA 1I09A 2JIIA 1X8BA 5KO1A 4K2RA 5IQCA 3UIXA 5E1EA 4EHEA 4BDKA 5I3RA 5TR6A 2LGCA 3R7OA 3UG2A 2HCKA 2JEDA 4O0RA 4PPAA 1ZYLA 2B9FA 2VNYA 3I7CA 4FTOA 5CSVA 3PJCA 5EW9A 1WVWA 3P4KA 4V0GA 4WG3A 5K5XA 2XUUA 4WA9A 3MWUA 4FYOA 5CSPA 4CG8A 1OIUA 1QPEA 2HYYA 3BYMA 2R64A 2C3IB 4WRGA 3TDWA 3RAHA 1H25A 3BHTA 4O0WA 2GU8A 4G16A 4YNEA 4UY9A 4EH7A 3WZKA 3OUNB 5EHOA 1IAJA 2PHKA 4G5JA 5CEPA 3AD4A 4A9TA 4DFNA 1CKJA 3DKGA 3HZTA 4JBPA 4E6DA 4RWKA 2YIRA 3SW4A 1ZOHA 4LRJA 3UMXA 3QC4A 3MTLA 2PULA 3JS2A 3EYHA 3HV5A 2BMCA 4FI1A 4FZAB 3RVGA 3EZVA 2WPAA 3ALOA 3HKOA 1JBPE 1SZMA 4GKHA 4KSQA 4PTEA 3POOA 2VAGA 5K4IA 4IMYA 2XKCA 4QMPA 4G9RA 5FDXA 3HLLA 3OW4A 3ZFMA 3IW7A 4RT7A 5H8BA 2YITA 4E93A 3C4XA 1H1SA 1M14A 2X1NA 4HOKA 4DGOA 4NFNA 1ZWSA 2H34A 3Q53A 4D9TA 2UW9A 3P7BA 2UW7A 2W4JA 3Q04A 2BTSA 4JAJA 4LV5A 4PMTA 3WZJA 2JIUA 3FQSA 3CTQA 4CKJA 3DNEA 3QCXA 3QQJA 4KA3A 2C3LA 1NVQA 3PZEA 3NNUA 3U4WA 4MD8E 3ZZWA 2P2HA 1W0XC 3G2FA 3ZTXA 2Y6OA 3R21A 1VEBA 4BCMA 2CNQA 3FC1X 4F6SA 4O0TA 4BZDA 4I0SA 4MYGA 2UZEA 3NSZA 3QTXA 3QQHA 4QMOA 4D2WA 4FTTA 4BIDA 4O7VA 4FT5A 2HXQA 2WB8A 3U87A 1UWHA 5JQ5A 1F0QA 2O3PA 3BLRA 2VN9A 3CPCA 4BCGA 4CT1A 3L8PA 4MK0A 4BBFA 4XLVA 2VO0A 2B0QA 2PZYA 5CQWA 2J4ZA 5AV2A 1GZ8A 4BDDA 2AC5A 3HA6A 3R6XA 2IVUA 4HPTE 2UW5A 4YUQA 5E91A 5EYDA 3F7ZA 4AOTA 3TT0A 2IW9A 4YTHA 3FI2A 3P23A 4DTBA 3BIZA 1KE5A 3QGYA 4IAYA 4IIRA 5CSWA 3UNKA 1GAGA 1Y91A 2W9ZB 3AC2A 3D7TB 4Q9SA 5HICA 5CX9A 3LCTA 3UZPA 2WTIA 3MH3A 2XBJA 3ZDIA 1PW2A 2CN5A 2Z60A 1UU8A 1Y6BA 3WILA 3Q9XA 3RK5A 4EYMA 3Q2MA 3IGGA 4IACA 2WTDA 2R3IA 3RKBA 2B9IA 3FL5A 3VO3A 5DMZA 3SXSA 5GIPE 5CAQA 4J52A 3FMKA 2VTSA 2GNFA 3P08A 2KULA 4AA5A 3KXMA 3WF5A 4BWXA 3BU5A 2OICA 4AGCA 3OG7A 4ANLA 4UYNA 3U4UA 4KSPA 5CNOA 5CXHA 2XIKA 3CKWA 1R1WA 1OKVA 3FY0A 3DBCA 3OVVA 5IG1A 1J7UA 3LJ0A 3R73A 5EQPA 3EN6A 4MNFA 2F7EE 1L8TA 4FKLA 2ZM1A 4W4XA 3DBFA 5CU6A 4ZXTA 5CS6A 4E26A 4K6ZA 5HTCA 3SRVB 1A06A 3QLFA 4X0MA 5BQ0A 4Z7HA 4WIHA 2R0UA 4O83A 3WF6A 5EM8A 3UVRA 5A3XA 5DR6A 3IW5A 5KUPA 2VGPA 4J96A 4CKRA 3CJGA 3R7IA 4PNIA 3ZUUA 2OJ9A 4KS7A 4JBQA 3LFCA 3NVKI 2R7IA 5HO7A 5JFXA 5M06A 5I5ZA 5E90A 2HWPA 4OTQA 3KFAA 2J0IA 4NK9A 5J5SA 3R04A 3ORMA 4V05A 4A9YA 3ZFXA 2HY0A 1TQMA 4IAZA 2B54A 2X0GA 4FIIA 5ETFA 1SNUA 3WIKA 4GEOA 3VW8A 4HJOA 3Q60A 3CGFA 5AX3A 2R3NA 5LVOA 4DFUA 4GH2A 5IQGA 3NW7A 3C13A 1KOBA 4BRXA 1URCA 4UX9A 2A0CX 5IA2A 4DEGA 1XQZA 1HCLA 3TI1A 4D2RA 4HGLA 3TKUA 2QOQA 4FIJA 3UC3A 2NRUA 4O7ZA 5EOBA 4NW6A 4MH7A 5J1VA 2WQNA 3HMNA 2CGWA 3VF8A 2XCKA 1H08A 3F3VA 3V8SA 4XG3A 4F0FA 5AV0A 2YN8A 4A9UA 5M07A 2JAVA 4QRCA 4O7SA 2UZOA 4I6HA 3T8OA 2WQEA 2FH9A 4ZY4A 3CBLA 3VHKA 1OBDA 4IZ7A 4L42A 4N6ZA 3A7GA 3QUPA 3RJCA 4A7CA 5KHWA 3BHVA 4QTDA 4CV8A 2VX0A 2YCSA 4BZNA 4FV9A 4NCTA 3Q4TA 4PDPA 3ROYA 4E6CA 5HVJA 5DRBA 5FP6A 3GC0A 4FVRA 4XP2A 2I0HA 2RSVA 4JQ7A 3V8TA 2W96B 3VWAA 1YXUA 3PVWA 4RC4A 1IASA 1SVHA 3O8UA 5CVGA 5M4IA 2QLQA 3NS9A 4HYHA 1GY3A 3PVUA 5M57A 4F1OA 3SX9A 5DI1A 4OTGA 2VWVA 3NPCA 4QP2A 4Z3VA 3QQKA 3LMIA 5HIEA 2XIZA 4C4IA 4EC9A 2BZHB 2RG6A 1JOWB 2QR7A 3LCDA 4OTFA 3ZEWA 5CF6A 4ORKA 2J5FA 2BILB 2XMYA 4YJSA 3KN6A 5GNKA 3E5AA 2BVAA 4OTWA 2YLEA 2V7AA 2JDSA 4CMTA 2BUJA 3CPBA 5JGDA 3ZM9A 3DTWA 3OFMA 4RSSA 4EOQA 1XH6A 4QTCA 4C58A 3MVHA 4A4OA 2OH4A 4W4WA 2UW4A 5KE0A 3ULZA 