5IA0A

Crystal structure of ephrin a2 (epha2) receptor protein kinase with alisertib (mln8237)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
286
structure length
263
Chain Sequence
FTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 2
publication title Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 263
sequence length 286
chains with identical sequence B, C
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ia0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ia0A01
3KULA 2WTKB 2R0IA 3PTGA 5HD7A 2WHBA 4BF2A 2WTDA 4EOLA 4QMXA 4NJDA 1VZOA 4EOQA 3I81A 3RGFA 4EOSA 1XWSA 3PA5A 5DWRA 2PZIA 2XIRA 4EJNA 2YISA 5EG3A 2C47A 2UW0A 3C13A 4F08A 5M09A 3G9NA 3EQGA 4G6OA 4KA3A 4OR5A 4BCJA 4BCGA 2UW3A 3O50A 4YJOA 3D0EA 4RIXB 4WIHA 4UY9A 3R6XA 2J0JA 1R3CA 3EQDA 5HNBA 1RW8A 4OUCA 1NA7A 3UYTA 3TZ8A 3UE4A 4FV8A 4R6VA 3R7OA 4J1RA 3L8SA 4QOXA 2WD1A 4O86A 5DHJA 4LYNA 2CCIA 4CKRA 2W7XA 4IAKA 4IAFA 1PXLA 4H1MA 2CKQA 2C5VA 2Q83A 4YSMA 1OL7A 4G9RA 2WOTA 3NVKI 4I5HA 3GC8A 3BHVA 5HVJA 2R3RA 4ZSLA 3DJ5A 4QTBA 2ZV8A 3FHIA 4W4VA 1PRYA 3EH9A 4JJRA 1IG1A 3LQ5A 5M4CA 1UA2A 4DH3A 4KBCA 2GDOA 3KK8A 2OBJA 4NIFB 4V0GB 4C35A 4E5BA 5FXRA 4FK6A 5JSMA 2QHMA 2W1GA 4NCTC 2C6MA 3OT8A 1XH8A 4IH8A 4PUZA 4FTAA 5HD4A 3EFKA 5HU9A 4Z16A 2UZWE 4OTFA 1KV2A 3ZFMA 1F0QA 3GU4A 4RRVA 3SW7A 4J8MA 3F69A 2R5TA 4FZDB 3LMGA 2W5AA 3FMNA 5HLPA 4QMOA 4ZTMA 4FKUA 1UNLA 4YJSA 1CM8A 4AZTA 5C26A 2WB8A 4X3FC 3DKOA 5AP0A 2BALA 3GFWA 3GI3A 4L43A 2XRUA 2B4SB 2YM3A 3UYSA 4DFUA 3QCQA 4QMMA 2B1PA 3E8DA 3VQHA 4CFWA 3G9LX 4N6ZA 3VF8A 1U46A 4L45A 3LKMA 2XCHA 3S2PA 3U6HA 3RPOA 2BRMA 4BBEA 3GQLA 2YM6A 2P2IA 3TCPA 4QMQA 1PMEA 5EW3A 4MNEB 2WOUA 4R3PA 3UDBA 3MVLA 3UO4A 3R30A 5E8WA 4CRSA 4O2ZA 3U87A 3F2RA 4G6NA 4XV3A 4C4JA 5E7RA 2YAKA 3NUUA 5D7VA 4V01A 4O7WA 3NYVA 3QCXA 3D9VA 3R1SA 3GC7A 4AX8A 2VTNA 1OIUA 5HU3A 1OL2A 5CAQA 3A2CA 2CKOA 2PHKA 4A06A 4MAOA 4WUAA 2EWAA 2F4JA 1SNXA 3Q4ZA 4M0YA 5GZ9A 2XKCA 3A4PA 4ACCA 2QO2A 1J3HA 2PVYA 3KU2A 3NUYA 5J9YA 4FTOA 4FSMA 4E4MA 2A0CX 3GB2A 4DINA 1LP4A 4UWCA 3ZC6A 5B2LA 4WNOA 2R7BA 4G9CA 2YABA 2BZIB 3FY2A 1OMWA 5HO6A 3F61A 3U9NA 2VNYA 3R8VA 3GCQA 4C3PA 5DR6A 1LPUA 3HZTA 3OHTA 4QYHA 3DK3A 3LPBA 3D5VA 4YZBA 3WZEA 3B8QA 5K5NA 3PZEA 4IAYA 3KN5A 3VS5A 3ZLXA 3H0YA 4TNDA 4GKHA 2ITQA 3ZHPC 2J7TA 3ORIA 2CN8A 3ZMMA 3FXXA 3GC9A 4O83A 4XX9A 3FKNA 2V55A 4LQMA 2YAAA 3QUEA 2VTJA 2Y8OA 3FMMA 4G17A 5CSVA 3JS2A 4DCAA 2YHVA 2GS6A 3UVPA 5AP5A 3B2TA 4U5JA 2QQ7A 4FG8A 2F7EE 2CGUA 4IM0A 4O0RA 2VTOA 2WXVA 5CAOA 3LCDA 2XNEA 4FKPA 4G3EA 1Q41A 2O63A 1STCE 2P4IA 3EQRA 4O96A 2JITA 3SXFA 3LQ8A 3WYXA 2Z7QA 3OS3A 3CCNA 3II5A 4BDHA 3JY9A 3Q6UA 4PX6A 3KRRA 3P23A 1DI9A 3BE2A 4G3FA 3HVCA 4JBVA 2PY3A 1PMUA 1YOMA 4MXYA 2BAQA 4D9UA 4F6WA 5JQ8A 4LGHA 4BKZA 4OTHA 4R7HA 3PP1A 3KL8A 4NL0A 2UZLA 3W2CA 5L2TA 2X6EA 2JAMA 3I7BA 3NAXA 3C5IA 2XM9A 4JQEA 3QQFA 4S34A 5IA2A 4GK4A 4D2TA 4L01A 3UPZA 2UZDA 2B9HA 2HK5A 3UZTA 3QTIA 4PNKA 4EORA 5M08A 3WZDA 3DBQA 5CXZA 2SRCA 3OW3A 3C0HA 5IQFA 4BCHA 3P4KA 3O2MA 3QD2B 3R1YA 3UODA 3R9OA 5IA1A 1O6KA 4L3PA 4E7WA 4BGQA 4GJ3A 3DTCA 4B7TA 4AXAA 2C68A 4RWIA 3EQPA 3FYKX 4G16A 3MSSA 3PA4A 3UG1A 3WF6A 4QP8A 3FKLA 3UO6A 3TKHA 3GCVA 4FV0A 3BWFA 4IDVA 3L8PA 3UIMA 5KZIA 4CTCA 3DT1A 2E2BA 3B8RA 3FI3A 5FD2A 5DEWA 5CS6A 4HOKA 3D14A 4DYMA 3PJ8A 4ANOA 1W83A 3FBVA 4QP1A 3SD0A 3FUPA 1H0WA 1SVGA 3ORTA 3OC1A 2VTRA 5KMMA 4N57A 2IW6A 1AQ1A 2XKDA 2OZAA 1OIRA 3D7TA 2JDVA 3F3VA 4BDDA 3QRIA 4D1ZA 4EHEA 2YLFA 3P9JA 3Q4CA 3UP2A 2XK8A 3R63A 4WRSA 2QOKA 3CSVA 4MF0A 3RAHA 2OI4X 4X3JA 4XG3A 4PP7A 4PQNA 3O7LD 3PVGA 5B7VA 1JVPP 4ZS4A 3I6WA 4NH1A 2UVXA 3P7CA 4BDBA 4IBMA 3MW1A 5FEDA 4KIOA 3MY0A 3ZZEA 2IN6A 2ZB0A 5DEYA 4JX7A 3Q52A 3VVHA 2WGJA 3HDNA 4IXPA 5GIOE 4NYEA 4BDGA 4O91A 3BQCA 2EXMA 3DDPA 4UEUA 3TKIA 3I0OA 4FT7A 2XNNA 4OT5A 4RGJA 4A4LA 5CF8A 3PIXA 3F3WA 1WBSA 2OIBA 4FG9A 4EI4A 3A4OX 4DEEA 4FSNA 4EQCA 4ZTHA 2WQNA 5IKWA 3RTPA 4JAJA 3TIYA 2IWIA 4FVPA 4C2WA 3CJFA 4PNIA 4BFMA 3S95A 1REJA 2VWUA 3WOWA 2JBPA 3CPCA 3L9PA 4H36A 1MRYA 2HOGA 4C34A 3EIDA 3ZXZA 2HWPA 2AC5A 2QNJA 2E9PA 3MGYA 4W8DA 4YJNA 3SG8A 2WQBA 3QTZA 3MA6A 3OCTA 1QL6A 2V7AA 3FHRA 5ETIA 1JPAA 4CT1A 3KRJA 2H9VA 2XKFA 3LOKA 4HNFA 4RWJA 4XG8A 3CQEA 4AGWA 4FZ6A 4YBKA 5CAUA 1PXJA 2ZDTA 3QD4A 1FOTA 2CNQA 1YXSA 3O0GA 3BKBA 1KE5A 2IW9A 4M13A 3NR9A 3G51A 5H3QA 3ULZA 3BYUA 4K6ZA 4CKJA 2ERZE 4M67A 1P2AA 2GHMA 3TL8A 3JXWA 4RIYB 4QMVA 2OIDA 4TWNA 3KCKA 4FGBA 4HGTA 5DT0A 3OTUA 3Q9ZA 1G8SA 2JIIA 2QKWB 5GNKA 3I4BA 1ZXEA 4AS0A 4JIAA 3TNWA 3FZ1A 3NYXA 4O1PA 4FV3A 5HTCA 5L4QA 4U43A 4W4XA 2W9FB 2CNUA 4IMYA 4RZWA 3AQVA 3C4ZA 2YFXA 2EB2A 4L44A 3RPRA 4S32A 4R7BA 3TUDA 3HV7A 4I23A 2YCFA 3ORXA 3TV7A 4YPDA 3R7EA 3QXPA 4DGMA 3C4FA 1B38A 5CXHA 1CSNA 1GZNA 2B9IA 2X4FA 2IVUA 2Z7LA 4QP7A 1PMVA 4WNKA 3V6SA 4EONA 3TNIA 3QTRA 4LMUA 3O71A 3C4EA 5AP2A 4NU1A 4KIKB 4BBFA 5ACBC 4CGAA 3OROA 3VS0A 2ITTA 2QO7A 1YVJA 4P4CA 4DLJA 5M4IA 2BKKA 3SRVB 5AV1A 1E1VA 3SA0A 4F09A 1S9JA 3A8WA 3KF7A 5JH6A 3ORKA 2VWXA 3WF8A 3FWQA 1H1QA 1HCLA 1LUFA 4A7CA 1XH9A 2XNBA 1PXPA 3QZFA 4USFA 2FA2A 2X2LA 3CTHA 