5I0BA

Structure of pak4
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
289
structure length
288
Chain Sequence
HEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PAK 4
publication title The discovery and the structural basis of an imidazo[4,5-b]pyridine-based p21-activated kinase 4 inhibitor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inihibitor
total genus 79
structure length 288
sequence length 289
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5i0bA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5i0bA01
5A6OA 2YZAA 4EJNA 3WZEA 2W1HA 1V0BA 4UWCA 4EK6A 3LZBA 5GINE 5EW9A 2ZMCA 3MY5A 5DYJA 2R3NA 3W32A 3DLZA 5LMBA 1XQZA 5H8BA 4DH5A 2J0MB 2RFDA 5BNJA 2B4SB 4FV6A 5JGBA 3SGCA 4ZMFA 4PY1A 3HA6A 4FK3A 2GHMA 2X8IA 3OROA 2E2BA 3A4PA 5HBEA 3DTWA 4IEBA 4OTIA 5AM7A 5DR9A 3UIUA 4BCQA 1SZMA 4U45A 3SDJA 3ZDUA 4UWBA 1LP4A 3QX2A 3TACA 3GC9A 4G31A 4OTDA 3R6XA 2XK3A 3C9WA 1HCKA 1DAWA 3DBDA 4KRDA 2OI4X 5AR5A 5C8MA 3RBWA 4CYIA 2ITVA 4DFNA 4QT1A 4ZZNA 2EVAA 4L9IA 1WBTA 2ETRA 1KE5A 3HDMA 3AC4A 3HV5A 4WNKA 1CKJA 1H01A 3WF7A 4B6LA 3B8QA 4D4RA 5BVDA 4N4SA 2C5VA 4DGNA 1LPUA 4TYHB 3VVHA 2JKQA 1SYKA 3LCSA 4YLLA 3SC1A 2QOQA 5HEZA 4XRJA 3RCDA 4CG9A 4CNHA 3QLGA 4LMNA 4X3FA 4IAYA 5FP5A 4NTTA 4RA5A 4YZ9A 3MY0A 4I5CA 5M4CA 2JGZA 4I5PA 2XBJA 4AACA 4C2WA 3KU2A 2VTHA 2FH9A 1MUOA 3EN5A 3MH0A 1NW1A 5C8NA 1H07A 1YDTE 3U87A 4AW0A 4F6UA 4MH7A 4RJ7A 5E1SA 3EN6A 3ORKA 3FLNC 2OW3A 4M69A 3DBQA 3R8UA 3HRCA 5CU4A 3ALNA 1KSWA 2PMLX 5B2LA 3OTUA 4O7WA 1M2QA 4A4LA 5FBNC 4PL5A 5M06A 1CMKE 3FLSA 3NNUA 1IA8A 4O0TA 4F64A 4FT0A 4JG8A 3QGWA 1OITA 4D1ZA 2AUHA 2YWVA 5A14A 4TXCA 4LV5A 5AP4A 4AN3A 2JBPA 3H0ZA 2O63A 4FT5A 4IWPA 3KXXA 3LFEA 5M53A 1LEZA 1PXPA 2YFXA 4IM3A 4BCIA 1W8CA 1K3AA 2BFYA 4QMYA 4UALA 2ITOA 2W4JA 5KMIA 5JMSA 4Y5QA 3GCPA 1MQBA 4RX5A 2IWIA 4XX9A 2BRHA 2GNJA 4O86A 2B9IA 4W8EA 3COIA 5A4TA 5KNJA 3Q6WA 2YLFA 1KE6A 2ZB1A 3BCEA 1MP8A 2X8EA 3L9PA 3QAME 5H8GA 4RC3A 4ZTNA 3U8WA 4CV8A 5CAOA 5CSHA 3Q9YA 4FVPA 3Q3BA 3R7IA 3G0FA 4I1ZA 1OL5A 3F9NA 2EU9A 2WD1A 4TWCA 3IQ7A 5I9XA 4EOIA 5IPJA 3K2LA 3VUGA 4BKYA 4XLVA 2HY0A 1XH8A 3PXQA 4GK4A 4EH3A 5EI8A 4HGLA 4K77A 2JDRA 4CGAA 2YM5A 4ANMA 3DTCA 4O6LA 2VTQA 4DC2A 2C5YA 3NPCA 4FL2A 4D28A 3RM6A 4RJ6A 2Q0BA 2HK5A 4HVDA 3GCQA 4QMMA 3K5UA 3B2WA 2KTYA 3QLFA 3QD4A 1CKPA 2O5KA 4A9TA 4ONAA 4L53A 4C4HA 3BYMA 2W0JA 2ERZE 2HIWA 2JLDA 4CFUA 5DT4A 3R71A 4D5HA 4F1MA 5J5SA 4KINA 5TT7A 5AV1A 3S95A 3QQKA 2V62A 3ID6C 4QMWA 1ERKA 5H2UA 1YXUA 1GIIA 2GQGA 2BZHB 2XH5A 2BFXA 3RPOA 5L4QA 4O2PA 1ZWSA 3T8OA 4BDJA 1OL7A 3KXZA 4MQ1A 4MHAA 1JAMA 1OL1A 3I5ZA 5AUYA 4EH5A 4EH6A 2QG7A 3F66A 5CZHA 4EOMA 3OCSA 4DG3E 5GJDA 1Q24A 5FRIA 5IUIA 4AT3A 2PYWA 3NX8A 2IVVA 3RI1A 4HPTE 3D2IA 4F9WA 5HQ0A 2YWPA 3KMUA 4YLKA 2O64A 1KE9A 4RJ3A 4GU9A 4UYAA 3HVCA 3R9HA 4FTLA 3P08A 4KIKA 5M56A 4MX9A 3SA0A 5C03A 2HZIA 3HGKA 5DFPA 1XH4A 4BDEA 2X8DA 2WIHA 5IMEA 3F2NA 3FE3A 1YWVA 3MH2A 2OFVA 4U42A 3L9NA 1P14A 2BCJA 4M13A 4TT7A 1URCA 4D2WA 5D10A 1RDQE 3F2RA 3S2PA 3ULIA 4KA3A 1Y8GA 2QVSE 3LCDA 5HU9A 4YC8A 4FKVA 4TYGA 5BVFA 1BYGA 4FR4A 3O7LB 4MNEB 5I9UA 4GUEA 2WO6A 1BL7A 4D55A 4YPDA 3FMDA 2OJJA 2C3JA 4MXZA 3ZLXA 3ZH8A 1STCE 3CD3A 3DJ5A 3FMMA 5DR6A 2C6MA 3KEXA 4HVIA 5CALA 4C4GA 3MVLA 3U6HA 1G5SA 4RQKA 5FXRA 5IQDA 4BVUA 3VBVA 4LL0A 4C4FA 3TWJA 5JFVA 2BIKB 4TWPA 2JFMA 2GNGA 3BU6A 4X2GA 5EYMA 3KKVA 1UVRA 1PW2A 4ANOA 4FTUA 3QYZA 2BAQA 3K54A 4ASDA 4Q5HA 1H28A 2BUJA 2WTVA 3A4OX 4UXLA 5TE0A 5FTGA 4WHZA 3SRVA 4R3PA 1KOBA 2DWBA 2HWPA 3O51A 3H4JA 2C3LA 4LOOA 5EYDA 2VX1A 1T45A 2P0CA 4YTCA 1F3MC 3CQWA 2A0CX 3VS3A 1J7UA 2X9EA 2GSFA 2VTTA 3RAKA 4FT9A 4GS6A 5JQ5A 4IAKA 4FYOA 4I6QA 2I0YA 1ZY4A 2V55A 1OMWA 4KIOA 2E9PA 3DKOA 3MFTA 3FLWA 4GVAA 5T3QA 4AFEA 4WG3A 4BL1A 4DA5A 1KOAA 4FIIA 2CLQA 3RGFA 1PMVA 1RW8A 3G6HA 2C6EA 3RAHA 1M14A 3ORZA 4DT8A 5JFSA 1DI8A 1RQQA 1NY3A 4Z9LA 2EUFB 3MV5A 4FIHA 5AM6A 2G2HA 2YM6A 3RWQA 4BKZA 4WIHA 4NT4A 4NZWB 3KL8A 4UEUA 4H3PA 2PZ5A 4MKCA 4C3FA 4QD6A 5IA1A 4BWXA 3GQIA 2PUIA 5J7BA 3KMWA 4ERKA 2VWVA 4ZZOA 3U9NA 4FMQA 4GFGA 2GCDA 4IWOA 3P7BA 1J1BA 4QO9A 3ZU7A 4O7VA 3R9OA 1Q3DA 2EXMA 4F7LA 4E93A 2H34A 3O8UA 3ZZWA 4EHGA 1H00A 3O8PA 1WBOA 4IFGA 4PDYA 3TT0A 2OJGA 4I4EA 2BZIB 3ROYA 1YW2A 4DCEA 2IJMA 4QMOA 4XV3A 4PF4A 5BYLA 3C4XA 3O7LD 1ZYJA 3ELJA 1OM1A 3JS2A 3LLTA 3PZHA 3BI6A 2WQOA 4OBQA 5LMAA 2R3HA 3V5JA 4ZY4A 3NVKI 3OCGA 3TL8A 5BVWA 5AR8A 1WVWA 4TYIA 1WVYA 2EB3A 4BGHA 3TDWA 5D11A 4OTFA 2ITQA 5M07A 3C0HA 5CSXA 4OAVB 3ZBXA 4UYNA 4EHVA 2C0TA 3DBCA 4S34A 4Q9SA 2CGVA 5HIBA 5A4EA 3QCXA 4M14A 4ACHA 5AA9A 4ZMEA 3LPBA 5EHLA 5E90A 2YITA 4CFFA 2QOCA 2QONA 5A9UA 3HV4A 2J50A 3DKFA 3UYSA 5CU3A 3V5LA 4N57A 1FBNA 5IA0A 1OKYA 5EQPA 5AR3A 4DTAA 2RKUA 3QZFA 1H1SA 5FTOA 3E8CA 5CI6A 4XLIA 3AC2A 1S9IA 5EM6A 4FUYA 2UW7A 5KHWA 4BIDA 4M0YA 2YISA 2YIXA 3W2RA 1V1KA 3LIJA 3WZDA 4AG8A 3VRYA 2C6KA 4FF8A 4GL9A 3GU7A 4D2VA 2BHHA 5CVFA 5GZAA 1WBPA 3V8SA 2QO9A 4ZY6A 2WMBA 4FA2A 2R0UA 3F3VA 5H3QA 4CCBA 5JK3A 4N0SA 5FQDC 1GZ8A 3E7OA 4B8LA 5BYYA 4M3QA 4A9UA 5BMSA 5LVPA 3QQGA 4ITIA 3IG7A 1ZY5A 4QYHA 4RIYB 3HP2A 2OH0E 