4Y8DA

Crystal structure of cyclin-g associated kinase (gak) complexed with selective 12i inhibitor
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
307
structure length
262
Chain Sequence
DFVGQTVELGELRLRVRRVLAEGGFAFVYEAQDVGSGREYALKRLLSNEEEKNRAIIQEVCFMKKLSGHPNIVQFCSAASIGKEESDTGQAEFLLLTELCKGQLVEFLKKMESRGPLSCDTVLKIFYQTCRAVQHMHRQKPPIIHRDLKVENLLLSNQGTIKLCDFGSATTISHYPYSNFPIGEKQDIWALGCILYLLCFRQHPFSIPPHDTQYTVFHSLIRAMLQVNPEERLSIAEVVHQLQEIAAARNVNPKSPITELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Cyclin-G-associated kinase
publication title Selective Inhibitors of Cyclin G Associated Kinase (GAK) as Anti-Hepatitis C Agents.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 262
sequence length 307
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4y8dA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4y8dA01
2ZB0A 1J7UA 4AN2A 5K0KA 3F3TA 1PW2A 3K5VA 4GYIA 3VBTA 4I5CA 2ERKA 4XYFA 5AADA 3MV5A 4RIOA 5HIBA 3HRBA 4XG6A 5CASA 3PVGA 2UW6A 2X1NA 2XM8A 3QRJA 4ITJA 4R8QA 4RJ3A 5GIPE 3QD3A 3QU0A 5F20A 4FTIA 3RM7A 4AZFA 4JT3A 5JKGA 5LWNA 5IEVA 4HW7A 3E93A 4OTRA 5C26A 2C6DA 4X6QC 1KV1A 3UYSA 3D7TB 3E8CA 4J8MA 2E9OA 3W55A 3BLQA 4IANA 3U6IA 3NSZA 4RX7A 1YXUA 4HJOA 3F9NA 3ZBXA 3QKMA 4M8TA 4IAFA 2IW6A 4W4VA 3SOCA 4BFMA 4XV2A 2GTMA 3HZTA 4J96A 4WUAA 2ITQA 4N4SA 4F9BA 1O6KA 1YHSA 4D5KA 4DH5A 4D2TA 5AUYA 5ANEA 3D4QA 5J7BA 3A99A 4D0XA 4EUTA 4RFZA 5HGIA 4FSUA 5EI8A 2WOUA 5EI6A 3LQ8A 2ZJWA 3LQ5A 4BI0A 5JN2A 5FM3A 3GU7A 2QHNA 2CKQA 3GC7A 3OC1A 2B0QA 3EQHA 2VTQA 3OD6X 2PK9A 3CPCA 3CC6A 4MNEB 4O7ZA 1TKIA 3E8EA 4ZLOA 3I0QA 5GIOE 2IZSA 2WMAA 4QNYA 5E8TA 2QOKA 3ZO1A 3SGCA 2VX3A 3FMNA 4X3FB 4QPAA 2HENA 4WNMA 5A6OA 2YDIA 1U5QA 4QMPA 2JDVA 2WB8A 2VWWA 3FMKA 4O27B 2YA9A 3KRLA 5DR9A 1YXSA 4RC2A 1WVYA 3VBVA 4B9DA 2WMVA 3EL8A 3OY1A 2UZDA 4L8MA 1P5EA 4FZFB 2UZNA 4BI2A 3KMMA 3HUCA 3O0GA 1OMWA 2VZ6A 2W7XA 4ID7A 4BIBA 1BUHA 4L52A 4MNFA 2F2UA 2W4OA 4M66A 5L6PA 4HYHA 2YCRA 4BR3A 3BCEA 4KS8A 3ZFMA 4AS0A 3SXSA 3I81A 4Z9LA 5CALA 3D7TA 4JRNA 2Y4PA 1PKGA 3QKLA 2WELA 3VS5A 4IWOA 3KFAA 4YHTA 3LKMA 4O0TA 3HDNA 4GRBA 1UU3A 5JZJA 2PE2A 4G1WA 3VF9A 2RIOA 3BZ3A 2VAGA 3LCDA 3H30A 5DEWA 5FTOA 4TNDA 5C03A 2VD5A 3C4EA 4KBKA 2J0JA 4B6LA 3TNHA 5H8GA 4IBMA 3ZUVA 2JFLA 3GFWA 3FMJA 4IVAA 3EYHA 4R78A 3KL8A 5GJDA 4IXPA 2QURA 4FEVA 4QYHA 4UEUA 5JQ8A 2E9NA 3D7ZA 4D1SA 4JG6A 4NW6A 4BHZA 3THBA 3ETAA 3R2YA 1FVTA 3OS3A 2JAMA 3M42A 1STCE 1ZMVA 5B2KA 3MESA 4TKSA 4MNEA 3A7IA 3EQCA 3UNJA 3IW6A 4C2VA 5LVNA 3EN7A 4O7NA 4X2KA 5KMNA 3DKOA 4Y46A 4HCVA 2WTKB 3F2NA 5E8YA 5HHWA 4QP8A 2WMXA 3PJ1A 4PPAA 4GW8A 4X3FA 4C62A 3QCSA 4FV5A 4QP9A 2ZOQA 3KXMA 4LOOA 3BE2A 3FMLA 2PZPA 3QX2A 4FBXA 4U42A 3TKIA 2G2FA 5AUUA 3GQIA 4HPTE 5IZFA 3CS9A 4FKLA 3RZBA 2EUFB 1JAMA 4L6QA 3RZFA 4K8AA 3DNEA 4LOPA 4CEGA 4CT1A 5EW9A 4HZSA 4JIKA 1R0PA 1YWRA 2V22A 2ZM4A 4PV0A 4YTCA 2IO6A 4HPUE 1J7LA 3UC4A 4C3PA 2E9PA 2QVSE 3EQBA 3MW1A 4DN5A 2IG7A 3DY7A 3ORTA 5C4KA 3SOAA 1PMUA 1FMKA 2Z7SA 4CKIA 5K5NA 1YHVA 5DN3A 3TXOA 4GV1A 3JPVA 4GH2A 5KKRB 3NNVA 3LFDA 4CLJA 3QL8A 5KBRA 2R3GA 2XIRA 3H9OA 2UZBA 1T45A 4YJQA 4X21A 4UB7A 2EB3A 5AR2A 2W1DA 3MPTA 4JX7A 3HVCA 3P0MA 1KE5A 1CKIA 1QMZA 3EQRA 3V3VA 3KCKA 3UNKA 3LJ0A 3I5ZA 4E4LA 5HCYA 3TN8A 3TV7A 1PKDA 1WMKA 2XYNA 2CKEA 2H34A 2YACA 3Q9YA 3QD0A 3BYUA 3MIYA 4TN6A 4NUSA 3ZOSA 4L7SA 5E8VA 3CKXA 2YJRA 3SAYA 3OF0A 4G3EA 4DFLA 1MP8A 4E5BA 1GIJA 3RPRA 2VU3A 3W32A 4BKYA 5HTCA 1P4OA 1SMHA 3ZTXA 3Q2JA 2Z60A 5DEYA 2G01A 3EMGA 3A7HA 3Q6WA 1PXMA 2P0CA 2JEDA 4UZHA 5E90A 2XH5A 5EM5A 3OTUA 4M13A 4EZ3A 3QTQA 2CNUA 4LG4A 1JSUA 4LRJA 4FSWA 3ANQA 4ANQA 2YIXA 5C27A 4F6WA 4Y8DA 2QLUA 3FXXA 3SXFA 4IWDA 5JK3A 3FZTA 2IVTA 3R6XA 4ZSEA 4YURA 4XP3A 4U6RA 2PZYA 3PXQA 1XJDA 4MCVA 3L8PA 2VWBA 1PF8A 1SVEA 5LQFA 2H8HA 4O2PA 4NCTC 2GPHA 2QCSA 4QYGA 4DLJA 4EOPA 2BZKB 4QOXA 4CCBA 2ITPA 3EQFA 4X0MA 4EKKA 3ZRMA 4AU8A 3R8MA 4BTJA 4RFMA 4M3QA 5CSPA 4C02A 4I6BA 4KIQA 4ASZA 3G0FA 4FTKA 4CG8A 5AP0A 3ID6C 3Q52A 2C3LA 4FIHA 4IB1A 2I0YA 1O6YA 2FB8A 3COKA 4X3FC 1F3MC 5C8MA 4DEEA 2ZM3A 5DYJA 3PVUA 1ZRZA 5HD7A 2QI8A 4A06A 5CAQA 5GHVA 2VTOA 4F7SA 2C0OA 4QMZA 4QQTA 3SRVB 5GZAA 3NNWA 4NT4A 3MGYA 4GUEA 4ZTSA 2XRUA 3D0EA 1V0OA 3FE3A 1PRYA 3C4XA 1YRPA 4JG7A 3RAHA 3F61A 3QCYA 4JX3A 2YIYA 3GCQA 5IA5A 3UDBA 2BVAA 3FDNA 4IC7A 4DFZE 3FAAA 4DTKA 1Q4LA 4PNIA 4QMLA 4GL9A 5AV2A 3AC2A 5EM8A 3R01A 5AV3A 2PUPA 4TWNA 4GKHA 4EH8A 5ANJA 1S9IA 5IISA 3WZEA 4BGGA 4DH8A 3QQGA 5BVKA 2IZUA 3UOLA 2XK7A 4FV6A 4GG7A 4ERKA 4C33A 1GNGA 2VTNA 4FG9A 4E4XA 3VUIA 5JQ5A 4N57A 2F4JA 3F3WA 4BTKA 3ZLYA 4IIRA 5HNIX 3CCNA 3R8LA 4IZYA 4NJDA 2HIWA 3COMA 3AGLA 3MI9A 4PDYA 3RCDA 3VQUA 5M06A 2AUHA 2F9GA 5I9VA 1CTPE 2OF4A 5HE3A 3DT1A 5KHXA 3DOGA 1H26A 2WMQA 2CMWA 4XG4A 4F99A 3VN9A 4NH1A 5KMKA 2VO0A 4TRLA 4KSQA 5EDRA 1T46A 1UNLA 2QU5A 3FY0A 3ZEPA 3IW8A 2GCDA 2WAJA 3PSDA 4PTEA 4E6CA 4U3YA 4YSJA 2W96B 5E8UA 1BMKA 2C3JA 2O64A 2WTCA 2WIHA 4G3CA 4G3DA 5E8XA 3RPSA 3ZUTA 3R1YA 4AUAA 2WMBA 3VW6A 4BCPA 3W8QA 2W1IA 1PHKA 1H28A 2WTKC 2Z7LA 3TCPA 3S00A 3OCBA 5L2SA 3UQCA 4XRJA 3JR1A 2V7AA 4QP6A 4TPTA 4ASEA 3AG9A 4NM7A 4E4MA 2HXQA 