5I0BA

Structure of pak4
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
289
structure length
288
Chain Sequence
HEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PAK 4
publication title The discovery and the structural basis of an imidazo[4,5-b]pyridine-based p21-activated kinase 4 inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inihibitor
total genus 79
structure length 288
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5i0bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5i0bA01
2CCHA 3LXLA 1OPJA 4R3CA 3GC7A 5GNKA 3QKLA 3QXOA 2OO8X 4QYYA 5ANOA 5E4HA 1U54B 3NSZA 3WYXA 4IW0A 5E8TA 5A6OA 4QMUA 5KMOA 2XIXA 3FXXA 5AUTA 3A2CA 3V5LA 3S0OA 3FC1X 4YJVA 4ZXTA 2C5VA 4GH2A 2UVYA 4DEHA 2PZ5A 2CLXA 4FMQA 4C0TA 3AOXA 2DYLA 3BZ3A 3BWFA 4KA3A 1PHKA 4BCKA 3C5IA 4AFEA 3A7GA 4TYGA 3V51A 3GOKA 2J9MA 2Y6OA 5FBNC 4FZAB 4APPA 2A2AA 4EH2A 1FVRA 1PXMA 5DHJA 4FTAA 4GS6A 3EN6A 4KAOA 3BKBA 3EYHA 2RKUA 4ZLZA 3UP2A 3HDNA 4LRKA 3DFAA 4K0YA 1YXTA 4JIAA 4F7NA 4IZYA 1PW2A 4H58A 4RIWA 4QMNA 4WIHA 3JUHA 2WD1A 3RPVA 4ZZOA 5EYCA 5CSPA 1A48A 5BYLA 4HGSA 3BEGA 3LPBA 2QR8A 3DKGA 5ANJA 4PRJA 5KBQA 3VJOA 4OTDA 4XP3A 4QYEA 4DBXA 3L8XA 4O0YA 4UYAA 2GCDA 3KXNA 4XX9A 4YTIA 2UV2A 4DEBA 1BI7A 2I40A 3Q4CA 5JT2A 2ZJWA 3G6GA 3PXRA 4F99A 1Q97A 3ORLA 3DJ6A 1U59A 4OT5A 3LAUA 2CNVA 5L6WL 4BN1A 3CPCA 1QCFA 4E7WA 2BFYA 3E87A 4YUQA 5LVPA 2P2HA 2WEIA 2Z60A 2ITQA 3W10A 2FSTX 3CXWA 3GVUA 2ZDTA 2QU5A 4FKLA 5HO7A 5KNJA 2UW0A 2RSVA 5DT0A 3SD0A 2VZ6A 1J1CA 4P7EA 5A3XA 4H3PA 2C69A 5AR7A 4RFYA 4G2FA 2GNFA 3Q9WA 5HG5A 4QMOA 1WBNA 1G3NA 4JNWA 4U43A 4W8EA 2X9FA 5GINE 4I92A 5EYDA 3ORTA 1AQ1A 1UU9A 2R4BA 3NNUA 3PY0A 3R1NA 4QP3A 1ATPE 2A27A 5EM5A 3R1SA 5AR8A 2CN8A 3QTWA 3VBQA 3MIAA 4K33A 1H4LA 4MNEA 3BIZA 2BTRA 2OJJA 3EJ1A 3MFUA 4I23A 4RVKA 4E5BA 2WB8A 4UBAA 3SHEA 4OTGA 3QX4A 4FVPA 1OM1A 4IB5A 5KMJA 2PVRA 4KWPA 4CQEA 2REIA 1TQMA 1Y6BA 1IR3A 1VEBA 1WCCA 3F3TA 3PYYA 4OGRA 4FZ6A 3RINA 4C62A 4PMTA 4NJDA 5AFVA 3F9NA 5FGKA 1QMZA 4ZJIA 5KMKA 3ELJA 4XUFA 3VQHA 5AEPA 4E1ZA 4HNFA 3QHWA 2C6KA 4EH4A 2WTKC 1YOLA 2X7GA 3IW4A 2R7IA 4L01A 5LMKC 4PWNA 3F69A 4FKVA 2OGVA 2WQNA 3R04A 4DEGA 5KHWA 5IA5A 4KIQA 1SM2A 3AC3A 2CN5A 3RZFA 2IZTA 2JLDA 4PDOA 5CEPA 3VQUA 5DH3A 4H1MA 4BKJA 4ASZA 4BIDA 2O64A 3MTFA 4QQJA 2WU7A 2P0CA 4ZSJA 5HOAA 3C4FA 5AIKA 4UALA 3NUNA 4NJ3A 3QZGA 5I0BA 3Q2JA 4IFGA 2OW3A 3TXOA 3F3ZA 5I9VA 3C13A 3EYGA 2YISA 2R7BA 3NNVA 5BYYA 4U6RA 3FYJX 2P55A 1H07A 2CPKE 3SLSA 3ZOSA 3U51A 4CCBA 5JH6A 4W4WA 2IJMA 2C5YA 2CGWA 3WE8A 3O7LB 3H9RA 4MH7A 3AT4A 5K4IA 3FSFA 4QMPA 5EI2A 4XG6A 3GU8A 4J97A 4ZLYA 3GCQA 4C3RA 4OBOA 3F88A 5HNIX 2QOHA 5DR2A 4UZHA 1RQQA 2BZIB 4B4LA 3DNEA 5HICA 3OWKA 3FLQA 5CU2A 4BF2A 5HLWA 4IEBA 1M7QA 3OXTA 4BHZA 4M0ZA 3EZVA 4QQ5A 4KNBA 4Y5HA 5EOBA 3OCSA 3O71A 5ETFA 4HZRA 2BAKA 4NCTC 1G8SA 4F9BA 3FI3A 3P4KA 3FI4A 2ETRA 3Q04A 3NUSA 4JRVA 4FUXA 4OBPA 4OTPA 4DGLC 3LQ8A 3P08A 4TRLA 3U4UA 1PMEA 5T68A 1ZMUA 3R9OA 4TZRA 3S4QA 4AOTA 1IA9A 4FV5A 2BHEA 4O38A 5D12A 1H01A 4PX6A 1P5EA 1FVTA 4IB0A 3W2PA 4PL5A 5DT4A 3ZLXA 2WIHA 1Q4LA 3UO5A 3VUKA 2F49A 3ZLYA 1PXNA 4BDAA 3QUEA 2DUVA 2QOOA 4D5KA 3CP9A 1NA7A 3V04A 4CV8A 2UZLA 5GZAA 2OIBA 4ITHA 4XV9A 5LWNA 3T8OA 3P7BA 3R7GA 4Y85A 4DT9A 2ZB0A 5CNOA 3IW5A 4D9TA 2XNGA 5HE2A 4N6ZA 4HGTA 1PXLA 1QPDA 2R5TA 3C0HA 2Y7JA 2W05A 5AR3A 3BYSA 2UW5A 4C38A 2XUUA 4O84A 5LXMA 3HMPA 3MWUA 4NTTA 2XEZA 1PXKA 4A9SA 5DLSA 1J7LA 3BLRA 4GG5A 4BDEA 3E62A 3FE3A 4RBLA 4UMTA 1XBAA 2V22A 2VO7A 4BCFA 1IAJA 4EQMA 2HW6A 3MA6A 3G51A 5AV0A 3ET7A 4PUZA 3TKHA 4HYHA 3M42A 3FMNA 2YN8A 3KVWA 4JI9A 3DPKA 1H08A 3DBDA 2W1CA 2IVUA 2UZTA 2X2MA 3PJ1A 4IHPA 4O0UA 3UTOA 4RX5A 3C4WA 3W16A 2GNLA 4BDBA 4WNPA 3KRWA 2ZMCA 1OBDA 5HKMA 5CSWA 3AC4A 3IPHA 2QNJA 3KMMA 1S9IA 1PY5A 4H1JA 5JGAA 3OCBA 2UW9A 1YDTE 4R5SA 1M7NA 3LCDA 3QD2B 3ZYAA 2VWVA 5K5XA 3E8DA 2YACA 5CNNA 4EZ7A 1M17A 4Z55A 2HCKA 3SGCA 5CI6A 4HCUA 5BVKA 3PPKA 4R77A 2R3GA 2C3JA 2ETMA 2QC6A 3HMMA 5HBEA 5C8NA 4D4VA 2CGXA 3ODYX 5IU2A 3QX2A 5EKOA 1MRVA 4QPMA 3HP2A 4MYGA 3TM0A 1UKIA 1E1VA 3O96A 3F5PA 3COIA 3A7FA 2OLCA 4KABA 3KY2A 4WD5A 4XV2A 4IX5A 5LCJA 4O0RA 1GY3A 4U0IA 1TKIA 3SVVA 4GIHA 2I1MA 3GB2A 4I6FA 1PYEA 4ZTRA 2AYPA 1U4DA 3UZRA 4DLIA 2JITA 4PP9A 1JKKA 1SVHA 2G9XA 5ANGA 1KE9A 4O91A 4PTCA 3V5JA 3WBLA 2GNGA 3LOKA 3C4EA 3ZUUA 2BAQA 4FTUA 1W83A 2EU9A 3F3VA 3FZTA 4LRJA 3VO3A 5BUJA 3PXYA 5J5TA 2QLQA 3D83A 4ONAA 4YHTA 2PVNA 3R1YA 2BZKB 5IQGA 2NRUA 1CKJA 1YXVA 4RFZA 3E8NA 1BLXA 2SRCA 3NUYA 1M52A 4C2VA 1PF8A 2OJFE 4C4GA 5K9IA 1YWVA 4IB3A 3F2AA 4JAJA 4C57A 2W9FB 3SX9A 4XG8A 4GFOA 4IM3A 4Q5EA 2XMYA 3BU5A 5CEQA 3ZTXA 4APCA 4EH6A 5EQPA 1R0EA 4K1BA 5KO1A 4PV0A 5E8XA 4D1XA 2UW8A 1W98A 4EH5A 4O0TA 3KXZA 2HK5A 4EORA 4GYGA 3R28A 4JG7A 4AOIA 5IA4A 1YI3A 5CX9A 1CKIA 4FT3A 4J7BA 3EQGA 3PWDA 4A4LA 4FIFA 3C1XA 2GSFA 4X6QC 5CT0A 3TNIA 5JRSA 4BR3A 3E92A 4RWIA 4EZ3A 4IVAA 5HU3A 4DCEA 4BC6A 4N57A 4ZTLA 2QKRA 3GCSA 4A9RA 3QRKA 2FSOX 2QHNA 1WVYA 4I0RA 4X21A 2Y4IB 3TG1A 3SV0A 3PVUA 3C0GA 4FTNA 4K77A 3LFDA 3NCGA 2WMBA 3R71A 4IC8A 4L52A 2W1EA 1ZOEA 2FB8A 3WF9A 3LCTA 2YIWA 