4OTGA 4H1JA 3DFCB 4RA4A 4CRSA 4ITHA 4AGCA 4XEYA 1KE8A 3R8PA 4BYIA 2NO3A 4DN5A 2OH4A 3MBLA 4JLCA 3TV6A 3PDTA 3AC3A 2ZYBA 1B6CB 4CTCA 3GU8A 3ZZEA 3CD8A 2PVFA 3WE8A 2R3MA 5IUGA 2BMCA 3TKHA 1A9UA 4PPCA 2PVNA 3I60A 2Q0NA 3KVXA 3I4BA 3CSVA 2PMNX 5M08A 4D2RA 2I6LA 1NT2A 3QRKA 5DT0A 5ICPA 4CSVA 1U59A 4PMMA 2WTCA 2ITTA 1PJKA 4FTRA 4L45A 2CGXA 4TYHA 5LQFA 2WQNA 3FL4A 4TNBA 1JKLA 5ANEA 1BMKA 3FY0A 4WSYA 5KKRB 2CJMA 4CMTA 3PLSA 1REJA 4WNPA 4AA0A 3UNKA 4KKEA 4BR3A 2GPHA 4J7BA 5CYIA 3VF8A 4F7JA 2GTMA 5H8EA 4RGJA 4E7WA 3FKNA 4QP9A 3DK3A 3IOKA 4EYMA 4QNAA 5E9EA 4BYJA 3UDBA 3GVUA 1JOWB 3QQJA 2IW9A 3RHKA 4X7QA 5TR6A 4M8TA 3DXQA 4PMSA 2DS1A 3VS7A 3TIZA 1WAKA 2YCFA 3P1AA 3PG1A 5LWMA 1I09A 3MN3A 4QPSA 4ACMA 1R1WA 5E8UA 5EDQA 3ZYAA 4S33A 2PTKA 4FKGA 2XB7A 1UNGA 4HZSA 4Y5HA 5EDRA 3TN8A 3W33A 4ALUA 5A4LA 2PU8A 2R5TA 1JLUE 2WMWA 3FYJX 3OZ6A 4BRXA 2WZJA 3LJ2A 2VO0A 2JKOA 5HE1A 5HORA 3FPQA 3MPMA 4L44A 4EBWA 2C6LA 3KRXA 4F9BA 5LCJA 4ZSLA 2B52A 2ZV2A 3ORPA 4RSSA 2IVSA 3AC8A 3WI6A 2XK9A 5L8JA 2Y8OA 4MAOA 3FZTA 3F3UA 2G2IA 5CASA 2YCQA 4YTHA 3DT1A 3QTZA 4Y73A 2BRMA 2J51A 4I0SA 2PZPA 2QKRA 5BUEA 3DK7A 1ZARA 5J1VA 3EH9A 4G9RA 2PE1A 2VX0A 2XYUA 1UU7A 4LFIA 1PY5A 4NM3A 3TKIA 4WO5A 3FMJA 4LMUA 4AWIA 3GCUA 5HD4A 2XNPA 4L46A 4MF0A 2VTPA 3RHXA 4CZUA 3PIXA 3UP7A 3C4FA 4O0SA 3MESA 4JIKA 5J5TA 4R3CA 1A48A 1EH4A 2OJFE 2OF2A 5AR4A 3TZMA 5FDPA 4K9YA 4FE2A 5E91A 4IFCA 2KULA 3QF9A 4JT3A 5IA3A 2WMUA 4FV2A 2QLUA 4O81A 4I0RA 3LJ0A 3UBDA 1JKTA 4EWHA 3FYKX 1YHWA 2BRBA 2BTSA 4DH8A 3NUSA 2VWIA 4QPMA 4B8MA 5B2MA 3CTJA 5DT3A 4CCUA 4UMQA 2W05A 2WTDA 3FEGA 3CPCA 4D2PA 2UV2A 4D1SA 3V8TA 5DR2A 4EONA 3BGQA 4IACA 3FPMA 3ZSIA 3GB2A 4KBKA 1Q8UA 4CV9A 4HVHA 5JRQA 5E8SA 1WFCA 3ANQA 4KIQA 2IVTA 3TNWA 5LCKA 3MB7A 4TL0A 4CD0A 1WBVA 1ZXEA 1SVGA 2J0LA 3AT4A 3MVMA 3RK5A 2PUNA 2I0EA 3NR9A 4LV8A 2Y4IC 3V5PA 4A7CA 3SW4A 3VBQA 1FMKA 5IQCA 3C4CA 3OVVA 2UZEA 3GFEA 4I94A 4F0FA 4YHTA 1NVSA 4JDIA 4HPUE 4IWQA 3VNTA 4ZLYA 3A2CA 2W4KA 3L9MA 5KMOA 3TXOA 4HYSA 5KMKA 2GMXA 2R3GA 3OCBA 5HTIA 3VIDA 5LVMA 3JY9A 3S0OA 5DH3A 4BDKA 3D4QA 1XH9A 2R0IA 3FLYA 4M68A 3CPBA 4R7IA 3RALA 1YI4A 3PJ3A 4C4IA 4E5WA 5IEXA 3P7AA 4X2FA 3CC6A 4MXAA 5I4NA 2HZ0A 2XF0A 4FZAB 4DTKA 3TDVA 5AWMA 4D9TA 3UVPA 4FBXA 4HW7A 1H08A 5JSMA 5DIAA 5T6KA 5BVKA 4AOIA 2R64A 4QMPA 3GENA 5IQGA 4UX9A 4L6QA 4I23A 2H9VA 2VTJA 3ORIA 3HEGA 1UWJA 2ESMA 3C0IA 3IW6A 3JYAA 3LHJA 4GT5A 3OOGA 3R9DA 5B7VA 2I1MA 3MVJA 3ZM4A 4E6DA 2X7FA 4ZTMA 3GU4A 3R21A 4CKRA 4ZIMA 1OI9A 2RF9A 2ZDTA 5CAUA 4ORKA 5BUJA 3EOCA 3OHTA 4FI1A 4L01A 3V8WA 4NEUA 3PPKA 4NK9A 5EKOA 1R39A 4BI2A 4QNYA 5D7VA 2JD5A 2ZJWA 3JY0A 4MNFA 4G3DA 4MWHA 5J1WA 2PVLA 3C4WA 4XV2A 5IDNA 3CCNA 5D1JA 4CVAA 5AP1A 4G6LA 3B8RA 2ETMA 2Y6OA 2X1NA 4IB1A 4LGDA 3CY3A 3Q5IA 4NFNA 2BALA 3P78A 4W8DA 5AIKA 3ZLYA 4CLJA 3LFDA 2ITZA 4XCUA 3UZTA 3EFWA 4UMRA 4JX3A 3P7CA 3VUTA 3IW4A 4HNIA 5HCYA 3JVSA 4LRMA 4JX7A 5F20A 3VW6A 2PL0A 4G6OA 4NKSA 5ETCA 4S32A 5E7RA 2IZSA 1O6KA 3K3IA 1V0PA 2UZUE 3QKLA 1A06A 1O9UA 2CKQA 4EUTA 3P79A 4FSZA 3BHVA 4NSTA 4ARKA 5IH4A 3G15A 4FTTA 1YRPA 2FSLX 3PY0A 4U40A 2BZJA 3QD0A 2QO7A 2UZOA 3FQSA 2ACXA 4IQ6A 3AC5A 4E5AX 4FV7A 2E9UA 3QCYA 3M11A 4EKLA 5CAPA 2YHVA 4RZVA 3BHHA 2XKEA 3RZFA 3MH3A 4EQMA 4ANSA 5HTCA 3O96A 3ATTA 4BY9E 4B9DA 2I0VA 3PA4A 3E64A 1G8AA 5AP0A 4NIFB 4DEIA 5HZNA 4DGMA 3KRRA 4OBPA 2FA2A 4AE9A 5AP2A 4FIFA 3ULZA 4XS2A 4DTBA 4Q9ZA 3LOKA 1J7LA 4KWPA 5L6WL 3NMUF 1BX6A 4OTHA 2LAVA 1XH6A 4V05A 2X9FA 4FTOA 3C5IA 2WQBA 3BU5A 5B2KA 4EYJA 3UO6A 1JQHA 4GVJA 2WU7A 2HY81 3BE9A 4MWIA 1W0XC 2B9HA 4YU2A 3RTPA 4B0GA 2XEYA 3G0EA 5JZJA 1FINA 4DBNA 3Q4UA 5HBHA 3ZRLA 4EOSA 5AFVA 3LFCA 3VS5A 3PFQA 3F3WA 3Q52A 4JVGA 4CXAA 4W4XA 1KV2A 3EZRA 3DDPA 4FNXA 4GU6A 1J91A 4E4MA 5AEPA 4UZDA 5DNRA 1T46A 2YCRA 3NCZA 2BIYA 5AUZA 2J9MA 3Q9WA 5IG1A 3LKMA 1R0EA 4YBKA 4RX9A 2Y0AA 4GT3A 2XJ1A 2YIRA 4NFMA 3ZSGA 3T3VA 2VWXA 3GI3A 2PK9A 2VGPA 5D7AA 3OMVA 2Z02A 3FZOA 3TI1A 4R77A 1FVVA 3LXNA 3GU5A 4BTKA 2ZV7A 4DAWA 2HOGA 4QP8A 4EH4A 5IH6A 3CY2A 3HX4A 5CZIA 3NUXA 1JBPE 1Q8YA 3PJ2A 4FOBA 3Q6UA 3U4UA 1DM2A 4M12A 1ZZLA 3VF9A 4LYNA 4C2VA 4DFZE 1ZAOA 1SNUA 3MJ2A 3OW3A 3TV7A 4BCMA 5DGZA 1IEPA 3UQGA 2HXLA 4EOJA 2BZKB 4DGOA 2J5FA 5AAFA 3LFNA 4D2SA 4FZ6A 4EOKA 4WG4A 5ITAA 5E8ZA 4BTJA 4MXXA 1JNKA 2XK4A 4O1PA 4BC6A 3GXLA 4D4YA 3BLQA 5EDPA 1YVJA 4O0UA 4WT6A 4BHZA 2YERA 4DLIA 2PE0A 5GIOE 3PSCA 5KMMA 5DBXA 4D5KA 5JRSA 4FKRA 4KBAA 3F7ZA 3HRBA 3I5NA 5FXSA 1YDSE 1ZZ2A 2YM3A 4HCVA 4QMLA 4YTIA 3ZXTA 2B9JA 4IJ9A 5FDXA 5AUTA 4XBRA 2IO6A 2R3KA 4PDOA 4QTCA 4HYHA 4YO6A 1IASA 4P7EA 3EYGA 4IX4A 3LXKA 5F1ZA 2IW6A 2BROA 2CDZA 4FOCA 4R1VA 1PXKA 2PUPA 3FMHA 4E8AA 3Q4CA 3QWJA 3ZMMA 1V0OA 1PMEA 4G3CA 4DGLC 1YI3A 4AOTA 1XWSA 3QD3A 3T3UA 3KMMA 2GNFA 3KRWA 2OFUA 4IH8A 3D94A 4XV1A 3NEWA 3OY3A 2AC5A 1RJBA 2VNWA 4CT1A 2YJRA 3G51A 1L3RE 2YM4A 3ZUVA 3QRUA 2OIBA 3ZUTA 3UC4A 4IVDA 3LM5A 2QI8A 2OZOA 2GHLA 4NW5A 1JKSA 3ORTA 4AZTA 4OTQA 3AD5A 5M55A 5BVOA 4IZAA 1JVPP 2RFNA 4FL3A 5FM2A 2QOOA 3UQCA 1ZOHA 2Z7QA 4F7SA 2XK8A 2F7EE 2XK6A 3DKGA 3OWLA 3I6UA 4F9AA 2RSVA 4RWJA 5I9WA 3POOA 1RE8A 4DGGA 4NL0A 