3BU5A

Crystal structure of the insulin receptor kinase in complex with irs2 krlb peptide and atp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
297
structure length
291
Chain Sequence
DEWEVSREKITLLRELGQGMVYEGNARDIIKGEAETRVAVKTVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSLRPEAENNPGRPPPTLQEMIQMAAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMAPESLKDGVFTTSSDMWSFGVVLWEITSLAEQPYQGLSNEQVLKFVMDGGYLDQPDNCPERVTDLMRMCWQFNPNMRPTFLEIVNLLKDDLHPSFPEVSFFHSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords insulin receptor subunit beta
publication title Structural and biochemical characterization of the KRLB region in insulin receptor substrate-2.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 291
sequence length 297
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-12-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3bu5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3bu5A01
2C6KA 3LJ0A 4EC8A 5A46A 2YCSA 4U81A 5CAPA 3AMYA 5CQUA 3LXNA 4QTBA 1J7LA 1K2PA 4CFVA 3OBJA 3O8TA 4AT4A 3IGOA 3MN3A 2ZJWA 4ZTLA 5FXSA 2ZAZA 2RSVA 4FSQA 4O82A 5A3XA 5AEPA 1SVEA 2F7EE 3DQXA 4ITHA 1PXOA 3TUBA 3QUEA 2ITNA 4FSTA 4D58A 4ZY5A 3FEGA 3EN4A 3FE3A 2R3KA 3OOGA 2X7FA 3KK8A 4NWMA 2PMOX 5IDPA 3FZOA 4BDGA 1BKXA 4HPUE 3VBWA 5ANEA 3MH3A 5GJDA 4D4VA 1YXVA 5D11A 4DF3A 5M4FA 4BKZA 1YRPA 1UVRA 5CEIA 2QOLA 3AXWA 4NTSA 3EWHA 5CENA 2CCIA 1MRVA 5KNJA 5IQGA 3DKCA 4XUFA 2G2HA 1SVHA 1UKIA 3O2MA 1FINA 2E9NA 3QC9A 5TT7A 3BBTB 5HVJA 2WIHA 2YZAA 4EI4A 5C8KA 3F5XA 2I6LA 2FSMX 4XCUA 4GG7A 3FQHA 3UOJA 5IA2A 5HO6A 5E8XA 4E4MA 5KKRC 4BDKA 3MESA 3L9MA 4L3JA 3ORXA 4MXOA 5LMAA 3UTOA 2OJ9A 4JX3A 3Q4UA 4FKIA 3EKNA 1R3CA 4O22A 3F88A 4ENYA 5F4NA 4ACDA 3E64A 3QLGA 2QCSA 3SA0A 4M14A 3LMHA 5EW3A 4EOPA 4DTBA 4YHJA 4QQ5A 1H28A 2PHKA 5EG3A 3JPVA 4PF4A 3WF5A 2WMUA 1IR3A 1KE7A 2OIDA 5B7VA 1QPCA 2W05A 3E3PA 3TM0A 3HYHA 3QZHA 3S0OA 4E6DA 3ZRMA 2IG7A 3EFJA 2ZVAA 4XP0A 1PKGA 3D5XA 4UMTA 3TTIA 4FKPA 3MS9A 4JIKA 4RQVA 3BHHA 2RF9A 4ZS4A 3HA8A 5DA3A 2IW9A 1PYXA 1U54B 2BRBA 2GHLA 3F2AA 5JFVA 4YLKA 3W1FA 2B55A 2VTLA 2WU6A 3BYSA 3MA3A 4IB0A 5L2IA 4LFIA 4AG8A 3DBDA 4IMYA 4G1WA 4TTHB 3F61A 3A7HA 4KIQA 3W18A 2YACA 5C03A 1WCCA 4P7EA 4Y73A 2GS2A 2QODA 4IFCA 4B8LA 3SXFA 4FT9A 4EHEA 3W8QA 3NUNA 4QTEA 2W4OA 3T9IA 3TG1A 2JAVA 5BUIA 1DI8A 4EKKA 2ZM4A 3WE4A 2PMNX 2W06A 4UMQA 4Z55A 4U0IA 1BLXA 1OZ1A 1Q99A 3LCTA 2W4KA 3QTXA 4I23A 4NKAA 4H3PA 2BFYA 2DYLA 1M52A 2PWLA 1ZRZA 3UNJA 3ZSIA 3PJ2A 3SDJA 4BIBA 3FQSA 3C4XA 1H1PA 4QMVA 3VF8A 1NA7A 3QWJA 4C4EA 1FVTA 5EYKA 4LG4A 3ZLSA 1ZARA 4R5YA 2BZKB 5KBQA 4LM5A 4F4PA 4J95A 3C4CA 4YZBA 3I4BA 4AN3A 3ELJA 3ZEPA 3F3WA 2HW7A 5GNKA 4ZTMA 3E7OA 4FV8A 3ODYX 3DJ7A 2Q83A 4ORKA 1OKZA 4P2KA 4UY9A 2LAVA 3V04A 4LV5A 5M06A 5K5XA 3TZ7A 4QRCA 5DLSA 1Z57A 2CCHA 3M11A 3FBVA 3PPZA 3R7OA 3RHXA 3FLYA 4DEIA 5IEYA 5JFXA 5KMIA 3NVKI 4KIKA 4A4XA 1YOMA 1TQMA 3WIGA 5CQWA 4IFGA 2W1HA 2Y4PA 4D2SA 2NO3A 4YZDA 3EFWA 4N70A 5EI8A 3OWJA 2QOIA 5DIAA 4EK8A 5CXZA 2XJ2A 3NUAA 2BAJA 4G34A 4N4SA 5CYIA 4CTBA 4M67A 4WUNA 4ZAUA 4B6LA 5IDNA 2HXLA 2QD9A 3MW1A 2X2LA 3LM5A 4M3QA 3R8PA 2QVSE 3MYGA 2R3IA 4DCEA 2BIYA 4DEAA 4ZMEA 4TWOA 5A4CA 5BVFA 2ITOA 2XCHA 1QMZA 2WTKB 2YFXA 4O1OA 5IG1A 3W33A 2RFNA 3R04A 5EKOA 2VTRA 1PXPA 2ITYA 5IUIA 1DAYA 5LQFA 3Q4CA 4YO6A 2GTNA 4D5HA 2XNOA 5I9WA 3OZ6A 3D0EA 4JBPA 3GU4A 2GCDA 3GCPA 3QALE 3EB0A 3HX4A 3FXWA 4DEEA 4JBQA 4BDFA 3QRUA 4F64A 3U8WA 5CU4A 3H9FA 4W9XA 3SRVA 4GK3A 2WTVA 1PMNA 3PG1A 2VV9A 4XOZA 5F94A 3TJDA 4TXCA 2VX3A 3GUBA 2Y8OA 5DNRA 5M09A 2QC6A 4M69A 3GFWA 3UQCA 4QP2A 3S3IA 3ZOSA 3ORKA 3OC1A 4NKSA 5AR8A 3ZYAA 2JITA 4BTJA 5ANKA 4DA5A 5M08A 3R30A 3FMJA 3OFMA 2BTRA 2YM7A 1KE9A 3DAJA 3P5KA 3CPCA 3EH9A 4G16A 2IVTA 3TNIA 5FUTA 3A4PA 3NRMA 3RPRA 1F0QA 4FVQA 2QOBA 4ZEGA 3KCKA 4MD8E 4E3CA 4ZZMA 4DT9A 3SOCA 1YOLA 3GCQA 3KXHA 2YZLA 3F3ZA 3UZRA 4OT6A 4CQEA 1LUFA 4DFZE 3MDYA 5A9UA 2C6IA 3QA8A 5HICA 4ANMA 5GZAA 5L6PA 3CBLA 2P3GX 3OW4A 3U6IA 1M7QA 4NH1A 1A06A 5IH6A 3LFAA 5HX6A 3WOWA 4ACGA 1KV1A 3QC4A 4FNXA 4HOKA 3KRRA 4P5QA 3F3VA 3O51A 2W1ZA 2XK4A 3ZS5A 3BEGA 4IZAA 2XIYA 5E4HA 4DFBA 3QTSA 4QP8A 3HUBA 2UW6A 3VS1A 4U6RA 4KD1A 5C9CA 2BKZA 5C4LA 2ACXA 2W1FA 4DC2A 4FODA 4MHAA 3QA0A 4D28A 5C01A 5EW8A 4BWXA 1HOWA 3CY2A 3NIZA 2QO2A 2YM3A 4FV3A 4RIYA 4X2FA 3IDCA 3RJCA 5I9UA 2OGVA 5FEDA 3TT0A 2Y7JA 4AP7A 5J95A 4CEGA 4DBNA 4RA5A 3D94A 3ZC5A 3VUMA 4W4YA 4ZJIA 4O81A 4CKJA 5EOLA 4DEHA 4OTGA 3R73A 2QO7A 4ZTRA 4AX8A 1XH5A 2YWPA 3D7TB 4U3ZA 4HZSA 3R9OA 4RX7A 4U43A 5IA5A 1IEPA 2YERA 3OUNB 5IPJA 3A60A 4FNZA 1ZYLA 4OLIA 4Q9SA 3V5QA 3MIYA 5HTIA 3Q5IA 4HCUA 4BI0A 1XWSA 5JZJA 2FH9A 4FL1A 1JNKA 5B2KA 3BZ3A 4K2RA 2ETMA 1OVEA 3QD3A 4JNWA 5IISA 1J1BA 4BB4A 3R7IA 3R21A 4YJTA 3UOKA 2XBAA 5CNNA 4WBBB 3RZFA 4A4LA 2HOGA 2ERKA 2LGCA 1O6YA 4XLIA 5AP7A 3G9NA 2WQMA 5AV0A 5J1VA 3C4WA 4O7SA 3P9JA 5HTCA 3QZGA 1F5QA 2PE1A 1AD5A 3RPSA 3EZRA 4BGHA 2B0QA 4FTRA 1PKDA 4BICA 3DB8A 4YC6A 3R6XA 1LPUA 4FSYA 4GKIA 2XRWA 2XH5A 2WFYA 4U79A 4NJ3A 3PXFA 4UV0A 5AUVA 3U6HA 4HNFA 3LLTA 4U97A 2AUHA 3BIZA 3TNHA 3EQDA 5AP2A 2W1DA 4J1RA 5HBHA 4LGDA 5HE2A 3LKMA 1GOLA 3NMUF 1EH4A 