4RWJA 3R9HA 1JVPP 4I1ZA 1JKLA 3GP0A 3NYVA 2CGVA 4TKSA 3MVMA 5CENA 3VBYA 4AGUA 4YP8A 3PFQA 2JC6A 2R3IA 5CSHA 5HTIA 4O7SA 4IQ6A 4GVJA 5DYJA 3LIJA 5EFQA 4NW5A 2CMWA 1JPAA 5HE3A 5AIRA 4F7JA 3AC8A 2XKFA 3MV5A 3CSVA 2B54A 4YZMA 5AM6A 4BTMA 4ZP5A 2BZHB 3OEZA 4JG8A 3D5UA 4ANQA 5DGZA 4RIWB 1NXKA 2OH4A 3VVHA 3L8VA 3VWAA 4FBXA 3BYUA 4QMWA 2X6DA 3UOJA 2B4SB 4LUDA 4J53A 3GU5A 3UBDA 4G9CA 4RQVA 2C3KA 5GZ9A 4YPDA 3ZEWA 1BYGA 1R78A 2YCRA 3SG8A 4W9WA 4AT4A 4DEAA 3R0TA 4FC0A 4FT5A 4EOOA 1GOLA 2VAGA 4D9UA 2YABA 2BDWA 3ERKA 2R3MA 2C4GA 4ZSAA 1UWJA 3QZFA 4L42A 3P9JA 2VU3A 1YHSA 4BB4A 2PPQA 5E8ZA 4MWHA 1STCE 2HIWA 5HG7A 5C01A 3LQ5A 4I6QA 4AZVA 3ZRLA 4QP1A 3DQWA 1P14A 1TVOA 3NCZA 1ZYDA 2Q0NA 4AUAA 2DWBA 4AS0A 2PMOX 3D7ZA 3ZSGA 5CAVA 3FKLA 5B2KA 3UO6A 3TIZA 3MBLA 4BGQA 3H30A 3IW6A 4ZLOA 3C0IA 1DM2A 3ZO1A 4BICA 1R1WA 3EKKA 4FKIA 4A7CA 3TDWA 2OJIA 3ZHPC 2V7OA 2OJGA 3IOKA 4FZFB 3UZPA 3W32A 4O82A 3W8LA 5CASA 2UZOA 4B8LA 5J1VA 4I41A 3VS5A 4QTCA 3HMOA 4AN9A 5ICPA 1UU8A 3Q53A 3QXPA 5HBHA 3I0QA 3S2PA 3PXKA 4QMZA 3CS9A 3T3UA 2XYNA 3A61A 3VNTA 4USEA 2YAAA 4I4FA 4WSQA 5HD4A 2JBOA 3CTQA 2O63A 3KA0A 1NVRA 2HXQA 4LMUA 3CBLA 2HY0A 3NDMA 4FTQA 4FOCA 4NUSA 3MVJA 4QYFA 4WNKA 5BUEA 1LPUA 4LRMA 2I7QA 3LE6A 4I93A 4UMQA 5AP3A 5M44A 4OTRA 1RE8A 2JBPA 4CCUA 1YDRE 4LG4A 1OKWA 4J1RA 4ANBA 2W1FA 4JR7A 3LFFA 4U8ZA 3PA3A 5C8KA 1GAGA 3HKOA 4RC2A 3NW7A 5H3QA 5ACKA 3QTZA 4OTWA 1HCLA 1SZMA 3QTXA 2XBAA 4LFIA 3ZC6A 5JN2A 3LZBA 3R02A 2C1BA 4M97A 1GJOA 4W4YA 4F1MA 3I6UA 3CQUA 5HESA 5CZIA 4UN0C 3TDVA 4G3FA 5I5ZA 2X2LA 4IX4A 5JZJA 5HI2A 4UMUA 4PPAA 4GK4A 2C0IA 3NUPA 4BZNA 1DI9A 5BVOA 5IQAA 4AG8A 2ITPA 2WQOA 3KVXA 3PVWA 1Z57A 1LP4A 4MQ2A 4Y46A 4F4PA 4MXOA 2V55A 3CGFA 4I20A 1JKTA 4A9TA 4ENYA 2VTAA 4R1YA 4X2JA 3I6WA 3I0OA 2PZIA 3ENHA 4LM5A 4IZ7A 2XJ0A 3OCGA 1H27A 5DOSA 4OT6A 4GJ3A 3NUUA 4LL5A 1ZARA 2NNWB 4GSBA 5EYMA 4DT8A 4YC8A 5CI7A 3MI9A 2Y4IC 2R2PA 4BDKA 4PP7A 3MY0A 1Q41A 3I4BA 1CDKA 1T46A 2YFXA 2OBJA 2PWLA 5DIAA 4FSQA 4D55A 2FSLX 4QP4A 3NVMB 5FBOA 3BEAA 3UC3A 4YC3A 3VS1A 4RJ4A 4FI1A 3VJNA 4ZTNA 2R3KA 4QMTA 3FDNA 3RBWA 5DVRA 4CLJA 3OWLA 3PXQA 4L8MA 3AD6A 3O2MA 4OR5A 5J7BA 4XP0A 4JX3A 1Q99A 1ZLTA 5IA3A 3KF7A 4L43A 4G3CA 4CMOA 2YWVA 2WTIA 3F5UA 4E4LA 3EIDA 3F61A 2BFXA 1TQPA 2BKZA 2RFSA 2X39A 4FKGA 2VGOA 2P2IA 4M66A 3OXZA 4WUNA 4Y95A 3VUMA 4IANA 4FODA 5IEXA 1Q8WA 5EI8A 3W2CA 4FV3A 5ETAA 3ZSHA 4P4CA 5E1EA 2J0KA 4EOMA 1ZOGA 2QO2A 2YWPA 3BQCA 5DG5A 5I3OA 1P2AA 3DLZA 2JDVA 5TT7A 2LAVA 1ZY5A 3IOPA 2UW4A 4RIYA 5D11A 4AOJA 4ZZNA 5C27A 2PYWA 3BYVA 1MQ4A 2JAMA 3D5XA 3EKNA 5GJFA 3KK9A 5FXQA 4J96A 4DH1A 4QD6A 2WMQA 3FZPA 3FHRA 1DAWA 3Q60A 3O8PA 2GQSA 3TV4A 4OAUC 3HVCA 2E9OA 2JFMA 3OTVA 4NKAA 3GC9A 3NYNA 2E9NA 3OBGA 3LMGA 5CLPA 4YZDA 2R3LA 3OOMA 4TWOA 4FYNA 4BKZA 4O7ZA 2BROA 5IA0A 2GFCA 3L8SA 5CEKA 4QMVA 2YJRA 2BMCA 2W7XA 4X6RA 4EQCA 3LCOA 4GJ2A 1IEPA 3PVGA 3FLWA 4X2KA 3RPOA 2F9GA 3KULB 4EK3A 3FZOA 5EQEA 3IKAA 5EW9A 4CQGA 4E5AX 4V0GA 3RM7A 3V8WA 4O7WA 2C30A 2NP8A 3DK7A 2YDIA 3QQGA 3UZTA 3OF0A 4BWKA 3ORIA 1H26A 2BHHA 3AXWA 4PTGA 4EH9A 3I5ZA 3DKFA 3HECA 4I0SA 5I9ZA 3PXZA 3PY1A 1KWPA 3VBXA 5IQHA 5LMBA 3BE2A 5AJQA 4C02A 2X4FA 4FL2A 4AU8A 2W9ZB 1W8CA 4CFWA 2WZJA 4WNOA 4HPTE 5I9XA 5J1WA 2BIKB 2NRYA 4KRDA 4RG0A 3E7VA 4TNBA 4YSMA 3P7AA 5DE2A 3RPYA 3TZ9A 3CD3A 2BILB 3MPMA 4NFNA 2GTMA 3C5UA 1SVEA 4DGOA 1Z9XA 1OMWA 4YO6A 3RHKA 4QPAA 4FVRA 5F1ZA 4I94A 4FKJA 3ZXTA 4JLCA 3ZRKA 3WF8A 4C4HA 1Q62A 4AE6A 3QD3A 3G90X 3VUDA 3TI1A 5CF6A 3HUCA 4I22A 3PE1A 5EW3A 3ALOA 4AZWA 1YKRA 3EHAA 1MUOA 2C5NA 3AD5A 4YLLA 2VO6A 3DBEA 4HVDA 4C61A 1H0WA 2C0TA 3IQ7A 2BZJA 2WTVA 3MPTA 4WRGA 4XEYA 5DBXA 3TKIA 3VRZA 4DFXE 4QRCA 2VTRA 2VWXA 1V1KA 4O86A 5TOZA 3JVRA 3JPVA 5AUWA 1UA2A 5JFWA 1F5QA 2PTKA 3E88A 4JBQA 4BDFA 5M4CA 4AE9A 4G3GA 4FTLA 3ZBFA 4YR8A 5KCVA 4ZEGA 4ZK5A 4AA0A 1XQZA 2XIZA 4AWIA 2XM9A 4TWNA 5CXZA 1M2QA 3GU4A 3BHHA 3EMGA 4YZBA 4Z7HA 2C0OA 5JKGA 2VO3A 5M06A 3U4WA 4D2PA 4GFGA 4FTOA 5HBJA 4IAFA 3BWJA 2GS6A 2YCQA 4ENXA 3QQUA 3LLAA 2E9PA 3MPAA 3CEKA 3VN9A 1FVVA 4ZMFA 4IM0A 3RVGA 2JKMA 3QRIA 3VUTA 3ZU7A 1S9JA 2FO0A 1OVEA 4J95A 2J2IB 2QODA 3UYSA 4M12A 3R01A 4EQUA 5CALA 1GZKA 5BYZA 4AP7A 3R7YA 3PIXA 1R0PA 3JY9A 4OLIA 3CR0A 5CF4A 5EH0A 2GQGA 3E3BX 5AV4A 3R63A 3TEIA 4EBWA 5HX8A 3UYTA 2ITNA 1KSWA 2JEDA 1XBBA 1Y57A 4L7FA 2C3LA 2YM4A 3FQEA 4XG7A 4DFNA 4V04A 4O2ZA 4CNHA 2X7OA 4LQMA 1OUYA 1ZAOA 3DTCA 3P23A 4WUAA 3WZUA 2Y6MA 2O65A 2B0QA 2R3NA 5A46A 3OCTA 3CJFA 4QMLA 5IQEA 3QQJA 2I0HA 2XM8A 4UXLA 4BCHA 4QP7A 4DA5A 4MXCA 5H9BA 2WOTA 3UG1A 4JL9A 4YJSA 4XOZA 1V0PA 4BWXA 3OY1A 5LJJA 5HG8A 3PLSA 2YIQA 3UG2A 4FSTA 3ORKA 2XK7A 3TZ8A 4D1SA 4KBAA 3KRRA 3RPSA 2PU8A 5IG1A 4NTSA 2F7XE 5EM7A 2WMRA 4M14A 1H1SA 4PNKA 1JLUE 3ZBXA 3PRIA 3ZZEA 3FYKX 2QR7A 5AV2A 1FMOE 4EKKA 5I3RA 5FM3A 5E8YA 4QMSA 5A9UA 4KD1A 2ZM3A 3M1SA 4MXXA 2VTOA 5JGDA 3BHYA 5CSVA 3DAJA 4C4JA 3ORPA 2H34A 3FXWA 2VTSA 4IDTA 2C6TA 4KKHA 2OFVA 3ZO2A 4FVQA 3DDPA 1PXOA 4PPBA 3RZBA 4R1VA 5M4IA 2Q83A 4PMMA 4O6EA 5IDNA 4ACGA 4Q9ZA 4MEDA 4I6BA 5J87A 3EN5A 2BRHA 4BZDA 1Q3DA 3OFMA 3QF9A 4XHKB 5A4QA 4HVGA 3QKMA 