3FKNA

P38 kinase crystal structure in complex with ro7125
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
349
structure length
346
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein, transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Mapping Binding Pocket Volume: Potential Applications towards Ligand Design and Selectivity
rcsb
source organism Homo sapiens
total genus 112
structure length 346
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3fknA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3fknA01
4BI0A 3EZVA 5LMAA 2B7AA 3LQ8A 1BI8A 3HV7A 4UXQA 4XG9A 2WTVA 3E7OA 4GVJA 4NM3A 4ANBA 3MTFA 1U59A 4FKTA 4L46A 3LCTA 4O83A 2ZDTA 4WIHA 4WRSA 2G01A 2OFUA 5JGDA 2XK9A 3ID6C 3ZRKA 4FTLA 4J98A 2BRBA 4IX6A 3QBNA 3CR0A 3TJDA 5CF5A 3I0OA 4QD6A 4DH3A 3F5PA 4DITA 3DK6A 5A46A 3PJ3A 3GU8A 3PP1A 1OUKA 4JVGA 4AE9A 2PYWA 5JMSA 3PDTA 2WGJA 3NUXA 3C4XA 1IASA 2OZAA 4I5HA 4ZSJA 3QQHA 2X8IA 3KRJA 4N6YA 2WOTA 2P33A 4HGSA 3OXTA 3VBXA 5KHWA 3BYUA 2E9NA 3W2SA 2UW8A 3PJ2A 5FBNC 4QMTA 3DU8A 2E9OA 3I4BA 5JRSA 3GFWA 3HRBA 4IM3A 2GNHA 4MBLA 4BGGA 4U79A 4BKYA 1Y8YA 3Q6UA 4FYNA 5EW9A 1WVYA 2PUPA 4TYIA 4GKIA 3LM5A 1RW8A 3DJ5A 4IADA 4DGOA 3SA0A 4NL0A 2PVYA 4G3GA 4V04A 1M52A 3C5IA 3SHEA 2BR1A 1M2RA 4DFYA 3LXPA 4FKRA 3GVUA 2O0UA 2QCSA 3NCGA 5D41A 4D4VA 2I40A 3EN5A 2B9FA 2W1IA 3KQ7A 2GHMA 4BY9E 4EL9A 3VBTA 1ZLTA 2ZM1A 4NIFA 2BPMA 3FMJA 4CKRA 3FXXA 3I1AA 3NNXA 1BYGA 3NYOA 4PL5A 4B8MA 4YHTA 4E5AX 3CCNA 4PP9A 2OG8A 4KRCA 4O7RA 3Q3BA 5F4NA 4EHZA 3U6IA 2XK8A 4KINA 5L2QA 1JSTA 1BMKA 4EOMA 2UZWE 4AT4A 1ND4A 1FPUA 3GCVA 4QMYA 3F2RA 2PVNA 5KMNA 1H0VA 3AC5A 3ZHPC 4LOQA 3BLQA 5D9HA 4QPSA 2OF4A 3V5QA 3NMUF 3R7OA 4BDJA 3W32A 4RJ8A 3IO7A 4DINA 3KF7A 4P5QA 2IZTA 3MA3A 1IAJA 3H0ZA 5AP3A 1REJA 2XKFA 4FGRA 3FZRA 1J7IA 2GSFA 2OJIA 4FOBA 5K4JA 3VBVA 4X2KA 4DC2A 4EH5A 4RC4A 1FGKA 2C5YA 2R3RA 2QOCA 3E3PA 5G1XA 4FTKA 4OGRA 1HCLA 2REIA 4FOCA 3DK7A 2ZV8A 3OC1A 4BHNA 4D4RA 4FIFA 4GFOA 4RVKA 4OTWA 