5IA0A

Crystal structure of ephrin a2 (epha2) receptor protein kinase with alisertib (mln8237)
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
286
structure length
263
Chain Sequence
FTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 2
publication title Chemical Proteomics and Structural Biology Define EPHA2 Inhibition by Clinical Kinase Drugs.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 82
structure length 263
sequence length 286
chains with identical sequence B, C
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5ia0A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5ia0A01
2YWPA 3UGCA 5HE2A 3FI8A 3OWLA 2BPMA 3GCSA 4O7VA 4ID7A 4BB4A 5I9WA 3PA4A 5AMNA 3FMMA 2RG5A 3BEGA 5HLPA 2VO6A 4ZOGA 3T9IA 4AW5A 4NFNA 2YAKA 3BQRA 4P7EA 3VUMA 3HEGA 4DEGA 2JGZA 4RFZA 2FSTX 3FZRA 5LCJA 4I4FA 3TT0A 3ULIA 3TXOA 4YU2A 1B38A 4OR5A 4ZTSA 2IO6A 3HUBA 2GPHA 2GCDA 3IG7A 1O6LA 4I23A 3EB0A 3G5DA 3UPXA 3TKIA 5CXHA 3R83A 4KWPA 3KY2A 3T3VA 5KMNA 5I9ZA 4FT3A 4HGLA 2XB7A 3CEKA 5AADA 3FLNC 3H9RA 3QKLA 5HU3A 4HYHA 3ORKA 4HNFA 1W82A 2H6DA 3QCYA 2CMWA 4K77A 4PUZA 1ZOEA 5IDPA 1T46A 3FLZA 5FXRA 1OIRA 5CVFA 4R5SA 1ZYDA 4IDTA 3ZCLA 4FSUA 1Q8TA 3QUPA 4IAYA 5DE2A 4CYJA 3LAUA 4KIKA 3PVWA 5F20A 2QG5A 4JAJA 3E8EA 4UEUA 5AUZA 4UALA 4I5CA 4FTMA 3O8UA 5CNOA 3HGKA 5KHWA 3VUIA 3A61A 4EH6A 4L8MA 2V55A 3FMNA 2XM8A 5C03A 5AAFA 4TRLA 3VUKA 3A4PA 2XM9A 2XF0A 1OPKA 3OG7A 3S95A 3TKUA 2VTOA 2VTMA 4RX5A 2XYUA 4Y73A 4CRLA 5CEOA 3N4TA 2XNGA 3BKBA 4GH2A 4BDCA 2DYLA 4E5BA 5EFQA 5K5NA 3FLYA 3BWJA 3R04A 1PXJA 2BRGA 2VO0A 3AC3A 3TNWA 4YC8A 5EKOA 2JKMA 5M51A 4A9RA 5AAGA 1PW2A 2QOQA 3BLQA 4ACDA 4XP3A 3WIKA 4ANQA 2WOTA 3C4EA 3D14A 4KKGA 4USFA 1IA9A 4BDKA 3NZ0A 3GVUA 4QTCA 2GNLA 3R9RA 4MQ1A 2CJMA 2X2MA 3HA8A 3W2SA 3GCVA 4BYIA 1SVEA 5JZNA 5C27A 2XIXA 3EQBA 4C2WA 3R73A 2CN8A 4W4VA 3NW7A 3TUCA 3FC2A 4QMVA 4DF3A 1XR1A 3FJQE 4BBFA 5HLWA 3FQSA 4V05A 5KE0A 3LCTA 4F6WA 4WG4A 3BHTA 3GU8A 5HI2A 3V5JA 2XJ2A 4BZOA 1JKSA 5CU6A 4LM5A 5HHWA 1U54A 3NW5A 4F9BA 4F9YA 2UW8A 4ZLOA 4N4SA 3C4ZA 4CLIA 3VC4A 4CV8A 3V8SA 1XH4A 5EH0A 3K5UA 4O7WA 1OL7A 2C5VA 3IK3A 4U79A 5ETFA 3MY1A 4XRLA 4ZIMA 4DLJA 4G2FA 4E3CA 1W7HA 5C4LA 3GCQA 3KQ7A 2C69A 3MFSA 4KABA 1KOAA 2FVDA 3EN6A 1M14A 1Y8GA 3BU6A 2FH9A 4EHZA 2ZM1A 1YW2A 1GIHA 4L53A 5HEZA 3SOCA 4IACA 4MAOA 3ZFXA 5HNGA 4BFMA 2PULA 2YIWA 1H4LA 4XV1A 4BC6A 3NVKI 1J7UA 4O7TA 3R8ZA 4NTSA 2W4JA 4OTHA 2ITYA 5LARA 5FEEA 1L8TA 4XLIA 3Q4ZA 5HG8A 4PNIA 5HVKA 2A19B 3L8SA 2PVKA 3F5GA 4U40A 5AX3A 2UZEA 2JITA 4U81A 5HE3A 5T68A 2B53A 4EH4A 5M09A 5GIPE 4O0YA 3UOJA 2XBJA 1EH4A 4LGDA 3CXWA 2PZYA 4F1MA 2VO7A 5A14A 3KKVA 5JRQA 4N57A 3QRKA 5J1VA 4PDYA 5EQYA 4IIRA 2DUVA 4ZJIA 5L2IA 3DA6A 1UU9A 4I4EA 2HENA 4QQ5A 4F7JA 4TWCA 2RSVA 3ZRMA 3ATTA 1YVJA 5IU2A 5FUTA 4FZDB 3W8LA 2WTVA 4QOXA 2VV9A 2VUWA 1J1BA 3DZOA 2E2BA 2VD5A 3PSDA 4MQ2A 4RVMA 4E1ZA 3SAYA 3QFVA 4GT5A 5G1XA 1H0WA 2R4BA 3NWWA 5AR4A 4IZAA 2PZPA 1FQ1B 3QLFA 4GJ2A 4IM3A 1SYKA 4FVQA 1VR2A 4TNBA 1QPDA 3VBXA 3QQFA 4EOOA 5IH4A 3LFEA 4RWJA 2F7XE 3KREA 3O96A 4DEBA 3EFWA 1PHKA 4YTIA 3E7OA 3FZSA 2OFUA 3E8DA 2XK3A 4X2NA 5AR5A 2YIQA 4KIKB 4M84A 4CKJA 4CYIA 2YIRA 3ORPA 2ITOA 2PMNX 4KA3A 3NDMA 1GZOA 2PVLA 4IW0A 4W8EA 4YNOA 4DC2A 2W1IA 5KBQA 3BLRA 4IB0A 2X4ZA 3MVHA 2PMIA 1YHWA 3FL5A 1IR3A 2GTNA 3FSFA 3I5NA 2I7QA 4D2PA 4MK0A 4RMZA 3N51A 5E8UA 2HOGA 4EHEA 4D2RA 4BY9E 2VRXA 4APCA 2C3LA 4IVBA 2JDOA 2UZLA 3C13A 3MIAA 3FKNA 3TZ8A 4CQEA 3TTJA 1JLUE 4F9AA 2VX3A 4KS7A 4WNPA 3N4VA 2X4FA 3B8RA 4LUEA 5I9VA 1I09A 2QODA 4MVFA 3WF8A 1WMKA 2C5YA 1IA8A 4ALUA 4BCHA 4LV8A 3HP2A 5AUUA 1H1PA 3P23A 5CU2A 4S31A 1OBGA 2HIWA 3UC4A 4ANSA 5D7VA 3SRVA 5ETAA 3L8VA 2QCSA 3SHEA 3BU5A 4RPVA 2VAGA 3QD3A 4GG5A 3ZO3A 2ZV2A 4FT0A 2JFMA 1ZMUA 1TQPA 4MNEA 4ZZNA 5I9XA 2QHNA 1OM1A 3QZHA 2BZIB 3EFLA 5A4LA 4OW8A 2QG7A 2NP8A 3DLSA 3KRLA 3VS0A 5ANKA 2XNPA 4IJPA 4EH5A 1HOWA 1Q5KA 4AP7A 3OUKA 4MTAA 3SLSA 4D55A 2WTCA 4PPBA 2ZM3A 4EQUA 4A4LA 2R3GA 3EZVA 4DEDA 4LV5A 3F3ZA 3POOA 4H1JA 5CF8A 3TUBA 4RJ7A 3NNUA 3PP0A 3UBDA 3MY5A 3VBVA 4UX9A 3D5XA 5HX6A 5DNRA 4AS0A 2AYPA 3Q52A 2X2KA 2E9NA 2R3QA 3FZTA 5BVDA 5IA3A 2CNVA 3LFSA 3EN4A 1OKZA 2VWUA 4HNIA 2X1NA 5KZIA 2YM4A 3SX9A 1CM8A 2PHKA 2W1DA 2OFVA 5E9EA 2V7AA 3MA6A 4GUBA 2JDRA 4IAAA 3LQ5A 5JH6A 5CU4A 3EIDA 3FY2A 2P55A 3HRFA 4QPAA 3CQUA 2UW9A 1GY3A 4XOZA 4BRXA 2B1PA 4ASEA 4ORKA 5BYLA 3RBWA 4K8AA 4N6ZA 3IW6A 2JKOA 5L2TA 3UYTA 4E7WA 3GOPA 4L68A 3ANRA 1MUOA 1NVRA 4YC3A 4M0YA 2C5XA 3QF9A 4W4XA 5HTIA 4I0TA 3NLBA 4YJPA 2ESMA 3IS5A 5CAVA 5KKRC 2WEIA 5ITAA 2QONA 3QTRA 5JK3A 4FEXA 1OUYA 3F5PA 4RC3A 3ELJA 2VWIA 3T3UA 3TV4A 3UZPA 3VAPA 2ZV9A 5I0BA 3SGCA 4WUAA 4NCTA 1YDSE 4GRBA 4HVSA 2QKRA 5ANEA 2J90A 4XG9A 4GMYA 1GJOA 3LFBA 4G9CA 4MD9E 3R8LA 5JFSA 1JKKA 3TNPC 3UOLA 2JFLA 3RK9A 3ZSIA 4B7TA 4YLJA 3FPMA 3HV5A 5CAQA 1YXXA 3DDQA 3I7BA 4DFUA 2ZM4A 1CSNA 1YHSA 5EI6A 3QUDA 3S3IA 4G3EA 1TVOA 1YXVA 3DOGA 3NYOA 3U9CA 3DPKA 5HU9A 3U6JA 4RRVA 3FV8A 2C30A 4UMQA 1UWHA 4TWNA 2RKUA 2ONLC 3HL7A 4JR7A 1Q8YA 5FDPA 3RM6A 5IQFA 1ND4A 2PZ5A 4QMXA 5ETCA 4M66A 3CC6A 2R3LA 3EL8A 2Y0AA 3MIYA 2QOIA 