4IWDA 4F1OA 3BPRA 3ZRLA 3CY3A 5CU6A 4PMSA 2JEDA 4Y73A 2R2PA 4FTIA 4CMTA 5CEKA 3GVUA 2Y0AA 4EC9A 3IW6A 3GC0A 4IFCA 1PHKA 4C2VA 1GAGA 2OW3A 2OFVA 2HZNA 4RLLA 2GSFA 3FQSA 4WSQA 1HCKA 3NW6A 4KSPA 3F5PA 3QXOA 3R8ZA 3VBTA 3R9RA 5C27A 5A14A 3VO3A 3VN9A 5L2SA 3FLSA 3UMWA 3PJ3A 4C62A 4PDPA 4S33A 2YJSA 2BIKB 2XEZA 3MVMA 1YKRA 2BAKA 3AC1A 5HI2A 4A9TA 2FSMX 4FTTA 4ZZOA 4K33A 3EN9A 3EB0A 5CY3A 2G2HA 4QT1A 2R3JA 3VAPA 4DN5A 5EDPA 2EB3A 3N4VA 3NW5A 5C4LA 3BI6A 2CKEA 1NVSA 3FZPA 4FNXA 4TYJA 4U40A 3BEGA 1JBPE 1QCFA 3S00A 5IA5A 4EH2A 1ZYSA 2DWBA 4CFFA 3MY5A 4QP9A 4TZRA 4NW5A 1ZAOA 1PW2A 4HCTA 1PXOA 4I5MA 3VUHA 3ORLA 5E8VA 2QURA 5LVMA 2C0TA 2GNJA 3F88A 2JC6A 4AWIA 5M07A 3KXXA 5HEZA 3RPVA 3LMIA 5HX8A 4QRCA 5LWMA 2PMOX 5TT7A 4AAAA 2W05A 5L2WA 4JR3A 5AP3A 2FB8A 2J6MA 1GIHA 4S31A 4DFNA 4K2RA 4ZAUA 3FPQA 2JD5A 5IMEA 2UZVA 3SW4A 4DT8A 4EHGA 4R77A 4JT3A 4ZZMA 3QALE 3VUIA 3FMEA 3HV4A 2P3GX 2QODA 3R83A 5C9CA 2GS7A 2R3OA 1M17A 2WZJA 2X0GA 3CD3A 3P7AA 4D1SA 3DOGA 2H6DA 4MQ1A 3MBLA 4XRJA 2XA4A 4CEGA 2OJGA 3HAVA 2XRWA 4ID7A 1P4FA 3EOCA 2R3NA 4GIHA 1AD5A 2BKZA 2ETMA 3A8XA 1TQIA 4EHZA 2QOOA 4KBAA 4EOPA 5GZ8A 3VBXA 3UZRA 5IUHA 2GNHA 2HYYA 3TXOA 5M44A 1Y8YA 3OD6X 4EBVA 4Y83A 2HCKA 3LVPA 4IWQA 1Q8UA 4IM2A 2R64A 4HGSA 3BRBA 3QHRA 5ANKA 4C8BA 2GQSA 3DTWA 2LAVA 4PL5A 5HZNA 3D2KA 4UMPA 1NW1A 5IA0A 4Q9ZA 5CASA 5DNRA 4DBNA 4DH8A 4LL5A 3PPKA 4U9AA 2UW9A 5CT7A 3R8LA 2XIZA 4HZSA 3V8SA 2BILB 1OM1A 3OCGA 4FT5A 4GUEA 3VIDA 3EHAA 2X2KA 3C4XA 1Q3DA 2VO3A 4UN0C 3OWPA 1ZOEA 3V5QA 4JX3A 5FLFA 5E91A 5EYMA 2JAVA 2YWPA 1BX6A 5BMMA 2VX1A 3NYNA 3LMHA 3CQUA 1DAWA 3C4WA 3GP0A 4TYIA 4EYJA 2R7IA 2QR8A 3ALOA 3QAME 5AP6A 2UW7A 4U45A 5HE0A 2BMCA 3O51A 1W8CA 4I6BA 4KS7A 5ICPA 2BUJA 3G33A 4X2NA 5CZIA 5DG5A 2J0MB 3D5XA 4U6RA 4YTFA 2J0KA 4L67A 3GUBA 1KE8A 4ZY4A 2XBAA 5ANDA 4FKOA 4L9IA 4NCTA 3UMXA 3NS9A 4AW1A 1DI8A 3CGOA 1IEPA 3L1SA 5EQEA 3BLQA 5DGZA 4BCFA 4L68A 4ANBA 4R3RA 5K0XA 3N51A 2WELA 4BYIA 3P0MA 2R0UA 2VWZA 2YZLA 1L3RE 3BZ3A 2CDZA 4X6QC 3F6XA 2CLQA 5JFWA 1MP8A 4LV8A 2BR1A 1V0OA 4G3GA 4S30A 1JKSA 4O6LA 5T3QA 3OWJA 4X3FA 3R8MA 3RPYA 2XMYA 1W84A 2C5XA 2X2MA 4UALA 2OF4A 3R7VA 4ALVA 1L8TA 2W4OA 1FQ1B 4RIWB 4RSSA 3N4TA 2CCHA 4KUJA 2HELA 2IZUA 2J4ZA 4YC6A 5BUIA 2XK7A 5BVDA 2UUEA 5C03A 4IX4A 3BWJA 3ANQA 5I9XA 2PVFA 3DJ7A 4BWPA 3JY0A 5B2KA 4DFYA 2BZKB 3V5JA 5BX0A 4IFGA 2W17A 3MTLA 4MXOA 3GQIA 4C4FA 1Y57A 3CS9A 2GQRA 4XRLA 4F6SA 3VS6A 1UKIA 1H1PA 2XK9A 2YIXA 2IZRA 5FEQA 3TNQB 5LVPA 4ZMEA 5AR4A 4FSTA 2J5EA 5I9WA 2PVJA 4DFLA 1J91A 3RK7A 4FTCA 5DT3A 3W10A 3QF9A 5IUGA 2XJ2A 3AT4A 2UVYA 3BYOA 4Y8DA 4F0IA 3ZM9A 2YIQA 4FNWA 1JSVA 3N9XA 3Q5ZA 3FMLA 4IAAA 2OK1A 4FTUA 3CXWA 4BCKA 4F7SA 3HKOA 4D2VA 4UYNA 5EOLA 5BVNA 3KFAA 2I6LA 4DG2E 2ITYA 3GCSA 4DF3A 3TT0A 3V01A 3KA0A 4FG7A 5AUVA 3OEZA 3HLLA 4CG8A 3KB7A 1YOJA 3FI4A 4WG3A 4AA0A 4BC6A 4YC8A 3FJQE 5JFXA 1UKHA 3RWPA 4MNFA 1FVTA 4C3FA 5CVHA 3ETAA 4MBLA 3TZ7A 4C02A 3F2NA 3KXHA 4H3BA 4CLIA 2VX3A 3EQIA 4ASEA 3QGYA 4CCBA 2OZOA 4PP9A 5F1ZA 2WAJA 2ZJWA 4FSQA 3G6GA 4RFZA 4DEGA 3HUBA 2BRNA 1H01A 3T9TA 4BY9E 1KUTA 4RPVA 3NYOA 3PSCA 2VO6A 3E93A 5A4TA 4ZJJA 1Q5KA 4BYJA 2OZAB 4RG0A 3TTIA 5TF9A 3D7TB 1MQBA 5EHYA 4O7RA 3MFRA 4U3ZA 3W2QA 4EUUA 3PJ1A 3LHJA 2YDJA 2I1MA 2ZVAA 2PYWA 3PY3A 4RWLA 3KVXA 2X4ZA 5AP7A 3PJCA 3QC4A 5AUUA 2V62A 4IVCA 3AT3A 4JOAA 2XJ0A 2VX0A 5BMSA 4C4HA 3FL4A 4I93A 4IAIA 2QLUA 2I0EA 4YGAA 3UC3A 4JG6A 3A7JA 3OTVA 3R04A 3MFTA 4KRDA 4RJ8A 4WHZA 2YWVA 3QTXA 5KNJA 2VU3A 3EQCA 5EYKA 2YEXA 1RQQA 3BYSA 4J53A 2QOLA 5IEVA 5BYLA 4KRCA 5EH0A 1CTPE 4IX6A 4LRKA 4XYFA 4ASDA 4ZLOA 2QD9A 1JOWB 2WEVA 2BTSA 4FTNA 5IPJA 3MH3A 4HPTE 4QPMA 3DK6A 3PA3A 1K9AA 2W1IA 3R22A 2IG7A 1ZYCA 3D83A 4AOJA 1DS5A 3EZRA 2WTJA 3V04A 1G3NA 1OL5A 4CV9A 3ODYX 5KBQA 4ANMA 3KY2A 3U55A 5CT0A 3OEFX 5LVNA 3TG1A 1M2QA 4JQ8A 2PTKA 5H8GA 4EH4A 4BICA 3FE3A 4AZSA 4HW7A 3NUXA 5DLSA 3FQEA 2X7GA 4KWPA 3H30A 2X39A 5IMXA 1JAMA 4BTMA 4RFYA 3D4QA 2QU6A 2HXLA 3ENHA 4AW2A 4GFOA 4GUBA 4J96A 4JVGA 5M55A 2PE0A 3UQGA 4F63A 5KMIA 3OOGA 2GFSA 3QKMA 1ZY5A 5FTQA 4D28A 1PJKA 5JFVA 3KRLA 2Y4IB 3VUKA 2PE1A 4BIDA 5HVKA 4EH6A 3V8TA 3OY3A 4EBWA 1MUOA 4I0TA 1OUYA 4E1ZA 1LEZA 3PIYA 3LFEA 4YNOA 3LM5A 4BBMA 1NVRA 2OFUA 2VRXA 3ELJA 4U7ZA 4YU2A 2BRGA 2YM8A 4IHPA 3ZM4A 4FL1A 1ZOHA 4CFUA 4ENXA 3Q60A 4BHZA 5HORA 4MVFA 5ANJA 3G6HA 3MH2A 3UIBA 2C6IA 4GH2A 3ZLYA 5KMNA 3KXNA 4E3CA 2ITPA 3M11A 4EOIA 3MESA 2BFYA 3F5UA 2LGCA 3I60A 5HE2A 3MTFA 5JQ5A 4F7JA 2Z60A 4N4SA 3OXTA 1YHSA 2A2AA 4RJ4A 2PVMA 4ZTSA 5IZFA 4XP3A 3PXZA 3PY0A 1WFCA 1JKKA 2G2IA 2VO0A 4EK8A 1J1CA 2HZIA 2WIHA 2XNOA 3ZO2A 3KXZA 2WQOA 4ZSEA 4ORKA 4JBQA 3MN3A 4EZ5A 2A4LA 3VS7A 4YTHA 3FDNA 4HVSA 4R78A 5H8EA 3RCDA 2J9MA 3BELA 3E63A 3CLYA 1UU3A 2V22A 3I79A 5A9UA 5IQGA 2YCQA 4O2PA 5A3XA 4CFMA 4P5ZA 4O27B 4QYFA 4RJ3A 5E8SA 3OBGA 4BRXA 3I5NA 3QZHA 1V1KA 3VC4A 2ZMDA 3LJ2A 1IAHA 1OPJA 5IQBA 3DBDA 1FPUA 3LFQA 4EKKA 5CSHA 5AR7A 4RZVA 2OJIA 3IGGA 2CGXA 5K4JA 2W4JA 1WMKA 3QWKA 5DI1A 5F95A 5EDRA 4O7ZA 5HTIA 3V51A 2UW8A 3DLSA 4ZP5A 3U54A 3GT8A 3HMPA 2FSLX 4PDSA 2WMRA 3E8CA 4DHFA 4S2ZA 5M57A 3LAUA 