5AIRA 1PXNA 1HOWA 2OIQA 3U4WA 4YC6A 3NW5A 3EHAA 2WMQA 4HJOA 4HCUA 4FKTA 4QP3A 4XHKB 5EYKA 1JPAA 4YJPA 2PPQA 3A7IA 4IX5A 3LXLA 4CKJA 5JZNA 4CFMA 3R04A 5L2IA 5HX8A 2VD5A 2O65A 3QBNA 3TIYA 3VJOA 5C01A 2YDJA 3L8VA 1H1RA 1H25A 4IB0A 2FGIA 3QL8A 3IDPA 4LI5A 4QMSA 4YJSA 3EKNA 1U46A 5L6PA 4ZSGA 2Y6MA 4B4LA 1LEWA 3PRFA 2FSOX 4XP0A 2W06A 4JR7A 3OP5A 2R3QA 3R0TA 3RVGA 5KO1A 3CJFA 3EQDA 1O6YA 4YJVA 5HICA 1MQ4A 4AZVA 5EM5A 2VTSA 3UQFA 3E8DA 4L00A 3ZFMA 1E1VA 3AQVA 4G1WA 4KKHA 4BICA 3E5AA 2PWLA 4GRBA 3SAYA 1OKZA 4XG7A 3N4TA 5IF1A 4E6CA 4DYMA 4E1ZA 3QX4A 5FBOA 3CKWA 3KULA 3ORLA 5J9ZA 2A1AB 5GZ9A 4DE4A 2C6DA 3MS9A 4IAAA 2RFEA 3R1SA 1PXMA 4F6SA 3R7VA 3R8LA 3COHA 4QTAA 2XRWA 5C27A 3PVGA 5M44A 3BYSA 4I20A 4FTKA 4QP2A 3VUIA 4C3RA 4XUFA 3PE1A 4YGAA 4BDIA 5EM8A 1YXSA 2ZV8A 2X0GA 3DZOA 5E8XA 3V5QA 4F1OA 3P0MA 4IMYA 2JDOA 3LE6A 3OF0A 4W9WA 5FLFA 2CKEA 4AE6A 3KB7A 2UW6A 4AGDA 2R9SA 4IX3A 2CLXA 3FAAA 2C0OA 4R8QA 3PJCA 4BCOA 3KRJA 4RPVA 4FKJA 3OT3A 4RRVA 2VO7A 5FXQA 4FNYA 4YJUA 2ONLA 3RPYA 2ITNA 4IB5A 5CU2A 4EBVA 3ITZA 3NNXA 4BIBA 2P2IA 5E8TA 3SXRA 5DLSA 5FTQA 4IVAA 4NM5A 2OLCA 2P3GX 4ENXA 2QOHA 5DPVA 3L9LA 4E3CA 3VUKA 1Q3WA 2YAKA 4JQ8A 3R2BA 2VNYA 2X39A 2W9ZB 3UIBA 4M67A 2C69A 3PP1A 5HHWA 4BBFA 3BELA 2XNOA 2NRYA 3E3BX 4CZTA 2BDJA 2QKWB 3DLSA 4FSYA 4ZTRA 5AX9A 1Q62A 5AAGA 3DJ7A 4RJ5A 3UNZA 1APME 1ZYCA 4FV0A 3ACJA 2XIRA 2VO6A 1PHKA 4FTIA 3SQQA 4TNDA 1Q99A 2E9VA 4YSMA 3D0EA 5AX3A 2YA9A 3VBWA 5G1XA 3RMFA 1BLXA 3WZUA 4USDA 2BHEA 2W5HA 3UPXA 5L2SA 4YUQA 4OT5A 2Z7RA 2NP8A 5IH5A 3BRBA 5EYCA 3WYYA 2BDWA 4ZSEA 1CKIA 3QCQA 3UPZA 4FG9A 4YJQA 3LMGA 1GZNA 4FEVA 4KSPA 3M42A 4QMTA 1G8SA 3B2TA 5IU2A 4IM0A 5DA3A 2A27A 1SNXA 4LGGA 4LRJA 4MYGA 2VTAA 5AV3A 3TJDA 4O7LA 2UZLA 2ZV9A 2EB2A 3U55A 4U3YA 2W5BA 4FSRA 4ANLA 5CF4A 5E8WA 4DFUA 4FTMA 5CWZA 4A4XA 3FSKA 3MA3A 4GW8A 2UVZA 1H1PA 1OPLA 5I3OA 2CKOA 3WARA 4KS8A 5I9YA 3ZO4A 1OIUA 3ENHA 4CLIA 5K3YA 3SV0A 4YURA 3R7EA 1PXOA 5L8LA 3NW7A 4OT6A 4FEUA 4MD9E 3SW7A 4DFXE 1M7NA 4F7NA 1DS5A 2HCKA 2RG5A 1GJOA 4FTNA 4Q2AA 4C59A 4X3JA 3UC3A 3CP9A 4L42A 5L2WA 5A54A 2QCSA 4Y8DA 5HVJA 3TEIA 5CX9A 4QMNA 5HLWA 2JDVA 4USFA 4BDAA 2OU7A 3BQCA 3DB8A 3CXWA 2R3RA 5CNNA 4RIOA 3QRJA 5GIPE 4EOOA 4USEA 5L3AA 5AV2A 1KE7A 3KK8A 4UBAA 4FV9A 3WZJA 4EK3A 5DOSA 4FT7A 4PL4A 1UU8A 4G6NA 4IZ7A 3UOHA 4U41A 4HGEA 5CEOA 3TNHA 3SG8A 4RLKA 4APPA 3ZC5A 3KA0A 3A7JA 4GSBA 2R4BA 3A99A 2V5QA 2W4OA 3K5VA 5DWRA 2UW0A 3DQXA 5TKDA 4N6ZA 4U8ZA 3SG9A 1ZYDA 2PE2A 2WMXA 5DG5A 3F5PA 3RM7A 4TTHB 2PVJA 3IGOA 3NCGA 4ERWA 5HNBA 4I24A 5F4NA 3GC7A 4Z7HA 2WGJA 4RFYA 4F9YA 3UVRA 4DEGA 4MXOA 4PP7A 4FV5A 3RPRA 5A46A 3PPZA 1PKGA 4YZCA 3DJ6A 3SXSA 2HXQA 4FSNA 2A2AA 4XMOA 1QPCA 4JL9A 3BHUA 4JBPA 3U51A 4OAUC 1M7QA 4ZJJA 1QPJA 3BWJA 3HL7A 3O50A 3PP0A 2VWBA 3PVBA 5HKMA 4KUJA 4GJ3A 2W1GA 3CIKA 3GU6A 5KBRA 4X2KA 3R02A 3POZA 4C4EA 2GFSA 2UW3A 3OBJA 3DXPA 4IANA 3K3JA 4O38A 1R0PA 2YM8A 3UIMA 1ZMUA 5GNKA 2O3PA 1M52A 4V0GB 4AW1A 4I5MA 4IZYA 4TWOA 2CN8A 1XO2B 3BGZA 4AW5A 4IIRA 5HCZA 3ZUUA 2W17A 5GJFA 2CCHA 4F63A 2XRUA 5IKWA 3I7BA 1FVRA 4DFYA 4P4CA 2DQ7X 1ZYLA 4E5BA 1BUHA 4BZNA 1W82A 3SX9A 4ZJIA 5ANKA 4GIHA 1MRUA 4BTFA 4F4PA 3UP2A 3D7TB 2J7TA 2YLEA 1XH5A 2F9GA 2Z2WA 3F3TA 5J79A 1Q5KA 1F5QA 4RT7A 3IK3A 4PUZA 5LVOA 3VS2A 3PXYA 3QZIA 4MVFA 3VS4A 3DU8A 5CAQA 3JR1A 4WNOA 3KGAA 2C3IB 2FUMA 4O27B 2IZUA 2XKDA 3PXKA 2XMYA 4LQMA 3U6IA 3D5XA 4DG0E 1UNLA 3MVHA 5HVYA 4PMPA 3LW0A 2JC6A 3QTSA 4CFWA 4M84A 1H1WA 3RPVA 4KAOA 3I0QA 4XYFA 4AXAA 3BBTB 4DG2E 5ANOA 2J4ZA 5J7HA 1J3HA 2G2FA 4IAFA 2GHGA 4FYNA 3C51A 4C37A 3GOKA 2ZDUA 3ORNA 2J2IB 4BDHA 3TM0A 2FO0A 4NJDA 4E20A 4QP4A 5HD7A 1CTPE 4LG4A 3KRLA 4C02A 4FICA 4DEBA 3OW4A 2F49A 2Y4PA 4AFJA 3OWPA 2C47A 2NNWB 4MXCA 4YNOA 5HE2A 4FIEA 1IAJA 4QOXA 2X6EA 3NUAA 4U6RA 4QMQA 5I9ZA 3E8NA 1YHSA 4IB3A 2R7IA 4ANNA 4C3PA 5AAEA 4ZY5A 1GZOA 4K0YA 5CEKA 2WKMA 4N6YA 2YIQA 3SLSA 1ATPE 4Z16A 5HLNA 2VU3A 3SOCA 4ZLOA 3FHRA 2PUUA 3DK6A 3KF4A 4CQEA 4WSQA 3Q5ZA 3TUBA 1JSVA 1FVTA 4D9UA 5FUTA 4H1MA 5EOBA 4DFLA 5HBJA 2RFSA 4JAJA 1Q61A 5AUVA 1P4OA 2G1TA 2JBOA 2PVMA 4OGRA 3QC4A 5K5NA 4Y72A 4GK3A 4BI0A 2YIYA 5K9IA 3LQ3A 1IRKA 3HMOA 4BGQA 2XYNA 4L3LA 1KWPA 2P2HA 2BVAA 1PMUA 4FSMA 2IVUA 5AP3A 4RQVA 3ZS5A 1UWHA 2VZ6A 1U5QA 3FKLA 4U5JA 5M4FA 3LMHA 3BGPA 4AN9A 4C4JA 3BWFA 5K4IA 4CFNA 1W7HA 4C57A 1R78A 1QPDA 4PTEA 2RL5A 3V04A 3VUMA 2GQRA 3BV3A 3R8MA 4O7NA 4X3FB 1IAHA 2JKMA 1YXTA 4BBMA 1K2PA 4FV4A 1OKWA 4F9CA 2ITXA 2F7ZE 2C5OA 3PA3A 3LCKA 1OIYA 2W1EA 3OUNB 3OXIA 4RZWA 3TKUA 4QTBA 3OOMA 5M09A 3GBZA 3OEZA 3FMNA 5EI6A 1YOJA 4BZOA 4XOZA 4RWIA 3COKA 5AP6A 3NZ0A 4G3GA 2QR8A 2WHBA 3NUUA 4A07A 2QU5A 5EHOA 3G2FA 4TZRA 4A9YA 4K33A 3THBA 3CQEA 5JN2A 4FZDB 3UOLA 4PRJA 4A9RA 4BDCA 5IQIA 3PPJA 5JEBA 1U4DA 3EMGA 4AN2A 1P4FA 4DEDA 4EOLA 2HYYA 3P23A 2HELA 3P86A 3E8EA 3KREA 4WBOA 5HOAA 3I79A 4WRGA 4QYGA 3PJ1A 3Q32A 3R28A 5AV0A 3OEFX 2PSQA 3UZPA 4AZSA 5GZ8A 3ZXZA 2JDSA 4PPBA 3EQIA 3WF9A 4NU1A 4O7TA 2OXYA 3HUCA 3PYYA 2UZNA 4DEEA 4JRNA 4BIEA 4BZDA 2ETKA 2YDIA 4JG7A 3KXGA 3M1SA 4IWDA 2W1IA 4IVBA 4M15A 3AG9A 2OICA 4IX6A 4JS8A 4O0WA 4QMZA 3RK7A 