3NNVA

Crystal structure of p38 alpha in complex with dp437
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
348
structure length
348
Chain Sequence
b'RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Switch control pocket inhibitors of p38-MAP kinase. Durable type II inhibitors that do not require binding into the canonical ATP hinge region
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 111
structure length 348
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3nnvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3nnvA01
2EB3A 3CC6A 3B2WA 2ZV2A 1GZNA 1KE8A 4C4IA 3C13A 4MVFA 4MAOA 5LQFA 4O84A 3NVKI 2X4FA 2F2CB 3KK8A 4ZXTA 3S4QA 4BDKA 2WD1A 3U6HA 2JKQA 1WCCA 2VRXA 3ALOA 4LM5A 5LMKC 5AFVA 3DFAA 1FQ1B 4IJPA 3BHHA 5CF4A 5I9XA 1VJYA 3RP9A 5DH3A 2OIQA 1UU8A 3KRWA 5C01A 3D15A 4EKKA 2VTNA 3HV3A 5JRQA 3LMIA 2GS2A 4M84A 3RPVA 5K9IA 3C50A 3EB0A 4ACDA 5B2LA 4U40A 3SA0A 4FEQA 1Q8WA 1IEPA 2C68A 2PZRA 4FZFB 3F2AA 3ORPA 3EQPA 2GNIA 5IUIA 3GUBA 3BGPA 1OIYA 4H36A 2X2MA 4KWPA 4WRSA 3FLSA 2XJ2A 5C03A 3LJ2A 3IK3A 2NNWB 5IMEA 4UMPA 1Y57A 4DTAA 3KN6A 4WIHA 1TKIA 2GQRA 5IH5A 5HE1A 2JGZA 4QPAA 3ZYAA 5HVJA 4PPCA 5M44A 5CT0A 3V8TA 4QYGA 2UW3A 3L8PA 3F3UA 4JAIA 3MI9A 4NU1A 5DT4A 5DMZA 3EQGA 3PVBA 5CEPA 2CN5A 3GU8A 3N9XA 4EK8A 4BCOA 2O65A 3AGLA 1WZYA 1XH7A 3VW6A 2V62A 2W99B 3TNWA 4BVUA 2FO0A 3RWPA 4OGRA 1U54A 4O2PA 2B1PA 3Q53A 4LV8A 2B0QA 4IB1A 1PF8A 3PPZA 4RMZA 1U5QA 3BKBA 3GVUA 5IPJA 3WZDA 4ZY4A 1RQQA 1W83A 2VU3A 3KN5A 5I9UA 1DI9A 2CNQA 4L68A 4O82A 2PWLA 4BDGA 3QZHA 3VJNA 4QP2A 3LW0A 1JKKA 2G2FA 3QCQA 3AD4A 4UXLA 3TUDA 1OVEA 3V5QA 4FNXA 4B8MA 3R8PA 2R3HA 3ZTXA 2VNWA 4G3DA 2OG8A 4ANLA 1UVRA 2WMWA 4F7LA 2AC3A 4PDOA 4M8TA 1RE8A 5HTIA 3LZBA 5AUWA 5HG8A 3MJ2A 2GFCA 3CE3A 3CTQA 3DZOA 3FY2A 4FSWA 5CSVA 4AT5A 4X2JA 3PPJA 5AEPA 3QBNA 3RAWA 4BCFA 4F6UA 5EQEA 4H3QA 4HGTA 2JBOA 4MQ1A 4BZOA 3NYNA 4ITIA 4CV9A 3VS6A 4F6WA 3CGFA 5DA3A 2JEDA 2YLFA 5E8XA 3TL8A 4F1MA 1UWHA 2BILB 2Y8OA 5AUVA 3FLYA 1WAKA 1F5QA 3HMOA 3QKLA 3Q32A 3UG2A 2P0CA 3Q9ZA 4GUBA 2XIXA 3W2PA 5AA9A 4O7SA 5KO1A 3ORZA 3KK9A 3OF0A 4I5HA 5BMMA 2YCQA 4R1YA 2ITYA 3MY5A 2OH0E 4M0ZA 2QO2A 2XM8A 4HOKA 4PV0A 2CKEA 3V51A 4DH5A 2B7AA 4R3CA 3VUTA 3ZM4A 4E5BA 1JOWB 4U44A 3RAHA 5DGZA 1ZMVA 3OC1A 2GS7A 4O6EA 2C5YA 3DKGA 3HMNA 4KBAA 4MXAA 3D14A 2B4SB 3VBYA 3FPMA 3VBWA 4RVKA 2X6DA 4LUEA 4CFUA 3BWJA 3ITZA 5CI7A 1YOLA 4KIOA 4CQGA 4AGWA 2IW9A 3QX4A 3ATTA 2CNVA 2BZIB 4QMNA 4U8ZA 2R0IA 2XK8A 3ORMA 2NO3A 3GU7A 3UMXA 4ZJVA 3E5AA 2RFDA 4ZSEA 5BVNA 5AV3A 3DDQA 5J87A 2QI8A 1GIIA 3G0FA 4GU9A 3DTCA 2PE2A 4KA3A 3R7UA 4FT0A 3VW8A 3T8OA 2PVHA 4RFMA 4RX7A 3A61A 3A2CA 4OBQA 3NYXA 2XH5A 4FEXA 4QRCA 4D55A 4LI5A 3MVLA 1PXPA 4O0SA 4HCTA 3OTUA 2B55A 3KF4A 1YDRE 3CR0A 2XB7A 1BL7A 4ALVA 4C33A 4G3GA 4I92A 5AX3A 3G90X 3FMNA 4GV1A 3U9NA 5AA8A 3LAUA 4FNYA 4UV0A 3D2IA 2CN8A 2J0MB 4IM2A 5FBNC 4I24A 2CCHA 4RWJA 5LXMA 2OKRA 2OW3A 5CANA 2SRCA 1FMOE 1ZRZA 4LMUA 4PTEA 4BDHA 2XK6A 2QHMA 2OICA 3FUPA 4G17A 2LGCA 2W05A 2I0VA 2XNEA 3QTUA 3U4UA 4C3FA 4MKCA 4RLLA 3JXWA 5AUYA 4WA9A 5CF5A 4ONAA 5IH4A 1JSUA 4NT4A 4QT1A 4D28A 2A0CX 3MV5A 4ZLZA 2FSOX 3LMGA 2BRBA 3DPKA 2HOGA 1H1SA 5EI6A 4O0XA 4JL9A 5HNIX 1IA9A 3FMLA 3CQEA 2JDVA 1CKJA 5T6KA 2DUVA 2RG5A 4FV3A 2IWIA 2IZTA 4DFYA 3NAYA 1NW1A 4RZVA 3FI2A 3VUHA 4CG8A 4IWOA 3W10A 4MNEA 4RA4A 4AT4A 2ZV7A 4TT7A 3LJ0A 4D1XA 5JGAA 3C5IA 3W2RA 4QQ5A 4LV5A 2XYNA 2VO3A 3QWJA 5HU3A 1H0WA 2ESMA 3K54A 5ETIA 4TNBA 5HCZA 2ITQA 4IMYA 4ITJA 4YLKA 4YLJA 2XRWA 1FPUA 4R7IA 5FP5A 4XG4A 5GHVA 4BI0A 5IDPA 2WEIA 3QQKA 3UZTA 4XYFA 3TI1A 5EM6A 3M2WA 4V0GB 4EZ5A 3QUPA 4BBFA 2WIPA 2Z2WA 3LQ3A 4GG5A 3IDCA 3Q96A 3IS5A 4QYHA 4K6ZA 3JVRA 3P9JA 4FKUA 4AGDA 2XK9A 5CQWA 4GVAA 5TE0A 3TV7A 4M67A 3C4EA 2XNBA 4J97A 4JIAA 5IKWA 1U46A 4BTJA 3II5A 4JG7A 3G15A 4A9UA 2A4LA 4ZZMA 4CTBA 4ZMEA 3ALNA 4GK3A 4DHFA 4YZCA 4P2KA 2HZ0A 3BELA 3OTVA 4DEGA 4NJDA 4PL5A 4FTTA 3FC2A 5ACBC 3DBFA 2ITVA 2O0UA 4IDVA 3TWJA 5GNKA 2XBJA 4QMMA 3F6XA 3QZIA 5CAPA 4LQMA 1NA7A 3R1SA 3CJGA 4FVPA 3I0OA 3MIYA 3OMVA 4J71A 5HO6A 3VRYA 4CMTA 4F9YA 5A4TA 3QQUA 3MFSA 3ZO3A 3LFQA 2XKEA 3KULA 3QD3A 4CFXA 1XH5A 3CQUA 2R3MA 3EN5A 4X2KA 4F99A 4DN5A 3GU4A 1J3HA 2H96A 4JR7A 3R7IA 2WFYA 4ALWA 3ZEWA 4DFLA 3C9WA 3P0MA 2GS6A 2H8HA 4YPDA 5CU6A 5FTQA 3VF8A 4EOMA 4APCA 3PY0A 3UDBA 4C3RA 3QXOA 3EHAA 3P7CA 4WHZA 4IX4A 3SD0A 1LEZA 2ITUA 3VQUA 4IFGA 3AC8A 4QO9A 3JR1A 2YIWA 4DEAA 4O7LA 2BUJA 4WKQA 2J5FA 4EBVA 4EH4A 2HZNA 3DK3A 3F3VA 4WBOA 2PSQA 4NZWB 3WBLA 4YNOA 5EI8A 2FA2A 3LXKA 3GT8A 3HEGA 3VWAA 3NUAA 5IA5A 4BN1A 3R83A 4NM7A 4YUQA 5JEBA 4LL0A 4BCIA 2RG6A 4YHFA 1ZMUA 5LMAA 4EC9A 4JXFA 1PXKA 3E88A 3QTQA 1B39A 4O6LA 4A4XA 4QQTA 2J7TA 1UU7A 4BB4A 3TKUA 3PIYA 4AGCA 3CXWA 4EWHA 2W4OA 3NPCA 4RVLA 5IH6A 4GRBA 2JDTA 3BBWA 5BUJA 2F4JA 4C34A 4NEUA 2OSCA 3C4CA 4DITA 3PA3A 2R3QA 5L2QA 4BIEA 3FZPA 5DR9A 4QMPA 3BYMA 3ENMA 1WBTA 2YDJA 2VO0A 3FZTA 3SX9A 3UPXA 4CZUA 4YZ9A 4Y72A 4EQMA 3U51A 2Y6MA 4C59A 4IWDA 2W06A 4U45A 3DOGA 5JT2A 1R78A 3F9NA 4IFCA 3VBQA 4AAAA 4AU8A 4G6LA 4JQ7A 4AZVA 4DBNA 4AQCA 4BHNA 4C3PA 3LE6A 