5IA0A

Crystal structure of ephrin a2 (epha2) receptor protein kinase with alisertib (mln8237)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
286
structure length
263
Chain Sequence
b'FTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 2
publication title Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 263
sequence length 286
chains with identical sequence B, C
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ia0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ia0A01
3C51A 4QP9A 2OJFE 3ANQA 4QYHA 5FTGA 4QQ5A 3EN7A 2QOFA 3O2MA 4BTFA 2XP2A 3P1AA 5DR6A 3IGOA 3IKAA 5EW8A 4IAYA 5HNBA 4AGCA 3HA6A 4YC6A 5KZIA 1SZMA 2XBJA 1AD5A 3OWLA 4WUAA 3FHRA 3HX4A 3Q6WA 4F7NA 4BCGA 1Z5MA 1S9JA 2JBPA 2X8EA 4G3EA 4EH9A 5EQPA 3RKBA 4EONA 1KWPA 4XRJA 5FXRA 1ND4A 3CKXA 3G9NA 1XKKA 3BHYA 4FEUA 3SRVB 1P5EA 1FVTA 3BLHA 4B4LA 4QMSA 5JN2A 4EUUA 5CQUA 5CEQA 4HVHA 3OY1A 4ZSGA 4C35A 3KXHA 3WILA 2C0TA 4FZFB 4EC8A 4H1JA 4F99A 5C8NA 4Q9SA 4FNYA 4FI1A 1X8BA 3D0EA 3KL8A 2YWVA 2UW0A 4YTCA 4DHFA 4CRSA 4CFWA 4XS2A 1LEWA 5EM6A 3FI8A 1PKDA 5BNJA 4CZUA 5M55A 4DEBA 5HTCA 2B4SB 3LFAA 3OXZA 4HYIA 3PVBA 4FTJA 4RJ5A 2YM3A 3R8VA 4BY9E 4FNXA 2ZM1A 3EQRA 1CMKE 3F69A 3Q6UA 3D5UA 1KE7A 2VTLA 4D5HA 3UP7A 3VW6A 5AUTA 4AW1A 3MY0A 4CFNA 4XP3A 5EKNA 1GZOA 2QOIA 3IO7A 4YZBA 3GT8A 2A19B 2F2UA 3F61A 3FZPA 2GDOA 4HJOA 5CSVA 4R3CA 4ZP5A 3QD0A 2ITOA 3BBTB 1GJOA 4DFXE 4QTEA 3S00A 2PYWA 3MH0A 4YNEA 3GC9A 2QO9A 3W33A 3H9OA 3GUBA 3LQ8A 2WELA 5E8XA 2SRCA 5CASA 5CF4A 2HENA 1JAMA 2GHLA 1E1VA 2DUVA 4PUZA 4BWPA 4NM0A 3S4QA 3RHXA 3AMAA 4IZ5A 2YM7A 2YHVA 3CJFA 3SQQA 3NYXA 4NM3A 3DKFA 2C0IA 2PE1A 2RKUA 1O9UA 3RCDA 4I41A 4HZSA 4O91A 5DT4A 3VUDA 2CSNA 4I5PA 4O0VA 5JFWA 5IQDA 3ORTA 1A06A 4FKGA 4BRXA 3EZVA 4FTNA 5EI8A 3S0OA 2ONLC 3CXWA 3WZUA 2BTRA 5IUHA 1ZLTA 2HY0A 2CN8A 4UXLA 2VWIA 2WMWA 5JGAA 3ZH8A 1U5RA 3IK3A 3RJCA 2WMXA 4CT2A 3ZO4A 4CV9A 3HEGA 4HGSA 4I92A 4TYGA 4DTBA 3ZU7A 4YJSA 4V05A 5D10A 4KIKB 5K3YA 4HGLA 3QTZA 1H1WA 4RX5A 1R0PA 4R3PA 3PIXA 4ZLYA 3NNXA 4GW8A 2XF0A 3LQ3A 3LXLA 4EQMA 2QCSA 5JQ8A 3TEIA 4JX3A 2BDJA 1DS5A 3TZMA 1Q8YA 3C4WA 2QOKA 3DNDA 3L9PA 2Z7LA 1W84A 2UZOA 4MNFA 5CEOA 4ERKA 3TN8A 4IZYA 4ANMA 3OOMA 2XK7A 2H9VA 3AD6A 1XQZA 3P08A 4QP6A 4ASEA 2BHEA 3T9IA 1OZ1A 2REIA 5F94A 2R7IA 1H28A 3C4XA 4F0FA 1YDTE 4JDJA 5HE2A 2F49A 5BUIA 1XWSA 1JPAA 4FKIA 5AUWA 3EN6A 4ASXA 4YTHA 3R9DA 4OLIA 3ORXA 1H08A 1QPJA 4IFGA 4K6ZA 5KHXA 3BGPA 3QTSA 3NYNA 4L45A 3U6HA 3R7IA 2PZPA 4RWIA 4PDYA 4JBQA 4O7NA 4M13A 2YAAA 4M0YA 4O2PA 5E4HA 4Z9LA 1YDRE 5GJGA 3R8UA 3QLGA 2RFDA 3KRJA 1ZMVA 4BDEA 4V0GB 2W96B 4HYSA 5GIOE 4DEHA 3ORIA 1F3MC 4YURA 3QKMA 2VO7A 3FY0A 4HYUA 1WCCA 2AYPA 5I9VA 2XRWA 3V5PA 4YBKA 4ZSEA 3EQIA 1RE8A 3FYJX 5LXMA 4K9YA 4RSSA 2XMYA 4LOPA 3QHRA 4FKUA 4EJNA 1JVPP 3P86A 1CM8A 1WMKA 2QC6A 2WQEA 2YISA 3F7WA 5AV4A 5HHWA 5M57A 2J7TA 3GU5A 4RA5A 4QP8A 3UVQA 4BR3A 2ZAZA 3EL8A 3UOLA 2E9OA 2XK4A 4BCFA 5LMKA 4FV2A 3WF9A 4XX9A 3QRIA 4MTAA 3RMFA 5CEMA 1ZRZA 3DU8A 3PLSA 3QX4A 4AA0A 3NVMB 4YSMA 4D9TA 1OUYA 2JLDA 1JKLA 1MUOA 3QD2B 4RIXB 5BVDA 5JEBA 3TUBA 1VYZA 4O96A 3TJDA 4TYEA 5L8KA 3DBFA 3KVWA 5KMNA 3FYKX 5CU6A 5HO7A 4KSPA 3V5QA 5AV0A 4M15A 1PXLA 3D14A 3RGFA 4BICA 2QO2A 3ACKA 5TE0A 4KNBA 4GCJA 3PPZA 2RFNA 5HG5A 4I1ZA 3RALA 1GOLA 2H34A 4DH1A 4W4WA 4QNAA 2B9JA 1ZOGA 4KUJA 1H01A 3PY1A 1UNHA 5AV1A 5IUIA 4OAUC 3V01A 3JY0A 3LMGA 3P4KA 4FBXA 4FKVA 4D28A 2BHHA 2ITYA 5C8KA 5J95A 2YABA 3FDNA 4USDA 5CYIA 2HCKA 3R1NA 4D1XA 2WTJA 4U45A 2PK9A 4MQ2A 5K4IA 3UNKA 1NT2A 1XH9A 2VTHA 2XA4A 3BQRA 1U59A 2OIQA 4PNKA 2VTRA 3AC8A 4IAKA 1Q3WA 3OS3A 5CX9A 5C26A 4IWPA 4MCVA 5HQ0A 4YTFA 3B8QA 4F9BA 3KVXA 4MXOA 4ZTNA 5AP0A 3R7GA 1Q62A 3LAUA 4FKTA 4JVGA 4PDPA 3ZEPA 3LFFA 3KF4A 4R7IA 3UG2A 3DDPA 2OG8A 3MBLA 2GNLA 3VF8A 1YQJA 4G31A 4IJPA 3IOKA 4UB7A 3EJ1A 3LIJA 4RFZA 4JIKA 3MH1A 4H39A 2BZKB 4FIHA 3ZRMA 5HG9A 5AV2A 3R1YA 4JQEA 4RVLA 4PP9A 1V0OA 3ZEWA 3ATTA 4D2SA 4IM2A 3JXWA 2VWXA 4RA4A 1IEPA 4C36A 5C01A 4DEDA 3OY3A 4LMUA 3NUXA 4KKGA 2J5EA 1FMKA 2Y6MA 3ZS5A 4O0XA 4CTBA 3EFKA 3IDCA 4HNFA 3RTPA 2V62A 3QA8A 4XJ0A 3RNYA 4FL2A 5DR2A 4H58A 4WA9A 3RK7A 3E3BX 3FXWA 2XNNA 3I7CA 4NCTC 5CLPA 4D4VA 5FDPA 2OI4X 1H00A 3KC3A 1AQ1A 5HICA 5FEQA 4Y72A 1ZYJA 3EQHA 1P4OA 4QYEA 1FGIA 3I4BA 3VQHA 5HX8A 1K9AA 4U3ZA 3A7JA 3MY5A 4PL5A 3SRVA 1JSUA 5A4CA 3KXMA 3UZTA 4YU2A 4JIAA 2BRGA 3DNEA 3VC4A 4MXAA 2GS6A 4M84A 3UC4A 1YI4A 4ZLOA 1PRYA 3PDTA 2HZ4A 3NR9A 4FEQA 3QC4A 4USFA 4AA5A 1OKWA 4RJ4A 2OJGA 4TWNA 4FKPA 2VAGA 2W4JA 3A99A 4YZCA 4PQNA 2PMNX 3U9CA 4S2ZA 4G3CA 4NFMA 3WYXA 2KTYA 2GS7A 3Q53A 4GJ3A 2GU8A 2IVTA 3LFCA 2EB2A 3DXNA 4IAZA 4HZRA 2UW3A 4FT3A 3WYYA 4QQCA 1S9IA 2CGXA 3QD4A 5DH3A 5JFXA 1Q41A 5HE1A 3RZBA 3ZO1A 2WIPA 5LARA 3IW8A 2UW8A 3U51A 3MS9A 3I7BA 2C5OA 4ZEGA 3LXNA 4TRLA 5M51A 4LRJA 4EQUA 4OTWA 3SX9A 3R8PA 3ORMA 4FIJA 5E8UA 2GQGA 4Z7GA 4HW7A 1U4DA 4Y85A 3KQ7A 4BCMA 3R00A 3RPOA 2PVKA 3I6UA 3AXWA 2YWPA 5ETCA 3TV4A 5HBEA 4C62A 4AF3A 4IB1A 3HAVA 2PMLX 4YLKA 2XS0A 3EQFA 3PVUA 4LGDA 4U8ZA 2B9HA 4ALWA 2F7XE 5CXHA 1OB3A 2I0VA 4FIEA 4F1TA 3G15A 1ZY4A 1OIQA 4UALA 