2BAJA 4ALUA 4EOJA 1S9IA 2BDWA 3FLQA 3MH1A 3FXWA 4FODA 4BKJA 1OPKA 1BYGA 1KE6A 1QPCA 3DBEA 3E8NA 4MTAA 4ZLZA 2BZJA 2JDTA 3ZBFA 3OWKA 5GHVA 4D55A 4HVIA 1ERKA 1UU9A 4ZIMA 3TN8A 2X81A 4E73A 4FGRA 4CYJA 1J7UA 2XH5A 3SXRA 4EZ7A 3S1HA 2UZBA 3LZBA 2J50A 2QC6A 3QLFA 4RVKA 4XH6A 1ATPE 1YI3A 2OH4A 4AGDA 4ZY5A 3MJ1A 5EQYA 4FR4A 4KSQA 4PV0A 2YIYA 1YHWA 2ITWA 3G0EA 4GFGA 4OTQA 1VR2A 2CGVA 3BIZA 1OKVA 1Q8WA 3WF9A 4IAZA 2WEIA 3DK7A 3IKAA 2OSCA 1OKWA 1XR1A 2JKOA 3OF0A 4FKTA 4MD7E 5IQHA 3IOKA 5LMAA 4PMPA 2XNPA 1GIJA 5M06A 3DQWA 3WZUA 5FEEA 4ZZNA 2VV9A 2C1BA 2Z7RA 1Q24A 3JPVA 5D7AA 4HYSA 5FBOA 5C1QB 2C3KA 5CNOA 4AU8A 5ANIA 3GU6A 2ETKA 4LL0A 1T45A 2DYLA 3DNDA 2VGPA 3D7ZA 5FXSA 3VQUA 4AFJA 4TL0A 2YM7A 4KKEA 3VUTA 2FO0A 5BYZA 4AQCA 3EQHA 1CKPA 3C0GA 4D4RA 1PKDA 5K3YA 4NKAA 4QQJA 5F4NA 3EMGA 2HZ4A 4QP6A 3RVGA 4WT6A 3DKFA 3NMUF 4RC4A 2ITNA 1K3AA 4Q5EA 4Z7HA 4ANLA 4QNAA 1Q61A 2VWWA 4RMZA 5E4HA 3MDYA 4FL2A 2VO7A 4QP4A 4FSUA 3A61A 5IA3A 4ONAA 3A7HA 2PK9A 2OXYA 3OUNB 5EYCA 2IVTA 3GGFA 4TWCA 4BDJA 4OTGA 4CZTA 1F3MC 5CLPA 4O7TA 2C5NA 5GINE 3T9IA 3CTJA 2OO8X 4H39A 3P5KA 4PL3A 3FC2A 5E90A 2CGWA 4LOQA 3MWUA 3HP5A 4YZDA 4RFMA 4QMTA 4ZY6A 3CE3A 3ZUTA 5CX9A 1FMOE 2OJJA 3Q9XA 3ZSHA 4A9RA 3CPBA 5KMJA 5HKMA 3UQFA 1FINA 4IB5A 3GNIB 5JN2A 1OECA 4I5CA 2I40A 4E6DA 1P4OA 5F20A 4TWOA 4FOCA 1ZWSA 1BLXA 5D41A 2JDSA 3H10A 4IZ7A 4PTCA 4TXCA 4UV0A 3O8UA 2JBOA 5A4QA 1BL6A 3K3IA 4AG8A 3PG3A 2JKMA 4YO4A 3UZPA 3LXLA 4EWHA 3N4UA 3C50A 3BV2A 2RG5A 5J8IA 2E9NA 2ZYBA 2PMNX 5M4UA 5J1VA 5LJJA 2B52A 4RC2A 3ZRMA 3DZOA 3LLAA 3O8PA 1OKYA 4CKIA 2ITOA 1KSWA 5FG8A 5E1SA 1JKLA 1QMZA 3AC2A 5EKNA 4TYHA 5BUJA 4BIEA 2REIA 3C4CA 5I3RA 4WBOA 5LOHA 4X3FB 4FSYA 4WD5A 5DRBA 5B0XA 4PL4A 4F1MA 3ID6C 2JIVA 5HIDA 2UZTA 4FKSA 2X8IA 1YWVA 4PPAA 3BU3A 4GIIA 1XH5A 3AC4A 1BL7A 4NM7A 3OP5A 2PVHA 4RVTA 2O64A 3H0ZA 5CVGA 4KS8A 4E6QA 4APCA 2CHLA 4X2JA 3R7UA 3ZBXA 4O0SA 4FUYA 3L9LA 2JKQA 3QTWA 4JDJA 3OY1A 4NKSA 4LG4A 4CRLA 4XMOA 3ZONA 5CNNA 4M69A 3P1AA 3V5LA 2GHLA 2W5BA 4C38A 3VBWA 5CEIA 3NUNA 3QUPA 2QG7A 4QD6A 4EC8A 5J1WA 4AUAA 4FK3A 3POZA 3EZVA 4NT4A 3VUGA 4IJ9A 2QKRA 3R28A 5JFSA 1WBTA 3PLSA 2C30A 2WTWA 3CP9A 4FTJA 3GOKA 1FVRA 3FLYA 4BDFA 3SGCA 5AWMA 5AX9A 5TR6A 4YC3A 4XP0A 2J0IA 5AJQA 3TJCA 4ITHA 4IB3A 5HOAA 3TEIA 3D2IA 3QA8A 3OMVA 4XOYA 3NUPA 4GW8A 3AC3A 3L8XA 5CAVA 1XBCA 3ZSGA 2RF9A 4HGLA 4C33A 4V05A 3FLZA 3O7LB 4LRJA 5EHOA 3LJ0A 4ZSAA 3IO7A 4I20A 3DKCA 3BLHA 4KBKA 5EHLA 4DFZE 3FEGA 2ITZA 4KNBA 3R8PA 4MXXA 2OICA 3W2PA 4I4FA 3QYZA 3LXKA 4I21A 4WG5A 5E8ZA 3UPXA 5HG8A 4ACDA 5CYIA 1LEWA 1ZYLA 3FV8A 3KKVA 3HA8A 3MVJA 3FC1X 4MXCA 2OU7A 2XYNA 4W9WA 5CF5A 3VHEA 4O21A 4ITJA 1U5RA 2B9JA 2QOCA 1UU7A 1IR3A 4GL9A 1Y6AA 3QLGA 4GYGA 4XLIA 3ZDIA 1SZMA 2R9SA 3CC6A 4FEVA 3E8EA 3LLTA 4OTPA 5IQCA 4FV6A 4F64A 3W1FA 4XV1A 4FA2A 5KUPA 4I92A 3AD4A 1DAYA 4FKVA 2R4BA 4QMYA 2GU8A 4U80A 4L46A 3C5UA 2C6LA 5KMLA 5H2UA 3U9CA 3NX8A 4MD8E 5J9ZA 1YDSE 3RPSA 4MWIA 4BDAA 4BI0A 3QQJA 5D9HA 3TNPC 3NUAA 3CY2A 3OXZA 1FGKA 3WE4A 4OGRA 5I0BA 3AD5A 2YM4A 3Q5IA 4XS2A 3RKBA 1UU8A 4NM3A 4O22A 4EH3A 3Q2MA 1JLUE 4QMUA 4HVHA 2BCJA 1Q97A 4APPA 3QA0A 2ZB1A 3R21A 2ZM4A 5IA4A 4GK2A 3MJ2A 5M53A 2PMLX 4GFMA 4MD9E 4NFNA 4FEUA 3DB6A 1M7QA 3ZEPA 4B6LA 4FEWA 5HO7A 2QOIA 4I0SA 2PVNA 3CQWA 2DQ7X 5KCVA 3EWHA 3VS4A 5AAEA 5DBXA 5I9VA 3PPJA 4YZMA 3QD3A 3QD0A 1WBNA 2C0OA 2VN9A 3QQHA 4M12A 5JKGA 5HGIA 3C0IA 3OW4A 4MHAA 3KC3A 4KIQA 2BVAA 1OB3A 3R71A 4KAOA 3R0TA 3HRCA 3POOA 1OUKA 1YOLA 3BQRA 4PMTA 2VD5A 2GNLA 3A7FA 2ACXA 4HCUA 2QOBA 2PVKA 4M97A 4USDA 3R9HA 4GT4A 4KABA 2WKMA 4D5HA 4EH7A 4EKLA 4IC8A 4F70A 3WI6A 3KULB 4J7BA 2YCSA 4C4IA 5CSPA 2HY81 3QC9A 3IGOA 3R73A 4F65A 4XP2A 1IA8A 1WZYA 4YHJA 3TJDA 5CQWA 2ZAZA 5G1XA 2PVRA 3UNJA 3JVRA 3WIGA 2RL5A 4JRVA 3ATTA 3VS1A 2OKRA 4GU6A 5EI6A 2PMIA 4GSBA 3DDQA 5IG1A 1GZ8A 3AG9A 2WMSA 2A27A 3VJNA 1NY3A 3RWQA 1E9HA 3G0FA 5FGKA 3RCJA 1IASA 4DAWA 5JMSA 4UMTA 2QI8A 3OOMA 2PU8A 4YJPA 5C8MA 3F5XA 2BTRA 3DAEA 4FKWA 4YJTA 5AAFA 3OCSA 3RP9A 3U8WA 3SHEA 5AIKA 5BVFA 2R3IA 5HCYA 5HG5A 2GCDA 4BCIA 1A9UA 5FP5A 3LFDA 4LV5A 5CENA 4FSWA 3IONA 3RM6A 4B8MA 2NRYA 3NIEA 3ROCA 5DR2A 1ZRZA 4O7LA 3DCVA 3DY7A 2BHHA 1NT2A 5EQPA 4FKJA 5JGDA 5AIRA 4RJ7A 4JR7A 4R3CA 4FIGA 3P79A 1BUHA 4M0ZA 3RAWA 4Q2AA 1GOLA 2FH9A 3K5VA 2XNMA 4ITIA 4U97A 3ANRA 5DE2A 2F49A 4AE6A 1UNGA 5AFVA 1MRVA 2ZM1A 4YTIA 3UP7A 4H05A 2O65A 2RFEA 4NIFA 4V0GA 4N0SA 4CZUA 3HUCA 4YPSA 3R2BA 2OJ9A 4IX5A 3MYGA 5FUTA 3E7OA 4HPUE 3ZZWA 5CI7A 3AMYA 1MQ4A 5I9UA 3E7VA 3ET7A 4FNZA 4ASXA 4F9AA 4FT3A 2XUUA 5DT4A 1RDQE 4AGCA 3TI1A 5IH6A 3DFCB 3PJ2A 3UQCA 3PUPA 2I0HA 1F5QA 2YJRA 2OXXA 4HVDA 4AW0A 3EL8A 4AN9A 3HNGA 3QFVA 4D0XA 2BIYA 3HP2A 5D1JA 4LM5A 5BNJA 2CNVA 3EKNA 4MBIA 5BYYA 3GCPA 1KOBA 3O23A 5IISA 4CSVA 5IDPA 1CDKA 3KN6A 4JAIA 2X8EA 4NJ3A 3OZ6A 2RGPA 3DGKA 4OBPA 4Q5HA 5A6OA 5FDPA 3SG9A 2C6OA 3VHKA 5EW9A 5AEPA 4BDKA 4M3QA 4HCVA 3GU7A 3CKWA 2OH0E 3RK9A 2ITXA 4FEQA 3ATSA 2JIUA 4J95A 2H8HA 1KOAA 4J98A 4FI1A 3EQFA 4JDKA 3LE6A 5I3OA 2W06A 2C5YA 3ZO4A 3Q96A 4IVAA 4EWQA 2HW6A 4X7QA 3PP0A 1FMKA 1Y8GA 2UZUE 3NSZA 2R3QA 2X1NA 