3GI3A 4CVAA 2ZMCA 4R7HA 4FSQA 1YXXA 4HVDA 4GRBA 3UJGA 3NIEA 4FNXA 3C5IA 3MESA 3TM0A 2BRMA 3DLSA 3TXOA 3MFTA 2BDJA 3E8EA 5F4NA 3PFQA 4ANOA 3BGPA 1KE6A 3MH0A 3Q96A 5CAVA 1WBPA 3KRXA 4TNBA 4FGRA 3QTZA 1WBOA 3EN7A 4F9YA 4BDFA 2J0MB 4XH6A 2H9VA 4XNEA 3MY1A 5AUWA 4YTIA 1PRYA 2WTWA 2WGJA 5BMMA 4TN6A 3VS2A 1PXNA 3BHHA 2R3FA 4MBIA 4F08A 4W4YA 3FZPA 4YLKA 2QI8A 3TV6A 3ZLXA 3SLSA 5FWKK 4FL3A 2W4OA 5IF1A 3F2RA 1K3AA 3ALNA 4IE9A 4QNYA 4O7RA 4YO6A 4TT7A 3RMFA 2YACA 3I0QA 5E92A 3MVJA 3FQHA 2C5VA 3RPYA 3I5NA 2UVXA 4UN0C 3I0OA 1VR2A 3OF0A 5HI2A 3S4QA 4LV8A 4BBEA 4CV9A 4PPCA 2CKPA 3PJ8A 5FLFA 5KKRC 4O82A 2W1DA 1KE8A 4F9BA 4HGEA 4AT5A 3FY2A 4C4EA 4R3CA 2Y4IC 4AGUA 3GQIA 3QGWA 4C8BA 5HVKA 4L9IA 3KY2A 4EOSA 3FHIA 4F6UA 2W05A 3PJ1A 4B7TA 2JBOA 3F7WA 3UYTA 5AUTA 1LUFA 4YJQA 2CCIA 2OSCA 3Q9WA 5KBRA 3SG8A 4HVGA 4YU2A 2H8HA 2PVJA 2OJIA 4FSMA 1J91A 4IWPA 1U54A 1FGIA 3O0GA 4RLKA 2HAKA 3VW6A 2O8YA 3KVXA 3PSBA 1OIQA 3ZCLA 2J0LA 1GZNA 4A9SA 2ITWA 1O9UA 1Q8ZA 3DTCA 4X2FA 5H8GA 3ZO2A 2UZLA 5HE1A 4AOIA 4AT4A 3KMWA 2F57A 4RWIA 4X3FA 4G3FA 5J87A 2W1GA 4FT9A 4YMJA 5HLWA 2CLXA 3Q4ZA 5M44A 3I6WA 4KIQA 3DBQA 3ZC6A 3DK3A 2BR1A 5CWZA 3VS3A 3RCDA 4CQGA 4MWHA 3PXQA 5AV3A 2ZB1A 4KKGA 5CEKA 4PL4A 4MHAA 1WBWA 4IB1A 4C57A 4GCJA 4EH2A 5HU3A 4LMUA 3FL4A 2BFXA 1MUOA 4FF8A 2FSTX 2QU5A 5CI6A 3SHEA 2VX3A 4OLIA 4AFJA 2C6MA 4JBOA 1J7IA 2AYPA 5D12A 1Z57A 4KKEA 2J0JA 4PMPA 4AE6A 3DQXA 3LHJA 5EOLA 5M55A 2BHEA 3R30A 4XMOA 2DYLA 4JDIA 4NM3A 4X2GA 5EYCA 5IMEA 3C0GA 1YRPA 3NUYA 4GVJA 2RF9A 2YABA 3DBDA 4JXFA 3D5UA 3PPZA 3QRIA 5DWRA 4EOIA 4ZK5A 3Q6WA 4FEVA 1XH9A 4NKAA 2OIBA 3OUKA 4TW9A 5IQFA 3G0EA 4R77A 3Q52A 4WBBB 1FINA 3GBZA 4RWLA 4YZDA 3WYXA 1NY3A 3NUSA 3QQLA 4UXQA 4CT2A 4H3PA 3QTUA 2C0TA 2UW6A 3EQDA 3FMLA 1FGKA 4AAAA 1M7QA 4AFEA 3PA3A 5KKRB 2A1AB 4FV4A 4IDVA 3JVRA 5KNJA 4FKQA 5BVEA 2Y4IB 3QUDA 4IW0A 3HECA 2YIWA 4I23A 3RPOA 4EK4A 3ATTA 1JWHA 3ZSIA 4S32A 4YC8A 1V0PA 2XK7A 3ORXA 3G90X 4ZLZA 4CFUA 3IONA 1AQ1A 5E8TA 4O81A 3ZRKA 4JT3A 4JG8A 1MRYA 4EOKA 3MJ1A 3OBGA 4L68A 3DS6A 4F70A 4IZAA 5J9LA 4D4SA 2GPHA 2NP8A 5DN3A 3VUIA 5DYJA 3DGKA 4JS8A 4IC7A 4U80A 2PE1A 5EDPA 4QPAA 2NRYA 3II5A 4I4FA 3C4CA 3AXWA 3HV7A 2XRUA 3KCFA 3HMOA 3KVWA 4DEDA 2HZ4A 2JITA 4BCOA 2XNEA 3PIXA 4IAAA 4BCIA 2QG7A 4NJDA 5JK3A 4FKPA 3HV3A 2GTMA 5IU2A 5M4CA 4RRVA 5EHYA 5ETCA 2OH0E 3LFBA 3HUCA 1OM1A 5HD7A 4YJUA 3W55A 4BI2A 4TKSA 2WQOA 5IDNA 2CKQA 4U42A 3V5QA 4OGRA 3EQCA 3KGAA 1ZMWA 3D2KA 2H6DA 1G5SA 3RWPA 2IZUA 1SNXA 3UNZA 4AW1A 4IBMA 3TJDA 4ZJIA 3MPMA 4FT0A 5HGIA 4U6RA 1KV1A 5KHXA 5DR9A 2VTOA 3AD5A 3PRFA 3DFAA 4FSNA 3ZO4A 3WE8A 3EQPA 4LOPA 4KIKB 4FOBA 4AU8A 2R3MA 4RG0A 3EJ1A 4DGGA 1ZARA 5FTOA 4BCNA 2WKMA 3RHXA 2B1PA 3A4PA 4KIPA 2ITUA 3PXRA 4O27B 2AUHA 3PLSA 3E62A 1OUYA 3VBWA 1BI8A 1FMKA 3NLBA 1M7NA 4JX7A 3ZZEA 5IH6A 3ENHA 2YAKA 4DINA 3KF4A 5AR8A 4H05A 4FG7A 3RM7A 3F2AA 5IQHA 3RZFA 3UOHA 4DG3E 4MXCA 4DGNA 4AF3A 1RJBA 4AOJA 4F6WA 4YC6A 2V7OA 3LXKA 3NNXA 5HLPA 5HU9A 4CRLA 4LOQA 5LMAA 3SRVA 4X21A 3RK9A 4E5BA 4AN2A 1Q8TA 4C3RA 4FICA 3GC9A 3LJ2A 3LQ8A 3C9WA 5T6KA 2P3GX 3DDQA 4MXZA 3ENMA 4MKCA 2Z7SA 2QLUA 4Q9ZA 3LZBA 2ETMA 2PTKA 4FTIA 5HG9A 1JLUE 4X2KA 4L8MA 3VS6A 3W1FA 5LMKA 4RZVA 1OPJA 3NYXA 4FVPA 3TNHA 4FZ6A 2CPKE 5KZIA 1JKLA 3UP7A 3HV6A 1OBGA 2YFXA 