3KKVA 3QU0A 1M2RA 2VO0A 3CTHA 3SKCA 3QGYA 4DN5A 5IPJA 3EFWA 2BUJA 5L3AA 2NPQA 3AT3A 4DH3A 2XIYA 1APME 3KN6A 4Y72A 4UZDA 3TZMA 4BYIA 4BWPA 4RA5A 4DFYA 4E73A 1OUKA 4IWPA 2QHMA 4L67A 3POOA 4FG8A 4NIFA 4XOYA 4QTAA 4E8AA 1GZNA 2IVTA 2VUWA 3KGAA 3IS5A 4N6YA 4GVAA 3W2RA 5AR4A 3EB0A 3HV3A 3TN8A 2Z8CA 4OAVB 4TY1A 4WNMA 3R22A 4NH1A 1B38A 2CSNA 2IW8A 3L8PA 3ZLWA 3AMYA 5JQ8A 1YOJA 4GG7A 3A60A 3FI2A 3PE2A 4YJTA 2XRUA 3AG9A 1PMNA 4I24A 3LJ2A 5EQYA 3D9VA 5LVOA 1WFCA 2WKMA 4FV8A 4O1OA 1K9AA 3D0EA 4G34A 5AX9A 4EKLA 4ORKA 1ZMWA 5E8WA 4W8DA 4FKSA 3IDCA 4QMMA 4UMPA 3F3UA 1JBPE 2QU6A 3EZRA 1YVJA 3CPBA 3FLZA 3IG7A 5AP1A 5L8JA 3SW4A 4IX3A 4R7IA 4D2WA 5CU4A 1MQBA 5F4NA 5K3YA 2GHLA 4C37A 2BAJA 2V5QA 4U40A 1MRUA 2WGJA 3R7EA 1CM8A 4HYSA 3DQXA 1B39A 4ALWA 2PY3A 4RLKA 4F7LA 3UDBA 3PJCA 2A4LA 4WG3A 2WU6A 1OIRA 2J5EA 1ZWSA 1CSNA 3ENMA 4B6LA 3RNIA 3ORZA 4XH6A 2B9JA 2VD5A 2YJSA 4ACCA 4F1TA 2GS2A 4W4XA 1GIHA 2WMXA 3ORNA 5J7HA 3DK6A 4RIXB 5M4FA 3CQEA 5B7VA 3O51A 2X9EA 3ORMA 5CZHA 2OZAA 4AA5A 4BI2A 5AP6A 5A4EA 3K3IA 3VS3A 4UWYA 3LXNA 4D4YA 3BGPA 1IA8A 3CCNA 4MVFA 2JDRA 4DG2E 4AA4A 3WZEA 4MXZA 4CEGA 1Y6AA 4QOXA 1G5SA 3PIZA 4H3QA 3EQCA 2H8HA 2Z2WA 4U41A 4U42A 5L2QA 4ZAUA 3K5UA 5DRBA 2UZWE 3OBJA 4H3BA 2WTJA 3PG3A 4G5PA 4U97A 2XNPA 2X0GA 3LCSA 5LARA 4TYHA 5M08A 2XKDA 3V3VA 1E1XA 4FNZA 4GT4A 5CY3A 2HZ0A 2VTHA 4FV2A 3L9MA 5BMMA 2PULA 3AMBA 3C7QA 2PMLX 2C68A 4BCNA 1PJKA 4DTAA 4WG4A 3U87A 4KIOA 3PTGA 5HVYA 3QTRA 3VBTA 3DOGA 5E8VA 3ZS5A 3KFAA 4P5ZA 5AP0A 4FG7A 1QPJA 3QTQA 3QALE 4LOOA 3G9NA 4RA4A 5GZ8A 4IWQA 2OKRA 3GU6A 5AUVA 3WIGA 5K0XA 2JFLA 3BHVA 5AX3A 3F82A 4F6UA 4YZ9A 1OIUA 2H6DA 2IZRA 2WQEA 4IWDA 5AUZA 5JEBA 1ZY4A 4B9DA 3VUIA 4C4IA 4F0GA 2CKPA 2J50A 3EQDA 3V5QA 2WELA 4YZCA 2J51A 2UUEA 4YJQA 2Z02A 3U6JA 1YXUA 1J3HA 2I0YA 5CANA 3OD6X 4CGAA 3BGQA 4RJ8A 5HCXA 3PVBA 5HLNA 5FEEA 3K2LA 5CYIA 4RZVA 4DYMA 2VV9A 3QAME 4MTAA 3SA0A 4ZMEA 2ERZE 4CD0A 4MD7E 5LVLA 4E93A 3BBWA 4C7TA 1HCKA 2ZYBA 3GENA 5DN3A 4AN3A 3V8SA 4PQNA 4DINA 5KUPA 1ZXEA 4GCJA 4UWBA 3RK5A 5L6PA 3FBVA 4V0GB 4C59A 4JDJA 2NO3A 4GYIA 4ITIA 4XBRA 4G31A 4LOQA 4QTBA 1TQIA 4YPSA 4ZY4A 3U9NA 2ZOQA 2ZV2A 3FMMA 4YHFA 5A4TA 4ANLA 4UX9A 3LHJA 1Y8YA 2VWBA 3LLTA 4BRXA 4X2NA 3MY1A 3A99A 4BVUA 4F70A 4K6ZA 4NL0A 5D10A 4MBLA 3MS9A 3HLLA 4IDVA 4IH8A 2XNOA 2PUIA 4FL3A 5CSXA 4BGHA 2XK9A 4IAKA 3WARA 4G1WA 4WHZA 4EHVA 3QD0A 3ULZA 4ID7A 3W2OA 4O96A 5FRIA 4ZJJA 4FSWA 4BL1A 5BVDA 5BPYA 5M57A 3OXIA 5AV1A 4F6WA 2X7FA 3TCPA 4ITJA 2X81A 2FGIA 3HV5A 2AC3A 1DS5A 4JBOA 5H2UA 3R7UA 4BCJA 4QMQA 2PVJA 4M8TA 5LVNA 5JFSA 1XH6A 3VS4A 4HZSA 2G01A 4F6SA 2CKQA 3RCDA 4OUCA 3D7TA 4G6LA 3HAMA 2O0UA 5ANKA 3BELA 3TV7A 3TTIA 4FEWA 4USDA 4YLKA 2VX1A 2YIRA 5F94A 2P3GX 1OL5A 2VN9A 4K9YA 1WMKA 2W4JA 4RWLA 4EK8A 5ETCA 4USFA 3R9RA 1XWSA 3QD4A 4Q9SA 4G17A 3GCPA 2WHBA 2R3FA 3DS6A 4BTKA 4JDIA 5FXRA 3RAKA 3HAVA 1WVWA 2X8DA 3CD8A 4JAIA 2B9IA 4ZY5A 2YLFA 3ZM4A 2CNQA 4YO4A 3KRLA 5CF8A 2GNIA 1YHWA 4Q2AA 2PVLA 2XNMA 4L44A 1VYWA 3H3CA 3H0ZA 1W82A 1DI8A 4XNEA 4FSYA 3F3WA 3G0EA 3KCFA 4KS7A 4RX8A 5GHVA 3W2QA 3BRBA 4DFLA 4D4RA 3I7BA 5J9ZA 5IH6A 4QO9A 4YTFA 2VNYA 4R3PA 4UXQA 2ITTA 4FV9A 5FP6A 1KE6A 3VULA 3R9NA 4WBOA 4QNYA 3NX8A 1NVSA 4MXAA 3ZH8A 4A06A 2JAVA 2IZUA 4EJ7A 3POZA 2B7AA 4I5PA 4EYJA 1OIYA 2RFEA 2EXEA 4QT1A 2JDOA 5DA3A 4QQTA 5J9YA 2HYYA 4U3YA 4IFCA 1RW8A 4FV0A 3N9XA 3TKUA 3ZUVA 2IWIA 3RWQA 3O7LD 5E90A 2BVAA 5L2IA 3D2IA 2YCSA 1SMHA 3RAIA 3P0MA 4LYNA 3QZHA 4CLIA 2UVXA 4NW6A 4AZEA 4D5HA 4DG3E 4TYJA 5IA1A 2ZV9A 3Q96A 2ETKA 3IK3A 3NYOA 5CVHA 3A7IA 3LM5A 4PDPA 4YTCA 4X2FA 4O21A 3FPQA 5FDPA 2OJ9A 4K18A 3SRVB 4NSTA 4S34A 4O27B 5HLPA 3S00A 3DNDA 2AC5A 1YWRA 3ZM9A 2ZAZA 1JSUA 1O6LA 3ETAA 1A9UA 4GFMA 1WZYA 1PKGA 4LMNA 1ZYCA 4I21A 1OPKA 3AC2A 3KXXA 4GW8A 3R7IA 4IVDA 4UV0A 1QL6A 4RZWA 4FYOA 5H8EA 2HELA 4FGBA 4CFUA 3G9LX 3DBFA 3C4CA 2CGUA 3RKBA 1IAHA 5A4CA 4ASDA 4CZUA 2VTJA 5IQFA 4NM3A 4V01A 4GUEA 2C6IA 2C6OA 4J8MA 4M3QA 4Z3VA 5LMKA 2OSCA 4EWQA 4CYJA 5EHOA 5HE0A 3FSKA 4R3RA 4PMSA 4IXPA 2VTLA 2ERKA 5D1JA 4CSVA 4KS8A 5EHLA 4FE2A 1GZ8A 3P7CA 2R0UA 5M53A 3BYOA 4DF3A 5IH4A 3NUAA 1K3AA 4M84A 3R7OA 2AUHA 2F2CB 4WKQA 4XP2A 3FWQA 3UIXA 3LFCA 4EONA 4G16A 4A9YA 1W84A 1UWHA 2R9SA 3BGZA 3QRJA 4U81A 1LEWA 4PL3A 5J79A 3MN3A 3R83A 3OS3A 5BMSA 3GFEA 2HZ4A 2OIDA 2ITZA 1OL2A 1U5RA 2OZOA 1EH4A 2YDKA 5JFXA 4RIOA 4XLVA 4NIFB 3SW7A 3ZLSA 4EH7A 5FEDA 4TWCA 4ACMA 4F65A 5TO8A 5DEWA 5CVFA 4KUJA 4NWMA 4BI1A 3ZC5A 4BDJA 2RG6A 3EQIA 4F1OA 4IAZA 3ITZA 3JYAA 4PF4A 3DB8A 3H9OA 4QP6A 3S95A 4ACDA 4HVSA 5KBRA 3PDTA 4IX6A 2G15A 5CTPA 3ZFXA 3BV3A 4DH7A 2GMXA 4AX8A 5TF9A 4O83A 1J7IA 3LMIA 5J9LA 4YBKA 2C3IB 2W0JA 2W1DA 4NCTA 3FI8A 4M15A 3UIBA 2IO6A 1B6CB 2JIIA 2GDOA 4MNEB 5A14A 4CG9A 2ONLC 4CTBA 5BVWA 4IZAA 4LOPA 2WMSA 5BX0A 1WBWA 3FQSA 4CMTA 5HORA 2J0LA 2XJ2A 2KTYA 3D4QA 4M7IA 3HRCA 3KEXA 4NM7A 4WT6A 2XIRA 4QP9A 3A8XA 4FKUA 4CT2A 3OTUA 3KL8A 2VTIA 5EG3A 2FUMA 1UNHA 2G2HA 4FV1A 4ANNA 2ITXA 4II5A 3DJ5A 4I4EA 4AW0A 3E7OA 4C3PA 3FMLA 5DR6A 2YAKA 1OZ1A 2QOQA 3Q32A 3R8ZA 5DNRA 3DB6A 4L3LA 4C4FA 4IADA 2VTPA 2I0EA 4ZS0A 5GIOE 3PJ3A 3G0FA 