4BCNA 4QP3A 4FYNA 2OG8A 5G6VA 3Q4UA 4IJPA 4DGLC 4DG3E 2YCRA 3D94A 2E9OA 4WRGA 4AP7A 4D2SA 5HTBA 4H3QA 2C6TA 4E20A 4IE9A 5ANEA 5L3AA 3I0QA 3TUCA 4RA5A 2J90A 2GNFA 2UV2A 3TUBA 2QR7A 4G1WA 4MYGA 4BCMA 1VYWA 1XH6A 3KXGA 4BTFA 4H1JA 1WVWA 4QMLA 3OFMA 3IECA 4NK9A 4AA5A 3R9NA 3QGWA 3SC1A 1UWJA 4IX3A 1KV1A 3DS6A 5H9BA 2HY0A 1JSTA 4FEXA 3C1XA 4O38A 4Y85A 1Z9XA 4LOOA 3QU0A 5L8JA 1DM2A 4HJOA 3F3TA 1YDTE 2W1HA 5T68A 3TKUA 4ACGA 2QOHA 3HMIA 4E5AX 4M68A 4EOMA 3PXRA 4DFBA 3EJ1A 5KHWA 4YZCA 2OLCA 4MXAA 4QQ5A 3TNHA 4FIJA 4E4NA 5AUZA 5FDXA 3UVQA 3WYYA 5M51A 3C51A 3AT2A 5E1EA 1YXVA 2VNWA 4CTBA 1CMKE 1OZ1A 2PPQA 4L3JA 3PSDA 1R78A 4PPCA 3HRFA 4KD1A 1W98A 4B99A 3TZ9A 2PSQA 2XS0A 3RAIA 3QX4A 4FF8A 3G5DA 4GMYA 4XG2A 3BHHA 5TKDA 3R00A 5EM5A 4M15A 2HIWA 5DVRA 2A19B 4PRJA 4HYUA 4QMNA 4RX7A 2YM5A 4I94A 4BR3A 4DLIA 3NLBA 3PDTA 1SVHA 2GTMA 4JXFA 4UWYA 3F7ZA 1YWNA 5FQDC 4HYIA 4AF3A 5CEQA 2W1FA 3VBVA 1NVQA 1BI8A 4CNHA 1WBVA 4O7NA 4O82A 3LXPA 4TYHB 2QHNA 2C69A 4BDIA 3V5WA 5LMBA 2V0DA 5AM6A 3W32A 3U6IA 4LI5A 3UO5A 3NEWA 3ERKA 1X8BA 4BZOA 4KKHA 4G34A 3H9OA 3W8QA 4YJQA 2RFNA 4BTKA 3FYJX 3EL7A 3D5UA 3IW8A 4PPBA 3ZTXA 4YURA 1Q4LA 3W2SA 2J51A 3RALA 1A48A 3VUDA 4FV4A 5DR9A 5JK3A 4C0TA 2O0UA 3ORNA 2VTLA 4HNIA 4A4XA 5IU2A 1VEBA 4WSYA 3Q04A 2I0YA 2QONA 5EYDA 3W55A 3E87A 5IH5A 2FVDA 1O9UA 2W99B 4M69B 4P5QA 1WAKA 4DH1A 3PWYA 4YHTA 5DYJA 2BZHB 1APME 1UWHA 5IDNA 4AE9A 4EL9A 2JLDA 3MY1A 4BHNA 1ZMUA 2VAGA 1H26A 2CMWA 4QPSA 2C6KA 4O7YA 5D11A 3UOHA 1U54A 4C58A 2Z7SA 5LMKC 4GYIA 4QP2A 3BLRA 5BUEA 3ORZA 2FGIA 3E92A 4F9YA 2I7QA 1ZOGA 3KREA 2WTIA 3HMNA 4FICA 2XP2A 4D4VA 1VJYA 3UJGA 4DGGA 2UZOA 2Y6MA 4LRMA 3F5GA 4D9TA 1H27A 2HENA 2GNIA 4O81A 4ZTNA 2HXQA 4FC0A 4K9YA 4M7IA 3SLSA 1GNGA 4PTGA 4XG4A 2BROA 3ZS5A 1M14A 2VTQA 4IWPA 4RJ5A 1BKXA 3COMA 1V0PA 4UWBA 4ZSGA 5DA3A 1WCCA 3LQ3A 2W5HA 1O6LA 3ZRKA 1YRPA 4LFIA 4EH9A 3DBFA 3VF9A 3IK3A 3IS5A 4YNEA 2R3FA 4FTRA 4F9BA 3QQKA 1Z5MA 4I6HA 3IPHA 3FY0A 4IIRA 4FUXA 1YXUA 1SVEA 2UW6A 2C3IB 5HQ0A 1OVEA 4FSRA 2VTIA 3MPTA 3RNYA 4JBPA 4ASZA 2W1CA 4QYEA 1H4LA 4RQKA 2QVSE 5FM2A 5FXQA 3Q6WA 1E1XA 4D0WA 3MB7A 3NRMA 4WO5A 4E6AA 4CVAA 5AA9A 4G5JA 5HE3A 5JGAA 4X6RA 2ZV7A 3BX5A 1A06A 2X6DA 4OW8A 3UOLA 4EHVA 5CEOA 4GT3A 4QTDA 2W4KA 1G5SA 5HBHA 4X21A 5TO8A 3JVSA 4UX9A 4E4XA 5CWZA 3E3PA 4FTQA 3D5WA 4JIKA 2JFLA 4ZMFA 5ACKA 1QPDA 4X2KA 5E92A 1OIYA 1H00A 4YTCA 2CPKE 4QTCA 4FKRA 4DH7A 5AX3A 2NP8A 4C57A 4ZLYA 2Q0BA 4F9WA 4JG8A 1Q62A 5CZHA 3GBZA 5JZNA 2F2UA 3H4JA 4K1BA 4EQMA 5DN3A 1H0VA 5KMOA 3UTOA 4BDCA 4D4YA 5A4CA 3ROYA 4R8QA 1JSUA 3F3UA 4O7VA 3NWWA 4IB1A 3GENA 3PZHA 4E26A 2G01A 3THBA 2WMXA 5L6WL 4ZXTA 3ZCLA 4XG7A 3UNKA 1TKIA 2X9FA 5ITAA 4WA9A 5AM7A 5HO8A 3E3BX 3OCBA 4XG9A 5LVOA 4BI1A 4FIEA 5JGBA 3BYVA 4GG5A 4W9XA 3VBYA 4OLIA 4FKGA 3UNZA 3KMWA 3WARA 5DOSA 1I09A 1PYXA 2ZM3A 3IDPA 4L6QA 4PDOA 4QNYA 3S3IA 4GJ2A 4RIOA 4GVAA 3W2OA 4C4GA 3UG2A 2W96B 5I5ZA 4F7NA 2GQGA 5EM6A 4B4LA 1FBNA 4TTHB 4KIKA 3EKKA 2JDOA 4E6CA 4EZ3A 2ONLC 3NCGA 4K8AA 5HNGA 3LIJA 5DH3A 5KMKA 4BTJA 4DTKA 4R5YA 2PZ5A 3NNXA 2BRBA 4CT2A 4BDEA 4TKSA 4RX5A 2RIOA 4XHKB 3UVRA 4DFXE 3CBLA 3NZ0A 4G3CA 4R1VA 3ZH8A 4C7TA 5I9ZA 2PULA 1SM2A 2R3GA 2QOQA 3BEAA 4XG6A 5JRQA 2WMAA 4E93A 3JR1A 3FMHA 4TYGA 3LCKA 4BGHA 5CF6A 3ZYAA 1G8AA 3OBJA 4JL9A 4EOOA 3PVBA 4ZTLA 3DA6A 4JI9A 4JDIA 3FSKA 5AAGA 4MF1A 5CALA 5BPYA 2X7FA 2HW7A 5KBRA 4AZFA 4FE2A 5AR5A 5HLWA 4EH5A 2NRUA 3H3CA 3W8LA 2C3LA 1YI6A 3ZFXA 4XBUA 4G5PA 4GKIA 3EQBA 3U4UA 2JKKA 1BI7A 1ND4A 3KQ7A 2C4GA 2YN8A 4GVJA 3RINA 4C4EA 3AGMA 3IDCA 3LXNA 4HGEA 3VBQA 5JEBA 3DXQA 3VRZA 3ZO3A 3UC4A 1XBAA 4F9CA 5GZAA 1WBPA 4AZEA 3WILA 2PZRA 2IVSA 3ZLWA 4JS8A 2H96A 4GCJA 5EM7A 5HIEA 3QCYA 1PF8A 5E8YA 3DZQA 5AMNA 1R1WA 2Y9QA 3RHKA 5KE0A 3MV5A 4ZOGA 5AR2A 1JQHA 3QQUA 4JQ7A 3ALNA 4X2FA 4U79A 4AN3A 4J99A 4II5A 3QZIA 3R1QA 5J95A 3DBCA 1AGWA 5A6NA 3MPMA 5ETCA 4CCUA 3W33A 4MEDA 5KX8A 3ODZX 2DUVA 4J97A 3DAKA 5LVLA 2PUPA 4YZ9A 5CTPA 2OWBA 4TY1A 3I7CA 3PWDA 3R01A 4RLKA 3RJCA 3F66A 1MRUA 3IQ7A 3NNVA 2V7OA 5J79A 2YZAA 4FNYA 4IWOA 1KE9A 2P0CA 3ZDUA 4CQEA 5FM3A 5KKRC 5K4IA 3DXNA 5L2IA 4U42A 3NVMB 1YQJA 5CEMA 3ZXTA 2JDRA 2NO3A 3FZTA 4UMUA 5EI8A 5K9IA 2IPXA 4FSZA 3I6UA 2ZOQA 4UMRA 3GCUA 1Q99A 4FV7A 3PPZA 4CXAA 4GG7A 4ZEGA 4I0RA 2O5KA 1UNHA 2VTAA 5HICA 3EN5A 3KEXA 4QMSA 4QMPA 3VRYA 4AOIA 2Y7JA 4CG9A 4AW5A 4HYHA 3OT3A 5F94A 4IQ6A 5EDQA 3CTQA 3QKKA 5A4LA 5B2MA 3IW7A 3NIZA 4H3PA 4ALWA 3UOJA 1H24A 5L6OA 4NEUA 1RE8A 5AR8A 4FKQA 4IZ5A 3JUHA 4N70A 2YERA 4JG7A 5ANOA 4A9YA 2B54A 4NTSA 4FIHA 4B9DA 2YDIA 1JNKA 2RKUA 3BBTB 3NDMA 4EOKA 1EH4A 4XNEA 4FX3A 3TV4A 4C36A 5J5SA 3F82A 4CQGA 1OITA 1H1WA 3SVVA 4FZ7A 4D2RA 4MWHA 4A9SA 2YITA 3AC5A 2IJMA 3Q32A 3H9RA 4BN1A 2Z2WA 3K2LA 3QUDA 2B0QA 4O0UA 3V8WA 3LFAA 2KULA 1Z57A 4UB7A 5AP4A 4X0MA 5IEXA 3FZRA 5HLNA 3MI9A 5CI6A 4UXLA 3KVWA 5GJGA 2QO9A 3AD6A 3QYWA 3G90X 1H8FA 4JLCA 3T8OA 4BIBA 3GFEA 1UV5A 3ZUUA 4RIWA 1H07A 4XCUA 3MPAA 2PZYA 4U0IA 4I22A 4D1XA 2B9FA 4XBRA 3LFNA 2QOFA 4F0GA 4DA5A 5C4KA 4BL1A 3PVWA 5LARA 5E8TA 4UZHA 3RM7A 1TQPA 1T46A 4ANQA 4G6LA 4P90A 5FP6A 4B0GA 4C59A 2VTSA 