2VWYA 5E8YA 4ZSEA 1JKSA 5AWMA 3BI6A 3ZSGA 3FWQA 4JVGA 2QR8A 4PP9A 2SRCA 4F65A 4HYUA 3UMWA 5CAUA 1ZOEA 3ORPA 5EH0A 4IAIA 2PVYA 3FYKX 4FE2A 1XBAA 4S2ZA 4QMTA 4WNKA 2C0IA 3MVLA 2C3JA 3O2MA 4RVKA 4WSYA 4UMPA 5A4CA 1Z9XA 5AP4A 3CGOA 4G31A 4O6LA 2Y7JA 5ANJA 3IW4A 5T68A 3PTGA 5IA5A 3FMJA 4EHZA 3QTWA 1YVJA 4IHPA 5FUTA 3LMGA 1FQ1B 5AP6A 2OIDA 3O7LD 2B52A 3P79A 4RIYB 3SKCA 3SDJA 3VC4A 4JDHA 4QMVA 2VO3A 5AUXA 4NIFB 5F9EA 2C0OA 2CNUA 4FSYA 1ZYCA 4GUEA 3N4VA 3MS9A 4HYIA 1YI6A 4XOYA 2XJ0A 2YM7A 1BI7A 3W18A 5JKGA 2BPMA 3VQUA 3EQFA 5AUYA 5A6OA 5FDPA 2OXYA 2EB2A 2RIOA 3DB6A 4D55A 3DJ6A 3FXXA 1JSTA 3OCTA 4A07A 3R0TA 3ACJA 3PSDA 4J53A 2JBPA 3GVUA 1H00A 5HZNA 1ATPE 2IJMA 3ZUTA 2G2IA 4EYJA 5DFPA 2ZM3A 4MXOA 4ZZMA 3T9IA 2WMBA 4CKIA 3OXTA 3QAME 5HE0A 5KMIA 3DK7A 4FV5A 4IC8A 4I6BA 3U55A 3IGOA 3WZEA 3VIDA 4MNEB 5IISA 4NH1A 3T9TA 3VBTA 1GIJA 5IKWA 3R9DA 4XP0A 1J1CA 4I0RA 4FV8A 4XLIA 3NWWA 3N9XA 3QWKA 4Q5HA 3RPVA 4IVDA 5EYMA 4HZSA 4KD1A 5EM7A 5LCJA 2F7XE 2YDKA 2PVRA 2X81A 4M68A 5FTQA 4L67A 4EBWA 4FA2A 4F9CA 1XH8A 1YWVA 5HESA 4LL5A 4BKYA 4ANBA 3FXWA 4PDYA 1OKZA 5EM5A 2DS1A 5LWMA 1JAMA 4O2PA 3UTOA 3HAVA 5AFVA 4EQCA 3OBJA 3IPHA 4O84A 4RZWA 3R7UA 5CALA 1JKTA 4DC2A 2E9OA 4MXYA 3SVVA 4HNIA 4O7NA 4AS0A 5E8SA 1KE7A 3CQWA 5KMKA 5FXQA 1YI4A 3COKA 1HOWA 3FZ1A 4BVUA 2ZDTA 4R6VA 1H01A 4XEYA 3OWJA 2JDTA 1Q3WA 1M2RA 5K5NA 4IQ6A 4C2VA 5IA1A 4M3QA 3CIKA 3HV4A 2WIPA 2IVTA 4FNYA 4WHZA 3QYWA 4GT3A 5H8EA 5LJJA 3SW7A 2PVFA 4FT7A 3DK6A 4M15A 2WTKC 3G51A 4XRJA 4EOMA 3OZ6A 5L2QA 5DA3A 2ETRA 4JG7A 2UVYA 3NYOA 2Q83A 5E4HA 4FSTA 4BTJA 4FNWA 3A7FA 3R9OA 2X4FA 3LVPA 4MX9A 3R8ZA 4D1SA 5LXMA 2VU3A 4X6QC 4ZTRA 4NW5A 3SC1A 4OAVB 4L52A 3OP5A 4WUNA 3IQ7A 5IH4A 4UEUA 3FPMA 3OCGA 2PMOX 4YJOA 1OB3A 2OG8A 3OWPA 4XG8A 3QD3A 4CZYB 4KBKA 4PQNA 4YLJA 3UO5A 3DDPA 4O96A 5BMSA 1KWPA 4D0XA 3M42A 2Z7QA 1MP8A 4RJ5A 5IA4A 3FKNA 1UU3A 4BCJA 1BMKA 2EWAA 4WNOA 5BUJA 3IO7A 1CKPA 5FXSA 3DCVA 4PV0A 5E8UA 2R3LA 1UKIA 3DXQA 3HMPA 2BAKA 1IR3A 4EKKA 2OO8X 1YOMA 3E3BX 4C62A 3F3ZA 3LFNA 4HVSA 3CC6A 3TV7A 3FE3A 1H27A 3ZONA 2C5XA 1O6KA 1SYKA 4WOVA 4K8AA 2R3JA 4L53A 4D5KA 2ITXA 5LVPA 4ANQA 3OCBA 3H9OA 2R2PA 2WMVA 1HCKA 3AC5A 3QALE 3CD8A 2X9FA 4R1YA 4JG6A 1QPJA 4GK2A 3WF7A 2YCRA 3ZBXA 2OW3A 2XIRA 4IB5A 5L4QA 4M84A 3NR9A 5JFSA 2EU9A 2W7XA 5KMJA 4QYHA 5GJGA 4CTCA 1WAKA 4BDGA 4I92A 3UVQA 4WNPA 3DJ7A 2RG5A 4LUDA 4QT1A 2X8IA 3VUKA 4B4LA 2JAMA 4FOCA 1KE9A 4K77A 4GFOA 5I9YA 1PXJA 3HA8A 5C4KA 3RTPA 2YLFA 4G6LA 4QP1A 2C6DA 3L8XA 1UA2A 4EWHA 4AW5A 1R78A 3TNQB 4MBLA 4JRNA 3OROA 4C2WA 3WZDA 4DFBA 4FL2A 2XYUA 3JXWA 3MBLA 4IDTA 3ZLSA 4TYGA 3AC4A 1U5QA 1Y6AA 2EXMA 3GOPA 5ANGA 4C35A 3TUBA 2QOKA 2R3KA 1KOAA 1Y8GA 3H0ZA 4DEAA 3AGLA 5KMOA 1H8FA 5ACBC 3MPAA 3GENA 2W9FB 3S95A 4PDSA 3CSVA 4FIGA 1XR1A 2YERA 3A7JA 4FKTA 4HGSA 4M69B 2HELA 5DOSA 4ITIA 3ZRLA 5HBJA 2XIXA 2XM9A 3OOGA 4FV2A 4GIHA 5H9BA 3UYSA 4EH8A 3PDTA 2PMIA 5IQEA 3UPXA 2OFVA 4MD7E 4BHNA 4CTBA 1YHWA 2PZ5A 2FO0A 4YURA 4ZJVA 3OW3A 3VJOA 3GU4A 4O1PA 3LFFA 5FTGA 4XCUA 4L43A 4D2TA 5FGKA 1Q97A 1BLXA 5DEWA 1CMKE 1S9IA 5D41A 3RZBA 2V22A 3W2SA 5AUUA 2Z7LA 3WYYA 4FEWA 3R1YA 3BBTB 3BKBA 4BYIA 3A4OX 3R2BA 4IB3A 5ANOA 3KREA 5FEEA 2HZNA 3QLGA 2YWPA 4XUFA 1EH4A 1IAHA 5EDQA 3LM0A 3O8PA 3DAJA 4H3BA 3L9MA 4C4GA 4GVAA 