4M15A 3ZHPC 2XIYA 4DCEA 4MX9A 3FEGA 1O6KA 3GBZA 3UOHA 2YIXA 4MTAA 4II5A 5FGKA 2R64A 4OT6A 5EOBA 4HVSA 3COIA 3CD8A 2GNJA 3GCQA 4PX6A 3WOWA 5AUUA 2DS1A 2C1AA 1Q24A 3K5VA 3R7GA 2VWWA 3RPSA 5KUPA 3LLAA 3OEFX 4I21A 4Y83A 2CLXA 3TUCA 2BRHA 1YHVA 3OY3A 4F65A 3WZJA 4FIGA 3UOJA 2HENA 4QQCA 3DAKA 5EI2A 4DFNA 2H9VA 3OXIA 3NZ0A 3PXFA 4UWYA 3V8WA 4JR3A 4MBIA 4RWLA 4L44A 3QRIA 4PDYA 2ITTA 4G1WA 5M56A 3MH3A 5AM6A 3RM7A 5HD7A 4C8BA 5FXSA 4WNPA 2UW4A 2XZSA 3JYAA 4YR8A 5F9EA 4WNOA 4L01A 4DCAA 4CMUA 2GU8A 4C37A 2V7OA 3PSBA 4CCUA 3FMHA 2ETMA 3ORKA 3QTZA 4BDJA 5IQFA 3PJ2A 5HBJA 4RIYB 2YCRA 5D10A 4FIIA 5AX9A 4RA5A 2YERA 2GNGA 4DGLC 4GCJA 2E9UA 3FMMA 4EKLA 4FKSA 3ZFMA 3D5WA 4BCNA 4N6ZA 3B2TA 1HCKA 4OTDA 4A9SA 4LMNA 2UW8A 5EW3A 4EH2A 3C4FA 4WOVA 4OTWA 1KV2A 2BRGA 2YM6A 3BV2A 5I9WA 2VTHA 3ZRLA 4PPAA 4KKHA 2C6MA 4A9YA 3BBTB 4FV6A 4CZYB 2P33A 3H3CA 3OD6X 3NGAA 4FYOA 5A3XA 3ZM9A 5AADA 3QQLA 5AWMA 5E4HA 4TWNA 5AAEA 4C62A 4JBVA 2QO9A 2IG7A 3DY7A 3FMEA 4TYHB 2GHGA 2W1DA 5E90A 3QFVA 1XH8A 1VYWA 3ZXTA 4G6NA 1YQJA 4YHTA 5TT7A 5BVDA 2ZVAA 1PHKA 2C6EA 2HWPA 4JNWA 5HCYA 2WZJA 2GDOA 3EN4A 3JUHA 5ANEA 3VS5A 2XNNA 4O22A 4I0SA 4ZTRA 2WEVA 3FZSA 5AP1A 2WMVA 3DNEA 4GVJA 5FG8A 3O51A 2FSMX 3FQHA 5FP6A 2UVXA 3RMFA 2UZDA 2P4IA 1M17A 3TDVA 4AOTA 1G8SA 1I09A 3ORXA 4IAIA 2GTNA 3ELJA 4B99A 3V8SA 4IAAA 1JNKA 1Z57A 2O64A 3ZS5A 4EOPA 4XCUA 4R5SA 3OW4A 1TQIA 5HE3A 4C4HA 2QC6A 2WU6A 3L8VA 4L43A 3H30A 4V04A 4NCTA 3MFTA 5HIBA 2WQBA 3IW5A 2E9NA 1CDKA 1PXLA 4Y5HA 2W1GA 2JKOA 4IAFA 4L52A 3WF7A 2ZV9A 4YGAA 3GOKA 4EOIA 5A4CA 5AIKA 4PP9A 3KXNA 3GFWA 3OOGA 3R22A 5CYIA 5AM7A 3SQQA 3PXKA 3KCFA 4AOIA 3LQ5A 5BMSA 2WNTA 4D58A 2WTJA 5DG5A 2VTJA 3I6UA 1UU9A 3KA0A 2PVKA 5M53A 5IA0A 3A60A 2BR1A 3K5UA 4CLJA 1M52A 2JBPA 4A7CA 3WZEA 3HL7A 2BPMA 4FA2A 4PPBA 4AACA 5AP4A 4XHKB 1BI8A 4F9AA 3I7CA 1JSVA 4WBBB 1H08A 4O91A 2R3NA 3FXWA 4MWHA 4OT5A 4RGJA 1OIRA 2YM7A 1BMKA 4FTJA 4RWIA 3P08A 4D2VA 5BQ0A 3HAMA 1JAMA 1OECA 3Q5ZA 3FHRA 4X3FA 2QG7A 5ANGA 5AV0A 4QNAA 5LOHA 4BYIA 5J79A 4FTLA 4M69A 1S9IA 1K3AA 4PWNA 5DBXA 3EOCA 3FJQE 3RPOA 2IPXA 3V6RA 5KCVA 4QP9A 3FMJA 4JOAA 4BFMA 4AZWA 1YXVA 3D9VA 4BKJA 3MESA 1H1QA 2JC6A 2H34A 4RT7A 4MCVA 4XG3A 4CLIA 2PYWA 1WVYA 4L00A 5CEIA 5K4JA 5CZIA 4WUAA 3MDYA 4FEWA 5CNOA 3PA5A 2PUUA 4TPTA 5E92A 4CD0A 2WO6A 2ZV8A 1Y8YA 4I6QA 2RFEA 5E7RA 2RIOA 5AJQA 5AR7A 3KB7A 2HW7A 3BRBA 4RJ3A 4FTNA 3QC9A 5DN3A 3PXRA 4CTCA 4YMJA 2AC5A 4GS6A 2ERKA 2VWYA 4A4LA 3H0ZA 4XG8A 4I94A 3TNQB 4TXCA 3SXFA 3S2PA 4RC4A 4W4YA 3UNKA 4KRDA 1W7HA 4KSPA 4N4SA 4WNMA 4AZTA 4FF8A 3G33A 4ENXA 2YAKA 1OUYA 2QR7A 3Q4TA 4FVQA 2WTWA 5BPYA 3R1NA 2X0GA 4XG9A 3SRVB 4YP8A 2CKOA 4DFBA 3FQEA 1ZYSA 4LRMA 4AA0A 4QP3A 3BGQA 4BWKA 3F5UA 1WBOA 4HCUA 3OXTA 3AXWA 4O7ZA 1KE6A 4ZMFA 4N70A 3UO5A 4L67A 3MVHA 3TN8A 4DH8A 2BVAA 4HVGA 4F6SA 5EQPA 2PZIA 3DB6A 3PVUA 2FH9A 1FMKA 5EDRA 2I6LA 2IW6A 4FG7A 4X2FA 4YO4A 5FM3A 1UNGA 3OUNB 4USFA 4FICA 4AS0A 5A46A 4L3LA 4XV3A 5CU3A 4E93A 3HP2A 3HDMA 4DINA 2VO7A 4FODA 3D0EA 4XV1A 4BTKA 4XV2A 4L8MA 4LOQA 1MP8A 2WOTA 1WBSA 3QU0A 2YM5A 2OF2A 2X4ZA 4IAYA 3QUDA 4FZAB 2DYLA 2XYUA 4RLKA 2CGXA 2REIA 2B52A 3NNVA 3NX8A 4PMMA 3VS2A 2F9GA 4PL4A 1PW2A 5E8TA 3LHJA 3LFSA 2QU6A 3TZMA 4L9IA 5LCKA 3ZSIA 4QP7A 3WYYA 2YWPA 4R78A 5DFPA 3LCOA 3R2YA 2UVYA 2WTCA 1JLUE 4D2SA 3SG8A 5CEKA 3HDNA 2G01A 2Z7QA 2F2UA 3MS9A 4IB3A 1S9JA 3UP7A 1GAGA 2OO8X 3QTWA 1OL5A 3BLQA 4K1BA 5CY3A 4RZWA 1RW8A 2HZIA 3WILA 4W8EA 4JI9A 4XG7A 3HV4A 4BICA 1EH4A 3E8CA 4OTHA 3KXGA 3OT8A 2R0UA 4EUUA 3F5GA 5AR5A 4BGHA 3DCVA 1IG1A 4O38A 4O0WA 3VS4A 4R7HA 4XV9A 4BCGA 2X2KA 3C51A 4NIFA 5IA4A 4ENYA 5KHXA 5C4LA 4M66A 4W9WA 2BDWA 2GPHA 2OFVA 2WTKC 4TWPA 4F7JA 1OKWA 2WXVA 3KREA 2YJSA 3SOCA 3EZRA 4BIDA 2YZAA 4IXPA 4K0YA 5L3AA 2WU7A 3KMMA 3EFJA 4D2WA 3SW4A 4BDAA 3GCPA 3K2LA 4K33A 2Q0NA 4M0YA 3FKNA 1WFCA 3Q6UA 4P4CA 2XBAA 3DAEA 4ZJJA 4O7WA 5LJJA 1TQPA 4O0VA 4EUTA 5DLSA 3HECA 4AA4A 4S30A 4YJSA 2OGVA 4E20A 5D41A 3DK7A 3GU6A 5HZNA 3BZ3A 4ZSGA 3BE2A 4UN0C 4K11A 3WF9A 4FTIA 2V0DA 4DT9A 4OUCA 3OG7A 2JFLA 2WMAA 3R21A 3RHXA 3FWQA 2HELA 3PG1A 5CQUA 2A27A 4ASEA 4USDA 4X0MA 1WBNA 4FG9A 4IB0A 3OZ6A 3UYTA 1P4OA 3BQRA 1V0OA 3FXXA 2UW5A 1GZKA 3O8UA 3UBDA 1OIUA 2VGPA 2PMOX 4M7IA 3R30A 5CU4A 4D0WA 5KX8A 3SHEA 1Q3WA 1XR1A 3ANRA 3P78A 3QALE 5KE0A 4ACCA 2NPQA 2VWUA 1ZARA 2XEYA 3Q6WA 3VHKA 3MH1A 3U55A 2XIKA 4U3YA 1GZ8A 2WMTA 3KRXA 4XRLA 1Y8GA 1MQ4A 4Y95A 4IADA 5KMMA 3F61A 5HGIA 2R3RA 5I0BA 1CSNA 4EK5A 1OL6A 4BCQA 5HEZA 2J51A 1LR4A 1ZOGA 5CSPA 3FDNA 1DM2A 4O0YA 3RGFA 3WE4A 2HWOA 3ETAA 1OBDA 5M4UA 2CGVA 3C7QA 3P7BA 2R3IA 5CSXA 3SV0A 5CALA 4F63A 1XQZA 3VUMA 5E8ZA 4JX7A 5CU0A 5EKNA 4ACMA 3RZFA 4JAJA 1K2PA 5IQDA 3MH2A 5HVYA 3TV6A 4NFMA 4EOQA 5HD4A 4U41A 2UW9A 2WB8A 3E8NA 4UYAA 3G2FA 1SNXA 4IWQA 4Z7HA 1ZMWA 2YISA 2OJJA 4FSUA 4YO6A 4K9YA 2RFSA 2W1HA 4FSMA 4FV9A 4FZDB 5GJDA 4D4RA 3KXXA 1YWVA 3HV6A 1H26A 3NS9A 4FL2A 4IX6A 5B0XA 2V5QA 2ZOQA 2XIZA 4FG8A 4Q9SA 3HRFA 4LGGA 3ULIA 3ORTA 1NXKA 3BYSA 3FL5A 3Q5IA 2QOLA 3JY9A 4FK3A 1PXOA 3HYHA 4QMLA 4WT6A 4YZDA 2WMUA 3E8EA 4RJ8A 2W0JA 5DWRA 2ZM3A 4BBMA 2DWBA 5GZ8A 