4ZZNA 1XHAA 1XBBA 1WVYA 1M7NA 2C30A 4C3PA 2VWYA 3QQJA 5IU2A 3QTRA 4H1MA 4LOQA 4EHZA 5HNIX 3DKOA 5H8GA 4BVUA 3BV3A 4LFIA 1MP8A 3T9TA 5BVNA 1CKJA 2RG5A 3NW5A 4Q2AA 4LUEA 5CEPA 3BHVA 2HY81 3BU6A 3O8UA 5CZHA 2BIKB 4WNPA 1GZ8A 3D15A 5CS6A 2OH4A 1E1XA 3BCEA 2P3GX 2JEDA 5DT3A 4W4VA 4CQGA 5A4TA 1XH8A 4L9IA 1OUKA 3DK7A 2XNMA 4L67A 3F5XA 4RLKA 4KIKA 4U43A 4G2FA 4QRCA 5J87A 4CLIA 4CT1A 3GC8A 4DG2E 2OIBA 4L3LA 4GEOA 3U9NA 4Z3VA 2NNWB 2UZBA 2CCHA 4KIOA 1PYXA 4GRBA 5EDRA 4IZ7A 3D2IA 3TACA 3FI2A 4QMXA 1PXKA 4XG9A 3O71A 4R8QA 2BZJA 2W99B 3ZFMA 4A4XA 1B6CB 5IA3A 3F3VA 3EKNA 3PA3A 4QTDA 5CF5A 1J91A 4KKEA 3KK8A 3VS4A 2I1MA 4MKCA 3VBVA 2C1BA 1IASA 4Z7HA 5KE0A 4DGGA 3Q5IA 3WF6A 3F7ZA 3ALOA 5HE3A 4C61A 5DIAA 3R30A 3NGAA 3KREA 1H1SA 2R5TA 2QURA 5AA8A 5EI6A 3HV4A 3AGMA 4I6QA 3MH2A 4RIYB 4ZK5A 1H1QA 4FEXA 4EK8A 4BGHA 3FZOA 3BEAA 4MEDA 3VBQA 2R3OA 4QP3A 4QMZA 2XKDA 4R5SA 2GTMA 4R6VA 3BYMA 4BYIA 4CFXA 2PVMA 3QRJA 3GEQA 3QHWA 3OHTA 3LFSA 4XCUA 4C7TA 2HK5A 3QRTA 2Q0NA 5JH6A 3F2AA 1LPUA 2WU7A 3C4EA 4V0GA 4E3CA 3VUHA 4CZTA 3BU5A 3HP5A 2QOQA 2VTTA 4F0IA 5KUPA 5D9HA 4XHKB 1OIYA 3PJ8A 3Q9ZA 3DV3A 3TXOA 2JD5A 5CSWA 5B7VA 3FUPA 3HDNA 4E5BA 3HV6A 3FLYA 3BHUA 5T6KA 3T3VA 4XEYA 4FE2A 2PVFA 4FG9A 4AS0A 3DZQA 3V5TA 4EC9A 3CJGA 3S3IA 4PDOA 1IRKA 1EH4A 4D2TA 3GQLA 1IA8A 3FI3A 3NEWA 5E91A 4KWPA 5HZNA 5HBJA 5IDPA 2O3PA 2OGVA 2V0DA 3U4UA 2VUWA 2Y4IC 4UMTA 1ZYCA 3Q4UA 3MDYA 3DKGA 4I0RA 5BYYA 4TXCA 4U3YA 5JZNA 3UODA 4RJ6A 4ZAUA 3MIAA 3UJGA 5JKGA 4FX3A 1IAHA 3TKHA 3FXXA 4OT6A 1M2QA 4BDHA 1UKIA 2P55A 5AP4A 1FMOE 4BCQA 4C02A 4FTTA 3Q2JA 2W9ZB 2C0OA 2R64A 3P7CA 1OL1A 3EQBA 3MA3A 4H3BA 3RHKA 4ENYA 2JDOA 4FK3A 3RVGA 2PE0A 4M69B 4E5WA 4O7TA 4DFZE 4MBJA 2J9MA 2BRBA 2IW9A 4ANNA 4FVPA 2J4ZA 2BTSA 3B8RA 3JPVA 4PTEA 3VULA 3GOKA 1OI9A 2OFVA 2XM9A 3TV7A 4U80A 3WF5A 3JVSA 3Q9YA 1WBWA 4A9RA 2R4BA 2VX3A 1PXIA 2FGIA 4AW2A 2YCSA 3D5VA 4ZXTA 5EOBA 3LKMA 3CTJA 4I5CA 3QTWA 4I5HA 1PXOA 3MVMA 3L8VA 3UO4A 4AN3A 2XEYA 4OBQA 4U42A 4FSMA 4NK9A 4ANOA 5M07A 2V7AA 3F6XA 3ET7A 2VO6A 4C4EA 3VS0A 4XBRA 5LMBA 2PUIA 4O6EA 5HTBA 1Q8ZA 4IM0A 5AX3A 4RFMA 1QMZA 5L8LA 3IGGA 3ZCLA 4ZMFA 4NM7A 1YWRA 3CIKA 4GKIA 3ZLXA 3GQIA 4EZ7A 3S1HA 2C3KA 3COKA 4I22A 3VUMA 4DLJA 2J6MA 2BZIB 3ALNA 4A7CA 1YW2A 1W83A 4AOTA 4BCIA 3O7LB 5IF1A 2CGVA 4YJNA 5I5ZA 2VTAA 3ZTXA 3QCXA 3GOPA 4KRCA 4WRSA 2ITPA 4G5JA 1CSNA 2WOTA 1WBOA 3LCKA 5L2TA 2YZAA 4FV6A 1IR3A 3FC2A 5A3XA 2VTOA 2JGZA 2VO0A 2O8YA 2E2BA 4KKHA 4JBVA 4E73A 3MY1A 4CKIA 3FJQE 3LMHA 2BROA 2XNEA 3CEKA 3V8WA 3PJCA 1VR2A 3LPBA 3ENMA 3PA4A 4NKAA 2JKKA 2QOLA 3V51A 2YIYA 1APME 1A48A 5IQIA 2IZSA 5HNGA 4BZDA 3NIZA 3QQKA 5GZAA 5CVGA 5IQBA 4CZYB 4FV4A 4S32A 3IS5A 3ZUTA 4UYNA 4LL5A 3QYZA 4PNIA 4DH3A 4NH1A 3DAKA 1WBVA 3OROA 2YM6A 4ALUA 3UMXA 4GG7A 4CFMA 1TQIA 4RQKA 3TZ9A 4YUQA 4KINA 5BYZA 1V0PA 2BIYA 2ZJWA 3L9NA 3OWJA 4IJ9A 4YBJA 4XV1A 4YHTA 3QA0A 4CMUA 5J1WA 2P2HA 4KSQA 4L7FA 3IG7A 4ZIMA 2FH9A 2ITZA 2OO8X 4DTKA 2GNIA 1R3CA 3EHAA 4QP4A 5AR2A 1GIJA 4BCPA 3MVHA 4ZTRA 2VX1A 4R5YA 5HI2A 3LXKA 4I4EA 3VS1A 4BHZA 2VWUA 2BAKA 3CS9A 3UZPA 5CANA 4BI2A 5AUUA 2W0JA 3ZXTA 4ZS0A 1H0VA 1G5SA 4J97A 5CWZA 5E7RA 3ACJA 4EH6A 4O7SA 2NRUA 5L8JA 4L52A 3G0FA 3MVLA 5FUTA 4L43A 4QPAA 3QTUA 4S30A 2F7EE 2JBOA 4O7ZA 5IQFA 1H4LA 5L2QA 4GL9A 4O0SA 3VUTA 4FEVA 3NUAA 4J1RA 4DEEA 3TM0A 4QNYA 1Q5KA 5LQFA 4YJUA 4LI5A 2C5YA 2R3HA 2PVHA 3F88A 2DYLA 3E63A 3KCKA 4O6LA 5J5SA 5HTIA 3QBNA 3E88A 2B9FA 2YCFA 4NM5A 3S95A 2PVJA 4BCHA 3FEGA 3M42A 4O22A 3FWQA 3BWJA 3DTCA 3A4OX 3GI3A 1FOTA 5GZ9A 1REJA 5FG8A 2XEZA 1R39A 4CRLA 3VQUA 4MXYA 4USEA 4FSWA 3F2NA 3UO6A 3W2SA 4D2PA 3C0GA 4FZAB 4X21A 3MTLA 4GH2A 3OXIA 3PSCA 4M67A 2FVDA 3NNVA 3Q4ZA 2HWOA 1W98A 4J52A 4PTGA 2A27A 3RPRA 4C59A 5IDNA 3TJCA 3DK6A 3NWWA 2E9NA 2B54A 5GNKA 3SV0A 4G3FA 4EOQA 3FQEA 2UZVA 3UIMA 3SA0A 3POOA 2OIDA 3NAXA 2ZV7A 4MWHA 3BRBA 3BYOA 4DLIA 3Q4CA 3G33A 2R3KA 4TPTA 1BX6A 2G01A 3MJ1A 5CF6A 2VTJA 2W9FB 3CY2A 1OIUA 4IFCA 4D4RA 4UMUA 3SOAA 4ZSAA 4FV1A 4PF4A 4WIHA 4CYIA 4OGRA 5LVPA 4FV9A 3EFJA 2EXEA 2HOGA 2C68A 3DPKA 2HWPA 3DTWA 4A4OA 3ZSHA 1PYEA 4GK2A 3EN4A 2WQNA 2EUFB 2JKOA 3MA6A 5GINE 2XIXA 4BFMA 3MSSA 2WMTA 3G2FA 3PPJA 4PTCA 4BDAA 4EOKA 4F7LA 3ZXZA 5J8IA 4HVSA 3R8MA 1YVJA 3DCVA 3N9XA 3MB6A 4IMYA 4FGBA 2IO6A 3H3CA 4K0YA 1M7QA 2R3GA 1WBNA 5FBNC 2PWLA 3UYSA 4K77A 3P7AA 5HCZA 4AE9A 4FSQA 4ERWA 3F3ZA 3WIKA 3W8LA 4JX7A 4FSRA 3LLAA 2ITXA 4ID7A 3QGWA 3SW7A 1Y91A 4E7WA 3BPRA 5EM7A 3KEXA 3R01A 3RWQA 4QMNA 5CZIA 2QOBA 4U5JA 3HAMA 4LGHA 4EOOA 3G6GA 5JRQA 1YXSA 3TNHA 3W32A 4D1SA 4F6WA 4GUEA 4RIYA 3V5JA 4I94A 1ZZ2A 4MH7A 4HVGA 4OTIA 2OWBA 4DE4A 4RMZA 4LG4A 3O51A 5BYLA 4X3FC 4X3FA 2BILB 2R3PA 4EBVA 3ID6C 3RK9A 3HUCA 1ZXEA 3HLLA 3PVGA 5M4UA 2CN5A 4IQ6A 5JSMA 1BMKA 3EH9A 2W1ZA 4EORA 4YMJA 4CG8A 5JK3A 5CEKA 4ANLA 5HOAA 1NVRA 4ACDA 2UZEA 5ETAA 2C5VA 1AGWA 4ZJJA 3U8WA 4BIEA 2VWBA 1XBCA 1P2AA 3I81A 1KE5A 4XV9A 1XJDA 2FSOX 3DFAA 2ERKA 5LVOA 5HD4A 3N51A 4MVFA 2Z2WA 4ASDA 1MRYA 3NRMA 5KZ0A 3HNGA 3OT3A 1ZAOA 3R0TA 5DN3A 4HOKA 3MVJA 2WTVA 3SGCA 4N57A 4E6AA 2RG6A 3GFWA 4AWIA 4GUBA 4AN2A 4PX6A 3DZOA 4F08A 