2B9IA 3FXXA 3DKFA 3QZFA 4C0TA 4YURA 3ZU7A 3LMIA 1APME 5FBOA 5H8BA 1ERKA 1XH7A 4C35A 4ZP5A 4EKKA 4NKAA 1WVXA 2IN6A 4G6LA 4Q5HA 3RINA 4F0GA 4AOTA 3L8XA 3DZQA 4G9RA 4ASDA 3UVQA 5M08A 2JC6A 2ZMCA 1Q61A 2BRBA 4UBAA 2QLQA 3DNDA 4XG2A 3L9PA 2RL5A 4JL9A 4N6YA 5IUGA 3Q6UA 1NT2A 4FC0A 4U80A 3OD6X 5ANOA 3OCTA 4IE9A 4RIXA 3Q9YA 5AV3A 4X3FC 4FI1A 4WA9A 1XBBA 3I1AA 5FXQA 2WOUA 5JMSA 4R77A 2RGPA 2HZNA 3EN7A 3FKLA 3HUCA 5GZ9A 5IA0A 2UZWE 3U55A 5HIBA 5BVKA 3NUYA 3QQUA 3SXFA 3C9WA 1Q4LA 4DFLA 3SRVB 2W1EA 3ETAA 1R0EA 5CF4A 3ACKA 4PV0A 1Q41A 3MYGA 4ZTHA 2RIOA 4MNEB 3R1SA 4L43A 4ZTLA 4MF0A 3ZYAA 3LM5A 4DTBA 4YZDA 5AR8A 5GIOE 3UVPA 2BIYA 4JDKA 4RFMA 5DEYA 2ITUA 1JSTA 3RAIA 3WZKA 3IW5A 4QYYA 3RAKA 5ANJA 4U7ZA 1R1WA 3LJ0A 4DH1A 5JGBA 2XNEA 5HO6A 2JIVA 4BCFA 3H0YA 5AAEA 4FTAA 4DH7A 3IOKA 2Z7LA 2HXLA 1YI3A 3PIZA 4Y72A 4IAIA 4FZAB 3LKMA 2OF4A 3AXWA 4XCUA 3IONA 4BIEA 2PU8A 2C6KA 4XNEA 2C47A 2QLUA 4PWNA 4C8BA 1CKPA 5HD7A 3ZHPC 4GVAA 1HCLA 4GUEA 4O0RA 3O17A 4XG7A 2ITTA 4AUAA 3ZDIA 4DH8A 4L46A 2R3FA 3DK3A 3DXPA 3UO6A 4KIOA 4IAFA 4E4LA 1PXIA 4GFOA 5DVRA 3TDVA 3OP5A 4TYHA 5DWRA 2ZJWA 5L6PA 3MH0A 2JBPA 3FZPA 3QD4A 5CALA 1GAGA 2C6OA 3LOKA 2FGIA 2ZV7A 1ZYCA 3C0HA 3OT8A 2Y7JA 2OG8A 1ZARA 5GJDA 4BHNA 5HZNA 1Y8YA 5I3RA 4BI1A 3O8PA 2H34A 2W5AA 3OCBA 4PMSA 3RKBA 4F4PA 5JT2A 5KO1A 4RJ5A 5AM6A 1H1QA 3KXZA 3NS9A 4RBLA 3EMGA 3O0GA 4JG7A 4APPA 3ZO4A 2JKKA 2C68A 3MH2A 3PJ8A 4QNAA 2ITZA 4DITA 4F65A 4EL9A 4BGQA 4FSZA 2ITQA 3GOKA 4XJ0A 4IANA 2GNIA 3ZBXA 4O0SA 4CNHA 3AOXA 4S30A 3OS3A 3ZFMA 4V01A 1H01A 3UIBA 1Q8ZA 3BHVA 3BHHA 5HOAA 4RIWA 3G15A 4QMWA 4CFNA 4WRSA 2Y4IB 4PMTA 3BV2A 3QTQA 5BQ0A 4RZVA 2ZB1A 1NW1A 4KS8A 4Z9LA 4HYIA 4QNYA 3I5ZA 4FGRA 3TV7A 3AC2A 5HO8A 3IGOA 2LAVA 3PJCA 4YTCA 3C7QA 2PL0A 2CSNA 1X8BA 3F7ZA 4U6RA 1YHVA 2W05A 3RALA 4C59A 2JAVA 2H8HA 3ERKA 1IAHA 4TKSA 4D2VA 4I21A 4OLIA 2GNFA 4EI4A 3UQGA 5IEVA 5DA3A 4HPUE 3Q96A 4KSPA 3HMOA 5AR3A 4NFMA 3ZM4A 5H8EA 3ZLSA 2EXCX 2QOFA 4EJNA 2YFXA 4BCQA 1OL5A 5KUPA 2WMWA 3HDMA 4O22A 3UE4A 2QKWB 2Q0NA 4EK4A 4Q9SA 3FY0A 3Q6WA 3LFCA 5AP3A 5CU3A 1OIUA 5E1EA 2DS1A 4RVLA 5L6OA 3D9VA 3LQ8A 4FSWA 4RIXB 2UZNA 3G90X 3MS9A 3FZ1A 3EQCA 2WMAA 3EN5A 5A54A 1O6YA 2OSCA 3BIZA 3CTQA 3CTJA 4Y83A 4BDJA 4DEEA 4YTFA 3VVHA 4QTAA 2F7EE 4LRKA 1UV5A 3WZEA 1IAJA 3W8QA 4FV1A 1H07A 1KV1A 2R3MA 3RPRA 3GNIB 5D9HA 1XH8A 5TO8A 4O91A 3FPQA 2GS2A 5LJJA 4WO5A 3PUPA 4MBJA 4M0ZA 3PVGA 1VYWA 1TKIA 4JG6A 2GQSA 4F7SA 3AMAA 3CS9A 4OAUC 3BE2A 4WIHA 5FP6A 1RW8A 4CFWA 3GEQA 3OTUA 4KKHA 1GOLA 3VF8A 4B0GA 4ZY5A 2UV2A 4FKIA 4DA5A 4GT3A 1WBOA 2FSOX 4V0GA 4C34A 3G0EA 2VTRA 3U8WA 3AQVA 4FSMA 3D94A 4UMPA 2W4OA 5EDQA 3MESA 5EI2A 1BL7A 3I79A 4UZDA 3QQLA 5BVFA 2B54A 4PQNA 3II5A 3ORLA 4UWCA 3VUGA 3CBLA 4A9TA 3Q04A 1JQHA 3HAVA 2XJ0A 3LFAA 4EOJA 3ZUVA 4J52A 5BYZA 5JFXA 3KA0A 5HO7A 3AMBA 4OT6A 3EQIA 3MVMA 4KNBA 4QP9A 4YNEA 1PMUA 3ZXZA 4ZAUA 2UW7A 1YOJA 3E64A 4U8ZA 4CT1A 3QTSA 5DPVA 4DT8A 1ZLTA 5IQCA 1ZOGA 4L01A 4TPTA 5TR6A 5HNBA 5DGZA 2Q83A 2RFEA 2ERKA 4TYHB 5K9IA 3RZBA 4J96A 3VW8A 2WMSA 2VNWA 4YJUA 4GYIA 4AW2A 3PXFA 2E9OA 1Q8UA 2AC3A 2CN5A 3FLWA 4O2ZA 4IJ9A 3C1XA 4FV2A 4X6RA 2W96B 3HKOA 5IMEA 1ZAOA 4BCIA 3AGLA 2PVJA 2EXMA 3OXIA 3QRIA 3F7WA 2G9XA 2XK8A 3C4FA 5JN2A 4EZ5A 3IW4A 3DBEA 3R01A 3ZS5A 4DEHA 2I40A 2XRUA 2QOLA 2Y8OA 2WMTA 1ZXEA 5BVEA 2E9UA 3UIMA 3TUDA 4DAWA 2PE0A 3W18A 3PVUA 3WZDA 3LE6A 4FEUA 4FVRA 4B6LA 3TG1A 4RIWB 4AW0A 3QHRA 4DG2E 4MBIA 4NL0A 4RX8A 1URCA 4X21A 5DIAA 2YM6A 3PXYA 3OXTA 3LXNA 4JRNA 4U43A 5EM7A 2FSLX 2R3NA 3RAWA 3QYZA 1M2RA 2BTRA 4ZSJA 3NCGA 4AGUA 4FV8A 4G5JA 2HZIA 1JWHA 2Q0BA 3EH9A 3UIUA 1KUTA 2X6DA 3FI4A 3IECA 4AE9A 4UWBA 3V6SA 4CFMA 2VZ6A 4RX9A 2FSMX 2PVMA 1PXMA 5K0KA 3R7IA 2CNQA 4DBNA 3VS3A 2OI4X 3R7EA 5GNKA 3WE8A 4M67A 3MWUA 2BTSA 1S9JA 4CZTA 3MPTA 4ZY6A 4CFFA 2EXEA 2YEXA 3QCSA 2XEZA 1XH6A 2A4LA 5L6WL 3LMGA 5HIDA 5HLNA 3UNKA 5LMAA 4NU1A 4HCVA 5IEXA 4PMMA 4EYJA 5GZ8A 1UNHA 1W0XC 3DCVA 4FX3A 4XG8A 2H96A 4UB7A 5K4IA 3BHYA 2XH5A 4K2RA 2C0TA 5JEBA 4BICA 2AC5A 2VWXA 3OWPA 3R02A 3I81A 4R8QA 5B7VA 3DFAA 5CQUA 4FTCA 4WD5A 3QZIA 3PWYA 1O6KA 3EQFA 4N0SA 4C61A 4HCUA 2C5NA 3QGWA 4DGOA 4F09A 2ZVAA 2A2AA 3H10A 3RTPA 2YCRA 3LQ3A 3CPBA 2QI8A 3UP7A 3WYXA 4F0IA 4QMMA 5IUHA 4ZLZA 3GC9A 1VJYA 2WTKC 2WTWA 4BIDA 3COMA 3QA8A 5BYYA 5HQ0A 2C6DA 5IDNA 3DK7A 4YP8A 2SRCA 4FEVA 4ZSEA 1UU7A 4CFUA 2GU8A 2XK4A 4BDGA 2UZBA 5A4QA 4RWKA 4HPTE 2W4KA 3LJ2A 4IX6A 2YCFA 4J8MA 3WF6A 2WMXA 2FUMA 3QX4A 4O1PA 5JGDA 2VTIA 3FZOA 5KNJA 2YWVA 4FVPA 3H9FA 4P5QA 2OIDA 5FXSA 5HKMA 3TIYA 3GXLA 3KXNA 3VS1A 1OECA 1SVHA 3CD8A 3FMLA 3R1NA 1FBNA 3VUHA 2OJFE 1IG1A 2WEVA 3R7YA 3HRCA 5E8VA 4GKIA 3KRJA 3R0TA 5JKGA 3KXGA 3KXMA 3UG2A 3GU7A 4Y95A 5FTGA 1SMHA 4EH7A 1SNUA 3ODZX 2G1TA 5C8NA 4FV4A 5LVPA 4IXPA 2QOCA 3DB8A 3CKXA 3BGPA 3P4KA 5BVWA 4ENXA 5IPJA 3UYSA 3ALNA 2VTLA 4RIYB 4EONA 3WBLA 4AN9A 2IWIA 3KK9A 3KRXA 2J6MA 3K3JA 5BMMA 4BHZA 3VS4A 1WBNA 2WHBA 4DGNA 4GL9A 3IKAA 4C36A 4D4YA 4OTDA 1U59A 2B52A 5L3AA 1LEWA 2XBAA 5JFWA 3OUNB 2WQNA 5FEDA 1E1VA 2OZOA 4YJRA 3R9DA 3N4UA 2QOKA 5JQ5A 2P4IA 3K5VA 4YZNA 2BAJA 4YSMA 2NNWB 4LRMA 4JBOA 3CPCA 