4Y8DA

Crystal structure of cyclin-g associated kinase (gak) complexed with selective 12i inhibitor
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
307
structure length
262
Chain Sequence
b'DFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPYSNFPIGEKQDIWALGCILYLLCFRQHPFSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclin-G-associated kinase
publication title Selective Inhibitors of Cyclin G Associated Kinase (GAK) as Anti-Hepatitis C Agents.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 262
sequence length 307
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4y8dA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4y8dA01
4MD7E 3A99A 5I3OA 5ANIA 2QOOA 4H3QA 5DIAA 1P2AA 3FMLA 4D0XA 3MB6A 1X8BA 4USDA 4PL5A 4FGBA 4OTFA 5DLSA 4M14A 5M4UA 1YXSA 4J98A 4XUFA 1OPJA 1MRUA 4YTIA 3LXKA 5AP2A 4QMQA 4R77A 5EKOA 3VUMA 3TG1A 4O7VA 3HV4A 4GKHA 5HQ0A 3NAXA 2XBJA 1YI3A 4AW0A 2FSMX 2VNYA 2YAAA 5HBHA 1PXJA 5BNJA 2WTDA 4AOJA 2V62A 4IJ9A 4A7CA 1FINA 5HU3A 4JDKA 3GEQA 3MIAA 3LM0A 5IQAA 4L9IA 3LLAA 2C6EA 5GJGA 3SGCA 1G5SA 2QOBA 1GAGA 3FSFA 4KKHA 1H28A 1BUHA 5KHWA 3NCZA 4NFMA 4PPCA 3R7UA 5HTCA 3NIZA 5JRQA 2YITA 1KOAA 1XH6A 3C0HA 2BVAA 3GU4A 5AUXA 4X2KA 4ASZA 3NUYA 5LWNA 4NFNA 3PE2A 1JSVA 3BU5A 5JH6A 4BCHA 3GBZA 4U79A 3K2LA 3GCVA 1W84A 3VS3A 2O63A 3SA0A 5EDQA 3KULA 5BYZA 2F2UA 1OUYA 3F66A 3IDPA 3K5VA 4OR5A 5AAGA 2QO2A 3DB6A 4MK0A 4DH5A 5CNNA 4FICA 4FKLA 3ORXA 5M55A 4JAJA 4ZZOA 1H26A 3MTLA 2VV9A 3MA3A 4FV6A 2KULA 2YEXA 2BRMA 3UBDA 3A4OX 2WU6A 1IAJA 5CLPA 3KEXA 3LM5A 5C8MA 3JY0A 5HNIX 4WRGA 4PL3A 2JFLA 1QPDA 3HMPA 4D0WA 4MXCA 1UU9A 4H58A 4BF2A 4FA2A 2BFXA 4QMMA 4QP6A 5EFQA 1REKA 2NO3A 5AUYA 4A9UA 2QNJA 3H3CA 4QMTA 4UMUA 2ZOQA 4UWCA 4RIXB 3RBWA 3ZBFA 3RINA 2C69A 4QMZA 4EK4A 4YLKA 4P90A 4GJ3A 3VBVA 4X3FC 4TKSA 4WIHA 2XUUA 2OI4X 4IXPA 2XBAA 3A62A 5HVJA 4AG8A 4KSPA 3V5LA 2B55A 4RVMA 1LUFA 4TTHB 3Q2MA 4AW1A 2IW6A 4FKUA 3CKWA 4C4EA 2Z2WA 2WGJA 4QP7A 4RVKA 4BTJA 1PXPA 4E1ZA 3V5PA 4B7TA 5BVKA 3DLSA 2YN8A 3GGFA 2REIA 3R0TA 3U6IA 3R9NA 5M56A 2X4ZA 4J53A 2HYYA 3Q3BA 1Y8YA 3NYVA 4JG7A 4ZS0A 2YCRA 5IDNA 3LAUA 2XM9A 4BB4A 1XBBA 1WAKA 2QKRA 4ONAA 4R5SA 5EYDA 3V5TA 4IIRA 3UG2A 3CPCA 4TYIA 1IR3A 2PZRA 4D2RA 5JK3A 3EN6A 3N4UA 5AR8A 2EUFB 2I0HA 2VTNA 3FZ1A 4IEBA 2DS1A 3NUUA 3OC1A 4GG7A 4D9UA 4O83A 2R2PA 1R1WA 4FIHA 5JZJA 2IW8A 1RW8A 1WZYA 2R3KA 2W9FB 4JRVA 4UZHA 4ORKA 2CCIA 4DHFA 4D2SA 1L8TA 4EC8A 4OGRA 3DFCB 5IQGA 2QOCA 4YJOA 4F7NA 4IB0A 4I20A 4AE9A 1XWSA 4DLJA 2QI8A 4D5HA 5DBXA 5IQDA 5FQDC 3S4QA 4C0TA 1Z9XA 4ALUA 4U81A 2HZIA 3Q96A 4BDBA 4MQ2A 5ACBC 5F9EA 4HGLA 1UNGA 3HA6A 3QL8A 3ZFXA 3UJGA 4AN2A 4TYEA 3BKBA 3DBEA 2IW9A 3G33A 3UPXA 2Y6MA 5B2KA 3QTSA 4L3PA 5BVOA 3TCPA 4AN9A 3C13A 2XK6A 3N4TA 4L42A 2HELA 1OPLA 4NTSA 4CFXA 4GEOA 4CYIA 1TQPA 3IG7A 4O0VA 3CTJA 1IA9A 1O6KA 3D5WA 4BZDA 3R22A 1TVOA 4D58A 4Y46A 2HY81 5A46A 3VS1A 3DJ6A 3QXPA 5JKGA 3DTWA 1FGIA 4RQVA 3HEGA 4XH6A 5DT0A 4DEAA 2BTRA 3W2PA 3ZLSA 2FA2A 4YURA 5KUPA 2RG6A 3RNIA 3DAKA 3POZA 4FSMA 2CDZA 4X3FA 4ALWA 4APCA 4YU2A 3QKLA 1H1QA 4F6SA 5BVFA 2JDTA 5EM7A 4F65A 2F4JA 3VF9A 5M4IA 3LE6A 5FXSA 4D4SA 3NUNA 5EDRA 3KK8A 4FG7A 2C5VA 4IAZA 3H0YA 5CENA 2JDSA 3V6SA 3CD3A 4IC8A 2F49A 3G6HA 3BGZA 4KS8A 5M44A 4D4VA 4YHFA 1JSUA 2QD9A 5CEOA 4AZWA 2UZOA 4HYSA 4QNAA 2E9PA 2JDVA 4LUEA 4O38A 4XBUA 2R3LA 4FTJA 1PKGA 5M57A 2QOQA 3NAYA 2C0TA 4UXLA 5I0BA 5J5TA 4YC8A 2X1NA 5FXRA 1W0XC 2EXMA 2Z8CA 3UOKA 4PMPA 2PZYA 3LXPA 2O2UA 4EYMA 4ANQA 3R8MA 4OBPA 1Q8TA 1SNXA 4I6HA 5CQWA 3EL8A 3OROA 4MF1A 3TM0A 4W4XA 4FTKA 4O0UA 3ZFYA 4EBVA 3N4VA 3EFLA 2WMXA 4E5BA 3Q6WA 1ZLTA 4CFNA 1I09A 2LGCA 3CTQA 3FJQE 5FP6A 3WF5A 2CGXA 2YDJA 3DJ5A 3HA8A 2R3RA 4XV3A 5JFSA 1GNGA 1Q5KA 3HECA 5CNOA 2DUVA 5IISA 1Q8ZA 4FG9A 1QL6A 4CZUA 2BIYA 4ERKA 4S33A 4LFIA 2X6DA 2Y4IC 4CFWA 4FMQA 1Q3WA 4R7HA 3DAJA 1OVEA 3DKOA 1IRKA 4DH1A 5TF9A 2CNVA 3UIXA 3M11A 1GJOA 5HTBA 1HCLA 4GH2A 4U40A 4CV9A 2PVJA 5HD7A 4FEWA 4RA5A 4I3ZA 4ACDA 2BRBA 2XCHA 4JXFA 4CG9A 3WI6A 5A4QA 3GC8A 5JGBA 4K0YA 3QRKA 4PP9A 2UZUE 3TTIA 1VEBA 3NPCA 4PP7A 3MVLA 2VX0A 3VBYA 2WQOA 4F6UA 1WBTA 4I41A 4BIEA 2QLQA 5HOAA 5CSPA 3ZU7A 2P2IA 3G6GA 3R1NA 4D1XA 1R0EA 4BKZA 3KKVA 5IH5A 5J9LA 3BYMA 3HMIA 1YHVA 3VQHA 3C4EA 4OT5A 4IWQA 2XNOA 4PMTA 1AD5A 3TNHA 4U9AA 3O7LD 4J8MA 4BICA 5J1WA 4O86A 2PMNX 4EI4A 1DI9A 3EQIA 5CT7A 2AUHA 2X8EA 3FV8A 5IKWA 4XG2A 3LLTA 2C47A 5TE0A 2PYWA 2QO7A 5KMLA 5ANEA 3HRCA 3P79A 3AMYA 4V0GA 4RVLA 4F9YA 3D0EA 4AX8A 4FUXA 3FPMA 4AW2A 3PY1A 3KL8A 4P5QA 4BN1A 4FNZA 2GNFA 1JKLA 3UNKA 3REPA 4JR3A 2WHBA 4FGRA 4BZNA 5C03A 3C4ZA 2VWUA 1YXXA 4F70A 3H4JA 4C4IA 5BUIA 1R39A 2P33A 3COHA 3F3VA 1DI8A 1JLUE 3BEAA 4I0SA 3S00A 4B0GA 3EYHA 4IX6A 2QLUA 3R6XA 4DEHA 4HVDA 3UP2A 4USEA 5ITAA 3ORPA 5IUGA 3D5VA 3FQEA 3QTXA 3QD3A 4M69B 4BBMA 5EHLA 3FMKA 5ANOA 2OIDA 2WFYA 4L43A 5EH0A 2GQGA 1M14A 4NSTA 1NT2A 3UZTA 1H01A 3GCUA 2UW4A 3LFNA 4AAAA 1XO2B 4FOCA 4PL4A 4IDTA 1E1VA 3DFAA 4OTIA 3RM6A 4GG5A 3EFJA 2OH4A 1XQZA 3O8UA 4FSWA 5DE2A 4YZCA 5KZ0A 4YZMA 1J7IA 4C8BA 2OICA 3R9DA 5JQ5A 4HYIA 2JGZA 3H0ZA 4P2KA 4GK4A 4BDJA 3FMEA 