2C5XA 5I9WA 1KSWA 4M0ZA 4FR4A 3KRXA 5AIRA 1Z9XA 3VS3A 4F0GA 2Q83A 3FMDA 1BKXA 3O0GA 4PV0A 3CSVA 5HVJA 2BAQA 4AOJA 4BDJA 4AFJA 2AC3A 2QD9A 5H2UA 4AGUA 2J90A 1DM2A 1PMNA 2IWIA 1GY3A 2LGCA 5HIEA 4G34A 1GZNA 1BYGA 4FIGA 4WHZA 1WZYA 2ZMDA 3SLSA 3G9LX 1PXJA 2WMRA 3A2CA 5F20A 3DXPA 3L8PA 5A54A 1WBPA 4FSYA 3DKCA 4M69A 2QKWB 4K8AA 3MTFA 2A0CX 4B8MA 2OU7A 4W4XA 4BKYA 2F2CB 3KXZA 2WTKC 3C7QA 3F5UA 4DN5A 5ANEA 4OTHA 3EQCA 2VWVA 2VTNA 2VWWA 2YIQA 4FT0A 2UZWE 3BKBA 4XH6A 3ITZA 3UOKA 3QRKA 2Y9QA 3C9WA 4H3PA 4JDHA 3P78A 4X7QA 3DJ6A 5L3AA 4GYIA 3ZSIA 1OPKA 4FTCA 4DEIA 2XK6A 1OITA 4CVAA 1G3NA 4AW0A 3H0ZA 3H9RA 3KXXA 5AV3A 4FSUA 2X7GA 3LMIA 2QNJA 4YO4A 4EQCA 4O84A 5IA2A 1LUFA 4R1YA 2OBJA 3PP0A 4CFFA 4QPMA 2PMOX 3QTIA 5EK7A 3D7TB 3Q9XA 4QMMA 4C4IA 1OL5A 3KCFA 4PL4A 3PLAE 5C03A 3ERKA 3OEFX 2CJMA 3OBGA 2E9PA 2UW5A 2W05A 4PRJA 4ZTLA 4HCTA 5AWMA 3F3TA 1QCFA 2XKCA 4BZOA 3AMYA 1OMWA 2IVVA 2X7OA 4G5PA 4IWDA 5IZFA 4BC6A 3FMLA 2YAKA 5CALA 4O82A 4AN9A 2PVLA 5D1JA 3TDWA 2GPHA 4O7LA 2EVAA 2WOUA 2IG7A 4XOZA 3GC7A 1XH4A 2UW4A 3AQVA 4TWCA 4WNMA 5EW9A 1ZY5A 3ZRLA 5CSPA 3FLNC 5EYMA 5CENA 3IW6A 2QOOA 3EFWA 4FZDB 4JS8A 2ZM3A 3CR0A 5B0XA 4XRLA 5AP7A 3K3IA 4E4XA 5JFVA 3UMWA 2JITA 4BGQA 3HMPA 2PVNA 5AIKA 4CMTA 4ZY6A 2UZTA 3CQEA 4FOBA 3DOGA 3V6RA 4JQ7A 2W5HA 5IQHA 5LMKC 3ORKA 2GFSA 2XK3A 4JOAA 1PHKA 1F0QA 5AR7A 2ETRA 3NDMA 2B1PA 3RAWA 4D5KA 5KMMA 3FZSA 4HVIA 3HL7A 4BDBA 3UZRA 3E92A 1YXUA 3FLQA 3PJ3A 5A6OA 4O81A 2YM4A 1SNUA 3DBDA 3IW5A 3MFTA 4UMQA 5A4EA 2XIYA 1YI6A 3FE3A 3W2QA 5KKRC 1JSVA 2JDVA 2QR7A 2OXDA 3QKLA 4PPAA 2JDRA 5GJDA 4C2VA 1WBSA 4P5QA 1I09A 5LVMA 4WBBB 2V22A 2YFXA 4AZFA 3C5IA 1IG1A 2BRNA 2CMWA 3ENHA 3VBTA 3WE4A 3BX5A 3SAYA 4U6RA 4OW8A 4DG0E 2G2HA 4MX9A 4J99A 2UUEA 3COMA 3LFEA 4E8AA 2XNPA 2XNBA 5CAQA 4P90A 3U54A 3FL5A 3QYWA 4IVDA 3R2BA 4OT5A 1JLUE 3QUEA 3LOKA 4C33A 1Q61A 4Q9ZA 4R77A 2VX0A 4LGGA 3SW4A 4CD0A 4GK3A 2QKRA 3PZHA 3C0IA 4QPSA 4IANA 2GCDA 2XJ0A 5IA5A 5LMAA 5HCXA 2XIZA 5TOZA 2FSMX 4DGMA 3JR1A 4ZS4A 5DHJA 3UC3A 4APCA 3PRIA 3RPSA 2O65A 4MHAA 4ZZMA 4JDIA 3D9VA 4I0TA 5AP6A 3COHA 1U54B 3EQDA 4C3RA 3QQGA 3F5GA 4JXFA 4QMOA 4FODA 5G6VA 3PTGA 2CCIA 2FUMA 1NA7A 2O0UA 2XUUA 3ZO2A 4TWOA 4EOPA 1BLXA 2JAVA 3F3UA 3TL8A 4E6DA 4BWXA 2X81A 3TCPA 5ANGA 4DA5A 3QC9A 3IQ7A 2GHGA 1Q97A 1KV2A 2EXMA 2XB7A 2ZMCA 5AUVA 4TT7A 3IW4A 3U4WA 2OZOA 1B39A 2IVSA 3ZONA 4BTMA 1Q4LA 2C3IB 2CDZA 5KX8A 4H05A 4QO9A 4F9CA 4ACGA 4ONAA 2BMCA 4IADA 4LMNA 4WG5A 2E9UA 2WHBA 4QMPA 3RZFA 1JOWB 4M8TA 1GAGA 3GP0A 3DBCA 4C4JA 2F7ZE 3ZM9A 1NXKA 4F70A 2C6LA 4TW9A 3P7BA 4YJPA 3II5A 3ZRKA 1WVXA 4AT3A 3HV3A 4QYYA 4FG7A 4WG3A 4O7YA 5LVLA 4CFUA 5CF8A 1PMVA 2UW9A 4B0GA 4IAIA 3LCOA 3G90X 3F5PA 2Z60A 3O8TA 4F65A 3DLZA 4UWCA 4CMOA 2CPKE 4MNEB 2UZUE 3NNWA 4C34A 3UP2A 1XH6A 4BL1A 2X4FA 2BDWA 4JRVA 1JQHA 1ZMWA 4XV2A 4BKZA 4FTIA 3PYYA 5EW3A 1V1KA 3U55A 4FT9A 4YZMA 4BN1A 5FTQA 4WNKA 5I9XA 1J1CA 4RC3A 4GU6A 4X2NA 5TO8A 2HW7A 3K3JA 3P5KA 3MPTA 4GT5A 2PZYA 5AM6A 3R7YA 3NSZA 1R0EA 3UOHA 4UXQA 4XP2A 2VGPA 1Q8WA 2OJ9A 4GFOA 4KD1A 2IJMA 5AAEA 2WPAA 4KS8A 3AD5A 5J5TA 3CQUA 4CV8A 5J7BA 3BBWA 2EB3A 4MBIA 4Y46A 4GSBA 5CTPA 3OCBA 2WMVA 4S31A 3FLWA 4WSYA 3RBWA 4FV5A 4F1MA 3DY7A 2WD1A 2R7BA 4A9UA 3OWKA 4MXXA 3LJ1A 4XG7A 1NVQA 1JBPE 2ACXA 4OUCA 5AA9A 1FGKA 3UQCA 4JRNA 2B53A 1RQQA 4O1OA 1K3AA 1ERKA 3QUDA 2GS2A 4MF1A 3MB7A 4DH5A 2QOCA 2WO6A 2C3JA 4RIWB 3SXFA 3E8NA 4YLJA 4G1WA 3BELA 3GGFA 4DITA 3SOCA 3LE6A 4O38A 4FZ6A 3KMWA 2GNJA 3TUDA 2UZNA 4GU9A 4XBUA 4I23A 2X6DA 5DG5A 5AAFA 2CLXA 5AP5A 4FKQA 4RWKA 4TWPA 4A4LA 2GMXA 4Y5QA 3SDJA 3N4UA 1PXPA 2WTDA 1JKSA 4JI9A 3WZDA 4XV3A 3C13A 4YHFA 4JR7A 2WTIA 3A8XA 2OZAB 3TKIA 4QOXA 4H36A 4DGNA 5C1QB 4U40A 3BEGA 1M14A 3W55A 3EMGA 1T45A 2LAVA 4RQVA 3Q60A 3HMMA 4IBMA 4RWLA 3GCPA 3I0QA 2C47A 3ZYAA 5FEDA 4ZZOA 4XOYA 2X9FA 2ERZE 2X0GA 5AJQA 2JIUA 4NKSA 3UE4A 3WF7A 3LW0A 2E9VA 1MQ4A 3VHEA 2G1TA 2WMQA 5AUXA 3EWHA 5E8ZA 4YJQA 4IDTA 2PZRA 3MV5A 4HCUA 3MYGA 3FMNA 3EYHA 3QALE 4NIFB 4PWNA 4TYHB 1GNGA 2ZV2A 2HXQA 3QX2A 4MBLA 2GNGA 5C27A 3RINA 4BCNA 2WMSA 3U6JA 1PXMA 2OSCA 2YLEA 3FHIA 3MI9A 4AP7A 4L46A 5CSXA 4TTHB 4NJ3A 2VNWA 3KULB 4YTIA 4FL3A 4Q5EA 3PXKA 3Q52A 4OTGA 5A4LA 3FPQA 4PY1A 4XYFA 3PVWA 3S2PA 2QOHA 4IB5A 3G5DA 3UNZA 3QF9A 4APPA 3SD0A 4A9TA 2HIWA 2I6LA 3D7TA 4MXZA 4WBOA 4I6BA 3IECA 3PPKA 5AEPA 3QUPA 4D9UA 5LOHA 2RFEA 1JNKA 1BI8A 3LFDA 5KCVA 1YXXA 1ZYDA 2JDSA 5DVRA 3VBWA 2UZDA 4EZ5A 3FSKA 2ZOQA 3KGAA 3ROYA 4E4MA 2WMAA 3QQLA 2W5BA 4GT3A 5B2KA 4LM5A 4O0WA 3RI1A 2J0KA 4PMPA 4ZMEA 3HMIA 3GU6A 3OMVA 1KUTA 3PXQA 4WT6A 2VNYA 2Z7SA 5CAOA 3Q4TA 1H24A 5IMXA 4G16A 3FQSA 3V6SA 5A4QA 3PE2A 1PF8A 4Y95A 5TKDA 3OBJA 5D12A 3H0YA 4C0TA 3E8DA 3GFEA 3GU7A 1UWJA 4FGRA 2IW8A 3FZRA 5H3QA 1R78A 1MRVA 2ITNA 1Q3DA 2QLQA 4BCOA 3CTHA 4N6ZA 4O21A 5KBRA 2OF2A 3BGQA 2KULA 3EIDA 5IEYA 2R3FA 2UW6A 5ETFA 4ZTQA 2ITTA 4JG7A 5FM3A 4DT8A 2ZVAA 4JR3A 5IQCA 4MD9E 4XG3A 4RIXA 4EK4A 1O6KA 2GHMA 3E7VA 4X2FA 3OW3A 4RJ8A 1DI9A 4YZ9A 4YC8A 4BBMA 2WKMA 3GVUA 2JFMA 3VS5A 2YDKA 5FBOA 3TZ7A 3HMOA 4CCUA 1FINA 1Z57A 3ULZA 3QTXA 4IC7A 5ITAA 4X6RA 4HGEA 4RLLA 