5J8IA 1J1CA 4O6LA 3UQFA 5CU6A 4C38A 4IMYA 3IOPA 4IX5A 2CNVA 4WIHA 4AA0A 4RBLA 5ICPA 3CGFA 2FYSA 3SRVA 4NJ3A 2YAAA 4L46A 3RBWA 4IJ9A 4F9CA 2C6TA 3HAVA 3VUTA 4U97A 5GJFA 2A1AB 3V5WA 1NVRA 2PE0A 4FTNA 1FQ1B 3FY2A 4Y72A 4AW5A 3VBYA 2I40A 5FP6A 3I0OA 4DA5A 3R7EA 1YDRE 1FVRA 1XWSA 1YI3A 5KKRC 3LFSA 3PXRA 5FEEA 5JFXA 5FRIA 4BY9E 2Y9QA 4AE6A 4OBQA 5HLNA 1XH7A 5HICA 5DHJA 5IQBA 4AN3A 3ZSIA 1UWJA 1X8BA 5FD2A 4I22A 2XKDA 4O22A 4D2SA 1YXTA 4YHJA 3FQHA 4FTMA 1ERKA 4E6QA 4TW9A 4CFWA 4GVAA 1AD5A 2BHEA 3KGAA 3PY1A 3QGYA 4CV8A 4KB8A 3IDPA 4BCOA 3T3VA 3SG9A 1E9HA 4XNEA 3ZO4A 1MQ4A 2H6DA 5F94A 3QTZA 1DI9A 1M14A 4E7WA 4CGAA 4USDA 3LFEA 4BBFA 3DBEA 3LOKA 3NUXA 2BZHB 4EJNA 3OP5A 3OTVA 4FVQA 4MWIA 3OXZA 1K3AA 4K2RA 3Q9XA 4FYOA 5KNJA 2IJMA 4UYNA 4BBMA 5M07A 2XNOA 5DG5A 4BC6A 2VO3A 3LFQA 2W4KA 3HGKA 2JKQA 2R3IA 1U4DA 5HG5A 2PZIA 5AV0A 3GUBA 4IM0A 4AZSA 5LMKC 4EH6A 4PPBA 2R3FA 5EDQA 2X8EA 3U6HA 2XCKA 4EL9A 3E3BX 5FBNC 5EQEA 3FL4A 4XV9A 3EQPA 4G3FA 4M15A 4C4FA 1NXKA 4F09A 3MPMA 4V05A 4D5HA 2UZVA 3L9LA 1ZZLA 2CGWA 4L00A 4LQMA 3AT3A 4W8DA 3RK7A 4ARKA 4FV0A 3NDMA 4IX3A 4D58A 2OI4X 2R3OA 3FSFA 3H10A 1WBWA 3CY3A 3D5WA 5EYDA 3ZFYA 5IH4A 3I60A 3NNUA 4JQEA 3W2RA 5M08A 4FL1A 5JGDA 5EM7A 2JDOA 2OIBA 3QRIA 4F6SA 5M4CA 2GQSA 2X39A 4MHAA 2J4ZA 2YLEA 4EC9A 2YISA 3DJ7A 4ZZMA 3FHRA 4RVLA 5A9UA 4FG8A 3BEGA 5DOSA 3V8TA 4FE2A 3BHVA 4ZSLA 5AP7A 3JY9A 3NW7A 3R0TA 3MJ2A 3ERKA 4IJPA 5G1XA 3ORLA 5JGBA 3TZ7A 4ZEGA 4B7TA 1KE8A 5TT7A 3QCXA 4CZYB 2FO0A 4BDDA 4H05A 1QPCA 3DS6A 3HKOA 3KMWA 3UGCA 2V55A 3W2QA 3TJCA 3H4JA 4OR5A 4EUUA 1Z5MA 2GS7A 2GU8A 4TYEA 2ZDUA 1FOTA 1BL6A 4YPSA 5BMMA 2W5BA 1PXIA 2YABA 2OU7A 2V7OA 3HV7A 4JAJA 4M68A 3PFQA 4WG5A 5AAGA 3R00A 4DEAA 5HQ0A 4XG9A 3TZ8A 2RF9A 5E1SA 5JFVA 4PDPA 2PSQA 3O7LB 5T6KA 2BHHA 3F5UA 4S32A 4ASXA 1YHWA 4UALA 3KU2A 5GZ9A 4KS7A 4ZIMA 3O50A 4YP8A 5HESA 3PXZA 4I4EA 4NSTA 1M2QA 4KBCA 4Y85A 3R8ZA 2UVYA 4FSTA 5KZ0A 3R63A 4QTDA 3HA8A 2CCHA 2YAKA 4DFYA 3V8SA 3SDJA 3V01A 2GQRA 5J9LA 3QQKA 2R3JA 5LJJA 3V6SA 2HXLA 5IQEA 4P4CA 5CVGA 3BI6A 4KA3A 3EQDA 1QPEA 4ZS4A 3TIYA 4YJPA 1GY3A 2RG6A 4A4XA 4XOZA 1H0VA 1PXNA 4G31A 5L2TA 4O1PA 2ZM1A 2J6MA 4BL1A 2I7QA 2PZ5A 4FTLA 3LXLA 4GIIA 5D41A 5HO8A 5HE2A 4DCEA 3P79A 3N4UA 4KNBA 4O91A 1P2AA 1JKLA 4FZ6A 5AM7A 4R1YA 4OTGA 3NEWA 3AT4A 4FA2A 4ANOA 2FA2A 5HTIA 2R0UA 1CM8A 1MRYA 3VUHA 5AIKA 4CQGA 4BIEA 5C9CA 5AJQA 4W4WA 4A9UA 3POZA 4E6AA 4I93A 5BVOA 5HG8A 3N4VA 3MA3A 2R7IA 4FV3A 2R3MA 1URCA 4DG2E 4GS6A 3NCGA 5DIAA 2WZJA 5EOBA 4U40A 3SA0A 5CQUA 3GU5A 5HEZA 3V04A 4EQMA 2VRXA 2ZB1A 5D12A 4CTCA 3CJGA 1P14A 4AOJA 5FTGA 5JSMA 2YWPA 3ORKA 5FDPA 3WZJA 3GNIB 3D14A 3ZXZA 3Q4UA 2A4LA 3MSSA 4NW5A 3B8RA 1TQPA 3OCSA 5AA8A 4I3ZA 3CQEA 2WEVA 3V5PA 1J3HA 1WBNA 3PIYA 2OJ9A 2R0IA 4FKVA 3F66A 4XP0A 5I9UA 3VS7A 4F1MA 4O7TA 5ETFA 5L8LA 5EHLA 2OIQA 4PMSA 3T9TA 4LV5A 5DBXA 1I44A 4UMRA 4D1XA 3C4ZA 1GJOA 5FXQA 3BGPA 3TV4A 4AAAA 4EBVA 2QOIA 5EFQA 2IW8A 4D1ZA 2OKRA 4J52A 4FIIA 2JC6A 2UW0A 4MBJA 3ROCA 2OXXA 3H3CA 2VTRA 2YHVA 5AUTA 4F0FA 3NYVA 2CHLA 3F88A 4U79A 4MBLA 2QOCA 4ZTRA 5AV1A 2X0GA 4F70A 3L8SA 3D94A 4NL0A 2UZEA 1OI9A 2E2BA 2X4ZA 3A8XA 3EKKA 2HY0A 3NX8A 1DS5A 4M67A 4S34A 5HCZA 2CDZA 3TDVA 2PULA 5JRQA 5CU0A 3PP0A 3AD6A 5IA4A 3I6WA 3PSBA 4I6QA 2CPKE 4W8EA 4FTRA 1Q8TA 3HP2A 2R3LA 3LZBA 5FLFA 2EB2A 2J5FA 4G5PA 3ZC5A 3CQUA 5HX8A 4HVDA 5HD4A 4FSNA 3EN5A 3U51A 1GZOA 3F5XA 3DDQA 4WHZA 2DS1A 5CZHA 2VWVA 4F1OA 3QRUA 1WBVA 3RI1A 3A60A 3RPOA 3WBLA 4EH5A 4AW2A 1I09A 4YLKA 1H8FA 4JXFA 4MK0A 2QOBA 2BFYA 3G90X 3TNPC 3SG8A 3QD2B 2LGCA 2GFCA 3FEGA 1ZYJA 3BWJA 4FKGA 4P5ZA 3UO5A 4RJ4A 3KRRA 5BVEA 4C4HA 4HNFA 5J5SA 4QTAA 1H08A 4MXYA 4FIFA 3PRFA 3CTQA 3P23A 1PXPA 1DAYA 1H00A 5AX3A 2PVHA 4M0ZA 3PXYA 5CEKA 1UU7A 2JBOA 4TWOA 4GFMA 4AN9A 4PP7A 3EQIA 4Q9SA 4NM0A 2Y4IB 3RWQA 3UP2A 4PP9A 3S2PA 2P2IA 3SVVA 1OIQA 2BAKA 2GS6A 4ZMEA 1SNUA 5IMEA 3FXWA 1K9AA 2SRCA 4M69B 4QMQA 4HCTA 5KMLA 4DT9A 1UWHA 4WUNA 3DJ6A 3FMHA 2P55A 4G5JA 2YM7A 4D4VA 5K5XA 4CT2A 1BLXA 2WU7A 3DZOA 4FYNA 4B99A 3R1SA 4D9UA 3K3IA 1JPAA 2IPXA 4EOKA 2NP8A 3FLNC 3OT3A 5AWMA 2ITYA 4RX8A 3MIAA 4X2NA 3OCGA 1UKIA 1R0EA 3EN9A 3UTOA 4PNKA 3W1FA 4W4YA 2W4JA 3CY2A 4UXQA 4MXAA 4DTAA 4H3PA 2I0VA 4BCNA 2QR8A 3DBFA 2HCKA 4JR3A 4EWQA 2QOFA 4ENXA 5IMXA 4FT9A 2R3PA 4GT3A 4DBNA 1Q99A 4KRDA 4O7VA 4YTHA 1KOBA 2B9FA 3T9IA 1M17A 4QQCA 4RWLA 3UG2A 3WE4A 4I23A 3F3ZA 4I6HA 4O6EA 2JDRA 5A6NA 3HEGA 4MD7E 5BYZA 4EOLA 1J7IA 3UNZA 5BX0A 4E1ZA 4YJOA 3QYWA 4A9SA 5IF1A 4O0YA 3EKNA 3ROYA 5FGKA 4I4FA 5E9EA 5EQPA 2VTIA 5BNJA 5M57A 2RGPA 4DAWA 4YJSA 2UZTA 3PJ3A 2BAQA 4M97A 4O0WA 4BYIA 4E73A 4IAAA 3F7WA 4RSSA 4EH9A 4IVBA 4C59A 5EYKA 5LXMA 2XK8A 1UA2A 4MH7A 4K11A 3WIGA 1JBPE 3R7IA 1OIUA 3PPJA 1YDTE 5A4QA 2ZVAA 2O63A 3VS1A 5AR7A 5AUXA 4CD0A 5FBOA 4DEGA 4JOAA 2Q0BA 2BRMA 4O21A 3OMVA 4UWYA 2JLDA 2PY3A 4FZAB 4RJ6A 3UPXA 1WAKA 5HE0A 4AXAA 1JKTA 3UZRA 3R8UA 3MDYA 4M69A 3KF7A 3KULB 2WMUA 4BTFA 4NZWB 4OAUC 2OBJA 4CMUA 1OZ1A 4F0IA 2PMLX 4QMSA 4AT3A 4WNKA 4QMUA 2KULA 3D15A 3OUNB 3P08A 4OAVB 4AE9A 2WPAA 2HYYA 2QG5A 5FM2A 4DH3A 3F7ZA 3CD3A 3PLSA 2WKMA 1YVJA 2W5HA 5CSHA 3F3VA 4A4OA 2B9JA 2FVDA 