5CU2A 4FT5A 4I6QA 2YN8A 4MAOA 4WD5A 5CASA 1MRYA 1WVWA 3I7CA 3CC6A 3FZPA 4APCA 4O82A 4O96A 2WQEA 3BCEA 1OBGA 2UW0A 1TVOA 4ASDA 5L6PA 4TTHB 4FA2A 4O2PA 5L4QA 3OWJA 5D1JA 2F2UA 2ITNA 2VV9A 5CSHA 4O27B 4CQGA 1YRPA 3KRLA 4BCKA 4FKJA 3QD4A 1L3RE 2FA2A 2OICA 1A06A 3ELJA 4ZZNA 4QQ5A 3ZRMA 3IW7A 3QQUA 4DEAA 2EXMA 3FMLA 1PW2A 4DH5A 1MRUA 2WTJA 3HV5A 3QCSA 4IX4A 2VGPA 5E1EA 4QYHA 3O2MA 4J8MA 1UU3A 1YW2A 1VJYA 3QL8A 2R64A 5CQWA 4KIPA 4BDCA 2OXDA 5JH6A 3REPA 1Q62A 1OPJA 3R28A 1U4DA 3C9WA 1OL1A 2R3LA 2O2UA 4KBKA 5EQYA 2VTIA 1W82A 3F3ZA 4CT1A 1FOTA 3DAKA 1J7UA 3H3CA 4QP3A 2ZVAA 4ZTMA 3TL8A 2VWXA 4I23A 4RWKA 1ZYSA 3V5LA 3MPAA 5AUTA 5CSXA 2CGWA 3AGLA 4I5MA 1J3HA 3QKLA 3QTWA 4KB8A 4V0GB 4YSMA 3UZRA 5AP4A 4U42A 3CQUA 4GK2A 4TWPA 3COKA 3KVWA 5C27A 5JZJA 1OKZA 3UO5A 3H9OA 3BV2A 4FT9A 4P4CA 3GB2A 3ACKA 3QZFA 4IE9A 4LRJA 3POOA 1V0OA 3PLSA 4PF4A 3RPVA 3VW8A 4BWKA 1XKKA 3TNHA 5E8UA 4FV2A 3AT4A 4OTPA 5BUEA 3MFSA 3EQGA 4I92A 5FQDC 2XNMA 3UYTA 4FVRA 5FM3A 2QNJA 4PTCA 4MF1A 4R78A 3MY1A 3UE4A 4KNBA 1H4LA 2ZM4A 3ZLXA 3NLBA 3MI9A 3OY1A 2XH5A 5IH4A 3KREA 2WD1A 2OIQA 5CANA 3MFTA 2X7OA 3CBLA 3BRBA 3OF0A 4ZLYA 3FLZA 2WHBA 4FODA 3DCVA 3D5VA 5EYMA 2XIXA 4C7TA 1Q41A 3QTQA 2ONLC 4O0VA 3UYSA 3ZSHA 3OWLA 4FV3A 5HVYA 3EQPA 2WPAA 5AAFA 4DF3A 2X6DA 5GIPE 3ATTA 4FKGA 4DEIA 3FL4A 4RLLA 4GEOA 4NM0A 5ANJA 5IA5A 3SW4A 3ZZEA 4DFZE 4OLIA 1GZKA 5B2LA 2WU6A 4EOLA 3R00A 4AA4A 1UWJA 4A7CA 5C8NA 4RIWA 2JGZA 5A4CA 4O22A 4BRXA 3HUCA 1OIUA 2W1FA 4C38A 5FD2A 3MSSA 4FVQA 2UW4A 5BYLA 2RFDA 3AT3A 3LOKA 1OKWA 4RLKA 4CKIA 3L8VA 3IQ7A 5C9CA 2W06A 2Y6MA 4XRJA 3GU6A 3UJGA 1IAHA 4D2TA 4JQ7A 4QPAA 4ZOGA 4X6QC 5FBOA 3TUCA 3R1QA 2VTNA 3AC1A 3ANQA 4EBVA 4O7TA 4CRLA 4RVLA 5EYCA 4DTBA 3MIYA 4FIGA 3QZIA 3BGPA 3HMOA 4FSUA 4UWYA 4JG8A 3EL7A 3LCKA 4U43A 5HHWA 3UIMA 3IK3A 3FMNA 3LIJA 4Y85A 4DH7A 4MNEB 4NJDA 4NK9A 4FTOA 2C3IB 1YWNA 2ZV7A 4GV1A 3HVCA 3R04A 4IBMA 1I44A 3CPCA 4R5SA 1Q8ZA 4NCTA 4O0TA 3ITZA 3RNIA 4AXAA 4UWCA 5HD4A 5D12A 4EHGA 