4D0XA 4GK2A 1BKXA 1WZYA 3I81A 4O2ZA 3HKOA 1OZ1A 1ZLTA 3KQ7A 3TNIA 4BGGA 5BX0A 4FTCA 1SMHA 3BX5A 3GC8A 3EQPA 2OIDA 3IW8A 2WTKB 4K18A 4YMJA 3NWWA 3ZRKA 3ORMA 3VQHA 3SHEA 5CSPA 3QC9A 1OPKA 3ROCA 1OUYA 3DV3A 3WIKA 4JXFA 3RKBA 1YKRA 2R3OA 4UMPA 5A6NA 3R01A 4FVRA 3WBLA 3FMKA 1J7IA 4JQEA 5GJGA 4D4SA 2XNBA 2FVDA 3VULA 3KVWA 3WF5A 4FKIA 4J95A 5CNOA 1NVQA 5CT7A 2H6DA 4X2JA 5HLPA 3ZEWA 4QP6A 1FGKA 2REIA 1BI7A 3HDNA 4JDKA 4EUUA 5IISA 1H8FA 4RIXB 4PDSA 1Q41A 1XBAA 3PZEA 2YABA 1QMZA 3WE4A 5K4JA 2XA4A 4RIWB 1E1XA 5JT2A 3NYNA 1VR2A 3UE4A 3HLLA 5CSWA 3QKMA 1OB3A 2RG6A 3QTWA 4MNEA 4CKIA 3EN9A 2VTNA 3BHTA 2ITUA 4AA4A 4D2TA 2ZM4A 4CQGA 2PZIA 5E92A 5DVRA 3KN6A 4YNEA 3T9IA 2GTNA 2UZWE 4OLIA 4RX8A 2VTOA 4FSTA 2E9NA 2WNTA 2QNJA 4DEHA 3NIZA 4QPAA 3PXFA 4ZTLA 3F5GA 5KKRC 3IKAA 2GNLA 4GFOA 1UNHA 2VUWA 2OWBA 2XNNA 3EFJA 3AMAA 3M2WA 2OXXA 3SKCA 2V0DA 2QOLA 5KHXA 4JBQA 4I5HA 2QC6A 3UVQA 3DFAA 4LM5A 1UKHA 3GUBA 2Z60A 2VO3A 4CG8A 2DYLA 3RP9A 4CMOA 3DCVA 3G9LX 1DI9A 4I6HA 3ZO2A 5EQYA 1XKKA 3MJ1A 4NWMA 5E1EA 4F09A 2WQMA 3FL5A 4U9AA 2BPMA 3G90X 4KRCA 1TQMA 2X2KA 3F5XA 2V7AA 3MGYA 4QYEA 5T68A 3ZFYA 3TZ7A 2B7AA 2WOTA 3N4VA 1PKDA 4FSQA 4PQNA 2OK1A 1H0WA 3IS5A 3BLRA 4V01A 3FXZA 4AA5A 4PV0A 5HIEA 5E4HA 3GCSA 4QQCA 4MD7E 3AD4A 1HCLA 1OUKA 2HWOA 3EN4A 3QUPA 4G17A 4K8AA 4TWNA 4ZTSA 4RG0A 5ANDA 3AT3A 4U3ZA 3F5UA 3W2PA 3MY1A 3AMBA 1NXKA 3RAWA 3DY7A 3KXNA 4KIPA 4J52A 5CXHA 3MTLA 4GFMA 1XHAA 2ZMDA 3EZVA 2PVYA 4TN6A 3BBWA 3BYOA 3E88A 3VHKA 3Q2JA 4O7RA 3ENMA 3LFQA 3QQFA 4O91A 3LCTA 4EL9A 2BKKA 3EYHA 5EW8A 2GDOA 3ZOSA 2A4LA 5AUWA 3R30A 3CE3A 5I9VA 2I0HA 3NSZA 4F0IA 2GQSA 3BHYA 3BQRA 3H9FA 3I0OA 4EC9A 2CNVA 4X2NA 3QRTA 3QTIA 4I3ZA 1YI6A 2J0KA 5CVGA 4DINA 4IVCA 4EK4A 2XIZA 3MIAA 2QURA 3PIYA 5EKNA 5HTBA 3UZRA 5BUIA 4K1BA 5DRDA 3VN9A 2EXEA 1W84A 2WEVA 4QMVA 4MQ2A 4Y46A 5HCXA 5DMZA 4FV8A 4EHEA 1Y6AA 4NM0A 3Q2MA 4YPSA 5DE2A 5HE0A 1PMNA 5FWKK 2AC3A 1ZYSA 2G01A 4U0IA 4U43A 4YLJA 3U9CA 5LXMA 3W1FA 4FK6A 2AYPA 3ZONA 1WBWA 4EOQA 3A62A 5HESA 1Z57A 1I44A 1XH7A 4JBOA 3AT2A 3JUHA 2FB8A 1JSTA 4Z7GA 3UGCA 4WA9A 3AXWA 5CEQA 3W2QA 5IA4A 4BDDA 3OXTA 2XNGA 1YOMA 3RNIA 1YHVA 3NAXA 3PSDA 3QKKA 2F4JA 1JWHA 2W1ZA 3DS6A 4X6RA 2HAKA 5HO6A 3ZC6A 4RJ4A 1ZMWA 2ONLC 3WILA 3RINA 5IQFA 3PA5A 4RVMA 3E3PA 1X8BA 1QCFA 2BAKA 2CN5A 1W98A 1AGWA 2WU6A 3DNDA 4DFBA 1Q8WA 2CCIA 3AOXA 2PVHA 3FI3A 4OBOA 4PMTA 5A3XA 2QU6A 4FODA 3FLQA 2PULA 5ETIA 3DZQA 2CPKE 5ANIA 4L68A 4O0YA 1YWRA 4FV1A 2PY3A 5D41A 3Q96A 5CS6A 3EN7A 5HVKA 3F61A 3NLBA 4G2FA 4RIYA 4RVKA 1H27A 3MSSA 3R7YA 3HUBA 2VTMA 3TG1A 4IE9A 4O1OA 4CTBA 2X7OA 4YTFA 3EFLA 5IDPA 2WTWA 1FQ1B 5LARA 4BDFA 2WIPA 2R3JA 5AADA 3F82A 4XG4A 5ETAA 3II5A 1U54B 4FL1A 3NUYA 2WPAA 2VTRA 3DBFA 3LCOA 3NNVA 3FMLA 4TPTA 2C6TA 5IMXA 2UW5A 1FPUA 2XP2A 3GCVA 5J95A 5KUPA 3L1SA 3L8XA 3NUNA 3QFVA 4KS7A 4OR5A 1WMKA 1YDRE 4XG2A 4ZAUA 4PTCA 5K0XA 1M2PA 5JGDA 1CDKA 2WMSA 5HG9A 1TVOA 4QMUA 5J9YA 1SVEA 2PHKA 1PRYA 3Q9ZA 5AMNA 3ETAA 4H3QA 5JFWA 3LLAA 4TW9A 4BCHA 4L43A 1ZOEA 5KMJA 2P33A 3GEQA 1QPEA 4JR3A 3E87A 3W18A 3WYXA 4IXPA 2H8HA 2C5XA 5BPYA 1GOLA 5IUHA 3DKCA 5HO7A 4NM7A 4J96A 4IM2A 1OBGA 3U54A 4S2ZA 4QQTA 3ZSHA 4PPAA 2GS6A 3IW5A 3F2AA 4R7BA 5CVHA 1U5RA 5CF8A 3TNQB 3OG7A 4QTEA 5BVEA 5FD2A 4ITJA 2B53A 4R1YA 3UJGA 4HVSA 3FV8A 1Q97A 4AZEA 3HNGA 1FOTA 1UV5A 5HI2A 3WZKA 1ND4A 2XM9A 2O8YA 4LUDA 4FKPA 2C68A 4FG8A 4R6VA 3R7OA 2X7GA 1Q8TA 4CRLA 2FYSA 3PG3A 2O2UA 2GU8A 3R1QA 4ZLZA 4HVGA 1B38A 3QRIA 3R7GA 2IN6A 5CANA 4GKIA 2WTIA 1UU3A 1W83A 2OSCA 3ANRA 4ZJVA 5F9EA 3FI2A 4F08A 3FBVA 4HNFA 4X21A 3DXNA 2UW8A 3G5DA 2JDTA 5CF6A 5ANJA 4RVLA 1REKA 2Z7LA 2XUUA 2C6OA 5J87A 3ZO1A 4AAAA 4X6QC 4IJPA 4PWNA 3ZO3A 5LMKC 4OTWA 3UG2A 1TQIA 2OZAB 2UW4A 1XBBA 5AA8A 5DRBA 2OG8A 3LAUA 4FX3A 2WEIA 3I7CA 1PXJA 4TKSA 4W9XA 4ZS0A 2WFYA 3P5KA 3DQWA 4PP9A 5BMMA 5J8IA 5HG8A 1KUTA 2X4FA 3BE2A 1E9HA 5JGAA 2HZ4A 4ZSJA 4E4LA 5C4LA 3Q4ZA 3QQUA 5CAVA 5FP6A 2XM8A 3LFBA 3FSFA 3FY2A 4GUBA 4Z3VA 2IPXA 2H96A 4U81A 4X3FC 4F65A 3AGMA 1K9AA 3VWAA 3MPAA 4UWYA 4W4VA 5KBQA 2BDFA 4HYUA 2C1AA 1UKIA 2WMRA 3A61A 4ASEA 2F2CB 2X4ZA 5GHVA 3EL7A 3ZFXA 1MRVA 3C5UA 4BHNA 4L67A 4AT5A 2WTJA 4KKGA 3UO5A 2IG7A 1Q8ZA 5FG8A 4MF1A 1B39A 1S9JA 2VGOA 3GNIB 5CI7A 3RNYA 4RWKA 2XIYA 2W99B 4DEAA 3D2KA 4XNEA 2VTLA 3FQHA 4LOPA 2PZRA 3C7QA 2J6MA 4I6BA 4FGBA 3LMIA 2G15A 5B0XA 2W1FA 1YWNA 2ERKA 1CM8A 4ZSAA 4XJ0A 1Y8YA 4S31A 4XH6A 2WOUA 4YJTA 4JAIA 3DA6A 1VYZA 5IQEA 3C1XA 2E9OA 2R3IA 3NDMA 2F57A 5JKGA 3DNEA 2QOBA 4I6FA 3MW1A 4ZP5A 3MIYA 4WUNA 3RAIA 4APCA 4BCJA 3EKKA 2CNUA 4XOYA 3LM0A 2VWYA 3C13A 4H36A 1OPJA 4IBMA 3BEAA 3ZLWA 4ALVA 4EZ7A 5BQ0A 2Q83A 5IQAA 3MFUA 3HMPA 1AD5A 1BI8A 2C6IA 3VUHA 3H10A 4AZWA 3L8SA 5L2TA 4RIXA 3FC2A 1F0QA 4PL3A 4YC3A 3A60A 3AMYA 4D0WA 4WD5A 3R1NA 4RIWA 4O7SA 4DH3A 1GZKA 1IG1A 2FSMX 3O0GA 3ZHPC 5EW3A 4Y85A 2WB8A 3TTIA 3OFMA 4BCFA 5M4IA 3Q9XA 5JFXA 4FUXA 5HNGA 2CSNA 4WG5A 4GT4A 2YN8A 1J1CA 4QTDA 3EB0A 3BZ3A 4YZMA 4LRKA 4G5JA 3IDBA 1JKKA 5IA5A 3BKBA 3S4QA 3R63A 3QXPA 2CNQA 4LOQA 3CGOA 5C4KA 5K5XA 2C5NA 4FZ7A 1NA7A 2PMOX 1Y57A 4QQ5A 2OBJA 2CMWA 3C4ZA 5IEVA 3PUPA 3RZBA 