2JBPA 1YXXA 2WGJA 1YKRA 4D55A 4IZ7A 4PF4A 3D9VA 3Q9WA 4XRLA 4GT4A 4JS8A 4QP4A 4RWJA 4YZDA 3LXKA 4R3RA 4E4NA 1FINA 4FEQA 3VJNA 3LVPA 3A2CA 2G9XA 2ETKA 4O96A 5HCXA 1ATPE 1Q3WA 4G3GA 3C0HA 1NT2A 4FK3A 2PMIA 5IQGA 3EYGA 4RJ7A 4KSPA 4F63A 4I21A 2JAVA 4XH6A 3AMAA 1XH5A 2X7FA 2HW7A 5HVYA 3HNGA 3GXLA 2YM6A 4GK3A 3UVQA 3ZUUA 4CSVA 3FZPA 3PJCA 4DF3A 2GFSA 3Q04A 3ZM4A 4A07A 2CJMA 1XBCA 2ITVA 1KOAA 4ITHA 5I9WA 1R1WA 4KKHA 5ANGA 2BCJA 3VC4A 5L6OA 2CLQA 1DI8A 4QP3A 4CMOA 2PVFA 3TKHA 1YWNA 2OJIA 4S33A 4DGMA 1ND4A 3I79A 4XG7A 3BQCA 4D28A 5AUVA 2OWBA 4PDOA 2WU6A 2QO9A 3BHUA 1BI8A 3KRWA 3WZKA 1OIYA 1XBAA 1W98A 4FTOA 3LQ3A 3G51A 4HOKA 1VYWA 3TZ9A 2XS0A 4W4XA 4O86A 5A4CA 3PP1A 4WO5A 2BRBA 3KULA 5FUTA 3RAKA 5AAEA 4MKCA 4CYIA 2GTNA 3BBTB 3KC3A 3A8WA 2WQBA 4NFNA 3MVMA 2J0MB 2XVDA 5DR2A 4KUJA 3BV2A 3FQEA 2Y4IC 5BYLA 1APME 3PVWA 4YJNA 4IVCA 1OGUA 4BHNA 2XJ0A 3IG7A 3ZSHA 4LRKA 3R22A 4TYIA 3AD4A 1OUYA 4YC6A 4JQ7A 4D2WA 5BUJA 2QOQA 2OJJA 5AM6A 2R3RA 4Q5HA 4FT3A 1IEPA 2IW9A 4AZWA 4FGRA 3P9JA 4FVPA 4R5YA 2C6KA 4LL5A 4USEA 5BVFA 2BILB 2YZAA 3FI4A 3GCSA 3GI3A 3HMIA 3ULZA 4RRVA 3E87A 3DGKA 4BDAA 1NW1A 4MXZA 1REKA 2JKOA 1URWA 4PL3A 3HV4A 4I0RA 5GJGA 3LJ2A 3MH3A 4GG5A 3TDWA 2UW3A 4FZDB 2QKWB 2QG7A 3K3JA 3O71A 4WKQA 3MB6A 4DFXE 5HNBA 3B8QA 3QKKA 2F7EE 2I0HA 5CXZA 3F2RA 1XR1A 4FT7A 1L8TA 5L8JA 2OH4A 2IN6A 4IDTA 3BU3A 5EM6A 4C36A 4DBXA 3DDPA 2ITXA 5LVLA 2C1BA 4AOTA 4EHEA 3DQXA 3KN6A 5LWMA 5IEYA 4DG3E 4AGWA 3A62A 4EEVA 4FSQA 5CX9A 2DWBA 3QQUA 1REJA 3G2FA 2WD1A 3EN4A 4GVJA 4EI4A 3E5AA 3VBXA 4FV9A 2VO6A 2PL0A 4ZMFA 3PG3A 4FSMA 1WVXA 3HMOA 2G2HA 2GSFA 5HLPA 3CIKA 3QF9A 4FKRA 4FKUA 1FMOE 3D2KA 4A9RA 4LMUA 5CI7A 4AZVA 4FTQA 3QHWA 4GKIA 3LFBA 5JT2A 2JFMA 3QA8A 1XH8A 3AOXA 5CU4A 4LGDA 3LCKA 4FL2A 3RMFA 3R9RA 3RTPA 2ONLA 1A06A 4TYGA 3FHIA 3TI1A 1PXLA 4NYEA 2BRHA 2UZWE 4JR7A 2XRWA 4JIAA 4J99A 3BGZA 3GENA 5CEQA 5DMZA 3TUCA 3UOKA 5IG1A 3DLSA 3VO3A 4EOSA 3IW4A 2XNBA 3KXHA 3JXWA 5DGZA 3QQFA 2WEIA 4XEYA 3F2AA 2EU9A 2GMXA 2B52A 5CF5A 1BYGA 2PVLA 4UWBA 2WFYA 4CFMA 4I92A 2BALA 5M4FA 2W9ZB 3CEKA 4ZZNA 3R71A 2OF2A 1OITA 4MD8E 5CVFA 1NVQA 5T68A 3TNWA 4PMMA 3HV3A 4ZTMA 3MVLA 5HI2A 1PMEA 2QHMA 4IQ6A 4C37A 1J91A 4KABA 2NO3A 3WZDA 3R8VA 3FZSA 1VJYA 2VWIA 3KXZA 3T3UA 5CF6A 2YCSA 4L9IA 3M1SA 4L01A 4RG0A 1OVEA 4DFBA 4QO9A 3RK5A 4ZJVA 2VWUA 4QT1A 1PXOA 2VTJA 2W9FB 3LFAA 4IAZA 4ERWA 5I5ZA 2XIZA 4YZ9A 3QUEA 4LGGA 4RT7A 4XBRA 3BHHA 4IFCA 4ONAA 3FYKX 4FKOA 3UE4A 4ALWA 2P2HA 3D5XA 4O0SA 3W16A 4Q9ZA 1JLUE 2XKEA 3CJFA 4EORA 3NCZA 1YOJA 4RWKA 3BQRA 3S95A 5HBHA 4EK8A 4FIGA 3GCPA 2PWLA 2VGOA 3NYOA 5C8NA 4P7EA 4LRMA 2R3QA 3ZH8A 4ZTHA 3G9LX 3FMDA 2WQOA 4BDJA 4ZY6A 4XV3A 3BBWA 2WTWA 1JWHA 3TV6A 2W5AA 1OL5A 1OL6A 3LFCA 3Q60A 5AR5A 5JZNA 2R3KA 4U43A 3GBZA 3RVGA 4CXAA 1FPUA 3VQHA 1PXKA 3QD4A 5M53A 2OLCA 4Y5QA 3LMIA 4D2VA 4O7RA 3SQQA 2XIXA 4BIDA 4Z7GA 5CWZA 5M44A 4J7BA 1O6LA 2J0KA 1U5RA 4A4LA 5TF9A 4FT5A 3RJCA 4W9XA 3IDCA 2J0LA 4KIOA 2YERA 4BCHA 3DZQA 4RA5A 4EKLA 3WI6A 2XNGA 2C5OA 1ZYCA 3ZZWA 4O81A 2J51A 3F6XA 3MTLA 3BX5A 4AA4A 3IW7A 4FEWA 4N70A 4ANMA 2ONLC 4EHVA 2VNYA 2W1HA 5L2IA 4PTCA 3OZ6A 3PJ2A 2YM4A 3Q5ZA 3UVPA 3BLRA 1LEZA 2GQGA 2NRYA 2W05A 3VUGA 4YZMA 2OICA 2C5YA 4PY1A 3DAJA 5KBQA 2BIYA 5J9YA 1XH6A 2HZ0A 4H3BA 3PIXA 4EHZA 1IG1A 3E64A 4PUZA 3PY3A 3LPBA 4XP2A 4BWPA 4E20A 4QMWA 3NW5A 3L9MA 5KCVA 3GOPA 3DBDA 2B4SB 5L6WL 5EKNA 4D4RA 2ESMA 5E7RA 4AA5A 1Q41A 1WFCA 3WF9A 3KRXA 5CF8A 4FEUA 3QXOA 4O7SA 3V5LA 3BU5A 4L44A 3UBDA 1YDSE 3V5TA 3E7VA 3B2WA 3QGWA 4ANSA 3GC8A 3LHJA 3ODZX 4ANLA 2PHKA 4MEDA 5HO6A 3KXXA 5HX6A 5J79A 5E8SA 3MY0A 4UWCA 4EQCA 4QMNA 5CEMA 3R83A 4CFXA 2XEYA 3MPAA 5LVPA 4C34A 3O8UA 4NM5A 3NS9A 4C8BA 4HGLA 2WNTA 2Y0AA 5LCKA 5TO8A 2BTSA 3DU8A 4ZOGA 4R3PA 5M4UA 1CKJA 3R9OA 2B1PA 3QWKA 3C0IA 4BCJA 1YW2A 4JLCA 3Q4ZA 4EK3A 1KWPA 1AGWA 4FKQA 3DA6A 4GSBA 4IAKA 5HU3A 4U9AA 2UVXA 4G6LA 1OKZA 1ZOHA 2VWZA 3UPZA 2WXVA 4O7LA 4AG8A 5JGAA 3BE9A 4BDKA 1OB3A 4MAOA 4WSQA 3ZRLA 3HMNA 4PRJA 4OTQA 3ORMA 3PY0A 4K18A 3ZCLA 2J90A 4KIPA 3VUDA 4EH3A 1ZMUA 1PMNA 2J50A 5CI6A 4FOCA 3CLYA 3KK9A 1HCLA 1CSNA 2I1MA 5DLSA 2Q83A 3F5PA 2YCFA 2C47A 4G6OA 4UMQA 2E9VA 3KVXA 4C3RA 1LPUA 4AX8A 4CFFA 5FDXA 2XF0A 5CAPA 3PE1A 3D2IA 3KA0A 4CTBA 3H0YA 4DT8A 5IKWA 3BRBA 3P7BA 2OIDA 5ETCA 3GFEA 2PUIA 4AGDA 4BWKA 4FOBA 4C58A 5J87A 3OWKA 3LIJA 4F64A 3UOHA 5AR8A 1Y91A 4BTMA 5AUZA 1WVWA 5E92A 4IWQA 3TNQB 3NPCA 2LAVA 1QCFA 3ZC6A 3R04A 3C51A 1YOMA 2X7GA 4P2KA 3E92A 4NIFB 2X7OA 4L53A 4F0GA 4O7YA 5LVMA 3K5UA 4QP1A 3V5QA 4DCAA 4FIJA 4K33A 2REIA 1BL7A 4FV1A 3PLAE 3CP9A 3EL7A 4L43A 4PX6A 4OT5A 4DGLC 1GZKA 4FICA 4CZTA 1H1RA 5DI1A 4EC8A 5A4TA 3FQSA 4GU9A 1ZY4A 3Q3BA 2FH9A 3Q4TA 4S31A 4OW8A 4AGUA 4F6UA 1TQIA 1FGIA 1R39A 3NYXA 3TZMA 3ZLSA 4EHGA 3BYSA 4IZAA 3ZRKA 4IAIA 2XBJA 3UIBA 1OECA 3OWJA 5IA3A 3DFAA 3QXPA 3HDMA 4YZBA 2W17A 4EK5A 3ZO3A 2AYPA 4EK4A 2UW7A 4BCGA 5IQIA 3E88A 3QC9A 4OTFA 3OROA 1QPDA 5AAFA 3GU6A 3LCTA 3LM5A 2G2IA 3NUSA 2X8DA 4A9TA 4FNZA 2C6MA 2WMSA 1ZARA 3D5VA 1HOWA 3JS2A 3W2PA 1KE9A 2C5NA 2Z7RA 3VNTA 3COIA 2P33A 4DYMA 4I94A 1UU8A 5AIRA 1EH4A 4ACCA 4D4YA 4FV4A 2HOGA 3C0GA 3JUHA 