3PRIA 4LOOA 4L8MA 2BZKB 2XNMA 2C68A 4CT1A 4NL0A 4BVUA 4K2RA 4QP2A 3P4KA 3NDMA 4XMOA 4D9TA 4K33A 4EOLA 2QONA 3MIYA 3WF9A 2A1AB 2G9XA 2VTTA 3PVUA 4XRLA 5ANGA 5BVEA 5KKRC 1B39A 2JKQA 3PE1A 4RQKA 3PXZA 1ZYJA 2Z60A 3V5QA 1U5QA 3JPVA 3FPQA 3PZEA 2XK8A 4IM3A 5CF8A 1U5RA 2OKRA 4PNIA 3F2NA 3QCXA 2PVHA 4FKVA 3A7IA 3S3IA 2CKEA 2WXVA 3LZBA 3PTGA 3HL7A 3FUPA 2NNWB 4G3GA 4O0XA 2H34A 2O0UA 1WFCA 4PF4A 3FMHA 3OCSA 3W8LA 1MUOA 3RTPA 2ACXA 2VNWA 2G2FA 1OKZA 3TTJA 2X7OA 4M12A 4X2GA 3UQFA 2XH5A 4YPDA 3P1AA 1XH8A 4YHJA 1Q8YA 1JWHA 3KFAA 4N0SA 5AP6A 2CMWA 5CALA 2VWWA 4L45A 4ENYA 5AR4A 1PHKA 3QGWA 4MXOA 4F09A 4YTCA 3C5UA 5C27A 1BYGA 4ASDA 3VJNA 4C2VA 1M7QA 2PVKA 4GRBA 3QQKA 3R8VA 2WMUA 5J5SA 3IECA 3HUBA 4IVAA 5GZ9A 4EHEA 3CXWA 4EZ5A 5HLNA 2OIBA 2WMVA 3PVGA 3ZLWA 1OZ1A 2W96B 4UWBA 3IW4A 3PVBA 3F7WA 4TWCA 3QZIA 2JIVA 3WIKA 1O6LA 1O6YA 4V05A 2JLDA 3DZQA 3PA5A 4KA3A 3QWJA 4ZK5A 4YR8A 4FKGA 4U44A 5HG5A 2I7QA 4GMYA 4TY1A 4F7SA 5L8JA 5HEZA 5K9IA 2NRYA 5A4CA 2GFSA 2QKWB 3FC2A 1W98A 1YWVA 2GS7A 3V8SA 2GQSA 2QC6A 4I22A 4L01A 1ZY4A 2HXLA 2BZHB 2OK1A 2GMXA 3TUDA 1OL6A 1PXMA 2O64A 1YRPA 4YNEA 5C4LA 3R73A 1KUTA 2IN6A 4FSNA 2OXDA 4ZSLA 2OJ9A 3BWFA 3T3VA 4QPMA 5JRSA 1A48A 4GUEA 2C3JA 3DLZA 5HO6A 4QQ5A 4ITJA 5LVPA 2E9VA 4KAOA 5E8TA 1Q41A 3VAPA 4HPTE 4C34A 3VF8A 5KMIA 3PUPA 4FZ6A 1YWNA 5AV3A 4YC3A 3PXFA 3GP0A 4S2ZA 3LFDA 1RDQE 1FVRA 4EWHA 3OT8A 1M2QA 4G9RA 3Q04A 3ZSHA 3UG1A 4FEUA 3AG9A 4RIYB 5ETCA 5JMSA 2XS0A 3ODYX 4BGQA 3R63A 4E6CA 5HG7A 4ZY5A 5M09A 3KRWA 4L7FA 4R1YA 4M3QA 4QMLA 5T68A 3R8UA 3PPZA 1LEZA 4GT4A 4KIOA 2FVDA 4JG6A 2IVSA 4OTGA 4Q9SA 4FTLA 4QT1A 3MS9A 3SW4A 3W8QA 4H1JA 4MCVA 5I9YA 2B9HA 1H4LA 2PVFA 3FHIA 2XKFA 3EQDA 4YZNA 5CU3A 5DEYA 5E8UA 3JVSA 1YHWA 1OECA 5IUIA 3ZH8A 5IQIA 4IAAA 2BDWA 4UZDA 2VTJA 4KSQA 2UVXA 4FSQA 2OJFE 3TNWA 2WTIA 3A7JA 5CQUA 3TDWA 4U41A 2C5YA 4ITIA 5EW3A 4BTFA 4D28A 5L6WL 3WF7A 5L8KA 3HVCA 3TNQB 3THBA 4BI2A 3RAIA 3MY1A 1KE5A 3PA3A 4HJOA 1YXTA 3ZUTA 1P4FA 3U4UA 4IC7A 3H9RA 3CGOA 4WSQA 2BHHA 4O0YA 5KBRA 3O8TA 3V8TA 5IQHA 4I5MA 4TL0A 5DA3A 2CCHA 4HVGA 3LFEA 2JDRA 3PXKA 3SXFA 4NH1A 3CP9A 2X2MA 4RFZA 3FZOA 3AC8A 5A14A 2QG5A 3PDTA 4WA9A 3V51A 3TNIA 5J1VA 3QQGA 4LM5A 3R83A 3M42A 3O51A 3I6UA 3LXLA 4TYHA 1W7HA 2J9MA 3GQLA 5M4FA 3R9OA 3ZZEA 3UPZA 1FMOE 4EOKA 4YO6A 2GNJA 4F7LA 1UWJA 3FLQA 3SDJA 4EKLA 4BYJA 4XV1A 3SRVB 3OBGA 2WIPA 3KMMA 4JT3A 5CSWA 3GVUA 3FAAA 2EU9A 4FIFA 4GFGA 2VGOA 2PL0A 4I4EA 3JYAA 3VBWA 4DN5A 3ORIA 2BTSA 3QFVA 3EHAA 3P86A 3G0EA 2GPHA 3EQGA 3PSCA 4L7SA 4U45A 1H0VA 4Y5QA 3ZZWA 4C36A 4CXAA 3CIKA 2XJ2A 4LRJA 5KMMA 2PUNA 3NMUF 3NNWA 4AU8A 3WYXA 5B2MA 1JAMA 1BX6A 2ZDTA 4FKOA 1TQMA 4YZBA 4YTHA 4EUTA 5AM7A 3CPBA 4MHAA 4F08A 3V04A 2R3PA 4AGUA 3ZDUA 3OCGA 4BBEA 2W4JA 3EN5A 1H0WA 3QZGA 5FM2A 3GOKA 3IONA 5LVNA 4D2PA 1UU7A 4AT3A 4G16A 3OY1A 5DVRA 4FK6A 5DGZA 4CVAA 1Q62A 2OXXA 3BBTB 1OKYA 2PE0A 2VWXA 3FLNC 4ZTQA 3KRRA 4PTGA 4XLIA 2J0LA 2GSFA 3MH2A 4UBAA 5E92A 1B6CB 4MF0A 4W8EA 2YISA 3W2CA 4C35A 3PJCA 2CLXA 2GS2A 2R3HA 3GCPA 3UC4A 4ACCA 2HY0A 3FYKX 5HVKA 1I44A 3WZUA 3FZRA 2C0OA 2JD5A 2OJIA 2YM5A 5IPJA 3B8RA 2X9EA 4BL1A 1BI7A 3ROYA 2EVAA 3E8NA 2HWOA 3H9OA 4WUAA 3TIYA 3SOCA 4EK3A 5I3RA 3HMMA 3KXGA 3Q5ZA 3QCQA 3OMVA 4NUSA 4X6QC 5EW8A 3RCDA 2V0DA 3F5XA 3R02A 2HZNA 4FSZA 2YZLA 2YIWA 2F57A 2EB2A 4MQ1A 4RWIA 3OP5A 4WRSA 5HX8A 3KA0A 2YJSA 4CLIA 5D10A 3NVMB 2I6LA 2VWIA 3QTIA 5FEEA 3II5A 1OITA 2R64A 3FLSA 3IGOA 4BWKA 3ZM4A 1YW2A 4XCUA 3V01A 4KUJA 4AWIA 4LGDA 3ZUVA 2W5BA 1XJDA 2QR8A 4NM5A 4YGAA 3MB7A 3HAVA 4C4GA 2UW0A 2BILB 4EH2A 5CAOA 2A27A 1OIUA 4FVQA 4BWPA 1APME 3C4FA 4QMYA 4ACGA 4BCJA 2VTAA 5IA1A 2UW5A 5LOHA 2VTRA 2BRNA 3F3UA 4L00A 4A9YA 1OKVA 3VBXA 3COMA 4YC6A 3FWQA 1KE8A 3I79A 4I92A 2WNTA 4ZLOA 5L3AA 3F3TA 4NEUA 2ZV9A 4DT9A 5HI2A 4PDSA 1JSTA 3UO6A 3FDNA 4DITA 3BZ3A 4RJ8A 2VU3A 4FV2A 4FVRA 4IDVA 3DZOA 3PY3A 2VTLA 4EJNA 4WSYA 1NA7A 2RFDA 1JKKA 5C9CA 3QU0A 3IGGA 4L3LA 5DFPA 3MESA 4USFA 4G3DA 1OL5A 1ZYDA 3DQXA 3GENA 4IAIA 4ARKA 3KRJA 4BDIA 4FTOA 4A9SA 3PSDA 1LEWA 3OZ6A 5CI6A 2J0IA 2X7GA 4Y95A 3VJOA 2XNGA 1OI9A 2UW9A 3RMFA 3NCGA 3ZONA 3C0GA 3ZDIA 5M07A 5IA2A 4EWQA 2C3IB 5ETAA 4F99A 5DOSA 3E8CA 2VTOA 4WG4A 5K0XA 1XBCA 4TYGA 4O84A 3N51A 4FV7A 5CEKA 2XNNA 5GINE 4WBBB 3TIZA 4UMTA 1U54A 4K8AA 3IS5A 4OUCA 4PMSA 2PPQA 4EKKA 1P14A 4XV2A 3QRTA 1KWPA 4UB7A 4BDFA 2WTKC 4DGNA 2H9VA 2HK5A 3B2TA 5AUZA 5TO8A 4BYIA 4CRLA 3DNEA 4E93A 3NW7A 3IW6A 4CMOA 3LJ1A 4IM0A 4CMUA 4XHKB 3GFWA 2YLEA 4U6RA 3TZMA 3VRYA 2OZOA 1KSWA 2P55A 4F9AA 1NVRA 4IE9A 3UVQA 1EH4A 1BI8A 4D2VA 4ZS4A 3OTVA 2CLQA 4FKSA 2WB8A 4PX6A 4QP3A 4YBKA 2PE1A 4I6FA 3R2YA 4ANNA 1WBPA 3ANQA 2W1FA 3R04A 3G15A 4FYNA 4MYGA 4O21A 1R3CA 2WTJA 2NP8A 4TNBA 4PDYA 1KV2A 4FSTA 2FB8A 3G9NA 1U59A 4I21A 3ZXTA 3QQJA 5CAQA 3F9NA 1M2PA 4F1TA 5HD4A 4BWXA 3R1QA 3BHVA 2ITVA 4UEUA 4FT5A 3L8VA 4IFGA 2R7BA 1YOMA 3EFWA 2X81A 4X6RA 5FGKA 3MN3A 5M51A 2YDIA 3TEIA 3UIMA 3VRZA 3AD6A 4XP0A 4LUDA 3OFMA 2WMRA 2CN8A 2VN9A 2OG8A 3ZO1A 3B2WA 4IZYA 4ZAUA 5FTOA 4MD8E 3SX9A 4I24A 1NY3A 5DEWA 3MPMA 2RL5A 4BGGA 5HO7A 4B8MA 1Q3DA 5LQFA 5LXMA 3P08A 3FXZA 1YWRA 