3PVUA 2PZPA 4TPTA 3Q4TA 3COKA 2R3LA 4J71A 5AV2A 5CF4A 4RVLA 2GS2A 5J5TA 4W8EA 3SOCA 4ZS0A 1PXMA 4EK3A 1HOWA 5KKRB 3ENMA 5HCXA 4ZTQA 3KRXA 1XH7A 3VJOA 1M2PA 4E5WA 3R7YA 1OKZA 3AOXA 4DTBA 4L7SA 3EFWA 1PXIA 2UZNA 4O0TA 2WQEA 3C7QA 5EW8A 1YI4A 4HZRA 4A4OA 3QZGA 2FSOX 2XJ1A 3KF4A 5K0KA 2X7OA 4D4SA 4E8AA 3EFJA 3ZO1A 4IZAA 4QMZA 1OBDA 4V04A 4QTEA 4L52A 4FZAB 4ZJVA 4CFNA 4C3RA 2ZV9A 3O17A 3GEQA 4G2FA 4EUTA 1FVVA 3E5AA 4MH7A 2R3MA 3NPCA 3HRBA 4YR8A 1SMHA 3DNEA 5DFPA 2QCSA 4O1OA 4OTIA 4QTAA 1M7NA 2IO6A 5A4EA 2OIQA 4JDHA 3FL5A 1U54B 4I6FA 4O0WA 3P7BA 2GHGA 3P08A 4EYMA 3MFUA 4DEAA 3QQLA 3EN6A 3V5PA 4ACMA 1H28A 1ZYJA 4RX8A 1OI9A 5KZ0A 3ACJA 3GXLA 5C8NA 2VTHA 1XKKA 4U44A 2GMXA 2KTYA 3U4WA 3TDWA 4RVMA 1ZY4A 4CZYB 4U81A 1QPEA 2AUHA 3QHWA 4CMOA 2BDJA 2G2FA 3VUMA 4FTLA 1H1SA 3HYHA 5LCKA 3V5TA 4EH8A 1OBGA 3QKLA 3MIYA 4L42A 1KWPA 1PXNA 1WVYA 3GU8A 2O3PA 3SKCA 1ZYDA 4IEBA 3L8VA 4L3LA 1Q3WA 5EFQA 2WU7A 4EK4A 1H08A 3GU5A 3FI2A 5DIAA 4B8LA 4CD0A 3EFLA 1IA9A 3K5UA 1R0PA 1V0BA 3BHUA 3QTSA 5FRIA 4G3DA 4NM0A 1CKJA 1P14A 2B53A 3FLWA 4XEYA 2C0IA 3LFCA 4CMUA 5M4FA 2XIYA 4MCVA 2HAKA 3NAYA 5AUXA 3RZBA 3TACA 4BCPA 5EI2A 4Q9SA 3MB6A 2HWOA 5AADA 1B6CB 4OBOA 2CKPA 3DJ6A 1SNUA 3F7WA 5IUIA 4XOZA 2WMBA 3L9NA 2GPHA 1BMKA 4Z3VA 4U8ZA 2GFCA 3FMKA 1XBBA 3QRTA 4LOPA 2CSNA 2IZSA 3HEGA 4X2GA 4D2PA 5L8KA 3RI1A 4QYGA 2XK3A 4Z9LA 3CKXA 5IF1A 5I9YA 4NTTA 2VTPA 2YIWA 5HBJA 4M14A 3WF5A 2XBJA 2VWYA 3NGAA 4O7SA 1Y91A 5GJDA 2C5OA 2C1AA 5C01A 3VS3A 3VWAA 4IACA 4YP8A 1J1BA 3NUSA 2IW8A 2WQMA 3DLZA 4RBLA 1P5EA 4UXQA 2X9EA 4XJ0A 4K18A 4DEHA 3UOKA 4DG0E 5AV0A 2RFDA 3Q3BA 2EVAA 4I24A 4IADA 2RG6A 5E8UA 3VULA 5LMKA 3BU6A 2OXDA 4AT3A 3QCSA 1SYKA 2PE2A 5C8KA 3DKGA 2GNGA 4A9UA 3M2WA 3R8UA 4MQ2A 3WZJA 3O96A 4EK5A 3REPA 4BWKA 4AOTA 4IM3A 4Z55A 3A7IA 4O6EA 3UBDA 2WO6A 4LUEA 5EM8A 2XIKA 2UW4A 4TW9A 4QYYA 4WOVA 1W0XC 3ZFYA 4JBOA 2C6DA 4IZYA 2JFMA 4NUSA 3I1AA 3FMDA 3P78A 2BRHA 3LFFA 3DPKA 3NNUA 3JYAA 2XZSA 1Y6BA 3E62A 3ORPA 3OVVA 4DBXA 4FV1A 4RIXA 4TWPA 5J9LA 4BKYA 1OL6A 2W1EA 4GRBA 2R3PA 3PG1A 5EK7A 3SOAA 3HMMA 2ZV2A 3KK9A 4O0XA 3ZUVA 5AV3A 4MX9A 5ETFA 3DB8A 2W1DA 3W2RA 1XO2B 2FUMA 2XVDA 4GT5A 4WUNA 4D2WA 3P86A 1YW2A 2CN5A 4DGNA 3LCOA 3FQHA 3PE2A 4P7EA 3Q53A 4Y72A 5DMZA 4QO9A 2PUIA 3BV3A 1YHVA 1R39A 2WTCA 2F7XE 3E88A 5CVFA 4WKQA 5ANGA 1URCA 4FVQA 4IW0A 3HA6A 2QU5A 1GIIA 3DV3A 5IQIA 1GZOA 4EQUA 4F1TA 5K5XA 2Y4PA 1REKA 4O84A 4D5KA 3CIKA 3RAKA 1OPLA 2E9UA 1LR4A 2UVZA 3COIA 2AYPA 3HV6A 2G1TA 2YDKA 2XEYA 4MKCA 4U3YA 4FIFA 4ENYA 5JT2A 3HAMA 5IQDA 3OUKA 2F9GA 2Z02A 1UVRA 2WPAA 3RBWA 2WMTA 3K3JA 4XV2A 5F9EA 4DH5A 4IC7A 4IB0A 2XIXA 4UMQA 4TT7A 1GZKA 4M66A 4K77A 3EN7A 2OF2A 4FT0A 4XV9A 5CU2A 4OAUC 1GY3A 5J7BA 4YUQA 3U51A 2G15A 2IVVA 4I5PA 4IDTA 5BVWA 4A07A 5E9EA 4DCEA 3QTUA 2AC3A 4OBQA 5AUYA 2I0VA 3SQQA 5AUTA 2WU6A 3NW7A 3PRFA 3WZKA 2YACA 5BVOA 2F57A 5FBNC 3QWJA 2VUWA 4I3ZA 4C61A 5L6PA 3IG7A 4J52A 4TRLA 1R0EA 4LGDA 4CYIA 2OGVA 2XM8A 4DEIA 2OJFE 4PF4A 3CJGA 2BHEA 3SX9A 2EXEA 5CEPA 3PE1A 3R2YA 4OTWA 3A7GA 3MVHA 5JRSA 3SV0A 4AT4A 5EKOA 2P33A 4P2KA 4PY1A 2WMUA 4WNPA 3AMBA 3TDVA 3R02A 1TQMA 3A99A 1ZMVA 4FTKA 4CLJA 4FMQA 3KMMA 5GJFA 1PKGA 2ONLA 1QPJA 2PUUA 3QQGA 4LGGA 4MNEA 1ZMWA 2Q0NA 2VWBA 4UZDA 3E64A 2FYSA 2ITUA 2VWVA 3F9NA 4MXZA 3DAJA 2PUNA 4LMNA 3S4QA 4QMWA 4OT6A 4RA4A 5KHXA 1WBOA 2WIPA 4GV1A 3M42A 1PY5A 3ZOSA 4F7LA 2Z8CA 4BVUA 5LXMA 2HZ0A 3OG7A 4M84A 3W16A 2XNGA 5AV4A 1H1RA 3IW4A 4FL3A 3VNTA 3PYYA 5HX6A 3W18A 5HG7A 4RWKA 3TZMA 5CU0A 2G9XA 4NZWB 3BYMA 3COHA 3TWJA 3CGFA 4RX9A 4K11A 5ETAA 3BCEA 3LFSA 3VW8A 3T3VA 4EK6A 5HBEA 5IEYA 1OL1A 3MIAA 2R3KA 2PWLA 3QX2A 3PRIA 4QPAA 1IAJA 5FTGA 5HCZA 3BHYA 4I6QA 2GTNA 3ACKA 3T3UA 5IQEA 3QRUA 3HV5A 4AACA 1NXKA 2B7AA 2BFXA 3PXKA 5H8BA 2XKEA 3HX4A 4FYOA 4I4EA 4K0YA 5E8XA 4ERKA 4NW6A 3FKOA 1XHAA 2FSTX 4BCQA 2XK6A 1I44A 4FT9A 5FTOA 3OXIA 4ZJIA 3FMJA 3WBLA 5M56A 2O8YA 4CV8A 4Y95A 3IDBA 4E4LA 2RSVA 1PYEA 4FZFB 4QQCA 1XQZA 3FZSA 5LWNA 3ZU7A 2VWIA 4PDYA 3EN4A 3BGPA 5HHWA 2CLXA 3MH0A 5FWKK 5BVEA 4Z7GA 2WFYA 4AFEA 2PL0A 4GS6A 5HVYA 3DQXA 3LFBA 2C6EA 4Y46A 5DPVA 3WF7A 3AGLA 1U5QA 2EUFB 3FSFA 3HECA 3NNWA 4TNBA 3FLNC 1TVOA 3IOPA 3RNIA 2UZEA 5AA8A 4DEBA 3KRWA 3PFQA 3OWLA 4ACHA 2YLEA 4YBJA 2QLQA 4YMJA 4RT7A 3PXFA 2NNWB 3KMUA 3PY1A 2WMQA 3DXPA 4BB4A 1JKTA 3A62A 4F0FA 2UW5A 4NFMA 3FAAA 3ZSIA 1PXKA 2ERKA 2QG5A 1H25A 2ZMCA 1ZARA 5KO1A 4AGUA 2BDFA 2XB7A 3ZLSA 3K54A 5CU4A 4MBJA 3AMAA 3B2WA 2XK4A 4BGGA 4KINA 3FPMA 3UIXA 1O6YA 4WNMA 3ULIA 3QL8A 4F4PA 2J5FA 3O8TA 1W82A 4OAVB 3LCSA 5TE0A 4YHFA 3AC8A 1M52A 2W9ZB 3UIUA 2O2UA 3PXQA 1JWHA 1GJOA 2VGOA 2VZ6A 4I1ZA 2ITVA 3NCZA 2PVLA 4YLLA 3R9DA 2B55A 3ZC5A 4FTMA 2WNTA 3PIZA 3KXMA 2YA9A 4N6YA 4D58A 3U6JA 4YZNA 4L53A 4O0YA 3HGKA 1ZZLA 4FIIA 3UGCA 4USEA 5DRDA 1VYZA 3LJ1A 4AN2A 4NSTA 3HV3A 5IQAA 2W0JA 3BU5A 4JRNA 5CAPA 5HNIX 4EJ7A 4FV5A 1OGUA 2XCKA 3LM0A 4J8NA 3V3VA 2WMVA 4ERWA 5IH4A 2EXCX 5EOBA 4DTAA 4C37A 3FI8A 4ZTRA 2F2CB 4TYEA 4PMMA 3QRJA 4I41A 5AUWA 4R1YA 3PSBA 4EEVA 3R1NA 2Y4IC 2RFSA 3CEKA 3GOPA 3C9WA 3Q9WA 2X8DA 3TV6A 5CANA 1CKIA 4CFXA 3ZEWA 5BQ0A 5BVKA 