4Y8DA

Crystal structure of cyclin-g associated kinase (gak) complexed with selective 12i inhibitor
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
307
structure length
262
Chain Sequence
DFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPYSNFPIGEKQDIWALGCILYLLCFRQHPFSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-G-associated kinase
publication title Selective Inhibitors of Cyclin G Associated Kinase (GAK) as Anti-Hepatitis C Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 262
sequence length 307
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4y8dA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4y8dA01
2W96B 3TZ8A 1BUHA 1GZ8A 5KMOA 4IHPA 3LMIA 2NRYA 2W1ZA 3W8LA 2V62A 4RQVA 2WTJA 4IANA 1W98A 3V8TA 2R5TA 2OF4A 4KIQA 5FEEA 5I3OA 1U4DA 5IA5A 3HV6A 3TTJA 5HKMA 2OZOA 3HA6A 4O0VA 2XKEA 2FYSA 2GNFA 2JDOA 3DGKA 3UOKA 2R3PA 4F0IA 4YJNA 3MB6A 2UZNA 2VTQA 3VS3A 5A6NA 4QMZA 2VWZA 5G6VA 3RWPA 1ND4A 5B7VA 2R3LA 3QGWA 4KIPA 3A4PA 3IDBA 3POZA 3VUMA 2KTYA 1WBWA 3EQBA 4NM3A 4Y5QA 2ITXA 5LQFA 4PUZA 2UW7A 2FB8A 3JXWA 5TF9A 4J52A 4BHZA 4BI1A 4CV9A 3TV6A 4JJRA 4FZ7A 1QPEA 3SDJA 3ZO1A 1GNGA 2I40A 4Y95A 5JGDA 2UW5A 3OXZA 5FLFA 2IZRA 4M0ZA 4XYFA 2IW9A 1SM2A 4FV2A 5GZAA 4QQ5A 4TPTA 3BYSA 4C0TA 5AUTA 3FQEA 4IBMA 2F2UA 4RC4A 3NIEA 5K0XA 2CMWA 4I6QA 4DTAA 4JQEA 3NGAA 3GVUA 1YXTA 2XEYA 4U3ZA 4G9CA 1UKHA 1JKSA 3IKAA 1JAMA 4W8DA 3GGFA 4QMWA 3FLWA 4C61A 3H3CA 1SVEA 4XOZA 2VNWA 2GTNA 3H9FA 4FL1A 3UP2A 1OGUA 4IFGA 3SGCA 1PY5A 4FVRA 3UNZA 2W4KA 2VTRA 4NW6A 5E8TA 5FEDA 4PNIA 3F3UA 3ZSHA 3SHEA 3EN4A 4R5SA 3VBTA 3UMWA 4HVDA 4BIBA 3ZYAA 4TKSA 4YNOA 3O50A 1P4OA 4O7VA 4JS8A 1FMKA 4EJ7A 1PHKA 4USEA 1XR1A 2Z2WA 1OI9A 3QRJA 4RIXA 2IW6A 2WQEA 4L9IA 3TACA 5EI8A 1O6LA 4FODA 3IOPA 4FVPA 4XJ0A 4CFWA 4AWIA 5HG5A 4F0GA 5A4LA 4O7ZA 3QXOA 4D55A 3C5IA 5IQIA 3LFFA 4AN3A 4M14A 3I81A 2XIXA 4IJ9A 4WT6A 3DA6A 1PMEA 5KHXA 2UUEA 3OWKA 4XG3A 1V0BA 3F61A 3SD0A 5JGAA 3QXPA 2JAMA 2JITA 2ZV8A 2JBPA 5M06A 3QWJA 4JAIA 4TYJA 5HO7A 5GJFA 4N6YA 4DEIA 4DEBA 4C3PA 3DK3A 4J8MA 4ANOA 5JT2A 4O1PA 2XNEA 4DEHA 5M4FA 2UVYA 4S31A 1YOLA 3GOKA 4UWYA 3CKWA 3TV4A 4F64A 2WTKC 4I1ZA 3RNYA 3D7TB 2VTSA 3GOPA 2ZV9A 4FTAA 4F0FA 1J1CA 3AQVA 4CLJA 1PXKA 4F6WA 4JX7A 2XYNA 3F3TA 4RIWB 5FTQA 2I0HA 2ZDTA 2ZM1A 4I6BA 3Q04A 1Q3DA 2JDRA 4J95A 3R7EA 2JDTA 3NYOA 3S4QA 4IB5A 2ERZE 5TT7A 3ZUTA 3A8XA 4AZWA 3CD8A 1VEBA 3ENMA 1R0EA 1E1VA 3BLQA 4AW0A 3VHKA 3UBDA 1LEWA 3A60A 3VBQA 3OG7A 4EORA 2W5BA 1XH5A 3LM0A 5CANA 3CBLA 4X6RA 1SVHA 4IX5A 3FY0A 5M08A 5DR2A 5M09A 3F3ZA 2WMWA 5KNJA 3E62A 1H08A 2RKUA 4E5WA 4L68A 3BV2A 1PMNA 2QO2A 2QOKA 1R1WA 3UOLA 5ANOA 1YW2A 3GC7A 4MCVA 3TN8A 5JFSA 3QTZA 2A2AA 4IDTA 4BDHA 5TR6A 5M4IA 2YACA 1E9HA 3FKLA 1YHSA 3EYHA 4IADA 4J99A 4EOQA 3DKOA 3DAEA 3JY0A 4FTJA 3V51A 1M52A 4NZWB 3LMGA 4O7NA 5IQBA 5C4LA 2CCIA 2PUPA 3VUTA 4UMQA 3L9LA 3R1YA 4FUYA 4RG0A 4U7ZA 1GIJA 4DHFA 4ANLA 4F70A 4BR3A 3W18A 5HOAA 5E92A 4NU1A 3ORMA 4IVDA 3ULZA 4BDCA 3VS4A 5CF6A 2X8EA 5M53A 2E9VA 3T9IA 1AGWA 5IF1A 2NPQA 4ZSGA 4EZ7A 1UV5A 2Z7RA 2ZAZA 1PW2A 2F57A 5D41A 2YIXA 4J1RA 2OH4A 3HLLA 2UZUE 4JR3A 4L44A 2IN6A 3KCKA 3R8LA 2IVSA 1BI7A 4WA9A 2C3IB 5FWKK 4QMQA 5JMSA 3Q60A 2RFDA 2VRXA 1OKWA 4FV1A 1R3CA 1XH6A 4IVAA 1Q8WA 5AAGA 1UWHA 1PKDA 4BVUA 4EOJA 2C5OA 4D0WA 3KF7A 4RQKA 4ZY4A 5HTCA 3DQWA 1XHAA 3BGZA 3ORXA 3Q6UA 1UVRA 3U8WA 1XH8A 1JNKA 4FNZA 4DH3A 3IONA 4QP6A 4HW7A 2PZRA 2A1AB 4S2ZA 3KKVA 4KRDA 4M84A 4DLIA 4FKLA 2UW0A 4YSMA 2BFYA 4GYGA 3TNIA 1M7NA 3TZ9A 1K3AA 1YOMA 4OTRA 4Y83A 4FMQA 4EBWA 3AXWA 5IKWA 3RAWA 2BR1A 2C30A 3WF8A 4AQCA 4MD9E 4BZNA 1YXXA 3P5KA 3L8PA 5E8ZA 3SC1A 1DS5A 3BGPA 4ZTSA 1Q97A 4M7IA 3E3PA 5FXQA 3WF7A 2WB8A 1KE8A 4MYGA 5AR2A 1BL7A 3OROA 4V01A 3VJOA 4XG6A 3RP9A 4F1OA 4O7RA 2UVXA 3P23A 3QCQA 5JFVA 4L3PA 3WZEA 3MFUA 4FIFA 2Q0BA 2BHHA 1J1BA 4ZSLA 3FXXA 4U79A 4E26A 4ZP5A 2QOQA 2ZB1A 3PXRA 3RNIA 5TE0A 1OB3A 2PK9A 3G90X 5HD4A 2WTKB 3VF9A 3ZO4A 2ZVAA 3KRWA 4IQ6A 4WG5A 5HLPA 4BTKA 4BWPA 4YJRA 4EHGA 5E7RA 1H8FA 4IX6A 3AC1A 1ZY5A 2XM8A 3FZTA 4QQCA 3RALA 5EKOA 5DVRA 2WTIA 4CKIA 2X4FA 5DRDA 4RFYA 4CRSA 4M0YA 3R63A 2C3LA 3VUIA 4IM3A 4MXAA 3V5PA 4CYJA 1IG1A 2QOLA 2F9GA 4OTQA 4CD0A 5AMNA 4BBFA 4RA5A 4PQNA 3MVJA 4E5AX 4YU2A 3CR0A 5IMEA 4C58A 5J7HA 3Q5IA 3IW8A 5A3XA 3D5UA 4IWOA 5CASA 2C3JA 3OD6X 1SYKA 4LGGA 4U9AA 4UWCA 2O3PA 3B8RA 5EYDA 3R7IA 4DGNA 4UXQA 2JFLA 4FV7A 3ZFMA 1XO2B 1W83A 3IDCA 4J96A 4ZZMA 3DJ6A 4GH2A 3Q5ZA 2C6MA 3Q4CA 4A7CA 1GZOA 4GK2A 5AP7A 3KY2A 5LWMA 5IQAA 4MBJA 3K2LA 5HLNA 1IEPA 5AUXA 3R04A 4QP4A 5H8BA 1O6YA 3MY0A 2P3GX 1ZOGA 3R8PA 4EQMA 1ZMUA 3GCPA 2ZMDA 3LXNA 4PL3A 4RFMA 4ZK5A 4YURA 2PZPA 3Q53A 2WD1A 2YERA 4JDHA 4JRNA 4XV1A 3UJGA 2CN8A 4ZSEA 3VAPA 3MJ2A 1XWSA 5HNIX 3OWLA 3MYGA 4BI0A 2B54A 1GIIA 2QKWB 2ZYBA 5HNGA 3R7YA 2C5XA 2C5VA 4FKWA 5JRQA 3ZEPA 3O23A 4FL2A 1OITA 3IPHA 3KXMA 1P2AA 5FP5A 3W16A 1OPLA 3KN5A 3O96A 3TXOA 2BTRA 4AOTA 4E4XA 3W55A 5KZIA 2B0QA 4ITJA 4BHNA 4EH2A 4OAUC 1FMOE 3FI8A 4FL3A 2HENA 2J51A 5CTPA 3VUGA 2WXVA 4CFNA 4CMOA 2XMYA 4DEDA 4QQTA 5BMSA 2OU7A 3NYXA 1JKLA 4NM0A 5KX8A 3VC4A 3FZPA 