2QI8A 4BTKA 3N4VA 5EH0A 3ZC6A 3KN6A 2GNHA 1KOAA 4DFUA 5DBXA 2PZIA 1UU7A 3EN5A 4KBAA 4CSVA 4F7SA 3TTJA 4BIBA 1KE6A 4U81A 2Y8OA 2HW6A 2V5QA 5CNOA 3OTVA 3UGCA 4ZJVA 4AG8A 5HLNA 3DQXA 3PE1A 3LFNA 3PSDA 2XM8A 5AP2A 2H8HA 1PMEA 1UWHA 3R8ZA 5DMZA 2C6IA 5IEVA 3FMMA 4WD5A 4QTCA 1BL6A 3UG1A 5DYJA 4QMUA 4AUAA 2YITA 5EOLA 4UMRA 2W5AA 1URCA 1WFCA 2BPMA 1OECA 1Y8GA 3E5AA 2PL0A 3E62A 3L1SA 3R71A 4JNWA 4LL0A 4MWIA 4EH4A 2FB8A 4UN0C 2PZ5A 5IEXA 4GKHA 4D2RA 4YP8A 3ZC5A 3OVVA 4M3QA 3K5VA 1U46A 3CY3A 4FTMA 4A06A 2WTKB 4UZDA 4TYJA 1DI8A 4D4YA 4YZNA 5KBQA 3VHKA 2GQRA 3M1SA 3NZ0A 4AZVA 5EG3A 5EHOA 2Q0BA 2PUUA 4LUDA 4LYNA 5A46A 4K1BA 3V8SA 3GU8A 4YR8A 4QQTA 3TG1A 3UQGA 3OF0A 2I7QA 2RFSA 3SC1A 2J0IA 4J8MA 4C57A 1GIHA 4M14A 4Y83A 3JS2A 1XBAA 5T68A 3FXZA 3OWPA 5ACKA 3EZRA 5CAVA 4BDIA 3CE3A 2JKQA 4U0IA 3OFMA 2ETKA 3P79A 5M4IA 1FPUA 1B38A 1DAWA 5CU2A 3TNQB 5DWRA 1Y57A 2NPQA 4L8MA 5JFSA 5FTOA 3MFSA 3PWDA 2WB8A 4XNEA 4YJVA 4YLLA 2G2IA 3MWUA 5C8MA 5H9BA 3BE2A 3AC4A 3TZ8A 3WZJA 2W4OA 2ITVA 4WNOA 1W7HA 3OC1A 4U79A 4X2GA 1UA2A 3LCDA 3LZBA 2EXCX 3NX8A 3ATSA 4U41A 4IIRA 3GNIB 3GCQA 2WZJA 4PMTA 3RWPA 2YN8A 3FMEA 3EYGA 4YPSA 5HESA 4X0MA 4EBWA 4FIFA 1YWVA 4EYMA 2CKQA 4H3QA 1GZKA 4RC2A 3D94A 3PFQA 3VF9A 1RDQE 3MPAA 3TUCA 3E87A 4QMYA 1KE8A 3HGKA 3HYHA 4IB3A 4C4HA 3ZLYA 4AU8A 3ZUUA 2PU8A 4Z16A 4F6UA 3ODZX 4JBPA 2UV2A 3OP5A 4FMQA 4KB8A 3BLQA 3WBLA 1JKTA 2PMIA 3RK5A 4O7RA 2HZIA 1YOLA 3EN9A 5C4KA 1LEZA 2RIOA 1P4FA 2YIXA 4F4PA 3DXQA 4HGTA 3LCTA 5KNJA 4TN6A 4GJ2A 2BAJA 3REPA 3UVRA 4QP1A 1OKZA 3PIYA 1FBNA 3TWJA 4FZ7A 3LM0A 3I1AA 4IEBA 4IM3A 4GIIA 4GT4A 4KS7A 5HE0A 3WZEA 5LCJA 2XJ2A 4D58A 3MH3A 2YJSA 5K0KA 4W9XA 4Y5HA 5LJJA 2WAJA 3LJ0A 1W0XC 1Y8YA 4BTJA 4OBPA 4U97A 3QAME 3PY3A 5LVNA 4RIWA 2XVDA 2R3NA 3NW6A 3K5UA 4L6QA 3B2TA 2PUPA 3DJ7A 3WI6A 2IZUA 2YA9A 4L00A 3GCUA 2A1AB 2WU6A 4LV5A 3B2WA 2NO3A 4OTDA 5IA0A 2PVYA 2OFUA 5EYDA 2CGUA 3VRZA 3LVPA 5M08A 4OR5A 2BRMA 4C8BA 2VGOA 4XLIA 2XZSA 3HZTA 4D4SA 2G9XA 2UW7A 3QXOA 5D7VA 3LFBA 4GFGA 4UWYA 2X1NA 4EOMA 5EYCA 2GNFA 3AC1A 3U87A 3WF8A 5KMKA 5AMNA 3ZBFA 4XG6A 5E9EA 3OCTA 4L7SA 2OZAA 5FWKK 3OXTA 4V04A 5FDXA 3ZO3A 3ZZEA 2OK1A 2OF4A 2R3JA 4FG8A 5DRBA 3W8QA 3Q3BA 5HORA 3BZ3A 3OW4A 1YHVA 3MJ2A 4UY9A 5DEYA 1UNGA 3ZZWA 5IPJA 5ACBC 4O0YA 4F9YA 3VS7A 2YM8A 2NRYA 1MRUA 1M17A 1ZWSA 4II5A 4JG8A 5HVKA 2FYSA 5CT0A 2CGWA 3ORNA 2BUJA 5L6WL 3W10A 4G3DA 2QHMA 3CD8A 2J51A 4J96A 3THBA 2QG7A 4DEAA 3BV2A 4EOJA 4W8DA 4M12A 4DGOA 3O50A 5E8TA 3C4CA 1OKVA 2YIWA 4RZWA 4TYHA 4C58A 3ZM4A 3BQCA 5EHYA 4A9SA 2JFLA 4O0TA 2X4ZA 5AAGA 4NW6A 3KN5A 4PDSA 4ZOGA 4LRKA 3UBDA 1UNLA 2BVAA 4IE9A 4G9CA 2I0HA 3AD4A 3PXZA 3VUKA 3QGYA 4G17A 4FSTA 3ETAA 2R3RA 3KULA 1RJBA 2I40A 1YXTA 1WAKA 2NP8A 2UZLA 2YEXA 3D4QA 2HELA 3OCGA 4NYEA 3CD3A 5D41A 3ZDIA 4EEVA 3TV6A 5BVEA 4FT7A 3BIZA 4JJRA 5I9YA 2XNOA 4FVRA 2RL5A 1KOBA 4BIDA 2JIIA 3NUSA 3QZFA 3EQGA 3KKVA 4FSNA 4F9WA 2YIRA 1STCE 4RX7A 4YPDA 4JDKA 5ANKA 3MPMA 4DCEA 3N4TA 3VVHA 3AC5A 5FXQA 3HKOA 3QQFA 1J3HA 4XUFA 4O7WA 2QU5A 2VTIA 2BKZA 1W82A 2OJIA 5IA4A 3CGOA 2C5NA 1FVRA 3A62A 1H1RA 4FVQA 4EH8A 1E9HA 1K2PA 2X6EA 5IISA 2WMUA 5KMJA 1ZOHA 2C3LA 3COIA 3QZIA 3VJNA 3QCSA 4WG4A 3HA8A 2CNUA 3GC0A 3FKNA 4FV3A 2P4IA 5C9CA 3A7GA 2B9IA 2RSVA 4YGAA 1JSTA 3UIUA 1BUHA 3VO3A 4DFNA 3EFLA 4P4CA 5I3OA 3QWKA 3I5NA 5E8WA 3ZOSA 1XH7A 3QCQA 2X9EA 3NAYA 4WSQA 4YJTA 3RPVA 4DC2A 3KMMA 2IPXA 2BALA 3A61A 3BLRA 4HYHA 3GCVA 2W1HA 2G15A 4FNWA 1FVVA 3JVRA 3Q96A 3WE8A 5DA3A 5CAUA 4F9AA 3NNUA 3I0OA 4F09A 4L68A 4J98A 3WOWA 1VJYA 2JAMA 2R3IA 2W1CA 5E8YA 2CHLA 4MK0A 3HP2A 3EB0A 4J53A 3V8TA 5FLFA 4KBCA 3ZFYA 4RVTA 3ZMMA 4Z55A 4CCBA 5IA1A 4L42A 3R7UA 3ZSGA 4OTFA 4NU1A 3PXFA 5IKWA 4BDDA 3DBEA 4CEGA 2W1FA 4V01A 5K9IA 4GMYA 4BCJA 5IQAA 5JT2A 2ITUA 2VU3A 3KK9A 4N6YA 3A4PA 3DDQA 4XG4A 3PA5A 4ACMA 4YNOA 1VYWA 3BHTA 3PUPA 4EZ3A 3HUBA 2ITWA 5CU4A 4BKJA 3O7LD 2BR1A 4ALVA 4O7VA 3C5UA 4GV1A 3CQWA 5BX0A 3LM5A 4U9AA 3BYUA 1M52A 3O23A 4AAAA 4AX8A 4EH7A 1Q8UA 1OPJA 2W1DA 4X3JA 3R9RA 2PULA 4AFEA 4EWQA 2ONLA 4N0SA 3W2OA 1SVEA 1TVOA 4WRGA 3E93A 1UKHA 5J9LA 4JAIA 5HU9A 5CU3A 3NUUA 2PTKA 3DAJA 4AACA 2X8IA 4FTKA 4CNHA 1KV1A 3IPHA 2PHKA 4FIIA 4BDCA 5ANOA 4IXPA 5TR6A 5I0BA 4O83A 5EYKA 2FA2A 3MFRA 4IWOA 4QMQA 4WO5A 4M7IA 3ELJA 5HIDA 2Y4PA 3W2PA 3R9HA 4RT7A 5KMOA 4E20A 1O6YA 2Z7QA 3Q04A 3GENA 3DQWA 3NS9A 4KIQA 3R6XA 3BYVA 2GQSA 3OTUA 4NW5A 1ZOEA 1V0BA 2EWAA 2W1EA 2OH0E 5M4CA 4PPCA 5I9ZA 2OXYA 4O0UA 5DLSA 5HG8A 5E1SA 3ROCA 4BI1A 2BZHB 3PXYA 2Z7RA 3E64A 2B7AA 3OOGA 4IACA 5CY3A 5EDQA 2XKFA 3VAPA 5HX6A 4C2WA 1UU3A 3BE9A 3R9OA 2H6DA 4I3ZA 4IVCA 1RW8A 4RIOA 5IH6A 4EH2A 2W06A 3H9FA 4CG9A 5HIBA 5J7HA 3V5WA 5BUEA 1PMUA 5J79A 5LWMA 2PPQA 2ZM4A 1YXVA 4FKOA 5M53A 1Q8TA 1Y6BA 1H07A 5CNNA 5EFQA 3UYTA 4FYOA 2OJJA 3V5LA 4MQ1A 4EH5A 3BHHA 1J7LA 2X39A 5CEIA 4E4LA 4IDVA 4EUTA 4QQJA 2VD5A 4FKSA 4NTSA 5DGZA 3FKLA 2JKMA 4ANBA 4AZSA 4C3FA 4C4FA 2YACA 5JZJA 1ZYSA 4GVJA 4JAJA 4G6OA 3IDPA 5J9ZA 3R1SA 4E1ZA 2XBAA 3TKUA 2PSQA 2C6MA 5FP5A 3ZFXA 4QMWA 3W2RA 5DEWA 4Q5HA 3PG1A 4X2KA 1XH5A 2WQOA 5A14A 1YRPA 5FEEA 4O27B 4QMTA 2ZB0A 5CVHA 