2R2PA 2C3KA 3CQWA 2Z60A 5EYCA 3DBCA 4TNDA 4QMPA 4I6QA 4DG3E 5HBEA 3ZLYA 3QRUA 1GZNA 3DXQA 3A4OX 3PXZA 1JNKA 3DB6A 3R1QA 4FYOA 3CY3A 3BELA 2WQOA 4H1MA 4JIKA 4MXYA 4X2FA 5ETIA 4DHFA 4JDIA 1P14A 4WNKA 4AZTA 4EK3A 4O82A 3THBA 2J0KA 2VTSA 2XYNA 2CLXA 3HV6A 4FL2A 4CXAA 4YC6A 3E3BX 2IPXA 4EH3A 4O0XA 3KMMA 2R7IA 5FLFA 3D2IA 5AX9A 3HAMA 4W4WA 3AC8A 3W1FA 4H3PA 4FNXA 2WELA 3FYJX 1FGIA 2YLEA 3MTLA 5D10A 3GCPA 1OGUA 4IWQA 3ZSGA 3QTUA 1R0PA 2WD1A 1QCFA 4NJ3A 2XK7A 2YABA 1R39A 1W83A 2B9FA 2GFSA 3E7VA 3O23A 2VWWA 3TNIA 4IAKA 4FKGA 4BTMA 3NX8A 3FSKA 1OKWA 4QMQA 4BKYA 4FV9A 3ROYA 2V22A 2UW0A 3NUUA 2BVAA 2QR7A 4RA5A 4YTHA 5AUWA 2OXYA 4WSQA 3LCKA 5AUYA 2BAQA 3EQPA 3VBTA 3WE4A 3UG1A 4WNOA 1XKKA 4O84A 1SM2A 3ZLWA 1O9UA 5AUVA 5IG1A 3VWAA 4PF4A 2XK9A 4YJTA 4EOMA 2O65A 4ZTNA 5TE0A 2RFSA 1NVQA 4OBOA 3KVWA 3ZXTA 2BMCA 4CZUA 3P08A 1V1KA 4EH9A 5E8SA 4HVIA 3UODA 1PMNA 4YGAA 3ZMMA 2F4JA 4JOAA 2QVSE 2JBOA 4O21A 1PYEA 3COHA 3GC8A 4EK8A 5L2QA 4WG3A 4EWHA 5DYJA 5E91A 4EBWA 4NW6A 1ZYLA 3RNIA 2YDKA 2YAAA 1G5SA 3VS2A 3PA5A 4YZ9A 1A06A 4Q9ZA 2O8YA 4IX5A 1F3MC 3CR0A 2IVVA 1B6CB 3DBQA 4YUQA 4LQMA 3NNWA 2ZB0A 3DLZA 3EOCA 5DRBA 3TZMA 4BDIA 2UZDA 4FT5A 4J1RA 5KMIA 2W0JA 2FA2A 3FMHA 5HICA 3HV3A 4YLLA 5IISA 4QPMA 4GKHA 2OW3A 5HBJA 1BI8A 3ORTA 3R2BA 4BWPA 3PVBA 1P5EA 4S34A 4ZZOA 3WIGA 1CMKE 2ACXA 2O2UA 4AU8A 4BKJA 2PPQA 4FZFB 4I92A 2J0IA 1DI9A 3HMPA 4FTKA 2EB3A 4X3JA 4MD7E 4EOKA 4DCAA 4D1SA 3PJ3A 1LP4A 4JBPA 4JI9A 3D4QA 4QMNA 1FMKA 3LCDA 1KE5A 2HAKA 4D1ZA 5DMZA 3F2RA 4J99A 5DG5A 4I94A 1OMWA 5E4HA 5KHXA 3LFNA 4WRGA 3QD0A 3ZZEA 4F70A 1YRPA 5M57A 4UY9A 4O96A 5A9UA 3MW1A 4O7YA 3G0FA 4FG7A 4GS6A 1SZMA 1H1WA 3BYUA 4G3GA 4M15A 4NM5A 5CI7A 1Y57A 5FP5A 1G3NA 1UWJA 2GSFA 2XIKA 3PPZA 3Q2JA 4QTDA 3LMHA 4DH5A 2BKZA 4PY1A 2VTPA 3GU6A 3S4QA 4IFGA 3U54A 3UP2A 4JQEA 3V8TA 3CJFA 2YZLA 3E62A 5AP2A 3P9JA 1M52A 4ASZA 5AP5A 3F9NA 4DINA 3ORMA 3MA3A 4ERKA 4YR8A 5E90A 4EUUA 4KKEA 2BR1A 3DBFA 2WIHA 3QX2A 4ITJA 3P1AA 4KB8A 1V0PA 2J51A 4NKSA 4QTBA 4A07A 2YM5A 3K3IA 4U5JA 2W9ZB 3DK6A 3BV3A 3I4BA 3L1SA 4IEBA 5D1JA 3RNYA 3TZ7A 3QCQA 4BDAA 5J7HA 4NSTA 4ZJJA 2UZUE 1XHAA 3GU4A 4FKJA 5A4EA 2OZAA 3ZEPA 3B2WA 3BI6A 4LOPA 5EK7A 4O38A 3FXZA 1PRYA 1UNLA 3NIZA 1OKYA 4AZEA 3FMDA 3SD0A 2C0OA 2O63A 4TY1A 3EZRA 5A3XA 1XH5A 2PK9A 3MY0A 2GHLA 2WMVA 2BFYA 3BYOA 3NYXA 4OTIA 2VX1A 3AD4A 4FSTA 3OCSA 4ZTRA 3SV0A 3GUBA 3ZLXA 4RLLA 2QU6A 4OBQA 1W84A 1UKHA 1VEBA 2X39A 4YO6A 4IZYA 3T8OA 4EH8A 2Z7SA 5CAUA 3L9LA 2J7TA 4D9UA 2UW5A 4BI0A 1ZYJA 4J71A 3P5KA 5M53A 3RK7A 3ZOSA 4B4LA 3F69A 3O50A 2PMOX 4IWDA 4F9WA 3LFQA 4U97A 4O7ZA 4FOBA 4QYEA 4IH8A 3QZGA 3NAYA 4XG4A 4USDA 5HG7A 4NM7A 4IMYA 5FBNC 3MFTA 3AT2A 4EWQA 3C51A 4YJQA 4BTKA 3RVGA 4D2SA 3OT3A 4TYIA 4DCEA 4CT2A 2PTKA 1YOMA 4IWPA 4MHAA 5FG8A 2BHEA 2QURA 4FTUA 4IADA 2OIBA 5E8ZA 3GC0A 3OC1A 3RI1A 4D4SA 3EQGA 4FOCA 2GS6A 1WBWA 2VNYA 3LFFA 4C33A 1PXPA 3KK8A 3PY1A 4RT7A 4EQCA 2C3IB 4L9IA 3PWDA 5AA9A 2J5FA 3DBDA 4IC8A 2I0EA 5AP4A 3LVPA 4C4GA 4IX3A 4D2TA 4F9CA 4TL0A 4I0RA 4ZY4A 1H28A 1PYXA 2REIA 5CI6A 1J1CA 3F2AA 4DT9A 3QLGA 5LMKA 3BYSA 4UMTA 2VWZA 2CHLA 3C4WA 3I60A 3LJ1A 3Q4TA 2GS7A 2OWBA 2BKKA 2FYSA 3GCUA 3TNQB 4F7NA 1FMOE 4D0XA 3NVMB 3QWKA 3BWFA 3WZUA 3BX5A 2OJIA 3ODYX 4GK2A 3RPYA 4KINA 5IQBA 4U0IA 4ZJVA 4CMOA 4TYGA 2X7GA 1XBCA 3FKOA 2QU5A 3QQGA 1V0BA 3CE3A 2NO3A 3QHWA 4A4OA 5HNIX 2W1GA 4QPSA 3F82A 4M12A 4BWXA 4C3FA 3TV6A 1YWNA 2F2UA 5GHVA 3OMVA 5EKNA 5KBRA 1Q97A 2OBJA 4RJ6A 5EI8A 1PMVA 4YPDA 3NGAA 4AA5A 1XJDA 1JBPE 4O81A 3LW0A 3PSCA 3TNHA 4M14A 4WSYA 1A48A 3CQEA 4QYHA 4E73A 5HX8A 2PY3A 4FNWA 3VW6A 5HE0A 4AZWA 4EKLA 4BCJA 3G33A 4YJNA 2IZTA 4IQ6A 4F7LA 4JRVA 4CG8A 1J91A 1NXKA 3DQWA 4XEYA 4R3CA 2BDFA 1P4OA 4I93A 5J8IA 5IUIA 4CCUA 3QAME 3QRTA 1H0VA 4YBKA 3R7OA 1H00A 5CLPA 3SXRA 4EEVA 3UO5A 3AC1A 5LVNA 4TTHB 4HVGA 2XKFA 4FYNA 4R7BA 4ERWA 4CTCA 4AA0A 4JVGA 4S32A 4UYNA 3EYGA 2J5EA 3A60A 4CZYB 5KX8A 4AG8A 3U9NA 4FT7A 4JX7A 4BF2A 5JZJA 3CTHA 2XK6A 2IZRA 4M69B 4Z3VA 4BZNA 3R7VA 3W2PA 4JJRA 3DGKA 5K4JA 5TKDA 2C1AA 4D58A 2OZAB 4L67A 3NYNA 3BBTB 4NWMA 3R28A 5C1QB 3JR1A 3NUAA 4CGAA 4BDEA 3DTCA 3QWJA 4EHGA 3VS7A 4B99A 4NTTA 4BDFA 4BZDA 4NK9A 3COKA 2F57A 5CZHA 4GFMA 3FC1X 3PYYA 4EJ7A 3SW4A 2UVZA 3FMKA 4J97A 4ZLYA 4G6NA 1U4DA 1KSWA 2VU3A 3AD6A 3KN6A 3M1SA 4G34A 5M06A 5E8XA 1DAYA 5DR9A 2W1CA 2XKEA 4XG3A 4L42A 3MN3A 3D7TA 2WU7A 2ETRA 3FHIA 4IDVA 3BRBA 3VJOA 1BLXA 3EYHA 3NUXA 4BCKA 1YDRE 5AUXA 2VTQA 4W9WA 5HD4A 3OXZA 4UMRA 3AD5A 2WXVA 4YJOA 4GSBA 5T6KA 4FTRA 2QHMA 5CZIA 4O86A 4CRSA 3MPMA 3GQIA 4YHFA 3KCFA 4TN6A 4MX9A 5AV2A 3MSSA 4FIHA 3JVSA 4QRCA 3CIKA 3NNVA 2W5HA 3IOPA 2VGOA 1M7QA 2W5BA 3BCEA 4LG4A 4FEQA 2WQEA 3NIEA 2QOHA 4W9XA 4B9DA 3TM0A 4FEWA 3VNTA 2P2IA 2CGXA 2VX0A 4IB5A 2W9FB 2OKRA 4LRJA 2YIYA 5DEWA 3LXLA 3S1HA 5KCVA 3ZONA 3PPJA 4IZ5A 4B8MA 4A9SA 4LUDA 4Z7GA 2WTJA 4PX6A 4UWYA 2IW9A 5HTCA 3MBLA 4GK3A 5DR6A 3VQUA 4GT4A 4QMUA 3C50A 3EFJA 3UOKA 4XP0A 3W2QA 1H08A 4EBVA 2C6MA 3DS6A 4FKOA 2YDIA 3FL4A 4FSNA 4OTWA 3HA6A 5HBHA 2B0QA 4AT4A 2VO3A 4DG0E 4ARKA 4XV2A 3ITZA 2HY81 4E4XA 5C26A 5J9YA 2ETMA 3T9TA 5AEPA 4AGCA 4HGTA 