5DI1A 4G6NA 4XG3A 2XZSA 3DJ7A 3R8UA 1Q8TA 3GGFA 4ANMA 4A9UA 4BCPA 4CV9A 4D2SA 1CMKE 1PXPA 2EUFB 3G6HA 5ANDA 4C34A 3W1FA 2CKOA 4FKWA 2FH9A 4C36A 2PE0A 4IVCA 4EOSA 3R1QA 3DK3A 5KMLA 3QC9A 5D9HA 2BALA 3FC2A 2DQ7X 4G9RA 2WTCA 3FMHA 3COKA 5I9WA 3HA8A 2R3OA 4YHJA 2J5FA 2OI4X 2YM8A 3CLYA 3QQLA 2RFNA 4FT0A 3GCUA 4QNAA 4EOJA 3A4OX 4C35A 4TYHB 4AZSA 4BDGA 4LGGA 2PUUA 1YRPA 1ZZ2A 4O2PA 3QWKA 2FSMX 4IACA 3IDPA 2VX0A 4RLLA 3ZMMA 3MESA 5E8SA 5A4LA 2YM5A 2YITA 2YZAA 4CVAA 3QCQA 5AR5A 3ZDUA 5FWKK 1AD5A 3AQVA 5AM7A 3C4ZA 3V6SA 4U7ZA 1ZRZA 3OY3A 2XH5A 5IISA 5G6VA 3UE4A 3UODA 4RQKA 3TT0A 1WBOA 4D28A 5L8KA 3QCYA 3QQFA 3ZXZA 4XLIA 2X8IA 4FTKA 4AT5A 2WO6A 1VZOA 2J0MB 2QOBA 2QQ7A 3BPRA 4GIIA 4MF1A 2YZLA 3HA6A 4L00A 4JDHA 2OG8A 3RJCA 3F2NA 4CZYB 4S32A 4NFMA 2QI8A 4ZSEA 3LW0A 3HUBA 3TV6A 3FL5A 3Q3BA 4RFMA 4EEVA 1H28A 3EN9A 3H4JA 4OTQA 2HXLA 3TL8A 3VC4A 3HX4A 5DR9A 4FEUA 1JQHA 4FKQA 5D7AA 1UNLA 2OU7A 2OXDA 3WZJA 4O81A 3IDBA 3KN5A 3MY5A 3WOWA 5AP7A 1OL7A 4BTFA 3FJQE 3K3JA 2BRBA 3RK7A 4DTKA 3UOHA 1OBGA 4DG0E 3M11A 3FLYA 3DT1A 3TJCA 2JDSA 5L2SA 3OG7A 1FINA 4UMRA 4QMXA 3C50A 4JOAA 5L2WA 4PY1A 1PMVA 3C51A 3QBNA 2C47A 5AP5A 1MP8A 5HO8A 1BI8A 4A4OA 3C9WA 2CCIA 4U80A 4X0MA 3UIUA 3AC5A 4EL9A 2CJMA 4XRJA 5M09A 3DAEA 4P5QA 5CAOA 5TE0A 1H25A 3TIYA 2VWZA 4BHNA 4BBFA 3KC3A 2X6EA 2JKOA 2QURA 1H1PA 2J0JA 4F9WA 4F08A 2IG7A 2O5KA 4FT9A 4M67A 3QUPA 4KIKA 1WAKA 3BLQA 4WG5A 3VBWA 4CFMA 1VR2A 5HHWA 3OT3A 3PPJA 4FIEA 4GU6A 3I5NA 4JVGA 5KMMA 3QA8A 2J0IA 3R6XA 5EHYA 4BZOA 1Y8GA 4TTHB 3D7TB 3QHRA 5AP4A 5CEIA 2W17A 3ZUTA 5HTBA 1VJYA 4DGMA 1BX6A 2OK1A 3VAPA 3PRFA 3UP7A 5I9UA 2G2IA 1Y91A 2I0VA 4FTCA 3NGAA 4J52A 4FZ7A 4E6DA 2XKCA 4D4SA 2YDJA 4ZTMA 5AUUA 4FGRA 3FMEA 5EI6A 3RWPA 2GS7A 5CXHA 5F9EA 4XV3A 4F09A 2WNTA 3T3VA 4ZY6A 4BIEA 4YJRA 2A1AB 2PMNX 3N4VA 3F5GA 4B0GA 2BIYA 4F0FA 3OHTA 3N51A 3NIZA 4YBJA 2W4OA 4JQ8A 2E9VA 4G3EA 5EDQA 4YTHA 4XYFA 2QO9A 1YXXA 2XNNA 5HIDA 4L46A 3RGFA 2WPAA 2I6LA 1OI9A 3R2BA 2WOUA 4C8BA 4L9IA 3AMAA 4ASXA 2FA2A 1Q24A 1UV5A 3Q5ZA 3NNXA 2RGPA 3R21A 4MX9A 3DXQA 1RJBA 2QOIA 3OP5A 3GT8A 3DU8A 5IMEA 3LFBA 4FEVA 4PMPA 3DV3A 4WRSA 4KBCA 1Q8YA 4FV6A 4UWCA 3UMWA 4EJNA 3KRXA 4LGDA 4JS8A 2IVVA 4R6VA 3T9TA 4DC2A 3UPZA 3EQRA 3HRBA 2QCSA 3IO7A 4E4MA 3TZ7A 5K5NA 5L6OA 3WZDA 3TTJA 1AGWA 3U54A 2XB7A 3LCKA 4YJUA 4IAIA 5IH5A 2RG5A 2Q0BA 2Z7QA 3QYZA 3EQFA 4R8QA 2Y4PA 4GRBA 4RPVA 3HV6A 3Q9XA 4MBJA 5IZFA 2V7AA 3NRMA 4R5YA 4EYMA 2V62A 2B9HA 2GFSA 2R3QA 2ZV8A 3OWJA 3S3IA 4B99A 5EKNA 4FNYA 3GC8A 3LFSA 3B8QA 5A6NA 4QP8A 5C4KA 5HVKA 3R73A 2J4ZA 1PXJA 4TN6A 4LGHA 4GK3A 5I9YA 1YI6A 3BCEA 5KX8A 1XO2B 5IEVA 4AGDA 4E6QA 3I7CA 4F9CA 4RVLA 4ANSA 3EL7A 3E8CA 5FDXA 4ZZMA 3HNGA 3D15A 4BCQA 3ANRA 4ZIMA 1R3CA 4D1ZA 3DZOA 5ETIA 1Q8ZA 3LXKA 3EQHA 3PG1A 4FR4A 4J99A 2WMVA 1ND4A 1Q5KA 2QOCA 3MIYA 3GUBA 5C4LA 3VRYA 1OKZA 4EOPA 4X3FA 1SYKA 4YU2A 5DFPA 5KE0A 3LFAA 5HG9A 3FL4A 2C6EA 1H8FA 3UVRA 2IZSA 5D41A 3RI1A 2QKWB 3ZDIA 1A06A 4YMJA 3MJ1A 5CAPA 2A19B 3NZ0A 4KSPA 3FY2A 3QFVA 4TXCA 3THBA 3ID6C 3DBQA 1PYXA 1BKXA 3KXGA 4E6AA 3PSBA 4P90A 4NZWB 3FLNC 4D0WA 3SQQA 1J91A 3HZTA 1ZYJA 2GU8A 3NUXA 3F5XA 4NEUA 5IMXA 3OMVA 2HWOA 2WFYA 3KXHA 3KB7A 4YLJA 5FLFA 1YWNA 3PA4A 4LUEA 3TNWA 5CAUA 3ALNA 1K2PA 1L3RE 2PMIA 3QYWA 4YNEA 2PHKA 5FQDC 2YHVA 2F7EE 4EWHA 4F0IA 2C5OA 3CQWA 4TWPA 3R30A 2Y8OA 4U44A 2H9VA 3E8EA 3E5AA 1URWA 4AXAA 5EYKA 3U6HA 3ANQA 2VTQA 4BCMA 3GXLA 4AW5A 5C03A 3DLSA 5AAFA 3CTJA 3D94A 4EOKA 5KKRB 5J5SA 1IASA 2VGPA 5CU3A 4GT5A 4NM5A 4YSJA 2XYUA 5AA8A 2VTTA 1NW1A 3Q52A 1BUHA 5EK7A 2VTNA 3SDJA 4UB7A 5IUIA 2VX3A 3PP1A 2BKKA 5TR6A 3P5KA 4FKOA 3HV4A 3QZIA 4ERKA 4DE4A 1F3MC 2PZRA 2W5BA 4C58A 3FXZA 3AC1A 3B2TA 4EOLA 3PZEA 4U5JA 4EBVA 4E26A 1G8AA 4CKRA 4P2KA 1NT2A 4BDDA 3NLBA 5CEOA 4D2RA 4YJNA 3O23A 2WAJA 3ACKA 4DTBA 1I44A 3ZRMA 2V0DA 3W55A 4FA2A 4IZ5A 5HE1A 2B9FA 3LVPA 4HCTA 3DTWA 3ORXA 2YM6A 4QQCA 1KOBA 3PSCA 2XVDA 3PIYA 2J6MA 4J98A 4Y73A 2ITYA 3FV8A 2QOLA 5AUYA 1YI4A 2PK9A 5FTQA 1URCA 4KINA 3HDMA 4S2ZA 4FF8A 1JWHA 4LV5A 3UVPA 4EK4A 2PUNA 4QPSA 2CLQA 2Y9QA 4Z9LA 2UZBA 3VUHA 4LI5A 4YJOA 4L3PA 3UO4A 4FIHA 3R00A 3BU3A 3NYXA 5E9EA 2YEXA 5TKDA 1OKYA 4KRCA 5E1SA 4NK9A 2X8EA 2R64A 4E5WA 4RJ6A 3V5TA 3V01A 5EM6A 2BRNA 5AUXA 3DBCA 5H8BA 1SVGA 2A0CX 1OKVA 4KBKA 3OROA 2UZVA 3OVVA 5AAEA 5FG8A 2JKQA 4N70A 4Z16A 3A62A 1OL1A 2IW6A 5T6KA 2XIKA 4M0YA 4MD9E 4ALUA 4M69A 3K54A 3NAXA 4WA9A 4FTRA 2RF9A 3BE9A 2PL0A 3RK9A 4ERWA 4MNFA 3CKWA 3EFKA 5CT7A 4O0SA 4FG9A 1WBTA 3V6RA 5E91A 2B52A 4PL4A 3UC4A 5AMNA 2C6DA 1U5QA 2EXCX 3OT8A 1U46A 4F64A 2W5AA 5F95A 4CYIA 3U6IA 3BI6A 5E8UA 2YIXA 3LQ3A 3VBVA 4NKSA 4DH5A 4O7VA 4RGJA 2GPHA 3PPZA 5J95A 3R2YA 3A7HA 2W1IA 2B1PA 1XR1A 3MGYA 5EM8A 1M2PA 4EK6A 5E7RA 3GQLA 3UIMA 3OZ6A 2XF0A 4S33A 4XCUA 4HOKA 3V5WA 2WMTA 3JR1A 2F7ZE 2PVMA 4I5MA 4RMZA 5HCZA 2GTNA 2HW7A 4QTEA 4YURA 4HVIA 5IDPA 4RIYB 3QL8A 4XMOA 1XH4A 4AZFA 4DAWA 3QTUA 3TUCA 3FLSA 4BBEA 4TNDA 2XP2A 5L8LA 3RMFA 3WI6A 1YDSE 2GNJA 4ARKA 3LJ0A 3E93A 5M07A 3MFTA 5K0KA 2VWIA 2BR1A 3JS2A 3DY7A 1M14A 2IVSA 3LM0A 4JBPA 1OPLA 2W4KA 2VWUA 5IKWA 3ZZWA 4EI4A 5CWZA 3PLAE 