4DG3E 5F1ZA 4HVDA 4UV0A 3F2RA 4FEWA 3W2CA 3I5ZA 1OGUA 3OUNB 3LCSA 4BHNA 3DA6A 4NUSA 2YZLA 1NY3A 3PY0A 2VWZA 3E8CA 3KFAA 4Y73A 2BFXA 3SXSA 4EK3A 2C69A 3WZKA 1CKIA 2F57A 2O5KA 4HPUE 4D2VA 4D2WA 2Y0AA 4NFNA 4NT4A 2XYNA 3DS6A 2FSTX 4I5MA 3NLBA 3LFQA 3CPBA 4R1VA 4L53A 5FGKA 5BVKA 3R28A 5FQDC 2Y4IB 2QODA 3VRYA 2W1IA 2JC6A 5M44A 3VNTA 2GTNA 4G6NA 1BL7A 3P9JA 5B2LA 4IH8A 4CYJA 4B99A 5A6NA 3JY9A 4O86A 5CAPA 4K11A 3R7VA 2XRUA 2ZV8A 3ZBXA 4LV8A 3UIXA 3I6WA 3R21A 4X2JA 4DT9A 1ZARA 5HBHA 4HPTE 1OL2A 2ZYBA 5CQWA 5LWNA 4DF3A 1P14A 3DK3A 4M66A 2YCQA 4TNDA 3VS2A 4CGAA 4ZY4A 1O6LA 3G51A 4RFYA 4EHVA 2HAKA 4YSJA 4BZNA 1L8TA 4WKQA 4L3JA 2X2MA 3LXPA 4KA3A 4TZRA 2WXVA 5IH4A 2O2UA 3QZHA 4FV7A 3WARA 5BUJA 3QWJA 2V55A 2W17A 2WQBA 4IAAA 3A8WA 3KXGA 4CTCA 4CKJA 3L9LA 2B55A 3P23A 3JUHA 4FTRA 1FQ1B 3AT4A 1PW2A 2QONA 4ASZA 5BVFA 3ORLA 3PZEA 4K2RA 4XMOA 4FF8A 2WNTA 3R22A 3EOCA 3D2KA 5E8SA 5DR9A 3KF7A 4EOSA 1REKA 2AUHA 2XYUA 5HU3A 5E8VA 2CNVA 4FL1A 5GIPE 5HEZA 2R0UA 5M06A 5AR8A 4RVMA 4XP0A 2IW6A 4DINA 4EKLA 4B9DA 4YC3A 2HYYA 5CI7A 3GXLA 3RCJA 4RX8A 1NW1A 2C1AA 4DAWA 2YM5A 4R3RA 4BDFA 3PJ1A 3PSBA 4AZTA 2CKPA 2VV9A 4FKJA 2Z8CA 5DRDA 2PY3A 1SYKA 3E8EA 3NUNA 5ANJA 4DTAA 4O1PA 3EL7A 2QG5A 5L2IA 2DS1A 3LJ2A 4ZY5A 1SVGA 5IG1A 3D83A 5BVOA 1XR1A 3FBVA 3FAAA 4W8EA 4YZDA 2PVRA 4KBKA 5IQGA 4ITIA 3ZHPC 3DB8A 3W16A 3OUKA 1M2RA 3K54A 4AA4A 2J0MB 3R83A 3CBLA 1NVSA 1LR4A 2J50A 3A7FA 3MIYA 4MD7E 3DT1A 4TNBA 2BDFA 2ETMA 2YDIA 2WMBA 2YDJA 4IX3A 4NCTA 4R7BA 1SNXA 4L44A 4S33A 4IVBA 4KAOA 1OVEA 5CSHA 1HCKA 2FSLX 2W4KA 4JQ8A 4RJ3A 3Q32A 4L01A 3FMJA 3PRFA 4MXCA 2B0QA 4FTAA 1PY5A 3AC3A 5CU0A 1UU9A 4DFBA 1VZOA 1YWNA 4E4NA 3F82A 2VTQA 2VTPA 4FOCA 3FZ1A 3LHJA 5JGBA 4P5ZA 3AGLA 4JBOA 2XIRA 3GU4A 1UV5A 4ZTSA 4NWMA 4AZEA 2VZ6A 4QT1A 1YOMA 4GYGA 4A07A 2B52A 4XG8A 5M4FA 2P0CA 1G8AA 4J7BA 4F64A 2R2PA 4RWJA 5F95A 4DBXA 5E1EA 4DH8A 1YKRA 5ICPA 2XH5A 1OPLA 5D7AA 3AOXA 4E6CA 3NIEA 3RAHA 4HCVA 4BDKA 1QPEA 4AXAA 2QQ7A 3D5WA 3UOJA 2R3QA 4E5AX 4DEGA 5FXSA 4FA2A 4U7ZA 4L3PA 3VIDA 3QZGA 5K5XA 2RGPA 4TYIA 4E26A 5J1VA 1H0WA 1WVWA 3R1QA 5KHWA 1F5QA 3CGFA 4OTRA 4QD6A 4BBFA 3C4ZA 4FTLA 5J9YA 2VTSA 2I0EA 2EU9A 5H8EA 3ULIA 3H4JA 3F9NA 2P2IA 3AT2A 5JRSA 4E6QA 3CP9A 4QYFA 3HDMA 3PWYA 2HXLA 4FICA 4IX5A 3CTQA 4P2KA 4TY1A 5BVWA 2XK8A 4ZJIA 4HNIA 1QPCA 2C6TA 3R7EA 4ENXA 4PMMA 5AM7A 5L6OA 2GFCA 4CFVA 5BQ0A 5L2SA 5M56A 3SHEA 4F6SA 3V3VA 1CTPE 3FI4A 4DBNA 3BI6A 4D0WA 5K5NA 3EKKA 1G8SA 5CT7A 3RM7A 4IZAA 3ANRA 4ITHA 4O2ZA 5DE2A 4A9YA 5GZ8A 3CLYA 3HVCA 3QFVA 4BB4A 3V04A 2I0YA 2ZB1A 4J95A 5AFVA 5DI1A 3W1FA 4CKRA 4IW0A 5HO6A 3KRWA 3W18A 1WBTA 1J7UA 4NZWB 4AGWA 4AOIA 2O63A 2XCHA 3H10A 3MGYA 2R3MA 3OD6X 3ORZA 5CI6A 3BYSA 5H8BA 2J2IB 5DOSA 5KMIA 2A2AA 3C4FA 4R7HA 4NJDA 4RPVA 4I21A 5JGDA 2UVYA 3MW1A 4EHEA 4I20A 4IX4A 1VEBA 3QKKA 3SG9A 3HRBA 3FSFA 3HMNA 2QVSE 3QU0A 5AR3A 5M09A 2OXXA 4F1OA 3VW8A 3R2YA 4AGDA 4EOIA 3P0MA 1Q24A 1TQMA 3KY2A 4IVAA 1JWHA 4B8LA 2OKRA 3RNIA 4YHJA 4D0XA 5DNRA 4ANSA 3SVVA 4BGGA 3AMBA 4W4YA 4KABA 4RZVA 3A7IA 3M11A 4W9WA 3R9NA 3TTIA 3ZLWA 3KMUA 1A9UA 2QHNA 2WTCA 4EK6A 3QCYA 3DB6A 4EOLA 2A4LA 3TNWA 1YHWA 3KRRA 3NYVA 3PP1A 3SKCA 1DAYA 1SVHA 3CCNA 4FKWA 4M97A 2YJRA 1JKKA 1KE9A 1YI3A 3VBXA 5HG7A 5FM2A 4EL9A 2QLUA 4K18A 2BCJA 4MF0A 3D5XA 3QL8A 3C0HA 4JL9A 3F66A 1TKIA 4MD8E 4GFMA 1Q99A 4FSZA 4RRVA 4XLVA 5AR4A 4AW5A 4B7TA 4ZTMA 3OG7A 3NUPA 2WEIA 3ZDUA 1T46A 2IN6A 2HZ0A 4QMVA 4N4SA 4X3FB 3CPCA 3VS6A 5F9EA 2X7FA 5EQYA 1J1BA 3E7OA 3LQ5A 4UZHA 5EI2A 5T3QA 4C38A 3FPMA 2C6EA 3QQUA 4Y8DA 1J7IA 4ORKA 3HV7A 5KO1A 4I6HA 1MQBA 4PP7A 1L3RE 2ESMA 4IB0A 4EH3A 3TDVA 4N70A 4TL0A 4JT3A 3PJ2A 4LQMA 5TT7A 4FTQA 5K0XA 3C50A 4G9RA 5E92A 3NMUF 4ZLZA 4DGLC 3R7OA 1H26A 2AC5A 4RX9A 4UMPA 2WEVA 4IWQA 3VJOA 2WIHA 3UO5A 3BWFA 4NL0A 4IHPA 4ACHA 4BDGA 2HZNA 3HRFA 3G6HA 3IOPA 4I0SA 4BI0A 1ZYLA 3UPZA 3VUGA 2YCRA 3O96A 3TNIA 1H1PA 5FRIA 2QO7A 3PXRA 5JQ5A 3M2WA 4D55A 4F63A 3AG9A 3VUIA 5L2WA 4OTPA 3VN9A 2ZDUA 4E93A 3Q2MA 4X6QC 5ANDA 1QL6A 3UNJA 4AT4A 2C6KA 2WTWA 4FV8A 1GIIA 3IDBA 3IW7A 4BWKA 5IH5A 3RAIA 3NPCA 4ZTHA 1H8FA 5HCYA 4CXAA 1PJKA 2V7OA 5HLWA 4FK6A 4RGJA 4UYAA 4RC4A 2RF9A 1UVRA 3FV8A 4S34A 4G6LA 4TKSA 1YHSA 4O0RA 5A9UA 2BRHA 1OKYA 4LOOA 2C4GA 4GK4A 4G3GA 4YO6A 5BMSA 3IONA 1HCLA 4CLJA 4IAFA 5I9UA 4JLCA 4AE6A 3EQPA 3VWAA 4FUXA 1U54A 3GBZA 4ZSJA 4EYJA 5BMMA 3K2LA 4DFLA 4QTBA 2DWBA 4NSTA 1ZZLA 3ZUVA 3FLZA 3RAKA 4AZWA 1UU8A 5B2MA 5HLPA 3AC2A 1IAJA 3I79A 3A7HA 2ITQA 3KU2A 3KXNA 3LLTA 3NCGA 3NW7A 4MYGA 5AR5A 5AADA 4WOVA 3DFCB 5I4NA 4JG6A 2XK9A 4IC8A 4KRDA 4FNZA 1PXNA 2ZDTA 3QRUA 4DFYA 4OBOA 1W8CA 4RG0A 4BCKA 3Q5ZA 4FKLA 3QXPA 3TIYA 1OIRA 3UDBA 5CVFA 1IA9A 1OM1A 4RJ7A 2R3LA 2R9SA 3GCSA 3DAEA 5KMLA 2UVZA 5HO8A 3U6IA 2CLQA 5GHVA 5AUZA 2J0LA 3OT8A 1H25A 3DJ5A 5HKMA 4KIPA 3KRLA 2X2KA 2X8DA 1XO2B 4EWHA 4I6FA 3UPXA 3D7ZA 4QP7A 3TT0A 1SM2A 4K33A 2VTMA 1HOWA 4CQEA 4I4FA 2W7XA 3NCZA 4FKRA 2CKOA 1OL7A 5FD2A 5HD7A 4DYMA 3RP9A 1ZMUA 5IMEA 2OLCA 2XNGA 4MNEA 3TIZA 1OBGA 1M2PA 2Z02A 4XG2A 1U5QA 3HECA 3PIZA 2XCKA 3BGZA 3OZ6A 4P7EA 2WFYA 4QP2A 4PL3A 3UIBA 4EHGA 3R63A 