2VO6A 3R2BA 4UB7A 4WNKA 3DLSA 4JRVA 5I9YA 2HCKA 3ACJA 3NSZA 3OUKA 2Z8CA 3D5UA 3ZFXA 5CEQA 2UZOA 3EFWA 5D9HA 2P3GX 2QG5A 3DDPA 1GOLA 4IJ9A 2GNHA 4L7SA 5CU2A 5KMLA 3LFNA 4JDJA 3R9OA 3QWKA 4R5YA 4YJOA 3E7OA 4DG3E 5HQ0A 3N4VA 4O1OA 4KIPA 5LWNA 3CIKA 4H58A 5M57A 3GC8A 2VTRA 4XLVA 4KNBA 2BZJA 3HGKA 4HPTE 3W16A 3ZLYA 5BYYA 4W9XA 5FEDA 2PMLX 2YHVA 2GHMA 2C69A 5DI1A 3BEGA 4G3EA 4GK2A 2YCSA 4C4EA 3JS2A 3U87A 3Q2JA 3BLHA 4NUSA 5JRSA 3LFEA 5IA2A 4EORA 5EFQA 4E6QA 3I1AA 2B9HA 2PL0A 5HE2A 2Y4PA 3NWWA 2BTRA 4QMVA 5CF6A 4IAKA 4FKRA 4C57A 4QOXA 3P79A 4D4YA 3E3PA 3IPHA 4HZSA 2ITPA 5EKOA 3VC4A 3BHTA 3E92A 4D1SA 3FLWA 5JMSA 1YWRA 3I7BA 1OM1A 4KS7A 1KWPA 4C38A 2OZOA 3F5PA 4J53A 4UX9A 1LP4A 3F2RA 1PXIA 5I4NA 4C7TA 4ALUA 4MXYA 1YDTE 3N51A 1F3MC 3A7FA 3KVXA 4RVMA 5CXHA 5HI2A 1OBGA 1V0PA 4MD9E 4ZTSA 3NW7A 4D1ZA 4TW9A 3WF5A 2WTKB 3I5ZA 3N4UA 1IR3A 3GI3A 3REPA 5TR6A 4LRJA 5EHYA 1OMWA 4QD6A 3KKVA 4LRKA 2J90A 4QMUA 4AOJA 4ZTHA 4Y73A 4H1JA 4KUJA 2PUPA 5ANIA 1LEWA 1M2QA 3QYZA 4IACA 4KABA 4M97A 4BF2A 3S00A 5DYJA 3RWQA 4F1TA 4FSRA 2RKUA 3DQWA 3GC0A 4W8DA 5JZNA 4H39A 2BHHA 4IC8A 2F7XE 3UC3A 2VTOA 2XKDA 3SGCA 2XP2A 3ZBFA 3NCGA 4BI1A 4O0UA 1FBNA 3DKOA 5CT7A 1OPKA 3L9NA 3FL4A 5IUGA 1Q62A 1E9HA 5LVPA 1SVHA 4EONA 3QKMA 5AR2A 2AUHA 3WYXA 2JDSA 5J9YA 4BL1A 5IG1A 4OW8A 3KRJA 3ZO4A 4TN6A 5KBQA 4C4JA 3VS7A 3R1QA 4TYIA 3QHRA 1H00A 2XCKA 5FQDC 4I20A 5JGBA 5JFSA 1YOMA 4ASXA 2C6DA 4BCHA 4XRJA 4AX8A 3IOPA 3UMWA 2QO7A 3D5VA 2PHKA 3TIYA 3MB6A 4AFJA 1XBAA 2X6EA 2X8EA 1R3CA 3VIDA 5HBEA 3T9TA 4EHGA 4OBOA 3KGAA 2HIWA 4XEYA 5A4EA 4FOCA 4I6FA 3GCSA 1SNUA 3V01A 1G8AA 4BRXA 1QPEA 2PPQA 4I5MA 4N6YA 4OTIA 4YTFA 3EH9A 3KMWA 1YWNA 2PVMA 2R3JA 3TT0A 4YURA 2XJ0A 5IUHA 3TUBA 4C58A 3ODYX 3FLZA 3W33A 1IAHA 4ZS4A 2G2HA 4HGLA 4PL3A 4RIXA 2GHLA 3LIJA 4H3BA 4A4OA 3R8VA 4EJNA 2QOFA 3Q9XA 2VWXA 3QRUA 3HA6A 4IDTA 4AGUA 1NVQA 4B9DA 4EI4A 1PYEA 1VYZA 3P1AA 4CEGA 2PUNA 2VD5A 2IVSA 3OBJA 4RX8A 3EKKA 4KBCA 3W2CA 2W4JA 2Y6OA 4RFYA 3HLLA 5AV4A 3E8DA 4HYIA 1CKPA 2E2BA 3LLTA 3EQDA 5CX9A 5F4NA 5LMKA 4YZMA 4GU6A 1REKA 2YN8A 3ZLWA 3H4JA 3PJ8A 3U9CA 5LVMA 2PZ5A 2OWBA 3GOPA 5DRBA 2V55A 2VNYA 2WQNA 2Q83A 2P55A 2E9OA 3A7GA 4HNFA 4O2ZA 1Q61A 2HXLA 2CMWA 4RIWA 5JFVA 3QGYA 1ZZLA 3PIXA 3MW1A 3TNIA 4AW5A 5HVKA 2FGIA 5CAUA 4DAWA 5IA1A 3TM0A 4X6QC 5DPVA 3O0GA 4Q9ZA 2X2LA 3BPRA 5E8VA 2VTPA 3GB2A 3P7AA 3RTPA 4C4FA 3QQFA 4FUYA 5HBHA 2A2AA 2ZB0A 4QPMA 4AG8A 4OAUC 4DEHA 2PE0A 4JQ8A 3BLRA 4U7ZA 5J1VA 2V22A 4JVGA 5GIPE 4NL0A 3L9LA 3JY0A 1YDSE 3OT3A 2YAAA 4V0GA 3ZO2A 4AFEA 4Z55A 3TACA 4FZ7A 3AQVA 3ZCLA 4DGNA 4HCVA 2OFUA 1DAYA 4F0GA 4BDCA 3QQHA 3VF9A 2XVDA 5B2MA 2BIYA 2VTSA 1VEBA 4ZZNA 4O7NA 1OITA 4A9RA 5A14A 2ZJWA 5GINE 1PMVA 5FDXA 4DFZE 3SXRA 5FM2A 3CS9A 4I5PA 4J96A 3QLFA 5IQGA 5IQCA 3R8UA 4B7TA 3L8XA 4XH6A 1OPLA 2YDKA 2EXEA 4BHZA 4JRNA 4ARKA 4BWXA 1ZYJA 2F49A 3NIEA 4U81A 5FUTA 3A7JA 4I93A 1KOBA 2QOOA 5HO7A 3KMUA 3GQLA 5CSWA 3FQSA 4I1ZA 4E1ZA 1Y6BA 2EXCX 2X7GA 2W9FB 1M2PA 1STCE 1G5SA 2JFMA 1SVEA 2VTAA 3AC5A 5DRDA 5EM8A 4ZY6A 3VN9A 2QCSA 4FTCA 3CSVA 3D94A 1PMNA 3MFRA 4QTCA 3QC4A 3DNDA 4R7BA 2QHNA 1Q8TA 4QP1A 1B38A 3PYYA 2GTMA 2YIQA 4UMTA 3OW3A 4E73A 3WIGA 3EL8A 4FC0A 3MGYA 2ITOA 2BRMA 4KIKB 2BFXA 1AQ1A 3BQCA 1MUOA 3HUBA 4TYEA 2Z7LA 1BYGA 4I3ZA 3GC7A 3E62A 4F0IA 4GYGA 4XP2A 3CY3A 4JIKA 4Y5QA 4EYJA 2W5AA 4G2FA 4L6QA 4N0SA 4DE4A 4C2VA 3L9PA 1AGWA 5FXQA 4HVIA 4ZSAA 5KMNA 1R39A 4Y46A 5DEWA 4J8MA 2BMCA 4OBPA 2PMNX 5CVHA 2UZWE 3FKLA 4LUDA 3QD4A 1A9UA 5ANOA 4ZY5A 5AMNA 5D7VA 1VR2A 3RPYA 4MNFA 5JFXA 3QF9A 4RQVA 3SAYA 5AP7A 3ZSHA 4EQUA 3KXHA 4PNIA 4EH6A 4MXZA 3W1FA 4XG2A 4ZLOA 3ORNA 1XJDA 2WQMA 2HY0A 4ACGA 4A06A 4FR4A 3QX2A 3OY1A 4J1RA 3FYJX 3MJ1A 3R7OA 3S3IA 4I23A 4AZEA 2WQEA 2YFXA 3QHWA 4I41A 2VTLA 3LQ8A 3DB8A 3L8SA 2OH4A 3U4WA 2ITXA 3PZEA 4C35A 3A7IA 1CM8A 3G51A 4I22A 2JDOA 4YTIA 5FXRA 3R7YA 1XH6A 3PLAE 3RCDA 1OL1A 3PJ1A 1WBPA 3QTSA 1H1WA 3AC4A 5HORA 4JDKA 2JD5A 3F66A 4PMSA 5M09A 2YLEA 2OXYA 3RPRA 5J5TA 4WSYA 2R3OA 4NM0A 2X7FA 1W98A 4YTHA 4ZAUA 2ZB1A 2E9PA 1BI7A 2W5BA 3FSKA 4I4FA 4DH7A 3TDWA 3MSSA 2C6KA 4KRCA 4BCPA 4OTPA 3NMUF 4D4SA 3ERKA 4FIEA 1W82A 1YI3A 3PTGA 1OL2A 2R3KA 4FKJA 4DLJA 4PTGA 1U5RA 4XX9A 3LCKA 4CRLA 4HW7A 4KD1A 2EVAA 1W84A 3QZGA 3PP0A 3LM5A 4ID7A 3KY2A 5FD2A 4C36A 5J1WA 1OGUA 4TKSA 5C9CA 4BGGA 2BHEA 2NP8A 3E87A 3KRRA 3P4KA 3DGKA 4M3QA 5KBRA 4O96A 3ZZEA 1M7NA 3R04A 4GSBA 4TZRA 2VX3A 2XNGA 4BKYA 3DXNA 3OS3A 5A4QA 4ZK5A 3CLYA 3T3VA 4BCKA 5E9EA 2WMBA 3TKIA 3I60A 3NW6A 3KRLA 5A6OA 3IOKA 1TVOA 3AMAA 3RK5A 4GKHA 4Y85A 4HYUA 4CKJA 5CENA 4K18A 3DJ6A 4CGAA 3NAXA 4HJOA 2QKRA 3MPTA 4B8LA 3FKOA 3RNYA 2XK7A 2R2PA 5AIRA 3SLSA 3WIKA 4H3PA 3ODZX 2BCJA 4RIYA 2CPKE 3LFAA 3LXNA 5E91A 1TQMA 4Q5EA 4Q5HA 3ROCA 4MHAA 3DXQA 2A19B 4GL9A 5E8UA 3MB7A 2R3FA 4QP8A 4ANSA 2RF9A 4FSZA 3GFEA 3KVWA 4AZFA 4L3JA 1R0PA 3L9MA 4FKWA 4YJNA 3GENA 3MPMA 4CRSA 1NT2A 5M08A 2R3LA 5HKMA 5DE2A 3RHKA 2R7IA 4EZ7A 4I6HA 5CAQA 2VN9A 4Q2AA 4JBQA 3UGCA 5J5SA 3PRIA 5EYMA 1H0VA 2J50A 4EK4A 5IDNA 2YIYA 3POZA 2QOHA 3O50A 4J7BA 5ACKA 2R3PA 4CXAA 4DFUA 3EQCA 2UZUE 3EQFA 3ZBXA 