3FKNA

P38 kinase crystal structure in complex with ro7125
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
349
structure length
346
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Mapping Binding Pocket Volume: Potential Applications towards Ligand Design and Selectivity
rcsb
source organism Homo sapiens
molecule tags Signaling protein, transferase
total genus 112
structure length 346
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fknA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fknA01
1OPLA 3GU7A 4EH3A 1JAMA 2HELA 1OL1A 4MX9A 4W4VA 4WUAA 3RMFA 5CNNA 4E7WA 2WMUA 3ORKA 4ZZOA 3BKBA 2ZV8A 2B4SB 3OXTA 5EYKA 4CQGA 4F9CA 2IWIA 3TNPC 1AGWA 4KWPA 3RINA 3ZH8A 4N6YA 4ZSGA 2VTMA 3RBWA 4EOMA 2OIDA 2PVKA 2YABA 4EWQA 1YWNA 5AFVA 3VULA 4NM0A 3QTQA 1ZLTA 4I21A 4JAIA 4MNEB 3UNJA 5L2WA 2YACA 2V0DA 2Y7JA 2FA2A 4QTCA 3UIXA 4WG5A 5E8UA 3SA0A 3SKCA 2C5NA 3R02A 4RC2A 3GGFA 4DEBA 5FTOA 5M53A 4BY9E 2P4IA 4BICA 2PU8A 5CAQA 4YURA 3VO3A 2GDOA 3ZXTA 3HAVA 4IJ9A 2HXLA 4N0SA 3ORTA 3RTPA 1W82A 5JN2A 2YITA 4AZWA 3VJOA 4I41A 3A8XA 1JSUA 5AAFA 3F7WA 5IQDA 4IB3A 4MYGA 4RMZA 3WF5A 4OUCA 4FOCA 5A3XA 4USFA 4YP8A 1GZ8A 3LCDA 3MS9A 3TN8A 1XH9A 3DFAA 5ITAA 1SYKA 5EM6A 3S95A 4JBOA 4I6QA 5HLNA 4XG6A 3KK9A 3V01A 1K3AA 5ANIA 3OVVA 4G1WA 4U41A 4GUEA 2W4JA 4FV1A 5AWMA 3CGOA 4MF0A 3VF9A 3CPCA 5FTQA 4EUUA 5T68A 1CKPA 3TCPA 4IAIA 4JBVA 4EOSA 2X6EA 3ZFMA 2ETRA 5CQUA 5CF6A 4IDVA 2VGOA 4YLJA 4MK0A 1YOMA 3U54A 3AC5A 4MD9E 1PXKA 1JPAA 4BCJA 3QWJA 2ITZA 3OS3A 4EH5A 3F7ZA 2H8HA 2H96A 3HMNA 4U80A 3LVPA 2H9VA 4RX7A 4RRVA 5CZHA 4FG9A 3QRUA 4IWPA 3FWQA 3MH0A 4AAAA 3ANRA 5CQWA 5E8SA 2PVRA 3WF9A 4C59A 2R7IA 1ZAOA 3TNQB 4FBXA 4TN6A 2XK6A 1FVRA 4FKWA 5HTCA 5BYLA 5BYZA 3EFKA 4J95A 2C6IA 3ZS5A 3JY9A 2C1BA 4EK3A 4BGGA 5IEYA 4DE4A 4ZLZA 3VJNA 4NYEA 5M51A 4FZAB 4F1TA 2XF0A 1YHWA 3EQDA 2QU5A 2VWUA 3C7QA 4FTTA 4RJ5A 3VBYA 2XZSA 3QTRA 5DE2A 3KMMA 3P9JA 2WQBA 4W8EA 4EOQA 1ATPE 3MA3A 1BI8A 3VRZA 4QQ5A 1NY3A 3R2BA 4C4IA 3TUBA 2F2UA 3R0TA 1M14A 4FVPA 4R7IA 5AP6A 4BZOA 5CEQA 2EXCX 3QD3A 2YWPA 3FV8A 3OD6X 4FE2A 3FI8A 2CMWA 5E4HA 3G9NA 4FV8A 4UX9A 3TZ7A 4HJOA 4U45A 4DGMA 4YZDA 2P3GX 2R3NA 4KSQA 1WZYA 3PVBA 3QZIA 5CAOA 3G2FA 5FXRA 3F2AA 4FSNA 2VX3A 4AP7A 3FE3A 4LUDA 2OBJA 4W9XA 3LJ2A 5AUWA 3SXRA 2H34A 2ITTA 5E7RA 1XBCA 4HPUE 4RLLA 4BDAA 2EWAA 4U3ZA 4IC8A 4UB7A 4RVTA 1JWHA 4ZJIA 3E62A 4OTDA 2PHKA 4ZTRA 3FZTA 3LFNA 1YDRE 2XNGA 5GJFA 3RNIA 4Z7HA 3G15A 4NM7A 4OT5A 3U51A 3Q2JA 3Q9ZA 4AN3A 3QKKA 1Q24A 3BEGA 4Q5HA 4HW7A 4APPA 5IZFA 2UZUE 3QCXA 1U5RA 1PYEA 2A19B 2C30A 4GG7A 3ZC5A 2CKOA 3EIDA 3C5UA 4F6UA 5ETAA 2XNOA 2WMTA 4BKYA 2QO7A 1W8CA 3HMOA 4DFLA 4EQUA 5I9VA 5J9ZA 5KX8A 5FDXA 1UVRA 2E9NA 3DZOA 4RC4A 4FKJA 4UBAA 4YPSA 3R9NA 3PZHA 4YC8A 5AAEA 3WF7A 1WCCA 3PDTA 5J9YA 3HRCA 3F82A 3E3BX 4BIBA 3MSSA 3KB7A 3ELJA 4MCVA 4BCPA 5IMEA 1W7HA 3FYJX 4HNIA 4BL1A 1OECA 3EKKA 3R7YA 3IG7A 5AUUA 3GENA 2FGIA 3EN7A 5EYMA 3QYWA 1H0WA 4FV0A 5A4QA 3PY1A 4DG0E 3LE6A 1CKIA 2Y4IC 4ZMEA 2QNJA 1U59A 2JIIA 5CANA 4PL4A 1VYWA 1PXIA 4ZS0A 3QRTA 3V8TA 4RJ4A 2QO9A 3VNTA 3DOGA 3IECA 2WOTA 2BTRA 2Z02A 3OCSA 3CR0A 3QKMA 2VX1A 3O17A 3RHXA 3UYSA 2E9UA 2PK9A 3QTXA 2BRGA 3O8UA 3EOCA 3ALNA 5IQBA 3G51A 3TZ9A 4GFOA 1JSTA 1ND4A 1BL6A 3S3IA 2XIRA 4L7FA 2R3IA 4PV0A 4L67A 3FDNA 2Y0AA 4AN2A 2JAMA 2I1MA 4DTKA 2R3LA 3AMYA 2VWZA 5AV2A 4LL5A 4FEQA 2BCJA 2ITUA 2PY3A 3OG7A 4EK8A 2PVYA 4EH2A 3KC3A 3B8RA 2GHMA 4AGWA 1Q5KA 3OCTA 2V62A 1GJOA 3QALE 5LARA 1FMOE 2W1GA 1XHAA 2WTVA 3FZRA 1OKVA 4PWNA 5ANEA 5B0XA 3R7IA 4BKZA 4DCEA 4O7VA 3PVUA 3FI4A 3GC8A 3ID6C 2XEYA 3KCFA 3QX2A 4YGAA 4GRBA 3Q96A 1W0XC 2C0OA 5L3AA 1GOLA 2OI4X 1E1XA 3BX5A 2G1TA 3FAAA 4BZNA 5LCJA 3GUBA 1UU7A 4FTQA 5J8IA 4UZHA 4AN9A 5DPVA 4OTWA 5E8WA 4DH1A 4PP9A 4E6AA 3NUSA 4ENYA 3SVVA 2PVHA 2F7XE 3MFTA 4FT3A 2GQGA 2BUJA 1W98A 1XH8A 2BR1A 3FC1X 2IW8A 1O9UA 2O2UA 5IQHA 4D2SA 3HV6A 4EKLA 1H01A 4GL9A 3KEXA 3LZBA 4ZY5A 5DHJA 5BX0A 3QF9A 4OBQA 4NL0A 4HYHA 3GB2A 5HICA 2BKZA 4M8TA 1QCFA 4I0TA 5A14A 3MVJA 3O50A 1JOWB 5BUIA 3QCSA 5FXQA 1H1RA 2H6DA 1JBPE 4G3CA 4YJSA 5IQFA 3T9TA 4B0GA 2XKFA 2CNUA 3SLSA 2NPQA 5HG9A 5HO6A 3W55A 3QAME 3A7FA 2HK5A 5IA5A 4AACA 5L8LA 3R04A 3C4EA 2W17A 2REIA 3HA8A 5GZAA 2BIKB 3I6WA 3RWPA 3FL5A 4BDDA 2CNVA 2WTKC 2UW9A 1GIJA 3B2WA 4GSBA 4RC3A 3BI6A 4L45A 4C58A 4HNFA 3KRLA 3N9XA 4L01A 2RG5A 3GXLA 3H4JA 2J4ZA 5DA3A 5IQGA 2XKCA 2BALA 5EK7A 3V3VA 2VWVA 2IG7A 4RIWB 2X1NA 1OGUA 3FMJA 4ERKA 2P0CA 3FKNA 3LXKA 4NTTA 4QMNA 3PE1A 3QRKA 1F0QA 2Z7RA 3DPKA 2YFXA 4BCQA 3WE8A 2W1IA 2GNGA 3E8DA 1VYZA 1S9IA 2IZRA 3KVXA 4FKQA 4YZMA 4CZTA 1ZWSA 2FO0A 2OU7A 3G6HA 3DAJA 3SRVB 4D28A 4V0GB 4JDJA 3ZRMA 3BPRA 4FV5A 3ROCA 1Y57A 2QOQA 3MJ1A 4GH2A 4FTIA 2X2MA 3RP9A 3UGCA 5HU9A 5IU2A 3VBVA 4QPAA 5HBHA 3GQIA 4CTBA 4R77A 3PXQA 3I0OA 2C3LA 2R3JA 3OY3A 4FTJA 3WBLA 2KTYA 3SG9A 4O0XA 2IN6A 4Y5HA 4Y95A 4D2VA 2VTNA 3NNVA 3QWKA 5ACBC 3TUDA 3L9LA 2UZBA 3C4FA 3LPBA 3SD0A 5CS6A 3V5WA 3VHKA 3MBLA 4EZ5A 3OT8A 4BDIA 3D14A 1JKTA 2OZAB 1JQHA 2BZIB 4FKRA 4O91A 3VIDA 1REKA 4K0YA 4Y83A 4MTAA 1H27A 3RPSA 4FVRA 4BBMA 5DBXA 