1PRYA 4OTHA 4I5HA 5JRQA 1BL7A 2C5XA 3F66A 1MRYA 5HNBA 5KKRC 4F9AA 4IB1A 5ACBC 3O50A 4CRLA 3FY0A 3IONA 3VHEA 1XBCA 2Z7SA 4FSMA 3Q9YA 2QOFA 4KKGA 4RWKA 5BQ0A 4CRSA 3QCSA 5FD2A 5AV3A 3SAYA 4C33A 3LKMA 4F9YA 3F7WA 4AGWA 3I60A 1PXIA 3TNQB 2ZDUA 4FSUA 3SOCA 3P79A 4FNWA 3CY3A 4JDKA 3DDQA 3JXWA 4JR3A 3ZONA 5HO6A 3E64A 1YOMA 3EWHA 4HPUE 4FTMA 2W5HA 3I81A 4TYEA 4CXAA 4FV7A 3G33A 2X2KA 1JKSA 5IF1A 4LV8A 4KIKB 1FOTA 4BI0A 3TNHA 1LR4A 3EL8A 4ACHA 2XK6A 2YA9A 2J90A 3IW7A 3DXNA 3MVHA 1O9UA 2WMUA 4I3ZA 4QMYA 3HRFA 3Q6WA 3BHTA 2JD5A 2R3RA 3UNJA 2Z7RA 3ULIA 2RIOA 2WIPA 5AADA 5GJDA 4GV1A 3UOLA 4TL0A 2F57A 3GU7A 2BTSA 1REKA 2ACXA 3Q4UA 2W99B 1KV2A 4MXYA 4N4SA 3VS0A 3R8VA 3L1SA 2IPXA 3COMA 3G15A 1REJA 3L9LA 4CFXA 3KULA 1XH7A 4EK5A 2BRGA 1ZZLA 3QUDA 4U45A 4JQEA 4XJ0A 2C1AA 3H9FA 4S30A 3O8UA 5HQ0A 1XH5A 3MSSA 1FGKA 2ITOA 5HEZA 4BYJA 4DGGA 3GCVA 2XK3A 4YC6A 1ZOHA 3NS9A 2X1NA 4WBBB 3DXPA 2CHLA 2QLUA 4O7NA 4JX7A 3CJGA 2OIQA 4RT7A 3MB6A 2CKEA 3OOGA 4DEIA 3QTSA 2GNHA 3VW6A 5IQBA 3DGKA 4FSNA 3QKKA 4UYNA 3QGWA 2GQRA 4G5JA 3VS2A 3PSDA 4A4XA 4I6HA 3HMNA 4Q5HA 4OTIA 2LGCA 3NW6A 3CE3A 4OTFA 2WEVA 3UOKA 4HGEA 3KREA 3HL7A 1GIJA 2YLEA 4IIRA 4FEXA 2WMAA 4FEQA 4GEOA 3PZHA 2PVFA 4RX9A 5CF5A 3MDYA 5L4QA 1Q3WA 3IGGA 5BUIA 5HX6A 5M56A 3V5PA 4AZTA 3A7JA 1J7UA 3TACA 2PZPA 4JT3A 1OITA 3ODZX 4RC3A 4FIIA 3R8PA 4TW9A 4CFNA 2JIUA 2JIVA 4I5CA 4FX3A 3RAHA 1W0XC 4XG9A 3DZQA 1H1QA 2BPMA 3UQGA 3QQKA 3B2WA 5LMAA 3JVSA 4BDCA 2XRWA 3KK8A 3KQ7A 3NR9A 4BDHA 5GIPE 3FMKA 2IW9A 3M2WA 3CC6A 4ZS4A 2JGZA 3GC0A 3PJ2A 3MH1A 4C4EA 4CKIA 3GFWA 4RJ3A 4IJ9A 4IE9A 3PA5A 1CKPA 4AW2A 4EH3A 3NMUF 4YNOA 3BU6A 3QWJA 4Y5QA 4WSYA 4ASEA 3OUNB 2WQBA 2QONA 2ZM1A 2G2FA 3D2KA 4D58A 5JSMA 3LXPA 3EH9A 5DPVA 4R78A 3R8LA 3DFCB 3QRTA 3W8QA 3FKNA 4K2RA 5J8IA 5AAGA 4ZSGA 5CEMA 2UW7A 4E6CA 4V05A 3PUPA 1P4FA 4FIJA 4JXFA 4BTJA 1KE7A 3VW8A 1P4OA 4WOVA 2R3PA 5LOHA 4UY9A 3NPCA 3QLGA 4L53A 2EWAA 4FSZA 2QD9A 4X3FB 5CU0A 2OFUA 3FMJA 4S31A 3UMXA 4N0SA 2WQMA 2W1ZA 3UQCA 3NW5A 4RX7A 2IN6A 2JDTA 4O0WA 2VTMA 4QYGA 2BDFA 1T45A 3UJGA 4PDYA 4DFBA 2XBJA 3FHIA 4CT1A 4F7SA 5M4UA 5FXSA 3BV2A 3P78A 3TWJA 4AN2A 1LUFA 2UW6A 3NVKI 4ZTQA 4UEUA 4R7BA 1SNUA 1XKKA 1Z5MA 4IWOA 3LFNA 5K4JA 3SG9A 2UZEA 2FYSA 3WF6A 5GJGA 5LQFA 3MFRA 4TPTA 5M51A 3GI3A 2ITVA 3WF5A 1H24A 3ZO4A 2R3JA 4PPCA 2Z7LA 4Z7GA 1SNXA 2BCJA 2HY81 3GQIA 4K11A 3UNZA 3U55A 1XJDA 5EDRA 2W96B 3TUDA 3GOPA 4O0VA 4HW7A 4XV1A 4Y8DA 3D5WA 3OWPA 3MB7A 5HCYA 3VHKA 2XS0A 2YIYA 3BX5A 1O6KA 3UPXA 2PSQA 3RP9A 3SXRA 1U54A 1WBPA 4FKPA 3RM6A 5HD7A 3KCKA 2XNBA 4KIPA 4O1PA 5B0XA 4GKHA 3MYGA 2UW3A 3FQHA 3KU2A 3AGLA 3MH3A 3OW3A 5CAQA 4W9XA 4HCVA 4X2GA 2XEYA 2E2BA 4EOQA 2VNWA 3QA0A 2WTWA 3UGCA 1V0BA 4NT4A 4FZDB 2PVHA 1GZOA 3OEFX 4O22A 3ROCA 5LWMA 4BCIA 1JAMA 3Q4ZA 2VWWA 3MTLA 1ZMVA 2EVAA 3KRJA 2DS1A 5BVFA 4L45A 2PZYA 4FTIA 3QTIA 4FUYA 2PVKA 5JFVA 5JK3A 5I4NA 3CIKA 1YHVA 2BRMA 1UNGA 3IW8A 5CQUA 2ZB1A 4AGCA 1H1WA 1UKHA 4H36A 3VS6A 3EN4A 2QOKA 2XNEA 4DCAA 4O6LA 4FSRA 5HNGA 4GK2A 4GUBA 4J8NA 3NNWA 3MVLA 4U3ZA 5C9CA 1IG1A 1OL6A 3MA3A 5FP5A 3WE4A 3AT2A 1LEZA 3H0YA 1O6YA 5T3QA 3BLHA 3RCJA 2O2UA 4A07A 4O7YA 3RAWA 3TNPC 3OUKA 5AA9A 3Q4TA 2UZNA 4TYIA 5H8GA 4FKRA 3HV7A 5CVGA 4ZSLA 1Q8UA 1BL6A 5DMZA 3O17A 4PNIA 4U79A 2OH0E 3RNYA 5A54A 3PWYA 3WF7A 3KF4A 4RVMA 3MH2A 2WTDA 3W33A 4DGNA 4E3CA 1QPCA 2BDJA 2OZAB 2G1TA 3G5DA 3E63A 1H1RA 1JOWB 3U8WA 1OGUA 1HOWA 5B2MA 1OIQA 4XRLA 1CTPE 4KB8A 4PTEA 4IM2A 4XS2A 2GHMA 4BFMA 3U9CA 5B2LA 2QVSE 1H00A 3HYHA 3PY3A 3BBTB 4M69B 1NVQA 4H05A 3ZO3A 5M55A 3S1HA 5JGBA 4X3FC 4OBQA 4D2VA 2R3HA 5HU9A 2HZNA 3SXSA 3ATTA 2QG5A 5AP2A 3DCVA 4FNXA 4FK6A 3MW1A 3VF8A 1ZYSA 3DA6A 3FUPA 5IQDA 3PJ8A 3AD4A 4M13A 1FMKA 1UU7A 5HIBA 5KMNA 3L9PA 3O8TA 3ZEPA 1KOAA 2PVYA 2F2UA 4DBNA 3WYYA 4JIKA 4RIXA 3SC1A 2OXXA 2UZDA 4RC4A 4DHFA 4EHZA 2HWPA 2P4IA 2W1HA 4CFVA 4NU1A 3WZKA 5ANIA 4EZ5A 1FPUA 4YZNA 1PKDA 2R0IA 3PXFA 4I0TA 4AACA 4BCGA 4G6OA 2KULA 1YQJA 3FMDA 3HP5A 4X7QA 4QP2A 4M68A 4GT3A 2EB3A 2ZVAA 1DAYA 4ZTSA 4ZTHA 2XCKA 4FKTA 4X3JA 5CU6A 2XJ1A 1IRKA 1F0QA 3QRUA 4EHGA 2O3PA 3HGKA 4CMUA 4KSQA 4AW1A 1JSVA 2W1GA 2UZUE 3EQPA 2FVDA 3KXMA 1J1BA 4XG4A 3R9DA 3HEGA 2X4ZA 3GBZA 4EH8A 4WO5A 3BHUA 3DKCA 4MK0A 1UVRA 4HNIA 4JJRA 4RJ7A 1KV1A 5EOLA 1FQ1B 4RVTA 3IECA 4L68A 4MWIA 1OB3A 1BMKA 3EQBA 2XCHA 3OW4A 3NEWA 4BCOA 4E20A 5IQCA 2YM7A 4EHEA 3UQFA 3ACJA 1PMUA 3L9NA 3VIDA 4H39A 3FZSA 4RSSA 5KZ0A 4GKIA 3REPA 3IGOA 4D0XA 3UVQA 1NY3A 1JSTA 1XH8A 5DT3A 4MAOA 1UU3A 5ANEA 2PE1A 4IJPA 4CKJA 4YJPA 4DH8A 4YGAA 4ZJVA 5D7VA 2B55A 4JBVA 2YM3A 4IAYA 5HVJA 4ALVA 4AFJA 4IBMA 5G1XA 1VYZA 3G2FA 2W06A 4GMYA 3ZSIA 2OF2A 5F20A 2EXMA 4ANOA 3B8RA 4R7HA 4MF0A 5CQWA 4EOIA 4FTJA 2RFDA 4FL1A 3GEQA 3ROYA 2F4JA 3NWWA 4FV4A 4K8AA 3P1AA 2O8YA 3DAKA 5FTOA 5ITAA 3Q5IA 3KMUA 4BDIA 1GIIA 5LCKA 1X8BA 5DEYA 1L8TA 3A8WA 5EDPA 3QCXA 3AGMA 2PE2A 1R39A 3VF9A 4FTTA 4U9AA 3EOCA 5AR2A 4MQ1A 5HTCA 4NM0A 4RRVA 4CFFA 2YCFA 4HVHA 1WBVA 3KMWA 3VUGA 4XBUA 2ZV7A 3DKOA 2UVZA 3FZRA 3LFQA 2H96A 4MCVA 1ZYLA 3RPRA 3W2SA 4MBIA 3ZFMA 4HYIA 4E4XA 1KUTA 2HOGA 4C2WA 4BY9E 4DFUA 1H0VA 3N4TA 