4J52A 3EQHA 4X2NA 4EJ7A 4MWIA 3KXMA 3KFAA 3PY3A 4PY1A 1NVSA 1URCA 3DT1A 5TOZA 1ZLTA 4ZSLA 5FEEA 2C5XA 4K77A 1PMEA 4QMWA 3R1YA 3H0YA 2WPAA 3HMIA 4YHJA 4CT2A 4TYHA 3GU5A 3PDTA 2B9JA 3UIXA 2B9IA 4FZ6A 5IQEA 4LOPA 3CTHA 3R00A 2QURA 3FLNC 3HRCA 2ZM4A 4NKAA 3U8WA 3F2NA 3UTOA 1SYKA 4DTKA 3DXPA 2EU9A 4AWIA 4GIIA 3F69A 4QP6A 3EN9A 1R0EA 4EOJA 4BY9E 3MPAA 4W4WA 3DTWA 5EW8A 3ZU7A 3IONA 2G1TA 3SOAA 3FSFA 2I0HA 4W4XA 2BROA 3PA4A 4FNWA 3QQGA 5LVLA 4EH3A 4JBPA 3S1HA 5AAFA 4RX9A 2CGWA 2QKWB 3QRKA 4GKIA 4JG6A 4BBEA 2W17A 4FT7A 3UIMA 1BKXA 4R1VA 4ORKA 4GEOA 4TL0A 2BDJA 5M51A 3SDJA 4P5QA 4U9AA 1Z5MA 4N57A 5E8SA 4QPSA 3A8WA 1P4FA 4FL3A 1UA2A 3ZZWA 2QONA 3ZC5A 1ZY5A 3EN7A 4M14A 4D2PA 3NDMA 2R5TA 3UNZA 1MRYA 3AC3A 1JKLA 1WVWA 3EJ1A 3OOMA 4JJRA 4I6BA 4M68A 4E5AX 1XKKA 2W1FA 5F20A 3ZC6A 3SW7A 4IE9A 4BKZA 5HLNA 4G9CA 3M11A 1H1RA 4D5KA 3CPCA 3BI6A 4IW0A 4F09A 5I3RA 5DOSA 4QMZA 3ZMMA 4IANA 3O23A 2KTYA 5AR3A 5EOLA 4LG4A 3IDPA 4MYGA 3CBLA 4DC2A 3OWLA 1Q97A 4U42A 5D11A 4UMQA 3PE2A 3QTXA 4RPVA 2P2HA 5JSMA 4FV7A 5J9LA 3AT3A 4D4VA 2IJMA 3FI4A 4G5PA 4TRLA 3AGMA 3GCVA 1XBCA 5HIDA 1KE7A 4R6VA 5DVRA 3SKCA 5FBOA 3PY1A 4FSTA 4QYYA 3G6GA 3IECA 5IMXA 3UIBA 4M12A 1NVRA 2XK4A 4EWQA 1PKDA 2UW0A 1OZ1A 4QYFA 3Q04A 5KNJA 5BVWA 4L45A 1BLXA 2IZUA 4EHVA 4FTQA 5KKRB 1OUKA 2GNFA 4C4GA 4FIHA 3A99A 4FTKA 3BYVA 3MH0A 4EHEA 2I0EA 3IW4A 3IQ7A 4PNKA 4QMSA 3OWJA 3C1XA 2J2IB 2XKFA 3NNWA 4F4PA 3EYHA 4UEUA 4UWBA 2PE1A 2B53A 2C0OA 4Z16A 4MXOA 4NWMA 3PVWA 2W5HA 3CTJA 4O27B 4BTFA 5FLFA 3PXQA 3VS1A 2JLDA 4R3RA 2CSNA 4YPSA 5ANDA 4FNZA 4FVRA 3UQGA 3IGOA 3MIAA 3WI6A 3LJ1A 4BDIA 4CZTA 2IVVA 2ETRA 1ZZ2A 2PMIA 4M13A 4S32A 3AMYA 5DNRA 4ZIMA 3V5WA 3WARA 4O81A 4KS8A 4FIFA 3IW8A 4I0TA 4E3CA 4HNIA 5L6WL 3VNTA 5JGDA 5FWKK 3Q2MA 4ANQA 4ANMA 5LARA 5AV2A 1PKGA 1LUFA 2I40A 2XRUA 2VAGA 4L46A 3FMKA 3SXSA 4RIOA 4EBWA 3SRVA 4OAVB 4D2TA 4WD5A 3OCSA 4AP7A 4J98A 3DS6A 2QOCA 2VWZA 1H8FA 2PZYA 2ZM1A 3R9DA 3UVQA 2XNPA 3A4PA 4IM3A 3LXPA 2X81A 3NNUA 3RI1A 5JN2A 4LOOA 4J8NA 3VVHA 3FI3A 3ZO1A 1QPJA 2HXQA 5K3YA 3DJ7A 4AUAA 2X8IA 4LFIA 4DGGA 2J0JA 2NRYA 2HZ4A 4QNYA 3ZONA 3KU2A 1SM2A 2OJGA 2OXDA 1IASA 3HMPA 3OEZA 3S95A 4DA5A 1G3NA 4E4LA 2YIRA 1CMKE 2ZDTA 4QQJA 3QRJA 4IIRA 4GFMA 3MA6A 3LOKA 4FSYA 3TZ8A 4I0RA 3D83A 4WO5A 1QPDA 4G34A 4GJ3A 4FGRA 2X7OA 4MBJA 1H28A 1WVXA 2CJMA 2UZLA 4RJ7A 3TIZA 3LCDA 4MF1A 5IQHA 2OZAB 2QLUA 4BTMA 5E8YA 3MTLA 5AR8A 4FKIA 4D5HA 5T3QA 3COKA 2FSTX 2XS0A 4GG7A 5GZ9A 5C8KA 4AW2A 4S31A 4DH1A 4U5JA 1ZY4A 4DEBA 4YSJA 5CS6A 2BKZA 1XO2B 4FTAA 1YRPA 3MBLA 4IX3A 4TY1A 1FGIA 1XH4A 4KIQA 2UUEA 1ERKA 5KMOA 4CKRA 4FKLA 3W55A 2C1BA 1J1CA 3DFCB 3NR9A 5JFWA 4DYMA 1AD5A 4KINA 4KB8A 3A7HA 3RAIA 3FC1X 2B9FA 3WZUA 3MA3A 3MFUA 1YXUA 3PIZA 2UW6A 4WG4A 4DGOA 2VTIA 5M4CA 3Q52A 3TJDA 1DI8A 4FEUA 4APPA 2CHLA 4YNEA 5EG3A 4RFZA 4F70A 1H07A 4YJRA 5JQ8A 4YBKA 2EWAA 3UO6A 1WBWA 3R02A 1GNGA 1WBVA 4PTCA 1OIQA 1X8BA 4AA5A 2JDRA 4BCJA 1Q4LA 3RZBA 2PVRA 1CTPE 3U6JA 4X21A 2HY81 3BGZA 4JLCA 4PP7A 2W1CA 3D7TA 2HK5A 4IB5A 4FV1A 4AN3A 3QGWA 3O71A 2PVYA 2I0YA 3QXPA 3TZ7A 1ZXEA 2ZAZA 3IDBA 2C3IB 2XKCA 3KEXA 3UODA 3FYKX 4S34A 3LKMA 5L8LA 3LCSA 4YJTA 2FSLX 4EK3A 1FVVA 2R7BA 3UC4A 4OTFA 4CQEA 3R0TA 2JITA 4FMQA 3TKHA 2VUWA 3ZRKA 4EH8A 5LWMA 3UG1A 2ZDUA 3GQIA 1U54B 3NUYA 5J8IA 4V05A 4F1OA 3HP5A 4DT8A 4ZP5A 2WIHA 5JK3A 3R73A 3BYUA 3H9FA 4K8AA 5HU9A 4FV5A 3PFQA 4JT3A 3UVRA 1ND4A 5G6VA 1V1KA 4C0TA 4HZRA 4EZ3A 5HLWA 5AP5A 3LMHA 3DKFA 2PU8A 4IZ7A 1XH9A 1A48A 4BC6A 2Z02A 4A07A 3MY1A 3DJ5A 5M07A 3HZTA 1HCLA 4ZZOA 5KZIA 3HA8A 3LM0A 2X9FA 2B54A 5I9VA 4DGMA 2RFNA 4Z7GA 4FX3A 3UPZA 3AT2A 4I5CA 4I4EA 2XJ1A 3DBEA 3MYGA 3BEAA 3DQXA 3EQIA 4CFMA 5BVEA 4EOLA 3LXLA 1ZWSA 3T3UA 2XK3A 2Y4IC 3G5DA 4QP4A 1KOAA 2YM3A 3TJCA 1H24A 1M7QA 4P5ZA 2OIBA 2PUIA 3RJCA 4FGBA 3KF7A 4MQ2A 2BRNA 3I79A 5FRIA 4XBUA 1P2AA 5LCJA 5AP3A 4FT3A 1GJOA 5J7HA 5EH0A 1YW2A 3NYVA 3BIZA 4E5WA 3I81A 4JQEA 2QODA 3R9HA 5C26A 1OKYA 2C5VA 4XG6A 2W9ZB 4BYJA 1GIJA 3VHEA 1ZOHA 5EDPA 1Y6AA 3R8ZA 4ASDA 5L6OA 2WMRA 1XHAA 1Q3DA 2BALA 3CCNA 1MRVA 3F3ZA 1YVJA 4J95A 2Q0BA 4O0TA 1WMKA 5DHJA 3ZOSA 4GMYA 5AP6A 2JKMA 5HE0A 2ZMCA 2FB8A 2YZLA 4KKGA 2QNJA 3EFKA 4E4XA 4D9UA 3QD0A 3ULZA 4HVHA 4IH8A 1KSWA 5HG5A 5HO8A 2I7QA 4WG5A 2VTQA 1ZYCA 4IZAA 4YLLA 3L1SA 4IM0A 3ORIA 4GJ2A 4GT5A 4MK0A 2JAMA 4E4MA 1PY5A 2XIRA 4FSNA 3MN3A 4GT3A 5GZAA 3UOKA 2C6TA 5ETCA 5IEXA 5HIEA 4MXXA 2IO6A 2GQSA 1DAWA 4V01A 4YJPA 1SMHA 5D1JA 4AE9A 3VO3A 4EQCA 5J7BA 5CVFA 3ZXZA 4O7TA 4ZOGA 5HOAA 2BDFA 3MY0A 4P7EA 4X6RA 3ZEPA 4DEEA 2G9XA 4EOKA 3Q4UA 1A06A 3DBDA 5CNNA 1V0BA 4FV0A 4JBOA 4CT1A 4IBMA 2ZYBA 4F9BA 1UV5A 2ONLA 2OU7A 5H2UA 1I44A 4HGSA 1L3RE 4BDBA 4IZ5A 1RDQE 4HYHA 5L4QA 1PYXA 3D5XA 3AMBA 1UNHA 5CAOA 3FV8A 3SVVA 2YDIA 4IVCA 4CCBA 1Q5KA 4RC3A 4CSVA 2ITZA 2VTTA 3UO4A 3DU8A 4LYNA 1O6YA 3NUNA 3O7LD 3P5KA 4GFGA 2HW6A 3GGFA 3CKWA 3AD6A 3QRTA 3CPBA 3I0QA 4QTBA 4NKSA 1YOJA 2XCHA 2HYYA 3DA6A 3JVSA 4FI1A 4MEDA 2JIUA 3G9LX 5C1QB 4O7VA 2GMXA 4O7RA 5CI6A 3QZFA 3GC9A 2C6OA 2VX0A 3ZUTA 4XOYA 1JKTA 2JIIA 3QAME 1UNLA 1P5EA 4U6RA 2O2UA 3W8QA 3KCKA 4FKTA 4EH5A 3OVVA 