2GS2A 3SHEA 1G5SA 4UYAA 3DNEA 4XJ0A 3EQBA 2R0UA 1GZKA 4EC8A 2QG5A 4USDA 5E8YA 3ITZA 4GFMA 4R1YA 3DBCA 5FLFA 3C4ZA 3BV3A 3T9IA 5KMNA 2WO6A 4ANNA 1PXOA 5D41A 2YA9A 3M11A 4DITA 3UIBA 2A27A 4F9WA 5J79A 5CX9A 3PXRA 2CNQA 4U43A 3DK3A 4YZ9A 5AADA 2Z8CA 3B8QA 2BDFA 3PPKA 4I4EA 5CSXA 2PMNX 3BE9A 3F3WA 4IXPA 3TKIA 4FKTA 1U5QA 2G2IA 4JBQA 1HCKA 2UUEA 4NZWB 3LMGA 4OTPA 3THBA 3V6SA 3HKOA 3U4UA 2E9PA 2WTCA 4IQ6A 4JDKA 4HCTA 4QT1A 3FZOA 3DK7A 5IKWA 4Y73A 2BDJA 3MTLA 4JQEA 4DEAA 3R9OA 2FB8A 5K9IA 3R1QA 5IF1A 2ZV2A 4JOAA 5E9EA 5K5XA 3QQLA 1LPUA 5D12A 5I0BA 4EYJA 5IQCA 3F3TA 4D4VA 2ERZE 5HQ0A 4RZWA 4IX4A 2QOHA 5C4LA 4C3FA 4QMQA 4HGSA 3OCGA 2UW4A 4RPVA 5CXHA 4LMNA 2XJ2A 4U44A 2QG7A 4QYGA 5LVMA 4NJDA 2C3JA 5IA2A 3AC8A 3EN5A 1IAHA 3GVUA 3TZ8A 5HLPA 4F9AA 3QUEA 3ZEWA 4FGRA 5H2UA 4BCOA 2OFVA 2WQNA 4IVCA 3TG1A 5EQYA 1QPEA 3GU4A 4TYEA 4BYIA 3OHTA 4P5QA 4PMMA 3K3JA 3TL8A 3OC1A 3MFUA 4QD6A 2R2PA 3OF0A 1J3HA 3VS0A 4HVGA 4AE9A 1OPJA 3PWDA 3U6IA 3HZTA 4NEUA 4CNHA 2J5FA 3OCBA 2PVMA 2W7XA 3LCKA 3S2PA 3S4QA 4BDGA 3UC3A 4YUQA 3GOKA 4EKKA 3IOKA 3QU0A 4NFMA 2X81A 4BDHA 4E93A 2I7QA 4AU8A 3PTGA 4IX5A 3E8EA 4D55A 4L00A 3E88A 1Q62A 4HGLA 2GNHA 5K0KA 4I0SA 2WIHA 5CAPA 4QMWA 3CKXA 5CF4A 4U97A 4C3PA 4R8QA 5FRIA 3MH1A 3ORPA 3NVMB 4GK4A 3H0YA 2QHNA 2XEZA 4TYJA 1T45A 3ENHA 3UBDA 1F3MC 2HIWA 2W4KA 4ZK5A 3TTIA 3PIZA 4WOVA 4GV1A 4U7ZA 4FV7A 2JDVA 2XUUA 4MQ1A 4QMPA 4XLIA 1QPCA 4RIXA 3ZEPA 3FY2A 4A9TA 3DK6A 3A99A 2CGVA 4J97A 4CT2A 5IPJA 2Z60A 4LOOA 5JSMA 3NUNA 4XLVA 5ANGA 3KXNA 4FZDB 3O23A 3FLQA 1E1VA 2I0VA 3KREA 4TYHA 4H05A 1UU3A 2C6KA 5TO8A 3UG1A 4M68A 4QP9A 4ZTMA 3P79A 4XG9A 5AP7A 3UVRA 4D2PA 1U54B 2PYWA 1YW2A 2ETKA 3D7TB 4FKPA 4IX6A 4QMVA 4RWKA 4A4XA 4G6LA 3EH9A 2WOUA 2OJ9A 4LGGA 4CG8A 3VBQA 3HEGA 1PMVA 1DM2A 3MIYA 4DC2A 4QP4A 1PF8A 3KCKA 1ZARA 3DFCB 3Q04A 4S33A 4A9SA 3UPZA 3GCSA 2XNNA 2OWBA 3ORXA 4J8NA 1BX6A 4ANOA 4BF2A 2WFYA 3FBVA 4MXOA 2VZ6A 4RX5A 3UPXA 3FKLA 2ZDUA 1H1SA 4FZ7A 2CJMA 3MTFA 2YJSA 4GFGA 3UIUA 3HV4A 3R2YA 3TDWA 1JKSA 1AQ1A 3FMMA 4FKGA 2OF4A 3LFBA 3OP5A 3ZSIA 4O0VA 4PDYA 2OGVA 3R9RA 4X3FB 3SGCA 1J1BA 4TYGA 5ANDA 2J2IB 3ZBXA 1YI6A 1OM1A 1R3CA 4XP2A 5KZIA 4LQMA 3UYTA 3H9FA 5E8ZA 5JFVA 4C7TA 3ZLYA 5EQPA 2JKMA 2XA4A 4YR8A 5AP2A 4IB5A 1OL7A 2FYSA 2QKWB 5C8MA 3QUDA 4MEDA 4DT9A 1PKGA 4JLCA 2X39A 5E8TA 3R7UA 5HZNA 3QX4A 2HYYA 3TNIA 3WZKA 5G6VA 1J7IA 3PRIA 3LFCA 3VS3A 4AW1A 4ZSLA 3KF4A 3ORMA 2Z7LA 4CQEA 4ZY6A 1B38A 3OZ6A 2PZIA 3RK9A 4BZDA 4EONA 4ZTQA 1K2PA 2PMOX 5F1ZA 3ORNA 3PIXA 5D7AA 4AOTA 2PMLX 3NAYA 4LMUA 5CT7A 4DG3E 2W1CA 3MI9A 3OOMA 2VRXA 3A8WA 4A7CA 4A9RA 2W1EA 2NRUA 3FSKA 4AOJA 4DH5A 3MY5A 5DT4A 1PY5A 4PNIA 4EEVA 4IZYA 3OW3A 5F95A 5BVFA 3UTOA 3NIEA 3W2OA 1M2PA 1UU8A 1YWRA 3GOPA 4GK2A 4E8AA 2YIYA 4WSQA 4BWPA 3WF6A 3CQWA 3FQSA 2OSCA 5AP0A 3QD4A 4F7JA 5M09A 4QYHA 2VNWA 3F3UA 4YJRA 1WBTA 5CWZA 4UMUA 1RQQA 5LXMA 3Q4TA 2PZ5A 3OWJA 2XYNA 4NH1A 4E5BA 3DKOA 3UOKA 4BFMA 3CLYA 3REPA 4D5HA 3W32A 4DEHA 3TUCA 2OK1A 2BAQA 2OXDA 3AC4A 3QLFA 3R7GA 4O0RA 5EDPA 4JX7A 5J7HA 5CLPA 4F4PA 3NS9A 4QMYA 5FQDC 2O0UA 4O7SA 4KIKA 5KZ0A 4DA5A 4TWCA 4N70A 3ERKA 3NYXA 2J0IA 2VU3A 2UW6A 2WMAA 3GCVA 2DUVA 4AGDA 3UZRA 4AXAA 3TZMA 2J0MB 4EOIA 4YHFA 3LCSA 3UQCA 1SMHA 3HP2A 4GU9A 3RPYA 3OBJA 1FINA 4HCUA 5I5ZA 4F08A 4ZJVA 5HO8A 5FGKA 4CCUA 1UKIA 4MBIA 3NNXA 4DBXA 4ONAA 2ITQA 3KL8A 5KO1A 3BLHA 3CE3A 3BHVA 3OOGA 4FSZA 2RKUA 4FMQA 4KA3A 3ZO3A 2RFEA 3LFFA 1KWPA 4CFXA 4CFFA 2V55A 3C0GA 5C01A 3AXWA 3VQUA 4NCTA 4I94A 2F2CB 3AMBA 2OXXA 2VO3A 3D5VA 3PYYA 2J51A 2ZYBA 3PJ3A 4KRCA 4E4LA 1UKHA 5JFXA 1HOWA 4CV8A 4FODA 5K3YA 3T3VA 4Y85A 4S34A 3Q9XA 4CTCA 2R5TA 4BTJA 5IUIA 1PXPA 3W2QA 4Q5EA 1SVGA 2CGWA 3KMUA 5D7VA 5J5SA 5CTPA 3C50A 4ZEGA 4QQTA 4B4LA 4H3PA 5IA0A 4YO6A 4QYYA 5FWKK 1VZOA 3QQGA 4RVKA 3VUKA 3W2RA 3HVCA 2BAKA 4IVBA 4NKSA 5CALA 1UU9A 1Q8UA 3RPOA 3VS2A 1JLUE 3DDPA 2HY0A 2WKMA 4FNZA 5AUTA 4M84A 2CPKE 4FSMA 3TDVA 4C4HA 2WB8A 3UIMA 2J0JA 4YJQA 4XOYA 5KCVA 2P33A 2YHVA 3DA6A 3F61A 3DXPA 3FLSA 4ZTLA 3F5PA 4BBEA 3L8PA 4FVQA 2GNJA 2CKPA 5LJJA 4FTLA 3P7CA 5F4NA 4APCA 2WMSA 3MJ2A 4RA5A 2YN8A 4F7NA 4YTFA 3A7IA 3FLYA 4B8MA 3WYXA 1F5QA 4FTMA 3L8VA 4G3FA 1JKLA 4YHJA 4X0MA 2C0IA 4QP3A 4O81A 2EXEA 4GIHA 3SDJA 4RZVA 2VO0A 3PE2A 5EOLA 2XM8A 2WQMA 2C3KA 4OTFA 3V5LA 2B9HA 4DFUA 4HCVA 4CXAA 4JIAA 1YI4A 3NUXA 3U87A 3ZUTA 3EFLA 5IDNA 4PPBA 4BI2A 4NJ3A 1AD5A 4RT7A 3V5QA 2Y9QA 4GT4A 5HIBA 5EQEA 3CC6A 2C6LA 3BWFA 2VWWA 2VTQA 4Q2AA 2JGZA 5M4CA 3EYGA 4HGTA 4PMPA 3E92A 2C5XA 2X2KA 3A60A 4GKHA 2ITVA 3SW4A 2YZLA 4RIOA 3G6GA 4ZTHA 3G5DA 1OB3A 1Y91A 2XNMA 4DEEA 4DLJA 3MYGA 3AD6A 5IG1A 4G6OA 4EUTA 2YJRA 5K4IA 3RCJA 4C4FA 4FT9A 4CMOA 3CXWA 4HYSA 3VVHA 1A9UA 4D9TA 2R3MA 4MBLA 3LW0A 2F4JA 3O51A 4UMQA 4ZLYA 2C5OA 3C5IA 1Z9XA 3UC4A 4YO4A 2QU6A 1O6LA 3MWUA 4II5A 4F9BA 1G3NA 4YJUA 4AZSA 3IONA 5IA1A 5DIAA 2ONLC 4RJ7A 4X2NA 4KB8A 2RF9A 4YTHA 5HBJA 5KHXA 4PMSA 3VF8A 4FIJA 2X6DA 3HV5A 2E9OA 2XJ1A 4AZEA 2RG6A 3OWPA 2IZUA 4LOQA 5GIPE 3QGYA 1KV1A 2J50A 3E3PA 4IHPA 2JBPA 4O86A 2BHEA 4JDHA 5DT0A 2R9SA 4MD7E 2X8DA 4ZP5A 2JKOA 3NVKI 1KSWA 4GVAA 4KRDA 1OKYA 