5C8MA 3VS7A 1R0PA 5LVMA 4FKOA 2AC3A 3P1AA 2ETKA 3GGFA 3C0IA 4AW2A 2PY3A 3T3UA 1WVYA 1JPAA 3C0HA 2VTHA 1PMVA 4F0IA 3IECA 1XH4A 1MQ4A 2BIKB 3W2CA 5HVYA 3VUGA 3LAUA 3N4TA 3EOCA 2FSLX 4KBAA 2ZJWA 2ZYBA 4MXXA 5GJDA 4M8TA 2OFUA 4QQCA 3EH9A 4UYAA 2BRHA 4L44A 4D4VA 3CR0A 1A48A 3H3CA 5CQUA 3SXRA 3B2TA 3BYOA 2O0UA 3DZOA 3ORLA 4KWPA 3QZGA 4DFZE 2OK1A 4PY1A 3BEAA 3PUPA 2QQ7A 2R3GA 2VUWA 5JFWA 3KCKA 3IOKA 3MV5A 5AX9A 5TT7A 4X3JA 5CSHA 4YJPA 4AZTA 2YHVA 4QP4A 1IG1A 4RJ6A 5EDRA 5EFQA 1RE8A 3BYVA 3WBLA 4ERKA 4HW7A 5C8KA 1FMOE 3DXPA 3LLAA 1QCFA 1B39A 3KK8A 4LFIA 3ANRA 4XV9A 4BR3A 4NZWB 4YSMA 4D1ZA 3A2CA 4A9RA 5J9ZA 2HIWA 4F09A 4LYNA 3KQ7A 4TYHA 4L7SA 2DUVA 3D0EA 3Q9ZA 1K2PA 3BE2A 1T45A 4CCBA 3UIMA 5HCXA 2JKQA 3E87A 3QC9A 4PX6A 4QOXA 3B2WA 4EQUA 2JDRA 1LR4A 4D0WA 3GEQA 4WG4A 4B0GA 2OJGA 3F3TA 2FUMA 4E1ZA 3HGKA 4HVHA 1SVGA 4NKSA 5FBOA 4DCEA 2FVDA 4YHJA 4FZ7A 4RIOA 3QA8A 4BF2A 2XM8A 5CU4A 2UVZA 2O2UA 2B9HA 2YDJA 4XG7A 4USDA 5DEYA 5EW3A 3FXZA 4P5QA 4QTBA 1YDTE 4OAUC 3C4WA 4J98A 4G3GA 3QTRA 3PY0A 1BKXA 3FI8A 1ND4A 2IG7A 5A4QA 2XEZA 5EG3A 5IUHA 1MRUA 3AC8A 3PJ3A 4JJRA 4PL5A 4FTNA 3MB7A 4IWOA 4ALUA 3R1NA 3PG1A 4QP7A 5BVFA 4EBVA 1BL6A 3FJQE 5JZJA 2C6EA 5HOAA 2XJ1A 3VJNA 4IADA 5BVDA 4BZOA 3V04A 3GFEA 3GCSA 4GUBA 3OTUA 3D83A 5GZ9A 5DPVA 5LWNA 5TO8A 5A6NA 4ZZOA 1S9JA 2E2BA 4UMRA 5BVNA 4Y46A 2ERKA 4FKSA 3QKKA 4FTUA 3AMYA 5IA3A 2W5BA 1WBTA 4HCTA 1YHVA 2VTPA 3EFJA 5AMNA 5BUIA 2GQGA 2IO6A 2CMWA 3E3PA 3QQFA 5HE2A 2BHHA 4AG8A 4AACA 1R3CA 3DY7A 1NVRA 4KB8A 5AP2A 1CKIA 3BCEA 3R8VA 4YZ9A 2C5YA 2RFDA 3G9LX 5L2IA 2CLQA 2QODA 3DXNA 5HQ0A 4CGAA 2WAJA 3COHA 4EQMA 1H07A 4U9AA 4QYYA 4J97A 5IEYA 2I7QA 2QONA 2IWIA 4FTMA 3ERKA 1ZZ2A 4TNDA 1PJKA 2VWXA 1CDKA 3L8VA 4P2KA 1UNHA 4EH4A 2EXCX 4A4XA 2R3QA 2GHLA 3TKIA 1M52A 2BFYA 3TTIA 1W82A 4UWCA 5BNJA 5J5TA 2RGPA 2DWBA 3I60A 3U51A 3QXOA 4ASZA 4NTTA 4DBXA 4LUEA 4RIXB 3R8MA 4U79A 4MF1A 4BKZA 4B9DA 5CF8A 3P7AA 5CT0A 2CJMA 4AZFA 2G9XA 4B8MA 5EKNA 1WMKA 3GCPA 2VTAA 1XKKA 3KULB 4QP6A 3W2QA 5HG7A 2BRGA 3C4ZA 3Q5IA 5EYKA 4U3ZA 2C6IA 4RIWB 3A7HA 2RFNA 3KK9A 4ZTLA 3UP2A 4Y72A 2Z7RA 1Q62A 4GU6A 4DTKA 3AC3A 2PSQA 2WQBA 4EC8A 4R7BA 4APPA 4TWOA 4CMUA 3EMGA 3ORKA 3FI4A 4DFXE 4GT4A 3RI1A 4RFYA 2QOFA 2QOHA 4RQVA 4W8DA 4CFXA 5L8LA 2W1IA 5HTBA 2FGIA 4ANSA 1E1XA 4DTAA 4QMUA 2JC6A 2QG5A 3OXZA 5AP3A 4E8AA 4WBOA 3G33A 3GOKA 2FB8A 3V51A 5AAGA 4YZCA 2ITZA 3EFWA 3HEGA 3ZXTA 3Q4UA 5F20A 5CAOA 1ZY4A 2CKEA 2ONLA 2XNPA 3R9RA 4E3CA 5CZHA 1OMWA 3LFDA 4YJNA 3QRUA 5IDPA 3QCQA 1APME 1ZRZA 2QOLA 3NGAA 2P2IA 3KRLA 4I4EA 1PY5A 5HEZA 2IW8A 4GG7A 4IB0A 5DG5A 3ZUVA 5HD4A 3U6JA 4ACMA 2PWLA 2FA2A 2QO7A
chains in the Genus database with same CATH superfamily
1Q3DA 3IDPA 2JFMA 3EKNA 1QPCA 4M97A 4QPMA 4R78A 3RM6A 4C4JA 4ALWA 3UIBA 4L6QA 5AR5A 4H36A 4C3PA 2OIQA 5M51A 1PMUA 2W06A 4GK4A 5ANIA 3UO6A 4FSUA 3UVPA 4P5ZA 3NW6A 1G8KA 1Y57A 1NT2A 3FZRA 3B8RA 3GC8A 5G1XA 3CQUA 1B38A 3EFKA 2JGZA 4YBJA 2C68A 4JDJA 4J71A 4L01A 3TIZA 3NNVA 4JIKA 4O0YA 3HMMA 3BL7A 3RNIA 4F4PA 5JRQA 3NNWA 4X2NA 2ESMA 3FLZA 5EI8A 1SMHA 5AR4A 4J7BA 4U43A 3M2WA 3BWJA 4WT6A 2OJFE 2ZAZA 3MSSA 5L6OA 2I0VA 4FL1A 2VTTA 4UBAA 1OPKA 2HOGA 3QF9A 2OZAA 3OOMA 5BVWA 4TTHB 4F9WA 5H3QA 4CFVA 3BE9A 2UZWE 3SG9A 3UG1A 1GZOA 1TQIA 4U41A 4ZS0A 5HBHA 