4AS0A 4FSWA 4NW6A 2W9FB 4EQUA 1PYXA 2YCSA 2QOFA 4RVTA 5M57A 3OY1A 3W2OA 3R8ZA 3BPRA 1CSNA 4YZNA 3SD0A 4CZYB 2F2UA 4G3FA 3HAVA 5JH6A 4Y95A 3IO7A 3PVUA 2ZVAA 3W10A 3FWQA 3NYVA 4YZBA 4G34A 4C58A 3F69A 1DAYA 4FKQA 4YR8A 3ET7A 2A19B 2CGUA 4O21A 5CQWA 3FC1X 3D5UA 3ZDIA 3KXMA 1WVXA 4KB8A 3CGFA 3TZ9A 4EC8A 3S1HA 3FJQE 4RC2A 4RBLA 3PXZA 4P90A 4V04A 2C4GA 4GMYA 4CFVA 1UU9A 1AQ1A 4QQJA 3AC1A 3W16A 3VBTA 4CT2A 1YXVA 4IW0A 2QR7A 5EH0A 3DDQA 3PSBA 3H30A 3LQ5A 1OVEA 4NIFA 1H4LA 4DF3A 1G3NA 5FEEA 3UNJA 3PLAE 2ZM1A 4I93A 3COMA 2BILB 4A06A 5LMKA 4G5PA 1OL2A 4EZ3A 3TV4A 3UO4A 3NNWA 4JQ7A 2ITPA 4JIAA 3QALE 1P2AA 4C38A 3MPTA 3UOKA 2PZYA 4AZFA 2XKCA 5CXZA 5TOZA 5LVNA 5DEYA 3SXFA 5IA2A 4EJ7A 3REPA 4LL5A 3GOPA 3DAJA 4ZEGA 3MH1A 5CQUA 4ZXTA 2V7OA 4RX7A 4ANQA 4QRCA 3CKXA 4IDVA 5G6VA 4DT9A 5CENA 4IZ5A 4IADA 5DHJA 5C8KA 2C1BA 4EI4A 3VAPA 4C0TA 4OW8A 4E4XA 4AQCA 2JAVA 4NCTC 1NVRA 4MBLA 3LVPA 3EL8A 4FNZA 2OJIA 4M7IA 4FT3A 5F94A 2X6DA 4E6QA 3MA6A 3QWKA 3GQLA 1VZOA 4AF3A 5CU6A 2XIXA 3FKOA 3ODYX 4EH7A 3O17A 3UYTA 2OKRA 2LGCA 5I0BA 3HV3A 4KD1A 2UZDA 4TY1A 1OGUA 4FNWA 2QODA 3NS9A 2R7BA 1O6LA 4U80A 3VO3A 4QMXA 2XS0A 4R5SA 4W4WA 3P4KA 5AR2A 5HIDA 4E6AA 5LVLA 4UXQA 5ACKA 3WIGA 2P55A 3IGGA 2I40A 4DH1A 4GCJA 4NH1A 3QTQA 5EHYA 3QQHA 4K2RA 2QOIA 3LXPA 4GG7A 4IC8A 2YIWA 4ZZMA 3VQUA 3ZEPA 4BCGA 3UG1A 3A8WA 1M2RA 2J90A 3I6WA 4GJ2A 3VJNA 1VEBA 4FKSA 4J97A 5DN3A 1OBDA 2VWZA 4EKKA 4UMTA 3EJ1A 3OD6X 1Z5MA 4NTSA 4H58A 5AP7A 2B55A 3C4EA 3FDNA 4L7FA 4ASXA 4BB4A 2QHNA 3V6SA 3FI8A 3V6RA 5FM3A 4AOJA 4F6WA 2VN9A 2QQ7A 4FTQA 5E8VA 2UW9A 4FZFB 4HZRA 3ODZX 4C8BA 4QYYA 3U6JA 1IR3A 3AD6A 3DOGA 3G9NA 3TZ8A 3D5VA 4FKOA 4XG9A 3QA8A 3W8LA 3MI9A 2IZTA 3T9TA 3HP5A 3ALOA 5ANGA 4ID7A 1U54A 2JIUA 4ZTHA 3V3VA 4UZHA 2Y9QA 1XR1A 4FKUA 3R00A 1TQPA 2HENA 5F95A 3DB6A 4M0ZA 4JDHA 4RWLA 2G9XA 5KMNA 5HX6A 4NJ3A 3D15A 4U97A 3UIXA 5CF5A 3SVVA 1YOLA 3E63A 5A4CA 4B7TA 4J8NA 3FMEA 3S3IA 3Q04A 4JG6A 4X0MA 5M51A 4RJ8A 3CR0A 4MCVA 3A7HA 4UY9A 4ZTQA 2CHLA 3EFKA 4YZDA 3W8QA 4CMUA 3O8TA 4ASZA 5CEPA 2Y4IB 3R2YA 4E26A 4C7TA 4R3RA 3JPVA 4I21A 4LUEA 4I92A 4M66A 4GH2A 4TRLA 4L3JA 5KMLA 2PMIA 4AUAA 3F6XA 4S30A 5EI2A 3N9XA 2WMTA 2OJ9A 4R7HA 3BU3A 4NKAA 4WNMA 1PYEA 4AGUA 3CTQA 3VRZA 4AW2A 2JITA 4GV1A 4O6EA 2OXDA 4EORA 1LR4A 2UUEA 3BYVA 2X81A 3DPKA 4K6ZA 4O7ZA 2WELA 4YHJA 4FEQA 3W2SA 4RMZA 4G3EA 4J53A 3VBXA 4E4NA 4EHZA 3LQ8A 2OGVA 4GYIA 4FTJA 4FIGA 3L8PA 3VUDA 3CLYA 4C33A 3QU0A 4J98A 3VW8A 4O0VA 4XG6A 4DH7A 4IHPA 3MDYA 4D58A 3QZHA 4QP1A 4ACGA 3ORXA 3DGKA 4II5A 3QTXA 3ZCLA 4IAZA 1Q4LA 3FHIA 4EK5A 4HGTA 4WBBB 3BEGA 5AR7A 5FEDA 2QOKA 1WBNA 5FEQA 5DEWA 3HRFA 1FMOE 4P5QA 3D14A 3EQRA 1YXXA 3FZ1A 4YJRA 4D1XA 3QTRA 2QLQA 3RCJA 4A4OA 4QP7A 3GGFA 3W2CA 4Y83A 3F88A 5AUUA 5HGIA 5LOHA 4L7SA 3EQFA 1VYWA 4MXYA 4W4YA 3O23A 4NUSA 3V5TA 3VS6A 3OS3A 3QQLA 3KCFA 2ITWA 4I0TA 5I5ZA 4MBIA 4G9CA 3WOWA 2OZAA 2RGPA 5EFQA 1WCCA 2X2LA 4YBJA 4BBEA 4DHFA 3OBGA 1OIRA 5AUXA 1L8TA 3GT8A 1KV1A 5LWNA 5J9LA 2BKZA 3R7UA 4JI9A 1WBSA 3KXHA 3PWDA 2ZOQA 2NRUA 2YJSA 4HCTA 4HOKA 3ZTXA 5JQ8A 2C0IA 3CBLA 4LGHA 4TYEA 4FKWA 3PRIA 3EQBA 4O82A 3WF6A 2V22A 3PY1A 4RC4A 3JXWA 3LFFA 4FIJA 4ALWA 3E7VA 2WMAA 4WKQA 3AGLA 4FV3A 5IEYA 3HMNA 2JIIA 4M69B 4H39A 5HG7A 3TUDA 4OTRA 3CEKA 2VWWA 3JVRA 2BTRA 4MTAA 4O83A 1OKVA 4H05A 4C34A 3QYWA 4NYEA 4L8MA 5AP5A 4BTMA 4AGWA 4GEOA 4GIIA 1Y6BA 2BR1A 2HW6A 3RJCA 3TTJA 2OO8X 4NCTA 2BRGA 4RFMA 1GIJA 1GNGA 2Y7JA 4U7ZA 5CSVA 1OECA 3OC1A 2WXVA 5EM7A 3V5WA 4XV9A 4ZS4A 4EH9A 4UB7A 2J0IA 3UODA 3ZBFA 3IPHA 5A4QA 3KC3A 1PF8A 3EIDA 4K11A 5DI1A 3BLHA 5C1QB 2I7QA 3NGAA 4MK0A 3KY2A 3H3CA 5I3RA 1PXIA 5M4UA 2JKKA 2W5AA 3OT8A 2XK7A 3KF7A 3NYXA 3KFAA 3LJ1A 3GFWA 3A7GA 3O2MA 3HECA 3Q4TA 3OCTA 4DBXA 3QUEA 3R83A 2OF4A 3VS0A 1URWA 3LFAA 3FZRA 2VRXA 5CTPA 2O0UA 2VAGA 3KULB 3PE2A 5TF9A 3VC4A 3HZTA 2NPQA 4TYJA 4AP7A 3D5WA 2XKFA 1IA9A 1SM2A 3F3ZA 2R3LA 4ACDA 3FZPA 4EQCA 3MYGA 3H9OA 4ZK5A 5CEIA 3NW6A 5IQHA 4L3PA 2W1DA 3PWYA 4XG8A 3UOJA 2W7XA 2RIOA 3FUPA 4L52A 3H0YA 3ATSA 3RPSA 3EWHA 4JOAA 3ACKA 2XCKA 3Q60A 2C30A 1OL6A 1TKIA 3HMIA 2DUVA 2YZLA 3CS9A 4BN1A 5BYZA 3H9RA 3Q53A 4DLJA 3EQCA 1H24A 3ZLSA 3TUCA 3R8VA 2YEXA 4O84A 3R9RA 2VV9A 4I4FA 5L8KA 4KNBA 4WRSA 4O22A 4EOPA 1UA2A 4C62A 4OUCA 5KZIA 5EG3A 3FQEA 5K0KA 5IQBA 3OWJA 4F70A 2IZRA 3ZM9A 2VX3A 4XBUA 2JEDA 3MB6A 3PIZA 5EK7A 2FSTX 2R3FA 2SRCA 3FLZA 3TNPC 2YACA 4BFMA 3TCPA 4AU8A 4FTAA 2XBAA 4F0GA 5L6OA 2XIKA 5FGKA 1XBCA 4EZ5A 3I1AA 3EQGA 4ZOGA 4B99A 4QYFA 4EK8A 5CY3A 3DBEA 2QHMA 5ETFA 2JIVA 4O0RA 1SVHA 2WQEA 3V01A 3MTFA 5ACBC 5AV4A 4FEXA 3QTUA 2XCHA 3F7WA 2GS7A 2XJ2A 2QO2A 3FI4A 3KN5A 4XRLA 1GAGA 5E8YA 5KE0A 1M17A 4JDJA 4G16A 4KIKB 2GS2A 3P9JA 3S00A 5CU0A 4R5YA 2YAAA 3BYUA 3A7FA 2GNIA 3GP0A 3E62A 3WF8A 3NAYA 2WAJA 2WMVA 4ACCA 4EH2A 2VTIA 2B0QA 5C26A 4UN0C 4XG3A 3OUKA 2B54A 3IONA 3QHWA 4JRVA 1XJDA 5CLPA 1VJYA 3PJ8A 3R73A 3FXWA 5CT0A 4BWPA 4WOVA 1GY3A 3W55A 3DAEA 5KCVA 2PVKA 4JBVA 3D9VA 5BVNA 4BI1A 2QD9A 4BKJA 1JSUA 2CKPA 3CJGA 3V51A 4YHFA 3VS1A 2C3KA 2J5EA 4EH8A 4YP8A 3DAKA 3MFSA 4O0XA 3FXXA 2UVXA 3PVWA 4BCPA 3D7ZA 2UVYA 4YJOA 4P5ZA 5HO8A 