2GHGA 4JG6A 3T9IA 2CDZA 2C6LA 3MFSA 4L7SA 2ITUA 3A4PA 4MHAA 2P33A 2OXYA 4TT7A 3FEGA 2RL5A 2XK4A 3LFEA 4PDSA 4XG2A 3I1AA 4JQ7A 4W4VA 5KZIA 4DITA 4FK3A 5IQIA 3TJDA 3R8MA 3ATSA 3WILA 1XH9A 5KMIA 4DEDA 4D2TA 4HGLA 5C26A 2EB2A 4GU9A 5FTGA 5IA2A 2ZM4A 4AQCA 3CKXA 2ITWA 4KKEA 3Q9ZA 4IC7A 2C6MA 2OICA 4BIBA 3C4XA 5BVNA 1ERKA 4CG8A 4IAAA 4IMYA 4C3FA 3EFJA 3ZCLA 4AAAA 4EC9A 4E4NA 3E3PA 3V8TA 3QC4A 3CY2A 4O7LA 1V0OA 5DRDA 5BVEA 3SXFA 4CZTA 3HMIA 3P86A 1I09A 4AT3A 3F2RA 3BQRA 4AF3A 1QPEA 3F7ZA 3NAYA 3OC1A 3FPMA 5FEQA 4CTCA 4L3JA 2E9UA 4LL0A 4EUTA 4ZOGA 1W7HA 2JKKA 4B7TA 3LJ1A 3QLFA 4EC8A 2XA4A 3II5A 1Q61A 5BNJA 1WVXA 2ESMA 1JNKA 2QO7A 3EN7A 4DEEA 3LMHA 5JQ5A 3FZ1A 3PP0A 4DFZE 4OW8A 4F63A 4Y83A 2OWBA 2PUPA 1KE8A 4FOBA 3CGOA 4RJ5A 3QQHA 3FKOA 2ONLA 4HYUA 3WIKA 2HENA 3RHXA 3D14A 2OF4A 2Y0AA 4NYEA 3D5VA 3TUBA 2ZMDA 2WMWA 3FAAA 1OECA 3COHA 2VWYA 5FM2A 3RTPA 2HZIA 3N4UA 5HIEA 2B53A 3JY0A 4O7RA 3MH0A 4QYHA 3I79A 1WBSA 4BKYA 5L2TA 5DWRA 1YXSA 4FICA 4BGGA 5IEYA 5C1QB 4QTDA 3Q6UA 5C8MA 2CNUA 1RDQE 4FIGA 4J71A 3W18A 1FGIA 5IUGA 5IUHA 4G3DA 3UNKA 2QG7A 4BBMA 5KHXA 4EUUA 4JRNA 4HJOA 2XKEA 5HZNA 2WTKB 2YERA 4L6QA 1GNGA 5JZNA 4O7TA 1E9HA 3BYMA 2VRXA 4FT7A 4DLJA 4IVBA 4MD8E 1XHAA 1FBNA 1YW2A 3GNIB 5AWMA 4MKCA 4B8MA 3Q2MA 5CS6A 3F6XA 3EFLA 3VS7A 5E92A 5FUTA 4O0XA 2WXVA 2XK8A 3SOAA 4GL9A 3RALA 5LVMA 2HAKA 5EW8A 3H10A 3NIEA 3R7VA 5HGIA 5JMSA 2J7TA 3K5VA 3O0GA 3SRVA 3ZFYA 1KE5A 3MJ2A
chains in the Genus database with same CATH superfamily
2CCHA 3LXLA 2XAOA 1OPJA 4R3CA 3GC7A 5GNKA 3QKLA 3QXOA 2OO8X 4QYYA 5ANOA 5E4HA 1U54B 3NSZA 3WYXA 4IW0A 5E8TA 5A6OA 4QMUA 5KMOA 2XIXA 3FXXA 5AUTA 3A2CA 3V5LA 3S0OA 3FC1X 4YJVA 4ZXTA 2C5VA 4GH2A 2UVYA 4DEHA 2PZ5A 2CLXA 4FMQA 4C0TA 3AOXA 2DYLA 3BZ3A 3BWFA 4KA3A 1PHKA 4BCKA 3C5IA 4AFEA 3A7GA 4TYGA 3V51A 3GOKA 2J9MA 2Y6OA 5FBNC 4FZAB 4APPA 2A2AA 4EH2A 1FVRA 1PXMA 5DHJA 4FTAA 4GS6A 3EN6A 4KAOA 3BKBA 3EYHA 2RKUA 4ZLZA 3UP2A 3HDNA 4LRKA 3DFAA 4K0YA 1YXTA 4JIAA 3AKKA 4F7NA 4IZYA 1PW2A 4H58A 4RIWA 4QMNA 4WIHA 3JUHA 2WD1A 3RPVA 4ZZOA 5EYCA 5CSPA 1A48A 5BYLA 4HGSA 3BEGA 4AXEA 3LPBA 2QR8A 3DKGA 5ANJA 4PRJA 5KBQA 3VJOA 4OTDA 4XP3A 4QYEA 4DBXA 3L8XA 4O0YA 4UYAA 2GCDA 3KXNA 4XX9A 4YTIA 2UV2A 4DEBA 1BI7A 2I40A 3Q4CA 5JT2A 2ZJWA 3G6GA 3PXRA 4F99A 1Q97A 3ORLA 3DJ6A 1U59A 4OT5A 3LAUA 2CNVA 5L6WL 4BN1A 3CPCA 1QCFA 4E7WA 2BFYA 3E87A 4YUQA 5LVPA 2P2HA 2WEIA 2Z60A 2ITQA 3W10A 2FSTX 3CXWA 3GVUA 2ZDTA 2QU5A 4FKLA 5HO7A 5KNJA 2UW0A 2RSVA 5DT0A 3SD0A 2VZ6A 1J1CA 4P7EA 5A3XA 4H3PA 2C69A 5AR7A 4RFYA 4G2FA 2GNFA 3Q9WA 5HG5A 4QMOA 1WBNA 1G3NA 4JNWA 4U43A 4W8EA 2X9FA 4DHIB 5GINE 4I92A 5EYDA 3ORTA 1AQ1A 1UU9A 2R4BA 3NNUA 3PY0A 3R1NA 4QP3A 1ATPE 2A27A 5EM5A 3R1SA 5AR8A 2CN8A 3QTWA 3VBQA 3MIAA 4K33A 1H4LA 4MNEA 3BIZA 2BTRA 2OJJA 3EJ1A 3MFUA 4I23A 4RVKA 4E5BA 4F78A 2WB8A 4UBAA 3SHEA 4OTGA 3QX4A 4FVPA 1OM1A 4IB5A 5KMJA 2PVRA 4KWPA 4CQEA 2REIA 1TQMA 1Y6BA 1IR3A 1VEBA 1WCCA 3F3TA 3PYYA 4OGRA 4FZ6A 3RINA 4C62A 4PMTA 4NJDA 5AFVA 3F9NA 5FGKA 1QMZA 4ZJIA 5KMKA 3ELJA 4XUFA 3VQHA 5AEPA 4E1ZA 4HNFA 3QHWA 2C6KA 4EH4A 2WTKC 1YOLA 2X7GA 3IW4A 2R7IA 4L01A 5LMKC 4PWNA 3F69A 4FKVA 2OGVA 2WQNA 3R04A 4DEGA 5KHWA 5IA5A 4KIQA 1SM2A 3AC3A 2CN5A 3RZFA 1TZDA 2IZTA 2JLDA 4PDOA 5CEPA 3VQUA 5DH3A 4H1MA 4BKJA 4ASZA 4BIDA 2O64A 3MTFA 4QQJA 2WU7A 2P0CA 4ZSJA 5HOAA 3C4FA 5AIKA 4UALA 3NUNA 4NJ3A 3QZGA 5I0BA 3Q2JA 4IFGA 2OW3A 3TXOA 3F3ZA 5I9VA 3C13A 3EYGA 2YISA 2R7BA 3NNVA 5BYYA 4U6RA 3FYJX 2P55A 1H07A 2CPKE 3SLSA 3ZOSA 3U51A 4CCBA 5JH6A 4DHJA 4W4WA 2IJMA 2C5YA 2CGWA 3WE8A 3O7LB 3H9RA 4MH7A 3AT4A 5K4IA 3FSFA 4QMPA 5EI2A 4XG6A 3GU8A 4J97A 4ZLYA 3GCQA 4C3RA 4OBOA 3F88A 5HNIX 2QOHA 5DR2A 4UZHA 1RQQA 2BZIB 4B4LA 3DNEA 5HICA 3OWKA 3FLQA 5CU2A 4BF2A 5HLWA 4IEBA 1M7QA 3OXTA 4BHZA 4M0ZA 3EZVA 4QQ5A 4KNBA 4Y5HA 5EOBA 3OCSA 3O71A 3W0QA 5ETFA 4HZRA 2BAKA 4NCTC 1G8SA 4F9BA 3FI3A 3P4KA 3FI4A 2ETRA 3Q04A 3NUSA 4JRVA 4FUXA 4OBPA 4OTPA 4DGLC 3LQ8A 3P08A 4TRLA 3U4UA 1PMEA 5T68A 1ZMUA 3R9OA 4TZRA 3S4QA 4AOTA 1IA9A 4FV5A 2BHEA 4O38A 5D12A 1H01A 4PX6A 1P5EA 1FVTA 4IB0A 3W2PA 4PL5A 5DT4A 3ZLXA 2WIHA 1Q4LA 3UO5A 3VUKA 2F49A 3ZLYA 1PXNA 4BDAA 3QUEA 2DUVA 2QOOA 4D5KA 3CP9A 1NA7A 3V04A 4CV8A 2UZLA 5GZAA 2OIBA 4ITHA 4XV9A 5LWNA 3T8OA 3P7BA 3R7GA 4Y85A 4DT9A 2ZB0A 5CNOA 3IW5A 4D9TA 4AXDA 2XNGA 5HE2A 4N6ZA 4HGTA 1PXLA 1QPDA 2R5TA 3C0HA 2Y7JA 2W05A 5AR3A 3BYSA 2UW5A 4C38A 2XUUA 4O84A 5LXMA 3HMPA 3MWUA 4NTTA 2XEZA 1PXKA 4A9SA 5DLSA 1J7LA 3BLRA 4GG5A 4BDEA 3E62A 3FE3A 4RBLA 4UMTA 1XBAA 2V22A 2VO7A 4BCFA 1IAJA 4AQKA 4EQMA 2HW6A 3MA6A 3G51A 5AV0A 3ET7A 4PUZA 3TKHA 4HYHA 3M42A 3FMNA 2YN8A 3KVWA 4JI9A 4O4DA 3DPKA 1H08A 3DBDA 2W1CA 2IVUA 2UZTA 2X2MA 3PJ1A 4IHPA 4O0UA 3UTOA 4RX5A 3C4WA 3W16A 2GNLA 4BDBA 4WNPA 3KRWA 2ZMCA 1OBDA 5HKMA 5CSWA 3AC4A 3IPHA 2QNJA 3KMMA 1S9IA 1PY5A 4H1JA 5JGAA 3OCBA 2UW9A 1YDTE 4R5SA 1M7NA 3LCDA 3QD2B 3ZYAA 2VWVA 5K5XA 3E8DA 2YACA 5CNNA 4EZ7A 1M17A 4Z55A 2HCKA 3SGCA 5CI6A 4HCUA 5BVKA 3PPKA 4R77A 2R3GA 2C3JA 2ETMA 2QC6A 3HMMA 5HBEA 5C8NA 1ST4A 4D4VA 2CGXA 3ODYX 5IU2A 3AKLA 3QX2A 5EKOA 1MRVA 4QPMA 3HP2A 4MYGA 3TM0A 