3ZM4A 5DT3A 4BDEA 1E1VA 4TYEA 2Y4PA 3TNIA 4H1MA 3RAKA 3EIDA 2V62A 4RFZA 2VWIA 3FSKA 1SVEA 1QL6A 3KU2A 2C6TA 1H28A 3FHRA 1QMZA 2QC6A 1ZYDA 4TL0A 4MVFA 3VBXA 3R7GA 4XG9A 3ZC5A 2UZTA 3D9VA 4BDBA 4UMTA 3ZHPC 3K3JA 2FSMX 3LMHA 5JFVA 2GFSA 3VS4A 1DI8A 2EUFB 2H96A 3VUMA 4NWMA 4F7JA 3R8PA 2PMLX 3DAKA 2OI4X 1ST0A 3G15A 2YZAA 1XH5A 2QNJA 4DA5A 5CU3A 3B8QA 3CE3A 4Y5QA 2GNJA 1L3RE 2R0IA 4ZP5A 4O7TA 4JR7A 2O65A 3TL8A 3FKLA 4GG5A 4ACHA 1BL7A 5HCZA 3L8SA 1OL7A 4XV3A 4ACDA 1GOLA 2YA9A 2R5TA 3MA3A 5D9HA 3QFVA 1OKYA 3V01A 3AKJA 2XCHA 3SQQA 2W1ZA 2WMTA 3H9FA 4JDKA 2VRXA 5AUVA 3LKMA 1UVRA 3HVCA 1BX6A 3TTJA 2HY81 4BJJA 2Q0BA 3TIYA 3EQRA 4YO4A 4JAIA 4EH3A 5J9YA 4C59A 3HL7A 4EL9A 4RC3A 1TFFA 4GL9A 5K4JA 4MUQA 1YXVA 2E9PA 4AWIA 3QZIA 4ANNA 5BYLA 4OW8A 2NNWB 5HIBA 4N0SA 1JKKA 3K3IA 4R3RA 1ZOGA 4EZ5A 3HDMA 4AA0A 1GIHA 2CGUA 4U5JA 2RFEA 3CTHA 3I7BA 4U44A 5EI6A 3LQ5A 4AX8A 4QEBA 3KIOC 4FIHA 4IX4A 3TN8A 2P4IA 4E5AX 4J95A 1FVTA 1MQBA 5IMXA 5EHLA 3RWQA 2HW6A 3VF9A 3LJ1A 3JY9A 1GZKA 3F6XA 4FV7A 2BDFA 5CENA 5C26A 2VTJA 4CD0A 2CGXA 2W0JA 3NX8A 3PY3A 3TACA 2R9SA 3LXPA 4FV6A 1VYZA 3EN5A 5CLPA 5CT7A 5ANEA 3Q3BA 5DVRA 4YP8A 3ZU7A 3U6HA 4ITJA 4XOZA 3GU7A 1OECA 3LXNA 5E8WA 4L00A 3KRRA 1RDQE 3IKAA 3W2RA 1M2PA 1G3NA 2YIXA 3FMEA 1H1WA 5CEOA 2VO6A 4XHKB 4NT4A 5HCYA 3F82A 4BCPA 3LCOA 3BYUA 1LP4A 3VUTA 3IDCA 2B4SB 3EHAA 4YNOA 1Q4LA 3UGCA 5IA0A 4I3ZA 4K1BA 3ZO1A 4KKHA 2PMNX 1NW1A 2OJJA 2PK9A 3QHRA 2B9JA 4E6QA 2GNGA 3D7TA 3IDBA 5DRDA 4EHVA 3TZ7A 5AM6A 2ITYA 4XV1A 5TF9A 3PRIA 3FLSA 3WF9A 4M0YA 2X39A 3BPRA 3H30A 2CGVA 4U81A 3ETAA 3NMUF 2C1AA 3I81A 4NCTC 4DH1A 5C9CA 3V6RA 4D4RA 5DT0A 5HLNA 3KXXA 1Q61A 4Y85A 3REPA 5JQ8A 4FGBA 4B8LA 3NUXA 5A54A 2WEIA 3MIYA 4OTRA 3ZH8A 5IQAA 5HNIX 2QOIA 2PZIA 2W5HA 2XNMA 3FZOA 2IZTA 3GU6A 3LPBA 3BLHA 4FSZA 5C8NA 3UZRA 1Q41A 4I22A 4R5SA 3TV4A 3VBYA 3H9RA 4ZTMA 2V55A 5CASA 2XIYA 4M13A 3R22A 4HYSA 4AP7A 4UWYA 4CG9A 3HUBA 4BCKA 5L8JA 4BIEA 1UWJA 4KRDA 1JSUA 5EK7A 3O7LB 4NUSA 4EK5A 4BWPA 2EXEA 5A4LA 3AT3A 4WG5A 4RJ8A 1Q8WA 4BCFA 1Q8YA 3S1HA 3CS9A 3C4FA 2WMRA 3ATSA 4AZVA 5ANDA 3TG1A 4KIOA 1PMEA 4CEGA 5KMNA 4RWJA 2XNOA 4BB4A 5FP5A 4ITHA 2W1FA 3ODYX 4QMYA 4RJ3A 1OPLA 2J0KA 3FSFA 4AN9A 3VUHA 5IEVA 1WFCA 4Q5EA 3KXHA 3NIZA 4DEIA 4D4YA 3SXFA 3EL7A 2CDZA 3VBQA 3R8UA 3PE2A 4BN1A 5CNNA 2F9GA 2QURA 2QHMA 1KSWA 5GIOE 4ZLYA 3C5UA 3ORNA 4FTAA 1F3MC 3BU3A 3GXLA 4M0ZA 4BGHA 3QL8A 2YM8A 4UWBA 4HNFA 3QD0A 1UV5A 4R3PA 3AKLA 4EH9A 2OZOA 4W8EA 5ACKA 2YM4A 4FSWA 3F5GA 2VTQA 2VD5A 2ZOQA 4LRMA 3G5DA 2V5QA 3PXZA 2XYNA 2ZB0A 4IJ9A 4UMQA 3RBWA 5L8KA 3TUDA 4F64A 4I93A 4OUCA 4Z9LA 4I21A 4BGGA 3DAEA 4N57A 3ZEPA 5IQDA 4DH8A 2X2KA 3U9NA 4HVIA 4YZBA 2NO3A 5AV4A 2PU8A 3KRJA 4UALA 2XVDA 2ZV7A 3QQUA 2X6EA 3OCSA 2J6MA 3DKFA 4RVLA 2A4LA 2VWBA 3U9CA 1IRKA 1VYWA 1T46A 4I24A 1XMLA 1FVRA 4F9AA 4E6AA 3R7YA 3V6SA 2X2LA 4O7WA 3PJ2A 4BDJA 4ZTNA 3EWHA 4D2SA 4DAWA 3D5WA 5C1QB 4RPVA 3QCYA 4GIIA 4E73A 4MQ2A 3COMA 2A27A 1STCE 3RAIA 3RPSA 4DEHA 1E9HA 1WZYA 5F1ZA 2R3OA 4F63A 4CRSA 4OR5A 5E1SA 1K9AA 2YEXA 3RPRA 3ODZX 2XKEA 1DAWA 2WD1A 3IS5A 4GK3A 4PL3A 4O4DA 3DBEA 4WKQA 3Q9YA 3ORZA 3O51A 4O21A 2GNLA 2VGOA 4PP7A 4H3QA 2XA4A 4NL0A 3AQVA 3OXIA 1LEZA 4OBQA 4FV0A 4FEQA 5E8VA 4FTQA 3BQRA 5HTIA 3PG3A 4QP8A 2J51A 4OTHA 1ERKA 2CKOA 