2YCFA 4X2KA 4XHKB 5K4JA 1APME 1JBPE 2J0IA 4XV2A 2X6EA 2F49A 1OIUA 1QCFA 3PTGA 2JAVA 3TIZA 3ZBXA 5AEPA 4UZDA 2CNUA 4J71A 3A99A 5FDXA 3N4VA 4NYEA 3QTRA 3PY3A 3QD2B 4GIIA 5GZ9A 3VBXA 4PP7A 4HCUA 2PVHA 4HPTE 4F9CA 3LM5A 4ID7A 4XX9A 4G3CA 3MB7A 4KSPA 2J5FA 1JKKA 5E1SA 5EDRA 3WE4A 3JVRA 1REKA 3KL8A 4IWQA 1KE5A 3F69A 4O0WA 3MA3A 4WNOA 3R8UA 4RWJA 5HCXA 3MI9A 2BIKB 2VWIA 4ZXTA 2QR8A 5DRBA 3VUDA 4PMSA 4AT5A 4GK4A 2O63A 3FHIA 4QYHA 5B2KA 3KMUA 3LCDA 2GNGA 3LOKA 3QRIA 2PZ5A 5BVFA 4AACA 3P7AA 5HBEA 4AT4A 4YJTA 2DS1A 3NAXA 3Q9WA 3ACJA 5K5XA 2PVLA 1IAJA 3R01A 2C6EA 4O2PA 3V3VA 4JR7A 4D2SA 3OXTA 2BFXA 5HVKA 3PE2A 4E1ZA 4M69A 5IUHA 3E93A 2O0UA 1A06A 5HCYA 5DYJA 2H9VA 4D5HA 2HIWA 3FLSA 4A9TA 4H58A 5EK7A 2XJ1A 3RK5A 1XH4A 4IDVA 1W8CA 3PLAE 3EQFA 3QALE 4LQMA 3G0EA 4C33A 2PUUA 3G6HA 4DH7A 1OVEA 5FQDC 4B8LA 4FKVA 2PTKA 3D83A 2QC6A 4RX9A 2F7XE 3EKKA 2Y6MA 3KXHA 3DDQA 5L6WL 3NUPA 3SQQA 2QLQA 4B9DA 3FUPA 3D5VA 3ET7A 2C0OA 2QURA 4EOSA 2UW3A 3KVWA 2R3KA 1OUKA 4HYUA 3LFEA 2VO7A 4JG8A 4V0GA 3DJ5A 3QQFA 5DT4A 1CM8A 3DXNA 3KQ7A 4D2WA 4QMVA 2C3KA 1KE6A 3WIKA 3WOWA 3OS3A 2BDFA 2PHKA 2VTNA 3TKIA 4CNHA 3N4TA 2QLUA 3FMDA 4EOKA 4RPVA 1GJOA 3ALNA 3F7ZA 4I22A 5BPYA 5HX8A 1WBOA 4G3DA 5JQ8A 3EB0A 3EQDA 3V8SA 3GCSA 3ZOSA 4XV9A 4PTGA 5IUGA 4IZ5A 5KZ0A 3VS6A 1U54B 3KXXA 4ANQA 2BDWA 4FSWA 3OZ6A 2QD9A 4AA0A 5J9LA 4RVLA 3BQCA 3BGQA 3EZRA 4L3LA 2CN5A 4JRVA 5CAOA 3FPMA 4NFNA 3ZUUA 3H4JA 4YLLA 4EI4A 4S32A 4YHFA 4CKJA 4K11A 4LI5A 4CFXA 4I4FA 2BRHA 3UOHA 2WTCA 4BCFA 2C6TA 4ANNA 2JKKA 4F08A 4GRBA 4TYIA 4E3CA 3Q4ZA 4BZOA 2XK8A 4J98A 4L43A 3LLAA 4O0UA 5J1VA 3QD4A 5ANEA 2J2IB 3ZSIA 4JIKA 3QC9A 4R78A 4CFMA 1H4LA 4QMMA 5LMKA 5H8EA 3RAKA 4U3YA 4TYHA 2CHLA 4DTBA 1OIQA 3NUYA 3VUHA 2IPXA 3KXZA 4FEQA 5GNKA 4I0SA 1H0VA 1PJKA 3PFQA 4CZYB 3SA0A 1FVVA 2FVDA 3CTQA 4L00A 4QQJA 3KN6A 2P2IA 4EEVA 3FLZA 3PG1A 3P78A 2XYUA 2Z7LA 5DE2A 4B99A 5AFVA 4MD7E 4ZY5A 3POOA 1UNHA 4MX9A 3DLSA 3NIZA 3R71A 4FG9A 4UY9A 4MXXA 4CTBA 4AA5A 4EBVA 4YP8A 5KMJA 2YIQA 4RZWA 4CZTA 3EQHA 3W1FA 4E4NA 2BRNA 4X21A 5L2SA 2I7QA 2DQ7X 2EVAA 3DV3A 4FG8A 4IB1A 4P4CA 1P4FA 4RZVA 2YN8A 2B9HA 2UW9A 4TWCA 2BRBA 5AADA 4TTHB 1FPUA 3OCBA 3PY0A 5AUZA 2FA2A 4WD5A 2WQBA 3I7CA 3D4QA 3GCUA 3QTXA 3UODA 4CCUA 2GFCA 2HW7A 4D28A 4LGHA 4LGDA 5AM6A 3SX9A 3VBWA 2YCRA 5CU6A 3UC4A 5JZJA 5HVJA 3VNTA 3UVRA 4WUNA 4XP2A 5CZHA 3HMOA 2JDSA 2PVFA 5CEQA 1GY3A 3RPYA 3VS2A 4NK9A 2CNVA 4DGOA 1O9UA 3FQHA 3RM7A 2UVZA 3GU5A 4E4MA 5D10A 4IFCA 4EH3A 2YCSA 3PJCA 5J79A 4L8MA 4NKSA 3DS6A 4FV5A 2PE1A 4GS6A 1S9JA 5DHJA 4N57A 2GS7A 2GS2A 4U41A 1OZ1A 5CZIA 5LXMA 5ETIA 2WMSA 3QF9A 2OIBA 3SW4A 2C6IA 3ZDUA 5LVMA 2HY81 5DH3A 2WTDA 1TKIA 3ZM4A 5M07A 4IAAA 4KIKB 3PJ8A 1PXIA 5L4QA 3VW8A 1Q24A 2J4ZA 4YC8A 4ZTNA 5FM3A 3NX8A 4CFVA 3FXWA 3FMMA 2FSMX 5HHWA 3ALOA 1Q8ZA 3KRXA 3RGFA 3WYXA 3C9WA 4EH8A 2OXYA 4FSMA 1XBAA 2GNJA 2YDKA 3MTLA 1YXVA 2ETRA 3NYNA 4RBLA 3RMFA 4EK5A 2IZSA 3NUUA 3KVXA 2XK6A 4I5MA 3TKHA 5CAVA 2ITYA 1QL6A 3P4KA 3CQWA 2FGIA 3R21A 2VTLA 4FBXA 3MGYA 4HYSA 4ZJJA 3FYKX 1PXMA 2J6MA 3IO7A 2VO0A 3EQCA 4TZRA 4QPSA 2BCJA 2X8DA 4KABA 3KXNA 1ZRZA 3E7OA 2XBJA 4KS7A 4HVGA 4YJUA 5EOBA 4YR8A 4ANMA 3PXFA 3CY2A 4FV9A 4IM0A 5IU2A 3MH3A 2YDIA 3CGOA 3OWJA 4BKJA 5DEWA 4EH9A 3QHRA 2ACXA 3PIZA 3WZUA 4EYMA 1CSNA 4O1OA 4LM5A 1BX6A 4P7EA 1ZOEA 3V6SA 4C62A 4D0XA 5J9YA 5T3QA 4QTCA 1J7LA 3FZOA 4KA3A 1ZYLA 3KRJA 3P0MA 5TOZA 1STCE 2X2LA 4GG7A 2CGVA 2O64A 2C4GA 3EYGA 4NTTA 1KUTA 5ANDA 3MPMA 5D9HA 4IAYA 4QOXA 5LVOA 4HYIA 4HVHA 4G16A 3WARA 1OKYA 4QP1A 1ZMVA 3OCGA 5J9ZA 2C1BA 2A4LA 1VZOA 5IMXA 2XS0A 2CJMA 3CGFA 4MBIA 3RZBA 1U5QA 2UV2A 2VWVA 5EM5A 4AE9A 1ZARA 4EONA 3MW1A 4UALA 4IWPA 3S2PA 1OM1A 2XJ2A 3GU6A 2YWPA 1G5SA 4CQGA 4LFIA 3O7LD 5C26A 3U9CA 4AE6A 5GIPE 3RJCA 4O7YA 3C4EA 4RIYA 2W17A 4ZIMA 4C4FA 2W1IA 3BLRA 3ZLYA 1DAWA 3MWUA 4IWDA 2W4JA 2ONLA 4IMYA 4Q9SA 4BDIA 2R3HA 4H1JA 2O8YA 4R8QA 3FBVA 5IQFA 3ZMMA 2PVYA 2ZV2A 2EB3A 2YCQA 4TYGA 2W1CA 4BDBA 4BRXA 2W1DA 4KKEA 4CFFA 4DC2A 3EN7A 5GIOE 5A4CA 2B1PA 4AT3A 4IVBA 1UU3A 4FTKA 4RWLA 4TYEA 4X2GA 2XIKA 4CRLA 4DAWA 2IZUA 1Q61A 2VTAA 4QTEA 4DT8A 2ITVA 4YBKA 2YM3A 2VWBA 4E5BA 4UMRA 3LFAA 4G5PA 4ENYA 1Q5KA 3K3JA 5HICA 4FEWA 1YQJA 2PE0A 4AF3A 5AR3A 3O2MA 5BUEA 5L8KA 4F4PA 4FYNA 2ITTA 2YM8A 4W4YA 2HZIA 3ZS5A 4O38A 5F9EA 4IZYA 2X9EA 4CG8A 5HG8A 5I3RA 5HVYA 4UX9A 2PYWA 3FHRA 3H10A 4ZEGA 1OECA 3ZCLA 3MS9A 1JQHA 4U0IA 4FKTA 1JLUE 5CI6A 2VWXA 3AMBA 3VIDA 4YNEA 3PY1A 5AX9A 5AAEA 3CIKA 3RPSA 3E5AA 3BRBA 4II5A 4YZBA 3TKUA 2W1HA 2C47A 4N6ZA 4ZSJA 2J0KA 1H00A 3A4OX 2XIRA 3SG8A 2HZ4A 3PSBA 4HJOA 4S34A 4PTEA 3EL7A 2H34A 1H1QA 5DR6A 1JSVA 4AGDA 4C2VA 3H9OA 1A9UA 4PDSA 4DH5A 4CT2A 2GNHA 1KV2A 3IK3A 2Y8OA 4HPUE 2UW6A 3VS7A 2QKRA 3QQJA 4JT3A 4XBUA 1H1RA 3D0EA 3II5A 3PJ3A 4C57A 3ZRLA 3RPOA 2BKKA 3OUKA 3PRFA 4O7SA 4FT5A 2B53A 2PWLA 2C6LA 3E8CA 3ENHA 3KULB 1JPAA 4U81A 5HIEA 3E63A 5EYCA 2EXEA 4RSSA 3NNUA 4X3FA 4LUDA 5KMKA 4PL5A 4OLIA 3SRVB 3QQLA 5TKDA 4W9XA 5GJGA 4U97A 5B0XA 1I44A 2QODA 4LRMA 4RVMA 4ZTLA 4EK3A 3GT8A 1OBGA 2V0DA 2RL5A 2E9OA 5ANKA 2B4SB 4QTAA 3WF5A 2WIPA 3ZUVA 3AC4A 3TNHA 3VRZA 