4WKQA 2P4IA 4FR4A 4BIDA 4Y85A 3AD4A 5H8BA 4JS8A 4E8AA 1H8FA 4RG0A 1GIHA 3QD2B 3B8QA 4ZSGA 2HOGA 2J6MA 2JIIA 3I60A 1SM2A 4G2FA 3UO5A 2HCKA 3AMBA 5H8GA 2ITWA 4A9RA 5CU4A 2WTCA 5KE0A 2BAQA 4Y5HA 3M2WA 3KMUA 5CU6A 2OF4A 3K3JA 4D1ZA 3R8PA 5IEVA 3LCTA 1RJBA 5IEXA 3SXSA 4BDAA 1URCA 4IVDA 4YUQA 2IPXA 2X6EA 3IW8A 2GNHA 4B9DA 4CFUA 2C3KA 2HXQA 1DAWA 4RX5A 1G8AA 2BFYA 3F2RA 5B2LA 1OKWA 4I94A 3Q53A 4QYGA 3LXNA 3NYNA 3F61A 3RPYA 4DG2E 1F0QA 4HNFA 5EI8A 3QAME 3PPJA 4UV0A 2GNLA 2XCKA 3R2BA 3PP0A 4CG8A 1J91A 3LCDA 2ZM3A 4FTCA 4F1OA 3R71A 3QC4A 4DBNA 5HKMA 4HCTA 4WNOA 4QYYA 1OMWA 2QU5A 5AR2A 3I7CA 4KNBA 1CKIA 3LCSA 3CY2A 2BRGA 2PVLA 3Q9YA 4JG8A 5EHYA 3ULIA 4YHTA 3OVVA 4PNKA 4KIKB 3FKOA 4QQTA 1YDRE 1PMNA 5DRBA 3SRVA 1FPUA 1XH7A 4B99A 4CQEA 2BDJA 3NWWA 3EMGA 4CNHA 1Q24A 4FT9A 4JQEA 2PZIA 5FEQA 3UVRA 3NNVA 1YXUA 4OAUC 3BU3A 4AXAA 5LMAA 5HGIA 3POOA 1MQBA 3E7VA 4ZXTA 5EKNA 2BALA 3COKA 5ACKA 1Q97A 3A7FA 1GZNA 4FUYA 3EZVA 4AACA 3GC9A 3ZOSA 4YMJA 2W9ZB 4DA5A 1OL7A 4FKIA 3QQUA 2OZAA 4WUNA 2YIYA 2VUWA 3RAKA 4DFBA 3A4PA 3IO7A 4CZTA 5C8KA 2OSCA 2PVNA 4CLJA 2WQEA 2YLFA 3V8WA 1Z5MA 4OTPA 3DBDA 4EHVA 5KCVA 3CC6A 4MAOA 4FEXA 2XK3A 4O22A 4IQ6A 4N70A 3QX2A 4DG0E 4X21A 2RKUA 3VVHA 5AFVA 3W2SA 4U42A 4EQCA 1MRYA 1VR2A 4QRCA 5AM6A 3Q6UA 4MWIA 5HICA 4G34A 2B54A 5HO8A 2QOLA 4QP8A 2OU7A 3E3BX 4FV4A 4JJRA 4YO4A 2ZAZA 4J99A 5AR5A 3R7GA 2BZIB 3MFTA 2R3MA 4ZZNA 5DRDA 3GU6A 3VS2A 4C3FA 4FG8A 4FKJA 1ND4A 1AGWA 4DFUA 3VULA 2H6DA 2B7AA 4RX9A 1L3RE 3ZEWA 4FTTA 2YIXA 3W32A 2I0VA 2UZDA 4AFJA 1H24A 4FZ7A 5FD2A 4AZFA 5LJJA 4O7LA 5DT4A 3SG8A 1ATPE 2PWLA 4I5CA 4AZEA 5JFWA 5DH3A 4JBVA 3QLGA 3QRIA 3KK9A 3RK7A 3UODA 4H05A 4BCFA 3SHEA 3IK3A 4RWJA 2NRUA 5ANKA 2CKQA 1DM2A 2BROA 3EQHA 4Q2AA 1Q4LA 3EKKA 3WF8A 5CEPA 5LMKC 2UW6A 2GCDA 3VUDA 4NIFA 1M17A 3MBLA 3SQQA 1PYXA 2B0QA 3LMGA 3ORZA 4L53A 4YLLA 5IUHA 3NYXA 3E63A 4LV8A 3CJFA 3HAMA 2Q83A 2VTHA 3QRJA 2C5OA 1FGKA 4HGSA 2VTMA 2C6OA 3UVPA 4EK6A 2QVSE 2UZTA 5H9BA 2F7EE 3A7HA 3BRBA 3ENHA 4LGHA 4FIEA 4O0WA 3DA6A 2EWAA 3DBQA 5K0KA 1OUKA 2RSVA 4U3ZA 5J9ZA 3Q9ZA 2VX1A 4LYNA 5A9UA 3GT8A 2PUIA 1TKIA 1VYZA 4FZDB 2J90A 2WQNA 3AT2A 4ACMA 4O81A 2CKPA 4LI5A 4ZJJA 4C61A 4OTDA 3LMHA 2GHLA 3CS9A 3DAEA 4KRDA 3SV0A 5FEDA 1E1XA 2C4GA 3PIZA 4J7BA 4FL3A 3G0FA 2IJMA 3Q4ZA 3QA0A 3EIDA 3RPRA 5CEIA 4ZTSA 1JOWB 2GTMA 2W5AA 3KC3A 5C01A 2C6DA 2XA4A 4K77A 4QTEA 4M15A 2ZMDA 5JFVA 4AZTA 2GDOA 3A8WA 3ENMA 2WEVA 3EWHA 3NW6A 4KIQA 4U97A 3ALNA 3WE8A 3AC1A 3UNZA 3EKNA 3QXOA 4FE2A 1WVYA 4XYFA 5IMEA 4NK9A 1H25A 4ZTNA 2GHMA 2R3OA 3OW3A 2YCSA 2W1HA 1PYEA 3OD6X 4NM7A 4QP4A 2W1GA 3QHRA 4I23A 4HOKA 5CAPA 4PUZA 4FV9A 2QCSA 5D12A 1YVJA 3FLWA 3GUBA 4EEVA 3FBVA 3R7YA 2IVVA 4L46A 4FSUA 4M67A 3DKFA 3GNIB 1ZOHA 5HZNA 3FMJA 4NJ3A 3UIBA 4F6WA 3PP1A 4G5JA 3F5UA 4KS7A 3NVKI 3CBLA 2IO6A 3ELJA 3ACJA 4JDJA 4CT2A 4O6LA 4ZOGA 2VTPA 3VNTA 1H1PA 4DAWA 1P4OA 1S9IA 4C37A 4B4LA 2RG5A 4ZP5A 4AA5A 5BUEA 5LMBA 2BZJA 2PSQA 3GCQA 4FKRA 4XLVA 5LMKA 2WMAA 4HPUE 4ZZMA 4Z7HA 2P0CA 2ZB0A 5AP5A 5KMOA 3O7LB 4K9YA 4TT7A 2IWIA 5JFXA 1VYWA 1ZRZA 2WAJA 3R9HA 3TI1A 1Q61A 1SYKA 3HDNA 4R3PA 4OAVB 4BDKA 3OY3A 3HV3A 4O2ZA 4MBLA 4DEBA 5M06A 4RGJA 2A19B 3E93A 3I6WA 4CZYB 2PULA 3FSKA 3NZ0A 3OWPA 4OTQA 5AP1A 4EHZA 1FQ1B 5EDPA 4AGWA 4C4HA 2W0JA 3L9LA 3ZCLA 2YCFA 2Z7SA 2GNGA 3I5ZA 4EH6A 1ZXEA 1A9UA 5CXHA 4LRKA 3ZBXA 2R5TA 4J8NA 2HIWA 4NZWB 5BMSA 3FMDA 2QOIA 1H1RA 4TWOA 4HCUA 4TN6A 3ZRMA 3VBTA 3PY0A 5KMJA 4CRSA 3ZLYA 2B53A 4FV0A 4IM2A 4OW8A 2WU7A 3DGKA 2E9OA 4RIXA 5D7VA 5HLWA 1QPCA 2F7ZE 2WTVA 3K5UA 4YJSA 5DYJA 1XR1A 3DXQA 2QOFA 3MDYA 3O23A 2WPAA 4KKGA 4DTKA 3SVVA 3ZTXA 3LQ8A 1KE6A 2VAGA 3MW1A 2JC6A 3DJ7A 4EORA 4Y72A 3TKHA 4XP2A 3TJCA 4E3CA 2XF0A 2XKCA 3R1SA 3E88A 3W16A 3U6HA 2ZM4A 4MD9E 5K5NA 4FZAB 4E6DA 5D1JA 2O65A 3BX5A 3QGYA 2UZLA 4CKJA 4EK8A 1ZWSA 2OJJA 4DEGA 2UZEA 2XK9A 4G3EA 4E7WA 4EH8A 4ERWA 4ASEA 5ICPA 3FKLA 5CF4A 2BKKA 5J79A 2RFEA 5A4EA 3BI6A 2FYSA 3BYOA 2ITPA 4IH8A 4F9BA 3BLRA 5CSXA 5HIBA 3UOJA 1BKXA 5CS6A 3WARA 3LQ5A 4FTAA 4CTCA 4EH5A 4RC4A 2XZSA 2Z02A 4ZMEA 5ANDA 3BHTA 4FV3A 2PZPA 2XK7A 3PXRA 4HNIA 1MRVA 5T3QA 3P9JA 4WG5A 4YLJA 3PXYA 4EOPA 5CEMA 4NWMA 2X0GA 3SD0A 3FEGA 4KBAA 2IZSA 4FVPA 1PY5A 5BUJA 4JDHA 4M0YA 2UW8A 4BTMA 2E2BA 3EN7A 4IZ7A 4BCPA 3PSBA 5HNBA 5LVLA 4WT6A 1ZMUA 5FTQA 5I4NA 4R8QA 5J87A 3TACA 2ZJWA 3TKUA 5BX0A 4XG4A 4FL1A 3SKCA 4BCIA 4DFZE 4JIKA 4E4MA 2ONLC 1WBVA 4IAFA 4IADA 2OO8X 3I4BA 4G6OA 4ZSAA 2C30A 5G6VA 5D11A 1V0BA 2VWBA 4D1SA 4LL0A 5IH4A 3Q4TA 2JBPA 3D9VA 3I0QA 4WHZA 4ZTLA 3RWQA 3L9NA 2WIHA 2BDFA 1WVWA 3ODZX 2OGVA 3JS2A 4ACHA 4M13A 3RHKA 2FSOX 3HRFA 3IOPA 3NNUA 3R28A 1WBNA 3F88A 3T9TA 3M1SA 4E4LA 3NW5A 1AQ1A 4FX3A 2YM6A 3E64A 4XG8A 4NW5A 3U6JA 3ZSIA 3W2QA 2RFSA 3KULB 3ERKA 4U7ZA 2LAVA 3O50A 2WMBA 4TW9A 3C5IA 2UZWE 4CCUA 3E8EA 4BR3A 2CKOA 4IJPA 2W1IA 3QCYA 5FP5A 3BIZA 2VZ6A 3AXWA 4UYAA 3T8OA 2HW7A 2R9SA 3WZDA 5HU9A 4EJ7A 5FDXA 4DT8A 3OCTA 1PXIA 1H1SA 1UV5A 4ZY4A 2ETRA 1Y6AA 2IVUA 1SVHA 2ITUA 4AUAA 1SNUA 3RZBA 2XIKA 2UZNA 3TT0A 5JQ8A 3RM7A 3U51A 4MBIA 1UNHA 2Q0NA 4NKSA 4GT3A 4CD0A 4DCAA 1FVTA 1GIJA 2WKMA 2WQMA 4NT4A 