4DBNA 3CY3A 4WRSA 2IVVA 2J50A 2VWUA 2YIYA 4FKWA 4P4CA 1OITA 3VULA 5HO8A 3SGCA 3QKMA 2OWBA 2C5NA 5E9EA 4YTFA 2P55A 4KRCA 4C33A 2HZ0A 1OIYA 1H0WA 3QUEA 4X3FC 5EQYA 4H39A 3FLWA 3FLYA 1R0EA 3OY3A 3E7VA 3A7IA 4FTLA 4P90A 4V01A 5A4TA 5I9XA 2YWVA 3RALA 4RIXA 1H26A 2G2HA 2W1EA 2W17A 5GZAA 2WMXA 3F66A 2ZV9A 1OL2A 4PTCA 1XHAA 1IEPA 4J1RA 5J1WA 3KULA 3OEFX 3V5JA 5AA8A 3EN9A 3IK3A 4FMQA 4MQ1A 3ZFYA 5DE2A 5HX6A 2VWZA 4EJ7A 4G3DA 3TEIA 1DM2A 3L9PA 3GU5A 3QRKA 3QRTA 4NM7A 5E7RA 3EQBA 3OT3A 3R8LA 5DIAA 1V0OA 5HIDA 4RX9A 4AGWA 3COIA 1P14A 3Q32A 1DI9A 4F1TA 5FG8A 3QX2A 4G2FA 5LARA 5GINE 4IAFA 1YDSE 2AQXA 2YIQA 1P2AA 5JMSA 3BQCA 2QKWB 2PPQA 4ZLOA 5EQEA 1OL1A 2QU6A 5M08A 3OHTA 4I20A 5CTPA 2XF0A 3FYJX 3LFEA 3LLTA 2G2FA 1YOLA 3ZRMA 4IVAA 3ACKA 4DLIA 2ITOA 4I0TA 4G6NA 4OTIA 4ZY5A 4C36A 3W0RA 4TXCA 4CFWA 3RINA 3AMAA 3G0FA 3MB6A 4AUAA 4MWIA 2Y6MA 4I5PA 2GCDA 2PVMA 4M7IA 2R7BA 3QBNA 4O4EA 2PUUA 1PKGA 4BYJA 3BBWA 5AIKA 2VTRA 1JNKA 3ELJA 4RC2A 4C0TA 5HNGA 4HPUE 3QTIA 4YGAA 3V5TA 4NYEA 5BYZA 3EQHA 3JY0A 4ACGA 3D5XA 1GJOA 3WI6A 2BKKA 4D58A 3RAWA 4DCAA 4C34A 3IOPA 5HO6A 3GCUA 2PZRA 3PP1A 5JRSA 4O0SA 4U0IA 4NTSA 2OKRA 3PP0A 3TZMA 1J1BA 5L3AA 4FKUA 4FTCA 3S3IA 4MD9E 4O0VA 5AR7A 3VBVA 2UW0A 2JKMA 2WMQA 4OTDA 4XRLA 3OY1A 4QQ5A 5IQIA 2GFCA 1PXIA 4PDOA 3DOGA 3ITZA 4LQMA 1U54B 4LM5A 3UOLA 3UOJA 1VLRA 3E92A 2W5AA 5B0XA 1LPUA 2C69A 2WOUA 2WU7A 2WMUA 4XG6A 5CEIA 4RJ4A 4X3FB 3U8WA 2BROA 1XMMA 4J8MA 4I6LA 3C51A 4ENYA 2ACXA 4QYFA 4BBMA 3W33A 1U4DA 2OF4A 2A19B 4BDIA 3GC7A 4CZTA 4IX5A 2OLCA 5JGBA 1PMNA 4G34A 3CP9A 3NCZA 3R7VA 4J99A 4BWKA 2XAOA 4RQKA 3PY1A 2FSOX 2JLDA 2QOBA 3I5ZA 3P86A 2C3KA 5TKDA 2BAQA 3FMMA 4QMXA 3R2YA 5IQBA 2GQRA 4FX3A 3E8NA 3W8LA 4WNMA 3ZO3A 3FMHA 4Y83A 2R4BA 2BCJA 2WTKB 4RBLA 1UKHA 4L3LA 4E7WA 3DNDA 3MY0A 4IEBA 3PWDA 4S31A 1FPUA 3GFWA 4WUAA 5ICPA 3FLNC 1DAYA 4FUXA 4XG2A 4BC6A 3TMOA 1H4LA 3KKVA 2REIA 4DLJA 4FZFB 4F1MA 3ULIA 4DHFA 2PVLA 1OVEA 2ITQA 3EKKA 2I6LA 3ORTA 3V5WA 3WF8A 1R39A 1OIRA 3NRMA 5D7VA 4IX6A 4Z16A 2J90A 3BELA 3UOKA 4YLLA 2CNVA 3MN3A 4FTJA 5D11A 2IPXA 5AP7A 4FV1A 4FODA 3QTQA 4LOOA 3QX4A 4EUTA 2ZV8A 3KMMA 1WBNA 4GW8A 4AT3A 3UZTA 1OGYA 4JL9A 2O64A 4S30A 3T3VA 4R7IA 2XK3A 4JOAA 1J7LA 4QQJA 2QVSE 3MH2A 4L45A 3R1SA 2EB3A 4II5A 4XX9A 5EM6A 3D4QA 3MPTA 3D15A 4F7SA 5A14A 5JEBA 4O4BB 1PXKA 4QYEA 4EZ7A 2X2MA 3R02A 4IVCA 2YM5A 3ZLWA 4GKIA 4QMNA 3GB2A 5CANA 4MEDA 1W8CA 5LMKC 1AD5A 2VO7A 4O6EA 2RKUA 4O91A 4HCVA 3RHKA 1XJDA 4DH7A 1ZZLA 2QD9A 3NZ0A 4BIBA 2UUEA 2WZJA 4FG9A 2HK5A 3EQIA 3IG7A 4FUYA 1IA9A 2UV2A 2QO2A 4ZIMA 5KCVA 4DT8A 1ZY5A 1Q24A 4FC0A 1WBSA 2XKFA 3D5VA 2GSFA 5DNRA 5AADA 4ALVA 4LMNA 1G8JA 3DT1A 4FKVA 1U5RA 5JN2A 4AAYA 5TOZA 4DGLC 3ANQA 3AOXA 4FV3A 3K5UA 3Q2JA 4QPSA 4UZDA 2VTMA 4TYJA 4QD6A 4QTEA 3NUAA 4GFGA 4O38A 3F61A 3QHWA 2GMXA 3IW6A 1GNGA 2PUNA 1RW8A 3S2PA 3ZDUA 4D9UA 4EI4A 4QMQA 2WMWA 4Y8DA 3LCKA 4KBCA 3PVGA 4M66A 4O0UA 3UPZA 4I94A 4C61A 5LVLA 4ASXA 4AZWA 2IN6A 3TNPC 4DH5A 3W16A 1IA8A 3TJCA 1YXSA 4Y5HA 3HYHA 3MI9A 4E4NA 3GNIB 4I5CA 3SOCA 4FEXA 3OT8A 2IZSA 5AP5A 5ITAA 1PYEA 5IPJA 3PPJA 3F2NA 1REKA 4N4SA 4CXAA 1V0BA 3A61A 3NAYA 4G5PA 1KUTA 1REJA 4YHTA 5FEQA 4FTKA 3R9HA 3DZQA 4XP3A 4CSVA 4KIKA 4ACCA 2VX1A 2GDOA 3CCNA 3L1SA 3MIAA 2R3HA 2WEVA 5CY3A 3W10A 2BAJA 