1UKIA 1E1VA 3O96A 3F5PA 3COIA 3A7FA 4O4FA 2OLCA 4KABA 3KY2A 4WD5A 4XV2A 4IX5A 5LCJA 4O0RA 1GY3A 4U0IA 1TKIA 3SVVA 4GIHA 2I1MA 3GB2A 4I6FA 1PYEA 4ZTRA 2AYPA 1U4DA 3UZRA 4DLIA 2JITA 4PP9A 1JKKA 1SVHA 2G9XA 5ANGA 1KE9A 4O91A 4PTCA 3V5JA 3WBLA 2GNGA 3LOKA 3C4EA 3ZUUA 2BAQA 4FTUA 1W83A 2EU9A 3F3VA 3FZTA 4LRJA 3VO3A 5BUJA 3PXYA 5J5TA 3NFGB 2QLQA 3D83A 4ONAA 4YHTA 2PVNA 3R1YA 2BZKB 5IQGA 2NRUA 1CKJA 1YXVA 4RFZA 3E8NA 1BLXA 2SRCA 3NUYA 1M52A 4C2VA 1PF8A 2OJFE 4C4GA 5K9IA 1YWVA 4IB3A 3F2AA 4JAJA 4C57A 2W9FB 3SX9A 2NYAA 4XG8A 4GFOA 4IM3A 4Q5EA 2XMYA 3BU5A 5CEQA 3ZTXA 4APCA 4EH6A 5EQPA 1R0EA 4K1BA 5KO1A 4PV0A 5E8XA 4D1XA 2UW8A 1W98A 4EH5A 4O0TA 3KXZA 2HK5A 4EORA 4GYGA 3R28A 4JG7A 4AOIA 5IA4A 1YI3A 5CX9A 1CKIA 4FT3A 4J7BA 3EQGA 3PWDA 4A4LA 4FIFA 3C1XA 2GSFA 4X6QC 5CT0A 3TNIA 5JRSA 4BR3A 3E92A 4RWIA 4EZ3A 4IVAA 5HU3A 4DCEA 4BC6A 4N57A 4ZTLA 2QKRA 3GCSA 4A9RA 3QRKA 2FSOX 2QHNA 1WVYA 4I0RA 4X21A 2Y4IB 3TG1A 1TFFA 3SV0A 3PVUA 3C0GA 4FTNA 4K77A 3LFDA 3NCGA 2WMBA 3R71A 4IC8A 4L52A 2W1EA 1ZOEA 2FB8A 3WF9A 3LCTA 2YIWA 4RWJA 3R9HA 1JVPP 4I1ZA 1JKLA 3GP0A 3NYVA 2CGVA 4TKSA 3MVMA 5CENA 3VBYA 4AGUA 4YP8A 3PFQA 2JC6A 2R3IA 5CSHA 5HTIA 4O7SA 4IQ6A 4GVJA 5DYJA 3LIJA 5EFQA 4NW5A 2CMWA 1JPAA 5HE3A 5AIRA 4F7JA 3AC8A 2XKFA 3MV5A 3CSVA 2B54A 4YZMA 5AM6A 4BTMA 4ZP5A 2BZHB 3OEZA 4JG8A 3D5UA 4ANQA 5DGZA 4RIWB 1NXKA 2OH4A 3VVHA 3L8VA 3VWAA 4FBXA 3BYUA 4QMWA 2X6DA 3UOJA 2B4SB 4LUDA 4J53A 3GU5A 3UBDA 4G9CA 4RQVA 2C3KA 5GZ9A 4YPDA 3ZEWA 1BYGA 1R78A 2YCRA 3SG8A 4W9WA 4AT4A 4DEAA 3R0TA 4FC0A 4FT5A 4EOOA 1GOLA 2VAGA 4D9UA 2YABA 2BDWA 3ERKA 2R3MA 2C4GA 4ZSAA 1UWJA 3QZFA 4L42A 3P9JA 2VU3A 1YHSA 4BB4A 2PPQA 5E8ZA 4MWHA 1STCE 2HIWA 5HG7A 5C01A 3LQ5A 4I6QA 4AZVA 3ZRLA 4QP1A 3DQWA 1P14A 1TVOA 3NCZA 1ZYDA 2Q0NA 4AUAA 2DWBA 4AS0A 2PMOX 3D7ZA 3ZSGA 5CAVA 3FKLA 5B2KA 3UO6A 3TIZA 3MBLA 4BGQA 3H30A 3IW6A 4ZLOA 3C0IA 1DM2A 3ZO1A 4BICA 1R1WA 3EKKA 4FKIA 4A7CA 3TDWA 2OJIA 3ZHPC 4QDVA 2V7OA 2OJGA 3IOKA 4FZFB 3UZPA 3W32A 4O82A 3W8LA 5CASA 2UZOA 4B8LA 5J1VA 4I41A 3VS5A 4QTCA 3HMOA 4AN9A 5ICPA 1UU8A 3Q53A 3QXPA 5HBHA 3I0QA 3S2PA 3PXKA 4QMZA 3CS9A 3T3UA 2XYNA 3A61A 3VNTA 4USEA 2YAAA 4I4FA 4WSQA 5HD4A 2JBOA 3CTQA 2O63A 3KA0A 1NVRA 2HXQA 4LMUA 3CBLA 2HY0A 3NDMA 4FTQA 4FOCA 4NUSA 3MVJA 4QYFA 4WNKA 5BUEA 1LPUA 4LRMA 2I7QA 3LE6A 4I93A 4UMQA 5AP3A 5M44A 4OTRA 1RE8A 2JBPA 4CCUA 1YDRE 4LG4A 1OKWA 4J1RA 4ANBA 2W1FA 4JR7A 3LFFA 4U8ZA 3PA3A 5C8KA 1GAGA 3HKOA 4RC2A 3NW7A 5H3QA 5ACKA 2X0QA 3QTZA 4OTWA 1HCLA 1SZMA 3QTXA 2XBAA 4LFIA 3ZC6A 5JN2A 3LZBA 3R02A 2C1BA 4M97A 1GJOA 4W4YA 4F1MA 3I6UA 3CQUA 5HESA 5CZIA 4UN0C 3UDSA 3TDVA 4G3FA 5I5ZA 2X2LA 4IX4A 5JZJA 5HI2A 4UMUA 4PPAA 4GK4A 2C0IA 3NUPA 4BZNA 1DI9A 5BVOA 5IQAA 4AG8A 2ITPA 2WQOA 3KVXA 3PVWA 1Z57A 1LP4A 4MQ2A 4Y46A 4F4PA 4MXOA 2V55A 3CGFA 4I20A 1JKTA 4DDIA 4A9TA 4ENYA 2VTAA 4R1YA 4X2JA 3I6WA 3I0OA 2PZIA 3ENHA 4LM5A 4IZ7A 2XJ0A 3OCGA 1H27A 5DOSA 4OT6A 4GJ3A 3NUUA 4LL5A 1ZARA 2NNWB 4GSBA 5EYMA 4DT8A 4YC8A 5CI7A 3MI9A 2Y4IC 2R2PA 4BDKA 4PP7A 3MY0A 1Q41A 3I4BA 1CDKA 1T46A 2YFXA 2OBJA 2PWLA 5DIAA 4FSQA 4D55A 2FSLX 4QP4A 3NVMB 5FBOA 3BEAA 3UC3A 4YC3A 3VS1A 4RJ4A 4FI1A 3VJNA 4ZTNA 2R3KA 4QMTA 3FDNA 3RBWA 5DVRA 4CLJA 3OWLA 3PXQA 4L8MA 3AD6A 3O2MA 4OR5A 5J7BA 4XP0A 4JX3A 1Q99A 1ZLTA 5IA3A 3KF7A 4L43A 4G3CA 4CMOA 2YWVA 2WTIA 3F5UA 4E4LA 3EIDA 3F61A 2BFXA 1TQPA 2BKZA 2RFSA 2X39A 4FKGA 2VGOA 2P2IA 4M66A 3OXZA 4WUNA 4Y95A 3VUMA 4IANA 4FODA 5IEXA 1Q8WA 5EI8A 3W2CA 4FV3A 5ETAA 3ZSHA 4P4CA 5E1EA 2J0KA 4EOMA 1ZOGA 2QO2A 2YWPA 3BQCA 5DG5A 5I3OA 1P2AA 3DLZA 4DDGA 2JDVA 5TT7A 2LAVA 1ZY5A 3IOPA 2UW4A 4RIYA 5D11A 4AOJA 4ZZNA 5C27A 2PYWA 3BYVA 1MQ4A 2JAMA 3D5XA 3EKNA 5GJFA 3KK9A 5FXQA 4J96A 4DH1A 4QD6A 2WMQA 3FZPA 3FHRA 1DAWA 3Q60A 3O8PA 2GQSA 3TV4A 4OAUC 3HVCA 2E9OA 2JFMA 3OTVA 4NKAA 3GC9A 3NYNA 2E9NA 3OBGA 3LMGA 5CLPA 4YZDA 2R3LA 3OOMA 4TWOA 4FYNA 4BKZA 4O7ZA 2BROA 5IA0A 2GFCA 3L8SA 5CEKA 4QMVA 2YJRA 2BMCA 2W7XA 4X6RA 4EQCA 3LCOA 4GJ2A 1IEPA 3PVGA 3FLWA 4X2KA 3RPOA 2F9GA 3KULB 4EK3A 3FZOA 5EQEA 3IKAA 5EW9A 4CQGA 4E5AX 4V0GA 3RM7A 3V8WA 4O7WA 2C30A 2NP8A 3DK7A 2YDIA 3QQGA 3UZTA 3OF0A 4BWKA 3ORIA 1H26A 2BHHA 3AXWA 4PTGA 4EH9A 3I5ZA 3DKFA 3HECA 4I0SA 5I9ZA 3PXZA 3PY1A 1KWPA 3VBXA 5IQHA 5LMBA 3BE2A 5AJQA 4C02A 2X4FA 4FL2A 4AU8A 2W9ZB 1W8CA 4CFWA 2WZJA 4WNOA 4HPTE 5I9XA 5J1WA 2BIKB 2NRYA 4KRDA 4RG0A 3E7VA 4TNBA 4YSMA 3P7AA 5DE2A 3RPYA 3TZ9A 3CD3A 2BILB 3MPMA 4NFNA 2GTMA 3C5UA 1SVEA 4DGOA 1Z9XA 1OMWA 4YO6A 3RHKA 4QPAA 4FVRA 5F1ZA 4I94A 4FKJA 3ZXTA 4JLCA 3ZRKA 3WF8A 4C4HA 1Q62A 4AE6A 3QD3A 3G90X 3VUDA 3TI1A 5CF6A 3HUCA 4I22A 3PE1A 5EW3A 3ALOA 4AZWA 1YKRA 3EHAA 1MUOA 2C5NA 3AD5A 4YLLA 2VO6A 3DBEA 4HVDA 4C61A 1H0WA 2C0TA 4O4EA 3IQ7A 2BZJA 2WTVA 3MPTA 4WRGA 4XEYA 5DBXA 3TKIA 3VRZA 4DFXE 4QRCA 2VTRA 2VWXA 1V1KA 4O86A 5TOZA 3JVRA 3JPVA 5AUWA 1UA2A 5JFWA 1F5QA 2PTKA 3E88A 4JBQA 4BDFA 5M4CA 4AE9A 4G3GA 4FTLA 3ZBFA 4YR8A 5KCVA 4ZEGA 4ZK5A 4AA0A 1XQZA 2XIZA 4AWIA 2XM9A 4TWNA 5CXZA 1M2QA 3GU4A 3BHHA 3EMGA 4YZBA 4Z7HA 2C0OA 5JKGA 2VO3A 5M06A 3U4WA 4D2PA 4GFGA 4FTOA 5HBJA 4IAFA 3BWJA 2GS6A 