3TIZA 3IW5A 5J7HA 1IRKA 4BI2A 3BGQA 2WTKC 4OTDA 4UBAA 4XLVA 3QBNA 4M8TA 2JGZA 3TM0A 3HL7A 5A46A 4BZDA 4PTEA 4G31A 3QTQA 5T6KA 2ETRA 3F3ZA 3EYHA 4U41A 4Y5QA 1U59A 4W4WA 4BWXA 1KE7A 2P55A 2W1ZA 1J7LA 3S0OA 3DU8A 1YWRA 2A1AB 3FZOA 4L8MA 5AP1A 5HE1A 3DFAA 2XYUA 4PWNA 3RHXA 4ANSA 5HG9A 3BBWA 3R7IA 4DT9A 5I4NA 2YIRA 1XJDA 3KCFA 3SXSA 3HMOA 3VW6A 4FOBA 4YJUA 5J87A 3RZFA 4R7IA 5HIBA 3QRKA 1J7IA 3EYGA 4FKLA 4MK0A 3SDJA 4QQTA 3G2FA 4YO6A 5CSWA 3PLAE 4OTRA 5L2QA 1YXXA 3F2AA 4RQVA 1Q8TA 1Q8YA 2NPQA 4H58A 5CU3A 1PMNA 5A54A 4TN6A 2VTMA 4NWMA 3MS9A 4AZVA 4FBXA 4DE4A 4DGOA 4UYAA 4GEOA 4YLJA 2WTVA 4AZWA 4BCOA 1WVXA 2C3JA 4FKIA 2BPMA 4DITA 4RC3A 4RJ6A 3TTJA 3ORMA 3M1SA 3WE8A 1M2RA 4AT5A 1XH4A 2WMWA 4O0VA 4R5SA 4ANNA 2IZTA 4XUFA 3RMFA 4F99A 5GIPE 3D15A 3KGAA 4RIYA 3FXZA 3SAYA 2EU9A 5D12A 5D10A 3H9FA 4GU9A 4ZSJA 1Q8ZA 4AA4A 4GK3A 4IANA 4IVBA 4L00A 2R3HA 2DS1A 4LUDA 4YLKA 4F6UA 2F7ZE 5CQUA 1W7HA 3L9MA 5JZJA 4YJRA 4DC2A 3PXYA 3BE9A 3R7GA 3VS2A 2ESMA 4NM5A 1ZZ2A 1B39A 3Q9YA 4FVRA 4KIPA 1RJBA 4FV9A 4W4YA 4DEDA 2VTTA 4KB8A 1FGIA 4YSJA 3LW0A 3HDMA 5LCJA 3ITZA 4ZK5A 1YXTA 2ZDUA 5CSXA 5AR3A 2CJMA 3A60A 4YJVA 3G15A 5HESA 5LQFA 1OIQA 3MA3A 2V5QA 3WIKA 4CFVA 3RK5A 4KKGA 1K2PA 4IVDA 1ZLTA 4JNWA 1YDRE 2J2IB 1WBWA 4BZNA 2E9VA 3BHTA 4L7FA 4WBBB 2P2HA 3I5ZA 3LCTA 2Y6OA 5L8LA 4Y5HA 3MFSA 3SRVA 3BGZA 4FV2A 2XF0A 3AXWA 3V6RA 1URWA 3Q2JA 3CD8A 5TOZA 2H34A 4HVGA 1U4DA 4ARKA 4WG4A 3CR0A 2J0LA
chains in the Genus database with same CATH superfamily
3KULA 2WTKB 2R0IA 3PTGA 5HD7A 2WHBA 2ZFYA 4BF2A 2WTDA 4EOLA 4QMXA 4NJDA 1VZOA 4EOQA 3I81A 3RGFA 4EOSA 1XWSA 3PA5A 5DWRA 2PZIA 2XIRA 4EJNA 2YISA 5EG3A 2C47A 2UW0A 3C13A 4F08A 5M09A 3G9NA 3EQGA 4G6OA 4KA3A 4OR5A 4BCJA 4BCGA 2UW3A 3O50A 4YJOA 3D0EA 4RIXB 4WIHA 4UY9A 3R6XA 2J0JA 1R3CA 3EQDA 5HNBA 1RW8A 4OUCA 1NA7A 3UYTA 3TZ8A 3UE4A 4FV8A 4R6VA 3R7OA 4J1RA 3L8SA 4QOXA 2WD1A 4O86A 5DHJA 4LYNA 2CCIA 4CKRA 2W7XA 4IAKA 4IAFA 1PXLA 4H1MA 2CKQA 2C5VA 2Q83A 4YSMA 1OL7A 4G9RA 2WOTA 3NVKI 4I5HA 3GC8A 3BHVA 5HVJA 2R3RA 4ZSLA 3DJ5A 4QTBA 2ZV8A 3FHIA 4W4VA 1PRYA 3EH9A 4JJRA 1IG1A 3LQ5A 5M4CA 1UA2A 4DDIA 4DH3A 4KBCA 2GDOA 3KK8A 2OBJA 4NIFB 4V0GB 4C35A 4E5BA 5FXRA 4FK6A 5JSMA 2QHMA 2W1GA 4NCTC 2C6MA 3OT8A 1XH8A 4IH8A 4PUZA 4FTAA 5HD4A 3EFKA 5HU9A 4Z16A 2UZWE 4OTFA 1KV2A 3ZFMA 1F0QA 3GU4A 4RRVA 3SW7A 4J8MA 3F69A 2R5TA 4FZDB 3LMGA 2W5AA 3FMNA 5HLPA 4QMOA 4ZTMA 4FKUA 1UNLA 4YJSA 1CM8A 4AZTA 5C26A 2WB8A 4X3FC 3DKOA 5AP0A 2BALA 3GFWA 3GI3A 4L43A 2XRUA 2B4SB 2YM3A 3UYSA 4DFUA 3QCQA 4QMMA 2B1PA 3E8DA 3VQHA 4CFWA 3G9LX 4N6ZA 3VF8A 1U46A 4L45A 3LKMA 2XCHA 3S2PA 3U6HA 3RPOA 2BRMA 4BBEA 3GQLA 2YM6A 2P2IA 3TCPA 4QMQA 1PMEA 5EW3A 4MNEB 2WOUA 4R3PA 3UDBA 3MVLA 3UO4A 3R30A 5E8WA 4CRSA 4O2ZA 3U87A 3F2RA 4G6NA 4XV3A 4C4JA 5E7RA 5BV3A 2YAKA 3NUUA 5D7VA 4V01A 4O7WA 3NYVA 3QCXA 3D9VA 3R1SA 3GC7A 4AX8A 2VTNA 1OIUA 5HU3A 1OL2A 5CAQA 3A2CA 2CKOA 2PHKA 4A06A 4MAOA 4WUAA 2EWAA 2F4JA 1SNXA 3Q4ZA 4M0YA 5GZ9A 2XKCA 3A4PA 4ACCA 2QO2A 1J3HA 2PVYA 3KU2A 3NUYA 5J9YA 4FTOA 4FSMA 4E4MA 2A0CX 3GB2A 4DINA 1LP4A 4UWCA 3ZC6A 5B2LA 4WNOA 2R7BA 4G9CA 2YABA 2BZIB 3FY2A 1OMWA 5HO6A 3F61A 3U9NA 2VNYA 3R8VA 3GCQA 4C3PA 5DR6A 1LPUA 3HZTA 3OHTA 4QYHA 3DK3A 3LPBA 3D5VA 4YZBA 3WZEA 3B8QA 5K5NA 3PZEA 4IAYA 3KN5A 3VS5A 3ZLXA 3H0YA 4TNDA 4GKHA 2ITQA 3ZHPC 2J7TA 3ORIA 2CN8A 3ZMMA 3FXXA 3GC9A 4O83A 4XX9A 3FKNA 2V55A 4LQMA 2YAAA 3QUEA 2VTJA 2Y8OA 3FMMA 4G17A 5CSVA 3JS2A 4DCAA 2YHVA 2GS6A 3UVPA 5AP5A 3B2TA 4U5JA 2QQ7A 4FG8A 2F7EE 2CGUA 4IM0A 4O0RA 2VTOA 2WXVA 5CAOA 3LCDA 2XNEA 4FKPA 4G3EA 1Q41A 2O63A 1STCE 2P4IA 3EQRA 4O96A 2JITA 3SXFA 3LQ8A 3WYXA 2Z7QA 3OS3A 3CCNA 3II5A 4BDHA 3JY9A 3Q6UA 4PX6A 3KRRA 3P23A 1DI9A 3BE2A 4G3FA 3HVCA 4JBVA 2PY3A 1PMUA 1YOMA 4MXYA 2BAQA 4D9UA 4F6WA 5JQ8A 4LGHA 4BKZA 4O4BB 4OTHA 4R7HA 3PP1A 3KL8A 4NL0A 2UZLA 3W2CA 5L2TA 2X6EA 2JAMA 3I7BA 3NAXA 3C5IA 2XM9A 4DHIB 3W0RA 4JQEA 3QQFA 4S34A 5IA2A 4GK4A 4D2TA 4L01A 3UPZA 2UZDA 2B9HA 2HK5A 3UZTA 3QTIA 4PNKA 4EORA 5M08A 3WZDA 3DBQA 5CXZA 2SRCA 3OW3A 3C0HA 5IQFA 4BCHA 3P4KA 3O2MA 3QD2B 3R1YA 3UODA 3R9OA 5IA1A 1O6KA 4L3PA 4E7WA 4BGQA 4GJ3A 3DTCA 4B7TA 3P5JC 4AXAA 2C68A 4RWIA 3EQPA 3FYKX 4G16A 3MSSA 3PA4A 3UG1A 3WF6A 4QP8A 3FKLA 3UO6A 3TKHA 3GCVA 4FV0A 3BWFA 4IDVA 3L8PA 3UIMA 5KZIA 4CTCA 4LDTA 3DT1A 2E2BA 3B8RA 3FI3A 5FD2A 5DEWA 5CS6A 4HOKA 3D14A 4DYMA 3PJ8A 4ANOA 1W83A 3FBVA 4QP1A 3SD0A 3FUPA 1H0WA 1SVGA 3ORTA 3OC1A 2VTRA 5KMMA 4N57A 2IW6A 1AQ1A 2XKDA 2OZAA 1OIRA 3D7TA 2JDVA 3F3VA 4BDDA 3QRIA 4D1ZA 4EHEA 2YLFA 3P9JA 3Q4CA 3UP2A 2XK8A 3R63A 4WRSA 2QOKA 3CSVA 4MF0A 3RAHA 2OI4X 4X3JA 4XG3A 4PP7A 4PQNA 3O7LD 3PVGA 5B7VA 1JVPP 4ZS4A 3I6WA 4NH1A 2UVXA 3P7CA 4BDBA 4IBMA 3MW1A 5FEDA 4KIOA 3MY0A 3ZZEA 2IN6A 2ZB0A 5DEYA 4JX7A 3Q52A 3VVHA 2WGJA 3HDNA 4IXPA 5GIOE 4NYEA 4BDGA 4O91A 3BQCA 2EXMA 3DDPA 4UEUA 3TKIA 3I0OA 4FT7A 2XNNA 4OT5A 4RGJA 4A4LA 5CF8A 3PIXA 3F3WA 1WBSA 2OIBA 4FG9A 4EI4A 3A4OX 4DEEA 4FSNA 4EQCA 4ZTHA 2WQNA 5IKWA 3RTPA 4JAJA 3TIYA 2IWIA 4FVPA 4C2WA 3CJFA 4PNIA 4BFMA 3S95A 1REJA 2VWUA 3WOWA 2JBPA 3CPCA 3L9PA 4H36A 1MRYA 2HOGA 