5AA8A 3H3CA 4X6QC 3QUEA 3AC4A 4KIQA 4RJ8A 4PTCA 1IEPA 5D11A 2PVNA 2YN8A 4DH3A 4KUJA 3PZHA 4L00A 3ENHA 4RG0A 3Q5ZA 5AFVA 3PPKA 3U4UA 3SXSA 1MP8A 2CCHA 4H39A 1U46A 4NIFA 2IZUA 5D7AA 2P33A 4YZCA 4OUCA 3V5TA 2VTAA 3UQFA 2R64A 3DQXA 3HP5A 5C8KA 5KMLA 5CT0A 3QTWA 3FI3A 5KMMA 1Z5MA 5J95A 4A4XA 4D5HA 4KAOA 1CKJA 2VWYA 1YOLA 1KWPA 5F4NA 4CFXA 1Y6AA 4FKSA 3AMYA 2C4GA 2R3HA 4GK4A 3BZ3A 4XMOA 4HYUA 4RIOA 5DT0A 2CGVA 3FXWA 3DXNA 1KV2A 5CSWA 2ITNA 2ITWA 3OW4A 4GU6A 3W32A 4NT4A 5J87A 1KE7A 2WIPA 4PPCA 3QU0A 3VS6A 1Y6BA 3HMIA 1E9HA 5CASA 1W98A 4MXZA 3ZSHA 5K3YA 4TW9A 3SA0A 1OIQA 5KMJA 4WNMA 3DJ7A 4G31A 4MXXA 3B2TA 3Q9XA 4MH7A 4QYFA 3ORIA 4R5YA 5AV0A 5HCXA 2XEYA 2IW8A 3ZRKA 3NUSA 3R6XA 5BPYA 2JD5A 4F08A 5HGIA 4F1OA 1OL6A 2YACA 2VWVA 4G17A 4BGHA 4XS2A 3FWQA 1OPLA 4JQ7A 1XQZA 2AUHA 5AR2A 4RFYA 4EHVA 3DAEA 4PPAA 5M55A 3GC7A 4C4JA 4ACCA 4FKWA 3W55A 2WMQA 3OEFX 2GTMA 1JKTA 5ACKA 5IZFA 2V0DA 4YJSA 5EYDA 2CCIA 1Z9XA 2X7OA 3R00A 2CLQA 4WKQA 1YDTE 2BUJA 4C7TA 4BYJA 3H30A 2HY0A 3D7TB 3QALE 3RJCA 2JAMA 2HWOA 4G16A 1L3RE 3Q60A 1H25A 2B7AA 4FTNA 4RC2A 4I1ZA 4E26A 3TKHA 4BCOA 4CEGA 2X8DA 3E93A 5HORA 2O64A 3P0MA 3S2PA 3SC1A 4IAZA 4CKRA 5LWNA 4FK6A 3E92A 1REKA 5DLSA 3CGFA 3MFRA 4PP7A 3E3PA 1RJBA 5CT7A 3QC9A 3F2NA 4RQKA 4P4CA 3F5UA 4C4EA 4UV0A 1XWSA 3QQHA 3AC5A 1P2AA 5EQEA 4O0WA 4LFIA 5CY3A 4RIYA 3QYWA 5EM6A 5M4IA 1OKVA 1OVEA 2UW3A 5LVLA 1J3HA 4MF1A 1Q3WA 3GT8A 2QR8A 2XNMA 3OBGA 4FA2A 5KKRB 4U9AA 3NYVA 4CMUA 3NW6A 5DT3A 3BLHA 4QO9A 4DGMA 2GNHA 4BCMA 5CEPA 3R21A 3VHEA 3U4WA 4FTLA 3E8NA 3DTWA 1TQIA 4DFBA 3CJGA 3REPA 2QNJA 1H1RA 5BMSA 2BAKA 2HXQA 1CDKA 1AD5A 3PP1A 4JLCA 1ZWSA 4X2GA 2BFXA 2CKQA 3NPCA 4UMUA 4JDHA 4DFZE 3KRWA 3GI3A 4TWPA 3UTOA 4AA4A 3E8CA 3SVVA 4U44A 3QKKA 2Y6OA 3L9NA 2NRUA 3RP9A 1K2PA 4QQCA 3D5VA 4CVAA 2YLFA 3V8WA 3H9OA 3S00A 1NY3A 5M56A 2NRYA 1K9AA 3O8TA 2G2FA 4YHJA 3FHRA 4O7NA 1SVGA 3FEGA 2X6EA 3ANQA 4BDBA 4AOIA 4NIFB 2F49A 5EW8A 3UIXA 5CXZA 3MFUA 4IBMA 4W4YA 4BDDA 4NJDA 4QMYA 4YZBA 3UO4A 4FKTA 2XIZA 4EORA 2PVRA 4MNFA 5EOLA 1W8CA 2A27A 2LGCA 3OY3A 2PVFA 3Q4UA 4PTEA 3QTXA 3FDNA 4E5AX 4DGLC 2XNNA 4EK5A 4Y85A 3CKWA 5J7BA 3L9MA 1LR4A 4J98A 2YJSA 3BGQA 3VS5A 3G6GA 4PRJA 2O3PA 1GIIA 5DR2A 4OT5A 3TN8A 4NM0A 4IFCA 4U3YA 4XH6A 4YPSA 5KZ0A 2VGPA 4D9TA 5I4NA 2EWAA 3GENA 2KULA 4RC4A 5EM8A 4AZSA 2WTDA 3G51A 4MXCA 5DBXA 3W33A 3PDTA 4RLKA 3PRFA 3W2RA 4GIIA 5LOHA 3HMNA 2BCJA 2R3JA 1WCCA 2UZTA 3GB2A 1M17A 4M3QA 5H3QA 3NR9A 2RFNA 2UUEA 5IQAA 1FVRA 2PMLX 2R7BA 2XMYA 5IH6A 3IW8A 4Y46A 4Y8DA 2OJGA 3C4XA 3PTGA 4CD0A 1JPAA 3MI9A 1DAWA 2XVDA 4JDJA 3U87A 2C5OA 3ENMA 5J9LA 3G2FA 3PLSA 5DRDA 2GQRA 3R22A 4PNKA 5IF1A 1PXOA 4C57A 1OI9A 1UU8A 4MCVA 3Q53A 4CTBA 2WQBA 4R3RA 2CPKE 3GGFA 3KRRA 5AR7A 4RJ4A 3K2LA 5AP1A 3HV4A 5CF6A 2FB8A 4R6VA 1QMZA 3CY2A 2BZKB 3JS2A 5FGKA 3ZEWA 3F3VA 5BUJA 5I5ZA 1LUFA 2R3OA 2OIQA 4E6CA 3OF0A 4K11A 3MH1A 1IASA 5IA5A 1KE8A 3M11A 3EKNA 3SG9A 1MRUA 4C3RA 2ZAZA 5AV4A 2BDJA 4FKLA 2QO7A 2A0CX 3FMEA 2YM3A 4L3PA 4LL0A 3RMFA 5BNJA 2R0IA 4PDOA 4C2VA 4JBVA 4K6ZA 5EHOA 4F6UA 2BZHB 1YWRA 4DLIA 3FAAA 2GMXA 2JKQA 4DFYA 5AWMA 4FTOA 5CAPA 4O0UA 1BUHA 1STCE 4MYGA 3V6RA 2UW6A 1Y91A 2ZV8A 3OFMA 1JKLA 2G2HA 3PRIA 4FTTA 1ATPE 1OITA 1ZZLA 4OTQA 5M4CA 4TYEA 4LOOA 2WAJA 5D12A 3KXHA 2YISA 4EUTA 4OAVB 1FVTA 1UVRA 4G5PA 4HOKA 3A7GA 4IVAA 5K0XA 5CEKA 4FIFA 4JAIA 4AW1A 2BRNA 3G9LX 2R3IA 1PXKA 2G15A 4FTIA 3E5AA 4FTJA 1M2QA 5TT7A 4AWIA 2ITXA 3CP9A 3TDWA 3P7BA 5ACBC 4CV9A 3A7JA 3MH3A 5E8YA 4AF3A 3UZRA 3R30A 2WZJA 3C5UA 4GYGA 4L6QA 2PUUA 5CF5A 5M44A 1PKDA 5EG3A 5LVOA 3JUHA 3DKCA 5IQHA 3IDPA 4PL5A 5AP0A 3HZTA 1WBPA 4HZRA 2IVSA 3OCGA 4TXCA 4MWIA 3SW7A 4QMLA 5CU0A 3ZUUA 4O6LA 5E1SA 4IWOA 2OU7A 2JIIA 2PE2A 2QOOA 2Z2WA 4C38A 2P2HA 2GDOA 4LI5A 1PY5A 3IO7A 3IPHA 3ZRLA 1QL6A 3TIZA 2GNJA 1OUKA 4WG5A 4FV0A 4JXFA 3WILA 1XH9A 4K1BA 4EOSA 5DOSA 5FTOA 2CKOA 4O0VA 2BILB 3A7HA 4CQGA 2IZSA 3QBNA 3Q5IA 5CSPA 1F0QA 3JXWA 4K9YA 3OVVA 3PE2A 4F63A 4FV7A 3HVCA 4GVJA 1ZMVA 2WU6A 3OROA 2X2LA 4GJ3A 4PL3A 4FG9A 2PUNA 4WUNA 4X0MA 2C6TA 4D0WA 1H27A 2E9PA 2J2IB 4ACHA 1T45A 3HDNA 2F7ZE 3R63A 2BZJA 3RCJA 1BL6A 1U5QA 3BYVA 4FT9A 4XHKB 4F64A 2YM7A 1JVPP 3KMWA 3COIA 5EYKA 5M4FA 3QXOA 4O2PA 2J50A 2IG7A 3OHTA 4DFXE 4LOQA 4QMTA 3V5PA 3DV3A 3M2WA 3GQLA 4S33A 3RAHA 3UZTA 4FIGA 3CD3A 3QTIA 1YXTA 4IM0A 2OLCA 1J7LA 3DAKA 3EJ1A 1PKGA 1PF8A 2WTIA 4Y5QA 2QOBA 4ASXA 3ALOA 3IGGA 4MD8E 5FM2A 4DTAA 4H05A 1UKIA 1TQMA 5BX0A 1ZZ2A 5EOBA 3SG8A 3L8PA 3MB6A 5EYMA 1JSVA 3R71A 4FF8A 1ZY5A 5A4TA 2YCSA 3ZH8A 5J5SA 2XP2A 1PXNA 2E9VA 5F95A 2BDWA 3DAJA 3KMUA 3B8QA 2W1ZA 3ROCA 4FNZA 4G3FA 4RVKA 3NUNA 4C58A 4YLKA 1WBTA 3MJ1A 2C6LA 1BX6A 3I0QA 3HYHA 4XG6A 4JT3A 5FDXA 1RQQA 5TOZA 3R9OA 4BWKA 2WPAA 2XRWA 3UPZA 4HZSA 4YO4A 4M7IA 1MQBA 3Q2MA 4E20A 3H4JA 5A46A 3H0ZA 1QPJA 5DFPA 4FKRA 4M68A 2VN9A 2CKEA 3RWPA 2BALA 4AE6A 3ZFYA 2XIRA 4FSYA 1H26A 4R7HA 4U45A 4QQTA 2R3RA 4PTGA 4QP1A 5FM3A 5B2MA 4IB1A 3PLAE 4ZMEA 4FZ6A 3QXPA 3AGMA 4L3LA 3ZO2A 2FO0A 1Q24A 4P2KA 4UXLA 3RHKA 4NW5A 4AXAA 2NPQA 2ERZE 3F5XA 4QP2A 3Q9WA 1UNGA 3A62A 5JQ8A 4X2KA 1A9UA 1LEZA 3O51A 5LCKA 3LIJA 3EQDA 