5F94A 3QRUA 2ZV2A 3Q5IA 4FSYA 3D4QA 2C6TA 4UWYA 1SVGA 5A4LA 3FY2A 3T3UA 4D55A 1R78A 3OOGA 5A3XA 3IQ7A 2G2HA 5JEBA 3D7TB 4RJ7A 4RX8A 2QU6A 2F2CB 3HYHA 3OWLA 4G5PA 1GZOA 3SG9A 5K3YA 5CVGA 3K3IA 3UOHA 2YERA 3V3VA 3VBQA 3PPKA 2ERZE 3R21A 4FV5A 3G2FA 4XOYA 3VS4A 5FTGA 3PLSA 4BKYA 2CNQA 4GJ2A 2W5HA 1U46A 3A61A 5AUWA 4O1PA 4WNMA 4DF3A 5F4NA 3I5NA 4BCGA 1G3NA 2WD1A 2ONLA 1T46A 4O7RA 4S32A 5IQEA 4HVSA 1HOWA 4HGTA 4S34A 4IB5A 5CSHA 5AMNA 5H3QA 3VO3A 4UN0C 1HCKA 2WZJA 5ETIA 4DEDA 4Z16A 3W1FA 3HUCA 3MVHA 3SW7A 5IEYA 4RLLA 3BHUA 2YM3A 4YSJA 3IKAA 3C50A 3JUHA 3LIJA 3BEGA 2ERKA 4RBLA 3LPBA 3RAHA 2FH9A 5EI2A 3CJGA 3OT3A 4I1ZA 3LVPA 4QYFA 5EYMA 3LQ3A 5KZIA 4Z55A 4ZLZA 4RLKA 2WEIA 2WOTA 4ZTRA 3DKGA 2FUMA 3VQUA 5HHWA 5HNGA 5B7VA 3NLBA 2HW6A 2QOHA 3MYGA 3NRMA 5CTPA 4W4WA 5BQ0A 4LL5A 2XYNA 2SRCA 3FQHA 3RNYA 3LJ0A 4IHPA 5TOZA 3HDMA 3UTOA 3VHKA 4DEIA 3UYTA 5A54A 1OBGA 4OBOA 3JR1A 1QPEA 3V6RA 2JITA 4FTIA 4J1RA 2PE2A 4QMXA 4BCKA 4FK3A 2YACA 5H8EA 1YQJA 4BY9E 3PJ2A 1STCE 4AGCA 4G3FA 3ZLXA 4AFEA 3E92A 3AC5A 1W83A 3PG1A 3KB7A 3Q4CA 3HP5A 4FL2A 1T45A 5HE3A 4BRXA 5CAVA 3NUPA 5L8LA 5GNKA 4PPAA 4C57A 5CT0A 5J9YA 4JRNA 5I9XA 3KMWA 3Q2JA 4IX3A 2P3GX 3GU8A 4G3CA 4IX5A 2BRHA 5K4IA 3ZC5A 4XV9A 2UW7A 4GIHA 4ZIMA 4BI0A 1J3HA 1R0PA 1SZMA 2BHEA 3F3ZA 2Z7QA 5D7AA 5KMKA 3KRXA 1H08A 4X3FB 3PVWA 5DWRA 1VZOA 3MH1A 4E5AX 3BE9A 3SOAA 1PXOA 4H39A 4PDOA 5KO1A 2XRWA 3UOLA 5GJFA 2G1TA 4YP8A 4ZJVA 4O6EA 1RQQA 4F0IA 4QMOA 3ETAA 4YJPA 3QTRA 5I9WA 4EH7A 2VRXA 3HX4A 2G01A 4IZ5A 2I1MA 4NU1A 2JAMA 4M84A 4GS6A 1W8CA 3MGYA 4JQ7A 2V22A 4EK5A 5JGAA 3S0OA 4M69A 4O2PA 4G9CA 4FT0A 4OBQA 3A2CA 5IA0A 4L67A 3AC4A 3OWKA 3FI8A 2JBOA 4ANMA 3CQEA 5EW9A 1BL7A 3RZFA 3PIYA 3IDCA 4P7EA 2PVYA 2UZVA 2Z7RA 3AMAA 2JIUA 3QUPA 4RIWB 1ZZLA 4EH4A 4JAIA 3NUAA 5M08A 1ZYLA 3Q4UA 1GY3A 4NW6A 3DK7A 5D9HA 5JT2A 4E5WA 5L2SA 3PJ3A 3CE3A 3OXIA 3E8DA 5AIKA 1K2PA 2DQ7X 1JQHA 3IPHA 3Q60A 3QX4A 4EHGA 1YHSA 2RF9A 5HTIA 3P23A 4N6ZA 2YA9A 3MJ1A 5J8IA 3WOWA 4ANOA 4EYJA 5TT7A 4J71A 2J2IB 4CCBA 3C4XA 2W7XA 2DYLA 4KABA 3P7BA 3WZKA 1NVQA 3FMNA 2P2HA 4GIIA 5L2IA 2X39A 3DB8A 3D2KA 3HNGA 3L9PA 4BGHA 4ZMFA 3D2IA 2KTYA 4E6QA 4RA4A 2OF2A 3ALOA 3BU6A 5DT3A 4GFMA 2WOUA 1V0OA 4M97A 4O91A 1IEPA 4EONA 5K4JA 1Q8UA 5CANA 5LVMA 4DCEA 4QQJA 4E20A 4YPSA 1J7UA 5CYIA 1P5EA 4Q9ZA 2WMWA 2HAKA 4CKRA 4YJUA 5EM6A 4S31A 3UNJA 3W2RA 3IW7A 2R4BA 4YSMA 1ZARA 2R3NA 5AA9A 3GU7A 5BVNA 5HESA 1ZAOA 3HGKA 4BHZA 4M7IA 4HVHA 5E4HA 3U9CA 1H07A 5C8NA 3EN4A 5IU2A 1J1BA 4TYJA 1H27A 2J0MB 2ZMCA 2ESMA 3D94A 4NM0A 3OOMA 4BIBA 4LMUA 4F63A 3TUCA 3DCVA 4AA4A 3U55A 1A06A 4UMPA 4W9XA 3R8ZA 1OIQA 4O7ZA 2C5NA 1S9JA 3HLLA 1JNKA 3FL5A 2R0UA 3MI9A 3O2MA 4MKCA 4G1WA 4IB3A 4K11A 4M0ZA 4U3YA 1YDSE 5T6KA 2CSNA 5BYYA 3KXHA 5EM5A 3O0GA 1IASA 1H1WA 5AP0A 4GU9A 4XS2A 5FBOA 2ITZA 5HBEA 2JDOA 2ITQA 3AD5A 3EN9A 3FLYA 4MNEB 4JR7A 4V0GB 4C2WA 3MH0A 3JVRA 5CU2A 4C7TA 4F7JA 2BAKA 3IW5A 3CQWA 3EH9A 3CCNA 2JFMA 4FTQA 3S95A 3TNPC 4A9TA 3P5KA 4KKEA 4F1MA 5EG3A 3QZHA 5E90A 1FMKA 3WZJA 2WTWA 4G6LA 3RPOA 3TZ7A 5IZFA 3KXZA 5CEQA 3FE3A 1PMEA 5ETFA 3AC3A 2C0IA 2XNPA 5LCJA 2X8DA 4IMYA 4NYEA 4FODA 3WZEA 3NYOA 3ZS5A 2YIQA 2J0JA 1OM1A 4IB1A 4FKWA 4BHNA 4HCVA 3GC0A 2GS6A 4L6QA 5DN3A 4FTNA 4AOIA 3PIXA 2W1EA 4LMNA 5EYKA 4U5JA 3BGQA 2VWVA 3OUNB 3EB0A 2XEZA 2DWBA 4MXZA 1MP8A 4GUBA 5EQYA 3LCOA 2VO7A 3C0IA 4FEQA 4F4PA 2OLCA 3VUGA 4O0RA 3I7BA 5C4KA 2BKZA 2Y4IB 4QYEA 3ZO2A 1OGUA 2Z7LA 3DQWA 5E8YA 4J96A 3SC1A 3CSVA 4CKIA 3KVXA 2C5XA 3KN6A 4KIPA 4EH3A 4DINA 3Q52A 4EZ3A 3BYUA 3QUEA 5K5XA 2QHNA 4Q5HA 4CFVA 2A4LA 1JBPE 4HW7A 4QMWA 2AC5A 3DOGA 4RIYA 5E91A 3KXXA 5J95A 3FI4A 4JOAA 4TWPA 3C4WA 3EQPA 3DT1A 4RC3A 2OWBA 1CKJA 4QMVA 3KQ7A 2V55A 4RWLA 2X2KA 2XJ0A 4IACA 3PRFA 4OTRA 1GOLA 1OL2A 4JBPA 5IQCA 1PF8A 5L6PA 2XIXA 4QYHA 5F1ZA 2CNUA 3F2AA 2PU8A 3KCKA 3PLAE 3FLZA 3D7TA 4EOSA 1KE7A 4D5KA 3QWKA 4NJDA 4Y73A 3QQHA 4DFNA 4E73A 1GZKA 3WILA 4EC9A 1GZ8A 3MFUA 4GL9A 4NKAA 2YFXA 1F3MC 1JKSA 3FQSA 3HKOA 2W06A 4HZRA 3MWUA 3N9XA 2B9FA 3QHWA 2Y9QA 4FNXA 2BR1A 4YJRA 2RGPA 4W8DA 4L52A 3UE4A 4II5A 3KRLA 2ETMA 2VWYA 5LCKA 3VHEA 3D83A 4DGGA 1WMKA 3OWJA 1PKDA 2PMLX 3C4CA 3QLFA 4M68A 3O17A 4F0GA 2W99B 1J1CA 4X3JA 3UMXA 4G6NA 5AAEA 4IAKA 3CEKA 1V0PA 3EQBA 5DR9A 2BCJA 4O7TA 3P0MA 5J7BA 4MWHA 5EOLA 3DBCA 1M2RA 2B9JA 2QR7A 3RJCA 1QPJA 4E6AA 5HCXA 2XK4A 4HYHA 5LARA 4TXCA 4AOTA 2VGPA 3DU8A 3QKKA 3AC2A 4O27B 4BTKA 3PG3A 3EL7A 3QUDA 4JI9A 4RX7A 1WCCA 3BLHA 4GYGA 2UUEA 1XH9A 3ORNA 5D41A 5HG9A 4RT7A 4HGEA 4FKTA 4GSBA 1LR4A 4GYIA 2E9UA 2C1AA 2C6KA 5FLFA 5CY3A 4LGGA 3TKIA 3TZ8A 4PTEA 3G5DA 4IX4A 4QNYA 4YJTA 5IG1A 3F7ZA 4EZ7A 3BLQA 3QCSA 5GIPE 2WQBA 5E7RA 4RPVA 2O8YA 1WBWA 2W05A 3RP9A 2V7OA 3KY2A 3S2PA 3RPVA 3DKCA 4FOBA 4GVJA 3SXRA 3BWJA 3Q32A 5GIOE 3PYYA 5DR6A 1ZY5A 5IDPA 2C1BA 3ZXZA 4XJ0A 5J7HA 4V04A 4AW5A 2X9FA 4R7BA 3VS6A 4GFOA 3EYGA 4LG4A 3EQRA 4A4LA 4YNOA 3AQVA 4QTBA 3FXXA 3R7EA 1XKKA 4IWDA 3AGMA 3R9RA 2PMOX 3AT4A 4QD6A 5FXQA 4DTBA 2OFVA 3FY0A 2GQRA 4C38A 2ZVAA 3P7AA 5KKRB 3PA4A 4A07A 3WYYA 2QURA 3L1SA 4M8TA 3VIDA 5A6OA 2PVMA 3ULZA 5BPYA 2ITTA 3I81A 3FKNA 3NUSA 3QC9A 