4C34A 3EIDA 3ZXZA 2HWPA 2AC5A 2QNJA 2E9PA 3MGYA 4W8DA 4YJNA 3SG8A 2WQBA 3QTZA 3MA6A 3OCTA 1QL6A 2V7AA 3FHRA 5ETIA 1JPAA 4CT1A 3BL7A 1VLRA 3KRJA 2H9VA 2XKFA 3LOKA 4HNFA 4RWJA 4XG8A 3CQEA 4AGWA 4FZ6A 4YBKA 5CAUA 3UDZA 1PXJA 2ZDTA 3QD4A 1FOTA 2CNQA 1YXSA 3O0GA 3BKBA 1KE5A 2IW9A 4M13A 3NR9A 3G51A 5H3QA 3ULZA 3BYUA 4K6ZA 4CKJA 2ERZE 4M67A 1P2AA 2GHMA 3TL8A 3JXWA 4RIYB 4QMVA 2OIDA 4TWNA 3KCKA 2IEWA 4FGBA 4HGTA 3W0QA 5DT0A 3OTUA 3Q9ZA 1G8SA 2JIIA 2QKWB 5GNKA 3I4BA 1ZXEA 4AS0A 4JIAA 3TNWA 3FZ1A 3NYXA 4O1PA 4FV3A 5HTCA 5L4QA 4U43A 4W4XA 2W9FB 2CNUA 4IMYA 4RZWA 3AQVA 3C4ZA 2YFXA 2EB2A 4L44A 3RPRA 4S32A 4R7BA 3TUDA 3HV7A 4I23A 2YCFA 3ORXA 3TV7A 4YPDA 3R7EA 3QXPA 4DGMA 3C4FA 1B38A 5CXHA 1CSNA 1GZNA 2B9IA 2X4FA 2IVUA 2Z7LA 4QP7A 1PMVA 4WNKA 3V6SA 4EONA 3TNIA 3QTRA 4LMUA 3O71A 3C4EA 5AP2A 4NU1A 4KIKB 4BBFA 5ACBC 4CGAA 3OROA 3VS0A 2ITTA 2QO7A 1YVJA 4P4CA 4DLJA 5M4IA 2BKKA 3SRVB 5AV1A 1E1VA 3SA0A 4F09A 1S9JA 3A8WA 3KF7A 5JH6A 3ORKA 2VWXA 3WF8A 3FWQA 1H1QA 1HCLA 1LUFA 4A7CA 1XH9A 2XNBA 1PXPA 3QZFA 4USFA 2FA2A 2X2LA 3CTHA 4IWDA 4F1OA 3BPRA 3ZRLA 3CY3A 5CU6A 4PMSA 2JEDA 4Y73A 2R2PA 4FTIA 4CMTA 5CEKA 3GVUA 2Y0AA 4EC9A 3IW6A 3GC0A 4IFCA 1PHKA 4C2VA 1GAGA 2OW3A 2OFVA 2HZNA 4RLLA 2GSFA 3FQSA 4WSQA 1HCKA 3NW6A 4KSPA 3F5PA 3QXOA 3R8ZA 3VBTA 3R9RA 5C27A 5A14A 3VO3A 3VN9A 5L2SA 3FLSA 3UMWA 3PJ3A 4C62A 4PDPA 4S33A 2YJSA 2BIKB 2XEZA 3MVMA 1YKRA 2BAKA 3AC1A 5HI2A 4A9TA 2FSMX 4FTTA 4ZZOA 4K33A 3EN9A 3EB0A 5CY3A 2G2HA 4QT1A 2R3JA 3VAPA 4DN5A 5EDPA 2EB3A 3N4VA 3NW5A 5C4LA 3BI6A 2CKEA 1NVSA 3FZPA 4FNXA 4TYJA 4U40A 3BEGA 1JBPE 1QCFA 3S00A 5IA5A 4EH2A 1ZYSA 2DWBA 4CFFA 3MY5A 4QP9A 4TZRA 4NW5A 1ZAOA 1PW2A 4HCTA 1PXOA 4I5MA 3VUHA 3ORLA 5E8VA 2QURA 5LVMA 2C0TA 2GNJA 3F88A 1W2CA 2JC6A 4AWIA 5M07A 3KXXA 5HEZA 3RPVA 3LMIA 5HX8A 4QRCA 5LWMA 2PMOX 5TT7A 4AAAA 2W05A 5L2WA 4JR3A 5AP3A 2FB8A 2J6MA 1GIHA 4S31A 4DFNA 4K2RA 4ZAUA 3FPQA 2JD5A 5IMEA 2UZVA 3SW4A 4DT8A 4EHGA 4R77A 4JT3A 4ZZMA 3QALE 3VUIA 3FMEA 3HV4A 2P3GX 2QODA 3R83A 5C9CA 2GS7A 2R3OA 1M17A 2WZJA 2X0GA 3CD3A 3P7AA 4D1SA 3DOGA 2H6DA 4MQ1A 3MBLA 4XRJA 2XA4A 4CEGA 2OJGA 3HAVA 2XRWA 4ID7A 1P4FA 3EOCA 2R3NA 4GIHA 1AD5A 2BKZA 2ETMA 3A8XA 1TQIA 4EHZA 2QOOA 4KBAA 4EOPA 5GZ8A 3VBXA 3UZRA 5IUHA 2GNHA 2HYYA 3TXOA 5M44A 1Y8YA 3OD6X 4EBVA 4Y83A 2HCKA 3LVPA 4IWQA 1Q8UA 4IM2A 2R64A 4FRFA 3BRBA 3QHRA 4HGSA 5ANKA 4C8BA 2GQSA 3DTWA 2LAVA 4DHJA 4PL5A 5HZNA 3D2KA 4UMPA 1NW1A 5IA0A 1OGYA 4Q9ZA 5CASA 5DNRA 4DBNA 4DH8A 4LL5A 3PPKA 4U9AA 2UW9A 5CT7A 3R8LA 2XIZA 4HZSA 3V8SA 2BILB 1OM1A 3OCGA 4FT5A 4GUEA 3VIDA 3EHAA 2X2KA 3C4XA 1Q3DA 2VO3A 4UN0C 3OWPA 1ZOEA 3V5QA 4JX3A 5FLFA 5E91A 5EYMA 2JAVA 2YWPA 1BX6A 5BMMA 2VX1A 3NYNA 3LMHA 1DAWA 3CQUA 3C4WA 3GP0A 4TYIA 4EYJA 2R7IA 2QR8A 3ALOA 3QAME 5AP6A 2UW7A 4U45A 5HE0A 2BMCA 3O51A 1W8CA 4I6BA 4KS7A 5ICPA 2BUJA 3G33A 4X2NA 5CZIA 5DG5A 2J0MB 3D5XA 4U6RA 4YTFA 2J0KA 4L67A 3GUBA 1KE8A 4ZY4A 2XBAA 5ANDA 4FKOA 4L9IA 4NCTA 3UMXA 3NS9A 4AW1A 1DI8A 3CGOA 1IEPA 3L1SA 5EQEA 3BLQA 5DGZA 4BCFA 4L68A 4ANBA 4R3RA 5K0XA 3N51A 2WELA 4BYIA 3P0MA 2R0UA 2VWZA 2YZLA 1L3RE 3BZ3A 2CDZA 4X6QC 3F6XA 2CLQA 5JFWA 1MP8A 4LV8A 2BR1A 1V0OA 4G3GA 4S30A 1JKSA 4O6LA 5T3QA 3OWJA 4X3FA 3R8MA 3RPYA 2XMYA 1W84A 2C5XA 2X2MA 4UALA 2OF4A 3R7VA 4ALVA 1L8TA 2W4OA 1FQ1B 4RIWB 4RSSA 3N4TA 2CCHA 4KUJA 2HELA 2IZUA 2J4ZA 4YC6A 5BUIA 2XK7A 5BVDA 2UUEA 5C03A 4IX4A 3BWJA 3ANQA 5I9XA 2PVFA 3DJ7A 4BWPA 3JY0A 5B2KA 4DFYA 2BZKB 3V5JA 5BX0A 4IFGA 2W17A 3MTLA 4MXOA 3GQIA 4C4FA 1Y57A 3CS9A 2GQRA 4XRLA 4F6SA 3VS6A 1UKIA 1H1PA 2XK9A 2YIXA 2IZRA 5FEQA 3TNQB 5LVPA 4ZMEA 5AR4A 4FSTA 2J5EA 5I9WA 2PVJA 4DFLA 1J91A 3RK7A 4FTCA 5DT3A 3W10A 3QF9A 5IUGA 2XJ2A 3AT4A 2UVYA 3BYOA 4Y8DA 4F0IA 3ZM9A 2YIQA 4FNWA 1JSVA 3N9XA 3Q5ZA 3FMLA 4IAAA 2OK1A 4FTUA 3CXWA 4BCKA 4F7SA 3HKOA 4D2VA 4UYNA 5EOLA 5BVNA 3KFAA 4AAYA 2I6LA 4DG2E 2ITYA 3GCSA 4DF3A 3TT0A 3V01A 3KA0A 4FG7A 5AUVA 3OEZA 3HLLA 4CG8A 3KB7A 1YOJA 3FI4A 4WG3A 4AA0A 4BC6A 4YC8A 3FJQE 5JFXA 1UKHA 3RWPA 4MNFA 1FVTA 4C3FA 5CVHA 3ETAA 4MBLA 3TZ7A 4C02A 3F2NA 3KXHA 4H3BA 4CLIA 2VX3A 3EQIA 4ASEA 3QGYA 4CCBA 2OZOA 4PP9A 5F1ZA 2WAJA 2ZJWA 4FSQA 3G6GA 4RFZA 4DEGA 3HUBA 2BRNA 1H01A 3T9TA 4BY9E 1KUTA 4RPVA 3NYOA 3PSCA 2VO6A 3E93A 5A4TA 4ZJJA 1Q5KA 4BYJA 2OZAB 4RG0A 3TTIA 5TF9A 3D7TB 1MQBA 5EHYA 4O7RA 3MFRA 4U3ZA 3W2QA 4EUUA 3PJ1A 3LHJA 2YDJA 2I1MA 2ZVAA 2PYWA 3PY3A 4RWLA 3KVXA 2X4ZA 5AP7A 3PJCA 3QC4A 3UDSA 5AUUA 2V62A 4IVCA 3AT3A 4JOAA 2XJ0A 2VX0A 5BMSA 4C4HA 3FL4A 4I93A 4IAIA 2QLUA 2I0EA 4YGAA 3UC3A 4JG6A 3A7JA 3OTVA 3R04A 3MFTA 4KRDA 4RJ8A 4WHZA 2YWVA 3QTXA 5KNJA 2VU3A 3EQCA 5EYKA 2YEXA 1RQQA 3BYSA 4J53A 2QOLA 5IEVA 4O4FA 4KRCA 5EH0A 5BYLA 1CTPE 4IX6A 4LRKA 4XYFA 4ASDA 4ZLOA 2QD9A 1JOWB 2WEVA 2BTSA 4FTNA 5IPJA 3MH3A 4HPTE 4QPMA 3DK6A 3PA3A 1K9AA 2W1IA 3R22A 2IG7A 1ZYCA 3D83A 4AOJA 1DS5A 3EZRA 2WTJA 3V04A 1G3NA 1OL5A 4CV9A 3ODYX 5KBQA 4ANMA 3KY2A 3U55A 5CT0A 3OEFX 1XMLA 5LVNA 3TG1A 1M2QA 4JQ8A 2PTKA 1XMMA 5H8GA 4EH4A 4BICA 3FE3A 4AZSA 4HW7A 3NUXA 5DLSA 3FQEA 2X7GA 4KWPA 3H30A 2X39A 5IMXA 1JAMA 4BTMA 4RFYA 3D4QA 2QU6A 2HXLA 3ENHA 