4HVIA 3OHTA 3TL8A 3V51A 2UZLA 4N6YA 4EOQA 4ZZOA 3H0ZA 4NU1A 2F49A 2ZV9A 4DITA 4XHKB 4BZDA 5C4LA 4ZP5A 5DWRA 3FWQA 5EQYA 4LUDA 5BYYA 5IQCA 3VF8A 4C57A 1MUOA 1Q8WA 4EOMA 4D0WA 5T3QA 5I0BA 2OSCA 3WF7A 4XLVA 5LOHA 1H25A 1UVRA 4C4JA 3MH0A 1BX6A 3HLLA 4HGEA 1IAJA 3V6RA 4NIFA 3P1AA 4H58A 5E8ZA 3UO4A 3QTUA 3A7JA 4CYJA 3SKCA 3UC3A 3TNIA 4BDHA 5IEXA 3GOKA 3IGOA 5E4HA 1S9JA 2OJGA 3EZVA 3ZDUA 3FLQA 3DB6A 4KIKA 4NK9A 4RGJA 1OM1A 4EBWA 3QC4A 5IA0A 4ACDA 3R7YA 4H1JA 5DH3A 4ZTLA 3LJ1A 3ORZA 1JKKA 2PMNX 4YLJA 4CV9A 5BVNA 2UZOA 2ZV8A 1A48A 4C4IA 2B53A 3Q2MA 4O2ZA 4WBOA 4TZRA 3KMUA 4RX5A 4YNEA 4JBQA 4MVFA 5KMOA 3PUPA 2ZAZA 2FUMA 2Q0NA 3JVSA 4IB0A 5EHOA 2XP2A 4GIHA 1Q3DA 3H9RA 3KF4A 5HO7A 5DR6A 4L3JA 2O8YA 1OKYA 4DFUA 2A0CX 2XKCA 2G1TA 4GJ3A 2XYUA 4I1ZA 4BKZA 2C6OA 2QO2A 2A27A 2YM5A 3OXIA 3QZIA 3VUMA 4L3PA 3WOWA 2ZMCA 4IWPA 1Q5KA 3HUBA 1VZOA 4FNYA 4YNOA 2C6EA 2R5TA 3R9DA 5B2LA 1JQHA 3OG7A 3BPRA 3HRFA 1KE6A 2EXMA 4J95A 4I5PA 1U54B 5ANIA 4JDIA 1H07A 3QZFA 2XBAA 3EB0A 3QFVA 4FNXA 3PZHA 4ANNA 4FKWA 2UUEA 2WTVA 4IE9A 3ZYAA 4RIWB 3O51A 3SLSA 3SD0A 1ZYSA 4M0YA 5M51A 3MB7A 3A4OX 2C3KA 2J0IA 3GCVA 4ALVA 1FBNA 3C5UA 3PXKA 2AC5A 3ODYX 5CEPA 5KE0A 5CEOA 5IQAA 3CQWA 4BGHA 4CQEA 1SM2A 3DK3A 4QMVA 5CNOA 3KXGA 4Y95A 4BWXA 2CGVA 4QYFA 2FSTX 2GDOA 2QOHA 2X81A 2PU8A 3R9HA 2UW9A 5B0XA 2CKPA 3PDTA 3NR9A 3EOCA 3QZHA 5KZIA 5AUWA 2CN5A 1M2RA 4BDBA 5IQDA 5CY3A 3F5GA 2WQMA 3EJ1A 3G9NA 2YM8A 5EKOA 5JEBA 3MVHA 3LLTA 4X2FA 5H2UA 1AQ1A 1IASA 1MRUA 1VR2A 2YCQA 2ZV2A 3D83A 3DKGA 3M2WA 4L67A 5CU3A 4YR8A 5A4LA 4TWCA 5DT0A 4BCIA 3UIXA 3MFRA 3EZRA 5C01A 2RG5A 3OEZA 4D2PA 4R3CA 3FLZA 4BDCA 4O82A 2A19B 4BCQA 1ZXEA 3DCVA 3TJDA 4R7IA 4MBIA 3G6HA 5ACKA 4H36A 2JIIA 4CMTA 5HNGA 2YIQA 2X8IA 1L3RE 3VBQA 3RPVA 1O9UA 2IWIA 4HGTA 4JRVA 4B8MA 2QO7A 2C5XA 3K54A 2ETMA 3IW5A 2CCIA 1Y57A 2VTLA 4RC3A 2O0UA 3DXPA 3IONA 4UZDA 5DRDA 4BKJA 2R3NA 4E5WA 5K4JA 4IVDA 3UQGA 4XJ0A 5B2MA 3C4CA 4F1TA 1H0WA 1XBBA 4FKSA 3AC8A 3FUPA 5CT7A 4YUQA 1U54A 3SW4A 2ITWA 1ZZ2A 4ZY5A 2PZRA 3W33A 1B6CB 1H1WA 3IPHA 5I9XA 3SW7A 2QONA 3OWLA 3QQLA 4RIXB 4U0IA 3S3IA 5BMSA 4BI1A 4JG8A 5DNRA 3G6GA 4IM3A 4FTCA 4FTUA 3R30A 4C61A 4DGNA 4RIWA 4ZJJA 4K77A 1PMVA 4QD6A 2ITUA 4ACMA 3PZEA 2VGPA 5D10A 2QKRA 4NTTA 5EI2A 4ZTNA 4D4SA 4ZLZA 3KEXA 1JSTA 4IFGA 5HE1A 5C1QB 5HORA 4FL3A 3QLGA 4ALUA 2XKFA 4TYHB 5EHYA 1OL2A 5IUGA 1Q8YA 4R7HA 5JRSA 5GZ8A 5KX8A 1G8AA 3VHEA 2IVSA 4FX3A 5A3XA 1ZMWA 1Q61A 5AX9A 1H01A 4HGSA 4I5HA 5HU9A 3QALE 3S4QA 5BVWA 3QWJA 2Z7QA 2XUUA 4EQUA 4IM2A 4P5QA 2WMTA 3C13A 3DAKA 3HECA 2CN8A 4FTAA 2XIYA 5FEDA 3JYAA 5AV4A 5BUIA 2HELA 3DLZA 3TUDA 2JKMA 3E62A 2PVMA 1V1KA 5HKMA 4E5AX 4FR4A 4YSMA 5CLPA 4YBKA 5FP5A 4D2RA 3AT2A 1WBOA 4YO6A 2VNWA 3A61A 2EVAA 2GNFA 1XH4A 3QQHA 5IPJA 3LMHA 4J71A 3HA6A 5D11A 3P4KA 3ACKA 3N51A 3AC1A 4RVKA 4WG3A 1IA9A 3REPA 4GK2A 2F2CB 3BYVA 2OZAB 3F3UA 3QRKA 4FVRA 4G16A 3VS0A 4DG0E 5IDPA 2BIKB 3RPYA 3WILA 3C9WA 2PUNA 4DEBA 4RPVA 1OKVA 3R7VA 4PDSA 4N6ZA 4R7BA 4BDEA 4KD1A 3IOKA 3ORNA 3OBJA 4DFNA 4MYGA 3OEFX 3ALNA 3U9NA 4F9WA 5M09A 2J9MA 3TM0A 1OL1A 3FKOA 5BVDA 4UX9A 4RIXA 4PMTA 3VRZA 5A54A 1H1SA 5D9HA 3TEIA 4GJ2A 2YJSA 4DC2A 2JD5A 4OT6A 2R4BA 3KKVA 4YJVA 3RALA 5H3QA 3DAEA 2BR1A 5J1VA 4A9YA 4JJRA 4IZ5A 3VVHA 2CGXA 2WQEA 4L3LA 4XUFA 3PPKA 1IR3A 4EOIA 2VTHA 3PA5A 4LUEA 4TYHA 2VX0A 3F82A 2J2IB 3RGFA 3EIDA 3FJQE 3IGGA 3MY1A 3DTWA 3PXFA 3NYNA 2W06A 4DINA 3C1XA 5IUIA 2NRUA 2BFXA 2QOOA 3KRJA 3IQ7A 4II5A 4QPSA 5AP5A 1QPJA 4WBBB 4C2WA 3ATSA 3UIMA 2G15A 3MBLA 4O0UA 5KUPA 3IK3A 4ZLYA 1WBSA 4RZWA 4OTPA 5LCJA 4PTGA 2OFVA 3E7OA 3G33A 4I24A 4YZNA 3E63A 4IX4A 4BZOA 2OJFE 4RA4A 2C0TA 2KTYA 3EWHA 4KAOA 2BMCA 3BIZA 3DK6A 4D9TA 3SV0A 2BDFA 4CKJA 5CQWA 3I7BA 3AQVA 3O96A 3MFSA 4RQKA 5EH0A 4ZSGA 3GGFA 1CMKE 4XG3A 5AR4A 2ITNA 2X2MA 3RHXA 5IDNA 2YIRA 1GOLA 3HL7A 5I4NA 3VUKA 4BDIA 3IECA 4QTCA 4BCMA 4ZAUA 2FSMX 2BZIB 3FMMA 2EXEA 2X2KA 3AC4A 3NUPA 5DVRA 3NUNA 2C6LA 2WIPA 3GVUA 4FF8A 5IH5A 4O84A 3U6JA 2OZAA 3ZFXA 4EONA 2X6EA 3Q5IA 5M4IA 1V0BA 3DPKA 3FC1X 4ACHA 3MFUA 1GZ8A 4AQCA 3QRTA 2YITA 5L2WA 1Y8GA 4F65A 5K0XA 2Y6OA 4ZSAA 2OG8A 2C6IA 3HP5A 4EOOA 5BUEA 3UZTA 2YFXA 2B9IA 4IAYA 3EHAA 3MH1A 3QBNA 4IX6A 3MA6A 3EFLA 3ZMMA 4C35A 2BDWA 3KREA 1BKXA 4YJTA 2VTAA 5G6VA 4V0GB 4F9AA 1BI7A 2OZOA 4EH7A 5M55A 3FLWA 1WCCA 2BRNA 2QC6A 5DA3A 2VWYA 4FV2A 1U59A 4G9RA 5CSWA 4MXOA 3R1NA 4BCFA 2CNQA 3NZ0A 3CKWA 3AXWA 3ZLWA 3HV5A 2CSNA 1E1XA 1W8CA 2Z2WA 4IACA 4AFJA 1XO2B 2VTSA 3BU6A 4QRCA 5HIDA 4UMUA 5M56A 4OGRA 4BDFA 3BELA 3DK7A 3LMGA 2XZSA 3OT8A 4KINA 4Z16A 1G3NA 3I5NA 4YU2A 4O83A 3HYHA 2HAKA 2WQNA 4BVUA 4GCJA 4H39A 4BZNA 2Y8OA 2WTDA 2X2LA 3EQGA 3IO7A 2FSLX 4FODA 3ORPA 2BUJA 5F4NA 3W2SA 5J95A 4Q2AA 5EG3A 3BLHA 2O3PA 3ALOA 3ET7A 3DBQA 2UW8A 4NCTA 1R78A 3NGAA 3ZLXA 4S30A 2QODA 1M7NA 2WTIA 1Y6BA 4XG8A 4UV0A 2JIVA 4ORKA 5IQHA 3MJ1A 3FSKA 4MF0A 1YQJA 2DUVA 2R7BA 1YOLA 2GNGA 2PE1A 2QNJA 3GCUA 3KXNA 4IADA 1CDKA 1NY3A 4FKIA 3NUYA 2BKZA 4B8LA 4GUBA 4EYMA 2CGUA 3S1HA 5FXSA 4FK6A 3TACA 3BYOA 3U8WA 1SYKA 1GAGA 4CLIA 1YXVA 4YZCA 2NNWB 5TKDA 4Z55A 2ZDTA 5AMNA 3LE6A 5AA9A 5F9EA 1Z9XA 3DFCB 4LI5A 2PVYA 3FBVA 