3Q53A 5A6OA 1B39A 4J98A 4CFUA 5AMNA 1I44A 3QQJA 4CFNA 5HVKA 4L44A 3ULIA 1IR3A 4QNYA 4QOXA 4DH3A 1YXUA 4E20A 4RWIA 3MW1A 5CU2A 4IMYA 1BUHA 3PVWA 5M55A 5CEMA 4DN5A 2BFXA 3LAUA 1WBPA 3HX4A 3W16A 1ZY5A 3GU8A 3W1FA 3ZCLA 3RAIA 4XBRA 2VWYA 3EN9A 4XG7A 1NT2A 4DTAA 1MRYA 2UVYA 4KKEA 2BTSA 4AQCA 3WZDA 1PW2A 5BUEA 3NW5A 5CT0A 1ZMWA 3EQRA 3CTQA 4FG8A 3VN9A 4GS6A 4WO5A 1CTPE 4BRXA 4G16A 1ZY4A 3F3ZA 3M42A 2VGPA 2X7FA 3VAPA 4G9CA 2A0CX 1PMUA 3IW5A 5HX6A 2UW3A 3KRJA 5J5TA 4G31A 5BPYA 3FLZA 4IIRA 4AT3A 4C02A 3EHAA 5K0XA 4ZTSA 2GNIA 2OW3A 1SNXA 3ODZX 1KUTA 5DRDA 4N4SA 2UW8A 5AUXA 2FSOX 2ZMCA 3Q6WA 4PPCA 3FC2A 4Z16A 4RJ8A 4BDCA 5EFQA 3VBXA 3CGFA 4FZ6A 1OKWA 5CVGA 3T8OA 5A6NA 3MPTA 4FKOA 2GHGA 2I0EA 3ACJA 2QOIA 2YAAA 4O0WA 4DGGA 5DG5A 2W1FA 4J96A 2NO3A 4FV4A 2VTTA 1ZYDA 5I9ZA 5DR2A 3U55A 3RI1A 3I5NA 3QTSA 3IPHA 1Q61A 4O0UA 4XS2A 3FPQA 5EYDA 2GFCA 4J52A 4B7TA 5KMLA 3GQLA 3BZ3A 4GUBA 2O5KA 3PPZA 1XH5A 2WD1A 4GVJA 4NM5A 4O6LA 1GNGA 5J95A 3QQUA 4R3RA 4IW0A 1H07A 5JRQA 2WXVA 3KU2A 4S31A 3RAHA 3BHUA 4EBVA 5CU6A 5AUYA 1OVEA 3IDCA 2ERKA 4FTAA 3SQQA 1Z5MA 3RZBA 1FGKA 3CKWA 4I1ZA 1M52A 2AC5A 2OICA 4A4LA 3BYUA 4XV3A 5A9UA 5DI1A 1FGIA 4M13A 4GIIA 1STCE 1YXTA 5CVFA 5HNGA 3A62A 1G8SA 2Y4IB 5M44A 3PSCA 4E1ZA 5DR9A 1ZZ2A 3FEGA 2B7AA 3JYAA 2GPHA 5AIRA 3O0GA 4FUXA 4MNEA 4AUAA 3TIZA 3FQHA 4I3ZA 4YSMA 4CSVA 4EHZA 1LEZA 5C9CA 3E8NA 3UQFA 1I09A 2VWXA 4YLKA 3R8VA 3LLAA 3R8ZA 1V0OA 4XOZA 3ZFYA 3K2LA 2J6MA 4R1VA 1UWJA 5HI2A 2R0IA 1FQ1B 1M2QA 2B52A 3C4XA 3ORZA 3NYNA 3EFJA 2WMQA 2W5AA 4WIHA 5HHWA 3ZUUA 4RIYB 5L2SA 4NSTA 5CEKA 5FD2A 5HLWA 2F7ZE 3V5PA 2ONLA 2R3FA 3W2PA 3W2CA 4A06A 1J7UA 2G9XA 3IKAA 3U6JA 4PP7A 2QOOA 2PZPA 4MWIA 1KE6A 3WE4A 4NM3A 1JNKA 2PL0A 1OIQA 2WIPA 3PP0A 3M1SA 4DF3A 3LCTA 2WMRA 4YZNA 5CAUA 3JVSA 4GKIA 2X4ZA 2UZNA 5JZNA 1ZOHA 4F6WA 3POZA 4J1RA 4HVDA 4AOIA 4K9YA 4E6CA 4L46A 1T46A 4FYNA 1WBOA 1DAWA 2UZDA 4CKIA 4AZVA 5KMJA 3L8SA 3LFSA 3AGLA 2YCRA 2V7OA 3JR1A 3GCQA 3HUBA 5AV4A 4O7NA 3R8LA 4J53A 2I6LA 4K11A 3IW4A 4DG2E 2VTPA 4BTFA 4FSQA 5GINE 3WYYA 3CQUA 4KNBA 3CCNA 3AC1A 1YI3A 4JG8A 3OFMA 4DEGA 3EL7A 4LYNA 5JKGA 4H1JA 4FIFA 4UY9A 1LEWA 4JNWA 3NUUA 4TYIA 5E91A 4K18A 4I6FA 4FL3A 4MAOA 1UNLA 1YQJA 3JVRA 2HENA 2GQSA 4MXYA 3FHIA 2GHLA 3IDBA 3VUDA 4YTCA 3C4WA 2ETMA 5BUJA 3QZFA 1QPJA 4YJNA 3EQGA 3NSZA 1A06A 1KE7A 3MPMA 1Q8TA 4I93A 4UMTA 2OZOA 2GNFA 1NW1A 1YXSA 2WTKB 1JVPP 2BFYA 1OI9A 4JIKA 1DS5A 5FXSA 3VBTA 4CFWA 5IISA 4ZMFA 5C27A 3NGAA 2OG8A 3BYOA 4K1BA 1ERKA 2VTOA 3FLNC 4JI9A 5DLSA 3FSFA 4WBBB 3RK7A 2AUHA 2VTAA 3HRBA 2HCKA 4PDOA 4W4YA 3WIGA 4MXXA 4KIQA 4J71A 4C4JA 5J1WA 3VS6A 4HOKA 2B9IA 4DFZE 4FG7A 3R8UA 4AZFA 3IK3A 2XIZA 4Y46A 3TV6A 4QTEA 3EQIA 4PTCA 5TT7A 1MRUA 3GCUA 3P7BA 2HOGA 4IFCA 3ZLWA 3HECA 3FXWA 1CSNA 2BILB 4XYFA 5M08A 3HA6A 1WVYA 4P7EA 3R83A 2C6MA 5A4LA 4FL2A 2J0KA 3BWJA 4FKVA 3IQ7A 3SC1A 1TQMA 3DTWA 3RM7A 4XG3A 2WQEA 4KIOA 2XRWA 3TEIA 4TYHB 3DGKA 3I0QA 4MWHA 1JSVA 3DV3A 3W8QA 1MUOA 4L52A 4R3CA 4UALA 2VWBA 3LHJA 3Q4CA 4G34A 4PDSA 5HG8A 2VTRA 3N51A 4I23A 4TZRA 2JD5A 3DBQA 3MVLA 3DY7A 5B2KA 3Q60A 3KRXA 3P23A 4M67A 4XUFA 2VAGA 5B7VA 3VS1A 5EHYA 3AGMA 1PYXA 4EL9A 4F0IA 4L43A 4C62A 4O7LA 3NUPA 3CBLA 5AA8A 4CT1A 2WZJA 4ID7A 3OROA 2DYLA 4I5MA 3COMA 3O7LB 3L9PA 3L1SA 2QD9A 4R3PA 2JDOA 3BGQA 2O63A 4QYFA 3ATTA 3TM0A 2QCSA 5HX8A 4O84A 3UOLA 4ZSJA 2EB3A 4BVUA 4DEIA 2ZM3A 4PF4A 4WG4A 1SVHA 4FSUA 4ALWA 3TT0A 4FIEA 1OPKA 4O7RA 3LOKA 4IAZA 4UEUA 5J9LA 3GT8A 5HE3A 4FI1A 2B9JA 4C33A 1BLXA 4TPTA 5H3QA 2ITYA 3QTUA 1XH6A 2HZNA 2XIKA 3P7AA 3KULA 2WELA 3O2MA 2WQOA 4IANA 3SG8A 3RHKA 5CEPA 2IJMA 2YCSA 3BU5A 4CKRA 3UNKA 1XBBA 2ITXA 4JXFA 5LCKA 4FC0A 3O71A 5HD4A 4BWXA 4QQJA 5DYJA 5IH4A 5ANKA 4FNXA 2BZHB 4O0SA 4ZAUA 3QD2B 4V04A 3RJCA 4L53A 4AW5A 5IQEA 4YLLA 4OW8A 3MVHA 3ZO4A 3RALA 3F69A 3KXXA 5D10A 4XV2A 1UNGA 5DOSA 5AR3A 3QGWA 4B8LA 4IAAA 3V5JA 4ASZA 4X2JA 4QQCA 3FL4A 4ZSAA 2NRYA 5M4UA 3RKBA 3UZPA 2CGUA 2OH4A 4IFGA 4JVGA 4O22A 4XMOA 4A4OA 3BU6A 4CMUA 4PX6A 4FIIA 3ZM9A 3LFEA 3PXFA 5M56A 3D2KA 4EORA 3VW8A 3POOA 4O38A 5IUGA 3DQWA 3HAMA 5BVKA 4XV1A 4TT7A 3F2RA 3LQ3A 5HO7A 2O3PA 1IA8A 3LM5A 4IBMA 3HRFA 3DBDA 4L3LA 4AW2A 4H3BA 4BR3A 2YDIA 5HIDA 3OEZA 4H58A 5GZ9A 4IM3A 4P4CA 1ZYLA 3F9NA 1KOBA 2E2BA 4YJPA 3M2WA 3MFRA 4AA5A 5KUPA 2W99B 3BCEA 3FI2A 1VJYA 4CMTA 4KUJA 5EYCA 3NMUF 2WU6A 2AYPA 2QO2A 3LXLA 4ARKA 4FKIA 3DLSA 2W1HA 3V51A 4GJ3A 5EH0A 1ZRZA 3I6UA 3AD4A 1HCLA 4FTCA 5CENA 4ASDA 1GIHA 2WMVA 2WPAA 4FV3A 4DFXE 5IDPA 4OGRA 1M7NA 4OAUC 5I4NA 3LXNA 4IWOA 4M12A 4U3YA 4L42A 5FM3A 3SXSA 4A9YA 3UOHA 3DAEA 1L3RE 4QMXA 3PRFA 4P2KA 5M06A 4WNOA 3VUIA 3NUAA 4PTEA 4CEGA 3KK8A 3EZVA 4PUZA 5IH5A 4AE6A 4FSWA 4AT4A 1R0PA 4L6QA 2YIRA 5CVHA 3QL8A 4L3JA 1ZMVA 2BDWA 4WHZA 3UDBA 2NNWB 3V04A 4PNKA 5LOHA 3R8PA 1PXJA 2XP2A 3DNDA 2IW9A 5BMSA 3MFSA 4IZ7A 3PY3A 2W96B 2QLQA 4QMLA 2XH5A 4NCTC 5L4QA 4KAOA 1LUFA 2RFNA 5AAGA 3R7OA 2YM7A 3RPRA 1WBVA 3CY2A 4D1SA 4F6SA 2RFSA 1FVVA 2W9ZB 2QHMA 3BQRA 3D4QA 3P08A 5CU3A 3SRVA 4E6QA 5HIEA 2QR8A 3PVGA 5A4EA 3PSDA 4V0GA 3LCOA 5E8VA 1YKRA 3QQKA 3PP1A 5JGBA 2QOBA 3QD0A 4RWLA 