2YCQA 4ENXA 3QQUA 3LLAA 2E9PA 3MPAA 3CEKA 3VN9A 1FVVA 4ZMFA 4IM0A 3RVGA 2JKMA 3QRIA 3VUTA 3ZU7A 1S9JA 2FO0A 1OVEA 4J95A 2J2IB 2QODA 3UYSA 4M12A 3R01A 3W0PA 4EQUA 5CALA 1GZKA 5BYZA 4AP7A 3R7YA 3PIXA 1R0PA 3JY9A 4OLIA 3CR0A 5CF4A 5EH0A 1XMMA 2GQGA 3E3BX 5AV4A 3R63A 3TEIA 4EBWA 5HX8A 3UYTA 2ITNA 1KSWA 2JEDA 1XBBA 1Y57A 4L7FA 2C3LA 2YM4A 3FQEA 4XG7A 4DFNA 4V04A 4O2ZA 4CNHA 2X7OA 4LQMA 1OUYA 1ZAOA 3DTCA 3P23A 4WUAA 3WZUA 2Y6MA 2O65A 2B0QA 2R3NA 5A46A 3OCTA 3CJFA 4QMLA 5IQEA 3QQJA 2I0HA 2XM8A 4UXLA 4BCHA 4QP7A 4DA5A 4MXCA 5H9BA 2WOTA 3UG1A 4JL9A 4YJSA 4XOZA 1V0PA 4BWXA 3OY1A 5LJJA 5HG8A 3PLSA 2YIQA 3UG2A 4FSTA 3ORKA 2XK7A 3TZ8A 4D1SA 4KBAA 3KRRA 3RPSA 2PU8A 3BLAA 5IG1A 4NTSA 2F7XE 5EM7A 2WMRA 4M14A 1H1SA 4PNKA 1JLUE 3ZBXA 3PRIA 3ZZEA 3FYKX 2QR7A 5AV2A 1FMOE 4EKKA 5I3RA 5FM3A 5E8YA 4QMSA 5A9UA 4KD1A 2ZM3A 3M1SA 4MXXA 4I6LA 2VTOA 5JGDA 3BHYA 5CSVA 3DAJA 4C4JA 3ORPA 2H34A 3FXWA 2VTSA 4IDTA 2C6TA 4KKHA 2OFVA 3ZO2A 4FVQA 3DDPA 1PXOA 4PPBA 3RZBA 4R1VA 5M4IA 2Q83A 4PMMA 4O6EA 5IDNA 4ACGA 4Q9ZA 4MEDA 4I6BA 5J87A 3EN5A 2BRHA 4BZDA 1Q3DA 3OFMA 3QF9A 4XHKB 5A4QA 4HVGA 3QKMA 3KKVA 3QU0A 1M2RA 2VO0A 3CTHA 4O4BB 3QGYA 3SKCA 4DN5A 5IPJA 3EFWA 2BUJA 5L3AA 2NPQA 3AT3A 4DH3A 1W2CA 2XIYA 1APME 3KN6A 4Y72A 4UZDA 3TZMA 4BYIA 4BWPA 4RA5A 4DFYA 4E73A 1OUKA 4IWPA 2QHMA 4L67A 3POOA 4FG8A 4NIFA 4XOYA 4QTAA 4E8AA 1GZNA 2IVTA 2VUWA 3KGAA 3IS5A 4N6YA 4GVAA 3W2RA 5AR4A 3EB0A 3HV3A 3TN8A 2Z8CA 4OAVB 4TY1A 4WNMA 3W0OA 3R22A 4NH1A 1B38A 2CSNA 2IW8A 3L8PA 3ZLWA 3AMYA 5JQ8A 1YOJA 4GG7A 3A60A 3FI2A 3PE2A 4YJTA 2XRUA 3AG9A 1PMNA 4I24A 3LJ2A 3PFYA 3D9VA 5LVOA 1WFCA 2WKMA 4FV8A 4O1OA 1K9AA 3D0EA 4G34A 5AX9A 4EKLA 4ORKA 1ZMWA 5E8WA 4W8DA 4FKSA 3IDCA 4QMMA 4UMPA 3F3UA 1JBPE 2QU6A 3EZRA 1YVJA 3CPBA 3FLZA 3IG7A 5AP1A 5L8JA 3SW4A 4IX3A 4R7IA 4D2WA 5CU4A 1MQBA 5F4NA 5K3YA 2GHLA 4C37A 2BAJA 2V5QA 4U40A 1MRUA 2WGJA 3R7EA 1CM8A 4HYSA 3DQXA 1B39A 4ALWA 2PY3A 4RLKA 4F7LA 3UDBA 3PJCA 2A4LA 4WG3A 2WU6A 1OIRA 2J5EA 1ZWSA 1CSNA 3ENMA 4B6LA 3RNIA 3ORZA 4XH6A 2B9JA 2VD5A 2YJSA 4ACCA 4F1TA 2GS2A 4W4XA 1GIHA 2WMXA 3ORNA 5J7HA 3DK6A 4RIXB 5M4FA 3CQEA 5B7VA 3O51A 2X9EA 3ORMA 5CZHA 2OZAA 4AA5A 4BI2A 5AP6A 5A4EA 3K3IA 3VS3A 4UWYA 3LXNA 4D4YA 3BGPA 1IA8A 3CCNA 4MVFA 2JDRA 4DG2E 4AA4A 3WZEA 4MXZA 4CEGA 1Y6AA 4QOXA 1G5SA 3PIZA 4H3QA 3EQCA 2H8HA 2Z2WA 4U41A 4U42A 5L2QA 4ZAUA 3K5UA 5DRBA 2UZWE 3OBJA 4H3BA 2WTJA 3PG3A 4G5PA 4U97A 2XNPA 2X0GA 3LCSA 5LARA 4TYHA 5M08A 2XKDA 3V3VA 1E1XA 4FNZA 4GT4A 5CY3A 2HZ0A 2VTHA 4FV2A 3L9MA 5BMMA 2PULA 3AMBA 3C7QA 2PMLX 2C68A 4BCNA 1PJKA 4DTAA 4WG4A 3U87A 4KIOA 3PTGA 5HVYA 3QTRA 3VBTA 3DOGA 5E8VA 3ZS5A 3KFAA 3W0NA 4P5ZA 5AP0A 4FG7A 1QPJA 3QTQA 3QALE 4LOOA 3G9NA 4RA4A 5GZ8A 4IWQA 2OKRA 3GU6A 5AUVA 3WIGA 5K0XA 2JFLA 3BHVA 5AX3A 3F82A 4F6UA 4YZ9A 1OIUA 2H6DA 2IZRA 2WQEA 4IWDA 5AUZA 5JEBA 1ZY4A 4B9DA 3VUIA 4C4IA 4F0GA 2CKPA 2J50A 3EQDA 3V5QA 2WELA 4YZCA 2J51A 2UUEA 4YJQA 2Z02A 3U6JA 1YXUA 1J3HA 2I0YA 5CANA 3OD6X 4CGAA 3BGQA 4RJ8A 5HCXA 3PVBA 5HLNA 5FEEA 3K2LA 5CYIA 4RZVA 4DYMA 2VV9A 3QAME 4MTAA 3SA0A 4BJJB 4ZMEA 2ERZE 4CD0A 4MD7E 5LVLA 4E93A 3BBWA 4C7TA 1HCKA 2ZYBA 3GENA 5DN3A 4AN3A 3V8SA 4PQNA 4DINA 5KUPA 1ZXEA 4GCJA 4UWBA 3RK5A 5L6PA 3FBVA 4V0GB 4C59A 4JDJA 2NO3A 4GYIA 4ITIA 4XBRA 4G31A 4LOQA 4QTBA 1TQIA 4YPSA 4ZY4A 3U9NA 2ZOQA 2ZV2A 3FMMA 4YHFA 5A4TA 4ANLA 4UX9A 3LHJA 1Y8YA 2VWBA 3LLTA 4BRXA 4X2NA 3MY1A 3A99A 4BVUA 4F70A 4K6ZA 4NL0A 5D10A 3UDZA 4MBLA 3MS9A 3HLLA 4IDVA 4IH8A 2XNOA 2PUIA 4FL3A 5CSXA 4BGHA 2XK9A 4IAKA 3WARA 4G1WA 4WHZA 4EHVA 3QD0A 3ULZA 4ID7A 3W2OA 4O96A 5FRIA 4ZJJA 4FSWA 4BL1A 5BVDA 5BPYA 5M57A 3OXIA 5AV1A 4F6WA 2X7FA 3TCPA 4ITJA 2X81A 2FGIA 3HV5A 2AC3A 1DS5A 4JBOA 5H2UA 3R7UA 4BCJA 4QMQA 2PVJA 4M8TA 5LVNA 5JFSA 1XH6A 3VS4A 4HZSA 2G01A 4F6SA 2CKQA 3RCDA 4OUCA 3D7TA 4G6LA 3HAMA 2O0UA 5ANKA 3BELA 3TV7A 3TTIA 4FEWA 4USDA 4YLKA 2VX1A 2YIRA 5F94A 2P3GX 1OL5A 2VN9A 4K9YA 1WMKA 2W4JA 4RWLA 4EK8A 5ETCA 4USFA 3ML1A 3R9RA 1XWSA 3QD4A 4Q9SA 4G17A 3W0SA 3GCPA 2WHBA 2R3FA 3DS6A 4BTKA 4JDIA 5FXRA 3O5AA 3RAKA 3HAVA 1WVWA 2X8DA 3CD8A 4JAIA 2B9IA 4ZY5A 2YLFA 3ZM4A 2CNQA 4YO4A 3KRLA 5CF8A 2GNIA 1YHWA 4Q2AA 2PVLA 2XNMA 4L44A 1VYWA 3H3CA 3H0ZA 1W82A 1DI8A 4XNEA 4FSYA 3F3WA 3G0EA 3KCFA 4KS7A 4RX8A 5GHVA 3W2QA 3BRBA 4DFLA 4D4RA 3I7BA 5J9ZA 5IH6A 4QO9A 4YTFA 2VNYA 4R3PA 4AXFA 4UXQA 2ITTA 1VLRA 4FV9A 5FP6A 1KE6A 3VULA 3R9NA 4WBOA 4QNYA 3NX8A 1NVSA 4MXAA 3ZH8A 4A06A 2JAVA 2IZUA 4EJ7A 3POZA 2B7AA 4I5PA 4EYJA 1OIYA 2RFEA 2EXEA 4QT1A 2JDOA 5DA3A 4QQTA 5J9YA 2HYYA 4U3YA 4IFCA 1RW8A 4FV0A 3N9XA 3TKUA 3ZUVA 2IWIA 3RWQA 3O7LD 5E90A 2BVAA 5L2IA 3D2IA 2YCSA 1SMHA 3RAIA 3P0MA 4LYNA 3QZHA 4AXCA 4CLIA 2UVXA 4NW6A 4AZEA 4D5HA 4DG3E 4TYJA 5IA1A 2ZV9A 3Q96A 2ETKA 3IK3A 3NYOA 5CVHA 3A7IA 3LM5A 4PDPA 4YTCA 4X2FA 4O21A 3FPQA 5FDPA 2OJ9A 4K18A 3SRVB 4NSTA 4S34A 4O27B 5HLPA 3S00A 3DNDA 2AC5A 1YWRA 3ZM9A 2ZAZA 1JSUA 1O6LA 3ETAA 1A9UA 4GFMA 1WZYA 1PKGA 4LMNA 1ZYCA 4I21A 1OPKA 3AC2A 3KXXA 4GW8A 3R7IA 4IVDA 4UV0A 1QL6A 4LDTA 4RZWA 4FYOA 5H8EA 2HELA 4FGBA 4CFUA 3G9LX 3DBFA 3C4CA 2CGUA 3RKBA 1IAHA 5A4CA 4ASDA