2IEWA 4LRKA 4F7NA 5BX0A 4P7EA 4IWDA 1B6CB 2B53A 2ITPA 4QMMA 3QD2B 2QOCA 3C50A 4GMYA 4FVQA 1H24A 3P5KA 4LGDA 4RGJA 2Z02A 4FYNA 1XWSA 5AIRA 4C37A 4Z7GA 3PXKA 2HWOA 1YKRA 4C02A 4ZMFA 2X8EA 3GQLA 4EH5A 3ZXZA 4M14A 4QQTA 2ZV2A 4GYIA 4BDAA 5CU2A 2GNIA 3FC2A 3NDMA 3PXYA 1ZMVA 4Y95A 3FBVA 4OT6A 5FM2A 4DITA 2F49A 4L7FA 1W7HA 4L46A 4PWNA 4BI1A 2YDIA 3KXGA 4DFYA 1UNLA 4MTAA 1J3HA 4XS2A 4X7QA 2YJSA 2C47A 3VRYA 5K0KA 2UZDA 5L6WL 4IVBA 4JQEA 4K18A 2JIVA 2O63A 5CSXA 4ZMEA 2HXLA 2IZRA 3VVHA 2VZ6A 1OUKA 2LAVA 4UXLA 4CLJA 4MBJA 4EONA 2YAAA 4ASEA 1JQHA 3PE1A 4YPDA 3NCGA 4U3YA 3R9NA 3R71A 5KMLA 4JI9A 5KZ0A 4G6OA 2B55A 4DN5A 3PYYA 2IVSA 2J7TA 4X6RA 2E9NA 4G9CA 4V04A 5ETAA 3WE4A 4CZUA 4NSTA 3F3UA 4IX3A 2WOTA 4O2ZA 5FRIA 1RQQA 4FNZA 5AAFA 2UZNA 3V3VA 3P7CA 3VQHA 2GQSA 2GHMA 4BDCA 3BGZA 4TZRA 2Y0AA 3PLAE 3QXPA 3P9JA 4RIYA 5J7HA 2HZIA 3CXWA 2R3RA 2YCQA 5DR2A 5EW8A 4NM0A 4NIFA 2C1BA 4BL1A 3NW5A 2ZDUA 3KB7A 2PE2A 2JD5A 4IANA 4KNBA 4HCUA 1XH7A 2RFSA 3DKOA 4CNHA 3OMVA 4YJVA 5JT2A 3NAXA 4YHFA 3BV3A 4ANMA 3HMIA 4IWQA 4QTAA 3WZUA 3GP0A 4YSJA 5E8ZA 2VTIA 4UV0A 1PXPA 2GTNA 2YCFA 3MA6A 3E93A 3O50A 3LQ3A 4BGQA 2JFLA 3PVBA 4IFGA 1JVPP 5I3OA 3JUHA 5LQFA 3DU8A 1XO2B 4M67A 3UQFA 4J8NA 2WTVA 5B2MA 2V0DA 4JX3A 4RX8A 3TCPA 3HX4A 5IZFA 4MNEA 3CKXA 4I6QA 2GNHA 1FVVA 3E8CA 4EK3A 1PF8A 5JH6A 5M4FA 3KRWA 4DF3A 3L9NA 3TZ8A 4CYIA 3LOKA 4OBOA 5IUGA 2ITVA 1PHKA 3PXFA 2WHBA 3PZHA 5DH3A 5HBEA 1AGWA 3VS5A 5J79A 3KL8A 4ZZNA 5K0XA 3WARA 4JIAA 3VS0A 3OC1A 3PIZA 3EZRA 5K3YA 2GS2A 4ZY6A 3VUDA 5CU0A 2R3PA 4ZTSA 3BV2A 3PPKA 2JKKA 2XNNA 3WIGA 2ZMDA 4TPTA 4D28A 4X2JA 2G01A 4A06A 4ENXA 4AXEA 2P0CA 5K9IA 1OL6A 1Y8YA 2BZJA 3P0MA 4QP9A 2C30A 3FV8A 2X7GA 2QHNA 4N6YA 5IUIA 5M53A 3BYSA 3VNTA 4LGGA 2J5EA 1VJYA 4ZOGA 3QZFA 4C3FA 4BDHA 1MRVA 2BIYA 3OD6X 3W2PA 5J7BA 4HGTA 1PXMA 3MVMA 5EI2A 2CSNA 4O7LA 2C5OA 3R63A 1H1RA 5G6VA 1V1KA 3O96A 4FIEA 4O0XA 5AP1A 5DBXA 4ZS4A 1UU7A 4D2PA 4ASDA 2BRBA 5LCKA 4AA4A 4D1XA 3ZSHA 1O6LA 5AUZA 1P4OA 3SV0A 5FBNC 5ANKA 2PL0A 3ZLYA 3BLAA 3AT4A 4CFFA 4IM0A 4BTMA 4K0YA 3F5PA 4F7LA 5D7AA 3GUBA 4BY9E 3UODA 4K11A 3F5UA 4LI5A 5BPYA 3GU8A 3DA6A 3BEGA 4R5YA 5LVNA 3ZYAA 4MAOA 5TE0A 4KABA 3KF7A 4FKJA 1H1QA 3CY2A 4G3EA 3E63A 3ZBFA 4FR4A 2XEYA 4K9YA 2XKDA 3I4BA 4BCHA 1W84A 3G6HA 3I6UA 4DT9A 2WNTA 4GYGA 3JPVA 4RFMA 4H58A 1YWNA 4LGHA 4RMZA 4AXAA 4K33A 4EOPA 4KAOA 2VWWA 4BI0A 2CCHA 1URWA 4RJ7A 1W83A 1YDRE 4FG8A 3C4EA 4BFMA 3D94A 3SAYA 5H2UA 5J95A 5BVKA 2C6KA 2Q0NA 3O71A 5AEPA 3K5VA 4B99A 3MDYA 3R00A 2VNWA 4QO9A 1CTPE 5C03A 1Q8UA 5I0BA 1VZOA 3OWLA 4OTPA 4PTGA 3TWJA 3HP2A 4YJTA 3HAMA 4TYIA 3MY5A 4V0GB 1YQJA 4IJPA 3V5LA 2C6OA 3CD3A 5HNBA 4YTCA 2IW6A 5I9VA 3GCQA 3ZOSA 5F95A 1YHSA 4U7ZA 3H0YA 3TNWA 4ZAUA 1O6YA 4OT5A 5I9WA 5L2SA 4RX5A 2OF2A 1PXLA 3FMDA 4D5HA 3TUCA 2PUIA 4PF4A 5HG5A 3V8WA 2GS7A 4W4VA 4DG2E 3HDNA 4G17A 5HORA 4KS8A 4UZHA 5FM3A 2QO9A 4ONAA 4Q2AA 4CQEA 5A46A 1Q99A 3NYNA 3FAAA 4NFMA 3EFLA 4G1WA 4EOLA 3M1SA 3AGMA 1Q5KA 3A62A 4PRJA 5HE3A 5I4NA 3S00A 5HHWA 1PXOA 3KA0A 3F69A 2GHGA 3POZA 2XK9A 4JLCA 5AA9A 2X4ZA 1YWRA 3JR1A 3MFRA 3NYVA 3QYZA 2WIHA 4XYFA 4FRFA 5FXRA 3Q4CA 3LFAA 3SD0A 3DJ5A 4UMUA 4FKGA 4TRLA 3U54A 2WXVA 2WU6A 3KEXA 3HP5A 3AD6A 1TKIA 4PMMA 3K54A 5FD2A 3NVMB 3OWKA 3RK7A 2ZM4A 3BZ3A 3RP9A 4AE9A 3LM5A 