4FNWA 4YJRA 3ZDIA 4FUYA 1H1QA 1PYXA 5IA2A 2QD9A 4PL4A 3GU4A 2YM3A 3QHRA 4U5JA 3VIDA 4EJ7A 3DQWA 2PPQA 2J7TA 3AC5A 3DKFA 2C5VA 4FSZA 2HW6A 2XB7A 2PUUA 5FG8A 5CXHA 4QP7A 3OWPA 4XX9A 4ZTQA 4V0GA 4F08A 2XNEA 3ORIA 5EOLA 2NPQA 5CF4A 2QLQA 4JNWA 4G34A 5DRBA 4BGQA 5D7AA 4CG9A 1YI4A 3UMWA 4WNOA 4UBAA 3RP9A 3BHYA 4WG4A 3W2OA 1PJKA 4GFOA 4GT5A 4L45A 1NA7A 4AZEA 3UODA 2XJ2A 5TOZA 3RK9A 5HLWA 5ITAA 2BRGA 3R8PA 1ZY5A 4WSYA 2JIUA 1SZMA 1V0PA 2O65A 2V62A 1Q8ZA 4NTSA 2C30A 4C3FA 5ANDA 3H9FA 2OO8X 3OOMA 1DAWA 2ITOA 2PVKA 4AOIA 4P90A 2R9SA 2Y6MA 1M7QA 1GZNA 4GYGA 4BF2A 5CT0A 4IHPA 3PIZA 3N4TA 4LL0A 1OKWA 4E26A 3FKLA 4YTIA 1LP4A 1ZAOA 5A14A 4R5SA 5JFSA 4FT0A 1H27A 4JL9A 1VEBA 2VN9A 3FYJX 3VS2A 5CU2A 3WE8A 3R2BA 5B7VA 3HMMA 4QTBA 4QMXA 3KVWA 4E93A 3BKBA 4Y5HA 4FIEA 5EYCA 2XA4A 4APPA 2XNPA 3C50A 3D5UA 2B55A 1UNHA 4RX9A 4XV1A 5AR3A 5J1WA 2YZLA 4NM3A 4YC8A 4ITIA 2XK3A 4XLIA 3UP7A 4KBAA 3FXZA 3B2TA 5L2QA 3DJ5A 3ULIA 4DTBA 3O8TA 4HYSA 1H1PA 5HIEA 4LV8A 4IC8A 4IH8A 3P7CA 4CVAA 3AMBA 4YMJA 4G9CA 3RM6A 5E8WA 2GNIA 4XOYA 3VULA 4BICA 4FKJA 1RQQA 4M7IA 2PVJA 3P5KA 3R02A 3ZM9A 5DFPA 4Z3VA 3MYGA 3M11A 3OXTA 4QP2A 3L9PA 4AW0A 4DE4A 2XNMA 4AACA 4O7WA 2A2AA 3I1AA 1IA8A 3LXNA 3Q32A 4BCKA 2XCHA 2F57A 3DXQA 2GNHA 2UW4A 2JITA 3PVBA 4HNIA 1GIHA 2RKUA 3I6UA 2B7AA 3FZ1A 3QUPA 4R1VA 3BWFA 1JSVA 2WMRA 3ZEWA 3W2CA 2O2UA 2UV2A 3ANRA 3NW6A 4APCA 2V5QA 3QTSA 4NEUA 4RLKA 3NVMB 4YO4A 3LXPA 2JDSA 2GHLA 2UZUE 3GP0A 3PPZA 3PWDA 1W84A 3IS5A 3CGOA 3II5A 1TQMA 4G6NA 4EH4A 5A46A 3PJ8A 4FSRA 5D7VA 4RQVA 1IRKA 2WMWA 2XIKA 5L3AA 4YGAA 4UXLA 3PYYA 3ZO2A 5KMIA 2P4IA 2GNJA 3R28A 2WOTA 4OBOA 3WF8A 3QZGA 4OBPA 4ZK5A 5K4IA 3VWAA 3NAYA 3ZBFA 3SXRA 1MQBA 1SVGA 3F69A 4UY9A 4UYAA 4EH2A 4OTWA 3FZOA 2ITTA 3LLAA 4F4PA 1LEWA 3CD8A 3LM0A 4RVTA 1W7HA 3W18A 5HZNA 1H4LA 2YDJA 2I0EA 2JDTA 3MVJA 4HYUA 4AFEA 3PTGA 1XHAA 1JNKA 2E9UA 2OXDA 4J97A 4GFGA 5J5TA 1W0XC 2B54A 5CNNA 4KWPA 4AP7A 3NLBA 3FL5A 3V8WA 5LMKA 4YHFA 1YI6A 3AD5A 3QCQA 1UKHA 3DV3A 2C68A 4YJUA 1ZYDA 2YLFA 4ZS0A 3Q6UA 1P4FA 3FKNA 4G2FA 4ZXTA 3NNXA 2ERZE 2R64A 3CPBA 5D1JA 5AP3A 4I5MA 3UOJA 3TTJA 2W0JA 3ZONA 4KRCA 4NKSA 3RAWA 3MFTA 2OFUA 4RMZA 1FGKA 4K0YA 4JVGA 5EK7A 2RFEA 3GT8A 4V04A 3RHKA 4K1BA 5LMAA 1F0QA 2HZ4A 2ZMDA 4O0VA 3VAPA 1WZYA 2HY81 1XKKA 4X2JA 2RFNA 5TR6A 1OPLA 4X7QA 3O2MA 4TWPA 5BQ0A 3SC1A 4DGGA 1G5SA 2W1EA 4YBJA 4OTIA 3KQ7A 3N9XA 5LVOA 4FV7A 5EW8A 2OXYA 3E8DA 1Q24A 3Q9ZA 5CEIA 3FI2A 5J9ZA 4RC4A 4MX9A 4H3QA 3WYXA 1XQZA 3W8LA 3RCJA 5BPYA 2GHGA 3POOA 1KSWA 2IVVA 1UV5A 3O8PA 3OW4A 3UO6A 2ACXA 5IQFA 4I6FA 4QYYA 2W99B 3LFNA 2PMOX 4JBOA 4C4GA 5ETAA 3VW8A 1FVVA 3HAMA 5LARA 3RAIA 4XBUA 4QMTA 4LGHA 4JQ8A 4U8ZA 5H8BA 1KV2A 4PL5A 4QQJA 1ZOGA 5HG9A 4ENYA 2VWXA 3EFKA 1B38A 3CXWA 3OCTA 1OIRA 3ELJA 1YWVA 3PRIA 3QTWA 3TT0A 4DEIA 5KMMA 5KHWA 4ACGA 4AW1A 4E3CA 4MXCA 3CTHA 2YIWA 3PG1A 2VTMA 1UU9A 5IH6A 2Z02A 2QQ7A 1Y6AA 4DGOA 3S0OA 1U46A 2JKKA 4J98A 4U44A 5H9BA 3LW0A 3VBWA 3VHKA 5AEPA 3GC9A 3MTFA 5KMJA 3GQLA 2BROA 1Z57A 3L8XA 4X2GA 4DLIA 2CKOA 5HTBA 3L1SA 4WD5A 5L8KA 1WBPA 3O7LD 4KIKB 5CENA 4MQ2A 4TTHB 4LMNA 1M2PA 3U4WA 4CFNA 1RDQE 3DKCA 3R7UA 5FQDC 3RNYA 3ZS5A 1ZWSA 4IDVA 4PPCA 4XCUA 3VS6A 4WOVA 5CSVA 3LFFA 4X6RA 4TNBA 3CR0A 2W1GA 4FV8A 3BEAA 3T8OA 5IUHA 3R7GA 1E1VA 1MRVA 3JVRA 4RZVA 4I41A 3MN3A 5CS6A 4HYIA 4YPDA 3ATTA 3U54A 3QYZA 4S2ZA 5KO1A 2XJ1A 4Y73A 2VX1A 4FTJA 4Y83A 5F95A 1W82A 4JAIA 2X4FA 4MF1A 4RFYA 3O23A 3SHEA 5AP4A 4I0TA 2EXCX 4CNHA 4DEDA 4RJ5A 3ENHA 4QMOA 1JKSA 5HVKA 2F7ZE 2HK5A 4LM5A 4LFIA 4F7LA 5AFVA 5K9IA 2RFDA 3C7QA 2C69A 4FKTA 3CSVA 3U55A 3EFWA 1OBGA 3A4PA 2AC3A 4H1MA 3Q53A 1ZYLA 2PTKA 3GU8A 4FMQA 3PA3A 4QYEA 3GEQA 3FI8A 3NVKI 4BN1A 2OH0E 4ZSJA 3P86A 1TVOA 4V01A 5EW3A 2X9FA 3TG1A 5CAUA 4K9YA 2BZJA 4YC3A 3NUUA 3HX4A 3R1QA 5LMBA 2YDKA 4I20A 4DH1A 4FSYA 5L4QA 2DYLA 4WA9A 3WARA 3KK8A 2EWAA 4QMYA 3BHTA 3RWPA 3EFJA 4A7CA 5AP1A 4EK6A 4PQNA 2XK9A 2PVNA 2R3HA 4O1OA 2GS2A 5HBEA 5HG7A 3VS3A 4F7NA 5CANA 5J7HA 4BRXA 4C7TA 1WBTA 3EN6A 4BYJA 4CZUA 3EH9A 3ENMA 1A9UA 2UVZA 2FGIA 4HVGA 3ORXA 5CAOA 2XK6A 4FKPA 4QMMA 3U87A 3AGMA 3MH2A 3LCOA 1OUKA 2BAJA 4TT7A 4NFMA 3DTCA 4KKGA 2JGZA 1DM2A 4ZJIA 3BV3A 3WYYA 4ANBA 5HVJA 1J1BA 3DBCA 2BPMA 4O38A 2FSOX 4RVMA 4FZ7A 4U3ZA 4U81A 5ANKA 4C4EA 4DH7A 3ZZEA 3DXNA 4XS2A 3TTIA 5HBJA 4TL0A 4RLLA 5CZIA 4R6VA 2WTJA 4AGCA 4O0RA 1XH9A 4Q5EA 4EWHA 2HWPA 2XNNA 3G0EA 3MY5A 3OOGA 2W1ZA 2BTRA 3GC0A 5JFWA 5HOAA 4MTAA 4YTFA 4IW0A 3UJGA 1RJBA 1LR4A 3OVVA 4L68A 3WF6A 3I4BA 5E91A 3TWJA 4UN0C 2YWVA 3DNDA 5CTPA 3Q96A 4JBVA 1NVSA 2RL5A 3I7CA 5FTQA 3UVRA 3ZU7A 3QAME 4KKEA 4MQ1A 3GB2A 4O0XA 1Q97A 4JDJA 1QL6A 4IB5A 4JDKA 3L9NA 3RKBA 1Y8YA 5I3RA 3LAUA 3SX9A 2RFSA 2ETRA 2C0IA 4AT4A 4BB4A 2ZYBA 4CKRA 3KCFA 3PA4A 4F9YA 1F5QA 4QTEA 1W83A 4LOQA 2VTTA 3AMYA 4FTTA 5DT4A 5ANOA 3HV6A 4BDGA 5AP6A 3UMXA 2WHBA 5IA1A 4HVSA 5JH6A 3R73A 2W1CA 5F1ZA 2QOLA 2XM9A 4WT6A 1ZOEA 3VS4A 2XMYA 3ZHPC 4UMTA 4OTHA 3V5JA 2GHMA 2O5KA 3IKAA 2H96A 3QLFA 3NWWA 4N0SA 4WRSA 3W10A 3ACJA 4PMPA 2VV9A 4HVHA 1SVHA 3UZPA 1ZLTA 3IDBA 1H24A 5ETIA 4AZTA 2R2PA 4PWNA 4CRSA 3FV8A 2W1FA 3VJOA 2VO7A 5AP2A 3VRYA 2PYWA 3MWUA 