1KUTA 5EW9A 1Y91A 4AW0A 2OLCA 4L42A 3M1SA 2X1NA 4QTAA 5EYKA 5I3OA 5HX6A 4NSTA 2A1AB 4MNEB 1ZYLA 3PP1A 5C8NA 3CY2A 3OCGA 3IW7A 4AF3A 5A6NA 4BDFA 3I4BA 3NW5A 5H8BA 4AXAA 3QTIA 2Y7JA 4YBJA 2C3LA 4JX3A 2F57A 3OHTA 4G16A 5AUXA 2CNUA 4O1PA 1B6CB 3PE1A 2C47A 4FK6A 3KXZA 5HG9A 3V5PA 5HTBA 4RIXB 2BAJA 4UMUA 5BYLA 3F7WA 3BU5A 2UZBA 3G9NA 3E3BX 4UY9A 3GP0A 2UZNA 5EHOA 5HG7A 2R9SA 5EM7A 2WKMA 4OTQA 2DQ7X 4XP3A 2XNOA 3PWDA 2PVJA 4LGHA 3CKXA 2AYPA 4EYMA 1JQHA 5DR2A 4EC8A 2XNMA 3AC1A 2X9EA 3M42A 4FKOA 5E1EA 5CTPA 1Q99A 2C5OA 4R77A 4HPUE 4FEVA 1J91A 3FI8A 2WTVA 3HV5A 5K0XA 1UWJA 4IAZA 4RRVA 5DR6A 4ZEGA 4FKGA 3BWFA 1P14A 4FE2A 1JPAA 1IAJA 4RIWB 2ETKA 3ZDIA 5I9ZA 5ANKA 3A4OX 3EFLA 5T68A 4YU2A 5HESA 3V6SA 1J7IA 3NYOA 4CYJA 3R9NA 4B0GA 3HX4A 1O6LA 3R9RA 3G6HA 1O9UA 4UXQA 2E9VA 2J9MA 3KULB 3O17A 4IZYA 2W7XA 5ANJA 2XF0A 2WMSA 3K3IA 3EKNA 4ITHA 3Q4ZA 4YSMA 3HNGA 3H10A 1Q8ZA 5CASA 2OK1A 1OPJA 3B8QA 2FYSA 3PZHA 2QOBA 3C0HA 2UZVA 2GFSA 2WMXA 3CQWA 3EQBA 3NEWA 4FKPA 5K5XA 5L8KA 4L53A 1YXSA 2Y4IB 4DEIA 5H3QA 2O5KA 3G0EA 3FAAA 4QMTA 4YC6A 1YI6A 3R6XA 4NCTC 5C8MA 5M55A 3VBXA 3UQCA 4GW8A 2BZKB 2H6DA 4Z3VA 1BX6A 2J0LA 5FEQA 3BYOA 2Y9QA 3PLSA 1GY3A 3PJCA 3W2QA 1YKRA 3BHYA 4PMPA 2GNLA 5GIOE 3DLZA 4FL1A 3VUKA 4MD8E 3FMDA 2C6IA 4H1MA 3F3WA 5HNGA 1JWHA 2CCIA 2YJRA 1YHSA 4RJ6A 3ACKA 4UYNA 5H9BA 4BDDA 3NUSA 3TEIA 3H9RA 3EZVA 3UNJA 1BL6A 3DK6A 5CEOA 1T45A 4U0IA 3RNIA 2YWVA 1J1BA 2W1EA 3HVCA 5G1XA 1FGKA 2VWBA 5AP2A 5AUZA 5A4LA 3QQJA 2XMYA 4YC8A 3QCXA 1PXNA 3UP2A 1E1XA 1H01A 4E6CA 2RL5A 5KHWA 3HKOA 5BVFA 3QLGA 1NY3A 4NH1A 3O7LB 4X3FC 1APME 3SC1A 5IQAA 3ZFYA 4JDHA 4UZDA 5IISA 2WTDA 4DBXA 5F95A 4EL9A 4RWKA 4CNHA 4KAOA 1URWA 5CF8A 3N4TA 3H9OA 3BV3A 1Q41A 2YACA 4HVDA 3POOA 5AR4A 4KBKA 5A54A 3RKBA 4EOOA 2W96B 2WHBA 1U4DA 3PXZA 3KL8A 2UVZA 5IF1A 4DEDA 5L8JA 3FPQA 5JKGA 3ZLXA 4OLIA 3WF8A 4B4LA 4F0FA 5JQ5A 4RJ4A 1H25A 2ITNA 3RK7A 4CMOA 2WGJA 4PDPA 2VWVA 2UZEA 2J5EA 2WTIA 3CJFA 4R8QA 4XBRA 3QKKA 4F08A 4USEA 2BAQA 3AOXA 4AN2A 2GSFA 2J0IA 5FTOA 4OTRA 3EIDA 5CZHA 4MXCA 4ZS0A 2OIDA 3CGOA 3MVMA 4IWPA 4U3ZA 2R4BA 2VTMA 2OF4A 5TF9A 2PULA 4PDSA 4QTEA 2Y0AA 3WZKA 5DIAA 1H1PA 2HAKA 3NCZA 4IVDA 4D9TA 1JKSA 2WELA 3C4WA 2NRUA 3O96A 4RSSA 5EYDA 3QYWA 4E8AA 3ROYA 2WMQA 5A9UA 1OL7A 3FZRA 3LVPA 3ZUUA 5ITAA 2R3GA 3FZ1A 5CWZA 5AP0A 4F9WA 1PJKA 4KIKA 4PF4A 2ZMDA 4FV2A 4EHZA 2Z7SA 3EWHA 4ZTQA 3E93A 5EM5A 3LFDA 3EYGA 2J4ZA 3AD5A 4DF3A 1CKIA 2OXXA 3NUUA 4O21A 3VBTA 1OKVA 2VGOA 2Z7RA 1UKHA 4ANBA 5IA3A 5DEYA 4ERKA 1E1VA 4FBXA 3OROA 5KKRC 1UKIA 4MF0A 3IGGA 4IVAA 4ANNA 3NRMA 3HMMA 4TYJA 1Q8YA 4WUNA 3I6WA 2J6MA 4DG0E 3A62A 4YTCA 2VX1A 3QCSA 3E7VA 3FY0A 1YI4A 3PPKA 5KMJA 3SG9A 1MRUA 5L2TA 1M14A 1QPCA 4W4VA 2XA4A 3FXZA 3R01A 4RG0A 3TNHA 4AE6A 3E63A 5CEMA 4MD7E 3THBA 4U97A 2GQGA 4FTUA 3O8TA 3ZUVA 4CVAA 3FZOA 3OP5A 3O2MA 4NK9A 2BKKA 4BZDA 4CFWA 2ERZE 1XWSA 4FIJA 4AW1A 2YM4A 2Z60A 5M06A 3AT4A 4S2ZA 4CFFA 2WAJA 1H4LA 4XP0A 4FYNA 3WF6A 1OKZA 4QMYA 4ASZA 4IC7A 2BAKA 1BUHA 5H8GA 5ETFA 3CD3A 4FOBA 4HGEA 3RAKA 4ACHA 1OI9A 3UZRA 3JPVA 5IU2A 1ZYDA 3DBQA 5JZJA 2YM8A 4YJUA 4BR3A 3COHA 5HX8A 5BUEA 3GNIB 4TWCA 3U54A 5B7VA 3COMA 4UBAA 2OJFE 4YJVA 1M2RA 3MTFA 3W2OA 2VWIA 1GIHA 2PVFA 3AG9A 4BGQA 2QD9A 3QCYA 4L7FA 1HOWA 3U6IA 2C0TA 5HNBA 4C02A 4QMQA 2UV2A 5IEYA 1L8TA 4E26A 1W0XC 1FVRA 1ZAOA 2YCFA 5FDPA 3GEQA 5AV1A 4C2WA 2P2IA 4QMXA 1REJA 3MVJA 3Q4CA 3QA8A 4ZSJA 2FUMA 4FUXA 3BE9A 3NUPA 4E6AA 5K5NA 3QTRA 4PRJA 3C5UA 2EUFB 4XOZA 3AC2A 4RJ5A 4FTMA 1MQBA 4GH2A 4YZNA 5I5ZA 2JAVA 2PVNA 1Q8UA 1ZOEA 3C0GA 4KSQA 4FV8A 3ZSGA 4RX5A 3R7VA 5C27A 5DT3A 4D2RA 1FINA 4E6DA 2I1MA 2O63A 2VZ6A 3OWPA 2LAVA 3V5TA 4F7NA 5CAVA 2V7AA 4TWOA 3IO7A 3NLBA 4O0RA 3EMGA 3F82A 5F94A 5TKDA 5EYCA 4FT9A 3TCPA 3TV4A 3UOLA 3OXZA 4AN9A 4EOSA 5JH6A 5HHWA 3NIZA 2BZHB 1T46A 4IQ6A 2YITA 3F88A 3BCEA 4F7SA 3UE4A 4NTTA 2OJIA 1YXTA 3RK9A 4L3PA 4CKIA 2CKPA 4R3PA 5ICPA 5IQBA 3PVGA 4WRGA 2UW7A 4X3FB 3PSDA 5K0KA 3TXOA 3TNPC 4ERWA 2FVDA 2EXMA 5LVNA 3LCTA 3R8LA 3Q9WA 4M69B 2O3PA 5K4IA 3VS0A 4Z9LA 3VS3A 2VV9A 2WOUA 3E64A 2UZTA 4K2RA 4PUZA 3FBVA 4F64A 3UZPA 5BUIA 3O8PA 3LFCA 5BX0A 4IX5A 1OB3A 3PG3A 1QCFA 2PK9A 3HUCA 1JBPE 3PWYA 3C4ZA 4X7QA 5KZ0A 5HTCA 5GJFA 2XM9A 3PJ3A 4G31A 3VJOA 2PTKA 4UZHA 5H8EA 2JKKA 5AUTA 4G6OA 3RM6A 3ZRMA 4DG2E 3ENHA 3EL7A 4E4NA 3P23A 1RJBA 3KC3A 2O8YA 2F7EE 3HRBA 4U43A 4E7WA 4DFXE 5AAGA 5M4IA 2CKQA 3Q3BA 4PMTA 5C4KA 2OI4X 4OTGA 3C0IA 3NUXA 3ZH8A 4O7YA 3R28A 3RVGA 2XUUA 3DV3A 3NNXA 5CSHA 4YC3A 1QL6A 1YHWA 4XMOA 3V5LA 4DLIA 3BU6A 4G3CA 4QTDA 4IEBA 2J0KA 3R7EA 4Y8DA 1FVTA 2RSVA 4CFNA 1LPUA 5EDQA 3QD2B 3ID6C 1W8CA 2QLQA 4HYSA 4GFOA 3RALA 4BWPA 4EH7A 3W32A 2C4GA 1J7LA 2BFYA 4FT5A 5LVOA 2YA9A 3EN6A 4CYIA 3DKCA 3D4QA 4AT3A 5E8WA 3LPBA 3TTJA 5J9ZA 3OBGA 4PQNA 4B6LA 4GK4A 1QMZA 1H27A 3VULA 4ANOA 3FE3A 1KE9A 4XNEA 3CEKA 3BHUA 2C30A 4NW5A 2QU5A 1KE5A 5HICA 3NVMB 4NW6A 4U79A 2OBJA 4CG9A 3QUEA 5HCXA 4TNDA 2QR8A 5B2KA 3PRFA 4D0XA 4O86A 3VAPA 4JG8A 3DZQA 5CXZA 4RBLA 3UVPA 5FTGA 2IZSA 4P90A 3V04A 3F7ZA 5EK7A 5ETAA 4AZSA 4FTRA 3R63A 3F3TA 4FKVA 4QMOA 2IN6A 2PZPA 2QVSE 