3FI2A 3SKCA 2C1BA 5FQDC 2WMBA 4X2JA 4ALVA 5LMKC 2WMUA 4L3JA 4ANLA 3KU2A 4WBBB 2P0CA 2XCHA 4HJOA 2YIXA 3A2CA 4FKQA 1AQ1A 2UVXA 1RDQE 3BU3A 4FSRA 4I24A 4ENYA 3OEZA 3BQCA 3NEWA 4I22A 5ANDA 3WF5A 3IQ7A 5HCYA 2EVAA 2R0UA 1DS5A 1WBVA 4NCTC 4NM3A 1WVYA 4ZSAA 5JGAA 1H8FA 1BYGA 3E87A 3EFKA 2CGWA 2WB8A 4IHPA 4L45A 3FE3A 4FIEA 2WGJA 4BTJA 3SDJA 4WT6A 4M69A 2Y4IC 1VZOA 1YWVA 4ZEGA 3QA0A 4XV9A 5EM5A 3JY0A 3GFWA 3OW3A 2YZAA 3TL8A 4CLJA 3CGOA 4K0YA 4QMZA 3NAXA 2IVUA 4KD1A 4O1OA 4C4IA 2R3KA 2WO6A 3EL7A 4QYGA 4FIIA 1RE8A 3VHKA 3JY9A 2Z02A 4Q5EA 1PXLA 4CG9A 5FTQA 3W10A 3RWQA 1V0OA 3DT1A 4QP4A 4BGGA 1WVWA 4I3ZA 3LM0A 4FV5A 5IQGA 3D0EA 4FMQA 4A9UA 5LMBA 3ORNA 4Y5HA 5B2LA 4LMUA 1AGWA 4JBQA 1FPUA 1JOWB 1Q8WA 3EHAA 3F66A 4QP7A 3G6HA 2QO2A 4ZXTA 3D7ZA 1MRYA 3HMMA 4E6AA 2XUUA 2ITPA 2ZMDA 2OXXA 3HRBA 2WTKB 3PXKA 2B55A 4TWOA 3F88A 3PY0A 4XBRA 1GZKA 2W17A 4EYMA 3ORXA 4RZWA 2I0HA 5H9BA 4CFVA 3DDPA 3R8UA 3U51A 3KL8A 4NZWB 3RPOA 5DI1A 3TCPA 4DE4A 3WI6A 4OTFA 1GIJA 5LVMA 3PIXA 4QP8A 1YQJA 4R1YA 3SOAA 4GIHA 5CNNA 4YHTA 4M97A 5IA2A 5C8MA 4I41A 2G01A 4FTQA 3E88A 3PJ2A 2DQ7X 1XO2B 2HYYA 1OL1A 1U54B 2YITA 2I0VA 2F9GA 2X81A 5HCZA 4Q2AA 3BPRA 1UU3A 5CWZA 4MXOA 3ID6C 4HW7A 4FUXA 5IMXA 3VBWA 2V62A 2PWLA 3TJDA 3PXQA 2C6EA 2JDVA 4MEDA 5H8GA 5JRSA 4DTKA 5AM7A 5AIKA 3VUTA 2PVYA 4AFJA 4RJ3A 4E6DA 1HCKA 4FG8A 3FQEA 1WBSA 2WQMA 5B2KA 5L8KA 3FLSA 1B39A 5BVOA 1BMKA 3O7LD 5AUTA 3AG9A 1QPCA 4HGSA 5CSHA 3TEIA 2XNBA 3ET7A 4XLVA 3AT3A 4LL5A 4Z55A 4R78A 4BBMA 2J9MA 5HG9A 4M13A 3F3UA 2YM8A 3ZTXA 3UJGA 4DFNA 3Q3BA 4FKVA 5CYIA 4YSJA 4I6BA 3HLLA 4R3PA 3OZ6A 4BI2A 1VYZA 1E1XA 3FQHA 2B9HA 4FV6A 4XP2A 4AACA 1WFCA 2P3GX 4L7FA 3PXRA 4F0FA 3QL8A 1GNGA 4GW8A 4QMSA 5L2SA 4USEA 2J0JA 4FKPA 2XNOA 3QGYA 2B4SB 2OXDA 3O2MA 4JIAA 3R9HA 3OWKA 4BDHA 4E5WA 5LQFA 2W1HA 5CVGA 3VO3A 1OIYA 3DJ6A 4G3DA 4H3QA 4KBAA 3R8PA 4D4RA 4ANOA 2JDTA 4TYJA 2CGUA 3W2OA 4J7BA 2X7FA 2OJ9A 3F6XA 5E92A 4KIPA 3OOGA 4AFEA 3NCZA 3VUDA 4V04A 1FGKA 5IQDA 1G8SA 3MB7A 4L44A 4D1XA 4RGJA 5DN3A 3IW7A 3KEXA 1ZMWA 2I6LA 2I1MA 4FBXA 5EDPA 4S2ZA 5CENA 4CKIA 5E8TA 5HIEA 5I3OA 2J4ZA 3P78A 4C4FA 1BKXA 4HVDA 5FEQA 5IQEA 4ITHA 3PFQA 4FL1A 5AV1A 1YXSA 3S0OA 3LCSA 3EQHA 1NA7A 5HVJA 1K3AA 4OTPA 4QQJA 1WZYA 2C3JA 2YERA 4LYNA 3KB7A 5EDRA 4ACGA 4C37A 1M7NA 1ZY4A 5CTPA 2ZDUA 4XOYA 5DT4A 2JDSA 4I6HA 4I5HA 4Z7HA 2QC6A 1I44A 5CVHA 1YI4A 2UZVA 5T3QA 5EW9A 4WOVA 4NEUA 3MVJA 2O0UA 3VF9A 4AX8A 4F99A 3A8WA 4BCGA 1F5QA 4NUSA 1ZOHA 3MJ2A 4H58A 4ACMA 4E8AA 3MVLA 3PY3A 1NVSA 3LLTA 4DN5A 3LLAA 2PUPA 4IX4A 2O5KA 4X7QA 2J0LA 4BKZA 4LGGA 5IA1A 5ICPA 2Z7RA 1P4FA 3LHJA 3D2KA 2W99B 3PA3A 3D83A 5L8JA 4AT5A 2PZIA 2WMRA 4EQMA 3R9NA 3DJ5A 4HCTA 3ZO1A 4ZS0A 3QC4A 3RCDA 3P86A 2W7XA 2HW7A 2VWBA 4PP9A 2WKMA 3KCKA 3CCNA 4CMTA 2H9VA 3ZBFA 5L4QA 3WARA 3KXXA 5IEYA 5EHLA 3DY7A 3UOHA 4XYFA 3HX4A 3BYMA 4H3BA 3VIDA 2GHGA 4FICA 2VTNA 3KVXA 5TF9A 3KN5A 4BIBA 4C62A 3WZJA 2WNTA 5CS6A 3KC3A 3GU5A 3KF4A 3MTFA 4KRCA 2I0YA 4ZZMA 5KMKA 3R8VA 4IM2A 5H2UA 4D2WA 5HG5A 2GNGA 4GV1A 3HV7A 3MV5A 1H1SA 2EB2A 1DM2A 3F3TA 4F1TA 4OTGA 1U5RA 4O7SA 4MXAA 2Z8CA 4C4HA 4O7RA 4FGBA 4KSQA 5L8LA 2XS0A 3OOMA 4RWIA 3TWJA 5LXMA 2IJMA 3NUPA 2XCKA 4AQCA 4ONAA 2VTHA 2V7OA 3LPBA 3Q9ZA 3RHXA 2CDZA 2JLDA 2GQGA 2PE1A 3PE1A 1YXUA 4ALWA 5F94A 3I7CA 4GEOA 3RK5A 3VBQA 3QTZA 2J0MB 4ZSGA 3A99A 3C0IA 3HECA 2YA9A 3RPSA 5AJQA 2QQ7A 2ONLA 3E63A 3V5QA 2QO9A 3CLYA 4FNYA 3A7IA 4FKUA 4FR4A 1URWA 4H36A 4QP3A 4K18A 3GFEA 4OTRA 4O6EA 2XKDA 4E93A 3DKGA 3QD2B 4PDPA 5D41A 4ANNA 4BL1A 4FE2A 4EK6A 2CKPA 3FYKX 4C02A 3NRMA 4FSQA 3UDBA 2BIKB 5AP6A 5FWKK 4QMOA 4ZSLA 3F3WA 4E6QA 1R3CA 4N70A 4P90A 3K54A 1IRKA 5BVNA 2OF2A 1GZ8A 3SQQA 4E4MA 1ZYSA 3ZUTA 4BCNA 4BR3A 1SNXA 3UVRA 1KE6A 1MQ4A 3KFAA 4I5MA 2OK1A 5GJGA 4DEAA 1DI8A 4ZTMA 4W8DA 3GP0A 4II5A 3WOWA 5IH5A 5ANIA 3ZM9A 1M2PA 5DH3A 4FZ7A 3DKOA 4DGGA 3D5WA 3GBZA 3PG1A 4I5PA 4AZFA 4E4NA 4X3FA 3ZC5A 3FMJA 4O0TA 4G3CA 5EW3A 3VJNA 4OGRA 3NNXA 2YJRA 3LFDA 5IQIA 2V5QA 3PZEA 4FODA 5C9CA 5E7RA 3V51A 2BHHA 4A7CA 3TTIA 3QRJA 3R8MA 2ETKA 4FK3A 3JYAA 3IDCA 2IVTA 4K33A 1XBAA 2X9FA 5ANGA 5CSXA 3PSBA 2EU9A 4G1WA 4MWHA 3U6IA 4R1VA 1Z57A 2UZOA 4XUFA 4FL3A 3V01A 3ATSA 3IDBA 4RSSA 4JNWA 4U42A 3VRYA 3I6UA 4RVTA 4XX9A 3VBYA 3I0OA 4QTEA 5I9YA 3KF7A 4EC8A 3R2YA 3LCOA 4IVCA 4NH1A 1G8AA 3VRZA 1JAMA 4O7LA 3MDYA 4U3ZA 4QT1A 2G2IA 3AT4A 3MGYA 4UXQA 4RA4A 3LZBA 3O71A 4RQVA 3VN9A 4LMNA 5HVYA 1KE9A 5AP7A 3TACA 2OICA 5AIRA 4ZMFA 4CSVA 3P7AA 3QCXA 2BROA 4AT3A 5A6OA 3D5UA 4JQ8A 4XV3A 2OH4A 1OZ1A 1ZRZA 5M07A 1H24A 1S9IA 3UNZA 2PUIA 2UW4A 4JS8A 4RX7A 3W16A 4C3PA 3W2CA 3RZFA 3V04A 3G9NA 3JVRA 4PDSA 5F1ZA 1YKRA 2GFCA 3BE9A 5CEQA 3EWHA 3KULA 4GU9A 1OL2A 4AAAA 3ACJA 1OPJA 2ZDTA 1UA2A 3MPAA 4ZK5A 3WF7A 4AN2A 5J5TA 3FUPA 2HZ0A 3EN9A 4A9YA 1LPUA 2RF9A 4B8LA 4QP6A 3RPVA 2JEDA 4OBPA 4EOIA 5K5XA 4P5ZA 4BBEA 3Q4CA 3OTVA 4UN0C 3NMUF 4IVDA 3BHUA 4O27B 2ITVA 4JX3A 4EZ3A 3BBWA 5M4UA 1FOTA 2HCKA 4DBXA 2XKCA 4BCPA 2DWBA 1MRVA 3UQCA 5G6VA 3RGFA 2YDJA 2OO8X 2YHVA 3A8XA 2QD9A 4I20A 4WHZA 3C4CA 3ULZA 4QD6A 3V3VA 4F6SA 4FUYA 3WF9A 4YMJA 2X9EA 4BTFA 1CTPE 1R78A 1WAKA 2HZ4A 