2O5KA 1RDQE 3W2SA 4G5JA 4M66A 4GKHA 1OL2A 3L8SA 3QKLA 1F5QA 4RC2A 5DOSA 5HO6A 2XK7A 4YTIA 4EOIA 2XRUA 3VULA 3OEZA 5KMNA 3TT0A 3UVPA 4AUAA 1QPJA 4GT3A 2HK5A 3F2RA 5L2IA 3IG7A 4AN9A 1HCLA 2YFXA 3V5QA 4QNYA 4KRCA 2J0JA 4IB0A 4PTCA 3E88A 2ZMCA 5HU9A 4BCHA 5AUYA 1CDKA 3LAUA 5IQEA 3CD3A 3QD3A 2PVNA 3KFAA 2QCSA 5FBOA 4AN2A 4EH5A 3TZMA 1Q41A 3LIJA 4FEXA 2VV9A 3BE2A 4PPBA 2QQ7A 3HMPA 4FZDB 4DG0E 4DCAA 3PYYA 4RT7A 3R1SA 4QP9A 3IDPA 4TWOA 4U42A 1V0PA 4ZS4A 2Q83A 2BZHB 4U45A 4QYEA 4APCA 4J53A 5BNJA 2ETMA 1H1PA 4D9UA 4FUXA 3MPAA 3ELJA 5CYIA 4FYOA 4BGQA 3EHAA 3QX2A 3FY2A 3F2AA 2HAKA 3UIUA 5HTBA 3C1XA 5EYKA 4EH7A 5CAUA 1CTPE 3BV3A 4NIFB 3UTOA 2NRUA 1QPCA 1YI4A 4F1TA 5HE1A 5I9VA 4YZDA 2E9UA 2GHLA 3OFMA 4GT5A 5AP0A 2BIYA 3PXYA 3F3VA 4C2WA 3RHXA 1O6KA 1PYEA 4XG4A 4CLIA 3BWJA 3HVCA 4I5CA 3ZO2A 4V05A 1PXNA 3DDPA 4O0RA 2PMNX 4FKRA 4QYFA 3FC1X 4R1VA 4WOVA 3FYJX 5EG3A 4FZAB 5KKRC 3LJ1A 2ITUA 4MNEB 5J8IA 4F7NA 4ALVA 3RKBA 4NH1A 1P14A 4QP8A 3FI4A 4XP0A 2J0MB 3HMNA 4AGWA 2X2KA 2XNOA 5DI1A 2V55A 5AP4A 4IH8A 2C5YA 3DAKA 4FEVA 2RFSA 3MFSA 5C8MA 4PMMA 4QPAA 5EH0A 5C4KA 2ZB0A 5EKNA 3BEAA 5JEBA 3SLSA 2QU6A 3PJ1A 4W4WA 4W4VA 3VN9A 4N4SA 3K5VA 1L3RE 5CVGA 3RCDA 3VWAA 4E4LA 4EYJA 3G9NA 1JWHA 4FV8A 4ZTRA 4YC3A 4DEAA 3DZQA 1FBNA 3FKOA 3HAMA 2C0IA 3LCTA 3DKGA 4BTFA 1ZWSA 4PMTA 5IA4A 3A7GA 3Q9YA 4DGGA 1MRYA 4BF2A 1F0QA 1V1KA 4MQ1A 4BN1A 2PSQA 2XKCA 3QTSA 2H6DA 5FXRA 2OW3A 3NW6A 4LOPA 1BYGA 4GFGA 4OBPA 2Z8CA 3QGYA 4IZAA 4TL0A 4GU9A 5J7BA 3TM0A 3S95A 1PXLA 3DTCA 1M2PA 1IA9A 4FTQA 1BL6A 1VR2A 2XNMA 3EFWA 3N9XA 4IX3A 3OW4A 5AV4A 4LMNA 4I5PA 4Q2AA 4UMTA 4YO6A 4IM2A 2R0IA 4PNKA 1PMVA 2BZKB 3G33A 4HGLA 4ZLYA 3FMEA 3NVMB 2Y0AA 3PPZA 3RWQA 1R0PA 3NUSA 4DGMA 1Y57A 5L6PA 5JN2A 3PVUA 5J87A 3I79A 1Y8GA 3NW5A 4O6EA 1OIYA 5FDPA 3F7WA 3EQGA 4EOLA 4WNMA 1ZLTA 4WKQA 5LJJA 3IECA 2IG7A 1PYXA 2FH9A 1K9AA 4BCOA 4HGTA 2VX1A 3A62A 4EOOA 1WZYA 3EQIA 3AT2A 4FOCA 4E6DA 3LQ3A 1ZYSA 4AZVA 3GBZA 3H30A 4FK6A 4XG2A 3ZM9A 2AYPA 4RMZA 3QUDA 3L9MA 4M8TA 2W9ZB 3C0HA 3QC4A 4NJDA 2VO6A 3SV0A 3P1AA 4ZLZA 3BHVA 1DAYA 2RG6A 5TO8A 5H2UA 2WIHA 4HZSA 4JBQA 4FSNA 2UZTA 4D2TA 3SXRA 2QNJA 3HMMA 2JBOA 3UPZA 1YDRE 2I0VA 4N0SA 4AZTA 4K77A 2BAJA 3A7HA 5DWRA 3HMIA 1YXSA 4WG4A 4PDOA 5DG5A 2B7AA 3GFWA 4TWPA 2WGJA 4AGUA 4AZSA 3HDNA 5IG1A 5KUPA 4AX8A 3LW0A 1W7HA 2VTOA 3QD0A 3BBTB 3H0YA 4KAOA 5T68A 2OJGA 4NT4A 3L1SA 1F3MC 3W8QA 3ZBFA 2DYLA 4FKOA 5DNRA 4YTFA 3CY3A 3DY7A 5AM7A 5L6OA 1SZMA 3SG9A 4C36A 1ATPE 3P08A 3DXPA 4MXYA 4RFZA 1OKVA 1CKPA 4OR5A 5AV1A 5HGIA 3PA4A 5AA8A 2O65A 3MN3A 1UWJA 2WELA 2YISA 4FZ6A 5KKRB 4BTJA 3KF4A 3QFVA 4V04A 3SOAA 3MVHA 2WMBA 4L67A 5LOHA 4EUTA 3GC0A 4H36A 3ZTXA 4JG7A 2XKFA 4BI2A 4S30A 4RIXB 1B38A 2B9JA 2WOTA 1SMHA 1YWNA 4DA5A 4C7TA 4CCBA 2VX3A 3QTWA 5CF4A 4I41A 2GQGA 4H1MA 4OUCA 5KCVA 3JR1A 1ZAOA 1IRKA 4L53A 5CU3A 4CXAA 5BX0A 4MF1A 1NVQA 4GFMA 5M57A 1FOTA 4O81A 3R83A 1MQ4A 3FPQA 4CMUA 4Z55A 1UU9A 3LLTA 1MUOA 4ERWA 2J5EA 3COHA 4L42A 3R22A 4CVAA 3FDNA 2YHVA 4BICA 1M14A 4EZ3A 3NWWA 4AU8A 5CSPA 4C35A 2GQRA 3QAME 4EWQA 2QG5A 2YAAA 4UN0C 3IW5A 4OTGA 2YIRA 3FI2A 4PY1A 4Y85A 3UYTA 4D2PA 3TUCA 4R3CA 2ITPA 3Q52A 1Y91A 4AP7A 3PZHA 4IJPA 4QMYA 5BVOA 3GQLA 5A54A 4WG3A 1H01A 4DLJA 3G2FA 3PA3A 1J91A 5M4CA 5FGKA 4IAFA 4A07A 5IH4A 1L8TA 1H1SA 4GJ2A 4MAOA 4O83A 4AW1A 4BCIA 1K2PA 4YJQA 4QMPA 4JI9A 5CWZA 4DT9A 4FIJA 1REJA 4A9RA 4F9BA 4F09A 4KIOA 2FUMA 2ITWA 3W2PA 5BVEA 4MXCA 1PMUA 3WE8A 3B2WA 3BI6A 3KMWA 4IXPA 5HE2A 5IQHA 2XP2A 2CKEA 2JIIA 3MVMA 1H25A 4ARKA 3CSVA 2IZTA 1XBCA 4GKIA 2OICA 4R7BA 2BPMA 3UIXA 2W99B 2GFSA 3OBGA 4G34A 4KBCA 4WRSA 4B8MA 2PVKA 4RWIA 4TW9A 1H07A 2RGPA 1P5EA 2B9IA 3LJ2A 3ZC5A 5EI6A 5AP6A 4JQ7A 3DLZA 3D5XA 4F1MA 2PZIA 2VNYA 1YWRA 2J9MA 2R3OA 4QMUA 3DBQA 3DBCA 1NY3A 2JGZA 3A61A 4K8AA 1JSUA 3R7OA 4ALUA 3VW6A 4UBAA 4K0YA 3CJGA 3ROCA 4KUJA 5CVHA 3ATTA 3NYVA 1Z9XA 2BVAA 3UIMA 4PRJA 3L9PA 4MBLA 3U51A 3QX4A 3DXQA 4FK3A 4L3JA 3SKCA 3O0GA 2ESMA 4GFOA 5CXHA 1H24A 2NP8A 3UG2A 3CPCA 3W32A 3EOCA 3ATSA 5IDPA 4O7WA 2C0TA 4X0MA 5AP1A 5K0KA 1W82A 1NXKA 4IX4A 2ZJWA 4FTRA 2ITZA 3NR9A 4JAJA 3WILA 5CXZA 5JFWA 2PUNA 4EQUA 3KMMA 3DTWA 5BQ0A 2FSOX 3FZSA 4MKCA 2P33A 3M2WA 4FV3A 3TUDA 4EK8A 3LCSA 4WBBB 4FTUA 3NEWA 4BBEA 2UZDA 4PL4A 3NSZA 3BHYA 1Y6AA 5DT3A 4DFXE 5J5TA 4C37A 5KE0A 2CLXA 2GHGA 3DBEA 3JYAA 4AOIA 4BDKA 2HYYA 2IVVA 3FSFA 3CXWA 4DFLA 1UU7A 4I24A 3TI1A 1Q99A 2WOUA 3AGMA 5CNOA 4K9YA 3W33A 1OL1A 4F7SA 4KINA 4RGJA 3R1QA 4L46A 4NL0A 3L8XA 2Y6OA 1Q3WA 2R3JA 1XJDA 3F5UA 3I6UA 1M17A 3D2IA 3EWHA 3VVHA 3HRBA 2QI8A 4LMUA 3WZDA 3ZO3A 2Y4PA 5I9XA 2OGVA 4DE4A 4DGLC 1PXOA 3NCZA 5EFQA 5AUWA 4E7WA 1Q4LA 4O6LA 4JL9A 3LFSA 4BKZA 3R2BA 4TT7A 5CSHA 5E8UA 4RIOA 2OJJA 3S3IA 4D9TA 4FV0A 3O71A 4CSVA 2QG7A 2WEVA 2GNLA 3FMJA 5D7AA 3UG1A 4YZCA 5CT0A 4F7JA 4BCJA 4ZSAA 4D1ZA 4E93A 4ZJVA 4Y5HA 1TQPA 1WVXA 2XJ0A 2R7BA 3D15A 4ASEA 3RCJA 2YLFA 2WU6A 3BYOA 2HWPA 1G8SA 1U46A 2B9FA 3RK7A 3PWDA 4WNPA 3OY3A 1AD5A 3NZ0A 3TTIA 5IA0A 2ITOA 4FNYA 2PMIA 3WF9A 4H3PA 4GV1A 3L8VA 4BIEA 3TV7A 3DNEA 2C6OA 5C27A 3V5TA 5DGZA 3TL8A 3Q9ZA 5IH5A 5DFPA 1T45A 2C1AA 4Y8DA 