3MPMA 1UNHA 3ORPA 2YAAA 4P5ZA 4A9YA 2R4BA 3P23A 2GNIA 4O0SA 3BRBA 2PVLA 3E7VA 5CF8A 4RJ7A 4ZMFA 2XA4A 3MY1A 4JI9A 4LGHA 3WARA 4D5KA 3VJNA 3UJGA 3LVPA 2WZJA 4WNOA 3P79A 4ZP5A 4USEA 1Y8GA 3CS9A 3EJ1A 1BI8A 2CKEA 4KIOA 4WO5A 4RIWB 4J8MA 3DCVA 4MTAA 5LMBA 5I9ZA 4M7IA 1NW1A 1O6KA 4O7RA 3VQHA 3FMMA 4XMOA 4EHGA 3OXIA 2ITWA 5HQ0A 3TN8A 3UVPA 2JD5A 3OS3A 1Q61A 5I9XA 4MKCA 2VTAA 2BROA 4ZOGA 1BUHA 4LUEA 3RMFA 5BMSA 2PE2A 2OXXA 3RK7A 4FEQA 4PL4A 4HJOA 4AFEA 4NZWB 3SVVA 2GHMA 4MWIA 4TYJA 2QLQA 3Q96A 4GH2A 4QMMA 4D1SA 3VVHA 5FGKA 3L1SA 4C4JA 3DK6A 2WEVA 4BGGA 3OEFX 3R02A 4IAZA 2X9FA 5CF5A 4EH9A 1JKKA 3DKGA 4QYYA 3OTVA 4UB7A 3VUGA 3QKKA 3R8UA 4YURA 3GOPA 3KULB 4QMTA 2JFLA 4LL0A 4C61A 5D9HA 2XBJA 3HMPA 3RINA 5IKWA 4J53A 2X8IA 2PUPA 4K0YA 2GFCA 4AU8A 2PYWA 5A54A 3EYGA 4ZJJA 3BWJA 3G2FA 3PP0A 4E8AA 2UZLA 3PLSA 4ID7A 2VUWA 4FIEA 2EXEA 2OXYA 1WMKA 3RAHA 1PY5A 3PPKA 5BVNA 5IUGA 4EOSA 5DR9A 4FTAA 3TV6A 4BTMA 3UC4A 5BYYA 2Y4IB 3QHWA 2YM8A 3OUKA 5BQ0A 3KRJA 5FDPA 4HVHA 4FZAB 4FT0A 5HX8A 4JDIA 5LVMA 3CKXA 3TZ9A 4M84A 2UW4A 4RZVA 4ALWA 3G9LX 3UIXA 2C3JA 3FKOA 4I0RA 4ZLOA 1JLUE 3HDNA 3PA3A 4YPDA 4I94A 2IN6A 4FUXA 3DNDA 3TKHA 2B4SB 2FSTX 3COKA 5EHLA 1U54A 5GJGA 1JBPE 4RMZA 3EN5A 4QMSA 4QMLA 1FBNA 3FHIA 4G9RA 5D7VA 4GIIA 4GUBA 1UWJA 2YIRA 3DBQA 3PZEA 2WQEA 1Q3WA 2R7BA 2CKOA 3BGZA 3BHVA 2CDZA 1ZMWA 3HGKA 2ZMCA 3EL8A 3POZA 3DBEA 4IVBA 5GHVA 4GV1A 1CDKA 2WMQA 4EH2A 4EOOA 3ULIA 3THBA 5EYCA 3OT8A 4JVGA 3RZBA 1PYEA 2AC5A 3QCSA 2PTKA 3IDPA 4CZYB 2CN8A 3GC9A 3R9HA 3FI2A 3RM7A 3BU5A 4FEUA 4FTTA 4C3RA 3QQFA 3G51A 4GFMA 2XKFA 4L53A 3BYVA 3NWWA 2YIXA 3O8UA 3ZBFA 3MVJA 2UV2A 2JIUA 1M17A 4B7TA 2RFDA 4NU1A 4QMOA 3FV8A 2X4ZA 4CSVA 5L6OA 4FV2A 3VO3A 2BAQA 4WNPA 3RAKA 4FC0A 5FDXA 2ZDTA 5JQ5A 2ITVA 4UMRA 4LUDA 3UC3A 3NVMB 1URWA 2J90A 4FTUA 5AJQA 2O0UA 3HV7A 4NTTA 4BCKA 3I1AA 4UZHA 3RGFA 5K0KA 2B9JA 4M12A 4KRDA 2EB2A 3AQVA 3GC7A 3MB6A 3VS0A 4A07A 2X6DA 4DE4A 3HP5A 3A8WA 5FTGA 2W17A 3IDBA 2UVYA 4BI1A 2ZB0A 4GT3A 4YTCA 2I0VA 4UN0C 4H36A 4DEGA 4C2VA 1OKWA 4FEVA 4QNYA 4DFLA 3SX9A 1FQ1B 1M2QA 3ORIA 3PIYA 4CFUA 5LVPA 2GQGA 5TKDA 4BDDA 2XCKA 2O64A 5ACBC 2C0TA 1MRYA 4GVAA 3MIAA 4XX9A 1YI6A 4I6FA 4FSMA 5HCXA 3DBFA 2IW8A 4PP9A 4RSSA 3NNUA 4RA4A 3QKMA 2ETKA 4MXZA 1U46A 4W4VA 3RALA 5JK3A 4RJ6A 4IM2A 4NSTA 4EUTA 3AC2A 2OLCA 3VBYA 4U9AA 3TZMA 3BHYA 2WTWA 5D12A 3H10A 1E1XA 4A06A 4BBFA 4C7TA 3RKBA 3SAYA 2C5VA 4PMTA 2HZIA 4U5JA 5L2WA 4IWDA 4BC6A 5E1EA 5M56A 3IW4A 3UZTA 3VS4A 4DT8A 4UYAA 3R8LA 4C8BA 1J91A 3ZFXA 3IGGA 1ZOEA 4M15A 2QLUA 4OBQA 2C68A 4FKOA 4PDOA 4ZK5A 1H1SA 3A7FA 2ZV9A 2BRGA 3R8VA 3T9TA 5TF9A 2UW9A 3LW0A 1FVRA 3Q9XA 4U40A 3VRZA 5JRSA 3VUKA 4GIHA 3CCNA 2BUJA 5L3AA 4MWHA 3VBTA 4B0GA 3UO6A 4D4YA 3FZ1A 5M4CA 1IA9A 3R7EA 4WRGA 4C3FA 2PVNA 4UALA 2YITA 5ANOA 5AAFA 3G90X 4XG8A 2AC3A 1FPUA 4MK0A 2XK8A 4YSMA 3VULA 3Q6WA 5ETCA 4JDKA 5DMZA 3BHTA 4GUEA 3V5TA 2GHGA 4F99A 4RWKA 1BL6A 2BFXA 3R2BA 1Q62A 2JDSA 3ZO3A 1TQPA 1P2AA 3KY2A 2H96A 3V8TA 1DI9A 2Q0NA 3A62A 3U4UA 5I4NA 2UZVA 4TZRA 2UW8A 4BI2A 3REPA 2J51A 3CXWA 4ONAA 4QPAA 4APPA 2YA9A 3HV5A 4R1VA 4DG0E 2QOQA 3VUTA 2F2UA 3P0MA 4BCOA 1B6CB 2PMLX 4QQCA 2OG8A 4I4EA 5HEZA 4RJ3A 4WG3A 2OZOA 4DGOA 2IW6A 4LGGA 4Y83A 3RP9A 4OTQA 3DU8A 2C3IB 3LFDA 1XH6A 4L9IA 3KXXA 2JEDA 2XNPA 3H3CA 2QHMA 3UDBA 2W9FB 4PPAA 2WMXA 3ZEWA 4IX3A 4YHTA 5EM7A 3UQGA 4HVSA 2XB7A 2JKMA 3E63A 3G5DA 1WBNA 1UNGA 3ZLYA 3NAXA 1IG1A 3NPCA 4ITJA 4O0WA 4GKHA 1NVQA 5TOZA 1WVYA 5L4QA 4JJRA 3G33A 4QMUA 4FV0A 3UMXA 3VWAA 5FXRA 5CEQA 1J7IA 3VC4A 3DAKA 4BCGA 3Q6UA 2X2MA 5DRDA 1PMVA 3BELA 3HRBA 3R1YA 5BVKA 4GFOA 4F63A 3EQIA 1Q4LA 5JEBA 5LWMA 4LMNA 3TDVA 4AT3A 3TXOA 4NUSA 3D7TA 3GB2A 4A4OA 3EL7A 2BHHA 2WO6A 5HNBA 5L2TA 5ANJA 1CKIA 3UODA 2ZDUA 5A14A 2ZMDA 5C27A 4J7BA 3D5WA 3HVCA 4D2PA 4WT6A 4I5HA 2IJMA 3VN9A 4WHZA 4RG0A 2ERZE 4CNHA 5H8EA 3IW5A 3PXQA 5B0XA 1KWPA 4QYHA 5E8WA 4L45A 4R1YA 4C59A 5CZHA 4P4CA 3T3UA 4BDJA 1KOAA 5CASA 3FQEA 4L46A 1OECA 4YZCA 4D2VA 3HMIA 4BWPA 1PXIA 3CTJA 3MTLA 4JG8A 4PRJA 2PPQA 1UA2A 3U87A 2V22A 5DG5A 2VTSA 2A2AA 5HE0A 3QD0A 5IA3A 3MFTA 1G8SA 4W4XA 1YVJA 2YJRA 4OTHA 5HOAA 3ZFMA 3FC1X 3MH2A 5HG5A 4EYJA 4H1MA 5AX9A 1ZY4A 2C3LA 4LRMA 1H25A 4PTEA 3TEIA 4YJVA 4YC3A 3G6HA 1GY3A 4ZJVA 2W9ZB 4PNIA 3A8XA 4IWOA 3UOHA 2KULA 2R0IA 4GMYA 4AA4A 4Z7HA 4WBOA 5M53A 4O7NA 4CRLA 4QO9A 1XO2B 5AR7A 4K6ZA 5AV3A 4V04A 3QU0A 5EI6A 4MAOA 3F5PA 4L68A 3VUIA 3VHKA 4ANQA 5LARA 3LJ1A 1GZNA 3AC5A 4ANLA 3KMUA 3NUXA 2RG6A 5CF4A 2WGJA 5A6NA 4GJ2A 4L8MA 3RM6A 5BPYA 4NIFB 4PDPA 2QKWB 3LPBA 1Q5KA 1W8CA 2P55A 4EWQA 3ORTA 5CX9A 5CAVA 1AQ1A 2OZAB 3DPKA 5DR2A 4DLIA 2GU8A 3C50A 5IEXA 3BGQA 4FK6A 2P0CA 4FVRA 4ZZOA 1WFCA 5HLNA 1R0EA 3U4WA 1H1QA 4JL9A 3DFAA 4IJ9A 5DBXA 3EFKA 1RDQE 4TNDA 4QTDA 3RWQA 1IRKA 3OY1A 2QG5A 2PUNA 4YJQA 1STCE 2C6MA 1ZOGA 3RAIA 2OW3A 1JWHA 1Q8UA 3TUCA 1KE5A 5CTPA 3UNZA 1YDTE 4M66A 4BIDA 1QPDA 4N6ZA 2IZTA 4X2GA 3R8ZA 3EN9A 5E8TA 4XG6A 5KZIA 5HTBA 3ITZA 3OT3A 5EM6A 1G8AA 2X1NA 2XKCA 4XP2A 3SC1A 3KULA 3BEAA 1APME 4J71A 1IAHA 2WOUA 2XNGA 3OMVA 3PJ3A 4O27B 5CVGA 5HKMA 3ZMMA 5JQ8A 1B38A 2JDRA 4I21A 5M51A 5F95A 4AZEA 2YISA 3KC3A 2PY3A 4RZWA 4XRJA 1H27A 