5A4CA 2YCQA 3C5IA 3D15A 3BGZA 3F61A 3QKMA 4IB3A 4L7SA 2WFYA 2OJJA 1REJA 3JPVA 4BN1A 5CEMA 4CCBA 3OBJA 2UVYA 3BEAA 5E8WA 5CX9A 1J7IA 3PJ1A 4JR3A 3PIYA 3FLQA 5KMOA 5FRIA 5BUEA 4Z16A 3QQJA 4J95A 4D4VA 4YBJA 2F2CB 2PSQA 3N9XA 2OGVA 4EH2A 3WYYA 1FINA 1FVVA 1Q62A 4KBCA 2R5TA 2X8IA 2C0IA 4FIJA 5I9UA 5IA4A 5HESA 4ANBA 4EC9A 4LGHA 2XZSA 4ITIA 5CEIA 2W06A 4TZRA 3VQHA 1PJKA 3ZZWA 3ZC6A 4RWLA 4D5KA 2X8EA 4WBOA 3M42A 5HTBA 4ZS4A 2XIYA 2JIUA 2Y4PA 2Z7QA 4XBUA 4AN3A 4AOJA 4IZ7A 3DNEA 4R7IA 4D28A 4NYEA 1PMEA 4M8TA 5J1WA 4ZTQA 3KGAA 4YZMA 4HYSA 4L52A 3PG3A 3ORZA 4GFGA 3EKKA 4DYMA 5JFVA 4MBLA 4X3FB 2HK5A 5J79A 2ZOQA 1YI6A 5BUIA 2OH0E 3UC3A 2PZRA 3P7CA 2HELA 4JG8A 4A06A 4MKCA 1Q99A 4KRDA 4UYAA 4EZ7A 4O83A 3UMXA 3FBVA 5FD2A 5HE1A 4XRJA 2Y9QA 4EOLA 1Q3DA 4AGDA 2VTTA 2XA4A 3OY1A 4I6FA 3VULA 2HWPA 4G6OA 3TI1A 3I6WA 2Y6MA 4HVHA 3DFCB 2IW6A 5DHJA 1CKIA 2BRHA 1BI7A 2BRMA 4ANMA 1OB3A 5CSVA 3UMWA 4AZVA 3DU8A 1KOBA 4GG7A 4GCJA 3HNGA 3R7UA 4EOPA 3O7LB 2ZYBA 2PVHA 4I0SA 5CANA 5GJFA 4KBKA 4AGWA 5A6NA 3TJCA 3RM7A 1JSUA 3EQRA 4YJVA 3V5WA 5F9EA 5C4KA 2KTYA 3OWJA 4UZHA 5EQPA 3R1YA 2A1AB 2PYWA 5J9ZA 3P79A 3C0GA 4EOQA 3U6HA 3Q32A 5B0XA 4PMPA 5EHYA 2CNUA 2X0GA 3A7FA 4U41A 3QQKA 4IC7A 3TZ9A 2C6IA 2EUFB 5CAOA 2XJ1A 3LXPA 5GZAA 2R9SA 4TT7A 5JSMA 4HGEA 3R7GA 2W1FA 2HW6A 2VTJA 5L2WA 3POZA 5LWMA 2RG6A 2RFDA 4FV3A 4J8NA 2B9JA 5CQWA 4BVUA 3V5LA 3ZDUA 2R3PA 3LXKA 4PL4A 2GHMA 3KULB 4J53A 5GINE 4V0GB 3CSVA 4DEIA 5IKWA 1OBDA 5C01A 1QPEA 3UNJA 3NSZA
chains in the Genus database with same CATH superfamily
2YWPA 3UGCA 5HE2A 3FI8A 3OWLA 2BPMA 3GCSA 4O7VA 4ID7A 4BB4A 5I9WA 3PA4A 5AMNA 3FMMA 2RG5A 3BEGA 5HLPA 2VO6A 4ZOGA 3T9IA 4AW5A 4NFNA 2YAKA 4LDTA 3BQRA 4P7EA 3VUMA 3HEGA 4DEGA 2JGZA 4RFZA 2FSTX 3FZRA 5LCJA 4I4FA 3TT0A 3ULIA 3TXOA 4YU2A 1B38A 4OR5A 4ZTSA 2IO6A 3HUBA 2GPHA 2GCDA 3IG7A 1O6LA 4I23A 3EB0A 3G5DA 3UPXA 3TKIA 5CXHA 3R83A 4KWPA 3KY2A 3T3VA 5KMNA 5I9ZA 2NYAA 4FT3A 4HGLA 2XB7A 3CEKA 5AADA 3FLNC 3H9RA 3QKLA 5HU3A 4HYHA 3ORKA 4HNFA 3W0SA 1W82A 2H6DA 3QCYA 2CMWA 4K77A 4PUZA 1ZOEA 5IDPA 1T46A 3FLZA 5FXRA 1OIRA 5CVFA 4R5SA 1ZYDA 4IDTA 3ZCLA 4FSUA 1Q8TA 3QUPA 4IAYA 5DE2A 4CYJA 3LAUA 4KIKA 3PVWA 5F20A 2QG5A 4JAJA 3E8EA 4UEUA 5AUZA 4UALA 4I5CA 4FTMA 3O8UA 5CNOA 3HGKA 5KHWA 3VUIA 3A61A 4EH6A 4L8MA 2V55A 3FMNA 2XM8A 5C03A 5AAFA 4TRLA 3VUKA 3A4PA 2XM9A 2XF0A 1OPKA 3OG7A 3S95A 3TKUA 2VTOA 2VTMA 4RX5A 2XYUA 3BL7A 3W0OA 4Y73A 4CRLA 5CEOA 3N4TA 2XNGA 3BKBA 4GH2A 4BDCA 2DYLA 4E5BA 5EFQA 5K5NA 3FLYA 3BWJA 3R04A 1PXJA 2BRGA 2VO0A 3AC3A 3TNWA 4YC8A 5EKOA 2JKMA 5M51A 4A9RA 5AAGA 1PW2A 2QOQA 3BLQA 4ACDA 4XP3A 3WIKA 4ANQA 2WOTA 3C4EA 3D14A 4KKGA 4USFA 1IA9A 4BDKA 3NZ0A 3GVUA 4QTCA 2GNLA 3R9RA 4MQ1A 2CJMA 2X2MA 3HA8A 3W2SA 3GCVA 4BYIA 1SVEA 5JZNA 5C27A 2XIXA 3EQBA 4C2WA 3R73A 2CN8A 4W4VA 3NW7A 3TUCA 3UDZA 3FC2A 4QMVA 4DF3A 1XR1A 3FJQE 4BBFA 5HLWA 3FQSA 4V05A 5KE0A 3LCTA 4F6WA 4WG4A 3BHTA 3GU8A 5HI2A 3V5JA 2X0QA 4DHZA 2XJ2A 4BZOA 1JKSA 5CU6A 4LM5A 5HHWA 1U54A 3NW5A 4F9BA 4F9YA 2UW8A 4ZLOA 4N4SA 3C4ZA 4CLIA 3VC4A 4CV8A 3V8SA 1XH4A 5EH0A 3K5UA 4O7WA 1OL7A 2C5VA 3IK3A 4U79A 5ETFA 3MY1A 4XRLA 4ZIMA 4DLJA 4G2FA 4E3CA 1W7HA 5C4LA 3GCQA 3KQ7A 2C69A 3MFSA 4KABA 1KOAA 2FVDA 3EN6A 1M14A 1Y8GA 3BU6A 2FH9A 4EHZA 2ZM1A 1YW2A 1GIHA 4L53A 5HEZA 3SOCA 4IACA 4MAOA 3ZFXA 5HNGA 4BFMA 2PULA 2YIWA 1H4LA 4XV1A 4BC6A 3NVKI 1TZDA 3KIOC 1J7UA 4O7TA 3R8ZA 4NTSA 2W4JA 4OTHA 2ITYA 5LARA 5FEEA 1L8TA 4XLIA 3Q4ZA 5HG8A 4PNIA 5HVKA 2A19B 3L8SA 2PVKA 3F5GA 4U40A 5AX3A 2UZEA 2JITA 4U81A 5HE3A 5T68A 2B53A 4EH4A 5M09A 5GIPE 4O0YA 3UOJA 3UDSA 2XBJA 1EH4A 4LGDA 3CXWA 2PZYA 4F1MA 2VO7A 5A14A 3KKVA 5JRQA 4N57A 3QRKA 5J1VA 4PDYA 5EQYA 4IIRA 2DUVA 4ZJIA 5L2IA 3DA6A 1UU9A 4I4EA 2HENA 4QQ5A 4F7JA 4TWCA 2RSVA 3ZRMA 3ATTA 1YVJA 5IU2A 5FUTA 4FZDB 3W8LA 2WTVA 4QOXA 2VV9A 2VUWA 1J1BA 3DZOA 2E2BA 2VD5A 3PSDA 4MQ2A 4RVMA 4E1ZA 3SAYA 3QFVA 4GT5A 5G1XA 1H0WA 2R4BA 3NWWA 5AR4A 4IZAA 2PZPA 1FQ1B 3QLFA 4GJ2A 4IM3A 1SYKA 4FVQA 1VR2A 4TNBA 1QPDA 3VBXA 3QQFA 4EOOA 5IH4A 3LFEA 4RWJA 2F7XE 3KREA 3O96A 4DEBA 3EFWA 1PHKA 4YTIA 3E7OA 3FZSA 2OFUA 3E8DA 2XK3A 4X2NA 4O4DA 5AR5A 2YIQA 4KIKB 4M84A 4CKJA 4CYIA 2YIRA 3ORPA 2ITOA 2PMNX 4KA3A 3NDMA 1GZOA 2PVLA 4IW0A 4W8EA 4YNOA 4DC2A 2W1IA 5KBQA 3BLRA 3NFGB 4IB0A 2X4ZA 3MVHA 2PMIA 1YHWA 3FL5A 1IR3A 2GTNA 3FSFA 3I5NA 2I7QA 4D2PA 4MK0A 4RMZA 3N51A 5E8UA 2HOGA 4EHEA 4D2RA 4BY9E 2VRXA 4APCA 2C3LA 4IVBA 2JDOA 2UZLA 3C13A 3MIAA 3FKNA 3TZ8A 4CQEA 3TTJA 1JLUE 4F9AA 2VX3A 4KS7A 4WNPA 3N4VA 2X4FA 3B8RA 4LUEA 5I9VA 1I09A 2QODA 4MVFA 3WF8A 1WMKA 2C5YA 1IA8A 4ALUA 4BCHA 4LV8A 3HP2A 5AUUA 1H1PA 3P23A 5CU2A 4S31A 1OBGA 2HIWA 3UC4A 4ANSA 5D7VA 3SRVA 5ETAA 3L8VA 2QCSA 3SHEA 3BU5A 4RPVA 2VAGA 3QD3A 4GG5A 3ZO3A 2ZV2A 4FT0A 2JFMA 1ZMUA 1TQPA 4MNEA 4ZZNA 5I9XA 2QHNA 1OM1A 3QZHA 2BZIB 3EFLA 5A4LA 4OW8A 2QG7A 2NP8A 3DLSA 3KRLA 3VS0A 5ANKA 2XNPA 4IJPA 4EH5A 1HOWA 1Q5KA 4AP7A 3OUKA 4MTAA 3SLSA 4D55A 2WTCA 4PPBA 2ZM3A 4EQUA 4A4LA 2R3GA 3EZVA 4DEDA 4LV5A 3F3ZA 3POOA 4H1JA 5CF8A 3TUBA 4RJ7A 3NNUA 3PP0A 3UBDA 3MY5A 3VBVA 4UX9A 3D5XA 5HX6A 5DNRA 4AS0A 2AYPA 3Q52A 