1GY3A 3GU6A 3OWKA 3PXYA 4EOLA 3H0ZA 4G3GA 4KS7A 4GK3A 3GC0A 3GBZA 2WMBA 1OMWA 3FMKA 3TNWA 3OBGA 3ALOA 5JRSA 5IQAA 4ACDA 2W9FB 4LG4A 4RWJA 2CCIA 2UZEA 4J8MA 4C4GA 2YDKA 4C4EA 5M07A 3F3VA 2QLUA 3MESA 5GNKA 3UVQA 4WKQA 3F5GA 4K6ZA 4QPSA 5AM7A 5JEBA 5KKRC 5L6OA 3OUKA 4AGUA 3DCVA 3SOCA 3QFVA 2OZAA 2FSMX 2BHHA 3QCYA 4RVMA 5HVJA 4EH4A 1ZZLA 4G3EA 2OH0E 3U4WA 1O6KA 3EMGA 5IMXA 4U40A 3BHYA 3FMDA 1BKXA 1U4DA 5DVRA 3ZDIA 3NR9A 4D1XA 4FT0A 4Q9ZA 4N57A 2X2LA 3COHA 2OFUA 4CLIA 1PHKA 3DQXA 3AT4A 4RJ3A 3EZRA 3QA8A 4FTNA 5G1XA 1ZOGA 1YDSE 2GCDA 2WTDA 5EDRA 1SVEA 4RVLA 1R0EA 3CJGA 4XHKB 4OTGA 3TV7A 4K77A 4AFEA 2R3QA 2PUIA 4XG8A 3DLZA 4DYMA 4Y72A 4UWCA 4ZY4A 5HG5A 4FK6A 4MBJA 4XX9A 1PMNA 4G9RA 4IZAA 3R22A 4FTKA 3W8LA 4ACHA 5ETIA 4S2ZA 1K9AA 5HESA 3H9OA 1PMEA 4AG8A 5EHOA 4D4SA 2E9VA 3PPJA 2UW7A 3JY0A 4CFVA 5A4TA 1P14A 1Y8GA 2XMYA 3BU3A 4ASEA 3GEQA 5CU0A 3PZEA 3CIKA 4HVSA 3A7JA 5CSWA 5HCZA 5AR2A 4QTAA 3V5TA 4O82A 1J91A 5AA9A 3VS5A 3OT3A 1MQ4A 2ZV9A 5M4IA 2SRCA 1Y6AA 1M17A 4WBOA 5E1EA 3D7ZA 5IH6A 3ODYX 4M15A 5HD7A 3EKNA 3S0OA 3RWQA 2EXMA 5JQ8A 3UVPA 4DAWA 4E5WA 4I6HA 4MXZA 2BRMA 2XM9A 4HGEA 4HZSA 1BMKA 3KY2A 3PA5A 4HVIA 2X0GA 2R3OA 2W06A 4OBPA 2Q83A 5IQIA 4FTOA 4O7ZA 4EQCA 3I5ZA 3G0FA 4JRNA 4R6VA 5I9UA 2IW6A 2VN9A 3MB7A 4RJ6A 3RM6A 3GCPA 3UP2A 2R64A 5CSVA 3PJ1A 4BKJA 2C1AA 3BEAA 3DDQA 4ITIA 2JEDA 4BCHA 3AT2A 3KN5A 3O8TA 5FEQA 3CJFA 3EQCA 2DWBA 5HEZA 3NLBA 3FMHA 2VTLA 5K5NA 4GW8A 3N4VA 3E7VA 5JQ5A 4FIHA 5JT2A 5EG3A 2F7EE 5LWMA 2PE2A 2WNTA 4P5ZA 3K3IA 1OL2A 3ZUVA 1Q41A 1FVTA 1WBSA 2PE1A 3DXNA 3G9LX 3D2IA 3BLRA 4KBKA 4M0ZA 3NNWA 5EM8A 4C57A 2ZVAA 4XP0A 3TWJA 5GJGA 2YM3A 2BRNA 3FZPA 2X8IA 3CTJA 2CDZA 3PY0A 5K4JA 4FEUA 1P4OA 3DBEA 1KE8A 5H8BA 1R39A 1OIRA 4G6NA 4GG5A 2YIXA 3OY1A 1V0PA 5EW9A 4WRSA 3R9HA 3V6RA 2BAJA 3HV7A 1YWVA 2OO8X 5E8XA 5H8GA 4UMPA 5CF8A 5CEIA 4JRVA 4M97A 2BRHA 3MGYA 4FKLA 5AX3A 1Q8ZA 1YXVA 3Q3BA 5HE0A 2CKQA 3HGKA 3QXOA 4KABA 4TWPA 3COIA 4BCKA 4TL0A 2HXQA 4NIFA 4PL5A 4YMJA 4GU6A 3FZ1A 3K5VA 4NTSA 3TJCA 2RFDA 3KXMA 4IM2A 3C0IA 4QRCA 3ZDUA 5KMMA 1ZYJA 4ITJA 4I5PA 5DMZA 2QONA 4F99A 1H26A 2PSQA 3MV5A 4D2RA 2WHBA 4ENXA 1OL6A 3NW6A 4O6EA 2XK3A 4NFNA 2Y6OA 5F94A 3JXWA 2CN5A 3NCZA 3S1HA 3LMHA 2UW5A 3P86A 3QQHA 5LVPA 3QQFA 5HORA 4C34A 4M69A 3TXOA 1OIYA 1U54A 2DS1A 5JMSA 3D7TA 1CDKA 1UV5A 1QPDA 1YRPA 2C69A 2VO6A 3PG3A 2F57A 3W33A 3R21A 2VV9A 3U6HA 2I0YA 3P1AA 4BDKA 3LFQA 1Q8YA 2OJJA 3II5A 2VWIA 2PWLA 3IW6A 4LM5A 4UXLA 4F63A 3Q5IA 4D4YA 1A48A 2BRBA 2BZJA 4OR5A 4X2FA 4D0XA 2PULA 3VS7A 4X3JA 3ZSHA 4CVAA 2WTWA 3LFDA 3NW7A 4XG4A 3BYMA 2EB2A 4ZTNA 3SV0A 4C37A 5TKDA 1H1QA 1WAKA 5FBOA 3GI3A 4C3RA 4H39A 3VS4A 2JIUA 3Q4UA 1ZYCA 3D0EA 4G5JA 4IZ5A 2GS6A 5FM2A 1P5EA 1YVJA 5AJQA 2QODA 4EH6A 2XKDA 2W0JA 1GZOA 3E7OA 4I6BA 2R3PA 4BCMA 2GU8A 4X3FA 4TWOA 3G0EA 3BRBA 3SOAA 2XK4A 4RFZA 2OJGA 5CSHA 2RL5A 2YM5A 5HE1A 2YCFA 4AGCA 2B9FA 4RFMA 4DINA 3KGAA 4AF3A 2A4LA 4ANSA 4CD0A 3GC9A 5JZJA 4DGOA 1GAGA 3KKVA 5CAVA 4H36A 1OBGA 3L9NA 2QOCA 5LMBA 1IG1A 3R8MA 2ACXA 2Z2WA 3FMEA 2WMWA 3S00A 2X9EA 4IVDA 4KKGA 5TF9A 2IVVA 5KBRA 4HZRA 4IWDA 2JIVA 4IAYA 5HKMA 4C2WA 4S32A 4CZUA 4E4XA 4YC3A 4EZ7A 2RSVA 4C38A 2HZ0A 2YM4A 2PTKA 3FY0A 5HTIA 3BELA 3B2TA 1X8BA 2V22A 4OTIA 3PJ2A 3OUNB 1M2RA 1ZXEA 4RA4A 3BE2A 4LOPA 5ANJA 3WZUA 2DQ7X 2J7TA 3FQEA 2YM6A 4AX8A 2B55A 4O27B 1H1PA 3Q4ZA 4TWNA 1LP4A 3C9WA 1W84A 5J87A 4EH7A 3FJQE 3NWWA 3PXZA 3Q5ZA 4FSTA 3BV2A 4F1OA 4CLJA 4R7HA 5IUHA 3Q32A 5AV0A 3QHWA 4FIGA 5C8NA 3PJCA 4F09A 5LQFA 4YSJA 3P4KA 3FZSA 4YZBA 2R4BA 4BN1A 2O65A 4RSSA 4XNEA 5A46A 1IAJA 2JKKA 3E93A 3O7LD 4KBAA 4FEXA 3NDMA 2CKEA 3R30A 4L68A 3OWLA 4BDFA 3HDNA 4IEBA 4EK5A 3DAKA 3UO5A 3UZTA 3R7VA 3ZLSA 4Z55A 3R1NA 4K8AA 3TJDA 3C4CA 3ZRLA 2IZSA 2JAVA 2XNPA 3MH3A 1URWA 4QNAA 5I9WA 1WVXA 3OTVA 5EW8A 5AV1A 4ZZNA 2YIWA 2XK7A 5M4FA 4TKSA 3ZC6A 1KV2A 4EYMA 4WUNA 1RJBA 4O0TA 4YPDA 4BCFA 3L8XA 4CYIA 1YOLA 5AIKA 3CD8A 2QURA 2VTIA 4O2ZA 4PTGA 4XP3A 2JFMA 4L8MA 2C0TA 1IEPA 4YJOA 2JDRA 2IVSA 3TI1A 2VO7A 2CLQA 4QMMA 3KRWA 4D4RA 3ZHPC 4AWIA 4C2VA 3DXQA 3UE4A 2OJIA 2UVZA 3DT1A 4G2FA 4E4NA 4F65A 2C68A 3C1XA 4QP2A 1NVSA 1MP8A 5IEVA 5FTGA 2X7OA 2PVLA 2W1ZA 4ACMA 4E5AX 4PDPA 5ACKA 4FNYA 4FTUA 3RAKA 3BQCA 4V05A 3QZGA 4ITHA 2NP8A 5BMMA 2C6EA 5GZ8A 4EHGA 3EWHA 3MA6A 2YAKA 2YEXA 3MDYA 3QHRA 1OUYA 4Z3VA 2W05A 2W5HA 3I7CA 1PXMA 4R5YA 3VUHA 3C0HA 3IOPA 3QTWA 2QOFA 4MNFA 1VR2A 2ZB0A 3P0MA 4IVAA 5AP4A 4KS8A 5AM6A 4I5HA 4AA0A 3DKCA 3BGPA 3LJ0A 4MH7A 4JQ8A 2GMXA 3R7EA 4D58A 1GZNA 3TKHA 3IW8A 3LM0A 4M14A 3QUPA 2XBJA 1UNHA 4X6RA 4QMZA 3W18A 2OIBA 5HOAA 5DR6A 4J7BA 4C35A 2V7AA 3QLGA 3R00A 5JFWA 3ANQA 3PUPA 1XBAA 1XQZA 2V5QA 3SXFA 4Z7GA 3WI6A 5CASA 3ROYA 3TTJA 5CEOA 2YLEA 2OKRA 3D5XA 2CLXA 2Y8OA 1DI9A 3GFWA 5CY3A 2XVDA 4ERWA 3MB6A 4FA2A 1PRYA 3G33A 2XCKA 2JLDA 3MIAA 4FOBA 1IRKA 1P4FA 4XEYA 3Q52A 4GYIA 4DH7A 3D9VA 2VTJA 3KRRA 4IAKA 4EC9A 3I81A 3CEKA 4O96A 4C0TA 2XIYA 5B2LA 5DEYA 1KE5A 2LAVA 3FPMA 1H08A 2HZIA 3GU5A 5FEEA 2Q0BA 4YZCA 3FMLA 3RAWA 1Y8YA 5I3RA 4IJPA 5EW3A 4ZS4A 2VTHA 3PFQA 2HW6A 4FSRA 4EOJA 5EI8A 1H4LA 5GHVA 2BPMA 