3UVQA 4FNWA 4X3JA 4L45A 3PVWA 4GCJA 3V5WA 1WCCA 1JSTA 2WMAA 4NSTA 3V5LA 3FC2A 4D1SA 3ORNA 2VAGA 3QUEA 2IJMA 4XUFA 5BVDA 4K33A 4ITHA 4L7SA 3NCGA 4I4EA 4QP3A 1U5RA 1UU8A 3B8QA 3V8WA 2C6KA 4DG2E 5KBQA 5HG9A 2PPQA 3AC2A 2HZNA 4XRLA 4C3FA 3EQPA 4M12A 3N4UA 4EH6A 2P0CA 3MY5A 4PDYA 2AC3A 1OMWA 2IO6A 5AP2A 4E6CA 2VUWA 2HCKA 2R3GA 1YKRA 4RJ4A 4CT1A 4AW2A 4RLKA 2Z7QA 3FJQE 4A9YA 4EKKA 5BVWA 3UNKA 3FWQA 1WVYA 3OOGA 3NNVA 4QO9A 4XOYA 5CY3A 5EOLA 5A14A 3U55A 3JY9A 3LCOA 3KRRA 4GIHA 3QZFA 3NNXA 2QHNA 1FGKA 4IAZA 4BWKA 3COKA 5CEKA 2DUVA 4G3EA 5CU4A 2BROA 4XG7A 5C8NA 4CGAA 4P90A 3U54A 2HOGA 4Q5HA 5CEPA 2CKOA 4K1BA 3MJ1A 4X2JA 3KGAA 4QMLA 2OO8X 4I5HA 3LCKA 4QD6A 3PZEA 3QTQA 4YJSA 2QOHA 3PRIA 4R7HA 5LMKC 4EK4A 4YLKA 3QQKA 2CPKE 4JIAA 1BLXA 5CF8A 4FE2A 2W0JA 2PE2A 3DFCB 5KMIA 2BZIB 1IA8A 2QU5A 5AR5A 4NCTA 3G15A 3Q2JA 4BDFA 3ETAA 4FIHA 2GMXA 4BDAA 5HESA 4EJNA 2P2HA 3BHTA 3ZLSA 2OZAA 5CLPA 2I6LA 5L2WA 2QHMA 3VF8A 3E87A 4RWKA 3QRKA 5GZ8A 4EKLA 2OH0E 2PVJA 1BMKA 3HUCA 2VTMA 4OT6A 4AA4A 3OTUA 3UNJA 4TXCA 3LFDA 3NLBA 4K6ZA 2LAVA 4E8AA 3AC3A 4YUQA 5IA2A 1IR3A 3ZLXA 3LXKA 3Q32A 4LRJA 4EK6A 5FBNC 4C8BA 4HZRA 2A19B 4RVKA 3EN9A 2JIUA 3HNGA 4YJVA 2BHEA 4Q5EA 5HEZA 1HOWA 2V7OA 3ULIA 2CSNA 5F95A 4NWMA 4LRKA 5HCZA 4IACA 5L3AA 5DT0A 4HYHA 3AD6A 4YC6A 4M69B 5FM2A 1SVGA 5AP5A 5JSMA 3S00A 4O86A 4JX3A 5E8VA 4ALWA 5CSWA 5CVFA 3PXKA 3REPA 3QLFA 5EQEA 1ZOHA 2RF9A 1BI8A 1JKTA 3QCYA 3VS1A 3EIDA 4ACMA 1OL5A 4GUBA 4I93A 2VTIA 4A9UA 2G2IA 5A9UA 5AR7A 3SAYA 4FX3A 5A4QA 3R8MA 3QRTA 5CALA 3AC5A 2VTTA 1IASA 4RJ5A 1J3HA 2HXLA 4BYJA 3NNWA 4A06A 3NW7A 2F4JA 3GUBA 2RFEA 4QT1A 3FAAA 5D7VA 5ETFA 4AZFA 2CCHA 4V0GB 4UB7A 2B55A 2QR7A 4B7TA 3MDYA 2GDOA 4UWBA 4EQCA 3QHWA 2YM7A 5IH6A 4DN5A 3D9VA 2UZVA 4OAVB 3OHTA 2C6DA 5CU2A 3C51A 4F9AA 3BX5A 3RAIA 3LXPA 1AQ1A 4HOKA 3D5WA 3EFLA 4HNFA 4CZUA 1OUYA 3GQIA 1G8AA 2UZOA 4GSBA 4Y73A 1URCA 2VD5A 3DB8A 4KD1A 4OBOA 4XG9A 4Z7HA 4FSZA 3FLNC 3GU7A 3BU3A 1ZYDA 2VWWA 3GCQA 3CTJA 4UV0A 4JLCA 4IZ7A 4D5KA 4DYMA 3TJDA 2EXCX 4FKPA 4X7QA 5AP3A 4G17A 3BU5A 1OPJA 2CDZA 4JBPA 3QKKA 3QTIA 2JFMA 4C4GA 5L2TA 4FSYA 4OW8A 5K9IA 4QMXA 4FF8A 3UOJA 3JVSA 5E91A 4APPA 3LHJA 2BALA 4U8ZA 2YJSA 1TQIA 4BBMA 5DBXA 4O2ZA 2V22A 5BVNA 5EHOA 5I5ZA 3D7TA 4PP9A 2BMCA 4DTKA 4ZJIA 4DEGA 4R1YA 4PPAA 4RIWA 4MVFA 3RPRA 3TNQB 4MHAA 3GFEA 4TYHB 3I0QA 2ITQA 4U43A 3WZJA 1X8BA 3O8PA 4RJ8A 3F3WA 4BIDA 5JGBA 1VYWA 5HBJA 1OPKA 3EFJA 4FV4A 2BAQA 4L7FA 4MK0A 3OOMA 5HLWA 3TNWA 3TNPC 4CV8A 4HNIA 5AX3A 3HKOA 2G15A 2QO7A 5FUTA 4G3FA 4ZTHA 4NTSA 4EUUA 4DBNA 3Q9XA 3DAJA 1I09A 3ORIA 2VWYA 2X81A 2ONLC 3R9RA 4I0TA 4BYIA 5DLSA 2R3QA 3FL4A 2XUUA 3Q96A 4CYIA 3BZ3A 5I9YA 4XLIA 3NUNA 3SOCA 2G9XA 4IE9A 2XH5A 3HV5A 3PXQA 5DPVA 2KULA 3IQ7A 4LOOA 4ZOGA 5JRSA 1MRVA 4XP3A 4FT0A 4YPDA 4EWHA 2JKMA 3CS9A 3RZFA 5K3YA 4G9RA 1DM2A 1ZY4A 2BAKA 5BYZA 1VJYA 3ANRA 3LVPA 4DFUA 4WBOA 2W05A 3HRFA 3DK6A 3E8NA 3K54A 3ZHPC 2XK3A 3PG3A 4F9YA 3F2NA 2WNTA 5ACKA 3R9DA 3LZBA 2R3NA 2QOIA 3AD5A 3EN5A 3FMKA 4QP7A 3MTFA 4FA2A 4ZLOA 4ONAA 2OZAB 3KK9A 3R73A 5AWMA 5H3QA 3BE9A 3IS5A 1WBSA 5F94A 2XIYA 5HZNA 4MD8E 4DCEA 1Q62A 3T3UA 3LJ0A 2R3MA 2W5HA 3OBJA 3EKNA 4BCKA 4EHZA 1Y8YA 1OL7A 3KB7A 4M67A 4ACHA 5IDNA 2GU8A 3BKBA 4GL9A 4XS2A 3UGCA 5FG8A 5M56A 2OXDA 2WMTA 1WAKA 4EOMA 4G2FA 1SNXA 5A4TA 3I6WA 4AW5A 5EM8A 2RIOA 2VTPA 3ODZX 2I0YA 5LVPA 4F63A 4YJOA 3T9TA 2OBJA 3V01A 4ASZA 2ZV7A 3PIXA 2PMLX 2JC6A 4GG5A 4F6SA 1ZZLA 2OK1A 5CQUA 4K18A 2CGXA 5FRIA 1KOBA 3QQHA 4FR4A 4GT4A 2IWIA 5EM7A 2PU8A 2HZ0A 1NVRA 2W9FB 3QL8A 5KBRA 1WFCA 2GSFA 4X3FC 2IVUA 5C1QB 4BTMA 4NJ3A 4O7LA 3Q6WA 3L9NA 4M68A 1Y6BA 3EL8A 4DITA 2W7XA 2XKDA 3HZTA 3PJ2A 2VTHA 2UW8A 4JDKA 3OWPA 4CKRA 2R2PA 3QA8A 4KS8A 2OKRA 3ZU7A 5CEOA 3I5ZA 5C01A 3F82A 3RM6A 3OC1A 2XVDA 2G2FA 3R7GA 3FV8A 4FT3A 4XCUA 5HBHA 5AUUA 4BY9E 3ORTA 2X9FA 4MWIA 3ZONA 5JKGA 2X8IA 4U6RA 3U4WA 3OCSA 1RW8A 4BWXA 1A48A 3C4FA 3PSCA 4DF3A 2XNBA 4EHEA 4DFNA 2XIZA 5IQDA 3UZTA 4O0TA 5LVLA 3AG9A 3HYHA 3F6XA 4A4XA 4ZMFA 3UO6A 3O17A 3UMXA 3U9NA 1FINA 5K5NA 4MXOA 3DT1A 3R7VA 4ANBA 1ZYCA 5IQCA 4DFBA 4YLJA 3I1AA 2WMUA 3GCVA 4XG8A 2J0LA 1E1XA 3ZEWA 1DI8A 4E73A 2VGOA 5I4NA 3EMGA 4DFYA 3GB2A 4H3BA 1OKZA 4XNEA 1M2QA 5CENA 2X0GA 3FLQA 2ITNA 1ZYJA 3U6IA 3BQRA 4RIYB 3QU0A 1OIRA 4EH4A 1CKIA 3UO5A 5IZFA 1WBNA 4YBJA 2X39A 3QYZA 2JEDA 2CKQA 2CGUA 2QOFA 3K5UA 4XBRA 2LGCA 3CEKA 3ORZA 5CQWA 3DFAA 3GEQA 3QA0A 5E4HA 4EOPA 4C4JA 2BILB 4MWHA 4F7LA 4OGRA 2BUJA 1KE9A 4HGSA 4N70A 2UZEA 4RJ6A 2WMQA 2XCHA 4BCNA 1NT2A 3MVLA 3JPVA 5HD7A 1R39A 1XQZA 4TRLA 3DBDA 3QQGA 3I4BA 3D94A 5EQYA 4DBXA 2PVRA 1UNGA 4R3RA 2X7GA 4WSYA 1OL6A 5DA3A 4ZY6A 4X6QC 4BDJA 4F65A 2WKMA 3EJ1A 1KE7A 5J95A 3MESA 3DZOA 4QYGA 1B39A 3NAYA 1S9IA 2XF0A 3FQSA 2OXXA 3M1SA 5F20A 3GC8A 4FC0A 4EC8A 3HRCA 4W9WA 4EHVA 3MFTA 5EHLA 4IB3A 3IW4A 2QONA 3KU2A 4CG9A 2YWVA 1FGIA 4ASDA 4BDGA 3BBWA 3C13A 3UQCA 2HXQA 3E64A 4ZTQA 4I21A 1YI3A 4JOAA 1WMKA 4YZ9A 4D4RA 4ZZNA 4U44A 1MQBA 2OJFE 2OSCA 2A0CX 3O7LB 1GIHA 4RLLA 4JDIA 3AT3A 1ZXEA 4G3GA 4QTDA 2OI4X 2V7AA 4A4LA 4XLVA 5A46A 2GCDA 5BUJA 1IAHA 4O0YA 3OUNB 2F7ZE 4CTCA 4KB8A 4OBQA 