3VS7A 2W1ZA 4J97A 3VS5A 4RZVA 2GFCA 2R3QA 4IAYA 3R8LA 4MBJA 5L2WA 3NGAA 4FV8A 2V5QA 4EOIA 4WG3A 4A4OA 4O7NA 1OIYA 1ZMVA 1XH4A 3DDPA 4RIOA 5AR3A 4BDCA 4CSVA 4U43A 2ZYBA 1NXKA 2ITYA 5I5ZA 3BV3A 4QQCA 3L8SA 2C3LA 1V1KA 3TN8A 2PMIA 2JKKA 2ZV7A 4G31A 4RZWA 5AJQA 3ACKA 3ZMMA 1E9HA 2R3FA 4ZJIA 3F6XA 3CQUA 3ZRKA 4YJVA 2CPKE 3QTUA 4EQMA 4S30A 1UVRA 3EOCA 5IA4A 3KREA 2RFNA 2XRUA 3F3WA 5AUVA 1DS5A 5C1QB 5HCYA 4HZSA 2I0YA 4JQ8A 3OTUA 2HENA 3BE2A 4U8ZA 5CXZA 5L4QA 4RIWA 1XHAA 3UZPA 3NNXA 1NW1A 4P4CA 4O7YA 4DBXA 4IWPA 2I0EA 1ZYSA 3NR9A 3PFQA 1H00A 5EYCA 4ZSEA 1JVPP 2ZB1A 2HWPA 3EQCA 4LRMA 1PMUA 3BYSA 2O5KA 4Y83A 3OG7A 5A4TA 3HV5A 3F69A 2YDKA 3GI3A 3NEWA 2JKMA 2CGWA 3G51A 3KXNA 1FOTA 4TWNA 4N57A 1KV1A 5CF6A 3KGAA 4HVIA 4L68A 4BCMA 3VN9A 5JGDA 1BMKA 4JBQA 3CY3A 2C6LA 4GW8A 4TYHB 4JL9A 3Q9XA 4YBJA 4F64A 1KE9A 3RK5A 5EK7A 1M7NA 5M4CA 3NIEA 2Y7JA 1CKPA 5KMNA 2R3IA 3R7IA 4EOJA 3DTCA 4YZ9A 3K54A 2HZ0A 4O0TA 3U8WA 3PXQA 2PUPA 4G17A 2ITNA 2VD5A 2B9IA 1XH5A 3QF9A 3ZFMA 1SMHA 3MTFA 4AN3A 4JLCA 4BDEA 1IA8A 2VTSA 2W17A 1PMVA 2F9GA 3KN5A 4WNKA 5AWMA 4MH7A 3H10A 3VUHA 3F5PA 4FIJA 3RWPA 3MA6A 5CWZA 2QG7A 5DG5A 4P5ZA 2R3GA 1OPKA 2B52A 2H96A 5FRIA 3MPAA 2VX3A 3BHYA 2XYUA 4C58A 4EOMA 4Z7GA 4O7WA 4O82A 3ZO4A 3PJ1A 2X2LA 4ANLA 4BBFA 5HE2A 3ORLA 3FHRA 4Y8DA 5LWMA 3FMMA 4XG7A 5EI6A 4PPBA 1Y91A 3VUTA 5HE1A 5CAUA 3DY7A 3R7OA 4BCNA 5JSMA 4AE6A 4UMRA 5BVWA 2QO9A 2X8IA 3GCSA 1UWHA 2X4FA 3AGLA 1QCFA 3I1AA 4FF8A 4MXXA 4U80A 2I40A 4AA0A 3FC1X 3CR0A 4I0RA 4E4XA 3SLSA 2GHGA 4F9WA 1PXKA 2J5FA 2YHVA 3TZ9A 5AUUA 4RFMA 4DLIA 2YM8A 3MJ2A 3LHJA 3FZSA 1UA2A 2J7TA 3E87A 3QTWA 4OT6A 3RI1A 4DFLA 4QPAA 1PJKA 1U4DA 5CU0A 3P78A 4KD1A 3OW4A 5CF5A 2QOKA 2G15A 4MNEA 4RJ4A 1BLXA 3BV2A 3MY0A 4XX9A 2YM7A 1WBOA 3DK6A 3OXTA 4N4SA 4GU6A 3O96A 2O3PA 4QMSA 2AC3A 3FL4A 1ZYCA 3A7GA 4DH7A 2Y4PA 4JX3A 4PWNA 4C4FA 2V7AA 1WVXA 3NSZA 3FZPA 4FT3A 4WO5A 4JBOA 3RGFA 1J7LA 2R0IA 2GU8A 2UZBA 1KOBA 3BPRA 2YCQA 2YZAA 5FM3A 3JXWA 4EOQA 4RMZA 3BGPA 5AAFA 3PJ8A 1O9UA 2UVZA 4W4VA 3BBWA 4I6QA 2XM8A 2XEYA 3U4WA 2CGVA 5DHJA 2FO0A 4PV0A 5HBJA 2JAVA 2WMQA 3QD0A 3UGCA 2B1PA 4FEVA 2W1DA 3QA8A 1UKHA 3PWYA 3PWDA 4HYUA 2BUJA 4KBCA 5L2QA 2CN5A 4X7QA 4XG9A 2NPQA 3GXLA 4JNWA 1F5QA 2YWPA 1Y6BA 3ATTA 5E8ZA 3QQFA 2YIRA 5IMXA 2WELA 3GU5A 5E8VA 3HP2A 3U87A 4ZTHA 3JY9A 5KHXA 4XRJA 4DGLC 4FIIA 4QPSA 4ZLYA 4GK2A 3TL8A 5AV2A 5L2TA 2F7XE 4ZTMA 4XG3A 5ANJA 3BQCA 2Q0BA 3WF6A 4CGAA 2UW3A 3KU2A 3OXZA 3E3PA 2YJRA 4ALVA 4WOVA 3RKBA 4DYMA 4X2JA 4EOOA 2FSLX 3CGFA 4CEGA 4FYOA 3BELA 3KCFA 4R3RA 4DFYA 3KF4A 4CQGA 3WIGA 3R01A 3F82A 4X2NA 4QO9A 1JPAA 3ORTA 4PRJA 5BMMA 5JZNA 2PY3A 3HV6A 4QP9A 4FNYA 1RE8A 1K9AA 3MVMA 2IZUA 4QOXA 5HLPA 3UDBA 4BZOA 1G8SA 4W9WA 3ZM9A 4RC2A 4O96A 2VO6A 4PTCA 4KINA 5EOBA 5I9VA 5GJDA 3QTQA 4F9CA 3ZSGA 3LFBA 4D4YA 1LP4A 1OIRA 4FIGA 3QALE 4JVGA 2J50A 2E9NA 4ENXA 4BCOA 3VWAA 4N6YA 3QZFA 4TPTA 2GTNA 4ANBA 4RSSA 5HG8A 5IQFA 4PDPA 3COIA 3LKMA 4H1MA 4CYJA 3LFAA 2BAJA 3C1XA 3OHTA 5G1XA 3VW6A 3MFSA 4A4XA 5I9UA 3EJ1A 4O0SA 2C6IA 3R7VA 4UYNA 3LJ2A 5AR7A 5IA3A 1OL1A 1OBDA 4MVFA 2CHLA 3VC4A 2ZDUA 4AT4A 3TUBA 2CGUA 3W10A 2XB7A 4PQNA 2YABA 4Q5EA 3CD8A 4IZAA 4R6VA 4UMQA 4AP7A 3MVJA 5AP7A 4C3RA 4KIKA 3ET7A 3HZTA 1U54B 1YDTE 4J95A 4X0MA 4IW0A 4MTAA 2OIQA 3L8XA 5FWKK 5HVYA 3UO4A 3W33A 4DH8A 5DPVA 1Q99A 3D5XA 4RWKA 4FI1A 4LOQA 3BHHA 3HRBA 3PZHA 4FTMA 4LOPA 4R78A 2Y0AA 3MPTA 4C33A 3RCJA 3GQIA 4U0IA 3QKMA 4XBRA 5HCZA 4QP1A 3W55A 4WNPA 2OJGA 2OW3A 2IG7A 4ZSJA 3LCKA 4IBMA 1OB3A 5E1EA 2ITXA 2QODA 4KBKA 4ASXA 4NTTA 2W1CA 4L44A 4A06A 1YOLA 4AQCA 3IOKA 2J4ZA 3W2OA 4UY9A 4D2WA 4GK3A 3L8PA 5AEPA 2OH0E 3NUXA 4K1BA 2YWVA 3CTHA 3GB2A 4IVBA 5I9ZA 2HZ4A 5AP3A 3H9FA 2Y8OA 4TZRA 5CI7A 3L9MA 4AS0A 1LPUA 3DS6A 3GC7A 5B0XA 4FKPA 2R3JA 2UV2A 2PK9A 4FTRA 4I0TA 4UXQA 2B4SB 2J51A 5F20A 3IDBA 3E62A 5HX6A 2QQ7A 2XVDA 3AOXA 4R7IA 3C9WA 5DNRA 4ZEGA 1IAHA 3ORMA 2ITOA 5CZIA 3VUKA 1TQIA 5F95A 4IFCA 4FT7A 3LFFA 1B38A 1YOJA 5EM8A 1FBNA 3VW8A 4NCTC 5AV4A 2W4KA 4QMPA 4BFMA 5E8WA 1ZMWA 3DXNA 4YJNA 1WBSA 5EHOA 4JX7A 3OBJA 3CKXA 2A0CX 3D15A 4PMMA 3AT3A 1XBAA 2XMYA 4K18A 4R5YA 4AZSA 4BKJA 1UKIA 2UVYA 4H36A 4ID7A 4LQMA 1CTPE 3O71A 3OEZA 5AX9A 1CMKE 2ETKA 1PXNA 2JKOA 2PTKA 4CFFA 3BCEA 4GCJA 5GZAA 3ROCA 3ZUUA 3H30A 3MFRA 4EUUA 1QMZA 3FZTA 4M66A 4I6BA 1FVVA 5HORA 5FBNC 3FI2A 4D4RA 2AYPA 3RHXA 4FZFB 1YI4A 4CTBA 5IQBA 3LOKA 4FTUA 1GIIA 2OFUA 3DK3A 3MH3A 1M52A 2BPMA 2XNEA 2XP2A 4FC0A 4XG6A 4UALA 5HIDA 3I0OA 4ZY6A 2OXYA 3WE4A 5IH6A 2R7IA 3S1HA 3ZHPC 1REJA 4UX9A 4KRCA 2J5EA 4R3CA 3SAYA 4B8LA 2YAKA 3HMOA 4YJQA 3UP7A 4C62A 4IVCA 4XNEA 4CFMA 5E8SA 4RJ3A 4QTDA 4C3PA 5CVHA 4GV1A 1YXVA 1ERKA 1Q8WA 2WTKB 3QTZA 4GVAA 3FI3A 1ZOEA 3DNDA 2XIZA 3KF7A 5FDPA 5KNJA 4YZDA 4DEEA 4RJ5A 3EQFA 1Y57A 2VO3A 1CSNA 1DAYA 3OS3A 3P7CA 4WD5A 1MQ4A 2X7FA 3GOPA 3NS9A 4FV1A 3EFKA 2FGIA 2OBJA 5JN2A 4GKIA 4KWPA 2PZ5A 3V5WA 4Z3VA 3VS0A 3D7ZA 3V5JA 5CVFA 4QTAA 4BDDA 5IF1A 5KX8A 1ZOGA 3E5AA 5AADA 3LFQA 3TXOA 4V01A 4D2TA 3TV6A 5AA8A 3MV5A 3E7OA 4ITHA 4JIAA 3U9NA 3UIUA 3U54A 4FSRA 5EQPA 3LFSA 1URWA 3ORKA 1Y8GA 1BL6A 2C6MA 4BC6A 3QYWA 