5DT0A 3R8MA 1IRKA 4XJ0A 3IG7A 2QQ7A 3IW6A 4ZTLA 3GXLA 4ZTMA 3VQHA 3GCUA 2YABA 4WG3A 4NM3A 3UJGA 3F5XA 4DH3A 1UU3A 2WQOA 4NTSA 4X3JA 1K9AA 3OFMA 3RCJA 5L2SA 3D7ZA 1PXMA 3BX5A 2W4KA 2IZRA 2QOKA 2BTSA 3FLQA 4C61A 1JVPP 4EK6A 1SVGA 4ZTNA 5M4FA 3MWUA 3UYSA 2G2IA 4GIHA 3OWKA 5BVKA 1PXJA 4NM5A 4UWCA 4UMRA 2KULA 4J99A 2CDZA 2X39A 3RINA 4NYEA 3EQRA 1VZOA 3K3JA 5IQIA 3A8XA 4G9RA 3TG1A 4X2GA 1FOTA 5L6PA 3D2KA 2G15A 1Z9XA 2W1IA 3PUPA 3QL8A 4XUFA 5D7AA 4U80A 3Q9YA 5KMIA 3V3VA 5EQYA 3DAJA 4OR5A 2OJ9A 2BIKB 4NIFB 3HAVA 2IW8A 3VBVA 1XBBA 3V5JA 2F7ZE 2CGUA 4FKQA 3RBWA 4KKEA 4BDEA 4NJ3A 3C4XA 4GUEA 5L2IA 4H05A 2ONLC 4YJQA 5CVGA 3VUIA 1PMUA 4MBLA 4ZLYA 4WSQA 3ANQA 2EB2A 3OCBA 2YEXA 3OCTA 4G3FA 3R71A 4UALA 4BZNA 1R1WA 3FHIA 3QA0A 1KV1A 3W2SA 2PY3A 4RQKA 5HLPA 2XEZA 3DBCA 5CLPA 3B8RA 3VUGA 3PSCA 2C0IA 3W8LA 4GYIA 4QYEA 4EH9A 4FV4A 3VRZA 4CFVA 5BYZA 3WE8A 1U59A 3PXYA 1J7UA 2IVTA 5F1ZA 4A9TA 4XLIA 4RVTA 4GT4A 4TTHB 3IKAA 2X8DA 3S0OA 3CP9A 3LFBA 4IHPA 2CLQA 2QOIA 3ET7A 3UQFA 2C6LA 1DS5A 4IVBA 4G5JA 2ITWA 1ATPE 4LL5A 3ZDUA 5IZFA 5TO8A 5BVOA 2W1ZA 4CV8A 1SZMA 2RGPA 2PVLA 2JIVA 3ZLSA 1JSTA 4BCMA 4EEVA 1F0QA 4FSQA 4XS2A 3P86A 2IVUA 5KMKA 5LMBA 4ZJIA 3T9IA 4BIBA 4DTBA 4FTOA 4YZBA 5L2WA 3I5NA 5IEVA 3Q60A 3HV7A 5J95A 3W18A 5BNJA 2C3JA 3BU3A 3TTIA 4RC2A 2GCDA 4F9CA 3LFFA 4NFNA 4JDIA 1YXXA 3ORLA 3TZ9A 3UIUA 1IA8A 5E1SA 3KQ7A 3D7TB 2ACXA 3VUDA 5GJGA 4JS8A 4LGDA 3ATSA 1GZOA 2OZAA 4S33A 4TYGA 2QOQA 4BI2A 5D12A 2C3KA 5EHLA 4O83A 2C5NA 1PRYA 4MH7A 3BHVA
chains in the Genus database with same CATH superfamily
2EB3A 3CC6A 3B2WA 2ZV2A 1GZNA 1KE8A 4C4IA 3C13A 4MVFA 4MAOA 5LQFA 4O84A 3NVKI 2X4FA 2F2CB 3KK8A 4ZXTA 3S4QA 4BDKA 2WD1A 3U6HA 2JKQA 1WCCA 2VRXA 3ALOA 4LM5A 5LMKC 5AFVA 3DFAA 4MUQA 1FQ1B 4IJPA 3BHHA 5CF4A 5I9XA 1VJYA 3RP9A 1G8KA 5DH3A 2OIQA 1UU8A 3KRWA 5C01A 3D15A 4EKKA 2VTNA 3HV3A 5JRQA 3LMIA 2GS2A 4M84A 3RPVA 5K9IA 3C50A 3EB0A 4ACDA 5B2LA 4U40A 3SA0A 4FEQA 1Q8WA 1IEPA 2C68A 2PZRA 4FZFB 3F2AA 3ORPA 3EQPA 2GNIA 5IUIA 3GUBA 3BGPA 1OIYA 4H36A 2X2MA 4KWPA 4WRSA 3FLSA 2XJ2A 5C03A 3LJ2A 3IK3A 2NNWB 5IMEA 4UMPA 1Y57A 4DTAA 3KN6A 4WIHA 1TKIA 2GQRA 5IH5A 5HE1A 2JGZA 4QPAA 3ZYAA 5HVJA 4PPCA 5M44A 5CT0A 3V8TA 4QYGA 2UW3A 3L8PA 3F3UA 4JAIA 3MI9A 4NU1A 5DT4A 5DMZA 3EQGA 3PVBA 5CEPA 2CN5A 3GU8A 3N9XA 4EK8A 4AXFA 4BCOA 2O65A 3AGLA 1WZYA 1XH7A 3VW6A 2V62A 2W99B 3TNWA 4BVUA 2FO0A 3RWPA 4OGRA 1U54A 4O2PA 2B1PA 3Q53A 4LV8A 2B0QA 4IB1A 1PF8A 3PPZA 4RMZA 1U5QA 3BKBA 3GVUA 5IPJA 3WZDA 4ZY4A 1RQQA 1W83A 2VU3A 2X0PA 3KN5A 5I9UA 1DI9A 2CNQA 4L68A 4O82A 2PWLA 4BDGA 3QZHA 3VJNA 4QP2A 3LW0A 1JKKA 2G2FA 3QCQA 3AD4A 4UXLA 3TUDA 1OVEA 3V5QA 4FNXA 4B8MA 3R8PA 2R3HA 3ZTXA 2VNWA 4G3DA 2OG8A 4ANLA 1UVRA 2WMWA 4F7LA 2AC3A 4PDOA 4M8TA 1RE8A 5HTIA 3LZBA 5AUWA 5HG8A 3MJ2A 2GFCA 3CE3A 3CTQA 3DZOA 3FY2A 4FSWA 5CSVA 4AT5A 4X2JA 3PPJA 5AEPA 3QBNA 3RAWA 4BCFA 4F6UA 5EQEA 4H3QA 4HGTA 2JBOA 4MQ1A 4BZOA 3NYNA 2AEGA 4ITIA 4CV9A 3VS6A 4F6WA 3CGFA 5DA3A 2JEDA 2YLFA 5E8XA 3TL8A 4F1MA 1UWHA 2BILB 2Y8OA 5AUVA 3FLYA 1WAKA 1F5QA 3HMOA 3QKLA 3Q32A 3UG2A 2P0CA 3Q9ZA 4GUBA 2XIXA 3W2PA 5AA9A 4O7SA 5KO1A 3ORZA 3KK9A 3OF0A 4I5HA 5BMMA 2YCQA 4R1YA 2ITYA 3MY5A 2OH0E 4M0ZA 2QO2A 2XM8A 4HOKA 4PV0A 2CKEA 3V51A 4DH5A 2B7AA 4R3CA 3VUTA 3ZM4A 4E5BA 1JOWB 4U44A 3RAHA 5DGZA 1ZMVA 3OC1A 2GS7A 4O6EA 2C5YA 3DKGA 3HMNA 4KBAA 4MXAA 3D14A 2B4SB 3VBYA 3FPMA 3VBWA 4RVKA 2X6DA 4LUEA 4CFUA 3BWJA 3ITZA 5CI7A 1YOLA 4KIOA 4CQGA 4AGWA 2IW9A 3QX4A 3ATTA 2CNVA 2BZIB 4QMNA 4U8ZA 2R0IA 2XK8A 3ORMA 2NO3A 3GU7A 3UMXA 4ZJVA 3E5AA 2RFDA 4ZSEA 5BVNA 5AV3A 3DDQA 5J87A 2QI8A 1GIIA 3G0FA 4GU9A 3DTCA 2PE2A 4KA3A 3R7UA 4FT0A 3VW8A 3T8OA 2PVHA 4RFMA 4RX7A 3A61A 3A2CA 4OBQA 3NYXA 2XH5A 4FEXA 4QRCA 4D55A 4LI5A 3MVLA 1PXPA 4O0SA 4HCTA 3OTUA 2B55A 3KF4A 1YDRE 3CR0A 2XB7A 1BL7A 4ALVA 4C33A 4G3GA 4I92A 5AX3A 3G90X 3FMNA 4GV1A 3U9NA 5AA8A 3LAUA 4FNYA 4UV0A 3D2IA 2CN8A 2J0MB 4IM2A 5FBNC 4I24A 2CCHA 4LV7A 4RWJA 5LXMA 2OKRA 2OW3A 3W0QA 5CANA 2SRCA 1FMOE 1ZRZA 4LMUA 4PTEA 4BDHA 2XK6A 2QHMA 2OICA 3FUPA 4G17A 2LGCA 2W05A 2I0VA 2XNEA 3QTUA 3U4UA 4C3FA 4MKCA 4RLLA 3JXWA 5AUYA 4WA9A 5CF5A 4ONAA 5IH4A 1JSUA 4NT4A 4QT1A 4FRFA 4D28A 2A0CX 3MV5A 4ZLZA 2FSOX 3LMGA 2BRBA 3DPKA 2HOGA 1H1SA 5EI6A 4O0XA 4JL9A 5HNIX 1IA9A 3FMLA 3CQEA 2JDVA 1CKJA 5T6KA 2DUVA 2RG5A 4FV3A 2IWIA 2IZTA 4DFYA 3NAYA 1NW1A 4RZVA 3FI2A 3VUHA 4CG8A 4IWOA 3W10A 4MNEA 4RA4A 4AT4A 3W0SA 2ZV7A 4TT7A 3LJ0A 4D1XA 5JGAA 3C5IA 3W2RA 4QQ5A 4LV5A 2XYNA 2VO3A 3QWJA 5HU3A 1H0WA 2ESMA 3K54A 5ETIA 4TNBA 5HCZA 2ITQA 4IMYA 4ITJA 4YLKA 4YLJA 2XRWA 1FPUA 4R7IA 5FP5A 4XG4A 5GHVA 4BI0A 5IDPA 2WEIA 3QQKA 3UZTA 4XYFA 3TI1A 5EM6A 3M2WA 4V0GB 4EZ5A 3QUPA 4BBFA 2WIPA 2Z2WA 3LQ3A 4GG5A 3IDCA 3Q96A 3IS5A 4QYHA 4K6ZA 3JVRA 3P9JA 4FKUA 4AGDA 2XK9A 5CQWA 4GVAA 5TE0A 3TV7A 4M67A 3C4EA 2XNBA 4J97A 4JIAA 5IKWA 1U46A 4BTJA 3II5A 4JG7A 3G15A 4A9UA 2A4LA 4ZZMA 4CTBA 4ZMEA 3ALNA 4GK3A 4DHFA 4YZCA 4P2KA 2HZ0A 3BELA 3OTVA 4DEGA 4NJDA 4PL5A 4FTTA 3FC2A 5ACBC 3DBFA 2ITVA 2O0UA 4IDVA 3TWJA 5GNKA 2XBJA 4QMMA 3F6XA 3QZIA 5CAPA 4LQMA 1NA7A 3R1SA 3CJGA 4FVPA 