3R1NA 3WYYA 3C50A 2ZM4A 4PF4A 4B4LA 3T3VA 2YM6A 4RX5A 1FVRA 4H05A 2PUIA 1PKGA 2WEIA 4AFEA 4USDA 3MIAA 2EXMA 2VZ6A 4FTOA 4I92A 3DK7A 4JBOA 5AV3A 2XRWA 2QOCA 2Z7SA 2JD5A 2R3FA 4IC7A 4X3FB 1KSWA 2AUHA 2QOBA 2XK4A 4TWNA 1H27A 3OMVA 4FKGA 4L6QA 5L8LA 2R64A 4AFJA 2XK9A 1GOLA 2VU3A 3O8TA 4YGAA 3FEGA 2A27A 4D4VA 3ZH8A 3F88A 1YXUA 4MF0A 3UZPA 4B6LA 4DH8A 3DU8A 4UMPA 4L52A 5C03A 3G0FA 4X2NA 4D4YA 2G01A 3DPKA 4FT7A 4GYIA 4M13A 4O22A 1YRPA 2NO3A 5CNNA 4G31A 4I6FA 4MQ2A 4TN6A 4KKGA 3PDTA 3E8EA 3OVVA 4I0RA 2Y9QA 4M3QA 2XNGA 4GUEA 5JK3A 4MXZA 4A9SA 3HGKA 4DFZE 5CEIA 4YTCA 4GEOA 4KKHA 2YIWA 4BCQA 3RHKA 4IAIA 4FT9A 4CFUA 1J7UA 2XEZA 3LKMA 3ZFYA 2QO9A 2WTWA 3MH2A 3P9JA 4AS0A 2G2HA 2OIQA 5C9CA 4FI1A 4C4HA 3LMHA 2P4IA 5JFXA 5AIKA 3F5PA 4FG7A 3FMNA 3QZGA 4E6AA 3WF6A 3PXZA 3UQFA 3FL5A 3I0OA 2WQNA 3QKMA 3M42A 2YLEA 4GW8A 4JBVA 4RC3A 3HV3A 4ENXA 5D11A 4ORKA 3DJ7A 3THBA 2YM5A 2R7IA 1YI6A 2PY3A 5AR8A 3FZ1A 3TUBA 3SVVA 4ANSA 5B2MA 3IGOA 1H1WA 4HCTA 2PMOX 3OCTA 3D2KA 3AT4A 4PMPA 3UZRA 4LV5A 2YZLA 4WUAA 3TDVA 2I1MA 3S0OA 5ANGA 4LL5A 3CPBA 4HVSA 1MRUA 4FIGA 3NDMA 4OTWA 4AXAA 3QZHA 1WBVA 2XBAA 4BL1A 5HQ0A 1KWPA 3R9OA 3Q4TA 4D1XA 3AOXA 1W84A 4FOBA 3I60A 4BB4A 1PXJA 3LFBA 1U54A 4XV3A 2X6DA 4ZAUA 3ANQA 1NA7A 5EW9A 3HDMA 1UKIA 3AMAA 2ZOQA 3AGLA 3HV7A 3NPCA 3ACKA 5HE3A 3OY1A 4FKIA 4QMOA 3HA8A 5GJDA 1T46A 1RJBA 3DB6A 3BWFA 2OJIA 1FQ1B 2W5AA 3FMHA 2WQMA 5HORA 1XH7A 2YA9A 5AAFA 5AIRA 3BYVA 5HE0A 4UYAA 3ZLWA 4ERKA 4ACGA 4YJPA 4LOQA 4FSQA 3ZZEA 4C4EA 4LV8A 4FEUA 3OXIA 3RK9A 3MSSA 1KOAA 2QOOA 3OF0A 3PPKA 3C4WA 3KRLA 3BIZA 3HP5A 2RFNA 5K4IA 3R0TA 1CKJA 1GAGA 2CNQA 5DIAA 5DMZA 4FTIA 4LG4A 4O96A 5CF5A 3UIBA 3MPTA 1QMZA 4ZS0A 3T8OA 4WSQA 5F4NA 1WBPA 3VS5A 5LWNA 5CT7A 4J97A 1LP4A 4P5ZA 3G5DA 3R28A 3COMA 4O0XA 4RX8A 2Y4IC 1LUFA 4TNDA 2PL0A 3HAVA 4F6UA 1YVJA 4QTBA 4J8NA 3GP0A 3ZFXA 3QZIA 4AAAA 3EH9A 2YABA 2YIYA 1Z5MA 3WIGA 4O84A 3WZKA 3BPRA 3SXSA 4OTFA 4LYNA 3HUBA 4RX7A 1GZNA 3LE6A 3F66A 3I7BA 3IW7A 4RA4A 4MEDA 2BRGA 4PDPA 1UNLA 5D1JA 4I23A 2XZSA 4JVGA 3K3IA 3QUPA 4C4IA 4OT5A 3WBLA 1M2RA 4FSRA 1GZKA 2R3IA 4FTMA 4QYYA 3TJCA 3O8UA 4AG8A 4C02A 3D14A 4ACDA 1JVPP 5FTGA 4BCPA 2OLCA 4O0SA 2RSVA 4FV6A 3W10A 3PE1A 3QRUA 2CKPA 3AMYA 3R2YA 2OFVA 3RPVA 4R7IA 4G6LA 2GS6A 1MP8A 5IUIA 3GENA 5LVNA 3CKXA 3IOKA 3BHUA 2XB7A 3F9NA 5HX6A 2YEXA 3R8VA 5E90A 3V04A 2R3RA 3OP5A 3R6XA 3P79A 3U4UA 5AV0A 3GU8A 4H39A 3E7VA 3FXZA 4OTHA 5GINE 4USFA 3VS0A 4KIKA 3PPJA 1Q8UA 2WPAA 1LEZA 4U80A 4NM7A 5LCJA 5M51A 1ERKA 4PPCA 4YHTA 1YDSE 5I9ZA 3F5GA 3RAHA 2V5QA 3H9RA 4WIHA 3FLYA 5CEMA 1YOJA 4UEUA 5EDPA 5CAQA 4HGEA 1Q8YA 3PVBA 2XCKA 3SW7A 4QMNA 2HWOA 4YSJA 4FGRA 4GK3A 2BDJA 4QNAA 5ACBC 3QQUA 3QLGA 3R8ZA 4JNWA 2X7FA 4WHZA 3UPXA 5HU3A 5E8YA 2R0UA 3R30A 4FNXA 4QMSA 3R00A 1Q8TA 2OIDA 3ZRKA 4D58A 4MH7A 3EZVA 1PF8A 3BELA 3FKNA 4WRGA 3HX4A 3VUKA 4ITIA 5EW3A 3MA6A 3C4XA 2E9NA 2WO6A 3ORLA 4JQ8A 3V5JA 4I94A 3R9NA 1UA2A 5KMMA 4C59A 5ANIA 2EU9A 3UO4A 5EDQA 2J50A 4H3QA 2Z60A 4NW5A 3KEXA 3UDBA 3F5XA 4I20A 4J7BA 3ZZWA 2YJRA 5LMBA 5M55A 3CE3A 2PULA 5E1EA 5FEQA 3ROYA 5KHWA 5EHYA 3EN6A 5ANJA 1OBDA 2EUFB 2YITA 3FZRA 2E9PA 4QPMA 4L01A 4GVJA 3U6JA 3ID6C 4HCVA 3KCFA 2WHBA 5HNBA 3BYMA 4K2RA 1EH4A 2GHMA 1RQQA 2CLQA 2OFUA 3C0IA 4BGGA 1H0WA 5CSXA 3A7IA 5C8KA 3S1HA 4FTTA 2Y4IB 4FVQA 1B6CB 4YPSA 1URWA 1XBBA 4GU6A 4U40A 4IIRA 3PIYA 5FP6A 3RINA 3ZXZA 3Q4UA 4DEEA 5IEVA 3UP7A 4XH6A 5E8WA 3R7UA 2H8HA 2HELA 2WMRA 4E20A 5KO1A 3ORPA 4BC6A 4W8EA 4BFMA 2WMVA 1DI9A 3TWJA 3KREA 3P86A 4YO4A 5I9UA 4C34A 4G6NA 4I3ZA 4YTHA 2Q0NA 3TIYA 3GC9A 3PSDA 3M11A 3TEIA 2W1FA 4QRCA 4BZDA 4P2KA 5DR9A 3R9HA 3E3BX 2YAKA 3W2OA 3LFQA 3HECA 4CMTA 4F99A 2XNNA 2SRCA 3DCVA 3C4ZA 3MY1A 5EI2A 4YHJA 4PX6A 4FICA 2BRMA 3OW3A 5FXSA 2VGPA 4EC9A 2VO3A 3RBWA 1H26A 3ITZA 5BUIA 5J5SA 4ZMEA 1PXPA 1VYZA 4Q9ZA 4YZMA 3JS2A 4XRJA 3CC6A 2EWAA 3C0GA 3Q2MA 1LPUA 4FKJA 4R3PA 3ZSGA 3C4CA 4B0GA 5EW8A 2FSTX 5IA3A 4MTAA 2WAJA 1XKKA 5GHVA 4LL0A 3FMLA 3ZXTA 4GMYA 2F2CB 4PV0A 4D2RA 4Z3VA 4FKQA 1YWVA 4QP2A 4RRVA 2X7OA 3BCEA 4OTIA 5CI7A 5HO8A 5BVKA 3VBVA 2PVMA 2YZAA 4R5YA 3PA5A 3HV4A 5AV2A 3QTUA 3W2RA 3KK8A 3VJNA 2EB2A 2JDVA 3FE3A 2JKOA 4I6HA 3OT3A 2IW8A 4ASXA 2JIVA 4BCGA 3GNIB 5ITAA 4KSQA 4IAKA 2WTVA 5L2QA 2OG8A 5J1WA 4EL9A 2BTSA 5EM6A 4AOJA 4DG3E 5E9EA 1TVOA 2J90A 3UYSA 3OTVA 4IVCA 3GXLA 3NUXA 2AC5A 4PWNA 3UC3A 3CQEA 3V6RA 3KULA 5H9BA 3NMUF 5A6OA 4KWPA 4M97A 3CLYA 3NRMA 3CTHA 2FSLX 3QBNA 3COIA 3PWYA 5HIDA 2VTJA 4CEGA 4WNKA 5JZNA 2YM4A 2W1GA 1TQMA 2UW4A 3SRVA 4U5JA 5B2LA 4AGCA 3H0ZA 2UZWE 1U59A 3B2TA 3LFNA 3SXFA 4HVIA 3NUAA 3HL7A 4OTPA 3BHHA 4F9WA 4JDJA 4ACCA 4OTDA 1RE8A 3QCXA 3A7FA 4FGBA 4YMJA 3VO3A 2UZLA 2WZJA 3ODYX 5IEYA 1YHWA 1CMKE 3KA0A 4FKSA 3IW6A 2FO0A 3C5UA 4NCTC 5JH6A 3ERKA 3PLSA 5JQ5A 1NW1A 5I9WA 3ORKA 4TY1A 4XEYA 3JUHA 5FD2A 4ZZOA 3NVKI 3DQXA 3G51A 2BKZA 3Q3BA 3R02A 2ZDUA 3PUPA 4M15A 3P7CA 3HP2A 4QMTA 2XA4A 1YHVA 3BU6A 3CJFA 1LR4A 3DOGA 3ZC6A 2NNWB 4R6VA 3VRYA 4C38A 4C3RA 3LFCA 5AA9A 5CU0A 5IISA 4R77A 2R4BA 3MFRA 4DINA 4O7TA 4GVAA 3HEGA 4UZHA 4A4OA 3VQUA 2OWBA 3A2CA 4W4XA 3LXLA 2B52A 4ZTMA 4O82A 2XM9A 