3FZSA 3IW7A 4JNWA 3R1YA 5KX8A 4MD8E 4I41A 1Z9XA 4P2KA 5HE3A 3HMMA 2VWUA 2Z7SA 4EWQA 4U44A 4HYIA 1MRYA 4FGRA 4GYGA 1ZRZA 4H3BA 3SRVB 4C61A 4R78A 3BV2A 4XP3A 4RFZA 1ZOGA 3G33A 5HU3A 2YDKA 2ZM3A 3MFRA 4HGSA 3GC0A 4O96A 5HG5A 2P4IA 1H0VA 4MEDA 4AX8A 4D4VA 3IOPA 3HAMA 2UZTA 4J8MA 4PNKA 2GNHA 3NVMB 2BAJA 3SOAA 5C9CA 4FC0A 3RWPA 4BWKA 2EXCX 4IDTA 4FVQA 3NRMA 2JFLA 3HV6A 4C36A 3VHEA 3KK9A 3HV7A 2GFCA 4J71A 4PX6A 3CQUA 1FGIA 3BIZA 5IZFA 2IW8A 4KBCA 2F7XE 3UTOA 2EWAA 2W96B 3N51A 2PVRA 3PY3A 2ZB0A 3QZGA 4YJNA 4V0GA 3QXOA 1QL6A 1H26A 4UV0A 4N70A 3UMWA 5EOLA 3C0GA 3OTVA 4RLLA 2X2MA 2BRNA 4U79A 4BDGA 4EEVA 3IECA 2W1CA 1YQJA 2CGWA 1PXLA 3C50A 3R22A 3QGYA 2WTKC 1GIHA 3D7TA 4FKLA 4Z55A 4GKHA 3EQHA 3KCKA 2HZNA 3QA0A 3QHRA 2XNMA 4BDBA 4FEWA 3R9NA 4CEGA 3PXRA 4WUAA 4O7YA 5TO8A 4A9SA 4JJRA 3HYHA 3O71A 3OXZA 1P5EA 4XP2A 4AT4A 4C35A 3RK9A 3CTHA 2R2PA 3E93A 2UZBA 4OTPA 4FSUA 5EQEA 3ZRMA 3LFSA 4IAIA 3TJCA 4BF2A 2XNEA 3IDCA 4J99A 2ZAZA 5LJJA 3MWUA 3QCSA 4YSJA 4CYJA 4F1TA 4PDPA 2HW7A 2J0JA 3PTGA 3A8XA 2B9FA 1H1QA 4UMUA 3NYOA 5AJQA 2UZVA 4KSQA 5D9HA 2Z8CA 3UMXA 3VBYA 4BCNA 1ZMVA 2XVDA 1BL6A 5D12A 2QG5A 4ANBA 2JAMA 2XEZA 3QUDA 4PTGA 5L2QA 3OWKA 4PNIA 4I22A 4BCKA 4ENYA 3D83A 2B1PA 2XJ0A 1Y91A 3G6GA 1OIQA 3HA8A 3NIEA 3E92A 4FG7A 4IC7A 4J1RA 3QD2B 4KABA 2XZSA 4Q5EA 5HNIX 3NUPA 4M97A 4DITA 4E73A 2R3PA 5CEMA 3N4UA 4YO4A 5KZ0A 4GG5A 4CFXA 1R3CA 2YM7A 4MBJA 4F99A 1LUFA 2ITYA 5H9BA 3ERKA 4DCAA
chains in the Genus database with same CATH superfamily
5A6OA 2YZAA 4EJNA 2AQXA 3WZEA 2W1HA 1V0BA 4UWCA 4EK6A 3LZBA 5GINE 5EW9A 2ZMCA 3MY5A 5DYJA 2R3NA 3W32A 3DLZA 5LMBA 1XQZA 5H8BA 4DH5A 2J0MB 2RFDA 5BNJA 2B4SB 4FV6A 5JGBA 3SGCA 4ZMFA 4PY1A 3HA6A 4FK3A 2GHMA 2X8IA 3OROA 2E2BA 3A4PA 5HBEA 3DTWA 4IEBA 4OTIA 5AM7A 5DR9A 3UIUA 4BCQA 1SZMA 4U45A 3SDJA 3ZDUA 4UWBA 1LP4A 3QX2A 3TACA 3GC9A 4G31A 4OTDA 3R6XA 2XK3A 3C9WA 1HCKA 1DAWA 3DBDA 4KRDA 2OI4X 5AR5A 5C8MA 3RBWA 4CYIA 2ITVA 4DFNA 4BJJB 4QT1A 4ZZNA 2EVAA 4L9IA 1WBTA 2ETRA 1KE5A 3HDMA 3AC4A 3HV5A 2X0PA 4WNKA 1CKJA 1H01A 3WF7A 4B6LA 3B8QA 4D4RA 5BVDA 4N4SA 2C5VA 4DGNA 1LPUA 4TYHB 3VVHA 2JKQA 1SYKA 3LCSA 4YLLA 3SC1A 2QOQA 5HEZA 4XRJA 3RCDA 4CG9A 4CNHA 3QLGA 4LMNA 4X3FA 4IAYA 5FP5A 4NTTA 4RA5A 4YZ9A 3MY0A 4I5CA 5M4CA 2JGZA 4I5PA 2XBJA 4AACA 4C2WA 3KU2A 2VTHA 2FH9A 1MUOA 3EN5A 3MH0A 1NW1A 5C8NA 1H07A 1YDTE 3U87A 4AW0A 4F6UA 4MH7A 4RJ7A 5E1SA 3EN6A 3ORKA 3FLNC 2OW3A 4M69A 3DBQA 3R8UA 3HRCA 5CU4A 3ALNA 1KSWA 2PMLX 5B2LA 3OTUA 4O7WA 1M2QA 4A4LA 5FBNC 4PL5A 5M06A 1CMKE 3FLSA 3NNUA 1IA8A 4O0TA 4F64A 4FT0A 4JG8A 3QGWA 1OITA 4D1ZA 2AUHA 2YWVA 5A14A 4TXCA 4LV5A 5AP4A 4AN3A 2JBPA 4LV7A 3H0ZA 2O63A 4FT5A 4IWPA 3KXXA 3LFEA 5M53A 1LEZA 1PXPA 2YFXA 4IM3A 4BCIA 1W8CA 1K3AA 2BFYA 4QMYA 4UALA 2ITOA 2W4JA 5KMIA 5JMSA 4Y5QA 3GCPA 1MQBA 4RX5A 2IWIA 4XX9A 2BRHA 2GNJA 4O86A 2B9IA 4W8EA 3COIA 5A4TA 5KNJA 3Q6WA 2YLFA 1KE6A 2ZB1A 3BCEA 1MP8A 2X8EA 3L9PA 3QAME 5H8GA 4RC3A 4ZTNA 3U8WA 4CV8A 5CAOA 5CSHA 3Q9YA 4FVPA 3Q3BA 3R7IA 3G0FA 4I1ZA 1OL5A 3F9NA 2EU9A 2WD1A 4TWCA 3IQ7A 5I9XA 4EOIA 5IPJA 3K2LA 3VUGA 4BKYA 4XLVA 2HY0A 1XH8A 3PXQA 4GK4A 4EH3A 5EI8A 4HGLA 4K77A 2JDRA 4CGAA 2YM5A 4ANMA 3DTCA 4O6LA 2VTQA 4DC2A 2C5YA 3NPCA 4FL2A 4D28A 3RM6A 4RJ6A 2Q0BA 2HK5A 4HVDA 3GCQA 4QMMA 3K5UA 3B2WA 2KTYA 3QLFA 3QD4A 1CKPA 2O5KA 4A9TA 4ONAA 4L53A 4C4HA 3BYMA 2W0JA 2ERZE 2HIWA 2JLDA 4CFUA 5DT4A 3R71A 4D5HA 4F1MA 5J5SA 4KINA 5TT7A 5AV1A 3S95A 3QQKA 2V62A 3ID6C 4QMWA 1ERKA 5H2UA 1YXUA 1G8KA 1GIIA 2GQGA 2BZHB 2XH5A 2BFXA 3RPOA 5L4QA 4O2PA 1ZWSA 3T8OA 4BDJA 1OL7A 3KXZA 4MQ1A 4MHAA 1JAMA 1OL1A 3I5ZA 5AUYA 4EH5A 4EH6A 2QG7A 3F66A 5CZHA 4EOMA 3OCSA 4DG3E 5GJDA 1Q24A 5FRIA 5IUIA 4AT3A 2PYWA 3NX8A 2IVVA 3RI1A 4HPTE 3D2IA 4F9WA 5HQ0A 2YWPA 3KMUA 4YLKA 2O64A 1KE9A 4RJ3A 4GU9A 4UYAA 3W0QA 3HVCA 2XALA 3R9HA 4FTLA 3P08A 4KIKA 5M56A 4MX9A 3SA0A 5C03A 2HZIA 3HGKA 5DFPA 1XH4A 4BDEA 2X8DA 2WIHA 5IMEA 3F2NA 3FE3A 1YWVA 3MH2A 2OFVA 4U42A 3L9NA 1P14A 2BCJA 4M13A 4TT7A 1URCA 4D2WA 5D10A 1RDQE 3F2RA 3S2PA 3ULIA 4KA3A 1Y8GA 2QVSE 3LCDA 5HU9A 4YC8A 4FKVA 4TYGA 5BVFA 1BYGA 4FR4A 3O7LB 4MNEB 5I9UA 4GUEA 2WO6A 1BL7A 4D55A 4YPDA 3FMDA 2OJJA 2C3JA 4MXZA 3ZLXA 3ZH8A 1STCE 3CD3A 3DJ5A 3FMMA 5DR6A 2C6MA 3KEXA 4HVIA 5CALA 4C4GA 3MVLA 3U6HA 1G5SA 4DDIA 4RQKA 5FXRA 1XMMA 3W0RA 5IQDA 4BVUA 3VBVA 4LL0A 4C4FA 3TWJA 5JFVA 2BIKB 4TWPA 2JFMA 2GNGA 3BU6A 4X2GA 5EYMA 3KKVA 1UVRA 1PW2A 4ANOA 4FTUA 3QYZA 1XMLA 2BAQA 3K54A 4ASDA 4Q5HA 1H28A 2BUJA 2WTVA 3A4OX 4UXLA 5TE0A 5FTGA 4WHZA 3SRVA 4R3PA 1KOBA 2DWBA 2HWPA 3O51A 3H4JA 2C3LA 4LOOA 5EYDA 2VX1A 1T45A 2P0CA 4YTCA 1F3MC 3CQWA 2A0CX 3VS3A 1J7UA 2X9EA 2GSFA 2VTTA 3RAKA 4FT9A 4GS6A 5JQ5A 4IAKA 4FYOA 4I6QA 2I0YA 1ZY4A 2V55A 1OMWA 4KIOA 2E9PA 3DKOA 3MFTA 3FLWA 4GVAA 5T3QA 4AFEA 4WG3A 4BL1A 4DA5A 1KOAA 4FIIA 2CLQA 3RGFA 1PMVA 1RW8A 3G6HA 2C6EA 3RAHA 1M14A 3ORZA 4DT8A 5JFSA 1DI8A 1RQQA 1NY3A 4Z9LA 2EUFB 3MV5A 4FIHA 5AM6A 2G2HA 2YM6A 3RWQA 4BKZA 4WIHA 4NT4A 4NZWB 3KL8A 4UEUA 4H3PA 2PZ5A 4MKCA 4C3FA 4QD6A 5IA1A 4BWXA 3GQIA 2PUIA 5J7BA 3KMWA 4ERKA 2VWVA 4ZZOA 3U9NA 4FMQA 4GFGA 2GCDA 