3I0OA 3MIYA 3OMVA 4J71A 5HO6A 3VRYA 4CMTA 4F9YA 5A4TA 3QQUA 3MFSA 3ZO3A 3LFQA 2XKEA 3KULA 3QD3A 4CFXA 1XH5A 3CQUA 2R3MA 3EN5A 4X2KA 4F99A 4DN5A 3GU4A 1J3HA 2H96A 4JR7A 3R7IA 2WFYA 4ALWA 3ZEWA 4DFLA 3C9WA 3P0MA 2GS6A 2H8HA 4YPDA 5CU6A 5FTQA 3VF8A 4EOMA 4APCA 3PY0A 3UDBA 4C3RA 3QXOA 3EHAA 3P7CA 4WHZA 4IX4A 3SD0A 1LEZA 2ITUA 3VQUA 4IFGA 3AC8A 4QO9A 3JR1A 2YIWA 4DEAA 4O7LA 2BUJA 4WKQA 2J5FA 4EBVA 4EH4A 2HZNA 3DK3A 3F3VA 4WBOA 2PSQA 4NZWB 3WBLA 4YNOA 5EI8A 2FA2A 3LXKA 3GT8A 3HEGA 3VWAA 3NUAA 5IA5A 4BN1A 3R83A 4NM7A 4YUQA 5JEBA 4LL0A 4BCIA 2RG6A 4YHFA 1ZMUA 5LMAA 4EC9A 4JXFA 1PXKA 3E88A 3QTQA 1B39A 4O6LA 4A4XA 4QQTA 2J7TA 1UU7A 4BB4A 3TKUA 3PIYA 4AGCA 3CXWA 4EWHA 2W4OA 3NPCA 4RVLA 5IH6A 4GRBA 2JDTA 3BBWA 5BUJA 2F4JA 4C34A 4NEUA 2OSCA 3C4CA 4DITA 3PA3A 2R3QA 5L2QA 4BIEA 3FZPA 5DR9A 4QMPA 3BYMA 3ENMA 1WBTA 2YDJA 2VO0A 3FZTA 3SX9A 3UPXA 4CZUA 4YZ9A 4Y72A 4EQMA 3U51A 2Y6MA 4C59A 4IWDA 2W06A 4U45A 3DOGA 5JT2A 1R78A 3F9NA 4IFCA 3VBQA 4AAAA 4AU8A 4G6LA 4JQ7A 4AZVA 4DBNA 4AQCA 4BHNA 4C3PA 3LE6A 4M15A 3ZHPC 2XIYA 4DCEA 4MX9A 3FEGA 1O6KA 3GBZA 3UOHA 2YIXA 4MTAA 4II5A 5FGKA 2R64A 4OT6A 5EOBA 4HVSA 3COIA 3CD8A 2GNJA 3GCQA 4PX6A 3WOWA 5AUUA 2DS1A 2C1AA 1Q24A 3K5VA 3R7GA 2VWWA 3RPSA 3AKKA 5KUPA 3LLAA 3OEFX 4I21A 4Y83A 2CLXA 3TUCA 2BRHA 1YHVA 3OY3A 4F65A 3WZJA 4FIGA 3UOJA 2HENA 4QQCA 3DAKA 5EI2A 4DFNA 2H9VA 3OXIA 3NZ0A 3PXFA 4UWYA 3V8WA 4JR3A 4MBIA 4RWLA 4L44A 3QRIA 4PDYA 2ITTA 4G1WA 5M56A 3MH3A 5AM6A 3RM7A 5HD7A 4C8BA 5FXSA 4WNPA 2UW4A 2XZSA 3JYAA 4YR8A 5F9EA 4WNOA 4L01A 4DCAA 4CMUA 2GU8A 4C37A 2V7OA 3TYKA 3PSBA 4CCUA 3FMHA 2ETMA 3ORKA 3QTZA 4BDJA 5IQFA 3PJ2A 5HBJA 4RIYB 2YCRA 5D10A 4FIIA 5AX9A 4RA5A 2YERA 2GNGA 4DGLC 4GCJA 2E9UA 3FMMA 4EKLA 4FKSA 3ZFMA 3D5WA 4BCNA 4N6ZA 3B2TA 1HCKA 4OTDA 4A9SA 4LMNA 2UW8A 5EW3A 4EH2A 3C4FA 4WOVA 4OTWA 1KV2A 2BRGA 2YM6A 3BV2A 1ST0A 5I9WA 2VTHA 3ZRLA 4PPAA 4KKHA 2C6MA 4A9YA 3BBTB 4FV6A 4CZYB 2P33A 3H3CA 3OD6X 3NGAA 4FYOA 5A3XA 3ZM9A 5AADA 3QQLA 5AWMA 5E4HA 4TWNA 5AAEA 4C62A 4JBVA 2QO9A 2IG7A 3DY7A 3FMEA 4TYHB 2GHGA 2W1DA 5E90A 3QFVA 1XH8A 1VYWA 3ZXTA 4G6NA 4AXDA 1YQJA 4YHTA 5TT7A 5BVDA 2ZVAA 1PHKA 2C6EA 2HWPA 4JNWA 5HCYA 2WZJA 2GDOA 3EN4A 3JUHA 5ANEA 3VS5A 2XNNA 4LDTA 4O22A 4I0SA 4ZTRA 2WEVA 3FZSA 5AP1A 2WMVA 3DNEA 4GVJA 5FG8A 3O51A 2FSMX 3FQHA 5FP6A 2UVXA 3RMFA 2UZDA 2P4IA 1M17A 3TDVA 4AOTA 1G8SA 1I09A 3ORXA 4IAIA 2GTNA 3ELJA 4B99A 3V8SA 4IAAA 1JNKA 1Z57A 2O64A 3ZS5A 4EOPA 4XCUA 4R5SA 3OW4A 1TQIA 5HE3A 4C4HA 2QC6A 3NFGB 2WU6A 3L8VA 4L43A 3H30A 4V04A 4NCTA 1TFFA 3MFTA 5HIBA 2WQBA 3IW5A 3BL7A 2E9NA 1CDKA 1PXLA 4Y5HA 2W1GA 2JKOA 4IAFA 4L52A 3WF7A 4BJJA 2ZV9A 4YGAA 3GOKA 4EOIA 5A4CA 5AIKA 4PP9A 3KXNA 3GFWA 3OOGA 3R22A 5CYIA 5AM7A 3SQQA 3PXKA 3KCFA 4AOIA 3LQ5A 5BMSA 2WNTA 4D58A 2WTJA 5DG5A 2VTJA 3I6UA 1UU9A 3KA0A 2PVKA 5M53A 5IA0A 3TMOA 3A60A 2BR1A 3K5UA 4CLJA 1M52A 2JBPA 4A7CA 3WZEA 3HL7A 2BPMA 4FA2A 4PPBA 4AACA 5AP4A 4XHKB 1BI8A 4F9AA 3I7CA 1JSVA 4WBBB 1H08A 4O91A 2R3NA 3FXWA 4MWHA 4OT5A 4RGJA 1OIRA 2YM7A 1BMKA 4FTJA 4RWIA 3P08A 4D2VA 5BQ0A 3HAMA 1JAMA 1OECA 3Q5ZA 3FHRA 4X3FA 2QG7A 5ANGA 5AV0A 4QNAA 5LOHA 4BYIA 5J79A 4FTLA 4M69A 1S9IA 1K3AA 4PWNA 5DBXA 3EOCA 3FJQE 3RPOA 2IPXA 3V6RA 4FJVA 5KCVA 4QP9A 3FMJA 4JOAA 4BFMA 4AZWA 1YXVA 3D9VA 4BKJA 3MESA 1H1QA 2JC6A 2H34A 4RT7A 4MCVA 4XG3A 4CLIA 2PYWA 1WVYA 4L00A 5CEIA 5K4JA 1XMLA 5CZIA 4WUAA 3MDYA 4FEWA 5CNOA 3PA5A 2PUUA 4TPTA 5E92A 4CD0A 2WO6A 2ZV8A 1Y8YA 4I6QA 2RFEA 5E7RA 2RIOA 5AJQA 5AR7A 3KB7A 2HW7A 3BRBA 4RJ3A 4FTNA 3QC9A 5DN3A 3PXRA 4CTCA 4YMJA 2AC5A 4GS6A 4QEBA 2ERKA 2VWYA 4A4LA 3H0ZA 4XG8A 4I94A 3TNQB 4TXCA 3SXFA 3S2PA 4RC4A 4W4YA 3UNKA 4KRDA 1W7HA 4KSPA 4N4SA 4WNMA 4AZTA 4FF8A 3G33A 4ENXA 2YAKA 1OUYA 2QR7A 3Q4TA 3P5JC 4FVQA 2WTWA 5BPYA 3R1NA 4O4DA 2X0GA 4XG9A 3SRVB 4YP8A 2CKOA 4DFBA 3FQEA 1ZYSA 4LRMA 4AA0A 4QP3A 3BGQA 4BWKA 3F5UA 1WBOA 4HCUA 3OXTA 3AXWA 4O7ZA 1KE6A 4ZMFA 4N70A 3UO5A 4L67A 3MVHA 3TN8A 4DH8A 2BVAA 4HVGA 4F6SA 5EQPA 2PZIA 3DB6A 3PVUA 2FH9A 1FMKA 5EDRA 2I6LA 2IW6A 4FG7A 4X2FA 4YO4A 5FM3A 1UNGA 3OUNB 4USFA 4FICA 4AS0A 5A46A 4L3LA 4XV3A 5CU3A 4E93A 3HP2A 3HDMA 4DINA 4I6LA 3UDSA 2VO7A 4FODA 3D0EA 4XV1A 4BTKA 4XV2A 4L8MA 4LOQA 1MP8A 2WOTA 1WBSA 3QU0A 2YM5A 2OF2A 2X4ZA 4IAYA 2NYAA 3QUDA 4FZAB 2DYLA 2XYUA 4RLKA 2CGXA 2REIA 2B52A 3NNVA 3NX8A 4PMMA 3VS2A 2F9GA 4PL4A 1PW2A 5E8TA 3LHJA 3LFSA 2QU6A 3TZMA 3NFFB 4L9IA 5LCKA 3ZSIA 4QP7A 3WYYA 2YWPA 4R78A 3PFYA 5DFPA 3LCOA 3R2YA 2UVYA 2WTCA 1JLUE 4D2SA 3SG8A 5CEKA 3HDNA 2G01A 2Z7QA 2F2UA 3MS9A 4IB3A 1S9JA 3UP7A 1GAGA 2OO8X 3QTWA 1OL5A 3BLQA 4K1BA 5CY3A 4RZWA 1RW8A 2HZIA 3WILA 4W8EA 4JI9A 4XG7A 3HV4A 4BICA 1EH4A 3E8CA 4OTHA 3KXGA 3OT8A 2R0UA 4EUUA 3F5GA 5AR5A 4BGHA 3DCVA 1IG1A 4O38A 4O0WA 3VS4A 4R7HA 4XV9A 4BCGA 2X2KA 3C51A 4NIFA 5IA4A 4ENYA 5KHXA 5C4LA 4M66A 4W9WA 2BDWA 2GPHA 2OFVA 2WTKC 4TWPA 4F7JA 1OKWA 2WXVA 3KREA 2YJSA 3SOCA 3EZRA 4BIDA 2YZAA 4IXPA 4K0YA 5L3AA 2WU7A 3KMMA 3EFJA 4D2WA 3SW4A 4BDAA 3GCPA 3K2LA 4K33A 2Q0NA 4M0YA 3FKNA 1WFCA 3Q6UA 4P4CA 2XBAA 3DAEA 4ZJJA 4O7WA 5LJJA 4AQKA 1TQPA 4O0VA 4EUTA 5DLSA 