1Z57A 3LPBA 4FTCA 2ZM3A 2RG5A 2YDJA 3BYUA 3CCNA 3E8DA 3E92A 4FSTA 5DN3A 5ETAA 5G1XA 4AZEA 2X4ZA 4D4SA 5M4UA 1M7QA 5I0BA 5BYYA 3I5NA 3PP1A 3O51A 4G6OA 5EYMA 1ZMWA 3U87A 2J7TA 2PZYA 2GNIA 1ZZ2A 5HG7A 3OT8A 3MH0A 2WFYA 4FTNA 3VQHA 2W4OA 2ERKA 2OF2A 3AC8A 3QWKA 2JKQA 5D12A 3A8WA 5AUVA 1JOWB 5A4EA 5BYLA 2VX0A 3DKFA 3IGGA 1H28A 2H96A 2JLDA 3PP0A 1KV1A 4UYNA 3RTPA 4NIFA 5CX9A 5HIBA 3KC3A 3LQ5A 3C7QA 4CQEA 5AR4A 3KXGA 3G9LX 2F7EE 1PRYA 3FI3A 4RJ3A 2W06A 5KMLA 4Z9LA 2ETKA 3N51A 2Y7JA 4NUSA 3DBFA 5FTOA 2WU7A 3TDWA 4Y72A 2HW6A 2GQSA 1R78A 3AD4A 2R9SA 5AJQA 2X2MA 2DWBA 3MV5A 2I0EA 4G1WA 2REIA 2E2BA 2GPHA 3PVGA 4BDDA 2X1NA 4NEUA 5CAPA 3FSKA 2WQOA 2Z02A 4XMOA 4MNEA 5LMAA 3WI6A 3D7ZA 1W0XC 3UQGA 3W2QA 1J7IA 5H8GA 4NKAA 5IA1A 4O27B 5ICPA 4RVTA 4P5QA 5DEYA 2C69A 3CQUA 4UXLA 5LCKA 3EQRA 4FKUA 5IEXA 5M44A 3VHEA 4EZ5A 3RI1A 4KBAA 5ETCA 4FZFB 3U6HA 4DH1A 5EQPA 4BKYA 4X2FA 5CSVA 3W2CA 4KNBA 4IEBA 4FIEA 2VN9A 4FIIA 4MNFA 5IPJA 2VWUA 3NS9A 2WMXA 1BKXA 2P55A 2O2UA 3BEGA 4KBKA 1QPDA 2C68A 2GTMA 3OEFX 5E8SA 3P7BA 5HTIA 2G1TA 3MH1A 3GU4A 4IC8A 4IW0A 4JXFA 4FSUA 3A7JA 3ZRMA 2XNPA 4O21A 4S33A 4WO5A 5L8JA 2OJ9A 3MIYA 3TG1A 4GJ3A 4LUEA 1V0OA 3QCSA 4FTLA 1HCKA 4UMUA 2HY0A 1FVTA 4YZNA 4RJ7A 2CGWA 5E8XA 3QYWA 3DKCA 1SNUA 4O91A 4BDEA 4D2VA 4Z7GA 3MBLA 5BMMA 3TZ7A 4NM5A 5F1ZA 3DNDA 1G3NA 4JG6A 4E6QA 5IQGA 5T6KA 3EFKA 5HI2A 1YDTE 1WVWA 3ZDIA 4Z16A 3G6GA 1NVSA 4Y46A 3CP9A 4TNBA 2W1EA 5CS6A 3TCPA 2C5NA 2IVTA 1WBTA 1XH9A 2QVSE 5LARA 3VBYA 3RVGA 3LQ8A 3GI3A 3UE4A 3BLHA 2UZBA 4BGHA 4NFMA 4BCMA 2BZJA
chains in the Genus database with same CATH superfamily
2W96B 3TZ8A 1BUHA 1GZ8A 5KMOA 4IHPA 3LMIA 2NRYA 2W1ZA 3W8LA 2V62A 4RQVA 2WTJA 4IANA 1W98A 3V8TA 2R5TA 2OF4A 4KIQA 5FEEA 5I3OA 1U4DA 2AQXA 3HV6A 5IA5A 3TTJA 5HKMA 2OZOA 3HA6A 4O0VA 2XKEA 2FYSA 2GNFA 2JDOA 3DGKA 3UOKA 2R3PA 4F0IA 4YJNA 3MB6A 2UZNA 2VTQA 2X0QA 3VS3A 5A6NA 4QMZA 2VWZA 5G6VA 3RWPA 1ND4A 5B7VA 2R3LA 3QGWA 4KIPA 3A4PA 3IDBA 3POZA 4O4DA 3VUMA 2KTYA 1WBWA 3EQBA 4NM3A 4Y5QA 2ITXA 5LQFA 4PUZA 2UW7A 2FB8A 3JXWA 5TF9A 4J52A 4BHZA 4BI1A 4CV9A 3TV6A 4JJRA 4FZ7A 1QPEA 3SDJA 3ZO1A 1GNGA 2I40A 4Y95A 5JGDA 2UW5A 3OXZA 5FLFA 2IZRA 4M0ZA 4XYFA 2IW9A 1SM2A 3W0SA 4FV2A 5GZAA 4QQ5A 4TPTA 3BYSA 4C0TA 5AUTA 3FQEA 4IBMA 2F2UA 4RC4A 3NIEA 5K0XA 2CMWA 4I6QA 4DTAA 4JQEA 3NGAA 3PUFC 3GVUA 1YXTA 2XEYA 4U3ZA 4G9CA 1UKHA 1JKSA 4DHJA 3IKAA 4O4CA 1JAMA 4W8DA 3GGFA 4QMWA 3FLWA 4C61A 3H3CA 1SVEA 4XOZA 2VNWA 2GTNA 3H9FA 4FL1A 3UP2A 1OGUA 4IFGA 3SGCA 1PY5A 4FVRA 3UNZA 2W4KA 2VTRA 4NW6A 5E8TA 5FEDA 4PNIA 3AKKA 3F3UA 3ZSHA 3SHEA 3EN4A 4R5SA 3VBTA 3UMWA 4HVDA 4BIBA 3ZYAA 4TKSA 4YNOA 3O50A 1P4OA 4O7VA 4JS8A 1FMKA 4EJ7A 1PHKA 4USEA 1XR1A 2Z2WA 1OI9A 3QRJA 4RIXA 2IW6A 2WQEA 4L9IA 3TACA 5EI8A 1O6LA 4FODA 3IOPA 4FVPA 4XJ0A 4CFWA 4AWIA 5HG5A 4F0GA 5A4LA 4O7ZA 3QXOA 4D55A 3C5IA 5IQIA 3LFFA 4AN3A 4M14A 3I81A 2XIXA 4IJ9A 4WT6A 3DA6A 1PMEA 5KHXA 2UUEA 3OWKA 4XG3A 1V0BA 3F61A 3SD0A 5JGAA 3QXPA 2JAMA 2JITA 2ZV8A 2JBPA 5M06A 3QWJA 4JAIA 4TYJA 5HO7A 5GJFA 4N6YA 4DEIA 4DEBA 4C3PA 3DK3A 4J8MA 4ANOA 5JT2A 4O1PA 2XNEA 4DEHA 5M4FA 2UVYA 4S31A 1YOLA 3GOKA 4UWYA 3CKWA 3TV4A 4F64A 4F78A 2WTKC 4I1ZA 3RNYA 3D7TB 2VTSA 3GOPA 2ZV9A 4FTAA 4F0FA 1J1CA 3AQVA 4CLJA 1PXKA 4F6WA 4JX7A 2XYNA 3F3TA 4AAYA 4RIWB 5FTQA 2I0HA 2ZDTA 2ZM1A 4I6BA 3Q04A 1Q3DA 2JDRA 4J95A 3R7EA 2JDTA 3NYOA 3S4QA 4IB5A 2ERZE 5TT7A 3ZUTA 3A8XA 4AZWA 3CD8A 1VEBA 3ENMA 1R0EA 1E1VA 3BLQA 4AW0A 3VHKA 2XARA 3UBDA 1LEWA 3A60A 3VBQA 3OG7A 4EORA 2W5BA 1XH5A 3LM0A 5CANA 3CBLA 4X6RA 1SVHA 4IX5A 3FY0A 5M08A 5DR2A 5M09A 3F3ZA 2WMWA 5KNJA 3E62A 1H08A 2RKUA 4E5WA 4L68A 3BV2A 1PMNA 2QO2A 2QOKA 1R1WA 3UOLA 5ANOA 1YW2A 3GC7A 4MCVA 3TN8A 5JFSA 3QTZA 2A2AA 4IDTA 4BDHA 5TR6A 5M4IA 2YACA 1E9HA 3FKLA 1YHSA 3EYHA 4IADA 4J99A 4EOQA 3DKOA 3DAEA 3JY0A 4FTJA 3V51A 1M52A 4NZWB 3LMGA 4O7NA 5IQBA 5C4LA 2CCIA 2PUPA 3VUTA 4UMQA 3L9LA 3R1YA 4FUYA 4RG0A 4U7ZA 1GIJA 4DHFA 4ANLA 4F70A 4BR3A 3W18A 5HOAA 5E92A 4NU1A 3ORMA 4IVDA 3ULZA 4BDCA 3VS4A 5CF6A 2X8EA 5M53A 2E9VA 3T9IA 1AGWA 5IF1A 2NPQA 4ZSGA 4EZ7A 1UV5A 2Z7RA 2ZAZA 1PW2A 2F57A 5D41A 2YIXA 4J1RA 2OH4A 3HLLA 2UZUE 4JR3A 4L44A 2IN6A 3KCKA 3R8LA 2IVSA 1BI7A 4WA9A 2C3IB 5FWKK 4QMQA 5JMSA 3Q60A 2RFDA 2VRXA 1OKWA 4FV1A 1R3CA 1XH6A 4IVAA 1Q8WA 5AAGA 1UWHA 1PKDA 4BVUA 4EOJA 2C5OA 4FRFA 4D0WA 3KF7A 4RQKA 4ZY4A 5HTCA 3DQWA 1XHAA 3BGZA 3ORXA 3Q6UA 1UVRA 3U8WA 1XH8A 1JNKA 4FNZA 4DH3A 3IONA 4QP6A 4HW7A 2PZRA 2A1AB 4S2ZA 3KKVA 4KRDA 4M84A 4DLIA 4FKLA 2UW0A 4YSMA 2BFYA 4GYGA 3TNIA 1M7NA 3TZ9A 1K3AA 1YOMA 4OTRA 4Y83A 4FMQA 4EBWA 3AXWA 5IKWA 3RAWA 2BR1A 2C30A 3WF8A 4AQCA 4MD9E 4BZNA 1YXXA 3P5KA 3L8PA 5E8ZA 3SC1A 1DS5A 3BGPA 4ZTSA 1Q97A 4M7IA 3E3PA 5FXQA 3WF7A 2WB8A 1KE8A 4MYGA 5AR2A 1BL7A 3OROA 4V01A 3VJOA 4XG6A 3RP9A 4F1OA 4O7RA 2UVXA 3P23A 3QCQA 5JFVA 4L3PA 3WZEA 3MFUA 4FIFA 2Q0BA 2BHHA 4LDTA 1J1BA 4ZSLA 4FJVA 3FXXA 4U79A 4E26A 4ZP5A 2QOQA 2ZB1A 3PXRA 3RNIA 5TE0A 1OB3A 2PK9A 3G90X 5HD4A 2WTKB 3VF9A 3ZO4A 2ZVAA 3KRWA 4IQ6A 4WG5A 5HLPA 4BTKA 4BWPA 4YJRA 4EHGA 5E7RA 1H8FA 4IX6A 3AC1A 1ZY5A 2XM8A 3FZTA 4QQCA 3RALA 