2YERA 5DPVA 4BBEA 5ETIA 2Y6OA 5DT0A 2F4JA 5JMSA 4U44A 4QMLA 5AP3A 3L8SA 3NVKI 2IVUA 2CKEA 3UQFA 1OBDA 3QLFA 3POZA 5EKOA 3A60A 3QQHA 5DFPA 5I3RA 4PMSA 4DH7A 4NEUA 3R02A 2CNQA 4R78A 2IZTA 5G1XA 1YDSE 5C4LA 5CXZA 4NTTA 4WUNA 3C1XA 3PG3A 4FV0A 3WIGA 3FC1X 3HRCA 4FT5A 1OL6A 5HGIA 4ACCA 3MESA 3R04A 3L8XA 4UX9A 4EJ7A 2WGJA 4J8NA 4B6LA 4QTAA 3GB2A 2Y7JA 4GIHA 3MN3A 3OCSA 5EM5A 3KB7A 5TF9A 5EDPA 1CDKA 1QPDA 3I60A 5BPYA 2PUNA 3KA0A 3H30A 3ODYX 5KKRB 2XKEA 3F3WA 3UVPA 4RVKA 3FKOA 4LRMA 3T3UA 1SMHA 2C6OA 2JDTA 4ITJA 2JIVA 3R8LA 4FYNA 2UVXA 2J5FA 4QYGA 2VRXA 3TI1A 5D11A 3JYAA 1BI7A 5E90A 3TNPC 3OEZA 3FMHA 4FTUA 3L9MA 5IQEA 3CC6A 3G0EA 1I44A 3BU3A 3QTQA 5L4QA 1URWA 3AT3A 4AT5A 3HV5A 1LP4A 1TQPA 2YLFA 2IZRA 4GVAA 5EM8A 5K4JA 3SG8A 3FL4A 3QD3A 4UEUA 2QU6A 5ANIA 2XJ1A 2FO0A 2BFYA 4BYJA 2DQ7X 2F9GA 3ORPA 4F7JA 2OICA 4FUYA 3VBYA 4UWBA 3Q9WA 4DCAA 4ARKA 3MFUA 3T8OA 3FLSA 3O8PA 4D1ZA 3FQHA 4C37A 4YJRA 2J0JA 3NYOA 4J71A 3NUYA 5HVYA 4ZSLA 5GJFA 4IX6A 4MAOA 5AX9A 5AUYA 5FP6A 2X2LA 4FTOA 4YJOA 2O64A 1H27A 3DBQA 1CKPA 3DGKA 4GS6A 3RPYA 4GG5A 4BF2A 4EI4A 3FZTA 4I93A 2QR8A 2P33A 2VO3A 2XIKA 2H96A 2W1GA 1PKGA 4UBAA 2PE2A 2VN9A 4RBLA 1ATPE 2C6DA 3FMKA 4OTQA 1YOJA 4FC0A 2R0IA 4OAVB 3CKWA 5EHLA 5L6PA 3SXRA 2GSFA 2G2FA 4EKKA 2OW3A 5IUGA 4PPBA 4EK5A 3FY2A 4I24A 4NIFA 5AP1A 2ZV9A 3O17A 5EQEA 3UTOA 4AQCA 2WQMA 1Y6AA 3DLSA 3RM6A 5F4NA 4M68A 4ANQA 2BKKA 3R73A 5LCKA 4C4GA 3E3PA 1R1WA 3ZLSA
chains in the Genus database with same CATH superfamily
3C51A 4QP9A 2OJFE 3ANQA 4QYHA 5FTGA 4QQ5A 4BJJB 3EN7A 2QOFA 3O2MA 4BTFA 2XP2A 3P1AA 5DR6A 3IGOA 3IKAA 5EW8A 4IAYA 5HNBA 4AGCA 3HA6A 4YC6A 5KZIA 1SZMA 2XBJA 1AD5A 3OWLA 4WUAA 3FHRA 3HX4A 3Q6WA 4F7NA 4BCGA 1Z5MA 1S9JA 2JBPA 2X8EA 4G3EA 4EH9A 5EQPA 3RKBA 4EONA 1KWPA 4XRJA 5FXRA 1ND4A 3CKXA 3G9NA 1XKKA 3BHYA 4FEUA 3SRVB 1P5EA 1FVTA 3BLHA 4B4LA 4QMSA 5JN2A 4EUUA 5CQUA 5CEQA 4HVHA 3OY1A 4ZSGA 4C35A 3KXHA 3WILA 2C0TA 4FZFB 4EC8A 4H1JA 4F99A 5C8NA 4Q9SA 4FNYA 4FI1A 1X8BA 3D0EA 3KL8A 2YWVA 2UW0A 4YTCA 4DHFA 4CRSA 4CFWA 4XS2A 1LEWA 5EM6A 3FI8A 1PKDA 5BNJA 4CZUA 5M55A 4DEBA 5HTCA 2B4SB 3LFAA 3OXZA 4HYIA 3PVBA 4FTJA 4RJ5A 2YM3A 3R8VA 4BY9E 4FNXA 2ZM1A 3EQRA 1CMKE 3F69A 3Q6UA 4F78A 3D5UA 1KE7A 2VTLA 4D5HA 3UP7A 3VW6A 5AUTA 4AW1A 3MY0A 4CFNA 4XP3A 5EKNA 1GZOA 2QOIA 3IO7A 4YZBA 3GT8A 2A19B 2F2UA 3F61A 3FZPA 2GDOA 4HJOA 5CSVA 4R3CA 4ZP5A 3QD0A 2ITOA 3BBTB 1GJOA 4DFXE 4QTEA 3S00A 2PYWA 3MH0A 4YNEA 3GC9A 2QO9A 3W33A 3H9OA 3GUBA 3LQ8A 2WELA 5E8XA 2SRCA 5CASA 5CF4A 2HENA 1JAMA 2GHLA 1E1VA 2DUVA 4PUZA 4BWPA 4NM0A 3S4QA 3RHXA 3AMAA 4IZ5A 2YM7A 2YHVA 3CJFA 3SQQA 3NYXA 4NM3A 3DKFA 2C0IA 2PE1A 2RKUA 1O9UA 3RCDA 4I41A 4HZSA 4O91A 5DT4A 3VUDA 3KIOC 2CSNA 4I5PA 4O0VA 5JFWA 5IQDA 3ORTA 1A06A 4FKGA 4BRXA 3EZVA 4FTNA 5EI8A 3S0OA 2ONLC 3CXWA 3WZUA 2BTRA 5IUHA 1ZLTA 2HY0A 2CN8A 4UXLA 2VWIA 2WMWA 5JGAA 3ZH8A 1U5RA 3IK3A 3RJCA 2WMXA 4CT2A 3O5AA 3ZO4A 4CV9A 3HEGA 4HGSA 4I92A 4TYGA 4DTBA 3ZU7A 4YJSA 4V05A 5D10A 4KIKB 5K3YA 4HGLA 3QTZA 1H1WA 4RX5A 1R0PA 4R3PA 3PIXA 4ZLYA 3NNXA 4GW8A 2XF0A 3LQ3A 3LXLA 4EQMA 2QCSA 5JQ8A 3TEIA 4JX3A 2BDJA 1DS5A 3TZMA 1Q8YA 3C4WA 2QOKA 3DNDA 3L9PA 2Z7LA 1W84A 2UZOA 4MNFA 5CEOA 4ERKA 3TN8A 4IZYA 4ANMA 3OOMA 2XK7A 2H9VA 3AD6A 1XQZA 3P08A 4QP6A 4ASEA 2BHEA 3T9IA 1OZ1A 2REIA 5F94A 2R7IA 1H28A 3C4XA 4F0FA 1YDTE 4JDJA 5HE2A 2F49A 5BUIA 1XWSA 1JPAA 4FKIA 2XALA 5AUWA 3EN6A 4ASXA 4YTHA 3R9DA 4OLIA 3ORXA 1H08A 1QPJA 4IFGA 4K6ZA 5KHXA 3BGPA 3QTSA 3NYNA 4L45A 3U6HA 3R7IA 2PZPA 4RWIA 4PDYA 4JBQA 4O7NA 4M13A 2YAAA 4M0YA 4O2PA 5E4HA 4Z9LA 1YDRE 5GJGA 3R8UA 3QLGA 2RFDA 3KRJA 1ZMVA 4BDEA 4V0GB 2W96B 4HYSA 5GIOE 4DEHA 3ORIA 1F3MC 4YURA 3QKMA 2VO7A 3FY0A 4HYUA 1WCCA 2AYPA 5I9VA 2XRWA 3V5PA 4YBKA 4ZSEA 3EQIA 1RE8A 3FYJX 5LXMA 4K9YA 4RSSA 2XMYA 4LOPA 3QHRA 4FKUA 4EJNA 1JVPP 3P86A 1CM8A 1WMKA 2QC6A 2WQEA 2YISA 3F7WA 5AV4A 5HHWA 5M57A 2J7TA 3GU5A 4RA5A 4QP8A 3UVQA 4BR3A 2ZAZA 3EL8A 3UOLA 2E9OA 2XK4A 4BCFA 5LMKA 4FV2A 3WF9A 4XX9A 3QRIA 4MTAA 3RMFA 5CEMA 1ZRZA 3DU8A 3PLSA 3QX4A 4AA0A 3NVMB 4YSMA 4D9TA 1OUYA 2JLDA 1JKLA 1MUOA 3QD2B 4RIXB 5BVDA 5JEBA 3TUBA 1VYZA 4O96A 3TJDA 4TYEA 5L8KA 3DBFA 3KVWA 5KMNA 3AKLA 3FYKX 5CU6A 5HO7A 4KSPA 3V5QA 5AV0A 4M15A 1PXLA 3D14A 3RGFA 4BICA 2QO2A 3ACKA 5TE0A 4KNBA 4GCJA 3PPZA 2RFNA 5HG5A 4I1ZA 3RALA 1GOLA 2H34A 4DH1A 4W4WA 4QNAA 2B9JA 1ZOGA 4KUJA 1H01A 3PY1A 1UNHA 5AV1A 5IUIA 4OAUC 3V01A 3JY0A 3LMGA 3P4KA 4FBXA 4FKVA 4D28A 2BHHA 3AKJA 2ITYA 5C8KA 5J95A 2YABA 3FDNA 4USDA 5CYIA 2HCKA 3R1NA 4D1XA 2WTJA 4U45A 2PK9A 4MQ2A 5K4IA 3UNKA 1NT2A 1XH9A 2VTHA 2XA4A 3BQRA 1U59A 2OIQA 4PNKA 2VTRA 3AC8A 4IAKA 1Q3WA 3OS3A 5CX9A 5C26A 4IWPA 4MCVA 5HQ0A 4YTFA 3B8QA 4F9BA 3KVXA 4MXOA 4ZTNA 5AP0A 3R7GA 1Q62A 3LAUA 4FKTA 4JVGA 4PDPA 3ZEPA 3LFFA 3KF4A 4R7IA 3UG2A 3DDPA 2OG8A 3MBLA 2GNLA 3VF8A 1YQJA 4G31A 4IJPA 3IOKA 4UB7A 3EJ1A 3LIJA 4RFZA 4JIKA 3MH1A 4H39A 2BZKB 4FIHA 3ZRMA 5HG9A 5AV2A 3R1YA 4JQEA 4RVLA 4PP9A 1V0OA 3ZEWA 3ATTA 4D2SA 4IM2A 3JXWA 2VWXA 4RA4A 1IEPA 4C36A 5C01A 4DEDA 3OY3A 4LMUA 3NUXA 4KKGA 2J5EA 1FMKA 2Y6MA 3ZS5A 4O0XA 4CTBA 3EFKA 