4I5HA 3RVGA 5L6OA 1SVEA 5IA5A 3WBLA 5E8XA 3A8XA 4C59A 2OZAB 1K3AA 1W82A 3OUKA 4PY1A 5H2UA 3W18A 4XOZA 4EBWA 4BDHA 2XKDA 2A2AA 2XKEA 2RIOA 2XJ1A 2G2IA 3OEFX 3OCBA 2WMSA 4NCTA 1CDKA 4AT5A 5C26A 4DC2A 1IG1A 4RRVA 3UQGA 5CASA 3Q9WA 3T9IA 3QYZA 4C02A 5KBQA 5AIRA 2IZTA 4KB8A 3G90X 4I5PA 4IWOA 2WMTA 4RVTA 4CV8A 3UZRA 3D14A 4EQUA 4JDIA 2JEDA 4DH3A 4DTAA 4MEDA 4DGOA 4B6LA 3R30A 5GHVA 3CLYA 4AZVA 4O7SA 4LV5A 2VTQA 4XEYA 3LMIA 4FKQA 4FBXA 1NVSA 2ZV8A 3OF0A 3UYSA 3R00A 5AUTA 5CX9A 3C51A 3VUIA 2XNBA 3HMNA 3ZRLA 2XIYA 4BDGA 5GZ8A 4MX9A 3G9LX 4X2FA 4FNWA 4K6ZA 2XIRA 3ZC6A 5LVOA 4MNFA 5DR2A 2WO6A 4GT5A 1ZZ2A 3GFEA 4DFXE 2EXEA 5DI1A 2Y6OA 4CMTA 4TNDA 5E1SA 3RK9A 3ATSA 1UU3A 1PW2A 2W4OA 4DE4A 3TV4A 2ZM1A 3DV3A 4ANSA 3TV7A 3FYJX 5HIEA 5AV0A 1YI6A 2EXCX 4Z9LA 3BYVA 3D5UA 4I93A 5AX3A 3F5GA 3ITZA 2BMCA 3BQRA 4NM3A 5AP4A 3NX8A 3UC3A 5TKDA 1JKTA 4QMUA 4EH9A 5A6NA 2QHMA 5EQEA 3RALA 4E4NA 4YTFA 3A60A 3DPKA 4EL9A 1YKRA 2YM4A 3ID6C 1CM8A 3HV7A 4J52A 5TR6A 4L3JA 4F0FA 5FG8A 3DXPA 3MSSA 2VO0A 4OTWA 4O1OA 4NIFB 3ZYAA 2PHKA 3KVWA 3LW0A 3R1YA 3TJDA 4H3BA 4AGDA 4QMNA 3RPSA 1PRYA 4XP3A 5FUTA 3MY5A 1UU8A 4AF3A 5CZHA 4W4YA 5DMZA 2FSTX 3DDQA 2PVRA 5M53A 3QD4A 4QTCA 3RAWA 3TWJA 3UMWA 3ZO3A 3C7QA 3ANRA 3TDVA 4BCQA 2H8HA 4C4JA 2CJMA 4H3PA 3FXWA 4RFYA 4DG3E 4DGMA 2IZRA 1VJYA 4WBOA 1PXLA 4MXAA 3DBFA 3UQCA 2J0KA 4R1VA 4BI1A 4IANA 5CSVA 2IVTA 3EZRA 3QQLA 4APPA 5E9EA 3ZEPA 4MXYA 2BIKB 1Z57A 3O8PA 5BVDA 2EB3A 3QBNA 1UNLA 4OLIA 2VTIA 5AV1A 4E26A 5HE0A 3LFCA 2GNIA 2VWZA 2PUUA 4I4FA 4OTHA 5BYLA 4TRLA 4RJ6A 3KXMA
chains in the Genus database with same CATH superfamily
4MD7E 3A99A 5I3OA 5ANIA 2QOOA 4H3QA 5DIAA 1P2AA 3FMLA 4D0XA 3W0RA 3MB6A 1X8BA 4USDA 4PL5A 4FGBA 4OTFA 3W0QA 5DLSA 4M14A 5M4UA 1YXSA 4J98A 4XUFA 1OPJA 1MRUA 4YTIA 3LXKA 5AP2A 4QMQA 3W0MA 4R77A 5EKOA 3VUMA 3TG1A 4O7VA 3HV4A 4GKHA 5HQ0A 3NAXA 2XBJA 1YI3A 4AW0A 2FSMX 2VNYA 2YAAA 5HBHA 1PXJA 5BNJA 2WTDA 4AOJA 2V62A 4IJ9A 4A7CA 1FINA 5HU3A 4JDKA 3GEQA 3MIAA 3LM0A 5IQAA 4L9IA 3LLAA 2C6EA 5GJGA 3SGCA 1G5SA 2QOBA 1GAGA 3FSFA 4KKHA 1H28A 1BUHA 5KHWA 3NCZA 4NFMA 4PPCA 3R7UA 5HTCA 3NIZA 5JRQA 2YITA 1KOAA 1XH6A 3C0HA 2BVAA 3GU4A 5AUXA 4X2KA 4ASZA 3NUYA 5LWNA 4NFNA 3PE2A 1JSVA 3BU5A 5JH6A 4BCHA 3GBZA 4U79A 3K2LA 3GCVA 1W84A 3VS3A 2O63A 3SA0A 5EDQA 3KULA 5BYZA 2F2UA 1OUYA 3F66A 3IDPA 3K5VA 4OR5A 5AAGA 2QO2A 3DB6A 4MK0A 4DH5A 5CNNA 4FICA 4FKLA 3ORXA 5M55A 4JAJA 4ZZOA 1H26A 3MTLA 2VV9A 3MA3A 4FV6A 2KULA 2YEXA 2BRMA 3UBDA 3A4OX 2WU6A 1IAJA 5CLPA 3KEXA 3LM5A 5C8MA 3JY0A 5HNIX 4WRGA 4PL3A 2JFLA 1QPDA 3HMPA 4D0WA 4MXCA 1UU9A 4H58A 4BF2A 4FA2A 2BFXA 4QMMA 4QP6A 5EFQA 1REKA 2NO3A 5AUYA 4A9UA 2QNJA 3H3CA 4QMTA 4UMUA 2ZOQA 4UWCA 4RIXB 3RBWA 3ZBFA 3RINA 2C69A 4QMZA 4EK4A 4YLKA 4P90A 4GJ3A 3VBVA 4X3FC 4BJJB 4TKSA 4WIHA 2XUUA 2OI4X 4IXPA 2XBAA 3A62A 5HVJA 4AG8A 4KSPA 3V5LA 2B55A 4RVMA 1LUFA 4TTHB 3Q2MA 4AW1A 2IW6A 4FKUA 3CKWA 4C4EA 2Z2WA 2WGJA 4QP7A 4RVKA 4BTJA 1PXPA 4E1ZA 3V5PA 4B7TA 5BVKA 3DLSA 2YN8A 3GGFA 2REIA 3R0TA 3U6IA 3R9NA 5M56A 2X4ZA 4J53A 2HYYA 3Q3BA 1Y8YA 3NYVA 4JG7A 4ZS0A 2YCRA 5IDNA 3LAUA 2XM9A 4BB4A 1XBBA 1WAKA 2QKRA 4ONAA 4R5SA 5EYDA 3V5TA 4IIRA 3UG2A 3CPCA 4TYIA 1IR3A 2PZRA 4D2RA 5JK3A 3EN6A 3N4UA 5AR8A 2EUFB 2I0HA 2VTNA 3FZ1A 4IEBA 2DS1A 3NUUA 3OC1A 4GG7A 4D9UA 4O83A 2R2PA 1R1WA 4FIHA 5JZJA 2IW8A 1RW8A 1WZYA 2R3KA 2W9FB 4JRVA 4UZHA 4ORKA 2CCIA 4DHFA 4D2SA 1L8TA 4EC8A 4OGRA 3DFCB 5IQGA 2QOCA 4YJOA 4F7NA 4IB0A 4I20A 4AE9A 1XWSA 4DLJA 2QI8A 4D5HA 5DBXA 5IQDA 5FQDC 3S4QA 4C0TA 1Z9XA 4ALUA 4U81A 2HZIA 3Q96A 4BDBA 4MQ2A 5ACBC 5F9EA 1W2DA 4HGLA 1UNGA 3HA6A 3QL8A 3ZFXA 3UJGA 4AN2A 4TYEA 3BKBA 3DBEA 2IW9A 3G33A 3UPXA 2Y6MA 5B2KA 3QTSA 4L3PA 5BVOA 3TCPA 4AN9A 3C13A 2XK6A 3N4TA 4L42A 2HELA 1OPLA 4NTSA 4CFXA 4GEOA 4CYIA 1TQPA 3IG7A 4O0VA 3CTJA 1IA9A 1O6KA 3D5WA 4BZDA 3R22A 1TVOA 4D58A 4Y46A 2HY81 5A46A 3VS1A 3DJ6A 3QXPA 5JKGA 3DTWA 1FGIA 4RQVA 3HEGA 4XH6A 5DT0A 4DEAA 2BTRA 3W2PA 3KIOC 3ZLSA 2FA2A 4YURA 5KUPA 2RG6A 3RNIA 3DAKA 3POZA 4FSMA 2CDZA 4X3FA 4ALWA 4APCA 4YU2A 3QKLA 1H1QA 4F6SA 5BVFA 2JDTA 5EM7A 4F65A 2F4JA 3VF9A 5M4IA 3LE6A 5FXSA 4D4SA 3NUNA 5EDRA 3KK8A 4FG7A 2C5VA 4IAZA 3TMOA 3H0YA 5CENA 2JDSA 3V6SA 3CD3A 4IC8A 2F49A 3G6HA 3BLAA 3BGZA 4KS8A 5M44A 4D4VA 4YHFA 1JSUA 2QD9A 5CEOA 4AZWA 2UZOA 4HYSA 4QNAA 2E9PA 2JDVA 4LUEA 4O38A 4XBUA 2R3LA 4FTJA 1PKGA 5M57A 2QOQA 3NAYA 2C0TA 4UXLA 5I0BA 5J5TA 4YC8A 2X1NA 5FXRA 1W0XC 2EXMA 2Z8CA 3UOKA 4PMPA 2PZYA 3LXPA 2O2UA 4EYMA 4ANQA 3R8MA 4OBPA 1Q8TA 1SNXA 4I6HA 5CQWA 3EL8A 3OROA 4MF1A 3TM0A 4W4XA 4FTKA 4O0UA 3ZFYA 4EBVA 3N4VA 3EFLA 2WMXA 4E5BA 3Q6WA 1ZLTA 4CFNA 1I09A 2LGCA 3CTQA 3FJQE 5FP6A 3WF5A 2CGXA 2YDJA 3DJ5A 3HA8A 2R3RA 4XV3A 5JFSA 1GNGA 1Q5KA 3HECA 5CNOA 2DUVA 5IISA 1Q8ZA 4FG9A 1QL6A 4CZUA 2BIYA 4ERKA 4S33A 4LFIA 2X6DA 2Y4IC 4CFWA 4FMQA 1Q3WA 4R7HA 3DAJA 1OVEA 3DKOA 1IRKA 4DH1A 5TF9A 2CNVA 3UIXA 3M11A 1GJOA 5HTBA 1HCLA 4GH2A 4U40A 4CV9A 2XANA 2PVJA 5HD7A 4FEWA 4RA5A 4I3ZA 4ACDA 2BRBA 2XCHA 4JXFA 4CG9A 3WI6A 5A4QA 3GC8A 5JGBA 4K0YA 3QRKA 4PP9A 2UZUE 3TTIA 1VEBA 3NPCA 4PP7A 3MVLA 2VX0A 3VBYA 2WQOA 4F6UA 