5I9ZA 3QTIA 2QU6A 4E8AA 5FXRA 2X9EA 4BBEA 2DQ7X 4IEBA 2YN8A 4XMOA 1PY5A 4L42A 4QNAA 3WF5A 4M12A 2PVRA 3FZRA 3OBGA 4TXCA 5DE2A 1G8SA 5C8KA 1GIIA 2F7XE 3BYMA 4E6DA 5CAVA 4GU6A 3R7OA 3AC3A 1VYZA 3QQJA 4JDHA 1KE7A 4Z7HA 1OPJA 4MD9E 3RINA 1K2PA 3TUBA 3R21A 3PE2A 3C5IA 5FWKK 4AF3A 1M52A 3RNIA 2HZNA 3OW3A 4FG7A 1KUTA 2IVUA 2OK1A 4OLIA 3FMEA 3K2LA 4UMPA 5CSXA 3G5DA 3L8VA 1UNGA 4IB3A 4C0TA 4I0SA 4FC0A 3COHA 4QQ5A 2IZTA 4TY1A 3LCSA 1OL7A 3NIEA 4MWHA 5EDPA 3UG1A 4ZY4A 3FPMA 4XG2A 4RIYB 5DT3A 4U80A 4X3JA 2WO6A 2B9HA 2C4GA 3FLYA 3O17A 2XEZA 4JI9A 2GNLA 3ZSGA 2XK4A 4J1RA 4LYNA 3TKUA 2BKKA 2HWOA 1OBDA 3JY0A 3KB7A 3CE3A 3OY3A 3UYTA 1HCKA 3P7AA 4WNPA 5JMSA 3BGQA 4QPMA 1R3CA 4OUCA 3NIZA 3C4FA 4G17A 3HRCA 2I6LA 3QUDA 5I3OA 4EOJA 4EYJA 2J5EA 1LUFA 3HMPA 4FI1A 4M84A 5A4EA 3ZXTA 2Y7JA 3WZUA 4F7JA 5E1EA 4L7FA 4ASDA 3FPQA 5ACBC 4K6ZA 2C3IB 4WRGA 2HZIA 4HZRA 4TYJA 4RWIA 5I9YA 4CCUA 4FUXA 3P78A 4NKAA 4YLLA 5FEQA 5IU2A 3A7FA 4AT5A 2RSVA 1SNXA 3CTJA 3QTRA 3OFMA 3FC2A 3WIKA 4EZ7A 1Q62A 5EYMA 4OTDA 3FLSA 4EZ5A 2V0DA 4DEHA 5GINE 3U4UA 3U9CA 2ITZA 2CLXA 1CKPA 1OPKA 3PWYA 2C1AA 4HCUA 4J53A 4U7ZA 4B0GA 4B4LA 1Q8UA 3TIZA 4CRLA 2P3GX 4FGBA 5DPVA 4U45A 1PYEA 3E8NA 3KY2A 3OUKA 4NWMA 5TE0A 3A7GA 2Z8CA 4CFVA 3NAXA 4U41A 4R77A 1B39A 1JOWB 3PSCA 2X6DA 4GK4A 4AWIA 3DB8A 4FEXA 2BDJA 5GNKA 4USFA 1JVPP 3MS9A 2VTPA 4W9WA 2OW3A 4GEOA 5H8EA 5K3YA 3UIUA 3FI3A 3NRMA 5CVHA 3QA0A 2VUWA 4CFUA 2OGVA 3Q4CA 1IAHA 2IZRA 3E3PA 2QR7A 1RE8A 4JBPA 3CBLA 4GMYA 4RIYA 1RW8A 4J8NA 4RJ8A 2ZV7A 3QTXA 3G15A 3NUAA 3QX4A 3C4WA 2YEXA 3NMUF 3ITZA 1PXJA 4DHFA 2UW5A 4M14A 3KN5A 5CYIA 3R9NA 4MXXA 2H9VA
chains in the Genus database with same CATH superfamily
2ZB0A 1J7UA 4AN2A 5K0KA 3F3TA 1PW2A 3K5VA 4GYIA 3VBTA 4I5CA 2ERKA 4XYFA 5AADA 3MV5A 4RIOA 5HIBA 3HRBA 4XG6A 5CASA 3PVGA 2UW6A 2X1NA 2XM8A 3QRJA 4ITJA 4R8QA 4RJ3A 5GIPE 3QD3A 3QU0A 5F20A 4FTIA 3RM7A 4AZFA 4JT3A 5JKGA 5LWNA 5IEVA 4HW7A 3E93A 4OTRA 5C26A 2C6DA 4X6QC 1KV1A 3UYSA 3D7TB 3E8CA 4J8MA 2E9OA 3W55A 3BLQA 4IANA 3U6IA 3NSZA 4RX7A 1YXUA 4HJOA 3F9NA 3ZBXA 3QKMA 4M8TA 4IAFA 2IW6A 4W4VA 3SOCA 4BFMA 4XV2A 2GTMA 3HZTA 4J96A 4WUAA 4F78A 2ITQA 4N4SA 4F9BA 1O6KA 1YHSA 4D5KA 4DH5A 4D2TA 5AUYA 5ANEA 3D4QA 5J7BA 3PFYA 3A99A 4D0XA 4EUTA 4RFZA 5HGIA 4FSUA 5EI8A 2WOUA 5EI6A 3LQ8A 2ZJWA 3LQ5A 4BI0A 5JN2A 3UDSA 5FM3A 3GU7A 2QHNA 2CKQA 3GC7A 3OC1A 2B0QA 3EQHA 2VTQA 3OD6X 2PK9A 3CPCA 3CC6A 4MNEB 4O7ZA 1TKIA 3E8EA 4ZLOA 3I0QA 5GIOE 2IZSA 2WMAA 4QNYA 5E8TA 2QOKA 1TZDA 3ZO1A 3SGCA 2VX3A 3FMNA 4X3FB 4QPAA 2HENA 4WNMA 5A6OA 2YDIA 1U5QA 4QMPA 2JDVA 2WB8A 2VWWA 3FMKA 4O27B 2YA9A 3KRLA 5DR9A 1YXSA 4RC2A 1WVYA 3VBVA 4B9DA 2WMVA 3EL8A 3OY1A 2UZDA 4L8MA 1P5EA 4FZFB 2UZNA 4BI2A 3KMMA 3HUCA 3O0GA 1OMWA 2VZ6A 2W7XA 4ID7A 4BIBA 1BUHA 4L52A 4MNFA 2F2UA 2W4OA 4M66A 5L6PA 4HYHA 2ZFYA 2YCRA 4BR3A 3BCEA 4KS8A 3ZFMA 4AS0A 3SXSA 3I81A 4Z9LA 5CALA 3D7TA 4JRNA 2Y4PA 1PKGA 3QKLA 2WELA 3VS5A 4IWOA 3KFAA 4YHTA 3LKMA 4O0TA 3NFGB 3HDNA 4GRBA 1UU3A 5JZJA 2PE2A 4G1WA 3VF9A 2RIOA 3BZ3A 2VAGA 3W0SA 3LCDA 3H30A 5DEWA 5FTOA 4TNDA 5C03A 2VD5A 3C4EA 4KBKA 2J0JA 4B6LA 3TNHA 5H8GA 4IBMA 3ZUVA 2JFLA 3GFWA 3FMJA 4IVAA 3EYHA 4R78A 3KL8A 5GJDA 4IXPA 2QURA 4FEVA 4QYHA 4UEUA 5JQ8A 2E9NA 3D7ZA 4D1SA 4JG6A 4NW6A 4BHZA 3THBA 3ETAA 3R2YA 1FVTA 3OS3A 2JAMA 3M42A 1STCE 1ZMVA 5B2KA 3MESA 4TKSA 4MNEA 3A7IA 3EQCA 3UNJA 3TYKA 3IW6A 4C2VA 5LVNA 3EN7A 4O7NA 4X2KA 5KMNA 3DKOA 4Y46A 4HCVA 2WTKB 3F2NA 5E8YA 5HHWA 4QP8A 2WMXA 3PJ1A 4PPAA 4GW8A 4X3FA 4C62A 3QCSA 4FV5A 4QP9A 2ZOQA 3KXMA 4LOOA 3BE2A 3FMLA 2PZPA 3QX2A 4FBXA 4U42A 3TKIA 2G2FA 5AUUA 3GQIA 4HPTE 5IZFA 3CS9A 4FKLA 3RZBA 2EUFB 1JAMA 4L6QA 3RZFA 4K8AA 3DNEA 4LOPA 4CEGA 4CT1A 5EW9A 4HZSA 4JIKA 1R0PA 1YWRA 2V22A 2ZM4A 4PV0A 4YTCA 2IO6A 4HPUE 1J7LA 3UC4A 4C3PA 2E9PA 2QVSE 3EQBA 3MW1A 4DN5A 2IG7A 3DY7A 3ORTA 5C4KA 3SOAA 1PMUA 1FMKA 2Z7SA 4CKIA 5K5NA 1YHVA 5DN3A 3TXOA 4GV1A 3JPVA 4GH2A 5KKRB 3NNVA 3LFDA 4CLJA 3QL8A 5KBRA 2R3GA 2XIRA 3H9OA 2UZBA 1T45A 3W0OA 4YJQA 4X21A 4UB7A 2EB3A 5AR2A 2W1DA 3MPTA 4JX7A 3HVCA 3P0MA 1KE5A 1CKIA 1QMZA 3EQRA 3V3VA 3KCKA 3UNKA 3LJ0A 3I5ZA 4E4LA 5HCYA 3TN8A 3TV7A 1PKDA 1WMKA 2XYNA 2CKEA 2H34A 2YACA 3Q9YA 4DHZA 3QD0A 3BYUA 3MIYA 4TN6A 4NUSA 3ZOSA 4L7SA 5E8VA 3CKXA 2YJRA 3SAYA 3OF0A 4G3EA 4DFLA 1MP8A 4E5BA 1GIJA 3RPRA 2VU3A 3W32A 4BKYA 5HTCA 1P4OA 1SMHA 3ZTXA 3Q2JA 2Z60A 5DEYA 2G01A 3EMGA 3A7HA 3Q6WA 1PXMA 2P0CA 2JEDA 4UZHA 5E90A 2XH5A 5EM5A 3OTUA 4M13A 4EZ3A 4BJJB 3QTQA 2IEWA 4LG4A 1JSUA 4LRJA 2CNUA 4FSWA 3ANQA 4ANQA 2YIXA 5C27A 4F6WA 4Y8DA 2QLUA 3FXXA 3SXFA 4IWDA 5JK3A 3FZTA 2IVTA 3R6XA 4ZSEA 4YURA 4XP3A 3W0RA 4U6RA 2PZYA 3PXQA 1XJDA 4MCVA 3L8PA 2VWBA 1PF8A 1SVEA 5LQFA 2H8HA 4O2PA 4NCTC 2GPHA 2QCSA 4QYGA 4DLJA 4EOPA 2BZKB 4QOXA 4CCBA 2ITPA 3EQFA 4X0MA 4EKKA 3ZRMA 4AU8A 3R8MA 4BTJA 4RFMA 4M3QA 5CSPA 4C02A 4I6BA 4KIQA 4ASZA 3G0FA 4FTKA 4CG8A 5AP0A 3ID6C 3Q52A 2C3LA 4FIHA 4IB1A 2I0YA 1O6YA 2FB8A 3COKA 4X3FC 1F3MC 5C8MA 4DEEA 2ZM3A 5DYJA 3PVUA 1ZRZA 5HD7A 2QI8A 4A06A 5CAQA 5GHVA 2VTOA 4F7SA 2C0OA 4QMZA 4QQTA 3SRVB 5GZAA 3NNWA 4NT4A 3MGYA 4GUEA 4ZTSA 2XRUA 3D0EA 1V0OA 3FE3A 1PRYA 