2CNUA 5HCZA 2UZEA 4FTIA 3ALOA 4XV9A 5F1ZA 3GU6A 3B8RA 4FL2A 1H0WA 5DOSA 4DH5A 1I09A 4DCAA 3CGFA 3WYYA 3WF8A 1E1VA 4BCHA 3QTWA 2YCFA 4BY9E 3P7CA 4MD7E 4AS0A 5HORA 4IAAA 3QUPA 3UBDA 2QOFA 3V51A 4UZDA 1YQJA 2QU6A 2HELA 2BRNA 3Q9WA 4XV3A 3UG1A 4RLLA 3I60A 3O71A 2I7QA 5E8VA 3HECA 4AF3A 3SG8A 3DS6A 5DHJA 4I5PA 3LFCA 3MJ1A 4YC8A 3I0QA 4RVTA 3U51A 3FLQA 1DAWA 3EQBA 5J87A 2KTYA 2OJFE 3DTCA 2XUUA 1KE6A 4JOAA 4RBLA 1W82A 3QHRA 5FM3A 2GS6A 3FAAA 4DH8A 2WQOA 1H08A 3FDNA 4M8TA 3HV4A 3HZTA 4C4FA 2EXCX 2Z2WA 3CD3A 3OW3A 4YP8A 2YM4A 3PWYA 4WOVA 4RX8A 3SGCA 3E8DA 4IZ5A 3CKWA 4L67A 4YTHA 2X8DA 3E8CA 3ORMA 1H07A 3S95A 5G6VA 4AOIA 3KU2A 1BYGA 4EZ3A 3FMHA 4DTKA 5CVHA 3KVWA 4U8ZA 2HW6A 3RCJA 3OCBA 4DLJA 2UUEA 3U9CA 3CSVA 4F6UA 3ZO4A 4LRKA 1RJBA 1PRYA 2H9VA 4DN5A 1SM2A 4FBXA 2JAMA 2XNBA 4HYHA 2IZRA 3KREA 3G0FA 3SW7A 3KN5A 4CMTA 5HNIX 2J9MA 5J5TA 5HIEA 5KO1A 4BL1A 3KMMA 5CEKA 3N51A 5HHWA 1PHKA 3D9VA 4AW2A 4IB5A 4GVJA 3A7GA 2F7ZE 2YHVA 3F66A 2Y6MA 2XNEA 3AD5A 3OBGA 4GU9A 4IB1A 4WNMA 2BILB 4ZTSA 4DH3A 2WMAA 3DV3A 2VD5A 5IQFA 4E7WA 3BLQA 4QQJA 1VYWA 4C0TA 5L8KA 3PYYA 4NL0A 3QQHA 5CSWA 5EH0A 4JG6A 4IC8A 4PPBA 3QQGA 4NW5A 3ZC6A 4IB3A 4C02A 1Y91A 4F9YA 3Q5ZA 5EQYA 3IW8A 2UW7A 2PK9A 3CC6A 3QQLA 5EDPA 2BKKA 3GCSA 4U3YA 4D2WA 2PVRA 3PWDA 5DI1A 3BQCA 2HYYA 4L42A 4RPVA 4GEOA 4CXAA 1CKJA 2C6TA 3PA5A 5CZIA 5HG8A 5TO8A 3ZUUA 3C1XA 4KKEA 4U80A 4BDBA 4YNOA 5FQDC 2OK1A 5KCVA 4HVIA 4AE6A 5IH5A 5CU3A 5IMEA 5FP6A 2RFEA 2YM5A 3Q53A 1ND4A 1JOWB 3FLSA 3OCGA 3NYNA 4EQCA 1NT2A 4QP6A 4RX5A 3DB6A 4FICA 3I0OA 3LE6A 4FK3A 5AUWA 2H34A 3NAYA 4JBOA 3D2IA 4NM7A 3QCXA 1IASA 2C6DA 2HIWA 4GSBA 5G1XA 5H8BA 3IQ7A 2J6MA 4EBWA 3UO5A 4G3GA 3GFEA 2BDFA 3ANQA 3ZSGA 4IAIA 3II5A 2ZYBA 3QCYA 4H39A 3R7UA 3B2WA 4CFXA 4F1OA 3ALNA 4UEUA 4J97A 2P33A 1XKKA 2GFSA 3PXZA 2W1GA 3A2CA 3IECA 1R1WA 3IO7A 3JY9A 4FGBA 3UYSA 4AQCA 4E5AX 3UNKA 3ZLXA 3HA6A 2VWXA 4KNBA 2E9PA 4ZSJA 4AZTA 2J5FA 5LMKA 3DXQA 1NY3A 2R3RA 4ZTNA 2JDOA 3GU8A 1V1KA 5HD7A 3SLSA 4KA3A 2BRHA 2OBJA 3AD4A 1ZXEA 3DXNA 4S32A 4BIEA 3KRLA 2PUUA 4ZSGA 2JKKA 1JSTA 5HNGA 3V8WA 2WTCA 3R7VA 4QMYA 3LMGA 2VTHA 4FZFB 4X3FB 4E20A 5LCJA 3OD6X 2CJMA 3CJGA 4YJSA 5KX8A 1P4OA 5CXHA 4XLVA 2PVKA 3NYOA 3ORNA 4F7NA 4AT5A 1OUKA 3WZUA 4JR3A 4YTIA 2HK5A 3H4JA 2VTIA 4G2FA 4I1ZA 4RX9A 5TR6A 3GC8A 2R3HA 3MTFA 2QHNA 1Q41A 4YR8A 3ZZWA 1YKRA 3NUUA 4IIRA 3BV3A 4NCTA 2VTPA 4FV6A 5LJJA 3BU3A 4XG7A 3SXRA 3OCSA 4IHPA 5FBOA 3LXKA 4MYGA 4B9DA 1OM1A 1IAJA 5AR2A 4J98A 4LL5A 3OHTA 4MEDA 5EHOA 5AP0A 2XVDA 3GQIA 4O0RA 2OIQA 3KF7A 1SVGA 2X81A 5AA9A 3L9PA 3FL5A 1TQIA 2F4JA 4FKLA 2VWWA 2YJSA 2CGUA 2XYUA 3DJ5A 4MXYA 1ZZLA 4BVUA 2PZRA 4RWJA 5ETAA 2OU7A 4FKSA 1OMWA 2HWOA 2GTMA 3O17A 3QRJA 4H3BA 4X21A 4YO4A 3RTPA 3FZPA 2BAKA 2J7TA 5FD2A 4UBAA 4JX7A 4R3PA 3CTQA 3AOXA 2H8HA 2XZSA 4WSYA 3ZUVA 1OL7A 4GJ3A 4O7VA 1ZYCA 3A4OX 4ASEA 5AP6A 4FOBA 1JSUA 4KUJA 3V8SA 4CT2A 5K5NA 2WPAA 5CAOA 4RGJA 4EK5A 3EZVA 3Q04A 3TI1A 3BYMA 4JLCA 5AUXA 4AFJA 4ZXTA 4JT3A 4BRXA 2PMIA 3R0TA 3GENA 1O6LA 4MX9A 2WMSA 3RWPA 4GG5A 2Z02A 3R7GA 3GXLA 3QD4A 1OIQA 2R3JA 2YDIA 2DWBA 2G9XA 2I0EA 4F1MA 3N4UA 2IVSA 3FPMA 3NLBA 3BV2A 2OKRA 2Z8CA 3QX2A 2GNLA 5K4IA 4FZDB 1M14A 4NYEA 3PE2A 2WIPA 3D5VA 4XBUA 4O1PA 3OOMA 1OPKA 5L6WL 4CG8A 3FKLA 4JDJA 3ZXTA 3LFNA 3CD8A 3W16A 4MQ2A 1GAGA 2J0MB 3PUPA 3VBVA 1WAKA 3JY0A 5K9IA 3A7JA 4RJ5A 3OCTA 5EFQA 4C62A 4FT5A 3ORLA 4J96A 4G5PA 2WTKC 1ZY5A 1NVRA 2B9HA 2C1BA 2FGIA 4XV1A 1OL2A 1VR2A 3VBQA 3MV5A 4IZYA 2PSQA 4XV2A 4FIFA 5HESA 5HI2A 4EQUA 4PTGA 4FI1A 4RRVA 4ZTQA 4I5MA 4PQNA 3V01A 3R00A 3R2YA 2ITXA 2G1TA 1XBBA 3W32A 1PF8A 2EXMA 3CPBA 2JBOA 3F3UA 4MBLA 4RC4A 3UYTA 4NIFA 2VO6A 2JBPA 2W4JA 4IM3A 4X0MA 3ZONA 3OWLA 3F7ZA 4BKYA 4HYUA 1H24A 4FF8A 4NJDA 2OZAA 2O5KA 1P5EA 4X2NA 4BTFA 2W5HA 3AC3A 3FMNA 2UZWE 3RBWA 2QU5A 4O0UA 3SXSA 2C6LA 4N6YA 2UZDA 3Q52A 2C30A 4OBPA 3WF6A 4TYHB 4S30A 3QUDA 2VWYA 4FTMA 4UMUA 1A48A 2C0OA 5EK7A 4W9WA 3PPJA 3P08A 2W1IA 3WYXA 4FV7A 4O86A 4EOLA 2IVUA 2UVZA 2WEIA 2BIKB 2YN8A 3JVSA 3MPAA 2X4FA 3MJ2A 4HZRA 4NM3A 4W4WA 4E5BA 1YI4A 5CF6A 4F9WA 4G3EA 4YNEA 4D0XA 4EH8A 5F9EA 4CKIA 4QMQA 2PU8A 4PV0A 5BVOA 2JKQA 4NFNA 1DS5A 4QP9A 4EH4A 4TKSA 5CVFA 4AZWA 2Z7LA 3F82A 3ZFYA 3MB7A 4G31A 3OWPA 4R3CA 4AUAA 4RQKA 3DNEA 3TIZA 4YJRA 4E26A 5E1SA 3DAEA 2XNNA 2UW0A 3PP1A 2WXVA 4HGSA 4RIXB 4RVLA 1Z5MA 2J0KA 4H58A 1JKTA 2EU9A 2VWBA 4OTWA 4S31A 1R39A 2R2PA 1H1RA 1UV5A 2XKDA 1S9IA 2WD1A 4IW0A 4MXAA 4UXQA 5JRQA 5EQPA 2SRCA 2J0IA 3BX5A 4XG3A 3L8VA 5E8ZA 1G5SA 3GQLA 3G6GA 4I6HA 3TUDA 4TWCA 2VWIA 3NW6A 3WZKA 4ALVA 4FE2A 3QFVA 4X6QC 3ZDUA 3SKCA 1XQZA 1ZAOA 4RWLA 2IWIA 2B7AA 4G6NA 4ANSA 4ASZA 2VTTA 4KS7A 2ITUA 3VS5A 2XEYA 4IAKA 1WVXA 2JDTA 3EYHA 3K5VA 4QYFA 4HW7A 4DBXA 3PJ8A 5HG9A 4ERWA 3DK7A 1FMKA 2HAKA 3FXXA 3AMBA 4ZTHA 3W2QA 2B52A 4FIHA 4MQ1A 3GC0A 4GK2A 1GZ8A 4IACA 2CMWA 3KRWA 1H00A 2VU3A 3PJCA 4PMPA 2B53A 5CU0A 3DOGA 3AT2A 2J5EA 4I93A 2ZM1A 4QTCA 5EI2A 3UPZA 4FIGA 2VN9A 2WTIA 5JKGA 5I3RA 3BHUA 4PDSA 4XG2A 2X8EA 4HPTE 2CGWA 5M57A 2ESMA 2REIA 3CEKA 4FG8A 5KMNA 3JYAA 2JLDA 3PXRA 3PRIA 5DYJA 3VQUA 2BVAA 3GCVA 2VGOA 1LEWA 3IOKA 3R22A 4A9TA 4IQ6A 4EBVA 5KHWA 5JMSA 1OBGA 1W0XC 