4E20A 2HENA 3D2IA 1DS5A 3NEWA 4KINA 1OL5A 3TDVA 5J8IA 3O17A 3SOAA 2EVAA 3NUUA 4LG4A 4M69A 1GIIA 1FOTA 3S0OA 4PUZA 4YZMA 4IH8A 1PKDA 3R28A 4CLIA 3FEGA 4F0GA 4FZDB 1U46A 3PWYA 5AR2A 5CXZA 4DGMA 4D2VA 1ZMUA 2CHLA 2J9MA 4DE4A 3R7EA 3UDTA 4O4FA 3EL8A 2OBJA 3BX5A 3E8DA 4YBKA 4ZSGA 3THBA 3G9NA 1H0VA 4C38A 5KBQA 1OI9A 4KUJA 4O7YA 4DG0E 2BKZA 1ZYJA 1OZ1A 3HRFA 1JSVA 4I1ZA 4XBUA 3UDBA 3MW1A 3NUNA 3DPKA 3QU0A 3AC1A 4TY1A 3PA5A 2YJRA 2XZSA 3HNGA 3LE6A 4MCVA 2O5KA 3MYGA 4JQ8A 4O22A 5B2KA 4A4LA 1G8AA 2BDWA 4AZEA 3BWFA 2DQ7X 5CVFA 5GHVA 3LIJA 2PE0A 3LCSA 4ERWA 3UQGA 5DGZA 4YPSA 4ZJJA 3H10A 2I40A 4NU1A 4HZRA 2PZPA 2QKRA 3D7ZA 5ETIA 3O23A 2XJ2A 3FZSA 3PA4A 4XG4A 5CEQA 2XARA 1ZYSA 1XBCA 4JBVA 3DV3A 1TQPA 3TKHA 3OTVA 2GS6A 5FEDA 3MFUA 4BTKA 4O86A 5F94A 4F78A 1P4FA 3A99A 3E88A 2PUPA 3BU6A 1A9UA 4GV1A 1YW2A 3ZMMA 4EJNA 1YOJA 5IH5A 4FSRA 2I1MA 4R8QA 2WQMA 3LXLA 4N70A 3R83A 2BZKB 5C4LA 5CEMA 2BTRA 3Q5ZA 1QPDA 4C4FA 3F88A 4DYMA 5M09A 4XBRA 5BUEA 3QTSA 4IXPA 3E64A 4ZTQA 3PIYA 4AZSA 4AN3A 4CFNA 4AXDA 4DFLA 4C7TA 1WCCA 3CTJA 4RVTA 1UU9A 3FMNA 4FK3A 3I1AA 3DQWA 1UNGA 4JNWA 4JR3A 4QP3A 4TYHB 5AV1A 1P5EA 2C4GA 3FPQA 4GT5A 4CYJA 4E4LA 4ZSJA 2F2CB 3BGQA 5DLSA 3O8TA 3E7OA 2I0EA 4WO5A 5I9ZA 2XNGA 5CVHA 3LW0A 1TVOA 3TZ9A 4RLLA 4EK8A 3AT2A 3M11A 3VS1A 3GT8A 1ZLTA 2UZUE 4TWNA 5JSMA 1CM8A 2QOOA 3RNYA 1NA7A 3C7QA 2BRNA 2HW7A 2OXDA 4IAKA 1ZAOA 2WTJA 3BRBA 4ZSLA 2XRWA 1YXTA 2YISA 2XNBA 3UNJA 2J2IB 2OXXA 1YI3A 4W9XA 1I44A 2CN8A 2PVKA 3A8WA 2QCSA 3HRCA 2WELA 3PFYA 5EKOA 3V5PA 3FDNA 2Y9QA 3L9LA 2X9EA 3QD4A 3G6GA 4QMSA 4CFMA 5BVOA 3K2LA 2PVHA 4LL0A 4S34A 3W32A 3Q6UA 1ZXEA 4E4XA 4I41A 3ID6C 3H4JA 4QMZA 2W4KA 4PMSA 1KV2A 4U40A 3P5JC 4EORA 4RX7A 2ERZE 2X8DA 1WBVA 5CAPA 2ONLC 3EYGA 1U59A 2VV9A 2WMAA 2WO6A 3EN4A 3IW8A 4FKRA 3UO4A 4AW0A 2BALA 4WD5A 3PSCA 4EWQA 3UE4A 5IEXA 1OKWA 2F7ZE 2XK8A 3ET7A 3CEKA 4NEUA 5HG8A 2YZLA 4OBPA 3QZHA 4ZTHA 5JGAA 3KMUA 3ROCA 5CYIA 2VTLA 3U6IA 5CZIA 5E8XA 1W98A 1WVXA 4ARKA 3ZS5A 3QRJA 5M4UA 3WOWA 2YM6A 5L2WA 2BZIB 3KXZA 3FQEA 3FLQA 3CQEA 4S33A 3F9NA 5A9UA 1BUHA 4H1JA 4PNKA 4AGDA 2ZVAA 5C01A 4RA4A 1PYXA 2UZBA 2G1TA 2UZVA 3LFQA 4W9WA 2XB7A 3QCSA 4GU9A 2E9UA 5FQDC 4JRVA 4L3JA 4M12A 2XS0A 4EUUA 3QWJA 4DEBA 3JVSA 5M56A 4ID7A 5D1JA 4IFCA 3QA0A 4NM5A 3SA0A 3KXNA 4RVMA 4WSQA 3NUPA 5T3QA 3FZTA 4BKJA 2X7OA 2X6DA 4XV2A 3DLZA 4L3PA 2PYWA 2W1CA 3A60A 1LEWA 4IZ5A 3A8XA 4MXAA 4DEEA 2WFYA 4GS6A 3MFSA 1NVSA 4Z55A 5L6PA 1SM2A 2NPQA 4TWPA 3QQGA 3DB8A 2FYSA 4BICA 5DT4A 3JYAA 5JZNA 5B7VA 3DFCB 3FUPA 3BHYA 4YZNA 1F5QA 3AMBA 4IM3A 4FK6A 3OEZA 3ORIA 5CF5A 4QMLA 4EOOA 5AR3A 4IM2A 1NXKA 4IZYA 2XH5A 2Y8OA 1OGUA 5HKMA 2E9VA 4MF0A 2RL5A 4ZEGA 3VHEA 3BLQA 4RIWA 3R01A 3MJ2A 2KTYA 5BYYA 4QYGA 2C6LA 4TWCA 4UB7A 3LFSA 2B7AA 4RA5A 5L2TA 4G3CA 1H1PA 4CMOA 1XBBA 4YJRA 2OU7A 3MTFA 2WMSA 4FBXA 2F2UA 3C1XA 2F4JA 2W1HA 4EHGA 4QMWA 2ITNA 2OGVA 3DKCA 5GJFA 3MH1A 1ST4A 3VRZA 2A2AA 1M2QA 3QKLA 4GSBA 3GCVA 5CF4A 1BYGA 2XK4A 5CI7A 4E5WA 4B6LA 4EOJA 4O1OA 2WTCA 5DHJA 4ZSAA 3N4UA 2Z2WA 4I6FA 4U97A 5LMBA 2XP2A 2ITTA 2UW8A 2YM3A 4DH3A 4AQCA 2PVNA 4FKIA 2VTNA 4I5MA 3VN9A 3UBDA 3VONA 3F3WA 4YC3A 5LOHA 1CSNA 4U45A 2Z8CA 2XBAA 4U8ZA 4I5HA 4EKLA 4F99A 5KMMA 5AP0A 4YR8A 3VAPA 2JDOA 2JKOA 4PPBA 3W2OA 3EQGA 4GFMA 5D10A 4USFA