4JBPA 1RE8A 4QMTA 2W5BA 3ORLA 4FV6A 4IADA 3G90X 1RDQE 3FXXA 4DGNA 2HWOA 3AOXA 3LXPA 3EQFA 5M57A 1FOTA 2JITA 1CMKE 4M7IA 4CG9A 3HL7A 3AC3A 4YU2A 2HAKA 3U8WA 3LKMA 5HU3A 2UW0A 2YISA 4DBNA 5CI6A 5FEDA 4IX3A 3R63A 4JDIA 3IW7A 1Q4LA 5I3OA 4ZZMA 4BTKA 4S30A 5DFPA 5T3QA 3GNIB 4JQ7A 2UZLA 4KSPA 5BYYA 4ASXA 3MH2A 3SAYA 4DLIA 4IDTA 4EZ3A 3EYHA 4I92A 3DJ7A 3QC9A 4NWMA 4O1OA 2ZM1A 2UVXA 5FBNC 3BLQA 5E1SA 3D83A 3SX9A 1RW8A 3HMPA 3HMMA 1MRVA 4FT7A 3KF7A 5AEPA 5L8KA 5HGIA 3A4PA 3H3CA 3HYHA 3KULB 2WEVA 3NPCA 4D2WA 3UMXA 4EJNA 2C6DA 4JG6A 3QRIA 3V8SA 3MY0A 5EKOA 3ZLXA 1H1WA 3EJ1A 4BWKA 1NXKA 3KVWA 3I7BA 3TV4A 4R78A 1VEBA 4CV9A 3W10A 4BI0A 4RX8A 5AUVA 4IAFA 5E92A 5AR7A 4YBJA 3ZZWA 2PUNA 3HV3A 3DTCA 5TR6A 4UMRA 2OLCA 4CRSA 2G01A 4BHNA 2GSFA 3QRJA 5C1QB 4OBOA 4EWHA 2YERA 1NVQA 2F49A 1R78A 2C5YA 3WOWA 5CU4A 1XJDA 4ACGA 3ZFXA 2JDTA 1V0BA 5JH6A 2ITNA 2UZVA 3KFAA 2Z7SA 4LI5A 2OIQA 1YXXA 2WGJA 3GP0A 4W8DA 4EHVA 2XIXA 3GC7A 3IO7A 3MPAA 5L8JA 2G2FA 5D1JA 1SZMA 4LL0A 5LVNA 4JX3A 2ZJWA 3TKUA 4F0FA 5C26A 3LMIA 5AR4A 3VUTA 1UA2A 3P78A 4BIDA 4ZJJA 3LJ1A 4WRGA 3UODA 3ZBFA 4O7WA 3IGOA 3JPVA 2WU7A 4X6QC 3AQVA 3QTIA 3WZEA 5FDPA 5HNIX 5EI2A 5B2MA 1UWHA 4QP7A 3R73A 4OT6A 2AC3A 4IWQA 4WG3A 2PMIA 4BI1A 4HYIA 3OXIA 3WZJA 3H10A 4QP8A 4JL9A 4F0GA 5L2QA 2CSNA 3ZO1A 5BNJA 5FP5A 1WBWA 4M66A 3PWYA 4LV5A 4BGHA 5AR5A 4YC6A 3BIZA 2XNEA 2Y4PA 3ZRKA 4F7SA 4A9UA 4ZIMA 2CHLA 3U9NA 1SM2A 2GTMA 5C4KA 1ZMUA 4FX3A 3DU8A 4KINA 4USEA 5IEXA 3RK5A 4XG2A 3VHEA 3PG1A 5AX9A 3ZO2A 5FUTA 4RIXB 2VX0A 4FKUA 3F5UA 4NKAA 5CF5A 2JDSA 4QMUA 3RPVA 1S9JA 4W4WA 4AT5A 4LRJA 4J99A 1Z57A 3F66A 1Q3DA 3DJ5A 5CNOA 3ZMMA 3MY1A 5AUZA 1U46A 4UN0C 4U79A 1J1CA 5LMAA 2OJFE 3ZM4A 3I1AA 4GT3A 3UP7A 1ZOEA 3KXHA 4BDJA 3DJ6A 4AA4A 5JGAA 3CSVA 2UZOA 3UG2A 3ZXZA 3EB0A 4ZXTA 2WAJA 3O8PA 3EFWA 4JT3A 3OTUA 4RX9A 5BVOA 3DKGA 3TACA 4RQVA 4V01A 3BGZA 1MQBA 3AG9A 4Y8DA 4I5CA 5DEWA 3VQHA 3VUGA 5LMKC 2WEIA 3A61A 3R28A 4IE9A 4KIPA 3KA0A 4JG7A 4XRLA 4YNOA 1G8AA 2PPQA 2BMCA 1YHSA 5KMOA 3PXKA 1IASA 2C47A 4DT8A 3ZONA 2XK8A 1PXLA 4DFNA 4QP1A 3PSBA 4WNMA 2QOKA 3O96A 2Y6MA 2YLFA 3CQEA 5CI7A 3WARA 3OMVA 2IVUA 3VRYA 2X4FA 2FSTX 3EQPA 4X2GA 2P55A 4TW9A 4AS0A 2XJ0A 4BTMA 3AD5A 4DFYA 1FBNA 4GMYA 3N4TA 4ZSEA 2EUFB 4BCGA 3QA0A 3HMIA 4K33A 4LRKA 4C61A 4PL3A 3MN3A 2A2AA 1WMKA 5EKNA 1APME 4ACCA 4NT4A 4GEOA 3PIYA 1H8FA 4LGHA 4ANQA 4U8ZA 4B6LA 4FEVA 4AZTA 4EOOA 3DBFA 4HPTE 5ETFA 3ZSGA 4RIYA 3WILA 1PXNA 4L9IA 3ZZEA 2WTJA 3RNYA 3DB8A 2XNBA 4U81A 1WFCA 2PE0A 3AT3A 1XR1A 3DZQA 3FLWA 2QQ7A 3D94A 4IB1A 4Q9SA 1GIIA 2ITOA 2X7GA 5AV3A 2B54A 3U9CA 1V1KA 3KN6A 4L3PA 4OLIA 5CZIA 5H9BA 4DTBA 1URCA 3MVMA 4E26A 1TQPA 2IO6A 4R5SA 2X9FA 1FMKA 4FGBA 3IS5A 3GFEA 3NRMA 4HYUA 2Q0NA 3DB6A 3L9MA 2EVAA 4DEDA 5I9YA 1JKKA 3PLSA 4TTHB 4DGLC 5LVOA 4E6DA 5IA4A 2WMXA 4CRLA 1PKDA 3FXZA 3I79A 1KE9A 2BKKA 2CN8A 3I4BA 3OXZA 3EN6A 5BVEA 4DFBA 1OITA 3H9RA 4FYOA 4O1PA 1NVRA 2VD5A 3EL8A 4FR4A 4H3QA 1L8TA 2BROA 3KXGA 2FH9A 3OEFX 1B6CB 2GS7A 3W2SA 2XK9A 4IC7A 1J7LA 3E5AA 4K2RA 2O64A 3Q6UA 4G17A 4CYJA 2W4OA 3HDMA 3LQ5A 4XH6A 4IM0A 4QMSA 1CM8A 4U6RA 3VC4A 1H24A 3PA3A 2QC6A 5F20A 2R3HA 4H1MA 1BYGA 5A54A 2R7BA 2GQRA 4LUEA 1SNUA 2VTSA 5H8EA 4O83A 4FT5A 3JS2A 4XCUA 3UO4A 5I9XA 4NK9A 3DS6A 2PZYA 3LLTA 2J0LA 2ZAZA 2BZKB 2C6TA 2JC6A 3IGGA 3OW4A 4LGDA 5TOZA 1XWSA 3FKOA 4GCJA 4XRJA 3QZHA 2B1PA 1ZYSA 2FVDA 3VWAA 3R6XA 1TVOA 4OTQA 5JK3A 3H30A 4FSYA 4Z9LA 5BQ0A 3UQGA 2A1AB 5HCYA 5KBQA 2X8EA 3NZ0A 4E3CA 4KIKB 2J9MA 5D9HA 1XKKA 2QR7A 2QI8A 5HTBA 5JFSA 1H0VA 1R1WA 3ENMA 2PVNA 2P2IA 3NUYA 5ANOA 3UNZA 4BC6A 1E9HA 2QVSE 4DH8A 4F9YA 4IB0A 4O21A 1FPUA 3CD3A 3QC4A 4W4XA 4U42A 4EK6A 2WTIA 1WVWA 5C8KA 3D15A 3KXZA 3NYVA 3RGFA 3ZTXA 4IH8A 1H00A 2HZ4A 4WT6A 4C8BA 5EM7A 3A7HA 4MF1A 1DI8A 4QMOA 4RIWA 4TNDA 2OXYA 3TIYA 5ICPA 3C13A 5KMIA 3A4OX 4P90A 3C51A 4F64A 3QXPA 4FF8A 5L2IA 3DKFA 4YHTA 4JR7A 3BHTA 3CP9A 4CFMA 5E90A 5DH3A 4NIFB 4EOPA 3ETAA 2R3KA 4C36A 1XO2B 2PVJA 5HNBA 2KULA 2CGXA 5AP1A 4D5KA 5GIOE 1YHVA 4Y5QA 4B9DA 3CS9A 2YZAA 4RFYA 5LMKA 4BCNA 4O7YA 2HW7A 4U9AA 3R1SA 3F88A 4G3DA 4LRMA 4RGJA 4WD5A 5DRBA 3HLLA 3A2CA 4LFIA 3QBNA 2C6OA 3ZOSA 4RQKA 4BB4A 4R7BA 1KOAA 2XS0A 3QTZA 3V8WA 4FTRA 4MKCA 1Y6BA 4ALVA 4PPAA 5DT3A 2JKQA 4EHEA 5EHLA 2UV2A 4U5JA 5HCXA 2ZMDA 4E73A 4QTBA 4UV0A 4F7LA 4M69B 3RVGA 3FI3A 5KKRB 3AC2A 4N6ZA 2ZDTA 3R01A 3VBWA 3BYSA 4YBKA 2XCHA 2R3RA 1O6YA 1TQIA 2G15A 2LGCA 2EU9A 1YDTE 3ET7A 3R71A 4GYGA 3ZU7A 1YOJA 4EBWA 5CXZA 2XKEA 3NX8A 2XYUA 4M3QA 4UXQA 2YDJA 4ANMA 2QKRA 3COKA 4TNBA 4PY1A 3CY3A 3WF8A 4EI4A 5TE0A 2GFSA 2HWPA 2JFLA 4O7TA 4EOKA 4BYJA 3WIKA 5J7BA 2ZB1A 4CZYB 1Q8WA 1CKJA 4DHFA 2VUWA 2YCQA 5L6PA 2YIQA 4KKHA 5HBEA 2PVFA 1OZ1A 4NU1A 3I60A 4QP6A 1QMZA 2ZM4A 3D5UA 3CTHA 3UMWA 1XH4A 2F9GA 3VW6A 4W9WA 4CCBA 5L6WL 4O2PA 4OTRA 4X3FC 5KHWA 3BHHA 3LFAA 4QO9A 4FV2A 1QL6A 3T3UA 2ZOQA 1LR4A 4NW5A 4BDEA 5EI6A 2GTNA 3FMNA 4EJ7A 5GJDA 4NUSA 1BI7A 3TNHA 5FG8A 4PMTA 2B0QA 4FUYA 3NCGA 5HVYA 2GNLA 4MXCA 1H28A 3UJGA 4CGAA 4EK4A 5FP6A 2VNYA 4M0YA 4UZDA 4RG0A 2J5EA 4PRJA 3UO6A 4LV8A 3PLAE 5KE0A 3R1YA 3EQHA 5BVNA 