3C4XA 1YRPA 4JG7A 3RAHA 3F61A 3QCYA 4JX3A 2YIYA 3GCQA 5IA5A 3UDBA 2BVAA 3FDNA 4IC7A 4DFZE 3FAAA 4LDTA 4DTKA 1Q4LA 4PNIA 4QMLA 4GL9A 5AV2A 3AC2A 5EM8A 3R01A 5AV3A 2PUPA 4TWNA 4GKHA 4EH8A 5ANJA 1S9IA 5IISA 3WZEA 4BGGA 4DH8A 3QQGA 5BVKA 2IZUA 3UOLA 2XK7A 4FV6A 4GG7A 4ERKA 4C33A 1GNGA 2VTNA 4FG9A 4E4XA 3VUIA 5JQ5A 4N57A 2F4JA 3F3WA 4BTKA 3ZLYA 4IIRA 5HNIX 3CCNA 4BJJA 3R8LA 4IZYA 4NJDA 2HIWA 3COMA 3AGLA 3MI9A 4PDYA 3RCDA 3VQUA 5M06A 2AUHA 2F9GA 5I9VA 4QEBA 1CTPE 2OF4A 5HE3A 3DT1A 5KHXA 3DOGA 1H26A 2WMQA 2CMWA 4XG4A 4F99A 3VN9A 4NH1A 5KMKA 2VO0A 4TRLA 4KSQA 5EDRA 1T46A 1UNLA 2QU5A 3FY0A 3ZEPA 3IW8A 2GCDA 2WAJA 3PSDA 4PTEA 4E6CA 4U3YA 4YSJA 2W96B 5E8UA 1BMKA 2C3JA 2O64A 2WTCA 2WIHA 4G3CA 4G3DA 5E8XA 3RPSA 3ZUTA 3R1YA 4AUAA 2WMBA 3VW6A 4BCPA 3W8QA 2W1IA 1PHKA 1H28A 2WTKC 2Z7LA 3TCPA 3S00A 3OCBA 5L2SA 3UQCA 4XRJA 3JR1A 2V7AA 4QP6A 4TPTA 4ASEA 3AG9A 4NM7A 4E4MA 2HXQA 5J8IA 1J1CA 4O6LA 3UQFA 5CU6A 4C38A 4IMYA 3IOPA 4IX5A 2CNVA 4WIHA 4AA0A 4RBLA 5ICPA 3CGFA 2FYSA 3SRVA 4NJ3A 2YAAA 4L46A 3RBWA 4IJ9A 4F9CA 2C6TA 3HAVA 3VUTA 4U97A 5GJFA 2A1AB 3V5WA 1NVRA 2PE0A 4FTNA 1FQ1B 3FY2A 4Y72A 4AW5A 3VBYA 2I40A 5FP6A 3I0OA 4DA5A 3R7EA 1YDRE 1FVRA 1XWSA 1YI3A 5KKRC 3LFSA 3PXRA 5FEEA 5JFXA 5FRIA 4BY9E 2Y9QA 4AE6A 4OBQA 5HLNA 1XH7A 5HICA 5DHJA 5IQBA 4AN3A 3ZSIA 1UWJA 1X8BA 5FD2A 4I22A 2XKDA 4O22A 4D2SA 1YXTA 4YHJA 3FQHA 4FTMA 1ERKA 4E6QA 4TW9A 4CFWA 4GVAA 1AD5A 2BHEA 3KGAA 3PY1A 3QGYA 4CV8A 4KB8A 3IDPA 4BCOA 3T3VA 3SG9A 1E9HA 4XNEA 3ZO4A 1MQ4A 2H6DA 5F94A 3QTZA 1DI9A 1M14A 4E7WA 4CGAA 4USDA 3LFEA 4BBFA 3DBEA 3LOKA 3NUXA 2BZHB 4EJNA 3OP5A 3OTVA 4FVQA 4MWIA 3OXZA 1K3AA 4K2RA 4AXDA 3Q9XA 4FYOA 5KNJA 2IJMA 4UYNA 4BBMA 2XARA 5M07A 2XNOA 5DG5A 4BC6A 2VO3A 3LFQA 2W4KA 3HGKA 2JKQA 4FRFA 2R3IA 1U4DA 5HG5A 2PZIA 5AV0A 3GUBA 4IM0A 4AZSA 5LMKC 4EH6A 4PPBA 2R3FA 5EDQA 2X8EA 3U6HA 2XCKA 4EL9A 3E3BX 5FBNC 5EQEA 3FL4A 4XV9A 3EQPA 4G3FA 4M15A 4C4FA 1NXKA 4F09A 3MPMA 4V05A 4D5HA 2UZVA 3L9LA 1ZZLA 2CGWA 4L00A 4LQMA 3AT3A 4W8DA 3RK7A 4ARKA 4FV0A 3NDMA 4IX3A 4D58A 2OI4X 2R3OA 3FSFA 3H10A 1WBWA 3CY3A 3D5WA 5EYDA 3ZFYA 5IH4A 3I60A 3NNUA 4JQEA 3W2RA 5M08A 4FL1A 5JGDA 5EM7A 2JDOA 2OIBA 3QRIA 4F6SA 5M4CA 2GQSA 2X39A 4MHAA 2J4ZA 2YLEA 4EC9A 2YISA 3DJ7A 4ZZMA 3FHRA 4RVLA 5A9UA 4FG8A 3BEGA 5DOSA 3V8TA 4FE2A 3BHVA 4ZSLA 5AP7A 3JY9A 3NW7A 3R0TA 3MJ2A 3ERKA 4IJPA 5G1XA 3ORLA 5JGBA 3TZ7A 4ZEGA 4B7TA 1KE8A 5TT7A 1OGYA 3QCXA 4DHJA 4CZYB 2FO0A 4BDDA 4H05A 1QPCA 3DS6A 3HKOA 3KMWA 3UGCA 2V55A 3W2QA 3TJCA 3H4JA 4OR5A 4EUUA 1Z5MA 3AKJA 2GS7A 2GU8A 4TYEA 2ZDUA 1FOTA 1BL6A 4YPSA 5BMMA 2W5BA 1PXIA 2YABA 2OU7A 2V7OA 3HV7A 4JAJA 4M68A 3PFQA 4WG5A 5AAGA 3R00A 4DEAA 5HQ0A 4XG9A 3TZ8A 2RF9A 5E1SA 5JFVA 4PDPA 2PSQA 3O7LB 5T6KA 2BHHA 3F5UA 4S32A 4ASXA 1YHWA 4UALA 3KU2A 5GZ9A 4KS7A 4ZIMA 3O50A 4YP8A 5HESA 2NYAA 3PXZA 4I4EA 4NSTA 1M2QA 4KBCA 4Y85A 3R8ZA 2UVYA 4FSTA 5KZ0A 3R63A 4QTDA 3HA8A 2CCHA 2YAKA 4DFYA 3V8SA 3SDJA 3V01A 2GQRA 5J9LA 3QQKA 2R3JA 5LJJA 3V6SA 2HXLA 5IQEA 4P4CA 5CVGA 3BI6A 4KA3A 3EQDA 4DDIA 1QPEA 4ZS4A 3TIYA 4YJPA 1GY3A 2RG6A 4A4XA 4XOZA 1H0VA 1PXNA 4G31A 5L2TA 4O1PA 2ZM1A 2J6MA 4BL1A 2I7QA 2PZ5A 4FTLA 3LXLA 4GIIA 5D41A 5HO8A 5HE2A 4DCEA 3P79A 3N4UA 4KNBA 4O91A 1P2AA 1JKLA 4FZ6A 5AM7A 4R1YA 4OTGA 3NEWA 3AT4A 4FA2A 4ANOA 2FA2A 5HTIA 2R0UA 1CM8A 1MRYA 3VUHA 5AIKA 4CQGA 4BIEA 5C9CA 5AJQA 4W4WA 4A9UA 3POZA 4E6AA 4I93A 5BVOA 5HG8A 3N4VA 3MA3A 2R7IA 4FV3A 2R3MA 1URCA 4DG2E 4GS6A 3NCGA 5DIAA 2WZJA 5EOBA 4U40A 3SA0A 5CQUA 3GU5A 5HEZA 3V04A 4EQMA 2VRXA 2ZB1A 5D12A 4CTCA 3CJGA 1P14A 4AOJA 5FTGA 5JSMA 2YWPA 3ORKA 5FDPA 3WZJA 3GNIB 3D14A 3ZXZA 3Q4UA 2A4LA 3MSSA 4NW5A 3B8RA 1TQPA 3OCSA 5AA8A 4I3ZA 3CQEA 2WEVA 3V5PA 1J3HA 1WBNA 3PIYA 2OJ9A 2R0IA 4FKVA 3F66A 4XP0A 5I9UA 3VS7A 4F1MA 4O7TA 5ETFA 5L8LA 5EHLA 2OIQA 4PMSA 3T9TA 4LV5A 5DBXA 1I44A 4UMRA 4D1XA 3C4ZA 1GJOA 5FXQA 3BGPA 3TV4A 4AAAA 4EBVA 2QOIA 5EFQA 2IW8A 4D1ZA 2OKRA 4J52A 4FIIA 2JC6A 2UW0A 4MBJA 3ROCA 2OXXA 3H3CA 2VTRA 2YHVA 5AUTA 4F0FA 3NYVA 2CHLA 3F88A 4U79A 4MBLA 2QOCA 4ZTRA 5AV1A 2X0GA 4F70A 3L8SA 3D94A 4NL0A 2UZEA 1OI9A 2E2BA 2X4ZA 3A8XA 3EKKA 2HY0A 3NX8A 1DS5A 4M67A 4S34A 5HCZA 2CDZA 3TDVA 2PULA 5JRQA 5CU0A 3PP0A 3AD6A 5IA4A 3I6WA 3PSBA 4I6QA 2CPKE 4W8EA 4FTRA 1Q8TA 3HP2A 2R3LA 3LZBA 5FLFA 2EB2A 2J5FA 4G5PA 3ZC5A 3CQUA 5HX8A 4HVDA 5HD4A 4FSNA 3EN5A 3U51A 1GZOA 3F5XA 3DDQA 4WHZA 2DS1A 5CZHA 2VWVA 4F1OA 3TMOA 3QRUA 1WBVA 3RI1A 3A60A 3RPOA 3WBLA 4EH5A 4AW2A 1I09A 4YLKA 1H8FA 4JXFA 4MK0A 2QOBA 2BFYA 3G90X 3TNPC 3SG8A 3QD2B 2LGCA 2GFCA 3FEGA 1ZYJA 3BWJA 4FKGA 4P5ZA 3UO5A 4RJ4A 3KRRA 5BVEA 4C4HA 4HNFA 5J5SA 4QTAA 1H08A 4MXYA 4FIFA 3PRFA 3CTQA 3P23A 1PXPA 1DAYA 1H00A 5AX3A 2PVHA 4M0ZA 3PXYA 5CEKA 1UU7A 2JBOA 4TWOA 4GFMA 4AN9A 4PP7A 3EQIA 4Q9SA 4NM0A 2Y4IB 3RWQA 3UP2A 4PP9A 3S2PA 2P2IA 3SVVA 1OIQA 2BAKA 2GS6A 4ZMEA 1SNUA 5IMEA 3FXWA 1K9AA 2SRCA 4M69B 4QMQA 4HCTA 5KMLA 4DT9A 1UWHA 4WUNA 3DJ6A 3FMHA 2P55A 4G5JA 2YM7A 4D4VA 5K5XA 4CT2A 1BLXA 2WU7A 3DZOA 4FYNA 4B99A 3R1SA 4D9UA 3K3IA 1JPAA 2IPXA 4EOKA 2NP8A 3FLNC 3OT3A 5AWMA 2ITYA 4RX8A 3MIAA 4X2NA 3OCGA 1UKIA 1R0EA 3EN9A 3UTOA 4PNKA 3W1FA 