1WBTA 4I41A 4BIEA 2QLQA 5HOAA 5CSPA 3ZU7A 2P2IA 3G6GA 3R1NA 4D1XA 1R0EA 4BKZA 3KKVA 5IH5A 5J9LA 3BYMA 3HMIA 1YHVA 3VQHA 3C4EA 4OT5A 4IWQA 2XNOA 4PMTA 4DHZA 1AD5A 3TNHA 4U9AA 3O7LD 4J8MA 4BICA 5J1WA 4O86A 2PMNX 4EI4A 1DI9A 3EQIA 5CT7A 2AUHA 2X8EA 3FV8A 5IKWA 4XG2A 3LLTA 2C47A 5TE0A 2PYWA 2QO7A 5KMLA 5ANEA 3HRCA 3P79A 3AMYA 4V0GA 4RVLA 4F9YA 3D0EA 4AX8A 4FUXA 3FPMA 4AW2A 3PY1A 3KL8A 4P5QA 4BN1A 4FNZA 2GNFA 1JKLA 3UNKA 3REPA 4JR3A 2WHBA 4FGRA 4BZNA 5C03A 3C4ZA 2VWUA 1YXXA 4F70A 3H4JA 4C4IA 5BUIA 1R39A 2P33A 3COHA 3F3VA 1DI8A 1JLUE 3BEAA 4I0SA 3S00A 4B0GA 3EYHA 4IX6A 2QLUA 3R6XA 4DEHA 4HVDA 3UP2A 4USEA 5ITAA 3ORPA 5IUGA 3D5VA 3FQEA 3QTXA 3QD3A 4M69B 4BBMA 5EHLA 3FMKA 5ANOA 2OIDA 2WFYA 4L43A 5EH0A 2GQGA 1M14A 4NSTA 1NT2A 3UZTA 1H01A 3GCUA 2UW4A 3LFNA 4AAAA 1XO2B 4FOCA 4PL4A 4IDTA 1E1VA 3DFAA 4OTIA 3RM6A 4GG5A 3EFJA 2OH4A 1XQZA 3O8UA 4FSWA 5DE2A 4YZCA 5KZ0A 4YZMA 1J7IA 4C8BA 2OICA 3R9DA 5JQ5A 4HYIA 2JGZA 3H0ZA 4P2KA 4GK4A 4BDJA 3FMEA 3PRIA 4LOOA 4L8MA 2BZKB 2XNMA 2C68A 4CT1A 4NL0A 4BVUA 4K2RA 4QP2A 3P4KA 3NDMA 4XMOA 4D9TA 4K33A 4EOLA 2QONA 3MIYA 3WF9A 2A1AB 2G9XA 2VTTA 3PVUA 4XRLA 5ANGA 5BVEA 5KKRC 1B39A 2JKQA 3PE1A 4RQKA 3PXZA 1ZYJA 2Z60A 3V5QA 1U5QA 3JPVA 3FPQA 3PZEA 2XK8A 4IM3A 5CF8A 1U5RA 2OKRA 4PNIA 3F2NA 3QCXA 2PVHA 4FKVA 3A7IA 1W2CA 3S3IA 2CKEA 2WXVA 3LZBA 3PTGA 3HL7A 3FUPA 2NNWB 4G3GA 4O0XA 2H34A 2O0UA 1WFCA 4PF4A 3FMHA 3OCSA 3W8LA 1MUOA 3RTPA 2ACXA 2VNWA 2G2FA 1OKZA 3TTJA 2X7OA 4M12A 4X2GA 3UQFA 2XH5A 4AXCA 4YPDA 3P1AA 1XH8A 4YHJA 1Q8YA 1JWHA 3KFAA 4N0SA 5AP6A 2CMWA 5CALA 2VWWA 4L45A 4ENYA 5AR4A 1PHKA 3QGWA 4MXOA 4F09A 4YTCA 3C5UA 5C27A 1BYGA 4ASDA 3VJNA 4C2VA 1M7QA 2PVKA 4GRBA 3QQKA 3R8VA 2WMUA 5J5SA 3IECA 3HUBA 4IVAA 5GZ9A 4EHEA 3CXWA 4EZ5A 5HLNA 2OIBA 2WMVA 3PVGA 3ZLWA 1OZ1A 2W96B 4UWBA 3IW4A 3PVBA 3F7WA 4TWCA 3QZIA 2JIVA 3WIKA 1O6LA 1O6YA 4V05A 2JLDA 3DZQA 3PA5A 4KA3A 3QWJA 4ZK5A 4YR8A 4FKGA 4U44A 5HG5A 2I7QA 4GMYA 4TY1A 4F7SA 5L8JA 5HEZA 5K9IA 2NRYA 5A4CA 2GFSA 2QKWB 3FC2A 1W98A 1YWVA 2GS7A 3V8SA 2GQSA 2QC6A 4I22A 4L01A 1ZY4A 2HXLA 2BZHB 2OK1A 2GMXA 3TUDA 1OL6A 1PXMA 2O64A 1YRPA 4YNEA 5C4LA 3R73A 1KUTA 2IN6A 4FSNA 2OXDA 4ZSLA 2OJ9A 3BWFA 3T3VA 1VLRA 4QPMA 5JRSA 1A48A 4GUEA 2C3JA 3DLZA 5HO6A 4QQ5A 4ITJA 5LVPA 2E9VA 4KAOA 5E8TA 4AXDA 1Q41A 3VAPA 4HPTE 4C34A 3VF8A 5KMIA 3PUPA 4QEBA 4FZ6A 1YWNA 5AV3A 4YC3A 3PXFA 3GP0A 4S2ZA 3LFDA 1RDQE 1FVRA 4EWHA 3OT8A 1M2QA 4G9RA 3Q04A 3ZSHA 3UG1A 4FEUA 3AG9A 4RIYB 5ETCA 5JMSA 2XS0A 3ODYX 4BGQA 3R63A 4E6CA 5HG7A 4ZY5A 5M09A 3KRWA 4L7FA 4R1YA 4M3QA 4QMLA 5T68A 3R8UA 3PPZA 1LEZA 1ST0A 4GT4A 4KIOA 2FVDA 4JG6A 2IVSA 4OTGA 4Q9SA 4FTLA 4QT1A 3MS9A 3SW4A 3W8QA 4H1JA 4MCVA 5I9YA 2B9HA 1H4LA 2PVFA 3FHIA 2XKFA 3EQDA 4YZNA 5CU3A 5DEYA 5E8UA 3JVSA 1YHWA 1OECA 5IUIA 3ZH8A 5IQIA 4IAAA 2BDWA 4UZDA 2VTJA 4KSQA 2UVXA 4FSQA 2OJFE 3TNWA 2WTIA 3A7JA 5CQUA 1G8JA 3TDWA 4U41A 2C5YA 4ITIA 5EW3A 4BTFA 4D28A 5L6WL 3WF7A 5L8KA 3HVCA 3TNQB 3THBA 4BI2A 3RAIA 3MY1A 1KE5A 3PA3A 4HJOA 1YXTA 3ZUTA 1P4FA 3U4UA 4IC7A 3H9RA 3CGOA 4WSQA 2BHHA 4O0YA 5KBRA 3O8TA 3V8TA 5IQHA 4I5MA 4TL0A 5DA3A 2CCHA 4HVGA 3LFEA 2JDRA 3PXKA 3SXFA 4NH1A 3CP9A 2X2MA 4RFZA 3FZOA 3AC8A 5A14A 2QG5A 3PDTA 4WA9A 3V51A 3TNIA 5J1VA 3QQGA 4LM5A 3R83A 3M42A 3O51A 3I6UA 3LXLA 4TYHA 1W7HA 2J9MA 3GQLA 5M4FA 3R9OA 3ZZEA 3UPZA 1FMOE 4EOKA 4YO6A 2GNJA 4F7LA 1UWJA 3FLQA 3SDJA 4EKLA 4BYJA 4XV1A 3SRVB 3OBGA 2WIPA 3KMMA 4JT3A 5CSWA 3GVUA 3FAAA 2EU9A 4FIFA 4GFGA 2VGOA 2PL0A 4I4EA 3JYAA 3VBWA 4DN5A 3ORIA 4O4FA 2BTSA 3QFVA 3EHAA 3P86A 3G0EA 2GPHA 3EQGA 3PSCA 4L7SA 4U45A 1H0VA 4Y5QA 3ZZWA 4C36A 4CXAA 3CIKA 2XJ2A 4LRJA 5KMMA 2PUNA 3PUFC 3NMUF 3NNWA 4AU8A 3WYXA 5B2MA 1JAMA 1BX6A 2ZDTA 4FKOA 1TQMA 4YZBA 4YTHA 4EUTA 5AM7A 3BL9A 3CPBA 4MHAA 4F08A 3V04A 2R3PA 4AGUA 3ZDUA 3OCGA 4BBEA 2W4JA 3EN5A 1H0WA 3QZGA 5FM2A 3GOKA 3IONA 5LVNA 4D2PA 1UU7A 4AT3A 4G16A 3OY1A 5DVRA 4FK6A 5DGZA 4CVAA 1Q62A 2OXXA 3BBTB 1OKYA 2PE0A 2VWXA 3FLNC 4ZTQA 3KRRA 4PTGA 4XLIA 2J0LA 2GSFA 3MH2A 4UBAA 5E92A 1B6CB 4MF0A 4W8EA 2YISA 3W2CA 4C35A 3PJCA 2CLXA 2GS2A 2R3HA 3GCPA 3UC4A 4ACCA 2HY0A 3FYKX 5HVKA 1I44A 3WZUA 3FZRA 2C0OA 2JD5A 2OJIA 2YM5A 5IPJA 3B8RA 2X9EA 4BL1A 1BI7A 3ROYA 2EVAA 3E8NA 2HWOA 3H9OA 4WUAA 3TIYA 3SOCA 4EK3A 5I3RA 3HMMA 3KXGA 3Q5ZA 3QCQA 3OMVA 4NUSA 4X6QC 5EW8A 3RCDA 2V0DA 3F5XA 3R02A 2HZNA 4FSZA 2YZLA 2YIWA 2F57A 2EB2A 4MQ1A 4RWIA 3OP5A 4WRSA 5HX8A 3KA0A 2YJSA 4CLIA 5D10A 3NVMB 2I6LA 2VWIA 3QTIA 5FEEA 3II5A 1OITA 2R64A 3FLSA 3IGOA 4BWKA 3ZM4A 1YW2A 4XCUA 3V01A 4KUJA 4AWIA 4LGDA 3ZUVA 2W5BA 1XJDA 2QR8A 4NM5A 4YGAA 3MB7A 3HAVA 4C4GA 4O4DA 2UW0A 2BILB 4EH2A 5CAOA 2A27A 1OIUA 4FVQA 4BWPA 1APME 3C4FA 4QMYA 4ACGA 4BCJA 2VTAA 5IA1A 2UW5A 5LOHA 2VTRA 2BRNA 3F3UA 4L00A 4A9YA 1OKVA 3VBXA 3COMA 4YC6A 3FWQA 1KE8A 3I79A 4I92A 2WNTA 4ZLOA 5L3AA 3F3TA 4NEUA 2ZV9A 4DT9A 5HI2A 4PDSA 1JSTA 3UO6A 3FDNA 4DITA 3BZ3A 4RJ8A 2VU3A 4FV2A 4FVRA 4IDVA 3DZOA 3PY3A 2VTLA 4EJNA 4WSYA 1NA7A 2RFDA 1JKKA 5C9CA 3QU0A 3IGGA 4L3LA 5DFPA 3MESA 4USFA 4G3DA 1OL5A 1ZYDA 3DQXA 3GENA 4IAIA 4ARKA 3KRJA 4BDIA 4FTOA 4A9SA 3AKLA 3PSDA 1LEWA 