4UYNA 3HP5A 5C03A 3IDPA 2PUPA 1P2AA 1OL5A 3E64A 4UWYA 4X7QA 3ZYAA 4EQMA 3P5KA 3CPBA 4U0IA 3KQ7A 4IACA 5DGZA 4RLKA 4KBCA 2C5VA 2W1DA 4NW6A 3FYKX 3BYVA 4CKJA 4DCAA 4QYEA 4FL1A 4TY1A 2Z7QA 5J1VA 5DN3A 4UWBA 3NAXA 4BDBA 2YM8A 5LWNA 4ANLA 4E4MA 3KMWA 5A4CA 3NYOA 4I4FA 5L2TA 4FNWA 4WSYA 2QOLA 2UZTA 1IA9A 1Q99A 4X2KA 4FEWA 5ETCA 2CCHA 2IVTA 2PZRA 4YJTA 2R3GA 5D11A 4GJ2A 1Q97A 1OUKA 3E87A 2O8YA 3QYZA 4I24A 4XV9A 1H25A 4ZLOA 2BIYA 3PA4A 3ORIA 4QTDA 3QCQA 4FZFB 1M7QA 2ESMA 3QKLA 4MVFA 3UOJA 4FV9A 1OIUA 5CSPA 3NEWA 4O0YA 4FKSA 3NIZA 4G5PA 4RBLA 5AP3A 1REJA 4D9UA 4F70A 4I0RA 1EH4A 4QPMA 3PJ8A 4YTIA 4F1MA 2FUMA 2ZV7A 3K5UA 3FHRA 4TXCA 5DWRA 2B53A 2PUUA 3ATSA 5HG7A 3BBTB 4YNEA 4WNPA 4JAJA 3SW7A 4EH8A 3BBWA 4MHAA 4XBUA 4JS8A 2ITWA 2RGPA 5AR8A 2HY81 4D2TA 4ORKA 2IZTA 4MXAA 4L7SA 4KD1A 1XH7A 1PJKA 3E63A 2UZWE 4JR3A 4BHZA 2FSLX 3R9DA 3N4UA 2OF2A 1BL7A 4PQNA 1TKIA 3Q9WA 3RZFA 4GT5A 4MQ2A 3ULZA 4JJRA 2I40A 4AW0A 1Q3WA 1NA7A 2BVAA 2J90A 3HUCA 3FUPA 2P2HA 4ALUA 5IA3A 5EDQA 4YJVA 1DAYA 3ACKA 4TRLA 5CYIA 3VUMA 2XBAA 3K54A 2RIOA 5HE2A 3F2NA 4ZOGA 5KNJA 5EOBA 5LVLA 3F5XA 2JBOA 3NNUA 2I0HA 4OTHA 1OBDA 1W83A 4WA9A 4X21A 4BGQA 4ANBA 3LIJA 5DNRA 4AFJA 5EM5A 4A07A 4I20A 3AMAA 4BCIA 4OAVB 3JUHA 2XB7A 4EH9A 4D1ZA 2G2HA 2IPXA 5BVDA 3F6XA 1OKZA 2C4GA 3Q9YA 3RCDA 5AP5A 4BBFA 4HVHA 4FICA 4WNKA 1WBNA 5T6KA 4D0WA 3E8CA 4FK3A 4BIEA 2C3IB 3LQ8A 3A7GA 3EN4A 5F9EA 4I22A 3D5WA 3HNGA 3Q2MA 2XRUA 4MD8E 5BVWA 2ITPA 5JGDA 5KMKA 4B99A 2YWVA
chains in the Genus database with same CATH superfamily
1OPLA 3GU7A 4EH3A 1JAMA 2HELA 1OL1A 4MX9A 4W4VA 4WUAA 3RMFA 5CNNA 4E7WA 2WMUA 3ORKA 4ZZOA 3BKBA 2ZV8A 2B4SB 3OXTA 5EYKA 4CQGA 4F9CA 2IWIA 3TNPC 1AGWA 4KWPA 3RINA 3ZH8A 4N6YA 4ZSGA 2VTMA 3RBWA 4EOMA 2OIDA 2PVKA 2YABA 4EWQA 1YWNA 5AFVA 3VULA 4NM0A 3QTQA 1ZLTA 4I21A 4JAIA 4MNEB 3UNJA 5L2WA 2X0OA 2YACA 2V0DA 2Y7JA 2FA2A 4QTCA 3UIXA 4WG5A 5E8UA 3SA0A 3SKCA 2C5NA 3R02A 4RC2A 3GGFA 4DEBA 5FTOA 5M53A 4BY9E 2P4IA 4BICA 2PU8A 5CAQA 4YURA 3VO3A 2GDOA 3ZXTA 3HAVA 4IJ9A 2HXLA 4N0SA 3ORTA 3RTPA 1W82A 5JN2A 2YITA 4AZWA 3VJOA 4I41A 3A8XA 1JSUA 5AAFA 3F7WA 5IQDA 4IB3A 4MYGA 4RMZA 3WF5A 4OUCA 4FOCA 5A3XA 4USFA 4YP8A 1GZ8A 3LCDA 3MS9A 3TN8A 1XH9A 3DFAA 5ITAA 1SYKA 5EM6A 3S95A 4JBOA 4I6QA 5HLNA 4XG6A 3KK9A 3V01A 1K3AA 5ANIA 3OVVA 4G1WA 4U41A 4GUEA 2W4JA 4FV1A 5AWMA 3CGOA 4MF0A 3VF9A 3CPCA 5FTQA 4EUUA 1G8JA 5T68A 1CKPA 3TCPA 4IAIA 4JBVA 4EOSA 2X6EA 3ZFMA 2ETRA 5CQUA 5CF6A 4IDVA 2VGOA 4YLJA 4MK0A 1YOMA 3U54A 3AC5A 4MD9E 1PXKA 1JPAA 4BCJA 3QWJA 2ITZA 3OS3A 4EH5A 3F7ZA 2H8HA 2H96A 3HMNA 4U80A 3LVPA 2H9VA 4RX7A 4RRVA 5CZHA 4FG9A 3QRUA 4IWPA 3FWQA 3MH0A 4AAAA 3ANRA 5CQWA 5E8SA 2PVRA 3WF9A 4C59A 2R7IA 1ZAOA 3TNQB 4FBXA 4TN6A 2XK6A 1FVRA 4FKWA 2X0PA 5HTCA 5BYLA 5BYZA 3EFKA 4J95A 2C6IA 3ZS5A 3JY9A 2C1BA 4EK3A 4BGGA 5IEYA 4DE4A 4ZLZA 3VJNA 4NYEA 2XAOA 5M51A 4FZAB 4F1TA 2XF0A 1YHWA 3EQDA 2QU5A 2VWUA 3C7QA 4FTTA 4RJ5A 3VBYA 2XZSA 3QTRA 5DE2A 3KMMA 3P9JA 2WQBA 4W8EA 4EOQA 1ATPE 3MA3A 1BI8A 3VRZA 4QQ5A 1NY3A 3R2BA 4C4IA 3TUBA 2F2UA 3R0TA 1M14A 4FVPA 4R7IA 5AP6A 4AXCA 4BZOA 5CEQA 2EXCX 3QD3A 2YWPA 3FV8A 3OD6X 4FE2A 3FI8A 2CMWA 5E4HA 3G9NA 4FV8A 4UX9A 3TZ7A 4HJOA 4U45A 4DGMA 4YZDA 2P3GX 2R3NA 4KSQA 1WZYA 3PVBA 3QZIA 5CAOA 3G2FA 5FXRA 3F2AA 4FSNA 2VX3A 4AP7A 3FE3A 4LUDA 2OBJA 4W9XA 3LJ2A 5AUWA 3SXRA 2H34A 2ITTA 5E7RA 1XBCA 4HPUE 4RLLA 4BDAA 2EWAA 4U3ZA 4IC8A 4UB7A 4RVTA 1JWHA 4ZJIA 3E62A 4OTDA 2PHKA 4ZTRA 3FZTA 3LFNA 1YDRE 2XNGA 5GJFA 3RNIA 4Z7HA 3G15A 4NM7A 4OT5A 4QDVA 3U51A 3Q2JA 3Q9ZA 4AN3A 3QKKA 1Q24A 3BEGA 4Q5HA 4HW7A 4APPA 5IZFA 2UZUE 3QCXA 1U5RA 1PYEA 2A19B 2C30A 4GG7A 3ZC5A 2CKOA 3EIDA 3C5UA 4F6UA 5ETAA 2XNOA 2WMTA 4BKYA 2QO7A 1W8CA 3HMOA 4DFLA 4EQUA 5I9VA 5J9ZA 5KX8A 5FDXA 1UVRA 2E9NA 3DZOA 4RC4A 4FKJA 4UBAA 4YPSA 3R9NA 3PZHA 4YC8A 5AAEA 3WF7A 1WCCA 4O4EA 3PDTA 5J9YA 3HRCA 3F82A 3E3BX 4BIBA 3MSSA 3KB7A 3ELJA 4MCVA 4BCPA 5IMEA 1W7HA 3FYJX 4HNIA 4BL1A 1OECA 3EKKA 3R7YA 3IG7A 5AUUA 3GENA 2FGIA 3EN7A 5EYMA 3QYWA 1H0WA 4FV0A 5A4QA 3PY1A 4DG0E 3LE6A 1CKIA 2Y4IC 4ZMEA 2QNJA 1U59A 2JIIA 5CANA 4PL4A 1VYWA 1PXIA 4ZS0A 3QRTA 3V8TA 4RJ4A 2QO9A 3VNTA 3DOGA 3IECA 2WOTA 2BTRA 2Z02A 3OCSA 3CR0A 3QKMA 2VX1A 3O17A 3RHXA 3UYSA 2E9UA 2PK9A 3QTXA 2BRGA 3O8UA 3EOCA 3ALNA 5IQBA 4AQKA 3G51A 3TZ9A 4GFOA 1JSTA 1ND4A 1BL6A 3S3IA 2XIRA 4L7FA 2R3IA 4PV0A 4L67A 3FDNA 2Y0AA 4AN2A 2JAMA 2I1MA 4DTKA 2R3LA 3AMYA 2VWZA 5AV2A 4LL5A 4FEQA 2BCJA 2ITUA 2PY3A 3OG7A 4EK8A 2PVYA 4EH2A 3KC3A 3B8RA 2GHMA 4AGWA 1Q5KA 3OCTA 2V62A 1GJOA 3QALE 5LARA 1FMOE 2W1GA 1XHAA 2WTVA 3FZRA 1OKVA 4PWNA 5ANEA 5B0XA 3R7IA 4BKZA 4DCEA 4O7VA 3PVUA 3FI4A 3GC8A 3ID6C 2XEYA 3KCFA 3QX2A 4YGAA 4GRBA 3Q96A 1W0XC 2C0OA 5L3AA 1GOLA 2OI4X 1E1XA 3BX5A 2G1TA 3FAAA 4BZNA 5LCJA 3GUBA 1UU7A 4FTQA 5J8IA 4UZHA 4AN9A 5DPVA 4OTWA 5E8WA 4DH1A 4PP9A 4E6AA 3NUSA 4ENYA 3SVVA 2PVHA 2F7XE 3MFTA 4FT3A 2GQGA 2BUJA 1W98A 1XH8A 2BR1A 3FC1X 2IW8A 1O9UA 2O2UA 5IQHA 4D2SA 3HV6A 4EKLA 1H01A 4GL9A 3KEXA 3LZBA 4ZY5A 5DHJA 5BX0A 3QF9A 4OBQA 4NL0A 4HYHA 3GB2A 5HICA 2BKZA 4M8TA 1QCFA 4I0TA 5A14A 3MVJA 3O50A 