3HECA 4AA4A 4S30A 4YJSA 2OGVA 4E20A 5D41A 3DK7A 3GU6A 5HZNA 3BZ3A 4ZSGA 3BE2A 4UN0C 4K11A 3WF9A 4FTIA 2V0DA 4DT9A 4OUCA 3OG7A 2JFLA 2WMAA 3R21A 3RHXA 3FWQA 2HELA 3PG1A 5CQUA 2A27A 4ASEA 4USDA 4X0MA 1WBNA 4FG9A 4IB0A 3OZ6A 3UYTA 1P4OA 3BQRA 1V0OA 3FXXA 2UW5A 1GZKA 3O8UA 3UBDA 1OIUA 2VGPA 2PMOX 4M7IA 3R30A 4O4BB 5CU4A 4D0WA 5KX8A 3SHEA 1Q3WA 1XR1A 3ANRA 3P78A 3QALE 5KE0A 4ACCA 2NPQA 2VWUA 1ZARA 2XEYA 3Q6WA 3VHKA 3MH1A 3U55A 2XIKA 4U3YA 1GZ8A 2WMTA 4AXCA 3KRXA 4XRLA 1Y8GA 1MQ4A 4Y95A 4IADA 5KMMA 3F61A 5HGIA 2R3RA 5I0BA 1CSNA 4DHIB 4EK5A 1OL6A 4BCQA 5HEZA 2J51A 1LR4A 1ZOGA 5CSPA 3FDNA 1DM2A 4O0YA 3RGFA 3WE4A 2HWOA 3ETAA 1OBDA 5M4UA 2CGVA 3C7QA 3P7BA 2R3IA 5CSXA 3SV0A 5CALA 4F63A 1XQZA 3VUMA 5E8ZA 4JX7A 5CU0A 1W2CA 5EKNA 4ACMA 3RZFA 4JAJA 1K2PA 5IQDA 3MH2A 5HVYA 3TV6A 4NFMA 4EOQA 5HD4A 4U41A 2UW9A 2WB8A 3E8NA 4UYAA 3G2FA 1SNXA 4IWQA 4Z7HA 1ZMWA 2YISA 2OJJA 4FSUA 4YO6A 4K9YA 4AXEA 2RFSA 2W1HA 4FSMA 4FV9A 4FZDB 5GJDA 4D4RA 3KXXA 1ST4A 1YWVA 3HV6A 1H26A 3NS9A 4FL2A 4IX6A 5B0XA 2V5QA 2ZOQA 2XIZA 4FG8A 4Q9SA 3HRFA 4LGGA 3ULIA 3ORTA 1NXKA 3BYSA 3FL5A 3Q5IA 2QOLA 3JY9A 4FK3A 1PXOA 3HYHA 4QMLA 4WT6A 4YZDA 2WMUA 3E8EA 4RJ8A 2W0JA 5DWRA 2ZM3A 4BBMA 2DWBA 5GZ8A 2VO6A 3R2BA 4UB7A 4WNKA 3DLSA 4JRVA 5I9YA 2HCKA 3ACJA 3NSZA 3OUKA 2Z8CA 3D5UA 3ZFXA 5CEQA 2UZOA 3EFWA 5D9HA 2P3GX 2QG5A 3DDPA 1GOLA 4IJ9A 2GNHA 4L7SA 5CU2A 5KMLA 3LFNA 4JDJA 3R9OA 3QWKA 4R5YA 4YJOA 3E7OA 4DG3E 5HQ0A 3N4VA 4O1OA 4KIPA 5LWNA 3CIKA 4H58A 5M57A 3GC8A 2VTRA 4XLVA 4KNBA 2BZJA 3HGKA 4HPTE 3W16A 3ZLYA 5BYYA 4W9XA 5FEDA 3AKLA 2PMLX 2YHVA 2GHMA 2C69A 5DI1A 3BEGA 4G3EA 4GK2A 2YCSA 4C4EA 3JS2A 3U87A 3Q2JA 3UDZA 3BLHA 4NUSA 5JRSA 3LFEA 5IA2A 4EORA 5EFQA 4E6QA 3I1AA 2B9HA 2PL0A 5HE2A 2Y4PA 3NWWA 2BTRA 4QMVA 5CF6A 4IAKA 4FKRA 4C57A 4QOXA 3P79A 4D4YA 4F78A 3E3PA 3IPHA 4HZSA 2ITPA 5EKOA 3VC4A 3BHTA 3E92A 4D1SA 3FLWA 5JMSA 1YWRA 3I7BA 1OM1A 4KS7A 1KWPA 4C38A 2OZOA 3F5PA 4J53A 4UX9A 1G8JA 1LP4A 3F2RA 1PXIA 5I4NA 4C7TA 4ALUA 4MXYA 1YDTE 3N51A 1F3MC 3A7FA 3KVXA 4RVMA 5CXHA 5HI2A 1OBGA 3VONA 1V0PA 4MD9E 4ZTSA 3NW7A 4D1ZA 4TW9A 3WF5A 2WTKB 3I5ZA 3N4UA 1IR3A 3GI3A 3REPA 5TR6A 4LRJA 5EHYA 1OMWA 4QD6A 3KKVA 4LRKA 2J90A 4QMUA 4AOJA 4ZTHA 4Y73A 4H1JA 4KUJA 2PUPA 5ANIA 1LEWA 1M2QA 3QYZA 4IACA 4KABA 4M97A 4BF2A 3S00A 5DYJA 3RWQA 4F1TA 4FSRA 2RKUA 3DQWA 3GC0A 4W8DA 5JZNA 4H39A 2BHHA 4IC8A 2F7XE 3UC3A 2VTOA 2XKDA 3SGCA 2XP2A 3ZBFA 3NCGA 4BI1A 4O0UA 1FBNA 3DKOA 5CT7A 1OPKA 3L9NA 3FL4A 5IUGA 1Q62A 2XAOA 1E9HA 5LVPA 1SVHA 4EONA 3QKMA 5AR2A 2AUHA 3WYXA 2JDSA 5J9YA 4BL1A 5IG1A 4OW8A 3KRJA 3ZO4A 4TN6A 5KBQA 4C4JA 3VS7A 3R1QA 4TYIA 3QHRA 2XANA 1H00A 2XCKA 5FQDC 4I20A 5JGBA 5JFSA 1YOMA 4ASXA 2C6DA 4BCHA 4XRJA 4AX8A 3IOPA 3UMWA 2QO7A 3D5VA 2PHKA 3TIYA 3MB6A 4AFJA 1XBAA 2X6EA 2X8EA 1R3CA 3VIDA 5HBEA 3T9TA 4EHGA 4OBOA 3KGAA 2HIWA 4XEYA 5A4EA 4FOCA 4I6FA 3GCSA 1SNUA 3V01A 1G8AA 4BRXA 1QPEA 2PPQA 4I5MA 4N6YA 4OTIA 4YTFA 3EH9A 3KMWA 1YWNA 2PVMA 2R3JA 3TT0A 4YURA 2XJ0A 5IUHA 3TUBA 4C58A 3ODYX 3FLZA 3W33A 1IAHA 4ZS4A 2G2HA 4HGLA 4PL3A 4RIXA 2GHLA 3LIJA 4H3BA 4A4OA 3R8VA 4EJNA 2QOFA 3Q9XA 2VWXA 3QRUA 3HA6A 4IDTA 4AGUA 1NVQA 4B9DA 4EI4A 1PYEA 1VYZA 3P1AA 4CEGA 1OGYA 2VD5A 2PUNA 2IVSA 3OBJA 4RX8A 3EKKA 4KBCA 3W2CA 2W4JA 2Y6OA 4RFYA 3HLLA 5AV4A 3E8DA 4HYIA 1CKPA 2E2BA 3LLTA 3EQDA 5CX9A 5F4NA 5LMKA 4YZMA 4GU6A 1REKA 2YN8A 3ZLWA 3H4JA 3PJ8A 3U9CA 5LVMA 2PZ5A 2OWBA 3GOPA 5DRBA 2V55A 2VNYA 2WQNA 2Q83A 2P55A 2E9OA 3A7GA 4HNFA 4O2ZA 1Q61A 2HXLA 2CMWA 4RIWA 5JFVA 3QGYA 1ZZLA 3PIXA 3MW1A 3TNIA 4AW5A 5HVKA 2FGIA 5CAUA 4DAWA 5IA1A 3TM0A 4X6QC 5DPVA 3O0GA 4Q9ZA 2X2LA 3BPRA 5E8VA 2VTPA 3GB2A 3P7AA 3RTPA 4C4FA 3QQFA 4FUYA 5HBHA 2A2AA 2ZB0A 4QPMA 4AG8A 4OAUC 4DEHA 2PE0A 4JQ8A 3BLRA 4U7ZA 5J1VA 2V22A 4JVGA 5GIPE 4NL0A 3L9LA 3JY0A 1YDSE 3OT3A 2YAAA 4V0GA 3ZO2A 4AFEA 4Z55A 3TACA 4FZ7A 3AQVA 3ZCLA 4DGNA 4HCVA 3W0MA 2OFUA 1DAYA 4F0GA 4BDCA 3QQHA 3VF9A 2XVDA 5B2MA 2BIYA 2VTSA 1VEBA 4ZZNA 4O7NA 1OITA 4A9RA 5A14A 2ZJWA 5GINE 1PMVA 5FDXA 4DFZE 3SXRA 5FM2A 3CS9A 4I5PA 4J96A 3QLFA 5IQGA 5IQCA 3R8UA 4B7TA 3L8XA 4XH6A 1OPLA 2YDKA 2EXEA 4BHZA 4JRNA 4ARKA 4BWXA 1ZYJA 2F49A 3NIEA 4U81A 5FUTA 3A7JA 4I93A 1KOBA 2QOOA 5HO7A 3KMUA 3GQLA 5CSWA 3FQSA 4I1ZA 4E1ZA 1Y6BA 2EXCX 2X7GA 2W9FB 1M2PA 1STCE 1G5SA 2JFMA 1SVEA 2VTAA 3AC5A 5DRDA 5EM8A 4ZY6A 3VN9A 2QCSA 4FTCA 3CSVA 3D94A 1PMNA 3MFRA 4QTCA 3QC4A 3DNDA 4R7BA 2QHNA 1Q8TA 4QP1A 1B38A 3PYYA 2GTMA 2YIQA 4UMTA 3OW3A 4E73A 3WIGA 3EL8A 4FC0A 3MGYA 2ITOA 2BRMA 4KIKB 2BFXA 1AQ1A 3BQCA 1MUOA 3HUBA 4TYEA 2Z7LA 1BYGA 4I3ZA 3GC7A 3E62A 4F0IA 4GYGA 4XP2A 3CY3A 4JIKA 4Y5QA 4AAYA 4EYJA 2W5AA 4G2FA 4L6QA 4N0SA 4DE4A 4C2VA 3L9PA 1AGWA 5FXQA 4HVIA 4ZSAA 5KMNA 1R39A 4Y46A 5DEWA 4J8MA 2BMCA 4OBPA 2PMNX 5CVHA 2UZWE 3FKLA 4LUDA 3QD4A 1A9UA 5ANOA 4ZY5A 5AMNA 5D7VA 1VR2A 3RPYA 4MNFA 5JFXA 3QF9A 4RQVA 3SAYA 5AP7A 3ZSHA 4EQUA 3KXHA 4PNIA 4EH6A 4MXZA 3W1FA 4XG2A 4ZLOA 3ORNA 1XJDA 2WQMA 2HY0A 4ACGA 4A06A 4FR4A 3QX2A 3OY1A 4J1RA 3FYJX 3MJ1A 3R7OA 3S3IA 4I23A 4AZEA 2WQEA 2YFXA 3QHWA 4I41A 2VTLA 3LQ8A 3DB8A 3L8SA 2OH4A 3U4WA 2ITXA 3PZEA