2YDJA 4K9YA 4RFMA 5AUUA 2J2IB 4MXXA 2UW5A 2IZSA 5J5SA 1F3MC 3FPQA 4Q2AA 2C69A 3PXKA 4QOXA 4LRJA 4APCA 5BUJA 5HZNA 5JH6A 4YJNA 3D2KA 5BVDA 3CQUA 3FY2A 3TNPC 4JR7A 4M0YA 4CRSA 2Z7SA 3Q9YA 3QAME 4ZLYA 3UIMA 4HVDA 3TNQB 2Y6OA 3LFEA 4N57A 3PSBA 3FSFA 4JQ7A 4AOTA 3KXMA 3VIDA 4GT5A 3M2WA 3A99A 3V5PA 3NZ0A 5B2LA 3DLSA 1VEBA 3GGFA 4K77A 4DEBA 3DLZA 3E5AA 4OTRA 3NS9A 3BLHA 5BMMA 2O65A 1OKVA 5EM5A 4FV5A 2IVVA 2ZM3A 3UVRA 3NSZA 3O7LB 2FYSA 5AP4A 4HNIA 4QQTA 4AACA 2XIRA 3OP5A 3LXLA 2XIZA 5HU3A 2VTNA 2ZV7A 4C3PA 2R3GA 5HG7A 3KF4A 1QCFA 3BE2A 3OROA 4E4NA 3D15A 4RVMA 4TN6A 4FKRA 2HXQA 5DT0A 3PIXA 2V55A 3RPVA 3C7QA 3W10A 5IZFA 3DJ6A 2YIYA 4QYGA 3HAVA 3F3TA 5DFPA 4YZNA 5KMKA 3NUSA 2EB3A 1PMEA 3BBWA 1WBVA 3KGAA 2A27A 1PJKA 1YI3A 3QTQA 3KFAA 4KIKB 4XH6A 1CTPE 4I92A 1OIRA 3RPOA 3HLLA 4I3ZA 4D4RA 4EK4A 2P2HA 5CS6A 1ZZ2A 2WMBA 4ZSEA 5LVNA 3OG7A 3UVQA 3V6RA 1WZYA 3L9LA 4S33A 4CV9A 2BR1A 4GCJA 1JSVA 2HZNA 4KSPA 5E90A 3S2PA 3WE8A 3ZM4A 4PNKA 5GZ8A 4OAVB 5AV1A 5AUZA 1Z9XA 3HMMA 3RI1A 4IAYA 1WBOA 2WU7A 1Q3DA 4G17A 5M4UA 2VWZA 4D2RA 3ENMA 3CGOA 3R01A 3ROYA 1I44A 4AGWA 2Y4IC 3HMOA 1YWNA 4CV8A 2OH0E 2X2KA 1M2RA 5JGBA 1PMUA 2XK9A 4UWYA 4BZOA 3DT1A 2GQRA 5IQHA 3O96A 5LVLA 5CAUA 5AAEA 2UZUE 5D41A 4ERKA 5LXMA 5D1JA 3ROCA 4Y46A 3RCDA 4C34A 1GNGA 3EQPA 4FTCA 4HGEA 5GIPE 2PVJA 3ZZEA 2GNHA 5CSVA 4F9BA 4ACCA 2PULA 3F9NA 1T46A 4HYSA 2BDWA 2XYNA 4X3FA 5FG8A 5AFVA 2W0JA 2R3FA 2WB8A 2YDKA 3E92A 4LYNA 5E7RA 4WRSA 3L8SA 3LAUA 4XHKB 3M1SA 4M13A 4R3RA 4ENXA 5HLPA 3RPYA 1XJDA 2BHEA 2YIWA 1J1CA 4H1JA 4QP1A 4ACMA 3N4VA 4IEBA 3T3VA 4R7IA 4KSQA 4ZSAA 4RT7A 5E8SA 1YXXA 2O8YA 2JIIA 3GNIB 5EM8A 4KS8A 3ATTA 5CSHA 1XH8A 3FLZA 1BI7A 3P1AA 4JRVA 5E8UA 4IDVA 4IVCA 2PVFA 3DGKA 4FKVA 4PPCA 4TWPA 4FEWA 3CP9A 1Q8YA 2YM6A 4OT5A 5EQEA 3ZTXA 4AN2A 5BNJA 4S34A 3MVLA 4B8MA 1JPAA 1YOJA 3K5UA 4FKQA 3EQGA 4C38A 5JN2A 2W99B 3HRCA 4YLJA 4EH5A 3WZDA 1W98A 2CNVA 2WKMA 3IK3A 4D2TA 5H3QA 5IEVA 1NVSA 5KKRB 1YW2A 3QYWA 1OL5A 3COIA 3UOLA 1ZMVA 3HKOA 4TNBA 4YZMA 4BHNA 3C0IA 2PZPA 1ZYJA 3MY0A 4DINA 3PTGA 4AAAA 4FYNA 4ALUA 4ASDA 4EH7A 4ASXA 2PZ5A 5IA4A 4R77A 1U59A 3PG3A 2QNJA 2V7AA 3JVRA 4GT4A 2FO0A 3BCEA 4Q9ZA 3GVUA 2E2BA 3QX4A 3LXPA 1SMHA 4AOJA 2XK3A 3H0ZA 3HP2A 3QZIA 4EYMA 2C1AA 1REKA 4IWPA 3ODZX 5CI6A 4O38A 5DN3A 1G3NA 1R0PA 4W8DA 4CFFA 5JT2A 5JGAA 4F6WA 1Y6AA 3TNWA 3LCDA 4JRNA 4F09A 4EQMA 4F0GA 2WAJA 1PXKA 3MVHA 4R8QA 4NFMA 5M44A 3PFQA 3QRKA 2FB8A 3QWKA 2J50A 3LHJA 2VO3A 3TTJA 4L52A 3VNTA 3R1QA 3U9NA 4J8NA 3MY5A 1JQHA 1M7NA 1S9JA 3QTZA 4Y5QA 5ETIA 3VS2A 3MFUA 4B99A 4FV1A 2P4IA 3PVWA 4IX4A 4OTDA 4ZS0A 2R3OA 2QI8A 4FSUA 4AA5A 3HL7A 4BF2A 2VTOA 4BCFA 4E6AA 4I24A 2BRMA 5L2QA 5C8NA 3R8MA 3FYKX 3BGPA 3R9RA 3C51A 4N0SA 3AT3A 3IOPA 3G0EA 4QPSA 4IBMA 4FX3A 2VWVA 3V5LA 4O83A 1UU9A 2JIVA 3GOKA 4WUAA 3WF9A 2Q0BA 1V0PA 2F57A 2UVXA 4X2KA 3UMWA 5LWNA 5AR5A 3GU5A 1U5RA 4LOOA 4BCIA 4O2ZA 3QQJA 3QRIA 4C2WA 1QPJA 3DFCB 4ITIA 1TKIA 3K54A 4FNWA 4TT7A 3SV0A 5BYLA 3ZSHA 3ACKA 4RIWA 4I4FA 2HY81 4RWIA 4IZ7A 5LMKC 5DEYA 3KCFA 2JC6A 1VJYA 2EVAA 4BZDA 4U45A 4AXAA 4YSJA 4DGMA 3TZ8A 5FEEA 5HE3A 4TY1A 4C37A 1JKLA 5I9YA 1MQBA 2OFUA 1OL1A 5A4LA 2B9IA 4E4LA 3RNYA 4XYFA 1PXJA 1V0OA 2XK6A 3MBLA 3PA4A 4AWIA 4O6LA 4EWHA 2OJIA 4TYHA 4Z16A 3OTUA 2C5YA 3E62A 4KABA 2WMVA 4QMNA 3R9NA 4FKJA 4Q5EA 3COMA 5LCKA 5HCYA 5A4TA 2C3KA 4EOQA 1WBWA 2OF2A 3R28A 2HENA 4USDA 3ZO1A 4FSWA 4E5WA 5J9LA 3I81A 4GK4A 1REJA 5FBNC 3AGLA 3QQUA 2A19B 4NCTC 1XH9A 3EQCA 5DR6A 3ET7A 4EL9A 4GU6A 3PJ1A 2CSNA 3MVMA 2V62A 3R71A 4YJUA 5ITAA 3D4QA 3CIKA 3FI3A 1PXLA 1Y57A 2WMTA 2Y0AA 1LP4A 3E8NA 3DKOA 3PE1A 4RIXA 5EW9A 2O2UA 4K33A 4U42A 4EK3A 4EORA 1BMKA 5T3QA 5ANIA 3D5UA 3V5JA 5T6KA 5EDRA 1SZMA 4IE9A 3NCGA 3ATSA 4E73A 5CEMA 2BZJA 5GZ9A 4MVFA 3B8QA 4DHFA 3R83A 2ITQA 2CGVA 1QL6A 2RIOA 1YWVA 4O0YA 3QD2B 5FP5A 4O84A 3O23A 3NDMA 3N4TA 1H8FA 1Q97A 4I5CA 2YIQA 3IPHA 4EH6A 1WVWA 4PY1A 3UIBA 4YU2A 2NNWB 3CE3A 4FSRA 4QTAA 3VUHA 3BE9A 3WF7A 5CSPA 4BCPA 4FG9A 1BL7A 4L6QA 3TKUA 5HIBA 2E9OA 5ACKA 3E93A 4F9AA 1MP8A 4DGLC 4BTKA 2R64A 3SQQA 4F0FA 5H8GA 2RG5A 4F6SA 3TDWA 2VGPA 4O7YA 1ZYDA 4D9TA 4F7SA 2PVYA 2XM8A 1FMOE 5CWZA 1RQQA 1Y6BA 3KRXA 4UWBA 4C58A 5J9ZA 2UW3A 3AC1A 2PVHA 3NNVA 2VTQA 4PDYA 3OXZA 5L2SA 3RAWA 4BCJA 3QCQA 3FZTA 3I7BA 4USFA 3I5ZA 4A9UA 3D83A 2OJJA 2EWAA 2OI4X 3LCKA 3FXZA 4D1ZA 5AIRA 3NYXA 4C4HA 2A0CX 4EHZA 1XHAA 3DY7A 3O8PA 5E92A 2QOCA 3WZJA 4ACHA 3COHA 3O50A 1YHVA 5AMNA 2QQ7A 3QGYA 4L7FA 5CANA 3PY0A 4L01A 5C26A 2CLXA 1LR4A 5FWKK 4O7LA 1UKHA 2RGPA 3KB7A 2YAKA 2FUMA 4JXFA 4IWQA 1Q8WA 3TJCA 4A7CA 5J9YA 2VAGA 3KEXA 5JZNA 2W1EA 3EKKA 5ANDA 2C5XA 3EQHA 4L43A 2DQ7X 5CT7A 1M2PA 1MRUA 1YDRE 2Z60A 1YDSE 3ZHPC 4YMJA 2YCQA 4G6OA 4G3CA 1OITA 3FMEA 3M42A 2CNQA 1GJOA 5AIKA 3LFSA 4TYEA 3UGCA 4KWPA 3QL8A 2ETRA 2QONA 3LM0A 5HVYA 1XBAA 3PSCA 1ZLTA 3NR9A 1KUTA 3C0HA 3T8OA 5HD4A 3FMLA 4EJ7A 5AX3A 1YXUA 4QT1A 1KOBA 4DYMA 3ZU7A 4MNEB 5AM7A 2XRUA 4Q5HA 2WELA 2X0GA 3QGWA 2AYPA 4OW8A 3TL8A 1URCA 2F2CB 2X6EA 3PDTA 4FOCA 5A4EA 2F9GA 2GNJA 1P4FA 2BMCA 3HRFA 4C57A 1PW2A 2C5NA 4D4SA 1GIJA 2YLFA 3UZPA 5HO7A 3G15A 3F6XA 3LCOA 3BYUA 3QBNA 2ITPA 3MH1A 3TV7A 1U4DA 1MUOA 