1JOWB 5BUIA 3QCSA 5FXQA 1H1RA 2H6DA 4DHJA 1JBPE 4G3CA 4YJSA 5IQFA 3T9TA 4B0GA 2XKFA 2CNUA 3SLSA 2NPQA 5HG9A 5HO6A 3W55A 3QAME 3A7FA 2HK5A 5IA5A 4AACA 5L8LA 3R04A 3C4EA 2W17A 2REIA 3HA8A 5GZAA 2BIKB 3I6WA 3RWPA 3FL5A 4BDDA 2CNVA 4DDIA 2WTKC 2UW9A 1GIJA 3B2WA 4GSBA 4RC3A 3BI6A 4L45A 4C58A 4HNFA 3KRLA 3N9XA 2X0QA 2RG5A 3GXLA 4L01A 3PUFC 3H4JA 2J4ZA 5DA3A 5IQGA 2XKCA 2BALA 5EK7A 3V3VA 2VWVA 2IG7A 4RIWB 2X1NA 1OGUA 3FMJA 4ERKA 2P0CA 3FKNA 3LXKA 4NTTA 4QMNA 3PE1A 3QRKA 3TYKA 1F0QA 2Z7RA 3DPKA 2YFXA 4BCQA 4QDEA 3WE8A 2W1IA 2GNGA 3E8DA 1VYZA 1S9IA 2IZRA 3KVXA 4FKQA 4YZMA 4CZTA 1ZWSA 2FO0A 2OU7A 3G6HA 3DAJA 3SRVB 4D28A 4V0GB 4JDJA 3ZRMA 3BPRA 4FV5A 3ROCA 1Y57A 2QOQA 3MJ1A 4GH2A 4FTIA 2X2MA 3RP9A 3UGCA 5HU9A 5IU2A 3VBVA 4QPAA 5HBHA 3GQIA 4CTBA 4R77A 3PXQA 3I0OA 2C3LA 2R3JA 3OY3A 4FTJA 3WBLA 2KTYA 3SG9A 4O0XA 2IN6A 4Y5HA 4Y95A 4D2VA 2VTNA 3NNVA 3QWKA 5ACBC 3TUDA 3L9LA 2UZBA 3C4FA 3LPBA 3SD0A 5CS6A 3V5WA 3VHKA 3MBLA 4EZ5A 3OT8A 4BDIA 3D14A 1JKTA 2OZAB 1JQHA 2BZIB 4FKRA 4O91A 3VIDA 1REKA 4K0YA 4Y83A 4MTAA 1H27A 3RPSA 4FVRA 4BBMA 5DBXA 2GS2A 3SHEA 1G5SA 4UYAA 3DNEA 4XJ0A 3EQBA 2R0UA 1GZKA 4EC8A 2QG5A 4USDA 5E8YA 3ITZA 4GFMA 4R1YA 3DBCA 5FLFA 3C4ZA 3BV3A 3T9IA 5KMNA 2WO6A 4ANNA 1PXOA 5D41A 2YA9A 3M11A 4DITA 3UIBA 2A27A 4F9WA 5J79A 5CX9A 3PXRA 2CNQA 4U43A 3DK3A 4YZ9A 5AADA 2Z8CA 3B8QA 2BDFA 3PPKA 4I4EA 5CSXA 2PMNX 3BE9A 3F3WA 4IXPA 3TKIA 4FKTA 1U5QA 2G2IA 4JBQA 1HCKA 2UUEA 4NZWB 3LMGA 4OTPA 3THBA 3V6SA 3HKOA 3U4UA 2E9PA 2WTCA 4IQ6A 4JDKA 4HCTA 4QT1A 3FZOA 3DK7A 5IKWA 4Y73A 2BDJA 3MTLA 1VLRA 4JQEA 4DEAA 3R9OA 2FB8A 5K9IA 3R1QA 5IF1A 2ZV2A 4JOAA 5E9EA 5K5XA 3QQLA 1LPUA 5D12A 5I0BA 4EYJA 5IQCA 2XAMA 3F3TA 4D4VA 2ERZE 5HQ0A 4RZWA 4IX4A 2QOHA 5C4LA 4C3FA 4QMQA 4HGSA 3OCGA 2UW4A 4RPVA 5CXHA 4LMNA 3AKLA 2XJ2A 4U44A 2QG7A 4QYGA 5LVMA 4NJDA 2C3JA 5IA2A 3AC8A 3EN5A 1IAHA 3GVUA 3TZ8A 5HLPA 4F9AA 3QUEA 3ZEWA 4FGRA 5H2UA 4BCOA 2OFVA 1W2FA 2WQNA 4IVCA 3TG1A 5EQYA 1QPEA 3GU4A 4TYEA 4BYIA 3OHTA 4P5QA 4PMMA 3K3JA 4BJJB 3TL8A 3OC1A 3MFUA 1W2CA 4QD6A 2R2PA 3OF0A 1J3HA 3VS0A 4HVGA 4AE9A 1OPJA 3PWDA 3U6IA 3HZTA 4NEUA 4CNHA 2J5FA 3OCBA 2PVMA 2W7XA 3LCKA 3S2PA 3S4QA 4BDGA 3UC3A 4YUQA 3GOKA 4EKKA 3IOKA 3QU0A 4FJVA 4NFMA 2X81A 4BDHA 4E93A 2I7QA 4AU8A 3PTGA 4IX5A 3E8EA 4D55A 4L00A 3E88A 1Q62A 4HGLA 2GNHA 5K0KA 4I0SA 2WIHA 5CAPA 4QMWA 3CKXA 5CF4A 4U97A 4C3PA 4R8QA 5FRIA 3MH1A 3ORPA 3NVMB 4GK4A 3H0YA 2QHNA 2XEZA 4TYJA 1T45A 3ENHA 3UBDA 1F3MC 2HIWA 2W4KA 4ZK5A 3TTIA 3PIZA 4WOVA 4GV1A 4U7ZA 2AQXA 4FV7A 2JDVA 2XUUA 4MQ1A 4QMPA 4XLIA 1QPCA 4RIXA 3ZEPA 3FY2A 4A9TA 3DK6A 3A99A 2CGVA 4J97A 4CT2A 5IPJA 2Z60A 4LOOA 5JSMA 3NUNA 4XLVA 5ANGA 3KXNA 4FZDB 3O23A 3FLQA 1E1VA 2I0VA 3KREA 4TYHA 4H05A 1UU3A 2C6KA 5TO8A 3UG1A 4M68A 4QP9A 4ZTMA 3P79A 4XG9A 5AP7A 3UVRA 4D2PA 1U54B 2IEWA 2PYWA 1YW2A 2ETKA 3D7TB 4FKPA 4IX6A 4QMVA 4RWKA 4A4XA 4G6LA 3EH9A 2WOUA 2OJ9A 4LGGA 4CG8A 3VBQA 3HEGA 1PMVA 1DM2A 3MIYA 4DC2A 4QP4A 1PF8A 3KCKA 1ZARA 3DFCB 3Q04A 4S33A 4A9SA 3UPZA 3GCSA 2XNNA 2OWBA 3ORXA 4J8NA 1BX6A 4ANOA 4BF2A 2WFYA 3FBVA 4MXOA 2VZ6A 4RX5A 3UPXA 4LV7A 3FKLA 2ZDUA 1H1SA 4FZ7A 2CJMA 3MTFA 2YJSA 4GFGA 3UIUA 3HV4A 3R2YA 3TDWA 1JKSA 1AQ1A 3FMMA 4FKGA 2OF4A 3LFBA 3OP5A 3ZSIA 4O0VA 4PDYA 2OGVA 3R9RA 4X3FB 3SGCA 1J1BA 4TYGA 5ANDA 2J2IB 3ZBXA 1YI6A 1OM1A 1R3CA 4XP2A 5KZIA 4LQMA 3UYTA 3H9FA 5E8ZA 5JFVA 4C7TA 3ZLYA 5EQPA 2JKMA 2XA4A 4YR8A 5AP2A 4IB5A 1OL7A 2FYSA 2QKWB 5C8MA 3QUDA 4MEDA 4DT9A 1PKGA 4JLCA 2X39A 5E8TA 3R7UA 5HZNA 3QX4A 2HYYA 3TNIA 3WZKA 5G6VA 1J7IA 3PRIA 3LFCA 3VS3A 4AW1A 4ZSLA 3KF4A 3ORMA 2Z7LA 4CQEA 4ZY6A 1B38A 3OZ6A 2PZIA 3RK9A 4BZDA 4EONA 4ZTQA 1K2PA 2PMOX 5F1ZA 3ORNA 3PIXA 5D7AA 4AOTA 2PMLX 3NAYA 4LMUA 5CT7A 4DG3E 2W1CA 3MI9A 3OOMA 2VRXA 3A8WA 4A7CA 4A9RA 2W1EA 2NRUA 3FSKA 4AOJA 4DH5A 3MY5A 5DT4A 1PY5A 4PNIA 4EEVA 4IZYA 3OW3A 5F95A 5BVFA 3UTOA 3NIEA 3W2OA 1M2PA 1UU8A 1YWRA 3GOPA 4GK2A 4E8AA 2YIYA 4WSQA 4BWPA 3WF6A 3CQWA 3FQSA 2OSCA 5AP0A 3QD4A 4F7JA 5M09A 4QYHA 2VNWA 3F3UA 4YJRA 1WBTA 5CWZA 4UMUA 1RQQA 5LXMA 3Q4TA 2PZ5A 3OWJA 2XYNA 4NH1A 4E5BA 3DKOA 3UOKA 4BFMA 3CLYA 3REPA 4D5HA 3W32A 4DEHA 3TUCA 2OK1A 2BAQA 2OXDA 3AC4A 3QLFA 3R7GA 4O0RA 5EDPA 4JX7A 5J7HA 5CLPA 4F4PA 3NS9A 4QMYA 5FQDC 2O0UA 4O7SA 4KIKA 5KZ0A 4DA5A 4TWCA 4N70A 3ERKA 3NYXA 2J0IA 2VU3A 2UW6A 2WMAA 3GCVA 2DUVA 4AGDA 3UZRA 4AXAA 3TZMA 2J0MB 4EOIA 4O4BB 4YHFA 3LCSA 3UQCA 1SMHA 3HP2A 4GU9A 3RPYA 3OBJA 1FINA 4HCUA 5I5ZA 4F08A 4ZJVA 5HO8A 5FGKA 4CCUA 1UKIA 4MBIA 3NNXA 4DBXA 4ONAA 2ITQA 3KL8A 5KO1A 3BLHA 3CE3A 3BHVA 3OOGA 4FSZA 2RKUA 4FMQA 4KA3A 3ZO3A 2RFEA 3LFFA 1KWPA 4CFXA 4CFFA 2V55A 3C0GA 5C01A 3AXWA 3VQUA 4NCTA 4I94A 2F2CB 3AMBA 2OXXA 2VO3A 3D5VA 3PYYA 2J51A 2ZYBA 3PJ3A 4KRCA 4E4LA 1UKHA 5JFXA 4AAYA 1HOWA 4CV8A 4FODA 5K3YA 3T3VA 4Y85A 4S34A 3Q9XA 4CTCA 2R5TA 4BTJA 5IUIA 1PXPA 3W2QA 4Q5EA 1SVGA 2CGWA 3KMUA 5D7VA 5J5SA 5CTPA 3C50A 4ZEGA 4QQTA 4B4LA 4H3PA 5IA0A 4YO6A 4QYYA 5FWKK 1VZOA 3QQGA 4FRFA 4RVKA 3VUKA 3W2RA 3HVCA 2BAKA 4IVBA 4NKSA 5CALA 1UU9A 1Q8UA 3RPOA 3VS2A 1JLUE 3DDPA 2HY0A 2WKMA 4FNZA 5AUTA 4M84A 2CPKE 4FSMA 3TDVA 