3IDCA 4HNFA 3RTPA 2V62A 3QA8A 4XJ0A 3RNYA 4FL2A 4BJJA 5DR2A 4H58A 4WA9A 3RK7A 3E3BX 3FXWA 2XNNA 3I7CA 4NCTC 5CLPA 4D4VA 3W0QA 5FDPA 2OI4X 1H00A 3KC3A 1AQ1A 5HICA 5FEQA 4Y72A 1ZYJA 3EQHA 1P4OA 4QYEA 1FGIA 3I4BA 4DHJA 3VQHA 5HX8A 1K9AA 4U3ZA 3A7JA 3UDTA 3MY5A 4PL5A 3SRVA 1JSUA 5A4CA 3KXMA 3UZTA 4YU2A 4JIAA 2BRGA 3DNEA 3VC4A 1ST4A 4MXAA 2GS6A 4M84A 3UC4A 1YI4A 4ZLOA 1PRYA 3PDTA 2HZ4A 3NR9A 4FEQA 3QC4A 4USFA 4AA5A 1OKWA 4RJ4A 2OJGA 4TWNA 4FKPA 2VAGA 2W4JA 3A99A 4YZCA 4PQNA 2PMNX 3U9CA 4S2ZA 4G3CA 4NFMA 3WYXA 2KTYA 2GS7A 3Q53A 4GJ3A 2GU8A 2IVTA 1XMLA 3LFCA 2EB2A 3DXNA 4IAZA 4HZRA 2UW3A 4FT3A 3WYYA 4QQCA 1S9IA 2CGXA 3QD4A 5DH3A 5JFXA 1Q41A 5HE1A 3RZBA 3ZO1A 2WIPA 5LARA 3IW8A 2UW8A 3U51A 3MS9A 3I7BA 2C5OA 4ZEGA 3LXNA 4TRLA 5M51A 4LRJA 4EQUA 4OTWA 3SX9A 3R8PA 3ORMA 4FIJA 5E8UA 2GQGA 4Z7GA 4HW7A 1U4DA 4Y85A 3KQ7A 4BCMA 3R00A 3RPOA 2PVKA 3I6UA 3AXWA 2YWPA 5ETCA 3TV4A 5HBEA 4C62A 4AF3A 4IB1A 3HAVA 2PMLX 4YLKA 2XS0A 3EQFA 3PVUA 4LGDA 4U8ZA 2B9HA 4ALWA 2F7XE 5CXHA 1OB3A 2I0VA 4FIEA 4F1TA 3G15A 1ZY4A 1OIQA 4UALA 4ZZNA 1XHAA 1XBBA 1WVYA 1M7NA 2C30A 4C3PA 2VWYA 3QQJA 5IU2A 3QTRA 4H1MA 4LOQA 4EHZA 5HNIX 3DKOA 5H8GA 4BVUA 3BV3A 4LFIA 1MP8A 3T9TA 5BVNA 1CKJA 1TFFA 2RG5A 3NW5A 4Q2AA 4LUEA 5CEPA 3BHVA 2HY81 3BU6A 3O8UA 5CZHA 2BIKB 4WNPA 1GZ8A 3D15A 5CS6A 2OH4A 1E1XA 3BCEA 2P3GX 2JEDA 5DT3A 4W4VA 4CQGA 5A4TA 1XH8A 4L9IA 1OUKA 3DK7A 2XNMA 4L67A 3F5XA 4RLKA 4KIKA 4U43A 4G2FA 4QRCA 5J87A 4CLIA 4CT1A 3GC8A 4DG2E 2OIBA 4L3LA 4GEOA 3U9NA 4Z3VA 2NNWB 2UZBA 2CCHA 4KIOA 1PYXA 4GRBA 5EDRA 4IZ7A 3D2IA 3TACA 3FI2A 4QMXA 1PXKA 4XG9A 3O71A 4R8QA 2BZJA 2W99B 3ZFMA 4A4XA 1B6CB 5IA3A 4JMQA 3F3VA 3EKNA 3PA3A 4QTDA 5CF5A 1J91A 4KKEA 3KK8A 3VS4A 2I1MA 4MKCA 3VBVA 2C1BA 1IASA 4Z7HA 5KE0A 4DGGA 3Q5IA 3WF6A 3F7ZA 3ALOA 5HE3A 4C61A 5DIAA 3R30A 3NGAA 3KREA 1H1SA 2R5TA 2QURA 5AA8A 5EI6A 3HV4A 3AGMA 4I6QA 3MH2A 4RIYB 4ZK5A 1H1QA 4FEXA 4EK8A 4BGHA 3FZOA 3BEAA 4MEDA 3VBQA 2R3OA 4QP3A 4QMZA 2XKDA 4R5SA 2GTMA 4R6VA 3BYMA 4BYIA 4CFXA 2PVMA 3QRJA 3GEQA 3QHWA 3OHTA 3LFSA 4XCUA 4C7TA 2HK5A 3QRTA 2Q0NA 3NFGB 5JH6A 3F2AA 1LPUA 2WU7A 3C4EA 4V0GA 4E3CA 3VUHA 4CZTA 3BU5A 3HP5A 2QOQA 2VTTA 4F0IA 5KUPA 5D9HA 4XHKB 1OIYA 3PJ8A 3Q9ZA 3DV3A 3TXOA 2JD5A 5CSWA 5B7VA 3FUPA 3HDNA 4E5BA 3HV6A 3FLYA 3BHUA 5T6KA 3T3VA 1VLRA 4XEYA 4FE2A 2PVFA 4FG9A 4AS0A 3DZQA 3V5TA 4EC9A 3CJGA 3S3IA 4PDOA 1IRKA 1EH4A 4D2TA 3GQLA 1IA8A 3FI3A 3NEWA 5E91A 4KWPA 5HZNA 5HBJA 5IDPA 2O3PA 2OGVA 2V0DA 3U4UA 2VUWA 2Y4IC 4UMTA 1ZYCA 3Q4UA 3MDYA 3DKGA 4I0RA 5BYYA 4TXCA 4U3YA 5JZNA 3UODA 4RJ6A 4ZAUA 3MIAA 3UJGA 5JKGA 4FX3A 1IAHA 3TKHA 3FXXA 4OT6A 1M2QA 4BDHA 1UKIA 2IEWA 2P55A 1FMOE 5AP4A 4BCQA 4C02A 4FTTA 3Q2JA 2W9ZB 2C0OA 2R64A 4QEBA 3P7CA 1OL1A 3EQBA 3MA3A 4H3BA 3RHKA 4ENYA 2JDOA 4FK3A 3RVGA 2PE0A 4M69B 4E5WA 4O7TA 4DFZE 4MBJA 2J9MA 2BRBA 2IW9A 4ANNA 4FVPA 2J4ZA 2BTSA 3B8RA 3JPVA 4PTEA 3VULA 3GOKA 1OI9A 2OFVA 2XM9A 3TV7A 4U80A 3WF5A 3JVSA 3Q9YA 1WBWA 4A9RA 2R4BA 2VX3A 1PXIA 2FGIA 4AW2A 2YCSA 3D5VA 4ZXTA 2X0PA 5EOBA 3LKMA 3CTJA 4I5CA 3QTWA 4I5HA 1PXOA 3MVMA 3L8VA 3UO4A 4AN3A 2XEYA 4OBQA 4U42A 4FSMA 4NK9A 4ANOA 5M07A 2V7AA 4DHIB 3F6XA 3ET7A 2VO6A 4C4EA 3VS0A 4XBRA 5LMBA 2PUIA 4O6EA 5HTBA 1Q8ZA 4IM0A 5AX3A 4RFMA 1QMZA 5L8LA 3IGGA 3ZCLA 4ZMFA 4NM7A 1YWRA 3CIKA 4GKIA 3ZLXA 3GQIA 4EZ7A 3S1HA 2C3KA 3COKA 4I22A 3VUMA 4DLJA 2J6MA 2BZIB 3ALNA 4A7CA 1YW2A 1W83A 4AOTA 4BCIA 3O7LB 5IF1A 2CGVA 4YJNA 5I5ZA 2VTAA 3ZTXA 3QCXA 3GOPA 4KRCA 4WRSA 2ITPA 4G5JA 1CSNA 2WOTA 1WBOA 3LCKA 5L2TA 2YZAA 4FV6A 1IR3A 3FC2A 5A3XA 2VTOA 2JGZA 2VO0A 2O8YA 2E2BA 4KKHA 4JBVA 4E73A 3MY1A 4CKIA 3FJQE 3LMHA 2BROA 2XNEA 3CEKA 3V8WA 3PJCA 1VR2A 3LPBA 3ENMA 3PA4A 3NFFB 4NKAA 2JKKA 2QOLA 3V51A 2YIYA 1APME 1A48A 5IQIA 2IZSA 5HNGA 4BZDA 3NIZA 3QQKA 5GZAA 5CVGA 5IQBA 3W0MA 4CZYB 4FV4A 4S32A 3IS5A 3ZUTA 4UYNA 4LL5A 3QYZA 4PNIA 4DH3A 4NH1A 3DAKA 1WBVA 3OROA 2YM6A 4ALUA 3UMXA 4GG7A 4CFMA 1TQIA 4RQKA 3TZ9A 4YUQA 4KINA 5BYZA 1V0PA 2BIYA 2ZJWA 3L9NA 3OWJA 4IJ9A 4YBJA 4XV1A 4YHTA 3QA0A 4CMUA 5J1WA 2P2HA 4KSQA 4L7FA 3IG7A 4ZIMA 2FH9A 2ITZA 2OO8X 4DTKA 2GNIA 1R3CA 3EHAA 4QP4A 5AR2A 1GIJA 4BCPA 3MVHA 4ZTRA 2VX1A 4R5YA 5HI2A 3LXKA 4I4EA 3VS1A 4BHZA 2VWUA 2BAKA 3CS9A 3UZPA 5CANA 4BI2A 5AUUA 2W0JA 3ZXTA 4ZS0A 4LV7A 1H0VA 1G5SA 4J97A 5CWZA 5E7RA 3ACJA 4EH6A 4O7SA 2NRUA 5L8JA 4L52A 3G0FA 3MVLA 5FUTA 4L43A 4QPAA 3QTUA 4S30A 2F7EE 2JBOA 4O7ZA 5IQFA 1H4LA 5L2QA 4GL9A 4O0SA 3VUTA 4FEVA 3NUAA 4J1RA 4DEEA 3TM0A 4QNYA 1Q5KA 5LQFA 4YJUA 4LI5A 2C5YA 2R3HA 2PVHA 3F88A 2DYLA 3E63A 3KCKA 4O6LA 5J5SA 5HTIA 3QBNA 3E88A 2B9FA 2YCFA 4NM5A 3S95A 2PVJA 4BCHA 3FEGA 3M42A 4O22A 3FWQA 3BWJA 3DTCA 3A4OX 3GI3A 1FOTA 5GZ9A 1REJA 5FG8A 2XEZA 1R39A 4CRLA 3VQUA 4MXYA 4USEA 4FSWA 3F2NA 3UO6A 3W2SA 4D2PA 3C0GA 4FZAB 4X21A 4AXEA 3MTLA 4GH2A 3OXIA 3PSCA 4M67A 2FVDA 3NNVA 3Q4ZA 2HWOA 1W98A 4J52A 4PTGA 2A27A 3RPRA 4C59A 5IDNA 3TJCA 3DK6A 3NWWA 2E9NA 2B54A 5GNKA 3SV0A 4G3FA 4EOQA 3FQEA 2UZVA 3UIMA 3SA0A 3POOA 2OIDA 3NAXA 2ZV7A 4MWHA 3BRBA 3BYOA 4DLIA 3Q4CA 3G33A 2R3KA 4TPTA 1BX6A 2G01A 3MJ1A 5CF6A 2VTJA 4FRFA 2W9FB 3CY2A 