4W4YA 2W4JA 3CY2A 4UXQA 4MXAA 4DTAA 4H3PA 2I0VA 4BCNA 2QR8A 3DBFA 2HCKA 4JR3A 4EWQA 2QOFA 4ENXA 5IMXA 4FT9A 2R3PA 4GT3A 4DBNA 1Q99A 4KRDA 4O7VA 4YTHA 1KOBA 2B9FA 3T9IA 1M17A 4QQCA 4RWLA 3UG2A 3WE4A 4I23A 3F3ZA 4I6HA 4O6EA 2JDRA 5A6NA 3HEGA 4MD7E 5BYZA 4EOLA 4AQKA 1J7IA 3UNZA 5BX0A 4E1ZA 4YJOA 3QYWA 4A9SA 5IF1A 4O0YA 4LV7A 3EKNA 3ROYA 5FGKA 4I4FA 5E9EA 5EQPA 2VTIA 5BNJA 5M57A 2RGPA 4DAWA 4YJSA 2UZTA 3PJ3A 2BAQA 4M97A 4O0WA 4BYIA 4E73A 4IAAA 3F7WA 4RSSA 4EH9A 4IVBA 4C59A 5EYKA 5LXMA 2XK8A 1UA2A 4MH7A 4K11A 3WIGA 1JBPE 3R7IA 1OIUA 3PPJA 1YDTE 5A4QA 2ZVAA 2O63A 3VS1A 5AR7A 5AUXA 4CD0A 5FBOA 4DEGA 4JOAA 2Q0BA 2BRMA 4O21A 3OMVA 4UWYA 2JLDA 2PY3A 4FZAB 4RJ6A 3UPXA 1WAKA 5HE0A 4AXAA 1JKTA 3UZRA 4O4FA 3R8UA 3MDYA 4M69A 3KF7A 3KULB 2WMUA 4BTFA 4NZWB 4OAUC 2OBJA 4CMUA 1OZ1A 4F0IA 2PMLX 4QMSA 4AT3A 4WNKA 4QMUA 2KULA 3D15A 3OUNB 3P08A 4OAVB 4AE9A 2WPAA 2HYYA 2QG5A 5FM2A 4DH3A 3F7ZA 3CD3A 3PLSA 2WKMA 1YVJA 2W5HA 5CSHA 3F3VA 4A4OA 2B9JA 2FVDA 2JBPA 1YXXA 2WGJA 1YKRA 4D55A 4IZ7A 4PF4A 3D9VA 3Q9WA 4XRLA 4GT4A 4JS8A 4QP4A 4RWJA 4YZDA 3LXKA 4R3RA 4E4NA 1FINA 4FEQA 3VJNA 3LVPA 3A2CA 2G9XA 2ETKA 4O96A 5HCXA 1ATPE 1Q3WA 4G3GA 3C0HA 1NT2A 4FK3A 2PMIA 5IQGA 3EYGA 4RJ7A 4KSPA 4F63A 4I21A 2JAVA 4XH6A 3AMAA 1XH5A 2X7FA 2HW7A 5HVYA 3HNGA 3GXLA 2YM6A 4GK3A 3UVQA 3ZUUA 4CSVA 3FZPA 3PJCA 3BLAA 4DF3A 2GFSA 3Q04A 3ZM4A 4A07A 2CJMA 1XBCA 2ITVA 1KOAA 4ITHA 5I9WA 1R1WA 4KKHA 5ANGA 2BCJA 3VC4A 5L6OA 2CLQA 1DI8A 4QP3A 4CMOA 2PVFA 3TKHA 1YWNA 2OJIA 4S33A 4DGMA 1ND4A 3I79A 4XG7A 3BQCA 4D28A 5AUVA 2OWBA 4PDOA 2WU6A 2QO9A 3BHUA 1BI8A 3KRWA 3WZKA 1OIYA 1XBAA 1W98A 4FTOA 3LQ3A 3G51A 4HOKA 1VYWA 3TZ9A 2XS0A 4W4XA 4O86A 5A4CA 2IF8A 3PP1A 4WO5A 2BRBA 3KULA 5FUTA 3RAKA 5AAEA 4MKCA 4CYIA 2GTNA 3BBTB 3KC3A 3A8WA 2WQBA 2X0OA 4NFNA 3MVMA 2J0MB 2XVDA 5DR2A 4KUJA 3BV2A 3FQEA 2Y4IC 5BYLA 1APME 3PVWA 4YJNA 4IVCA 1OGUA 4BHNA 2XJ0A 3IG7A 3ZSHA 4LRKA 3R22A 4TYIA 3AD4A 1OUYA 4YC6A 4JQ7A 4D2WA 5BUJA 2QOQA 2OJJA 5AM6A 2R3RA 4Q5HA 4FT3A 1IEPA 2IW9A 4AZWA 4FGRA 3P9JA 4FVPA 4R5YA 2C6KA 4LL5A 4USEA 5BVFA 2BILB 2YZAA 3FI4A 3GCSA 3GI3A 3HMIA 3ULZA 4RRVA 3E87A 3DGKA 4BDAA 1NW1A 4MXZA 1REKA 2JKOA 1URWA 4PL3A 3HV4A 4I0RA 5GJGA 3LJ2A 3MH3A 4GG5A 3TDWA 2UW3A 4FZDB 2QKWB 2QG7A 3K3JA 3O71A 4WKQA 3MB6A 4DFXE 5HNBA 3B8QA 3QKKA 2F7EE 2I0HA 5CXZA 3F2RA 1XR1A 4FT7A 1L8TA 5L8JA 1G8KA 2OH4A 2IN6A 4IDTA 3BU3A 5EM6A 4C36A 4DBXA 3DDPA 2ITXA 5LVLA 2C1BA 4AOTA 4EHEA 3DQXA 3KN6A 5LWMA 5IEYA 4DG3E 4AGWA 3A62A 4EEVA 4FSQA 5CX9A 2DWBA 3QQUA 1REJA 3G2FA 2WD1A 3EN4A 4GVJA 4EI4A 2XAMA 3AKKA 3E5AA 3VBXA 4FV9A 2VO6A 2PL0A 4ZMFA 3PG3A 4FSMA 1WVXA 3HMOA 2G2HA 2GSFA 5HLPA 3CIKA 3QF9A 4FKRA 4FKUA 1FMOE 3D2KA 4A9RA 4LMUA 5CI7A 4AZVA 4FTQA 3QHWA 4GKIA 3LFBA 5JT2A 2JFMA 3QA8A 1XH8A 2X0PA 3AOXA 5CU4A 4LGDA 3LCKA 4FL2A 3RMFA 3R9RA 3RTPA 2ONLA 1A06A 4TYGA 3FHIA 3TI1A 1PXLA 4NYEA 2BRHA 2UZWE 4JR7A 2XRWA 4JIAA 4J99A 3BGZA 3GENA 5CEQA 5DMZA 3TUCA 3UOKA 5IG1A 3DLSA 3VO3A 4EOSA 3IW4A 2XNBA 3KXHA 3JXWA 5DGZA 3QQFA 2WEIA 4XEYA 3F2AA 2EU9A 2GMXA 2B52A 5CF5A 1BYGA 2XALA 2PVLA 4UWBA 2WFYA 4CFMA 4I92A 2BALA 5M4FA 2W9ZB 3CEKA 4ZZNA 3R71A 2OF2A 1OITA 4MD8E 5CVFA 1NVQA 5T68A 3TNWA 4PMMA 3HV3A 4ZTMA 3MVLA 5HI2A 1PMEA 2QHMA 4IQ6A 4C37A 1J91A 4KABA 4AXFA 2NO3A 3WZDA 3R8VA 3FZSA 1VJYA 2VWIA 3KXZA 3T3UA 5CF6A 2YCSA 4L9IA 3M1SA 4L01A 4RG0A 1OVEA 4DFBA 4QO9A 3RK5A 4ZJVA 2VWUA 4QT1A 1PXOA 2VTJA 2W9FB 3LFAA 4IAZA 4ERWA 5I5ZA 2XIZA 4YZ9A 3QUEA 4LGGA 4RT7A 4XBRA 3BHHA 4IFCA 4ONAA 3FYKX 4FKOA 3UE4A 4ALWA 5BV3A 2P2HA 3D5XA 4O0SA 3W16A 4Q9ZA 1JLUE 2XKEA 3CJFA 4EORA 3NCZA 1YOJA 4RWKA 3BQRA 3S95A 5HBHA 4EK8A 4FIGA 3GCPA 2PWLA 2VGOA 3NYOA 5C8NA 4P7EA 4LRMA 2R3QA 3ZH8A 4ZTHA 3G9LX 3FMDA 2WQOA 4BDJA 4ZY6A 4XV3A 3BBWA 2WTWA 1JWHA 3TV6A 2W5AA 1OL5A 1OL6A 3LFCA 3Q60A 5AR5A 5JZNA 2R3KA 4U43A 3GBZA 3RVGA 4CXAA 1FPUA 3VQHA 1PXKA 3QD4A 5M53A 2OLCA 4Y5QA 3LMIA 4D2VA 4O7RA 3SQQA 2XIXA 4BIDA 4Z7GA 5CWZA 5M44A 4J7BA 1O6LA 2J0KA 1U5RA 4A4LA 5TF9A 4FT5A 3RJCA 4W9XA 3IDCA 2J0LA 4KIOA 2YERA 4BCHA 3DZQA 4RA5A 4EKLA 3WI6A 2XNGA 2C5OA 1ZYCA 3ZZWA 4O81A 2J51A 3F6XA 3MTLA 3BX5A 4AA4A 3IW7A 4FEWA 4N70A 4ANMA 2ONLC 4EHVA 2VNYA 2W1HA 5L2IA 4PTCA 3OZ6A 3PJ2A 2YM4A 3PUFC 3Q5ZA 3UVPA 3BLRA 1LEZA 2GQGA 2NRYA 2W05A 3VUGA 3BL9A 4YZMA 2OICA 2C5YA 4PY1A 3DAJA 5KBQA 2BIYA 5J9YA 1XH6A 2HZ0A 4H3BA 3PIXA 4EHZA 1IG1A 3E64A 4PUZA 3PY3A 3LPBA 4XP2A 4BWPA 4E20A 4QMWA 3NW5A 3L9MA 5KCVA 1XMLA 3GOPA 3DBDA 2B4SB 5L6WL 5EKNA 4D4RA 2ESMA 5E7RA 4AA5A 1Q41A 1WFCA 3WF9A 3KRXA 5CF8A 4FEUA 3QXOA 4O7SA 3V5LA 3BU5A 4L44A 3UBDA 1YDSE 3V5TA 3E7VA 3B2WA 3QGWA 4ANSA 3GC8A 3LHJA 3ODZX 4ANLA 2PHKA 4MEDA 5HO6A 3KXXA 5HX6A 5J79A 5E8SA 3MY0A 4UWCA 4EQCA 4QMNA 5CEMA 3R83A 4CFXA 2XEYA 3MPAA 5LVPA 4C34A 3O8UA 3O5AA 4NM5A 3NS9A 4C8BA 4HGLA 2WNTA 2Y0AA 5LCKA 5TO8A 2BTSA 3DU8A 4ZOGA 4R3PA 5M4UA 1CKJA 3R9OA 2B1PA 3QWKA 3C0IA 4BCJA 1YW2A 4JLCA 3VONA 3Q4ZA 4EK3A 1KWPA 1AGWA 4FKQA 3DA6A 4GSBA 4IAKA 5HU3A 4U9AA 2UVXA 4G6LA 1OKZA 1ZOHA 2VWZA 3UPZA 2WXVA 4O7LA 4DDGA 4AG8A 5JGAA 3BE9A 4BDKA 1OB3A 4MAOA 4WSQA 3ZRLA 3HMNA 4PRJA 4OTQA 3ORMA 3PY0A 4K18A 3ZCLA 2J90A 4KIPA