2VWWA 2XJ0A 3TXOA 2GQGA 3VUHA 4W8DA 5IQFA 5JSMA 4CZTA 2Z2WA 4LMNA 4ANNA 4NYEA 2UZOA 1YWRA 3FDNA 3P7BA 1UKHA 3A4OX 2E9UA 3M11A 2GPHA 4CGAA 3HRCA 2PMNX 2XEYA 3GFEA 1Y6AA 3HLLA 4EBWA 4IZ7A 3V3VA 4BR3A 3L9MA 4FI1A 3FLYA 3KRXA 4O0RA 2R2PA 5IG1A 3PWYA 2UW3A 4M69B 4ASEA 2HZIA 4O0YA 3F3WA 5J5SA 3BPRA 3IONA 2V7AA 2P3GX 4NEUA 4ZLZA 5HX8A 4YTHA 2IZUA 2VWZA 3OWPA 2FGIA 4RC2A 4BI1A 4GKHA 2VO6A 5KKRB 1XH4A 3FBVA 3UQGA 4KKHA 4CFFA 3PG3A 1CMKE 4X2NA 4XCUA 3LFBA 3U54A 5FWKK 1UNHA 4PPCA 5DT0A 5KMKA 3NSZA 3A7IA 2QVSE 3ORPA 2WOUA 5IU2A 2B0QA 5DMZA 4W8EA 3TKIA 3KCFA 3QWJA 4R5YA 4JJRA 2YA9A 3JS2A 4BYIA 4QMWA 3QYWA 4AWIA 5AEPA 3I5NA 2W7XA 3OZ6A 3ZOSA 3EHAA 4PPAA 5EH0A 3KXZA 4AW1A 3GQLA 5IQDA 3DB8A 3PXFA 4E5WA 3CPBA 3II5A 5I9XA 2HXQA 5HE3A 4BICA 3PPJA 4LUEA 1JSUA 4HYHA 3T3UA 3VUKA 3P7CA 4AFJA 3LXLA 5E8SA 4ZXTA 4FTAA 4GS6A 4LYNA 4HCUA 4BCIA 3GC8A 4NW6A 3OXIA 3VNTA 2Y8OA 5I9YA 4BZOA 3Q53A 4D58A 4NM5A 3WZDA 1UVRA 3DKCA 3VUTA 1RE8A 3VJNA 3N4UA 2G1TA 5EM5A 4ITJA 5CEIA 4FEQA 2R3MA 2R7IA 5HLPA 5TF9A 4K9YA 5HNGA 3ZO1A 4BB4A 5M4UA 4F7JA 4DTKA 1H1RA 1ZOGA 2BHHA 3BLHA 3EQRA 2BRGA 3VRZA 2X9FA 3D7TA 3FLNC 4QPMA 1FINA 3Q9WA 2OWBA 2VTLA 1BX6A 5I9VA 3HMPA 3K54A 5EQEA 4DA5A 1G5SA 4LRKA 2BFXA 3HAVA 3P4KA 3QTUA 3D2KA 3R7GA 4YHJA 1DI9A 4F0FA 4RX8A 4UMRA 2FSMX 4FV9A 4MCVA 2GCDA 1UKIA 5LVNA 4MXCA 4BHZA 4RT7A 1PMUA 5FDXA 3I6WA 2OW3A 4KSQA 3HP5A 2ZV2A 3DXNA 3PUPA 3EQCA 4IAZA 4MX9A 2ZYBA 4ONAA 3F3VA 5EDRA 3SDJA 2BDFA 3MYGA 3OEZA 4L44A 4M12A 4RFMA 1J1BA 3UNZA 1PRYA 2YIWA 4RPVA 3DKOA 5BUIA 4C4GA 3A7FA 4YJSA 3O7LB 3RGFA 1KOAA 1ZOEA 3ORTA 2ITOA 4M0ZA 3NUPA 3R22A 4R1VA 3BHUA 4GT4A 2VNWA 5AUYA 4DCEA 4B8LA 4C4EA 1TQIA 5DR2A 5HTCA 3F88A 4WBBB 5AP2A 4XG4A 1ZMVA 5TO8A 3LFFA 1YXVA 2O64A 2PUNA 1GOLA 5CI6A 3KFAA 4I5PA 3SD0A 3KK8A 3K3JA 3TZ9A 2E9PA 5KBRA 2HENA 5FEQA 5IA2A 3ORKA 1YOMA 1UU8A 4XNEA 2J0IA 4GJ3A 2YM4A 3BYSA 4K18A 4DG3E 1K3AA 2WO6A 2YCQA 4FKWA 5J1WA 3SG9A 4I93A 4QQCA 4JRVA 2F7ZE 3LPBA 1I09A 4BDIA 3MVMA 4I0SA 