5FEQA 4DEDA 5KBRA 2OF4A 4F9CA 3GI3A 2CN5A 5CI7A 1U5QA 3KXGA 4EH3A 1KE8A 2W1CA 3L8XA 5BVWA 3WZEA 4QNAA 5K4JA 4FKUA 2OJGA 4QP7A 1GZKA 2FVDA 3QQKA 2RL5A 3Q60A 4CFMA 4DFYA 4CKRA 4WKQA 4HYIA 2G2FA 3ORZA 4CFWA 2B1PA 3UG2A 1OBDA 4FG7A 3RNIA 4PX6A 2ITZA 3I7CA 3JR1A 3AC8A 2I40A 4RLKA 4BZNA 4EC9A 1J7UA 2HY0A 4GYGA 4BR3A 4YTFA 5CAQA 3BKBA 3OXTA 4A9SA 3AGMA 4HGTA 1B39A 4UYNA 4FMQA 1OGUA 4FA2A 3IKAA 4FTOA 5FTOA 4DFNA 3I79A 3POOA 3JUHA 4FTKA 4X6RA 5M55A 1ERKA 3PXYA 4AGDA 4WG4A 5HIDA 5M4IA 3DXPA 3AMAA 2PE0A 3U55A 4O0VA 2NPQA 3OVVA 4OR5A 4L3LA 3CLYA 3K3JA 4V0GB 3FI8A 4F7JA 4BDIA 4CCUA 4FT3A 4Z9LA 4GW8A 1SNUA 3DDPA 3EFLA 4QMPA 3WIKA 4IH8A 5ICPA 5EDQA 5AV4A 3BPRA 4ZZNA 4II5A 3F69A 3R1SA 4F08A 4U7ZA 4ARKA 4Y8DA 3UE4A 3NEWA 2CLQA 4EZ5A 5L8LA 4AW5A 1KV2A 5FRIA 4AZSA 2G15A 5IUHA 1OI9A 4JQ8A 4BGQA 5C8MA 5EKNA 2G2IA 5DVRA 5DT3A 3ZO2A 4U44A 4FKGA 2PL0A 3D14A 4BYIA 2R7IA 2C0IA 3EHAA 3VS6A 4CZUA 3L8PA 4DFXE 5KMLA 3GP0A 3VRYA 3Q3BA 3TWJA 2W96B 2OXDA 3MH0A 4K1BA 4RJ8A 2R3MA 4QP4A 3UO4A 3V3VA 5AR3A 4DTAA 2F49A 2RKUA 3C5IA 3FSKA 5HGIA 3RK9A 1Q24A 2W5BA 4ANNA 2YEXA 4XJ0A 5TE0A 3EMGA 3V6SA 3F5UA 3LFBA 4FSZA 5HE1A 5JFWA 4V01A 1OIUA 4O2PA 1YWRA 3H9OA 4QMZA 4O7ZA 1ZWSA 2R3LA 2X9EA 5B2MA 3DKFA 3RK5A 4K18A 4QYEA 5CSXA 3TKIA 1H1WA 4TYGA 4IJPA 4OAUC 2XF0A 1OKYA 4EK6A 4WG5A 3B2TA 4YJPA 4PTCA 3ZH8A 5AA8A 1JKSA 2I0YA 4CMOA 5AM6A 5IA0A 3KKVA 3HEGA 3UPXA 3W2SA 4EOKA 3BI6A 4FR4A 2OO8X 2X7OA 4FV4A 4KB8A 1H01A 4FTQA 5CNOA 5CU6A 3Q9ZA 3PZHA 4C33A 4LV8A 5DEWA 1H0VA 3KA0A 4KRCA 4AN9A 2BDJA 3CTHA 5KMJA 1CSNA 2VX0A 4O0TA 4FT7A 1JVPP 3P7BA 5HVKA 4L7SA 5BUEA 1FGKA 2R3NA 2BALA 1KSWA 2UZTA 5DGZA 3JS2A 2GDOA 4AGCA 3RHKA 4IVDA 3C4EA 4WIHA 2WNTA 2VO0A 4M68A 2ZV2A 5CEPA 1XH4A 3SD0A 3OEZA 3NUPA 4R78A 4YLLA 2R5TA 3E88A 4IANA 3KVXA 3FUPA 3MSSA 4YPSA 2YABA 5LOHA 4G5JA 1WBPA 3LQ3A 4AZFA 3VBXA 4K8AA 3P7AA 4BWKA 3BYOA 3R1NA 4M0ZA 5IH4A 4EKLA 4FKTA 2I0HA 4O7WA 3H30A 4EEVA 1UWHA 3HV6A 4OTFA 3LJ2A 2XJ0A 5KE0A 3LFQA 3EQFA 2P2IA 3LQ8A 4S2ZA 4I6BA 3PLAE 4RFZA 3GBZA 4Y72A 4JS8A 4DG2E 2J0JA 4IVAA 5AP1A 3HUCA 4OGRA 5GJFA 4B4LA 4L00A 4UX9A 2CKQA 4TPTA 1AGWA 3NUYA 2WMWA 2ZB1A 4FV9A 4V05A 4X3FC 3C4FA 3VUDA 5HLWA 3K3IA 1TVOA 3NX8A 5C4KA 5J8IA 2I1MA 2VRXA 4X3JA 5DPVA 5KZ0A 4DH7A 3CY3A 2UZOA 5CU2A 5F20A 3TACA 3HMNA 2FA2A 4YGAA 4ZLZA 2OSCA 1X8BA 3HNGA 4IX5A 5I9VA 2QKRA 2CGXA 2FSOX 4BN1A 4E6CA 2XJ1A 3H0YA 2WQNA 3MWUA 4I41A 4JQEA 5J79A 3P86A 2EUFB 1W83A 5EHYA 4NK9A 3MA6A 3NW5A 4KBCA 4C4IA 4UMPA 1ZMUA 4DGNA 4QD6A 4HCTA 2UZBA 4XG9A 4MCVA 2JKOA 4R5SA 5H9BA 5HO8A 5IQBA 5DE2A 3PIZA 1H26A 5AADA 4KAOA 3FYJX 4CVAA 4BCMA 4HVGA 4H05A 3WILA 1XH7A 3DZOA 5AUTA 4CMUA 4YJOA 3NCZA 2O63A 3PY3A 2UZNA 2VX1A 3EQRA 5E91A 5D10A 3KXNA 2A4LA 4NT4A 1ATPE 1YXSA 2WTDA 4F0IA 5BX0A 3ZXZA 2E9UA 2VNYA 3F2NA 4Y85A 4G3FA 3W8LA 5CLPA 4PUZA 3LFFA 4Y5HA 3VW8A 4FGRA 3VHEA 3IS5A 2WQBA 2CPKE 3AC4A 2C5OA 5AP3A 4BFMA 1JAMA 4FTNA 4I20A 5IQIA 3RVGA 1H4LA 4AE9A 3VS7A 1UU3A 5A4QA 4PL3A 4PL5A 2J4ZA 4PMSA 5T68A 4FNYA 3QF9A 5AUYA 5FLFA 4FSNA 2R3QA 4P90A 2JDVA 3HDMA 4FYOA 5I3OA 1CKPA 3BQRA 4KKHA 4ANOA 1HCKA 3GEQA 3A61A 3QLFA 2GMXA 3QXOA 4YHFA 2PZYA 1L3RE 5E9EA 4UWCA 4O7TA 2HZ4A 3O7LD 5DH3A 3ZCLA 4IAFA 2CHLA 3IG7A 1K3AA 2XIKA 3FMKA 4EOJA 4EZ7A 3KK9A 4KIPA 3FZSA 3TIYA 2GQSA 4RIOA 2YWVA 4ZIMA 1W7HA 4O0XA 5J7BA 4DH1A 2WTJA 3UIUA 1OPJA 2OH4A 4X2JA 3P78A 3ZRKA 3Q2JA 1PXNA 3UP7A 3CJFA 1J3HA 5D7AA 4I6QA 2RFSA 5CALA 1YHWA 1W84A 3W2RA 1Q8TA 3GU7A 4GFGA 4D55A 1GIHA 4JIAA 3ETAA 4E4XA 1OPLA 2NP8A 3NYVA 3LMIA 1OIYA 2BPMA 3QTRA 4D1XA 1CM8A 3K2LA 4WD5A 2ONLC 5HBJA 4UXLA 3FZRA 4X7QA 4JDHA 2PVMA 5HU9A 1MQ4A 3DZQA 1Y8YA 4DGGA 3QYZA 4MF1A 3BU6A 4LOQA 4XOYA 3W55A 4EOMA 1BX6A 2NRYA 4TL0A 3JXWA 2V5QA 4G3DA 5J7HA 3LZBA 3U6JA 2XS0A 2Z7QA 2BZIB 4BCQA 5E8YA 2R3PA 3FHRA 3MFRA 3S4QA 2ITTA 2VO7A 4MNFA 4XRLA 5AV2A 5JSMA 2CKPA 3VAPA 3C5UA 4NM5A 3UP2A 4QMXA 4RFYA 5K3YA 3KQ7A 4CG9A 4WA9A 5DWRA 2DS1A 2ZV8A 3SOAA 3W2PA 2Y9QA 5CT0A 4R6VA 3FL4A 3KL8A 3FWQA 4AW0A 3PRFA 3BLRA 2X39A 2JFMA 4MF0A 3QRTA 4XEYA 4GS6A 3TV4A 2Z7RA 1YHSA 5ANGA 4J99A 4F65A 4CLJA 3AD6A 4TRLA 3VS3A 2QG7A 3R7YA 4MXCA 4MNEA 1R78A 1UNLA 4LOPA 4EHVA 4F1TA 1IA8A 5EYMA 3S00A 4IM0A 2C4GA 4FTJA 4I0SA 4ZY6A 2ZOQA 3EN6A 3DTWA 2WMRA 3FI4A 2BZHB 5BVEA 3FJQE 4FIJA 4K11A 4RVKA 3FLWA 4IC7A 3IW7A 1YXTA 3H9RA 5FXQA 3WI6A 2B54A 4Z3VA 4EOIA 2HZ0A 2OIBA 3U54A 4BDAA 4EUUA 1PXMA 3NNWA 4E6QA 4BDCA 2V0DA 4M97A 2H6DA 3QTIA 1GIIA 4J52A 2OICA 4CQGA 1HCLA 3CQEA 4RC2A 5K0XA 3HV3A 5FM2A 2X7GA 4HGLA 4ZSLA 4CFNA 4WNKA 5IU2A 2QR7A 1VZOA 2GNFA 3NNXA 2GS7A 4HCVA 4JBVA 3DDQA 3F5GA 3QKLA 4LI5A 3AT4A 4XBRA 4XP3A 2PUIA 3LQ5A 4DFUA 4CTCA 3OF0A 4FL3A 4FZ7A 4R7BA 2C47A 4FZ6A 4FVPA 3MGYA 2C6OA 4AGUA 3E8EA 4YBKA 4D9UA 4XG4A 3ERKA 5KHXA 4R7HA 4I0TA 3N9XA 5IF1A 1L8TA 4DITA 5GIOE 2GSFA 4YUQA 2VTMA 3SRVB 4NM0A 4BDHA 5AAGA 3IONA 3ZRLA 3LOKA 5KUPA 5IQAA 3O0GA 4FIIA 4BDEA 1DM2A 4F70A 2F7XE 4D0WA 5DT4A 3ENHA 5A6OA 4H3QA 3L9NA 3F2RA 5IQEA 1NXKA 3R63A 3OWKA 2IPXA 3PVBA 4M69B 1V0BA 1RE8A 5EYDA 1GZOA 5H2UA 3I6WA 4V0GA 3E3BX 3SHEA 1VYZA 2XP2A 3F7WA 5BYZA 2YCRA 3AG9A 3ZM9A 3QXPA 4LMUA 2GPHA 1P14A 4LQMA 1FGIA 1QPEA 5LVOA 4IXPA 3PVUA 5JFSA 