4IWOA 3P7BA 1J1BA 4QO9A 3ZU7A 3ML1A 4O7VA 3R9OA 1Q3DA 2EXMA 4F7LA 4E93A 2H34A 3O8UA 3ZZWA 4EHGA 1H00A 3O8PA 1WBOA 4IFGA 4PDYA 4F78A 3TT0A 2OJGA 4I4EA 2BZIB 3ROYA 1YW2A 4DCEA 2IJMA 4QMOA 4XV3A 4PF4A 5BYLA 3C4XA 3O7LD 1ZYJA 3ELJA 1OM1A 3JS2A 3LLTA 3PZHA 3BI6A 2WQOA 4OBQA 5LMAA 2R3HA 3V5JA 4ZY4A 3NVKI 3OCGA 3TL8A 5BVWA 5AR8A 1WVWA 4TYIA 1WVYA 2EB3A 4BGHA 3TDWA 5D11A 4OTFA 2ITQA 5M07A 3C0HA 5CSXA 4OAVB 3ZBXA 4UYNA 4EHVA 2C0TA 3DBCA 4S34A 4Q9SA 2CGVA 5HIBA 5A4EA 3QCXA 4M14A 4ACHA 5AA9A 4ZMEA 3LPBA 5EHLA 5E90A 2YITA 4CFFA 2QOCA 2QONA 5A9UA 3HV4A 2J50A 3DKFA 3UYSA 5CU3A 3V5LA 4N57A 1FBNA 5IA0A 1OKYA 5EQPA 5AR3A 4DTAA 2RKUA 3QZFA 1H1SA 5FTOA 3E8CA 5CI6A 4XLIA 3AC2A 1S9IA 5EM6A 4FUYA 2UW7A 5KHWA 4BIDA 4M0YA 3VONA 2YISA 2YIXA 3W2RA 1V1KA 3LIJA 3WZDA 4AG8A 3VRYA 2C6KA 4FF8A 4GL9A 3GU7A 4D2VA 2BHHA 5CVFA 5GZAA 1WBPA 3V8SA 2QO9A 4ZY6A 2WMBA 4FA2A 2R0UA 3F3VA 5H3QA 4CCBA 5JK3A 4N0SA 5FQDC 1GZ8A 3E7OA 4B8LA 5BYYA 4M3QA 4A9UA 5BMSA 5LVPA 3QQGA 4ITIA 3IG7A 1ZY5A 4QYHA 4RIYB 3HP2A 2OH0E 4OTGA 4H1JA 3DFCB 4RA4A 4CRSA 4ITHA 4AGCA 4XEYA 1KE8A 3R8PA 4BYIA 2NO3A 4DN5A 2OH4A 3MBLA 4JLCA 3TV6A 3PDTA 3AC3A 2ZYBA 1B6CB 4CTCA 3GU8A 3ZZEA 3CD8A 2PVFA 3WE8A 4BJJA 2R3MA 5IUGA 2BMCA 3TKHA 1A9UA 4PPCA 2PVNA 3I60A 2Q0NA 3KVXA 3I4BA 3CSVA 2PMNX 5M08A 4D2RA 2I6LA 1NT2A 3QRKA 5DT0A 5ICPA 4CSVA 1U59A 4PMMA 2WTCA 2ITTA 1PJKA 4FTRA 4L45A 2CGXA 4TYHA 5LQFA 2WQNA 3FL4A 4TNBA 1JKLA 5ANEA 1BMKA 3FY0A 4WSYA 5KKRB 2CJMA 4CMTA 3PLSA 1REJA 4WNPA 4AA0A 3UNKA 4KKEA 4BR3A 2GPHA 4J7BA 5CYIA 3VF8A 4F7JA 2GTMA 5H8EA 4RGJA 4E7WA 3FKNA 4QP9A 3DK3A 3IOKA 4EYMA 4QNAA 5E9EA 4BYJA 3UDBA 3GVUA 1JOWB 3QQJA 2IW9A 3RHKA 4X7QA 5TR6A 4M8TA 3DXQA 4PMSA 2DS1A 3VS7A 3TIZA 1WAKA 2YCFA 3P1AA 3PG1A 5LWMA 1I09A 3MN3A 4QPSA 4ACMA 1R1WA 5E8UA 5EDQA 3ZYAA 4S33A 2PTKA 4FKGA 2XB7A 1UNGA 4HZSA 4Y5HA 5EDRA 3TN8A 3W33A 4ALUA 5A4LA 2PU8A 2R5TA 1JLUE 2WMWA 3FYJX 3OZ6A 4BRXA 2WZJA 3LJ2A 2VO0A 2JKOA 5HE1A 5HORA 3FPQA 3MPMA 4L44A 4EBWA 2C6LA 3KRXA 4F9BA 5LCJA 4ZSLA 2B52A 2ZV2A 3ORPA 4RSSA 2IVSA 3AC8A 3WI6A 2XK9A 5L8JA 2Y8OA 4MAOA 3FZTA 3F3UA 2G2IA 5CASA 2YCQA 4YTHA 3DT1A 3QTZA 4Y73A 2BRMA 2J51A 4I0SA 2PZPA 2QKRA 5BUEA 3DK7A 1ZARA 5J1VA 3EH9A 4G9RA 2PE1A 2VX0A 2XYUA 1UU7A 4LFIA 1PY5A 4NM3A 3TKIA 4WO5A 3FMJA 4LMUA 4AWIA 3GCUA 5HD4A 2XNPA 4L46A 4MF0A 2VTPA 3RHXA 4CZUA 3PIXA 3UP7A 3C4FA 4O0SA 3MESA 4JIKA 5J5TA 4R3CA 1A48A 1EH4A 2OJFE 2OF2A 5AR4A 3TZMA 5FDPA 4K9YA 4FE2A 5E91A 4IFCA 2KULA 3QF9A 4JT3A 5IA3A 2WMUA 3W0OA 4FV2A 2QLUA 4O81A 4I0RA 3LJ0A 3UBDA 1JKTA 4EWHA 3FYKX 1YHWA 2BRBA 2BTSA 4DH8A 3NUSA 2VWIA 4QPMA 4B8MA 5B2MA 3CTJA 5DT3A 4CCUA 4UMQA 2W05A 2WTDA 3FEGA 3CPCA 4D2PA 2UV2A 4D1SA 3V8TA 5DR2A 4EONA 3BGQA 4IACA 3FPMA 3ZSIA 3GB2A 4KBKA 1Q8UA 4CV9A 4HVHA 5JRQA 5E8SA 1WFCA 3ANQA 4KIQA 2IVTA 3TNWA 5LCKA 3MB7A 4TL0A 4CD0A 1WBVA 1ZXEA 1SVGA 2J0LA 3AT4A 3MVMA 3RK5A 2PUNA 2I0EA 3NR9A 4LV8A 2Y4IC 3V5PA 4A7CA 3SW4A 3VBQA 1FMKA 5IQCA 3C4CA 3OVVA 2UZEA 3GFEA 4I94A 4F0FA 4YHTA 1NVSA 4JDIA 4HPUE 4IWQA 3VNTA 4ZLYA 3A2CA 2W4KA 3L9MA 5KMOA 3TXOA 4HYSA 5KMKA 2GMXA 2R3GA 3OCBA 5HTIA 3VIDA 5LVMA 3JY9A 3S0OA 5DH3A 4BDKA 3D4QA 1XH9A 2R0IA 3FLYA 4M68A 3CPBA 4R7IA 3RALA 1YI4A 3PJ3A 4C4IA 4E5WA 5IEXA 3P7AA 4X2FA 3CC6A 4MXAA 5I4NA 2HZ0A 2XF0A 4FZAB 4DTKA 3TDVA 5AWMA 4D9TA 3UVPA 4FBXA 4HW7A 1H08A 5JSMA 5DIAA 5T6KA 5BVKA 4AOIA 2R64A 4QMPA 3GENA 5IQGA 4UX9A 4L6QA 4I23A 2H9VA 2VTJA 3ORIA 3HEGA 1UWJA 2ESMA 3C0IA 3IW6A 3JYAA 3LHJA 4GT5A 3OOGA 3R9DA 5B7VA 2I1MA 3MVJA 3ZM4A 4E6DA 2X7FA 4ZTMA 3GU4A 3R21A 4CKRA 4ZIMA 1OI9A 2RF9A 2ZDTA 5CAUA 4ORKA 5BUJA 3EOCA 3OHTA 4FI1A 4L01A 3V8WA 4NEUA 3PPKA 4NK9A 5EKOA 1R39A 4BI2A 4QNYA 5D7VA 2JD5A 2ZJWA 3JY0A 4MNFA 4G3DA 4MWHA 5J1WA 2PVLA 3C4WA 4XV2A 5IDNA 3CCNA 3O5AA 5D1JA 4CVAA 5AP1A 4G6LA 3B8RA 2ETMA 2Y6OA 2X1NA 4IB1A 4LGDA 3CY3A 3Q5IA 4NFNA 2BALA 3P78A 4W8DA 5AIKA 3ZLYA 4CLJA 3LFDA 2ITZA 4XCUA 3UZTA 3EFWA 4UMRA 4JX3A 3P7CA 3VUTA 3IW4A 4HNIA 5HCYA 3JVSA 4LRMA 4JX7A 5F20A 3VW6A 2PL0A 4G6OA 4NKSA 5ETCA 4S32A 5E7RA 2IZSA 1O6KA 3K3IA 1V0PA 2UZUE 3QKLA 1A06A 1O9UA 2CKQA 4EUTA 3P79A 4FSZA 3BHVA 4NSTA 4ARKA 5IH4A 3G15A 4FTTA 1YRPA 2FSLX 3PY0A 4U40A 1G8JA 2BZJA 3QD0A 2QO7A 2UZOA 3FQSA 2ACXA 4IQ6A 3AC5A 4E5AX 4FV7A 2E9UA 3QCYA 3M11A 4EKLA 5CAPA 2YHVA 4RZVA 3BHHA 2XKEA 3RZFA 3MH3A 4EQMA 4ANSA 5HTCA 3O96A 3ATTA 4BY9E 4B9DA 2I0VA 3PA4A 3E64A 1G8AA 5AP0A 4NIFB 4DEIA 5HZNA 4DGMA 3KRRA 4OBPA 2FA2A 4AE9A 5AP2A 4FIFA 3ULZA 4XS2A 4DTBA 4Q9ZA 3LOKA 1J7LA 4KWPA 5L6WL 3NMUF 1BX6A 4OTHA 2LAVA 1XH6A 4V05A 2X9FA 4FTOA 3C5IA 2WQBA 3BU5A 5B2KA 4EYJA 3UO6A 1JQHA 4GVJA 2WU7A 2HY81 2IEWA 3BE9A 4MWIA 1W0XC 2B9HA 4O4BB 4YU2A 3RTPA 4B0GA 2XEYA 3G0EA 5JZJA 1FINA 4DBNA 3Q4UA 5HBHA 3ZRLA 4EOSA 5AFVA 3LFCA 3VS5A 3PFQA 3F3WA 3Q52A 4JVGA 4CXAA 4W4XA 1KV2A 3EZRA 3DDPA 4FNXA 4GU6A 1J91A 4E4MA 5AEPA 4UZDA 5DNRA 1T46A 2YCRA 3NCZA 2BIYA 5AUZA 2J9MA 3Q9WA 5IG1A 3LKMA 1R0EA 4YBKA 4RX9A 2Y0AA 4GT3A 2XJ1A 2YIRA 4NFMA 3ZSGA 3T3VA 2VWXA 3BLAA 3GI3A 2PK9A 2VGPA 5D7AA 3OMVA 2Z02A 3FZOA 3TI1A 4R77A 1FVVA 3LXNA 3GU5A 4BTKA 2ZV7A 4DAWA 2HOGA 4QP8A 4EH4A 5IH6A 3CY2A 3HX4A 