4C4HA 2WB8A 3UIMA 2J0JA 4YJQA 4XOYA 5KCVA 2P33A 2YHVA 3DA6A 3F61A 3DXPA 3FLSA 4ZTLA 3F5PA 4BBEA 3L8PA 4FVQA 2GNJA 2CKPA 5LJJA 4FTLA 3P7CA 5F4NA 4APCA 2WMSA 3MJ2A 4RA5A 2YN8A 4F7NA 4YTFA 3A7IA 3FLYA 4B8MA 3WYXA 1F5QA 4AXFA 4FTMA 3L8VA 4G3FA 1JKLA 4YHJA 4X0MA 2C0IA 4QP3A 4O81A 2EXEA 4GIHA 3SDJA 4RZVA 2VO0A 3PE2A 5EOLA 2XM8A 2WQMA 2C3KA 4OTFA 3V5LA 2B9HA 4DFUA 4HCVA 4CXAA 4JIAA 1YI4A 3NUXA 3U87A 3ZUTA 3EFLA 5IDNA 4PPBA 4BI2A 4NJ3A 1AD5A 4RT7A 3V5QA 2Y9QA 4GT4A 5HIBA 5EQEA 3CC6A 2C6LA 3BWFA 2VWWA 2VTQA 4Q2AA 2JGZA 5M4CA 3EYGA 4HGTA 4PMPA 3E92A 2C5XA 1W2DA 2X2KA 3A60A 4GKHA 2ITVA 4QEBA 3SW4A 2YZLA 4RIOA 3G6GA 4ZTHA 3G5DA 1OB3A 1Y91A 2XNMA 4DEEA 4DLJA 3MYGA 3AD6A 5IG1A 4G6OA 4EUTA 2YJRA 5K4IA 3RCJA 4C4FA 4FT9A 4CMOA 3CXWA 4HYSA 4JMQA 3VVHA 1A9UA 4D9TA 2R3MA 4MBLA 3LW0A 2F4JA 3O51A 4UMQA 4ZLYA 2C5OA 3C5IA 1Z9XA 3UC4A 4YO4A 2QU6A 1O6LA 3MWUA 1XMLA 4II5A 4F9BA 1G3NA 4YJUA 4AZSA 3IONA 5IA1A 5DIAA 2ONLC 4RJ7A 4X2NA 4KB8A 2RF9A 4YTHA 5HBJA 5KHXA 4PMSA 3VF8A 4FIJA 2X6DA 3HV5A 2E9OA 2XJ1A 4AZEA 2RG6A 3OWPA 2IZUA 4LOQA 5GIPE 3QGYA 1KV1A 2J50A 3E3PA 4IHPA 2JBPA 4O86A 2BHEA 4JDHA 5DT0A 2R9SA 4MD7E 2X8DA 4ZP5A 2JKOA 3NVKI 1KSWA 4GVAA 4KRDA 1OKYA 3Q53A 5A6OA 1B39A 4J98A 4CFUA 5AMNA 1I44A 3QQJA 4CFNA 5HVKA 4L44A 3ULIA 1IR3A 4QNYA 4QOXA 4DH3A 1YXUA 4E20A 4RWIA 3MW1A 5CU2A 4IMYA 1BUHA 3PVWA 5M55A 5CEMA 4DN5A 2BFXA 3LAUA 1WBPA 3HX4A 3W16A 1ZY5A 3GU8A 3W1FA 3ZCLA 3RAIA 4XBRA 2VWYA 3EN9A 4XG7A 1NT2A 4DTAA 1MRYA 2UVYA 4KKEA 2BTSA 4AQCA 3WZDA 1PW2A 5BUEA 3NW5A 5CT0A 1ZMWA 3EQRA 3CTQA 4FG8A 3VN9A 4GS6A 4WO5A 1CTPE 4BRXA 4G16A 1ZY4A 3F3ZA 3M42A 2VGPA 2X7FA 3VAPA 4G9CA 2A0CX 1PMUA 3IW5A 5HX6A 2UW3A 3KRJA 5J5TA 4G31A 5BPYA 3FLZA 4IIRA 4AT3A 4C02A 3EHAA 5K0XA 4ZTSA 2GNIA 2OW3A 1SNXA 3ODZX 1KUTA 5DRDA 4N4SA 2UW8A 3NFFB 5AUXA 2FSOX 2ZMCA 3Q6WA 4PPCA 3FC2A 4Z16A 4RJ8A 4BDCA 4O4FA 5EFQA 3VBXA 3CGFA 4FZ6A 1OKWA 5CVGA 3T8OA 5A6NA 3MPTA 4FKOA 2GHGA 2I0EA 3ACJA 2QOIA 2YAAA 4O0WA 4DGGA 5DG5A 3TMOA 2IF8A 2W1FA 4J96A 2NO3A 4FV4A 2VTTA 1XMMA 1ZYDA 5I9ZA 5DR2A 3U55A 3RI1A 3I5NA 3QTSA 3IPHA 1Q61A 4O0UA 4XS2A 3FPQA 5EYDA 2GFCA 4J52A 4B7TA 5KMLA 3GQLA 3BZ3A 4GUBA 2O5KA 3PPZA 1XH5A 2WD1A 4GVJA 4NM5A 4O6LA 1GNGA 5J95A 3QQUA 4R3RA 4IW0A 1H07A 5JRQA 2WXVA 3KU2A 4S31A 3RAHA 3BHUA 4EBVA 5CU6A 5AUYA 1OVEA 3IDCA 2ERKA 4FTAA 3SQQA 1Z5MA 3RZBA 1FGKA 3CKWA 4I1ZA 1M52A 2AC5A 2OICA 4A4LA 3BYUA 4XV3A 5A9UA 5DI1A 1FGIA 4M13A 4GIIA 3W0RA 1STCE 1YXTA 5CVFA 5HNGA 3A62A 1G8SA 2Y4IB 5M44A 3P5JC 3PSCA 4E1ZA 5DR9A 1ZZ2A 3FEGA 2B7AA 3JYAA 2GPHA 5AIRA 3O0GA 4FUXA 4MNEA 4AUAA 3TIZA 3FQHA 4I3ZA 4YSMA 4CSVA 4EHZA 1LEZA 5C9CA 3E8NA 3UQFA 1I09A 2VWXA 4O4CA 4YLKA 3R8VA 3LLAA 3R8ZA 1V0OA 4XOZA 3ZFYA 3K2LA 2J6MA 4R1VA 1UWJA 5HI2A 2R0IA 1FQ1B 1M2QA 2B52A 3C4XA 3ORZA 3NYNA 3EFJA 2WMQA 2W5AA 4WIHA 5HHWA 3ZUUA 4RIYB 5L2SA 4NSTA 5CEKA 5FD2A 5HLWA 5BV3A 2F7ZE 3V5PA 2ONLA 2R3FA 3W2PA 3W2CA 4A06A 1J7UA 2G9XA 3IKAA 3U6JA 4PP7A 2QOOA 2PZPA 4MWIA 1KE6A 3WE4A 4NM3A 1JNKA 4MUQA 3NFGB 2PL0A 1OIQA 2WIPA 3PP0A 3M1SA 4DF3A 3LCTA 2WMRA 4YZNA 5CAUA 3JVSA 4GKIA 2X4ZA 2UZNA 5JZNA 1ZOHA 4F6WA 3POZA 4J1RA 2NYAA 4HVDA 4AOIA 4K9YA 4E6CA 4L46A 1T46A 4FYNA 1WBOA 1DAWA 2UZDA 4CKIA 4AZVA 5KMJA 3L8SA 3LFSA 3AGLA 2YCRA 2V7OA 3JR1A 3GCQA 3HUBA 5AV4A 4O7NA 3R8LA 4J53A 2I6LA 4K11A 3IW4A 4DG2E 2VTPA 4BTFA 4FSQA 5GINE 3WYYA 3CQUA 4KNBA 3CCNA 3AC1A 1YI3A 4JG8A 3OFMA 4DEGA 3EL7A 4LYNA 5JKGA 4H1JA 4FIFA 4UY9A 1LEWA 4JNWA 3NUUA 4TYIA 5E91A 4K18A 4I6FA 4FL3A 4MAOA 1UNLA 1YQJA 3JVRA 2HENA 2GQSA 4MXYA 3FHIA 2GHLA 3IDBA 3VUDA 4YTCA 3C4WA 2ETMA 5BUJA 3QZFA 1QPJA 4YJNA 3EQGA 3NSZA 1A06A 1KE7A 3MPMA 1Q8TA 4I93A 4UMTA 2OZOA 2GNFA 1NW1A 1YXSA 2WTKB 1JVPP 2BFYA 1OI9A 4JIKA 1DS5A 5FXSA 3VBTA 4CFWA 5IISA 4ZMFA 5C27A 3NGAA 2OG8A 3BYOA 4K1BA 1ERKA 2VTOA 3FLNC 4JI9A 5DLSA 3FSFA 4WBBB 3RK7A 2AUHA 2VTAA 3HRBA 2HCKA 4PDOA 4W4YA 3WIGA 4MXXA 3UDSA 2XALA 4KIQA 4J71A 4C4JA 5J1WA 3VS6A 4HOKA 2B9IA 4DFZE 4FG7A 3R8UA 4AZFA 3IK3A 2XIZA 4Y46A 3TV6A 4QTEA 3EQIA 3UDTA 4PTCA 5TT7A 1MRUA 3GCUA 3P7BA 2HOGA 4IFCA 3ZLWA 3HECA 3FXWA 1CSNA 2BILB 4XYFA 5M08A 3HA6A 1WVYA 4P7EA 3R83A 2C6MA 5A4LA 4FL2A 2J0KA 3BWJA 4FKVA 3IQ7A 3SC1A 1TQMA 3DTWA 3RM7A 4XG3A 2WQEA 4KIOA 2XRWA 3TEIA 4TYHB 3DGKA 3I0QA 4MWHA 1JSVA 3DV3A 3W8QA 1MUOA 4L52A 4R3CA 4UALA 2VWBA 3LHJA 3Q4CA 4G34A 4PDSA 5HG8A 2VTRA 3N51A 4I23A 4TZRA 2JD5A 3DBQA 3MVLA 3DY7A 5B2KA 3Q60A 3KRXA 3P23A 4M67A 4XUFA 2VAGA 5B7VA 3VS1A 5EHYA 3AGMA 1PYXA 4EL9A 4F0IA 4L43A 4C62A 4O7LA 3NUPA 3CBLA 5AA8A 4CT1A 2WZJA 4ID7A 3OROA 2DYLA 4I5MA 3COMA 3O7LB 3L9PA 3L1SA 2QD9A 4R3PA 2JDOA 3BGQA 2O63A 4QYFA 3ATTA 3TM0A 2QCSA 5HX8A 4O84A 3UOLA 4ZSJA 2EB3A 4BVUA 4DEIA 2ZM3A 4PF4A 4WG4A 1SVHA 4FSUA 4ALWA 3TT0A 4FIEA 1OPKA 4O7RA 3LOKA 4IAZA 4UEUA 5J9LA 3BLAA 3GT8A 5HE3A 4FI1A 2B9JA 4C33A 1BLXA 4TPTA 5H3QA 2ITYA 3QTUA 1XH6A 2HZNA 2XIKA 3P7AA 3KULA 2WELA 3O2MA 2WQOA 4IANA 3SG8A 3RHKA 5CEPA 2IJMA 2YCSA 3BU5A 4CKRA 3UNKA 1XBBA 2ITXA 4JXFA 5LCKA 4FC0A 3O71A 5HD4A 4BWXA 4QQJA 5DYJA 5IH4A 5ANKA 3BL7A 4FNXA 2BZHB 4O0SA 4ZAUA 3QD2B 4V04A 3RJCA 4L53A 4AW5A 5IQEA