3LCSA 3FLNC 5HBEA 3E87A 3MI9A 4TW9A 4BYJA 3DK3A 1SYKA 2QO9A 4RJ4A 5AWMA 4EONA 4PWNA 3MFSA 4O21A 2A1AB 1T45A 1O9UA 3EN7A 5EOBA 3V5WA 4FEXA 3GCUA 4O91A 3EIDA 3DA6A 4FUYA 4JG7A 3OY3A 3I5NA 2R9SA 5AR4A 3UQFA 3PVGA 2XNMA 4XS2A 4KKGA 3S1HA 2BTSA 1UU7A 1UU8A 3ACJA 3NW7A 2XEZA 3C13A 3CR0A 4JAJA 4PMMA 4TWNA 3W2CA 4A9RA 4E93A 1XBCA 4BBEA 4BCNA 5I5ZA 2VZ6A 4BKJA 5IQDA 2XMYA 2XK7A 2NRUA 5L8JA 5I0BA 2C6EA 3HAMA 4CLIA 4U41A 3IW6A 3C4ZA 3PY1A 4OBOA 4MH7A 3MPTA 4CT1A 1E9HA 4RIYB 2V7OA 3ZLWA 2WOTA 4AA0A 3ZBXA 3LIJA 2QOKA 3QTUA 4O96A 3C0GA 4XNEA 4E1ZA 4F7LA 4PP7A 1RW8A 5AP5A 4OTPA 4AW1A 4C4GA 2XIXA 4MBIA 1OL6A 4QP3A 3KN6A 1WBSA 3TCPA 4CZTA 4L3PA 2OFVA 1A9UA 3W2OA 5C1QB 2R0UA 4YBJA 4ZY4A 2XM9A 4NEUA 4GRBA 3FC2A 3FMDA 4KBKA 3R9DA 3ID6C 4CD0A 2QR8A 2J0LA 3ZDIA 1FVVA 1LEZA 3SG9A 4EJNA 2FSLX 4Y95A 4CYIA 5IMXA 5FTQA 4JAIA 4G6LA 1CMKE 2QOOA 2HCKA 4CCBA 4GYIA 2IO6A 3LLAA 2GNGA 2BCJA 3FY0A 3Q2MA 4AZVA 3KXZA 1OB3A 4MBJA 1WBTA 2PZIA 4C36A 4KINA 3WBLA 4G9CA 4I22A 4GL9A 4CGAA 4MD9E 3I6UA 4CYJA 3ANRA 4C35A 5KMMA 4Z7GA 3DBCA 2QOHA 4FTLA 4IX6A 4O6EA 2IZUA 5DRBA 5JGDA 4NW6A 4OUCA 3BWFA 3VJOA 2ONLA 2HWPA 3QZFA 4QPMA 4DAWA 2VTJA 1ZYSA 4IDTA 4W8EA 3EOCA 5IQCA 5M07A 3VF9A 4IADA 2YLEA 3Q32A 3P4KA 2WHBA 1XR1A 5CY3A 4L44A 2W5AA 2XKEA 4KBAA 1ZOHA 3NGAA 2E9VA 2W7XA 4RC3A 4YZ9A 3FKNA 5ETFA 4DG3E 4FKWA 5IA1A 3Q4ZA 3ULZA 3CQWA 5KMOA 2O3PA 3PSDA 3VW6A 4ANBA 2VNWA 1OUYA 1Q8ZA 3NIEA 2JGZA 2DUVA 3Q4TA 4TYIA 4BBMA 5J1WA 1FOTA 1SNXA 4QMWA 3D7ZA 4BHZA 5CEOA 2G01A 4OTIA 3ZUTA 3GT8A 2QURA 5GINE 2B9FA 3DQWA 1K9AA 2OWBA 3A7IA 3SW4A 3KMWA 2VWUA 3C9WA 4WSQA
chains in the Genus database with same CATH superfamily
2C6KA 3LJ0A 4EC8A 5A46A 2YCSA 4U81A 5CAPA 3AMYA 5CQUA 3LXNA 4QTBA 1J7LA 1K2PA 4CFVA 3OBJA 3O8TA 4AT4A 3IGOA 3MN3A 2ZJWA 4ZTLA 5FXSA 2ZAZA 2RSVA 4FSQA 4O82A 5A3XA 5AEPA 1SVEA 2F7EE 3DQXA 4ITHA 1PXOA 3TUBA 3QUEA 2ITNA 4FSTA 4D58A 4ZY5A 3FEGA 3EN4A 3FE3A 2R3KA 3OOGA 2X7FA 3KK8A 4NWMA 2PMOX 5IDPA 3FZOA 4BDGA 1BKXA 4HPUE 3VBWA 5ANEA 3MH3A 5GJDA 4D4VA 1YXVA 5D11A 4DF3A 5M4FA 4BKZA 1YRPA 1UVRA 5CEIA 2QOLA 3AXWA 4NTSA 3EWHA 5CENA 2CCIA 1MRVA 5KNJA 5IQGA 3DKCA 4XUFA 2G2HA 1SVHA 1UKIA 3O2MA 1FINA 2E9NA 3QC9A 5TT7A 3BBTB 5HVJA 4DHJA 2WIHA 2YZAA 4EI4A 5C8KA 3F5XA 2I6LA 2FSMX 4XCUA 4GG7A 3FQHA 3UOJA 5IA2A 5HO6A 5E8XA 4E4MA 5KKRC 4BDKA 3MESA 3L9MA 4L3JA 3ORXA 4MXOA 5LMAA 3UTOA 2OJ9A 4JX3A 3Q4UA 4FKIA 3EKNA 1R3CA 4O22A 3F88A 4ENYA 5F4NA 4ACDA 3E64A 3QLGA 2QCSA 3SA0A 4M14A 3LMHA 5EW3A 4EOPA 4DTBA 4YHJA 4QQ5A 1H28A 2PHKA 5EG3A 3JPVA 4PF4A 3WF5A 2WMUA 1IR3A 1KE7A 2OIDA 5B7VA 1QPCA 2W05A 3E3PA 3TM0A 3HYHA 3QZHA 3S0OA 4E6DA 3ZRMA 2IG7A 3EFJA 2ZVAA 4XP0A 1PKGA 3D5XA 4UMTA 3TTIA 3W0SA 4FKPA 3MS9A 4JIKA 4RQVA 3BHHA 2RF9A 4ZS4A 3HA8A 5DA3A 2IW9A 1PYXA 1U54B 2BRBA 2GHLA 3F2AA 5JFVA 4YLKA 3W1FA 2B55A 2VTLA 2WU6A 3BYSA 3MA3A 4IB0A 5L2IA 4LFIA 4AG8A 3DBDA 4IMYA 4G1WA 4TTHB 3F61A 3A7HA 4AAYA 4KIQA 3W18A 2YACA 5C03A 1WCCA 4P7EA 4Y73A 2GS2A 2QODA 4IFCA 4B8LA 3SXFA 4FT9A 4EHEA 3W8QA 3NUNA 4QTEA 2W4OA 3T9IA 3TG1A 2JAVA 5BUIA 1DI8A 4EKKA 2ZM4A 3WE4A 2PMNX 2W06A 4UMQA 4Z55A 4U0IA 1BLXA 1OZ1A 3VONA 1Q99A 3LCTA 2W4KA 3QTXA 4I23A 4NKAA 4H3PA 2BFYA 2DYLA 1M52A 2PWLA 1ZRZA 3UNJA 3ZSIA 3PJ2A 3SDJA 4BIBA 3FQSA 3C4XA 1H1PA 4QMVA 3VF8A 1NA7A 3QWJA 4C4EA 1FVTA 5EYKA 4LG4A 3ZLSA 1ZARA 4R5YA 2BZKB 5KBQA 4LM5A 4F4PA 4J95A 2ZFYA 3C4CA 4YZBA 3I4BA 4AN3A 4O4CA 3ELJA 3ZEPA 3F3WA 2HW7A 5GNKA 4ZTMA 3E7OA 4FV8A 3ODYX 3DJ7A 2Q83A 4ORKA 1OKZA 4P2KA 4UY9A 2LAVA 3V04A 4BJJA 4LV5A 5M06A 5K5XA 3TZ7A 4QRCA 5DLSA 1Z57A 2CCHA 3M11A 3FBVA 3PPZA 3R7OA 3RHXA 3FLYA 4DEIA 5IEYA 5JFXA 5KMIA 3NVKI 4KIKA 4A4XA 1YOMA 3NFGB 1TQMA 3WIGA 5CQWA 4IFGA 2W1HA 2Y4PA 4D2SA 2NO3A 4YZDA 3EFWA 4N70A 5EI8A 3OWJA 2QOIA 5DIAA 4EK8A 5CXZA 2XJ2A 3NUAA 2BAJA 4G34A 4N4SA 5CYIA 4CTBA 4M67A 4WUNA 4ZAUA 4B6LA 5IDNA 2HXLA 4MUQA 2QD9A 3MW1A 2X2LA 3LM5A 4M3QA 3R8PA 2QVSE 3MYGA 2R3IA 4DCEA 2BIYA 4DEAA 4ZMEA 1TFFA 4TWOA 5A4CA 5BVFA 2ITOA 2XCHA 1QMZA 2WTKB 2YFXA 4O1OA 5IG1A 3W33A 2RFNA 3R04A 5EKOA 2VTRA 1PXPA 2ITYA 5IUIA 1DAYA 5LQFA 3Q4CA 4YO6A 2GTNA 4D5HA 2XNOA 5I9WA 3OZ6A 3D0EA 4JBPA 3GU4A 2GCDA 3GCPA 3QALE 3EB0A 3HX4A 3FXWA 4DEEA 4JBQA 4BDFA 3QRUA 4F64A 3U8WA 5CU4A 3H9FA 4W9XA 3SRVA 4AXEA 4GK3A 2WTVA 1PMNA 3PG1A 2VV9A 4XOZA 5F94A 3TJDA 4TXCA 2VX3A 3GUBA 2Y8OA 5DNRA 5M09A 2QC6A 4M69A 3GFWA 3UQCA 4QP2A 3S3IA 3ZOSA 3ORKA 3OC1A 4NKSA 5AR8A 3ZYAA 2JITA 4BTJA 5ANKA 3ML1A 4DA5A 5M08A 3R30A 3FMJA 3OFMA 2BTRA 2YM7A 1KE9A 3DAJA 3P5KA 3CPCA 3EH9A 4G16A 2IVTA 3TNIA 5FUTA 3A4PA 3NRMA 3RPRA 1F0QA 4FVQA 2QOBA 4ZEGA 3KCKA 4MD8E 4E3CA 4ZZMA 4DT9A 3SOCA 1YOLA 3GCQA 3KXHA 2YZLA 3F3ZA 3UZRA 4OT6A 4CQEA 1LUFA 4DFZE 3MDYA 5A9UA 2C6IA 3QA8A 5HICA 4ANMA 5GZAA 5L6PA 3CBLA 2P3GX 3OW4A 3U6IA 3P5JC 1M7QA 4NH1A 1A06A 5IH6A 3LFAA 1ST0A 5HX6A 3WOWA 4ACGA 1KV1A 3QC4A 4FNXA 4HOKA 3KRRA 4P5QA 3F3VA 3O51A 2W1ZA 2XK4A 3ZS5A 3BEGA 4IZAA 2XIYA 5E4HA 4DFBA 3QTSA 4QP8A 3HUBA 2UW6A 3VS1A 4U6RA 4KD1A 5C9CA 2BKZA 5C4LA 2ACXA 2W1FA 4DC2A 4FODA 4MHAA 3QA0A 4D28A 5C01A 5EW8A 4BWXA 3BL9A 2XARA 1HOWA 3CY2A 3NIZA 2QO2A 2YM3A 4FV3A 4RIYA 4X2FA 3IDCA 3RJCA 5I9UA 2OGVA 5FEDA 3TT0A 