4AW2A 4GFOA 4GUBA 4J96A 4JVGA 5M55A 2PE0A 3UQGA 4F63A 5KMIA 3OOGA 2GFSA 3QKMA 1ZY5A 5FTQA 4D28A 1PJKA 5JFVA 3KRLA 2Y4IB 3VUKA 2PE1A 4BIDA 5HVKA 4EH6A 3V8TA 3OY3A 4EBWA 1MUOA 4I0TA 1OUYA 4E1ZA 1LEZA 3PIYA 3LFEA 4YNOA 3LM5A 4BBMA 1NVRA 2OFUA 2VRXA 3ELJA 4U7ZA 4YU2A 2BRGA 2YM8A 4IHPA 3ZM4A 4FL1A 1ZOHA 4CFUA 4ENXA 3Q60A 4BHZA 5HORA 4MVFA 5ANJA 3G6HA 3MH2A 3UIBA 2C6IA 4GH2A 3ZLYA 5KMNA 3KXNA 4E3CA 2ITPA 3M11A 4EOIA 3MESA 2BFYA 3F5UA 2LGCA 3I60A 5HE2A 3MTFA 5JQ5A 4F7JA 2Z60A 4N4SA 3OXTA 1YHSA 2A2AA 4RJ4A 2PVMA 4ZTSA 5IZFA 4XP3A 3PXZA 3PY0A 1WFCA 1JKKA 2G2IA 2VO0A 4EK8A 1J1CA 2HZIA 2WIHA 2XNOA 2IF8A 3ZO2A 3KXZA 2WQOA 4ZSEA 4ORKA 4JBQA 3MN3A 4EZ5A 2A4LA 3VS7A 4YTHA 3FDNA 4HVSA 4R78A 5H8EA 3RCDA 2J9MA 3BELA 3E63A 3CLYA 1UU3A 2V22A 3I79A 5A9UA 1TFFA 2YCQA 5IQGA 4O2PA 5A3XA 4CFMA 4P5ZA 4O27B 4QYFA 4RJ3A 5E8SA 3OBGA 4BRXA 3I5NA 3QZHA 1V1KA 3VC4A 2ZMDA 3LJ2A 1IAHA 1OPJA 5IQBA 3DBDA 1FPUA 3LFQA 4EKKA 5CSHA 5AR7A 4RZVA 2OJIA 3IGGA 2CGXA 5K4JA 2W4JA 1WMKA 3QWKA 5DI1A 5F95A 5EDRA 4O7ZA 5HTIA 3V51A 2UW8A 3DLSA 4ZP5A 3U54A 3GT8A 3HMPA 2FSLX 4PDSA 2WMRA 3E8CA 4DHFA 4S2ZA 5M57A 3LAUA 2BAJA 4ALUA 4EOJA 1S9IA 2BDWA 3FLQA 3MH1A 3FXWA 4FODA 4BKJA 1OPKA 1BYGA 1KE6A 1QPCA 3DBEA 3E8NA 4MTAA 4ZLZA 2BZJA 2JDTA 3ZBFA 3OWKA 5GHVA 4D55A 4HVIA 1ERKA 1UU9A 4ZIMA 3TN8A 2X81A 4E73A 2X0OA 4FGRA 4CYJA 1J7UA 3BL9A 2XH5A 3SXRA 4EZ7A 3S1HA 2UZBA 3LZBA 2J50A 2QC6A 3QLFA 4RVKA 4XH6A 1ATPE 1YI3A 2OH4A 4AGDA 4ZY5A 3MJ1A 5EQYA 4FR4A 4KSQA 4PV0A 2YIYA 1YHWA 2ITWA 3G0EA 4GFGA 4OTQA 1VR2A 2CGVA 3BIZA 1OKVA 1Q8WA 3WF9A 4IAZA 2WEIA 3DK7A 3IKAA 2OSCA 1OKWA 1XR1A 2JKOA 3OF0A 4FKTA 4MD7E 5IQHA 3IOKA 5LMAA 4PMPA 2XNPA 1GIJA 1W2DA 3DQWA 3WZUA 5FEEA 4ZZNA 2VV9A 2C1BA 2Z7RA 1Q24A 3JPVA 5D7AA 4HYSA 5FBOA 5C1QB 2C3KA 5CNOA 4AU8A 5ANIA 3GU6A 2ETKA 4LL0A 1T45A 2DYLA 3DNDA 2VGPA 3D7ZA 5FXSA 3VQUA 4AFJA 4TL0A 2YM7A 4KKEA 3VUTA 2FO0A 5BYZA 4AQCA 3EQHA 1CKPA 3C0GA 4D4RA 1PKDA 5K3YA 4NKAA 4QQJA 5F4NA 3EMGA 2HZ4A 4QP6A 3RVGA 4WT6A 3DKFA 3NMUF 4RC4A 2ITNA 1K3AA 4Q5EA 4Z7HA 4ANLA 4QNAA 1Q61A 2VWWA 4RMZA 5E4HA 3MDYA 4FL2A 2VO7A 4QP4A 4FSUA 3A61A 5IA3A 4ONAA 3A7HA 2PK9A 2OXYA 3OUNB 5EYCA 2IVTA 3GGFA 4TWCA 4BDJA 4OTGA 4CZTA 1F3MC 5CLPA 4O7TA 2C5NA 5GINE 3T9IA 3CTJA 2OO8X 4H39A 3P5KA 4PL3A 3FC2A 5E90A 2CGWA 4LOQA 3MWUA 3HP5A 4YZDA 4RFMA 4QMTA 4ZY6A 3CE3A 3ZUTA 5CX9A 1FMOE 2OJJA 3Q9XA 3ZSHA 4A9RA 3CPBA 5KMJA 5HKMA 3UQFA 1FINA 4IB5A 3PFYA 3GNIB 5JN2A 1OECA 4I5CA 2I40A 4E6DA 1P4OA 5F20A 4TWOA 4FOCA 1ZWSA 1BLXA 5D41A 2JDSA 3H10A 4IZ7A 4PTCA 4TXCA 4UV0A 3O8UA 2JBOA 5A4QA 1BL6A 3K3IA 4AG8A 3PG3A 2JKMA 4YO4A 3UZPA 3LXLA 4EWHA 3N4UA 3C50A 3BV2A 2RG5A 5J8IA 3ML1A 2E9NA 2ZYBA 2PMNX 5M4UA 5J1VA 5LJJA 2B52A 4RC2A 3ZRMA 2AEGA 3DZOA 1ST0A 3O8PA 3LLAA 1OKYA 4CKIA 2ITOA 1KSWA 5FG8A 5E1SA 1JKLA 1QMZA 3AC2A 5EKNA 4TYHA 5BUJA 4BIEA 2REIA 3C4CA 5I3RA 4WBOA 5LOHA 4X3FB 4FSYA 4WD5A 5DRBA 5B0XA 4PL4A 4F1MA 3ID6C 2JIVA 5HIDA 2UZTA 4FKSA 2X8IA 1YWVA 4PPAA 3BU3A 4GIIA 1XH5A 3AC4A 1BL7A 4NM7A 4O4EA 3VWAA 3OP5A 2PVHA 4RVTA 2O64A 3H0ZA 5CVGA 3O5AA 4KS8A 4E6QA 4APCA 2CHLA 4X2JA 3R7UA 3ZBXA 4O0SA 4FUYA 3L9LA 2JKQA 3QTWA 4JDJA 3OY1A 4NKSA 4LG4A 4CRLA 4XMOA 3ZONA 5CNNA 4M69A 3P1AA 3V5LA 2GHLA 2W5BA 4C38A 3VBWA 5CEIA 3NUNA 3QUPA 2QG7A 4QD6A 4EC8A 5J1WA 4AUAA 4FK3A 3POZA 3EZVA 4NT4A 3VUGA 4IJ9A 2QKRA 3R28A 5JFSA 1WBTA 3PLSA 2C30A 2WTWA 3CP9A 4FTJA 3GOKA 1FVRA 3FLYA 4BDFA 3SGCA 5AWMA 5AX9A 5TR6A 4YC3A 4XP0A 2J0IA 5AJQA 3TJCA 4ITHA 4IB3A 5HOAA 3TEIA 3D2IA 3QA8A 3OMVA 4XOYA 3NUPA 4GW8A 3AC3A 3L8XA 5CAVA 1XBCA 3ZSGA 2RF9A 4HGLA 4C33A 1G8KA 4V05A 3FLZA 3O7LB 4LRJA 5EHOA 3LJ0A 4ZSAA 3IO7A 4I20A 3DKCA 3BLHA 4KBKA 5EHLA 4DFZE 3FEGA 2ITZA 4KNBA 3R8PA 4MXXA 2OICA 3W2PA 4I4FA 3QYZA 3LXKA 4I21A 4WG5A 5E8ZA 3UPXA 5HG8A 4ACDA 5CYIA 1LEWA 1ZYLA 3FV8A 3KKVA 3HA8A 3MVJA 3FC1X 4MXCA 2OU7A 2XYNA 4W9WA 5CF5A 3VHEA 4O21A 4ITJA 1U5RA 2B9JA 2QOCA 1UU7A 1IR3A 4GL9A 1Y6AA 3QLGA 4GYGA 4XLIA 3ZDIA 1SZMA 2R9SA 3CC6A 4FEVA 3E8EA 3LLTA 4OTPA 5IQCA 4FV6A 4F64A 3W1FA 4XV1A 4FA2A 5KUPA 4I92A 3AD4A 1DAYA 4FKVA 2R4BA 4QMYA 2GU8A 4U80A 4L46A 3C5UA 2C6LA 5KMLA 5H2UA 3U9CA 3NX8A 4MD8E 5J9ZA 1YDSE 3RPSA 4MWIA 4BDAA 4BI0A 3QQJA 5D9HA 3TNPC 3NUAA 3CY2A 3OXZA 1FGKA 3WE4A 4OGRA 5I0BA 3AD5A 2YM4A 3Q5IA 4XS2A 3RKBA 1UU8A 4NM3A 4O22A 1W2FA 3Q2MA 1JLUE 4EH3A 4QMUA 4HVHA 2BCJA 1Q97A 4APPA 3QA0A 2ZB1A 3R21A 2ZM4A 5IA4A 4GK2A 3MJ2A 5M53A 2PMLX 4GFMA 4MD9E 4NFNA 4FEUA 3DB6A 1M7QA 3ZEPA 4B6LA 4FEWA 5HO7A 2QOIA 4I0SA 2PVNA 3CQWA 2DQ7X 5KCVA 3EWHA 3VS4A 5AAEA 5DBXA 5I9VA 3PPJA 4YZMA 3QD3A 3QD0A 1WBNA 2C0OA 2VN9A 3QQHA 4M12A 5JKGA 5HGIA 3C0IA 3OW4A 4MHAA 3KC3A 4KIQA 2BVAA 1OB3A 3R71A 4KAOA 3R0TA 3HRCA 3POOA 1OUKA 1YOLA 3BQRA 4PMTA 2VD5A 2GNLA 3A7FA 2ACXA 4HCUA 2PVKA 4M97A 4USDA 3R9HA 4GT4A 4KABA 2WKMA 4D5HA 4EH7A 4EKLA 4IC8A 4F70A 3WI6A 3KULB 4J7BA 2YCSA 4C4IA 5CSPA 2HY81 3QC9A 3IGOA 3R73A 4F65A 4XP2A 1IA8A 1WZYA 4YHJA 3TJDA 5CQWA 2ZAZA 5G1XA 2PVRA 3UNJA 3JVRA 3WIGA 2RL5A 4JRVA 3ATTA 3VS1A 2OKRA 4GU6A 5EI6A 2PMIA 4GSBA 3DDQA 5IG1A 1GZ8A 3AG9A 2WMSA 2A27A 3VJNA 1NY3A 3RWQA 1E9HA 3G0FA 5FGKA