3OZ6A 5CI6A 2J0IA 2X7GA 4Y95A 3VJOA 2XNGA 1OI9A 2UW9A 3RMFA 3NCGA 3ZONA 3C0GA 3ZDIA 5M07A 5IA2A 4EWQA 2C3IB 5ETAA 4F99A 5DOSA 3E8CA 2VTOA 4WG4A 5K0XA 1XBCA 4TYGA 4O84A 3N51A 4FV7A 5CEKA 2XNNA 5GINE 4WBBB 3TIZA 4UMTA 1U54A 4K8AA 3IS5A 4OUCA 4PMSA 2PPQA 4EKKA 1P14A 4XV2A 3QRTA 1KWPA 4UB7A 4BDFA 2WTKC 4DGNA 2H9VA 2HK5A 3B2TA 5AUZA 5TO8A 4BYIA 4CRLA 3DNEA 4E93A 3NW7A 3IW6A 4CMOA 3LJ1A 4IM0A 4CMUA 4XHKB 3GFWA 2YLEA 4U6RA 3TZMA 3VRYA 2OZOA 1KSWA 2P55A 4F9AA 1NVRA 4IE9A 3UVQA 1EH4A 1BI8A 4D2VA 4ZS4A 3OTVA 2CLQA 4FKSA 2WB8A 4PX6A 4QP3A 4YBKA 2PE1A 4I6FA 3R2YA 4ANNA 1WBPA 3ANQA 2W1FA 3R04A 3G15A 4FYNA 4MYGA 4O21A 1R3CA 2WTJA 2NP8A 4TNBA 4PDYA 1KV2A 4FSTA 2FB8A 3G9NA 1U59A 4I21A 3ZXTA 3QQJA 5CAQA 3F9NA 1M2PA 4F1TA 5HD4A 4BWXA 3R1QA 3BHVA 2ITVA 4UEUA 4FT5A 3L8VA 4IFGA 2R7BA 1YOMA 3EFWA 2X81A 4X6RA 5FGKA 1TFFA 3MN3A 5M51A 2YDIA 3TEIA 3UIMA 3VRZA 3AD6A 4XP0A 4LUDA 3OFMA 2WMRA 2CN8A 2VN9A 2OG8A 3ZO1A 3B2WA 4IZYA 4ZAUA 1ST4A 5FTOA 4MD8E 2IF8A 3SX9A 4I24A 1NY3A 5DEWA 3MPMA 2RL5A 4BGGA 5HO7A 4B8MA 1Q3DA 5LQFA 5LXMA 3P08A 3FXZA 1YWRA 4WKQA 2P4IA 4FR4A 4BIDA 4Y85A 3AD4A 5H8BA 4JS8A 4E8AA 1H8FA 4RG0A 1GIHA 3QD2B 3B8QA 4ZSGA 2HOGA 2J6MA 2JIIA 3I60A 1SM2A 4G2FA 3UO5A 3UDSA 2HCKA 3AMBA 5H8GA 2ITWA 4A9RA 5CU4A 2WTCA 5KE0A 2BAQA 4Y5HA 3M2WA 3KMUA 5CU6A 2OF4A 3K3JA 4D1ZA 3R8PA 5IEVA 3LCTA 1RJBA 5IEXA 3SXSA 4BDAA 1URCA 4IVDA 4YUQA 2IPXA 2X6EA 3IW8A 2GNHA 4B9DA 4CFUA 2C3KA 2HXQA 1DAWA 4RX5A 1G8AA 2BFYA 3F2RA 5B2LA 1OKWA 4I94A 3Q53A 4QYGA 3LXNA 3NYNA 3F61A 3RPYA 4DG2E 1F0QA 4HNFA 5EI8A 3QAME 3PPJA 4UV0A 2GNLA 2XCKA 3R2BA 3PP0A 4CG8A 1J91A 3LCDA 2ZM3A 4FTCA 4F1OA 3R71A 3QC4A 4DBNA 5HKMA 4LDTA 4HCTA 4WNOA 4QYYA 1OMWA 2QU5A 5AR2A 3I7CA 4KNBA 1CKIA 3LCSA 3CY2A 2BRGA 2PVLA 3Q9YA 4JG8A 5EHYA 3ULIA 4YHTA 3OVVA 4PNKA 4KIKB 3FKOA 2X0OA 4QQTA 1YDRE 1PMNA 5DRBA 3SRVA 1FPUA 1XH7A 4B99A 4CQEA 2BDJA 3NWWA 3EMGA 4CNHA 1Q24A 4FT9A 4JQEA 2PZIA 5FEQA 3UVRA 3NNVA 1YXUA 4OAUC 3BU3A 4AXAA 5LMAA 5HGIA 3POOA 1MQBA 3E7VA 4ZXTA 5EKNA 2BALA 3COKA 5ACKA 1Q97A 3A7FA 1GZNA 4FUYA 3EZVA 4AACA 3GC9A 3ZOSA 4YMJA 2W9ZB 4DA5A 1OL7A 4FKIA 3QQUA 2OZAA 4WUNA 2YIYA 2VUWA 3RAKA 4DFBA 3A4PA 3IO7A 4CZTA 5C8KA 2OSCA 2PVNA 4CLJA 2WQEA 2YLFA 3V8WA 1Z5MA 4OTPA 3AKJA 2ZFYA 3DBDA 4EHVA 5KCVA 3CC6A 4MAOA 4FEXA 2XK3A 4O22A 4IQ6A 4N70A 3QX2A 4DG0E 4X21A 2RKUA 3VVHA 5AFVA 3W2SA 4AQKA 4U42A 4EQCA 1MRYA 1VR2A 4QRCA 5AM6A 3Q6UA 4MWIA 5HICA 4G34A 2B54A 5HO8A 2QOLA 4QP8A 2OU7A 3E3BX 4FV4A 4JJRA 4YO4A 2ZAZA 4J99A 5AR5A 3R7GA 2BZIB 3MFTA 2R3MA 4ZZNA 5DRDA 3GU6A 3VS2A 4C3FA 4FG8A 4FKJA 4O4BB 1AGWA 1ND4A 4DFUA 3VULA 2H6DA 2B7AA 4RX9A 1L3RE 3ZEWA 4FTTA 2YIXA 3W32A 2I0VA 2UZDA 4AFJA 1H24A 4FZ7A 5FD2A 4AZFA 5LJJA 3ML1A 4O7LA 5DT4A 3P5JC 3SG8A 1ATPE 2PWLA 4I5CA 4AZEA 5JFWA 5DH3A 4JBVA 3QLGA 2X0PA 3QRIA 3KK9A 3RK7A 3UODA 4H05A 4BCFA 3SHEA 3IK3A 4RWJA 2NRUA 5ANKA 2CKQA 1DM2A 2BROA 3EQHA 4Q2AA 1Q4LA 3EKKA 3WF8A 5CEPA 5LMKC 4DDGA 2UW6A 2GCDA 3VUDA 4DHIB 4NIFA 1M17A 3MBLA 3SQQA 1PYXA 2B0QA 3LMGA 3ORZA 4L53A 4YLLA 5IUHA 3NYXA 3E63A 4LV8A 3CJFA 3HAMA 2Q83A 2VTHA 3QRJA 2C5OA 1FGKA 4HGSA 2VTMA 2C6OA 3UVPA 4EK6A 2QVSE 2UZTA 5H9BA 2F7EE 3A7HA 3BRBA 3ENHA 4LGHA 4FIEA 4O0WA 1OGYA 3DA6A 2EWAA 3DBQA 5K0KA 1OUKA 2RSVA 4U3ZA 5J9ZA 3Q9ZA 2VX1A 4LYNA 5A9UA 3GT8A 2PUIA 1TKIA 1VYZA 4FZDB 2J90A 2WQNA 3AT2A 4ACMA 4O81A 2CKPA 4LI5A 4ZJJA 4C61A 4OTDA 3LMHA 2GHLA 3CS9A 3DAEA 2X0QA 4KRDA 5FEDA 3SV0A 1E1XA 2C4GA 3PIZA 4J7BA 4FL3A 3G0FA 2IJMA 3Q4ZA 3QA0A 3EIDA 3RPRA 5CEIA 1G8KA 4ZTSA 1JOWB 2GTMA 2W5AA 3KC3A 5C01A 2C6DA 2XA4A 4K77A 4QTEA 4M15A 2ZMDA 5JFVA 4AZTA 2GDOA 3A8WA 3ENMA 2WEVA 3EWHA 3NW6A 4KIQA 4U97A 3ALNA 3WE8A 3AC1A 3UNZA 3EKNA 3QXOA 4FE2A 1WVYA 4XYFA 5IMEA 4NK9A 1H25A 4ZTNA 2GHMA 2R3OA 3OW3A 2YCSA 2W1HA 1PYEA 3OD6X 4NM7A 4QP4A 2W1GA 3QHRA 4I23A 4HOKA 5CAPA 2AEGA 4PUZA 4FV9A 2QCSA 5D12A 1YVJA 3FLWA 3GUBA 4EEVA 3FBVA 3R7YA 2IVVA 4L46A 4FSUA 4M67A 3DKFA 3GNIB 1ZOHA 5HZNA 3FMJA 4NJ3A 3UIBA 4F6WA 3PP1A 4G5JA 3F5UA 4KS7A 1W2FA 3NVKI 3CBLA 2IO6A 3ELJA 3ACJA 4JDJA 4CT2A 4O6LA 4ZOGA 2VTPA 3VNTA 1H1PA 4DAWA 1P4OA 1S9IA 4C37A 4B4LA 2RG5A 4ZP5A 4AA5A 5BUEA 5LMBA 2BZJA 2PSQA 3GCQA 4I6LA 4FKRA 4XLVA 5LMKA 2WMAA 4HPUE 4ZZMA 4Z7HA 2P0CA 2ZB0A 5AP5A 5KMOA 3O7LB 4K9YA 4TT7A 2IWIA 5JFXA 1VYWA 1ZRZA 2WAJA 3R9HA 3TI1A 1Q61A 1SYKA 3HDNA 4R3PA 4OAVB 4BDKA 3OY3A 3HV3A 4O2ZA 4MBLA 4DEBA 5M06A 4RGJA 2A19B 3E93A 3I6WA 4CZYB 2PULA 3FSKA 3NZ0A 3OWPA 4OTQA 5AP1A 4EHZA 1FQ1B 5EDPA 4AGWA 4C4HA 2W0JA 3L9LA 3ZCLA 2YCFA 2Z7SA 2GNGA 3I5ZA 4MUQA 3BL7A 4EH6A 1ZXEA 1A9UA 5CXHA 4LRKA 3ZBXA 2R5TA 4J8NA 2HIWA 4NZWB 5BMSA 3FMDA 2QOIA 1H1RA 4TWOA 4HCUA 4TN6A 3ZRMA 3VBTA 3PY0A 5KMJA 4CRSA 3ZLYA 2B53A 4FV0A 4IM2A 4OW8A 2WU7A 3DGKA 2E9OA 4RIXA 5D7VA 5HLWA 1QPCA 2F7ZE 2WTVA 3K5UA 4YJSA 5DYJA 1XR1A 3DXQA 2QOFA 3MDYA 3O23A 2WPAA 4KKGA 4DTKA 4BJJA 3SVVA 3ZTXA 3LQ8A 1KE6A 2VAGA 3MW1A 2JC6A 3DJ7A 4EORA 4AXFA 4Y72A 3TKHA 4XP2A 3TJCA 4E3CA 2XF0A 2XKCA 3R1SA 3E88A 3W16A 3U6HA 2XAOA 2ZM4A 4MD9E 5K5NA 4FZAB 4E6DA 5D1JA 2O65A 3BX5A 3QGYA 2UZLA 4CKJA 4EK8A 1ZWSA 2OJJA 4DEGA 2UZEA 2XK9A 4G3EA 4E7WA 4EH8A 4ERWA