2Y7JA 4AP7A 5J95A 4CEGA 4DBNA 4RA5A 3D94A 3ZC5A 3VUMA 4W4YA 4ZJIA 4O81A 4CKJA 5EOLA 4DEHA 4OTGA 3R73A 2QO7A 4ZTRA 4AX8A 1XH5A 2YWPA 3D7TB 4U3ZA 4HZSA 3R9OA 4RX7A 4U43A 5IA5A 1IEPA 2YERA 3OUNB 5IPJA 3A60A 4FNZA 1ZYLA 4OLIA 4Q9SA 3V5QA 3MIYA 5HTIA 3Q5IA 4HCUA 4BI0A 1XWSA 5JZJA 2FH9A 3W0NA 4FL1A 1JNKA 5B2KA 3BZ3A 4K2RA 2ETMA 1OVEA 3QD3A 4JNWA 5IISA 1J1BA 4BB4A 3R7IA 3R21A 4YJTA 3UOKA 2XBAA 4DDGA 5CNNA 4WBBB 3RZFA 4A4LA 2HOGA 2ERKA 2LGCA 1O6YA 4XLIA 5AP7A 3G9NA 2WQMA 5AV0A 5J1VA 3C4WA 4O7SA 3P9JA 5HTCA 3QZGA 1F5QA 2PE1A 1AD5A 3RPSA 3EZRA 4BGHA 2B0QA 4JMQA 4FTRA 1PKDA 4BICA 3DB8A 4YC6A 3R6XA 1LPUA 4FSYA 4GKIA 2XRWA 2XH5A 2WFYA 4U79A 4NJ3A 3PXFA 4UV0A 5AUVA 3U6HA 4HNFA 3LLTA 4U97A 2AUHA 3BIZA 3TNHA 3EQDA 5AP2A 2W1DA 4J1RA 5HBHA 4LGDA 5HE2A 3LKMA 1GOLA 3NMUF 1EH4A 3MPMA 1UNHA 3ORPA 2YAAA 4P5ZA 4A9YA 2R4BA 3P23A 2GNIA 4O0SA 3BRBA 2PVLA 3E7VA 5CF8A 4RJ7A 4ZMFA 2XA4A 3MY1A 4JI9A 4LGHA 3WARA 4D5KA 3VJNA 3UJGA 3LVPA 2WZJA 4WNOA 3P79A 4ZP5A 4USEA 1Y8GA 3CS9A 3EJ1A 1BI8A 2CKEA 1W2DA 4KIOA 4WO5A 4RIWB 4J8MA 3DCVA 4MTAA 5LMBA 5I9ZA 4M7IA 1NW1A 1O6KA 4O7RA 3VQHA 3FMMA 4XMOA 4EHGA 3OXIA 2ITWA 5HQ0A 3TN8A 3UVPA 2JD5A 3OS3A 1Q61A 5I9XA 4MKCA 2VTAA 2BROA 4ZOGA 1BUHA 4LUEA 3RMFA 5BMSA 2PE2A 2OXXA 3RK7A 4FEQA 4PL4A 4HJOA 4AFEA 4NZWB 3SVVA 2GHMA 4MWIA 4TYJA 2QLQA 3Q96A 4GH2A 4QMMA 4D1SA 3VVHA 5FGKA 3L1SA 4C4JA 3DK6A 2WEVA 4BGGA 3OEFX 3R02A 4IAZA 2X9FA 5CF5A 4EH9A 1JKKA 3DKGA 4QYYA 3OTVA 4UB7A 3VUGA 3QKKA 3R8UA 4YURA 3GOPA 3KULB 4QMTA 2JFLA 4LL0A 4C61A 5D9HA 2XBJA 3HMPA 3RINA 5IKWA 4J53A 2X8IA 2PUPA 4K0YA 2GFCA 4AU8A 2PYWA 5A54A 3EYGA 4ZJJA 3BWJA 3G2FA 3PP0A 4E8AA 2UZLA 3PLSA 4ID7A 2VUWA 4FIEA 2EXEA 2OXYA 1WMKA 3RAHA 1PY5A 3PPKA 5BVNA 5IUGA 4EOSA 5DR9A 4FTAA 3TV6A 4BTMA 3UC4A 5BYYA 2Y4IB 3QHWA 2YM8A 3OUKA 5BQ0A 3KRJA 5FDPA 4HVHA 4FZAB 4FT0A 5HX8A 4JDIA 5LVMA 3CKXA 3TZ9A 4M84A 2UW4A 4RZVA 4ALWA 3G9LX 3UIXA 2C3JA 3FKOA 4I0RA 4ZLOA 1JLUE 3HDNA 3PA3A 4YPDA 4I94A 2IN6A 4FUXA 3DNDA 3TKHA 2B4SB 2FSTX 3COKA 5EHLA 1U54A 5GJGA 1JBPE 4RMZA 3EN5A 4QMSA 4QMLA 1FBNA 3FHIA 4G9RA 5D7VA 4GIIA 4GUBA 1UWJA 2YIRA 3DBQA 3PZEA 2WQEA 1Q3WA 2R7BA 2CKOA 3BGZA 3BHVA 2CDZA 1ZMWA 3HGKA 2ZMCA 3EL8A 3POZA 3DBEA 4IVBA 5GHVA 4GV1A 1CDKA 2WMQA 4EH2A 4EOOA 3ULIA 3THBA 5EYCA 3OT8A 4JVGA 3RZBA 1PYEA 2AC5A 3QCSA 2PTKA 3IDPA 4CZYB 2CN8A 3GC9A 3R9HA 3FI2A 3RM7A 3BU5A 4FEUA 4FTTA 4C3RA 3QQFA 3G51A 4GFMA 2XKFA 4L53A 3BYVA 3NWWA 4DDIA 2YIXA 3O8UA 3ZBFA 3MVJA 2UV2A 2JIUA 1M17A 4B7TA 2RFDA 4NU1A 4QMOA 3FV8A 2X4ZA 4CSVA 5L6OA 4FV2A 3VO3A 2BAQA 4WNPA 3RAKA 4FC0A 5FDXA 2ZDTA 5JQ5A 2ITVA 4UMRA 4LUDA 3UC3A 3NVMB 1URWA 2J90A 4FTUA 5AJQA 2O0UA 3HV7A 4NTTA 4BCKA 3I1AA 4UZHA 3RGFA 5K0KA 2B9JA 4M12A 4KRDA 2EB2A 3AQVA 3GC7A 3MB6A 3VS0A 4A07A 2IF8A 2X6DA 4DE4A 3HP5A 3TYKA 3A8WA 5FTGA 2W17A 3IDBA 2UVYA 4BI1A 2ZB0A 4GT3A 4YTCA 2I0VA 4UN0C 4H36A 4DEGA 4C2VA 1OKWA 4FEVA 4QNYA 4DFLA 3SX9A 1FQ1B 1M2QA 3ORIA 3PIYA 4CFUA 5LVPA 3AKJA 2GQGA 5TKDA 4BDDA 2XCKA 2O64A 5ACBC 2C0TA 1MRYA 4GVAA 3MIAA 4XX9A 1YI6A 4I6FA 4FSMA 5HCXA 3DBFA 2IW8A 4PP9A 4RSSA 3NNUA 4RA4A 3QKMA 2ETKA 4MXZA 1U46A 4W4VA 3RALA 5JK3A 4RJ6A 4IM2A 4NSTA 4EUTA 3AC2A 2OLCA 3VBYA 4U9AA 3TZMA 3BHYA 2WTWA 5D12A 3H10A 1E1XA 4A06A 4BBFA 4C7TA 3RKBA 3SAYA 2C5VA 4PMTA 2HZIA 4U5JA 5L2WA 4IWDA 4BC6A 5E1EA 5M56A 3IW4A 3UZTA 3VS4A 4DT8A 4UYAA 3R8LA 4C8BA 1J91A 3ZFXA 3IGGA 1ZOEA 4M15A 2QLUA 4OBQA 2C68A 4FKOA 4PDOA 4ZK5A 1H1SA 3A7FA 2ZV9A 2BRGA 3R8VA 3T9TA 5TF9A 2UW9A 3LW0A 1FVRA 3Q9XA 4U40A 3VRZA 5JRSA 3VUKA 4GIHA 3CCNA 2BUJA 5L3AA 4MWHA 3VBTA 3O5AA 4B0GA 3UO6A 4D4YA 3FZ1A 5M4CA 1IA9A 3R7EA 4WRGA 4C3FA 2PVNA 4UALA 2YITA 5ANOA 5AAFA 3G90X 4XG8A 3PUFC 2AC3A 1FPUA 4MK0A 2XK8A 4YSMA 3VULA 3Q6WA 5ETCA 4JDKA 5DMZA 3BHTA 4GUEA 3V5TA 2GHGA 4F99A 4RWKA 1BL6A 2BFXA 3R2BA 1Q62A 2JDSA 3ZO3A 1TQPA 1P2AA 3KY2A 2H96A 3V8TA 1DI9A 2Q0NA 3A62A 3AKKA 3U4UA 5I4NA 2UZVA 4TZRA 3UDTA 2UW8A 4BI2A 3REPA 2J51A 3CXWA 4ONAA 4QPAA 4APPA 2YA9A 3HV5A 4R1VA 4DG0E 2QOQA 3VUTA 2F2UA 3P0MA 4BCOA 5BV3A 1B6CB 2PMLX 4QQCA 2OG8A 4I4EA 5HEZA 4RJ3A 4WG3A 2OZOA 4DGOA 2IW6A 4LGGA 4Y83A 3RP9A 4OTQA 3DU8A 2C3IB 3LFDA 1XH6A 4L9IA 3KXXA 2JEDA 2XNPA 3H3CA 2QHMA 3UDBA 2W9FB 4PPAA 2WMXA 3ZEWA 4IX3A 4YHTA 5EM7A 3UQGA 4HVSA 2XB7A 2JKMA 3E63A 3G5DA 1WBNA 1UNGA 3ZLYA 3NAXA 1IG1A 3NPCA 4ITJA 4O0WA 4GKHA 1NVQA 5TOZA 1WVYA 5L4QA 4JJRA 3G33A 4QMUA 4FV0A 3UMXA 3VWAA 5FXRA 5CEQA 1J7IA 3VC4A 3DAKA 4BCGA 3Q6UA 2X2MA 5DRDA 1PMVA 3BELA 3HRBA 3R1YA 5BVKA 4GFOA 4F63A 3EQIA 1Q4LA 5JEBA 5LWMA 4LMNA 3TDVA 4AT3A 3TXOA 4DHZA 4NUSA 3D7TA 3GB2A 4A4OA 3EL7A 2BHHA 2WO6A 5HNBA 5L2TA 5ANJA 1CKIA 3UODA 2ZDUA 5A14A 2ZMDA 5C27A 4J7BA 3D5WA 3HVCA 4D2PA 4WT6A 4I5HA 2IJMA 3VN9A 4WHZA 4RG0A 2ERZE 4CNHA 5H8EA 3IW5A 3PXQA 5B0XA 1KWPA 4QYHA 5E8WA 4L45A 4R1YA 4C59A 5CZHA 4P4CA 3T3UA 4BDJA 1KOAA 5CASA 3FQEA 4L46A 1OECA 4YZCA 4D2VA 3HMIA 4BWPA 1PXIA 3CTJA 3MTLA 4JG8A 4PRJA 2PPQA 1UA2A 3U87A 2V22A 5DG5A 2VTSA 2A2AA 5HE0A 3QD0A 5IA3A 3MFTA 1G8SA 4W4XA 1YVJA 2YJRA 4OTHA 5HOAA 3ZFMA 3FC1X 3MH2A 5HG5A 4EYJA 4H1MA 5AX9A 1ZY4A 2C3LA 4LRMA 1H25A 4PTEA 3TEIA 4YJVA 4YC3A 3G6HA 1GY3A 4ZJVA 2W9ZB 4PNIA 3A8XA 4IWOA 3UOHA 