1OIUA 4IFCA 4D4RA 4UMUA 3SOAA 4ZSAA 4FV1A 4PF4A 4WIHA 4CYIA 4OGRA 5LVPA 3BLAA 4FV9A 3EFJA 2EXEA 2HOGA 2C68A 3DPKA 2HWPA 3DTWA 4A4OA 3ZSHA 1PYEA 4GK2A 3EN4A 2WQNA 2EUFB 2JKOA 3MA6A 5GINE 2XIXA 4BFMA 3MSSA 2WMTA 3G2FA 3PPJA 4PTCA 4BDAA 4EOKA 4F7LA 1OGYA 3ZXZA 2IF8A 5J8IA 4HVSA 3R8MA 1YVJA 3DCVA 3N9XA 3MB6A 4IMYA 4FGBA 2IO6A 3H3CA 4K0YA 1M7QA 2R3GA 1WBNA 5FBNC 2PWLA 3UYSA 4K77A 3P7AA 5HCZA 4AE9A 4FSQA 4ERWA 3F3ZA 3WIKA 3W8LA 4JX7A 4FSRA 3LLAA 2ITXA 4ID7A 3QGWA 3SW7A 1Y91A 4E7WA 3BPRA 5EM7A 3KEXA 3R01A 3RWQA 4QMNA 5CZIA 2QOBA 4U5JA 3HAMA 4LGHA 4EOOA 3G6GA 5JRQA 1YXSA 3TNHA 3W32A 4D1SA 4F6WA 4GUEA 4RIYA 3V5JA 4I94A 1ZZ2A 4MH7A 4HVGA 4OTIA 2OWBA 4DE4A 4RMZA 4LG4A 3O51A 5BYLA 4X3FC 4X3FA 2BILB 2R3PA 4EBVA 3ID6C 3RK9A 3HUCA 1ZXEA 3HLLA 3PVGA 5M4UA 2CN5A 4IQ6A 5JSMA 1BMKA 3EH9A 2W1ZA 4EORA 4YMJA 4CG8A 5JK3A 5CEKA 4ANLA 5HOAA 1NVRA 4ACDA 2UZEA 5ETAA 2C5VA 1AGWA 4ZJJA 3U8WA 4BIEA 2VWBA 1XBCA 1P2AA 3I81A 1KE5A 4XV9A 1XJDA 2FSOX 3DFAA 2ERKA 5LVOA 5HD4A 3N51A 4MVFA 1G8JA 2Z2WA 4ASDA 1MRYA 3NRMA 5KZ0A 3HNGA 3OT3A 1ZAOA 3R0TA 5DN3A 4HOKA 3MVJA 2WTVA 4AXDA 3SGCA 4N57A 4E6AA 2RG6A 3GFWA 4AWIA 4GUBA 4AN2A 4PX6A 3DZOA 4F08A 2C5XA 5I9WA 1KSWA 4M0ZA 4FR4A 3KRXA 5AIRA 1Z9XA 3VS3A 4F0GA 2Q83A 3FMDA 1BKXA 3O0GA 4PV0A 3CSVA 5HVJA 2BAQA 4AOJA 4BDJA 4AFJA 2AC3A 2QD9A 5H2UA 4AGUA 2J90A 1DM2A 1PMNA 2IWIA 1GY3A 2LGCA 5HIEA 2XARA 4G34A 1GZNA 1BYGA 4FIGA 4WHZA 1WZYA 2ZMDA 3SLSA 3G9LX 1PXJA 2WMRA 3A2CA 5F20A 3DXPA 3L8PA 5A54A 1WBPA 4FSYA 3DKCA 4M69A 2QKWB 4K8AA 3MTFA 2A0CX 4B8MA 2OU7A 4W4XA 4BKYA 2F2CB 3KXZA 2WTKC 3C7QA 3F5UA 4DN5A 5ANEA 4OTHA 3EQCA 2VWVA 2VTNA 2VWWA 2YIQA 4FT0A 2UZWE 3BKBA 4XH6A 3ITZA 3UOKA 3QRKA 2Y9QA 3C9WA 4H3PA 4JDHA 3P78A 4X7QA 3DJ6A 5L3AA 4GYIA 3ZSIA 1OPKA 4FTCA 4DEIA 2XK6A 1OITA 4CVAA 1G3NA 4AW0A 3H0ZA 3H9RA 3KXXA 5AV3A 4FSUA 2X7GA 3LMIA 2QNJA 4YO4A 4EQCA 4O84A 5IA2A 1LUFA 4R1YA 2OBJA 3PP0A 4CFFA 4QPMA 2PMOX 3QTIA 5EK7A 3D7TB 3Q9XA 4QMMA 4C4IA 1OL5A 3KCFA 4PL4A 3PLAE 5C03A 3ERKA 3OEFX 2CJMA 1XMMA 3OBGA 2E9PA 2UW5A 2W05A 4PRJA 4ZTLA 4HCTA 5AWMA 3F3TA 1QCFA 2XKCA 4BZOA 3AMYA 1OMWA 2IVVA 2X7OA 4G5PA 4IWDA 5IZFA 4BC6A 3FMLA 2YAKA 5CALA 4O82A 4AN9A 2PVLA 5D1JA 3TDWA 2GPHA 4O4EA 4O7LA 2EVAA 4DHZA 2WOUA 2IG7A 4XOZA 3GC7A 1XH4A 2UW4A 3AQVA 4TWCA 4WNMA 5EW9A 1ZY5A 3ZRLA 5CSPA 3FLNC 5EYMA 5CENA 3IW6A 2QOOA 3EFWA 4FZDB 4JS8A 2ZM3A 3CR0A 5B0XA 4XRLA 5AP7A 3K3IA 4E4XA 5JFVA 3UMWA 2JITA 4BGQA 3HMPA 2PVNA 5AIKA 4CMTA 4ZY6A 2UZTA 3CQEA 4FOBA 3DOGA 3V6RA 4JQ7A 2W5HA 5IQHA 5LMKC 3ORKA 2GFSA 2XK3A 4JOAA 1PHKA 1F0QA 5AR7A 2ETRA 3NDMA 2B1PA 3RAWA 4D5KA 5KMMA 3FZSA 4HVIA 3HL7A 4BDBA 3UZRA 3E92A 1YXUA 3FLQA 3PJ3A 5A6OA 4O81A 2YM4A 1SNUA 3DBDA 3IW5A 3MFTA 4UMQA 5A4EA 2XIYA 1YI6A 3FE3A 3W2QA 5KKRC 1JSVA 2JDVA 2QR7A 2OXDA 3QKLA 4PPAA 2JDRA 5GJDA 4C2VA 1WBSA 4P5QA 1I09A 5LVMA 4WBBB 2V22A 2YFXA 4AZFA 3C5IA 1IG1A 2BRNA 2CMWA 3ENHA 3VBTA 3WE4A 3BX5A 3SAYA 4U6RA 4OW8A 4DG0E 2G2HA 4MX9A 4J99A 2UUEA 3COMA 3LFEA 4E8AA 2XNPA 2XNBA 5CAQA 4P90A 3U54A 3FL5A 3QYWA 4IVDA 3R2BA 4OT5A 1JLUE 3QUEA 3LOKA 4C33A 1Q61A 4Q9ZA 4R77A 2VX0A 4LGGA 3SW4A 4CD0A 4GK3A 2QKRA 3PZHA 3C0IA 4QPSA 4IANA 2GCDA 2XJ0A 5IA5A 5LMAA 5HCXA 2XIZA 5TOZA 2FSMX 4DGMA 3JR1A 4ZS4A 5DHJA 3UC3A 4APCA 3PRIA 3RPSA 2O65A 4MHAA 4ZZMA 4JDIA 3D9VA 4I0TA 5AP6A 3COHA 1U54B 3EQDA 4C3RA 3QQGA 3F5GA 4JXFA 4QMOA 4FODA 5G6VA 3PTGA 2CCIA 2FUMA 1NA7A 2O0UA 2XUUA 3ZO2A 4TWOA 4EOPA 1BLXA 2JAVA 3F3UA 3TL8A 4E6DA 4BWXA 2X81A 3TCPA 1W2FA 5ANGA 4DA5A 3QC9A 3IQ7A 2GHGA 1Q97A 1KV2A 2EXMA 2XB7A 2ZMCA 5AUVA 4TT7A 3IW4A 3U4WA 2OZOA 1B39A 2IVSA 3ZONA 4BTMA 1Q4LA 2C3IB 2CDZA 5KX8A 4H05A 4QO9A 4F9CA 4ACGA 4ONAA 2BMCA 4IADA 4LMNA 4WG5A 2E9UA 2WHBA 4QMPA 3RZFA 1JOWB 4M8TA 1GAGA 3GP0A 3DBCA 4C4JA 2F7ZE 3ZM9A 1NXKA 4F70A 2C6LA 4TW9A 3P7BA 1W2CA 4YJPA 3II5A 3ZRKA 1WVXA 4AT3A 3HV3A 4QYYA 4FG7A 4WG3A 4O7YA 5LVLA 4CFUA 5CF8A 1PMVA 2UW9A 4B0GA 4IAIA 3LCOA 3G90X 3F5PA 2Z60A 3O8TA 3PUFC 4F65A 3DLZA 4UWCA 4CMOA 2CPKE 4MNEB 2UZUE 3NNWA 4C34A 3UP2A 1XH6A 4BL1A 2X4FA 2BDWA 4JRVA 1JQHA 1ZMWA 4XV2A 4BKZA 4FTIA 3PYYA 5EW3A 1V1KA 3U55A 4FT9A 1G8KA 4YZMA 4BN1A 5FTQA 4WNKA 5I9XA 1J1CA 4RC3A 4GU6A 4X2NA 5TO8A 2HW7A 3K3JA 3P5KA 3MPTA 4GT5A 2PZYA 5AM6A 3R7YA 3NSZA 1R0EA 2A98A 3UOHA 4UXQA 4XP2A 3BL9A 2VGPA 1Q8WA 2OJ9A 4GFOA 4KD1A 2IJMA 5AAEA 2WPAA 4KS8A 3AD5A 5J5TA 3CQUA 4CV8A 5J7BA 3BBWA 2EB3A 4MBIA 4Y46A 4GSBA 5CTPA 3OCBA 2WMVA 4S31A 3FLWA 4WSYA 3RBWA 4FV5A 4F1MA 3DY7A 2WD1A 2R7BA 4A9UA 3OWKA 4MUQA 4MXXA 3LJ1A 4XG7A 1NVQA 1JBPE 2ACXA 4OUCA 5AA9A 1FGKA 3UQCA 4JRNA 2B53A 1RQQA 4O1OA 2XAOA 1K3AA 1ERKA 3QUDA 2GS2A 4MF1A 3MB7A 4DH5A 2QOCA 2WO6A 2C3JA 4RIWB 3SXFA 3E8NA 4YLJA 4G1WA 3BELA 3GGFA 4DITA 3SOCA 3LE6A 4O38A 4FZ6A 3KMWA 2GNJA 2X0OA 3TUDA 2UZNA 4GU9A 4XBUA 4QDVA 4I23A 2X6DA 5DG5A 5AAFA 2CLXA 5AP5A 4FKQA 4RWKA 4TWPA 4A4LA 2GMXA 4Y5QA 3SDJA 3N4UA 1PXPA 2WTDA 1JKSA 4JI9A 3WZDA 4XV3A 3C13A 4YHFA 4JR7A 2WTIA 3A8XA 2OZAB 3TKIA 4QOXA 4H36A 4DGNA 5C1QB 4U40A 3BEGA 1M14A 3W55A 3EMGA 1T45A 2LAVA 4RQVA 3Q60A 3HMMA 4IBMA 4RWLA 3GCPA 3I0QA 2C47A 3ZYAA 5FEDA 4ZZOA 4XOYA 2X9FA