2X2KA 2E9NA 2R3QA 3FZTA 5BVDA 4QDEA 5IA3A 2CNVA 3LFSA 3EN4A 1OKZA 2VWUA 4HNIA 2X1NA 5KZIA 2YM4A 3SX9A 1CM8A 2PHKA 2W1DA 2OFVA 5E9EA 2V7AA 3MA6A 4GUBA 2JDRA 4IAAA 4DDGA 3LQ5A 5JH6A 5CU4A 3EIDA 3FY2A 2P55A 3HRFA 4QPAA 3CQUA 2UW9A 1GY3A 4XOZA 4BRXA 2B1PA 2X0OA 4ASEA 4ORKA 5BYLA 3RBWA 4K8AA 4N6ZA 3IW6A 2JKOA 5L2TA 3UYTA 4E7WA 3GOPA 4L68A 3ANRA 1MUOA 1NVRA 4YC3A 4M0YA 2C5XA 3QF9A 4W4XA 5HTIA 4I0TA 3NLBA 4YJPA 2ESMA 3IS5A 5CAVA 5KKRC 2WEIA 5ITAA 2QONA 3QTRA 5JK3A 4FEXA 1OUYA 3F5PA 4RC3A 3ELJA 2VWIA 3T3UA 3TV4A 3UZPA 3VAPA 2ZV9A 5I0BA 3SGCA 4WUAA 4NCTA 1YDSE 4GRBA 4HVSA 4MUQA 2QKRA 5ANEA 2J90A 4XG9A 4GMYA 1GJOA 3LFBA 4G9CA 4MD9E 3R8LA 5JFSA 1JKKA 3TNPC 3UOLA 2JFLA 3RK9A 3ZSIA 4B7TA 4YLJA 3FPMA 3HV5A 5CAQA 1YXXA 3DDQA 3I7BA 4OAUC 4DFUA 2ZM4A 1CSNA 1YHSA 5EI6A 3QUDA 3S3IA 4G3EA 1TVOA 1YXVA 3DOGA 3NYOA 3U9CA 3DPKA 4DHIB 5HU9A 3U6JA 4RRVA 3FV8A 2C30A 4UMQA 1UWHA 4TWNA 2RKUA 2ONLC 3HL7A 4JR7A 1Q8YA 5FDPA 3RM6A 5IQFA 1ND4A 2PZ5A 4QMXA 5ETCA 4M66A 3CC6A 2R3LA 3EL8A 2Y0AA 3MIYA 2QOIA 2B9IA 3FXXA 3DKFA 3QZFA 4C0TA 4YURA 3ZU7A 3LMIA 1APME 5FBOA 5H8BA 1ERKA 1XH7A 4C35A 4ZP5A 4EKKA 4NKAA 1WVXA 2IN6A 4G6LA 4Q5HA 3RINA 4F0GA 4AOTA 3L8XA 3DZQA 4G9RA 4ASDA 3UVQA 5M08A 2JC6A 2ZMCA 1Q61A 2BRBA 4UBAA 2QLQA 3DNDA 4XG2A 3L9PA 2RL5A 4JL9A 4N6YA 5IUGA 3Q6UA 1NT2A 4FC0A 4U80A 3OD6X 5ANOA 3OCTA 4IE9A 4RIXA 3ML1A 3Q9YA 5AV3A 4X3FC 4FI1A 4WA9A 1XBBA 3I1AA 5FXQA 2WOUA 5JMSA 4R77A 2RGPA 2HZNA 3EN7A 3FKLA 3HUCA 5GZ9A 5IA0A 2UZWE 3U55A 5HIBA 5BVKA 3NUYA 3QQUA 3SXFA 3C9WA 1Q4LA 4DFLA 3SRVB 2W1EA 4AQKA 3ETAA 1R0EA 5CF4A 3ACKA 4PV0A 1Q41A 3MYGA 2XAOA 4ZTHA 2RIOA 4MNEB 3R1SA 4L43A 4ZTLA 4MF0A 3ZYAA 3LM5A 4DTBA 4YZDA 5AR8A 5GIOE 3UVPA 2BIYA 4JDKA 4RFMA 5DEYA 2ITUA 1JSTA 3RAIA 3WZKA 3IW5A 4QYYA 3RAKA 5ANJA 4U7ZA 1R1WA 3LJ0A 4DH1A 5JGBA 2XNEA 5HO6A 2JIVA 4BCFA 3H0YA 5AAEA 4FTAA 4DH7A 3IOKA 2Z7LA 2HXLA 1YI3A 3PIZA 4Y72A 4IAIA 4FZAB 3LKMA 2OF4A 3AXWA 4XCUA 3IONA 4BIEA 2PU8A 2C6KA 4XNEA 2C47A 2QLUA 4PWNA 4C8BA 1CKPA 5HD7A 3ZHPC 4GVAA 1HCLA 4GUEA 4O0RA 3O17A 4XG7A 2ITTA 4AUAA 3ZDIA 4DH8A 4L46A 2R3FA 3DK3A 3DXPA 3UO6A 4KIOA 4IAFA 4E4LA 1PXIA 4GFOA 5DVRA 3TDVA 3OP5A 4TYHA 5DWRA 2ZJWA 5L6PA 3MH0A 2JBPA 3FZPA 3QD4A 5CALA 1GAGA 2C6OA 3LOKA 2FGIA 2ZV7A 1ZYCA 3C0HA 3OT8A 2Y7JA 2OG8A 1ZARA 5GJDA 4BHNA 5HZNA 1Y8YA 5I3RA 4BI1A 3O8PA 2H34A 2W5AA 3OCBA 4PMSA 3RKBA 4F4PA 5JT2A 5KO1A 4RJ5A 5AM6A 1H1QA 3KXZA 3NS9A 4RBLA 3EMGA 3O0GA 4JG7A 4APPA 3ZO4A 2JKKA 2C68A 3MH2A 3PJ8A 4QNAA 2ITZA 4DITA 4F65A 4EL9A 4BGQA 4FSZA 2ITQA 3GOKA 4XJ0A 4IANA 2GNIA 3ZBXA 4O0SA 4CNHA 3AOXA 4S30A 3OS3A 3ZFMA 4V01A 1H01A 3UIBA 2AEGA 1Q8ZA 3BHVA 3BHHA 5HOAA 4RIWA 3G15A 4QMWA 4CFNA 4WRSA 2Y4IB 4PMTA 3BV2A 3QTQA 5BQ0A 4RZVA 2ZB1A 1NW1A 4KS8A 4Z9LA 4HYIA 4QNYA 3I5ZA 4FGRA 3TV7A 3AC2A 5HO8A 3IGOA 2LAVA 3PJCA 4YTCA 3C7QA 2PL0A 2CSNA 1X8BA 3F7ZA 4U6RA 1YHVA 2W05A 3RALA 4C59A 2JAVA 2H8HA 3ERKA 1IAHA 4TKSA 4D2VA 4I21A 4OLIA 2GNFA 4EI4A 3UQGA 5IEVA 5DA3A 4HPUE 3Q96A 4KSPA 3HMOA 5AR3A 4NFMA 3ZM4A 5H8EA 3ZLSA 2EXCX 2QOFA 4EJNA 2YFXA 4BCQA 1OL5A 5KUPA 2WMWA 3HDMA 4O22A 3UE4A 2QKWB 2Q0NA 4EK4A 4Q9SA 3FY0A 3Q6WA 3LFCA 4FRFA 5AP3A 5CU3A 1OIUA 5E1EA 2DS1A 4RVLA 5L6OA 3D9VA 3LQ8A 4FSWA 4RIXB 2UZNA 3G90X 3MS9A 3FZ1A 3EQCA 2WMAA 3EN5A 5A54A 1O6YA 2OSCA 3BIZA 3CTQA 3CTJA 4Y83A 4BDJA 4DEEA 2ZFYA 4AXFA 4YTFA 3VVHA 4QTAA 2F7EE 4LRKA 1UV5A 3WZEA 1IAJA 3W8QA 4FV1A 1H07A 1KV1A 2R3MA 3RPRA 3GNIB 5D9HA 1XH8A 5TO8A 4O91A 3FPQA 2GS2A 5LJJA 4WO5A 3PUPA 4MBJA 4M0ZA 3PVGA 1VYWA 1TKIA 4JG6A 2GQSA 4F7SA 3AMAA 3CS9A 4O4FA 3BE2A 4WIHA 5FP6A 1RW8A 4CFWA 3GEQA 3OTUA 4KKHA 1GOLA 3VF8A 4B0GA 4ZY5A 2UV2A 4FKIA 3VONA 4DA5A 4GT3A 1WBOA 2FSOX 4V0GA 4C34A 3G0EA 2VTRA 3U8WA 3AQVA 4FSMA 3D94A 4UMPA 2W4OA 5EDQA 3MESA 5EI2A 1BL7A 3I79A 4UZDA 3QQLA 5BVFA 2B54A 4PQNA 3II5A 3ORLA 4UWCA 3VUGA 3CBLA 4A9TA 3Q04A 1JQHA 3HAVA 2XJ0A 3LFAA 4EOJA 3ZUVA 4J52A 5BYZA 5JFXA 3KA0A 5HO7A 3AMBA 4OT6A 3EQIA 3MVMA 4KNBA 4QP9A 4YNEA 1PMUA 3ZXZA 4ZAUA 2UW7A 1YOJA 3E64A 4U8ZA 4CT1A 3QTSA 5DPVA 4DT8A 1ZLTA 5IQCA 1ZOGA 4L01A 4TPTA 5TR6A 5HNBA 5DGZA 2Q83A 2RFEA 2ERKA 4TYHB 5K9IA 3RZBA 4J96A 3VW8A 2WMSA 2VNWA 4YJUA 4GYIA 4AW2A 3PXFA 2E9OA 1Q8UA 2AC3A 2CN5A 3FLWA 4O2ZA 4IJ9A 3C1XA 4FV2A 4X6RA 2W96B 3HKOA 5IMEA 4DDIA 1ZAOA 4BCIA 3AGLA 2PVJA 2EXMA 3OXIA 3QRIA 3F7WA 2G9XA 2XK8A 3C4FA 5JN2A 4EZ5A 3IW4A 3DBEA 3R01A 3ZS5A 4DEHA 2I40A 2XRUA 2QOLA 2Y8OA 2WMTA 1ZXEA 5BVEA 2E9UA 3UIMA 3TUDA 4DAWA 2PE0A 3W18A 3PVUA 3WZDA 3LE6A 4FEUA 4FVRA 4B6LA 2XAMA 3TG1A 4RIWB 4AW0A 3QHRA 4DG2E 4MBIA 4NL0A 4RX8A 1URCA 4X21A 5DIAA 2YM6A 3PXYA 3OXTA 3LXNA 4JRNA 4U43A 5EM7A 2FSLX 2R3NA 3RAWA 3QYZA 1M2RA 2BTRA 4ZSJA 3NCGA 4AGUA 4FV8A 4G5JA 2HZIA 1JWHA 2Q0BA 3EH9A 3UIUA 1KUTA 2X6DA 3FI4A 3IECA 4AE9A 4UWBA 3V6SA 4CFMA 2VZ6A 4RX9A 2FSMX 2PVMA 1PXMA 5K0KA 3R7IA 2CNQA 4DBNA 3VS3A 2OI4X 3R7EA 5GNKA 3WE8A 4M67A 3MWUA 2BTSA 1S9JA 4CZTA 3MPTA 4ZY6A 4CFFA 2EXEA 2YEXA 3QCSA 2XEZA 1XH6A 2A4LA 5L6WL 3LMGA 5HIDA 5HLNA 3UNKA 5LMAA 4NU1A 4HCVA 5IEXA 4PMMA 4EYJA 5GZ8A 1UNHA 1W0XC 3DCVA 4FX3A 4XG8A 2H96A 4UB7A 5K4IA 3BHYA 2XH5A 4K2RA 2C0TA 5JEBA 4BICA 2AC5A 