2KULA 2R0IA 4GMYA 4AA4A 4Z7HA 4WBOA 5M53A 4O7NA 4CRLA 4QO9A 1XO2B 5AR7A 4K6ZA 5AV3A 4V04A 3QU0A 5EI6A 4MAOA 3F5PA 4L68A 3VUIA 3VHKA 4ANQA 5LARA 3LJ1A 1GZNA 3AC5A 4ANLA 3KMUA 3NUXA 2RG6A 5CF4A 2WGJA 5A6NA 4GJ2A 4L8MA 3RM6A 5BPYA 4NIFB 4PDPA 2QKWB 3LPBA 1Q5KA 1W8CA 2P55A 4EWQA 3ORTA 5CX9A 5CAVA 1AQ1A 2OZAB 3DPKA 5DR2A 4DLIA 2GU8A 3C50A 5IEXA 3BGQA 4FK6A 2P0CA 4FVRA 4ZZOA 1WFCA 5HLNA 1R0EA 3U4WA 1H1QA 4JL9A 3DFAA 4IJ9A 5DBXA 3EFKA 1RDQE 4TNDA 4QTDA 3RWQA 1IRKA 3OY1A 2QG5A 2PUNA 4YJQA 1STCE 2C6MA 1ZOGA 2A98A 3RAIA 2OW3A 1JWHA 1Q8UA 3TUCA 2AEGA 1KE5A 5CTPA 3UNZA 1YDTE 4M66A 4BIDA 1QPDA 4N6ZA 2IZTA 4X2GA 3R8ZA 3EN9A 5E8TA 4XG6A 5KZIA 5HTBA 3ITZA 3OT3A 5EM6A 1G8AA 2X1NA 2XKCA 4XP2A 3SC1A 3KULA 3BEAA 1APME 4J71A 1IAHA 2WOUA 2XNGA 3OMVA 3PJ3A 4O27B 5CVGA 5HKMA 3ZMMA 5JQ8A 1B38A 2JDRA 4I21A 5M51A 5F95A 4AZEA 2YISA 3KC3A 2PY3A 4RZWA 4XRJA 1H27A 2CNUA 5HCZA 2UZEA 4FTIA 3ALOA 4XV9A 5F1ZA 3GU6A 3B8RA 4FL2A 1H0WA 5DOSA 4DH5A 1I09A 4DCAA 3CGFA 3WYYA 3WF8A 1E1VA 4BCHA 3QTWA 2YCFA 4BY9E 4QDEA 3P7CA 4MD7E 4AS0A 5HORA 4IAAA 3QUPA 3UBDA 2QOFA 3V51A 4UZDA 1YQJA 2QU6A 2HELA 2BRNA 3Q9WA 4XV3A 3UG1A 4RLLA 3I60A 3O71A 2I7QA 5E8VA 3HECA 4AF3A 3SG8A 3DS6A 5DHJA 4I5PA 3LFCA 3MJ1A 4YC8A 3I0QA 4RVTA 3U51A 3FLQA 1DAWA 3EQBA 5J87A 2KTYA 2OJFE 3DTCA 2XUUA 1KE6A 4JOAA 4RBLA 1W82A 3QHRA 5FM3A 2GS6A 3FAAA 4DH8A 2WQOA 1H08A 3FDNA 4M8TA 3HV4A 3HZTA 4C4FA 2EXCX 2Z2WA 3CD3A 3OW3A 4YP8A 2YM4A 3PWYA 4WOVA 4RX8A 3SGCA 3E8DA 4IZ5A 3CKWA 4L67A 4YTHA 2X8DA 3E8CA 3ORMA 1H07A 3S95A 5G6VA 4AOIA 3KU2A 1BYGA 4EZ3A 3FMHA 4DTKA 5CVHA 3KVWA 4U8ZA 2HW6A 3RCJA 3OCBA 4DLJA 2UUEA 3U9CA 3CSVA 4F6UA 3ZO4A 4LRKA 1RJBA 3NFFB 1PRYA 2H9VA 4DN5A 1SM2A 4FBXA 2JAMA 2XNBA 4HYHA 2IZRA 3KREA 3G0FA 3SW7A 3KN5A 4CMTA 5HNIX 2J9MA 5J5TA 5HIEA 5KO1A 4BL1A 3KMMA 5CEKA 3N51A 5HHWA 1PHKA 3D9VA 4AW2A 4IB5A 4GVJA 3A7GA 2F7ZE 3W0MA 2YHVA 3F66A 2Y6MA 2XNEA 3AD5A 3OBGA 4GU9A 4IB1A 4WNMA 2BILB 4ZTSA 4DH3A 2WMAA 2X0OA 3DV3A 2VD5A 5IQFA 4E7WA 3BLQA 4QQJA 1VYWA 4C0TA 5L8KA 3PYYA 4NL0A 3QQHA 5CSWA 5EH0A 4JG6A 4IC8A 4PPBA 3QQGA 4NW5A 3ZC6A 4IB3A 4C02A 1Y91A 4F9YA 3Q5ZA 5EQYA 3IW8A 2UW7A 2PK9A 3CC6A 3QQLA 5EDPA 2BKKA 3GCSA 4U3YA 4D2WA 2PVRA 3PWDA 5DI1A 3BQCA 2HYYA 4L42A 4RPVA 4GEOA 4CXAA 1CKJA 2C6TA 3PA5A 5CZIA 5HG8A 4AXFA 5TO8A 3ZUUA 3C1XA 4KKEA 4U80A 4BDBA 4YNOA 5FQDC 2OK1A 5KCVA 4HVIA 4AE6A 5IH5A 5CU3A 5IMEA 5FP6A 2RFEA 2YM5A 3Q53A 1ND4A 1JOWB 3FLSA 3OCGA 3NYNA 4EQCA 1NT2A 4QP6A 4RX5A 3DB6A 4FICA 3I0OA 3LE6A 4FK3A 5AUWA 2H34A 3NAYA 4JBOA 3D2IA 4NM7A 3QCXA 1IASA 2C6DA 2HIWA 4GSBA 5G1XA 5H8BA 3IQ7A 2J6MA 4EBWA 3UO5A 4G3GA 3GFEA 2BDFA 3ANQA 3ZSGA 4QDVA 4IAIA 3II5A 2ZYBA 3QCYA 4H39A 3R7UA 3B2WA 4CFXA 4F1OA 3ALNA 4UEUA 4J97A 2P33A 1XKKA 2GFSA 3PXZA 2W1GA 3A2CA 3IECA 1R1WA 3IO7A 3JY9A 4FGBA 3UYSA 4AQCA 4E5AX 3UNKA 3ZLXA 3KIOC 3HA6A 2VWXA 4KNBA 2E9PA 4ZSJA 4AZTA 2J5FA 5LMKA 3DXQA 1NY3A 2R3RA 4ZTNA 2JDOA 3GU8A 1V1KA 5HD7A 3SLSA 4KA3A 2BRHA 2OBJA 3AD4A 1ZXEA 3DXNA 4S32A 4BIEA 3KRLA 2PUUA 4ZSGA 2JKKA 1JSTA 5HNGA 3V8WA 2WTCA 3R7VA 4QMYA 3LMGA 2VTHA 4FZFB 4X3FB 4E20A 5LCJA 3OD6X 2CJMA 3CJGA 4YJSA 5KX8A 1P4OA 5CXHA 4XLVA 2PVKA 3NYOA 3ORNA 4F7NA 4AT5A 1OUKA 3WZUA 4JR3A 4YTIA 2HK5A 3H4JA 2VTIA 4G2FA 4I1ZA 4RX9A 5TR6A 3GC8A 2R3HA 3MTFA 2QHNA 1Q41A 4YR8A 3ZZWA 1YKRA 3NUUA 4IIRA 3BV3A 4NCTA 2VTPA 4FV6A 5LJJA 3BU3A 4XG7A 3SXRA 3OCSA 4IHPA 5FBOA 3LXKA 4MYGA 4B9DA 1OM1A 1IAJA 5AR2A 4J98A 4LL5A 3OHTA 4MEDA 5EHOA 5AP0A 2XVDA 3GQIA 4O0RA 2OIQA 3KF7A 1SVGA 2X81A 5AA9A 3L9PA 3FL5A 1TQIA 2F4JA 4FKLA 2VWWA 2YJSA 2CGUA 2XYUA 3DJ5A 4MXYA 1ZZLA 4BVUA 2PZRA 4RWJA 5ETAA 2OU7A 4FKSA 1OMWA 2HWOA 2GTMA 3O17A 3QRJA 4H3BA 4X21A 4YO4A 3RTPA 4I6LA 3FZPA 2BAKA 2J7TA 5FD2A 4UBAA 4JX7A 4R3PA 3CTQA 3AOXA 2H8HA 2XZSA 4WSYA 3ZUVA 1OL7A 4GJ3A 4O7VA 1ZYCA 3A4OX 4ASEA 4DHIB 5AP6A 4FOBA 1JSUA 4KUJA 3V8SA 4CT2A 5K5NA 2WPAA 5CAOA 3UDZA 4RGJA 4EK5A 3EZVA 3Q04A 3TI1A 3BYMA 4JLCA 5AUXA 4AFJA 4ZXTA 4JT3A 4BRXA 2PMIA 3R0TA 3GENA 1O6LA 4MX9A 2WMSA 3RWPA 4GG5A 2Z02A 3R7GA 3GXLA 3QD4A 1OIQA 2R3JA 2YDIA 2DWBA 2G9XA 2I0EA 4F1MA 3N4UA 2IVSA 3FPMA 3NLBA 3BV2A 2OKRA 2Z8CA 3QX2A 2GNLA 5K4IA 4FZDB 1M14A 4NYEA 3PE2A 2WIPA 3D5VA 4XBUA 4O1PA 3OOMA 1OPKA 5L6WL 4CG8A 3FKLA 4JDJA 3ZXTA 3LFNA 3CD8A 3W16A 4MQ2A 1GAGA 2J0MB 3PUPA 3VBVA 1WAKA 3JY0A 5K9IA 3A7JA 4RJ5A 3OCTA 5EFQA 4C62A 4FT5A 3ORLA 4J96A 4G5PA 2WTKC 1ZY5A 1NVRA 2B9HA 2C1BA 2FGIA 4XV1A 1OL2A 1VR2A 3VBQA 3MV5A 4IZYA 2PSQA 4XV2A 4FIFA 5HESA 5HI2A 4EQUA 4PTGA 4FI1A 4RRVA 4ZTQA 4I5MA 4PQNA 3V01A 3R00A 3R2YA 2ITXA 2G1TA 1XBBA 3W32A 1PF8A 2EXMA 3CPBA 2JBOA 3F3UA 4MBLA 4RC4A 3UYTA 4NIFA 2VO6A 2JBPA 2W4JA 4IM3A 4X0MA 4O4FA 3OWLA 3ZONA 3F7ZA 4BKYA 4HYUA 1H24A 4FF8A 4NJDA 2OZAA 2O5KA 1P5EA 4X2NA 4BTFA 2W5HA 3AC3A 3FMNA 2UZWE 3RBWA 2QU5A 4O0UA 3SXSA 2C6LA 4N6YA 2UZDA 3Q52A 2C30A 4OBPA 3WF6A 4TYHB 4S30A 3QUDA 2VWYA 4FTMA 4UMUA 1A48A 2C0OA 5EK7A 4W9WA 3PPJA 3P08A 2W1IA 3WYXA 4FV7A 4O86A 4EOLA 2IVUA 2UVZA 2WEIA 2BIKB 2YN8A 3JVSA 3MPAA 2X4FA 3MJ2A 4HZRA 4NM3A 4W4WA 4E5BA 1YI4A 5CF6A 4F9WA 4G3EA 4YNEA 4D0XA 4EH8A 5F9EA 4CKIA 4QMQA 2PU8A 4PV0A 5BVOA 2JKQA 4NFNA 1DS5A 4QP9A 4EH4A 4TKSA 5CVFA 4AZWA