5EKOA 5DVRA 2WTIA 4CKIA 2X4FA 5DRDA 4RFYA 4CRSA 4M0YA 3R63A 2C3LA 3VUIA 4IM3A 4MXAA 3V5PA 4CYJA 1IG1A 2QOLA 2F9GA 4OTQA 4CD0A 5AMNA 4BBFA 4RA5A 4PQNA 3MVJA 4E5AX 4YU2A 3CR0A 5IMEA 4C58A 1XMMA 5J7HA 3Q5IA 3IW8A 5A3XA 3D5UA 4IWOA 5CASA 2C3JA 3OD6X 1SYKA 4LGGA 4U9AA 4UWCA 2O3PA 3B8RA 5EYDA 3R7IA 4DGNA 4UXQA 2JFLA 4FV7A 3ZFMA 1XO2B 2ZFYA 1W83A 3IDCA 4J96A 4ZZMA 3DJ6A 4GH2A 3Q5ZA 2C6MA 3Q4CA 4A7CA 1GZOA 4GK2A 5AP7A 3KY2A 5LWMA 5IQAA 2XAMA 4MBJA 3K2LA 5HLNA 1IEPA 5AUXA 3R04A 4QP4A 5H8BA 1O6YA 3MY0A 2P3GX 1ZOGA 3R8PA 4EQMA 1ZMUA 3GCPA 2ZMDA 3LXNA 4PL3A 4RFMA 4ZK5A 4YURA 2PZPA 3Q53A 2WD1A 2YERA 4JDHA 4JRNA 4XV1A 3UJGA 2CN8A 4ZSEA 3VAPA 3MJ2A 1XWSA 5HNIX 3OWLA 3MYGA 4BI0A 2B54A 1GIIA 2QKWB 2ZYBA 5HNGA 3R7YA 2C5XA 2C5VA 4FKWA 5JRQA 3ZEPA 3O23A 4FL2A 1OITA 3IPHA 3KXMA 1P2AA 5FP5A 3W16A 1OPLA 3KN5A 3O96A 3TXOA 2BTRA 4AOTA 4E4XA 3W55A 5KZIA 2B0QA 4ITJA 4BHNA 4EH2A 4OAUC 1FMOE 3FI8A 4FL3A 2HENA 2J51A 5CTPA 3VUGA 2WXVA 4CFNA 4CMOA 2XMYA 4DEDA 4QQTA 5BMSA 2OU7A 3NYXA 1JKLA 4NM0A 5KX8A 3VC4A 3FZPA 2YCFA 4X2KA 4XHKB 5K4JA 1APME 1JBPE 2J0IA 4XV2A 2X6EA 2F49A 1OIUA 1QCFA 3PTGA 2JAVA 3TIZA 3ZBXA 5AEPA 4UZDA 2CNUA 4J71A 3A99A 5FDXA 3N4VA 4NYEA 3QTRA 3PY3A 3QD2B 4GIIA 5GZ9A 3VBXA 4PP7A 4HCUA 2PVHA 4HPTE 4F9CA 3LM5A 4ID7A 4XX9A 4G3CA 3MB7A 4KSPA 2J5FA 1JKKA 5E1SA 5EDRA 3WE4A 3JVRA 1REKA 3KL8A 4IWQA 1KE5A 3F69A 4O0WA 3MA3A 1W2FA 4WNOA 4RWJA 5HCXA 3MI9A 2BIKB 2VWIA 4ZXTA 2QR8A 5DRBA 3VUDA 4PMSA 4AT5A 4GK4A 2O63A 3FHIA 4QYHA 5B2KA 3KMUA 3LCDA 2GNGA 1W2DA 3LOKA 3QRIA 2PZ5A 5BVFA 4AACA 3P7AA 5HBEA 4AT4A 4YJTA 2DS1A 3NAXA 3Q9WA 3ACJA 5K5XA 2PVLA 1IAJA 3R01A 2C6EA 4O2PA 3V3VA 4JR7A 4D2SA 3OXTA 2BFXA 5HVKA 3PE2A 4E1ZA 4M69A 5IUHA 3E93A 2O0UA 1A06A 5HCYA 5DYJA 2H9VA 4D5HA 2HIWA 3FLSA 4A9TA 4H58A 5EK7A 2XJ1A 3RK5A 1XH4A 4IDVA 1W8CA 3PLAE 3EQFA 3QALE 4LQMA 3G0EA 4C33A 2PUUA 3G6HA 4DH7A 1OVEA 5FQDC 4B8LA 4FKVA 2PTKA 3D83A 2QC6A 4RX9A 2F7XE 3EKKA 2Y6MA 3KXHA 3DDQA 5L6WL 3NUPA 3SQQA 2QLQA 4B9DA 3FUPA 3D5VA 3ET7A 2C0OA 2QURA 4EOSA 2UW3A 3KVWA 2R3KA 1OUKA 4HYUA 3LFEA 2VO7A 4JG8A 4V0GA 3DJ5A 3QQFA 5DT4A 1CM8A 3DXNA 3KQ7A 4D2WA 4QMVA 2C3KA 1KE6A 3WIKA 3WOWA 3OS3A 2BDFA 2PHKA 2VTNA 3TKIA 4CNHA 3N4TA 2QLUA 3FMDA 4EOKA 4RPVA 1GJOA 3ALNA 3F7ZA 4I22A 5BPYA 5HX8A 1WBOA 4G3DA 5JQ8A 2IF8A 4DHZA 3EB0A 3EQDA 3W0QA 3V8SA 3GCSA 3ZOSA 4XV9A 4PTGA 5IUGA 4IZ5A 5KZ0A 3VS6A 1U54B 3W0OA 3KXXA 4ANQA 2BDWA 4FSWA 3OZ6A 2QD9A 4AA0A 5J9LA 4RVLA 3BQCA 3BGQA 3EZRA 4L3LA 2CN5A 4JRVA 5CAOA 3FPMA 4NFNA 3ZUUA 3H4JA 4YLLA 5BV3A 4EI4A 4S32A 4YHFA 4CKJA 4K11A 4LI5A 4CFXA 4I4FA 2BRHA 3UOHA 2WTCA 4BCFA 2C6TA 4ANNA 2JKKA 4F08A 4GRBA 4TYIA 4E3CA 3Q4ZA 4BZOA 2XK8A 4J98A 4L43A 3LLAA 4O0UA 5J1VA 3QD4A 5ANEA 4DDGA 2J2IB 3ZSIA 4JIKA 3QC9A 4R78A 4CFMA 1H4LA 4QMMA 5LMKA 5H8EA 3RAKA 4U3YA 4TYHA 2CHLA 4DTBA 1OIQA 3NUYA 3VUHA 2IPXA 3KXZA 4FEQA 5GNKA 4I0SA 1H0VA 1PJKA 3PFQA 4CZYB 3SA0A 1FVVA 2FVDA 3CTQA 4L00A 4QQJA 3KN6A 2P2IA 4EEVA 3FLZA 3PG1A 3P78A 2XYUA 2Z7LA 5DE2A 4B99A 5AFVA 4MD7E 4ZY5A 3POOA 1UNHA 4MX9A 3DLSA 3NIZA 3R71A 4FG9A 4DDIA 4UY9A 4MXXA 4CTBA 4AA5A 4EBVA 4YP8A 5KMJA 2YIQA 4RZWA 4CZTA 3EQHA 3W1FA 4E4NA 2BRNA 4X21A 5L2SA 2I7QA 2DQ7X 2EVAA 3DV3A 4FG8A 4IB1A 4P4CA 1P4FA 4RZVA 2YN8A 2B9HA 2UW9A 4TWCA 2BRBA 5AADA 4TTHB 1FPUA 3OCBA 3PY0A 5AUZA 2FA2A 4WD5A 2WQBA 3I7CA 3D4QA 3GCUA 3QTXA 3UODA 4CCUA 2GFCA 2HW7A 4D28A 4LGHA 4LGDA 5AM6A 3SX9A 3VBWA 2YCRA 5CU6A 3UC4A 5JZJA 5HVJA 3UDZA 3VNTA 3UVRA 4WUNA 4XP2A 5CZHA 3HMOA 2JDSA 2PVFA 5CEQA 1GY3A 3RPYA 3VS2A 4NK9A 2CNVA 4DGOA 1O9UA 3FQHA 3RM7A 2UVZA 3GU5A 4E4MA 5D10A 4IFCA 4EH3A 2YCSA 3PJCA 5J79A 4L8MA 4NKSA 3DS6A 4FV5A 2PE1A 4GS6A 1S9JA 5DHJA 4N57A 2GS7A 2GS2A 4U41A 1OZ1A 5CZIA 5LXMA 5ETIA 2WMSA 3QF9A 2OIBA 3SW4A 2C6IA 3ZDUA 5LVMA 2HY81 5DH3A 2WTDA 1TKIA 3ZM4A 5M07A 4IAAA 4KIKB 4MUQA 3PJ8A 1PXIA 5L4QA 3VW8A 1Q24A 2J4ZA 4YC8A 4ZTNA 5FM3A 3NX8A 4CFVA 3BL7A 3FXWA 3FMMA 2FSMX 5HHWA 3ALOA 1Q8ZA 3KRXA 3RGFA 3WYXA 3C9WA 4EH8A 2OXYA 4FSMA 1XBAA 2GNJA 2YDKA 3MTLA 1YXVA 2ETRA 3NYNA 4RBLA 3RMFA 4EK5A 2IZSA 3NUUA 3KVXA 2XK6A 4I5MA 3TKHA 5CAVA 2ITYA 1QL6A 3P4KA 3CQWA 2FGIA 3R21A 2VTLA 4FBXA 3MGYA 4HYSA 4ZJJA 3FYKX 1PXMA 2J6MA 3IO7A 2VO0A 3EQCA 4TZRA 4QPSA 2BCJA 2X8DA 4KABA 3KXNA 1ZRZA 3E7OA 2XBJA 4KS7A 4HVGA 4YJUA 5EOBA 4YR8A 4ANMA 3PXFA 3CY2A 4FV9A 4IM0A 5IU2A 3MH3A 2YDIA 3CGOA 3OWJA 4BKJA 5DEWA 4EH9A 3QHRA 2ACXA 3PIZA 3WZUA 4EYMA 1CSNA 4O1OA 4LM5A 1BX6A 4P7EA 1ZOEA 3V6SA 4C62A 4D0XA 5J9YA 5T3QA 4QTCA 1J7LA 3FZOA 4KA3A 1ZYLA 3KRJA 3P0MA 5TOZA 1STCE 2X2LA 4GG7A 2CGVA 2O64A 2C4GA 3EYGA 4NTTA 1KUTA 5ANDA 3MPMA 5D9HA 4IAYA 4QOXA 5LVOA 4HYIA 4HVHA 4G16A 3WARA 1OKYA 4QP1A 1ZMVA 3OCGA 5J9ZA 2C1BA 2A4LA 1VZOA 5IMXA 2XS0A 2CJMA 3CGFA 4MBIA 3RZBA 1U5QA 2UV2A 2VWVA 5EM5A 4AE9A 1ZARA 4EONA 3MW1A 4UALA 4IWPA 3S2PA 1OM1A 2XJ2A 3GU6A 2YWPA 1G5SA 4CQGA 4LFIA 3O7LD 5C26A 3U9CA 4AE6A 5GIPE 3RJCA 4O7YA 3C4EA 4RIYA 2W17A 4ZIMA 4C4FA 2W1IA 3BLRA 3ZLYA 1DAWA 3MWUA 4IWDA 2W4JA 2ONLA 4IMYA 4Q9SA 4BDIA 2R3HA 4H1JA 2O8YA 4R8QA 3FBVA 5IQFA 3ZMMA 2PVYA 2ZV2A 2EB3A 2YCQA 4TYGA 2W1CA 2AEGA 4BDBA 4BRXA 2W1DA 4KKEA 