2VWXA 3OWPA 3R02A 3I81A 4R8QA 5B7VA 3DFAA 3PUFC 5CQUA 4FTCA 4WD5A 3QZIA 3PWYA 1O6KA 3EQFA 4N0SA 4C61A 4HCUA 2C5NA 3QGWA 4DGOA 4F09A 2ZVAA 2A2AA 3H10A 3RTPA 2YCRA 3LQ3A 3CPBA 2QI8A 3UP7A 3WYXA 4F0IA 4QMMA 5IUHA 4ZLZA 3GC9A 1VJYA 2WTKC 2WTWA 4BIDA 3COMA 3QA8A 5BYYA 5HQ0A 2C6DA 5IDNA 3DK7A 4YP8A 2SRCA 4FEVA 4ZSEA 1UU7A 4CFUA 2GU8A 2XK4A 4BDGA 2UZBA 5A4QA 4RWKA 4HPTE 2W4KA 2XALA 3LJ2A 4IX6A 2YCFA 4J8MA 3WF6A 2WMXA 2FUMA 3QX4A 4O1PA 5JGDA 2VTIA 3FZOA 5KNJA 2YWVA 4FVPA 3H9FA 4P5QA 2OIDA 5FXSA 5HKMA 3TIYA 3GXLA 3KXNA 3VS1A 1OECA 1SVHA 3CD8A 3FMLA 3R1NA 1FBNA 3VUHA 2OJFE 1IG1A 2WEVA 3R7YA 3HRCA 5E8VA 4GKIA 3KRJA 3R0TA 5JKGA 3KXGA 3KXMA 3UG2A 3GU7A 4Y95A 5FTGA 1SMHA 4EH7A 1SNUA 3ODZX 2G1TA 5C8NA 4FV4A 5LVPA 4IXPA 2QOCA 3DB8A 3CKXA 3BGPA 3P4KA 5BVWA 4ENXA 5IPJA 3UYSA 3ALNA 2VTLA 4RIYB 4EONA 3WBLA 4AN9A 2IWIA 3KK9A 3KRXA 2J6MA 3K3JA 5BMMA 4BHZA 3VS4A 1WBNA 2WHBA 4DGNA 4GL9A 3IKAA 4C36A 4D4YA 4OTDA 1U59A 2B52A 5L3AA 1LEWA 2XBAA 5JFWA 3OUNB 2WQNA 5FEDA 1E1VA 2OZOA 4YJRA 3R9DA 3N4UA 2QOKA 5JQ5A 2P4IA 3K5VA 4YZNA 2BAJA 4YSMA 2NNWB 4LRMA 4JBOA 3CPCA 2R2PA 2C3KA 3CQWA 2Z60A 5EYCA 3DBCA 4TNDA 4QMPA 4I6QA 4DG3E 5HBEA 3ZLYA 3QRUA 1GZNA 3DXQA 3A4OX 3PXZA 1JNKA 3DB6A 3R1QA 4FYOA 3CY3A 3BELA 2WQOA 4H1MA 4JIKA 4MXYA 4X2FA 5ETIA 4DHFA 4JDIA 1P14A 4WNKA 4AZTA 4EK3A 4O82A 3THBA 2J0KA 2VTSA 2XYNA 2CLXA 3HV6A 4FL2A 4CXAA 4YC6A 3E3BX 2IPXA 4EH3A 4O0XA 3KMMA 2R7IA 5FLFA 3D2IA 5AX9A 3HAMA 4W4WA 3AC8A 3W1FA 1W2FA 4H3PA 4FNXA 2WELA 3FYJX 1FGIA 2YLEA 3MTLA 5D10A 3GCPA 1OGUA 4IWQA 3ZSGA 3QTUA 1R0PA 2WD1A 1QCFA 4NJ3A 2XK7A 2YABA 1R39A 1W83A 2B9FA 2GFSA 3E7VA 3O23A 2VWWA 3TNIA 4IAKA 4FKGA 4BTMA 3NX8A 3FSKA 1OKWA 4QMQA 4BKYA 4FV9A 3ROYA 2V22A 2UW0A 3NUUA 2BVAA 2QR7A 4RA5A 4YTHA 5AUWA 2OXYA 4WSQA 3LCKA 5AUYA 2BAQA 3EQPA 3VBTA 3WE4A 3UG1A 4WNOA 4QDVA 1XKKA 4O84A 1SM2A 3ZLWA 1O9UA 5AUVA 5IG1A 3VWAA 4PF4A 2XK9A 4YJTA 4EOMA 2O65A 4ZTNA 5TE0A 2RFSA 1NVQA 4OBOA 3KVWA 3ZXTA 2BMCA 4CZUA 3P08A 1V1KA 4EH9A 5E8SA 4HVIA 3UODA 1PMNA 4YGAA 3ZMMA 2F4JA 4JOAA 2QVSE 2JBOA 4O21A 1PYEA 3COHA 3GC8A 4EK8A 5L2QA 4WG3A 4EWHA 5DYJA 5E91A 4EBWA 4AAYA 4NW6A 1ZYLA 3RNIA 2YDKA 2YAAA 1G5SA 3VS2A 3PA5A 4YZ9A 1A06A 4Q9ZA 2O8YA 4IX5A 1F3MC 3CR0A 2IVVA 1B6CB 3DBQA 4YUQA 4LQMA 3NNWA 2ZB0A 3DLZA 3EOCA 5DRBA 3TZMA 4BDIA 2UZDA 4FT5A 4J1RA 5KMIA 2W0JA 2FA2A 3FMHA 5HICA 3HV3A 4YLLA 5IISA 4QPMA 4GKHA 2OW3A 5HBJA 1BI8A 3ORTA 3R2BA 4BWPA 3PVBA 1P5EA 4S34A 4ZZOA 3WIGA 1CMKE 2ACXA 2O2UA 4AU8A 4BKJA 2PPQA 4FZFB 4I92A 3AKKA 2J0IA 1DI9A 3HMPA 3W0PA 4FTKA 2EB3A 4X3JA 4MD7E 4EOKA 3PFYA 4DCAA 4D1SA 3PJ3A 1LP4A 4JBPA 4JI9A 3D4QA 4QMNA 1FMKA 3LCDA 1KE5A 2HAKA 4D1ZA 3AKJA 5DMZA 3F2RA 4J99A 5DG5A 4I94A 1OMWA 5E4HA 5KHXA 3LFNA 4WRGA 3QD0A 3ZZEA 4F70A 1YRPA 1XMMA 5M57A 4UY9A 4O96A 5A9UA 3MW1A 4O7YA 3G0FA 4FG7A 4GS6A 1SZMA 1H1WA 3BYUA 4G3GA 4M15A 4NM5A 5CI7A 1Y57A 5FP5A 1G3NA 1UWJA 2GSFA 2XIKA 3PPZA 3Q2JA 4QTDA 3LMHA 4DH5A 2BKZA 4PY1A 2VTPA 3GU6A 3S4QA 4IFGA 3U54A 3UP2A 4JQEA 3V8TA 3CJFA 2YZLA 3E62A 5AP2A 3P9JA 1M52A 4ASZA 5AP5A 3F9NA 4DINA 3ORMA 3MA3A 2IEWA 4ERKA 4YR8A 5E90A 4EUUA 4KKEA 2BR1A 3DBFA 2WIHA 1G8KA 3QX2A 4ITJA 3P1AA 4KB8A 1V0PA 2J51A 4NKSA 4QTBA 4A07A 2YM5A 3K3IA 4U5JA 2W9ZB 3DK6A 3BV3A 3I4BA 3L1SA 4IEBA 5D1JA 3RNYA 3TZ7A 3QCQA 4BDAA 5J7HA 4NSTA 4ZJJA 2UZUE 1XHAA 3GU4A 4FKJA 5A4EA 2OZAA 3ZEPA 3B2WA 3BI6A 4LOPA 5EK7A 4O38A 3FXZA 1PRYA 1UNLA 3NIZA 1OKYA 4AZEA 3FMDA 3SD0A 2C0OA 2O63A 4TY1A 3EZRA 5A3XA 1XH5A 2PK9A 3MY0A 2GHLA 2WMVA 2BFYA 3BYOA 3NYXA 4OTIA 2VX1A 2IF8A 3AD4A 4FSTA 3OCSA 4ZTRA 3SV0A 3GUBA 3ZLXA 4RLLA 2QU6A 4OBQA 1W84A 1UKHA 1VEBA 2X39A 4YO6A 4IZYA 3T8OA 4EH8A 2Z7SA 5CAUA 3L9LA 2J7TA 4D9UA 2UW5A 4BI0A 1ZYJA 4J71A 3P5KA 5M53A 3RK7A 3ZOSA 4B4LA 3F69A 3O50A 2PMOX 4IWDA 4F9WA 3LFQA 4U97A 4O7ZA 4FOBA 4QYEA 4IH8A 3QZGA 3NAYA 4XG4A 4USDA 5HG7A 4NM7A 4IMYA 5FBNC 3MFTA 3AT2A 4EWQA 3C51A 4YJQA 4BTKA 3RVGA 4D2SA 3OT3A 4TYIA 4DCEA 4CT2A 2PTKA 1YOMA 4IWPA 4MHAA 5FG8A 2BHEA 2QURA 4FTUA 4IADA 2OIBA 5E8ZA 3GC0A 3OC1A 3RI1A 4D4SA 3EQGA 4FOCA 3BLAA 2GS6A 1WBWA 2VNYA 3LFFA 4C33A 1PXPA 3KK8A 3PY1A 4RT7A 4EQCA 2C3IB 4L9IA 3PWDA 5AA9A 2J5FA 3DBDA 4IC8A 2I0EA 5AP4A 3LVPA 4C4GA 4IX3A 4D2TA 4F9CA 4TL0A 4I0RA 4ZY4A 1H28A 1PYXA 2REIA 5CI6A 1J1CA 3F2AA 4DT9A 3QLGA 5LMKA 3BYSA 4UMTA 2VWZA 2CHLA 3C4WA 3I60A 3LJ1A 3Q4TA 2GS7A 2OWBA 2BKKA 2FYSA 3GCUA 3TNQB 4F7NA 1FMOE 4D0XA 3NVMB 3QWKA 3BWFA 3WZUA 3BX5A 4F78A 2OJIA 3ODYX 4GK2A 3RPYA 4KINA 5IQBA 4U0IA 4ZJVA 4CMOA 4TYGA 2X7GA 1XBCA 3FKOA 2QU5A 3QQGA 1V0BA 3CE3A 2NO3A 3QHWA 4A4OA 5HNIX 2W1GA 4QPSA 3F82A 4M12A 4BWXA 4C3FA 3TV6A 1YWNA 2F2UA 5GHVA 3OMVA 5EKNA 5KBRA 1Q97A 2OBJA 4RJ6A 5EI8A 1PMVA 4YPDA 3NGAA 4AA5A 1XJDA 1JBPE 4O81A 3LW0A 3PSCA 3TNHA 4M14A 4WSYA 1A48A 3CQEA 4QYHA 4E73A 5HX8A 2PY3A 4FNWA 3VW6A 5HE0A 4AZWA 4EKLA 4BCJA 3G33A 4YJNA 2IZTA 4IQ6A 4F7LA 4JRVA 4CG8A 1J91A 1NXKA 3DQWA 4XEYA 4R3CA 4O4BB 2BDFA 1P4OA 4I93A 5J8IA 5IUIA 4CCUA 3QAME 3QRTA 1H0VA 4YBKA 3R7OA 1H00A 5CLPA 3SXRA 4EEVA 3UO5A 3AC1A 5LVNA 4TTHB 4HVGA 2XKFA 4FYNA 4R7BA 4ERWA 4CTCA 4AA0A 4JVGA 4S32A 4UYNA 3EYGA 2J5EA 3A60A 4CZYB