5CZIA 3NUXA 1JBPE 1Q8YA 3PJ2A 4FOBA 3Q6UA 3U4UA 1DM2A 4M12A 1ZZLA 3VF9A 4LYNA 4C2VA 4DFZE 1ZAOA 1SNUA 3MJ2A 3OW3A 3TV7A 4BCMA 5DGZA 1IEPA 3UQGA 2HXLA 4EOJA 2BZKB 4DGOA 2J5FA 5AAFA 3LFNA 4D2SA 4FZ6A 4EOKA 4WG4A 5ITAA 5E8ZA 4BTJA 3PUFC 4MXXA 1JNKA 2XK4A 4O1PA 4BC6A 3GXLA 4D4YA 3BLQA 5EDPA 1YVJA 4O0UA 4WT6A 4BHZA 2YERA 4DLIA 2PE0A 5GIOE 3PSCA 5KMMA 5DBXA 4D5KA 5JRSA 4FKRA 4KBAA 3F7ZA 3HRBA 3I5NA 5FXSA 1YDSE 1ZZ2A 2YM3A 4HCVA 4QMLA 4YTIA 3ZXTA 2B9JA 4IJ9A 5FDXA 5AUTA 4XBRA 2IO6A 2R3KA 4PDOA 4QTCA 4HYHA 4YO6A 1IASA 4P7EA 3EYGA 4IX4A 3LXKA 5F1ZA 2IW6A 2BROA 2CDZA 4FOCA 4R1VA 1PXKA 2PUPA 3FMHA 4E8AA 3Q4CA 3QWJA 3ZMMA 1V0OA 1PMEA 4G3CA 4DGLC 4AAYA 1YI3A 4AOTA 1XWSA 3QD3A 3T3UA 3KMMA 2GNFA 3KRWA 2OFUA 4IH8A 3D94A 4XV1A 3NEWA 3OY3A 2AC5A 1RJBA 2VNWA 4CT1A 2YJRA 3G51A 1L3RE 2YM4A 3ZUVA 3QRUA 2OIBA 3ZUTA 3UC4A 4IVDA 3LM5A 2QI8A 2OZOA 2GHLA 4NW5A 1JKSA 3ORTA 4AZTA 4OTQA 3AD5A 5M55A 5BVOA 4IZAA 1JVPP 2RFNA 4FL3A 5FM2A 2QOOA 3UQCA 1ZOHA 2Z7QA 4F7SA 2XK8A 2F7EE 2XK6A 3DKGA 3OWLA 3I6UA 4F9AA 2RSVA 4RWJA 5I9WA 3POOA 1RE8A 4DGGA 4NL0A 5AIRA 1PXNA 1HOWA 2OIQA 3U4WA 4YC6A 3NW5A 3EHAA 2WMQA 4HJOA 4HCUA 4FKTA 4QP3A 4XHKB 5EYKA 1JPAA 4YJPA 2PPQA 3A7IA 4IX5A 3LXLA 4CKJA 5JZNA 4CFMA 3R04A 5L2IA 5HX8A 2VD5A 2O65A 3QBNA 3TIYA 3VJOA 5C01A 2YDJA 3L8VA 1H1RA 1H25A 4IB0A 2FGIA 3QL8A 3IDPA 4LI5A 4QMSA 4YJSA 3EKNA 1U46A 5L6PA 4ZSGA 2Y6MA 4B4LA 1LEWA 3PRFA 2FSOX 4XP0A 2W06A 4JR7A 3OP5A 2R3QA 3R0TA 3RVGA 5KO1A 3CJFA 3EQDA 1O6YA 4YJVA 5HICA 1MQ4A 4AZVA 5EM5A 2VTSA 3UQFA 3E8DA 4DDGA 4L00A 3ZFMA 1E1VA 3AQVA 4G1WA 4KKHA 4BICA 3E5AA 2PWLA 4GRBA 3SAYA 1OKZA 4XG7A 3N4TA 5IF1A 4E6CA 4DYMA 4E1ZA 3QX4A 5FBOA 3CKWA 3KULA 3ORLA 5J9ZA 2A1AB 5GZ9A 4DE4A 2C6DA 3MS9A 4IAAA 2RFEA 3R1SA 1PXMA 4F6SA 3R7VA 3R8LA 3COHA 4QTAA 2XRWA 5C27A 3PVGA 5M44A 3BYSA 4I20A 4FTKA 4QP2A 4QDVA 3VUIA 4C3RA 4XUFA 3PE1A 4YGAA 4BDIA 5EM8A 1YXSA 2ZV8A 2X0GA 3DZOA 5E8XA 3V5QA 4F1OA 3P0MA 4IMYA 2JDOA 3LE6A 3OF0A 4W9WA 5FLFA 2CKEA 4AE6A 3KB7A 2UW6A 4AGDA 2R9SA 4IX3A 2CLXA 3FAAA 2C0OA 4R8QA 3PJCA 4BCOA 3KRJA 4RPVA 4FKJA 3OT3A 4RRVA 2VO7A 5FXQA 4FNYA 4YJUA 2ONLA 3RPYA 2ITNA 4IB5A 5CU2A 4EBVA 3ITZA 3NNXA 4BIBA 2P2IA 5E8TA 3SXRA 3NFGB 5DLSA 5FTQA 4IVAA 4NM5A 2OLCA 2P3GX 4ENXA 2QOHA 5DPVA 3L9LA 4E3CA 3VUKA 1Q3WA 2YAKA 4JQ8A 3R2BA 2VNYA 2X39A 3AKLA 2W9ZB 3UIBA 4M67A 2C69A 3PP1A 5HHWA 4BBFA 3BELA 2XNOA 2NRYA 3E3BX 4CZTA 2BDJA 2QKWB 3DLSA 4FSYA 4O4CA 4ZTRA 5AX9A 1Q62A 5AAGA 3DJ7A 4RJ5A 3UNZA 1APME 1ZYCA 4FV0A 3ACJA 2XIRA 2VO6A 1PHKA 4FTIA 3SQQA 4TNDA 1Q99A 2E9VA 4YSMA 3D0EA 5AX3A 2YA9A 3VBWA 5G1XA 3RMFA 1BLXA 3WZUA 4USDA 2BHEA 2W5HA 3UPXA 5L2SA 4AXFA 4O4EA 4OT5A 4YUQA 2Z7RA 2NP8A 5IH5A 3BRBA 5EYCA 3WYYA 2BDWA 4ZSEA 1CKIA 3QCQA 3UPZA 4FG9A 4YJQA 3LMGA 1GZNA 4FEVA 4KSPA 3M42A 4QMTA 1G8SA 3B2TA 5IU2A 4IM0A 5DA3A 2A27A 1SNXA 4LGGA 4LRJA 4MYGA 2VTAA 5AV3A 3TJDA 4O7LA 2UZLA 2ZV9A 2EB2A 3U55A 4U3YA 2W5BA 4FSRA 4ANLA 5CF4A 5E8WA 4DFUA 4FTMA 5CWZA 4A4XA 3FSKA 3MA3A 4GW8A 2UVZA 1H1PA 1OPLA 5I3OA 2CKOA 3WARA 4KS8A 5I9YA 3ZO4A 1OIUA 3UDZA 3ENHA 4CLIA 5K3YA 3SV0A 4YURA 3R7EA 1PXOA 5L8LA 3NW7A 4OT6A 4FEUA 4MD9E 3SW7A 4DFXE 1M7NA 4F7NA 1DS5A 2HCKA 2RG5A 1GJOA 4FTNA 4Q2AA 4C59A 4X3JA 3UC3A 3CP9A 4L42A 5L2WA 5A54A 2QCSA 4Y8DA 4I6LA 5HVJA 3TEIA 5CX9A 4QMNA 5HLWA 2JDVA 4USFA 4BDAA 2OU7A 3BQCA 3DB8A 3CXWA 2R3RA 5CNNA 4RIOA 3QRJA 5GIPE 4EOOA 4USEA 5L3AA 5AV2A 1KE7A 3KK8A 4UBAA 4FV9A 3WZJA 4EK3A 5DOSA 4FT7A 4PL4A 1UU8A 4G6NA 4IZ7A 3UOHA 4U41A 4HGEA 5CEOA 3TNHA 3SG8A 4RLKA 4APPA 3ZC5A 3KA0A 3A7JA 4GSBA 2R4BA 3A99A 2V5QA 2W4OA 3K5VA 5DWRA 2UW0A 3DQXA 5TKDA 4N6ZA 4U8ZA 3SG9A 1ZYDA 2PE2A 2WMXA 5DG5A 4AXDA 3F5PA 3RM7A 4TTHB 2PVJA 3IGOA 3NCGA 4ERWA 5HNBA 4I24A 5F4NA 3GC7A 4Z7HA 2WGJA 4RFYA 4F9YA 3UVRA 4DEGA 4MXOA 4PP7A 4FV5A 3RPRA 5A46A 3PPZA 1PKGA 4YZCA 3DJ6A 3SXSA 2HXQA 4FSNA 2A2AA 4XMOA 1QPCA 4JL9A 3BHUA 4JBPA 3U51A 4OAUC 1M7QA 4ZJJA 1QPJA 3BWJA 3HL7A 3O50A 3PP0A 2VWBA 3PVBA 5HKMA 3P5JC 4KUJA 4GJ3A 2W1GA 3CIKA 3GU6A 5KBRA 4X2KA 3R02A 3POZA 4C4EA 2GFSA 2UW3A 3OBJA 3DXPA 4IANA 3K3JA 4O38A 1R0PA 2YM8A 3UIMA 1ZMUA 5GNKA 2O3PA 1M52A 4V0GB 4AW1A 4I5MA 4IZYA 4TWOA 2CN8A 1XO2B 3BGZA 4AW5A 4IIRA 5HCZA 3ZUUA 2W17A 5GJFA 2CCHA 4F63A 2XRUA 5IKWA 3I7BA 1FVRA 4DFYA 4P4CA 2DQ7X 1ZYLA 4E5BA 1BUHA 4BZNA 1W82A 3SX9A 4ZJIA 5ANKA 4GIHA 1MRUA 4BTFA 4F4PA 3UP2A 3D7TB 1TZDA 2J7TA 2YLEA 1XH5A 2F9GA 2Z2WA 3F3TA 5J79A 1Q5KA 1F5QA 4RT7A 3IK3A 4PUZA 5LVOA 3VS2A 3PXYA 3QZIA 4MVFA 3VS4A 3DU8A 5CAQA 3JR1A 4WNOA 3KGAA 2C3IB 2FUMA 4O27B 2IZUA 2XKDA 3PXKA 1W2FA 2XMYA 4LQMA 3U6IA 4DHZA 3D5XA 4DG0E 1UNLA 3MVHA 5HVYA 5BV3A 4PMPA 3LW0A 2JC6A 3QTSA 4CFWA 4M84A 1H1WA 3RPVA 4KAOA 3I0QA 4XYFA 4AXAA 3BBTB 3W0SA 4DG2E 5ANOA 2J4ZA 5J7HA 1J3HA 2G2FA 4IAFA 2GHGA 4FYNA 3C51A 4C37A 3GOKA 2ZDUA 3ORNA 2J2IB 4BDHA 3TM0A 2FO0A 4NJDA 4E20A 4QP4A 5HD7A 1CTPE 4LG4A 3KRLA 4C02A 4FICA 4DEBA 3OW4A 2F49A 2Y4PA 4AFJA 3OWPA 2C47A 2NNWB 4MXCA 4YNOA 5HE2A 4FIEA 1IAJA 4QOXA 2X6EA 3NUAA 4U6RA 4QMQA 5I9ZA 3E8NA 1YHSA 4IB3A 2R7IA 4ANNA 4C3PA 5AAEA 4ZY5A 1GZOA 4K0YA 5CEKA 2WKMA 4N6YA 2YIQA 3SLSA 1ATPE 4Z16A 5HLNA