4CFFA 4DC2A 3EN7A 5GIOE 5A4CA 2B1PA 4AT3A 4IVBA 1UU3A 4FTKA 4RWLA 4TYEA 4X2GA 2XIKA 4CRLA 4DAWA 2IZUA 1Q61A 2VTAA 4QTEA 4DT8A 2ITVA 4YBKA 2YM3A 2VWBA 4E5BA 4UMRA 3LFAA 4G5PA 4ENYA 1Q5KA 3K3JA 5HICA 4FEWA 1YQJA 2PE0A 4AXEA 4AF3A 5AR3A 3O2MA 5BUEA 5L8KA 4F4PA 4FYNA 2ITTA 2YM8A 4W4YA 2HZIA 3ZS5A 4O38A 5F9EA 4IZYA 2X9EA 4CG8A 5HG8A 5I3RA 5HVYA 4UX9A 2PYWA 3FHRA 3H10A 4ZEGA 1OECA 3ZCLA 3MS9A 1JQHA 4U0IA 4FKTA 1JLUE 5CI6A 2VWXA 2X0PA 3AMBA 4YNEA 3VIDA 3W0RA 3PY1A 5AX9A 5AAEA 3CIKA 3RPSA 3E5AA 3BRBA 4II5A 4YZBA 3TKUA 2W1HA 2C47A 4N6ZA 4ZSJA 2J0KA 1H00A 3A4OX 2XIRA 3SG8A 2HZ4A 1ST0A 3PSBA 4HJOA 4S34A 4PTEA 3EL7A 2H34A 1H1QA 5DR6A 1JSVA 4AGDA 4C2VA 3H9OA 1A9UA 3W0PA 4PDSA 4DH5A 4CT2A 2GNHA 1KV2A 3IK3A 2Y8OA 4HPUE 2UW6A 3VS7A 2QKRA 3QQJA 4JT3A 4XBUA 1H1RA 3D0EA 3II5A 3PJ3A 4C57A 3ZRLA 3RPOA 2BKKA 3OUKA 3PRFA 4O7SA 4FT5A 2B53A 2PWLA 2C6LA 3E8CA 3ENHA 3KULB 1JPAA 4U81A 5HIEA 3E63A 4DHIB 5EYCA 2EXEA 4RSSA 3NNUA 4X3FA 4LUDA 5KMKA 4PL5A 4OLIA 3SRVB 3QQLA 5TKDA 4W9XA 5GJGA 4U97A 5B0XA 1I44A 2QODA 4LRMA 4RVMA 4ZTLA 4EK3A 3GT8A 1OBGA 2V0DA 2RL5A 2E9OA 5ANKA 2B4SB 4QTAA 3WF5A 2WIPA 3ZUVA 1VLRA 3AC4A 3TNHA 3VRZA 2O5KA 1RDQE 3W2SA 4G5JA 4M66A 4GKHA 1OL2A 3L8SA 3QKLA 1F5QA 4RC2A 5DOSA 5HO6A 2XK7A 4YTIA 4EOIA 2XRUA 3VULA 3OEZA 5KMNA 3TT0A 3UVPA 4AUAA 1QPJA 4GT3A 2HK5A 3F2RA 5L2IA 3IG7A 4AN9A 1HCLA 2YFXA 3V5QA 4QNYA 4KRCA 2J0JA 4IB0A 4PTCA 3E88A 2ZMCA 5HU9A 4BCHA 5AUYA 1CDKA 3LAUA 5IQEA 3CD3A 3QD3A 2PVNA 3KFAA 2QCSA 5FBOA 4AN2A 4EH5A 3TZMA 1Q41A 3LIJA 4FEXA 2VV9A 3BE2A 4PPBA 1OGYA 2QQ7A 3HMPA 4FZDB 4DG0E 4DCAA 3PYYA 4RT7A 3R1SA 4QP9A 3IDPA 4O4BB 4TWOA 1V0PA 4U42A 2Q83A 2BZHB 4ZS4A 4U45A 4QYEA 4APCA 4J53A 5BNJA 2ETMA 1H1PA 4D9UA 4FUXA 3MPAA 3ELJA 5CYIA 4FYOA 4BGQA 3EHAA 3QX2A 3FY2A 3R8UA 3F2AA 2HAKA 3UIUA 5HTBA 3C1XA 5EYKA 4EH7A 5CAUA 1CTPE 3BV3A 4NIFB 3UTOA 2NRUA 1QPCA 1YI4A 4F1TA 5HE1A 5I9VA 4YZDA 2E9UA 2GHLA 3OFMA 1TFFA 4GT5A 5AP0A 2BIYA 3PXYA 3F3VA 4C2WA 3RHXA 1O6KA 1PYEA 4XG4A 4CLIA 3BWJA 3HVCA 4I5CA 3ZO2A 4V05A 1PXNA 3DDPA 4O0RA 2PMNX 4FKRA 4QYFA 3FC1X 4R1VA 4WOVA 3FYJX 5EG3A 4FZAB 5KKRC 3LJ1A 2ITUA 4MNEB 5J8IA 4F7NA 4ALVA 3RKBA 4NH1A 1P14A 4QP8A 3FI4A 4XP0A 2J0MB 3HMNA 4AGWA 2X2KA 4I6LA 2XNOA 5DI1A 2V55A 5AP4A 1W2CA 4IH8A 1G8JA 3NFFB 2C5YA 3DAKA 4FEVA 1TZDA 2RFSA 3MFSA 5C8MA 4PMMA 4QPAA 5EH0A 5C4KA 2ZB0A 5EKNA 3BEAA 5JEBA 3SLSA 2QU6A 3PJ1A 4W4WA 4W4VA 3VN9A 4N4SA 3K5VA 1L3RE 5CVGA 3RCDA 3VWAA 4E4LA 4EYJA 3G9NA 1JWHA 4FV8A 4ZTRA 4YC3A 4DEAA 3DZQA 1FBNA 3FKOA 3HAMA 2C0IA 3LCTA 3DKGA 4BTFA 1ZWSA 4PMTA 5IA4A 3A7GA 3Q9YA 4DGGA 1MRYA 4BF2A 1F0QA 1V1KA 4MQ1A 4BN1A 2PSQA 2XKCA 3QTSA 2H6DA 5FXRA 2OW3A 3NW6A 4LOPA 1BYGA 3BLAA 4GFGA 4OBPA 2Z8CA 3QGYA 4IZAA 4TL0A 4GU9A 5J7BA 3TM0A 3S95A 1PXLA 3DTCA 1M2PA 1IA9A 4FTQA 1BL6A 1VR2A 2XNMA 3EFWA 3N9XA 4IX3A 3OW4A 5AV4A 4LMNA 4I5PA 4Q2AA 4UMTA 4YO6A 4IM2A 2R0IA 4PNKA 1PMVA 2BZKB 3G33A 4HGLA 4ZLYA 3FMEA 3NVMB 2Y0AA 3PPZA 3RWQA 1R0PA 3NUSA 4DGMA 1Y57A 5L6PA 5JN2A 3PVUA 5J87A 3I79A 1Y8GA 3NW5A 4O6EA 1OIYA 5FDPA 3F7WA 3EQGA 4EOLA 4WNMA 1ZLTA 4WKQA 5LJJA 3IECA 2IG7A 1PYXA 2FH9A 1K9AA 4BCOA 4HGTA 2VX1A 3A62A 4EOOA 1WZYA 3EQIA 3AT2A 4FOCA 4E6DA 3LQ3A 1ZYSA 4AZVA 3GBZA 3H30A 4FK6A 4XG2A 3ZM9A 2AYPA 4RMZA 3QUDA 3L9MA 4M8TA 2W9ZB 3C0HA 3QC4A 4NJDA 2VO6A 3SV0A 3P1AA 4ZLZA 3BHVA 1DAYA 2RG6A 5TO8A 5H2UA 2WIHA 2IEWA 4HZSA 4JBQA 4FSNA 2UZTA 4D2TA 3SXRA 2QNJA 3HMMA 2JBOA 3UPZA 1YDRE 2I0VA 4N0SA 4AZTA 4K77A 2BAJA 3A7HA 3AKJA 5DWRA 3HMIA 1YXSA 4WG4A 4PDOA 2X0OA 5DG5A 2B7AA 3GFWA 4TWPA 2WGJA 4AGUA 4AZSA 3HDNA 5IG1A 5KUPA 4AX8A 3ML1A 3LW0A 1W7HA 2VTOA 3QD0A 3BBTB 3H0YA 4KAOA 5T68A 2OJGA 4NT4A 3L1SA 1F3MC 3W8QA 3ZBFA 2DYLA 4FKOA 5DNRA 4YTFA 3CY3A 3DY7A 5AM7A 5L6OA 1SZMA 3SG9A 4C36A 1ATPE 3P08A 3DXPA 4MXYA 4RFZA 1OKVA 1CKPA 4OR5A 5AV1A 5HGIA 3PA4A 5AA8A 2O65A 3MN3A 1UWJA 2WELA 2YISA 4FZ6A 5KKRB 4BTJA 3KF4A 3QFVA 4V04A 3SOAA 3MVHA 2WMBA 4L67A 5LOHA 4EUTA 3GC0A 4H36A 3ZTXA 4JG7A 2XKFA 4BI2A 4S30A 4RIXB 1B38A 2B9JA 2WOTA 1SMHA 1YWNA 4DA5A 4C7TA 4CCBA 2VX3A 3QTWA 5CF4A 4I41A 2GQGA 4H1MA 4OUCA 5KCVA 3JR1A 1ZAOA 1IRKA 4L53A 5CU3A 4CXAA 5BX0A 4MF1A 1NVQA 4GFMA 5M57A 1FOTA 4O81A 3R83A 1MQ4A 3FPQA 4CMUA 4Z55A 1UU9A 3LLTA 1MUOA 4ERWA 2J5EA 3COHA 4L42A 3R22A 4CVAA 3FDNA 4QEBA 2YHVA 4BICA 1M14A 4EZ3A 3NWWA 4AU8A 5CSPA 4C35A 2GQRA 3QAME 4EWQA 2QG5A 2YAAA 4UN0C 3IW5A 4OTGA 2YIRA 3FI2A 4PY1A 4Y85A 3UYTA 4D2PA 3TUCA 4R3CA 2ITPA 3Q52A 1Y91A 4AP7A 3PZHA 4IJPA 4QMYA 5BVOA 3GQLA 5A54A 4WG3A 1H01A 4DLJA 3G2FA 3PA3A 1J91A 5M4CA 5FGKA 4IAFA 4A07A 5IH4A 1L8TA 1H1SA 4GJ2A 4MAOA 4O83A 4AW1A 4BCIA 1K2PA 4YJQA 4QMPA 4JI9A 5CWZA 4DT9A 4FIJA 1REJA 4A9RA 4F9BA 4F09A 4KIOA 2FUMA 2ITWA 3W2PA 5BVEA 4MXCA 1PMUA 3WE8A 3B2WA 3BI6A 3KMWA 4IXPA 5HE2A 5IQHA 2XP2A 2CKEA 2JIIA 3MVMA 1H25A 4ARKA 3CSVA 2IZTA 1XBCA 2NYAA 4GKIA 2OICA 4R7BA 2BPMA 3UIXA 2W99B 2GFSA 3OBGA 4G34A 4KBCA 4WRSA 4B8MA 2PVKA 4RWIA 4TW9A 1H07A 2RGPA 1P5EA 2B9IA 3LJ2A 3ZC5A 5EI6A 5AP6A 4JQ7A 3DLZA 3D5XA 4F1MA 2PZIA 2VNYA 1YWRA 2J9MA 2R3OA 4QMUA 3DBQA 3DBCA 1NY3A 2JGZA 3A61A 4K8AA 1JSUA 3R7OA 4ALUA 3VW6A 4UBAA 4K0YA 3CJGA