4HVGA 4L3LA 4NTSA 5H8BA 5A54A 3DOGA 3OW4A 4XG7A 1NY3A 4J95A 4WNOA 3EIDA 1VZOA 4M68A 2X2MA 3T9IA 3PSBA 3D94A 2EWAA 5C03A 3ZC5A 4ZJJA 2YISA 4D9UA 3EH9A 3PZEA 3R6XA 4OAVB 3HZTA 3R2YA 4O0UA 3FC2A 3RNYA 5CAUA 4UWBA 2ZOQA 1B6CB 2C6MA 4WUAA 4IC7A 1OL6A 4JAJA 4KIQA 4BDAA 3W2QA 2EXCX 4C35A 3PRIA 1QL6A 2R9SA 4F99A 4EC8A 1WBOA 3MH3A 3S00A 4C4JA 3PXRA 4G3CA 3DLZA 4DH1A 5DOSA 3SVVA 3OVVA 4BCOA 1PKGA 1M7NA 2C68A 4C62A 4FG7A 4E8AA 5KHXA 3IGOA 2HWPA 4FC0A 2HYYA 2BFYA 2CNVA 3UVRA 2B9HA 1EH4A 3JUHA 4HVDA 4G6NA 3L8PA 3BU5A 4ASZA 4CNHA 4U3ZA 4R3PA 4XV1A 4O6EA 2VTPA 3LJ1A 3D5XA 4RG0A 3R8PA 3FAAA 5IQBA 3BEGA 3MPTA 1OPKA 3BHTA 3RWQA 3EWHA 3S1HA 4DT8A 5GINE 5BYYA 2Y9QA 1JKKA 5IDNA 5FTQA 4FEXA 4TWCA 3TT0A 5J8IA 3VO3A 4C0TA 4EH7A 3HDNA 3RAIA 4C36A 3S3IA 3LFQA 3AT2A 3KEXA 1E1VA 4FMQA 1T46A 4FF8A 3DTCA 5KMOA 2EB3A 2NP8A 3AC2A 3P23A 4USFA 5AP0A 4QQJA 4OTDA 3ZXTA 3ORMA 2YZLA 3NNVA 4FNWA 4IX3A 4O7LA 5DR9A 5FDPA 3HX4A 4HGEA 5CEMA 2CSNA 5IA4A 1WVXA 4BGHA 3VJOA 4GW8A 3MFUA 2RIOA 5LCKA 5CT7A 2P2IA 4E5BA 2OGVA 4FKIA 4I6HA 4TPTA 1QPCA 5K5NA 4MF0A 1O6KA 2XP2A 3VS0A 4GUBA 3Q96A 4LL5A 4ERWA 1Y57A 3QX2A 3DGKA 2CNQA 3WZKA 4YZNA 4GYGA 4O0XA 2V62A 3UP7A 5IH5A 4O7ZA 4R3RA 4DFLA 5A4TA 4BIEA 2WMBA 3FQHA 3TIYA 4FKQA 3T9TA 4MKCA 3LQ3A 3IOKA 2ZB0A 4G3DA 3WE4A 4B99A 3NS9A 3KCKA 3L1SA 3RAKA 3UC3A 4FSNA 5HICA 1K9AA 2PL0A 5CY3A 2FO0A 3C13A 4GVAA 3O7LD 5HBHA 3OG7A 2VTTA 2UW6A 4G6OA 3DT1A 3GI3A 5HX6A 4C2VA 3OW3A 3FWQA 3QQKA 4ZK5A 4BWPA 4QMQA 3NR9A 3WF6A 4TZRA 3EMGA 1VYZA 3FXWA 2RG5A 4GU6A 5HG9A 2CGXA 2VWVA 5GJFA 2R3HA 4ERKA 4CCBA 4KWPA 3JPVA 2W5AA 5CNOA 4FKVA 4O21A 3G6GA 4FV4A 4NH1A 2OZAB 5H2UA 5FTGA 3NX8A 4RA4A 1OKYA 3UIBA 1PMEA 5HD7A 1P5EA 2JBOA 2JIIA 4J1RA 5M53A 3PVUA 2WQMA 1R0PA 2I0YA 4JR7A 4R7IA 3MB7A 1XJDA 4MHAA 4CFVA 3QHWA 5BVDA 5L3AA 2P2HA 3SXSA 5B2MA 3OCTA 2FUMA 3G0FA 3OT3A 3PXZA 5A3XA 5CSVA 4EKLA 1RJBA 3EQHA 2G2FA 4TYGA 4S33A 2Y6OA 4J96A 3NUUA 4RIXB 2YIYA 3QALE 3KK9A 1YXXA 4MXOA 3IW6A 4FYOA 4Z9LA 3SXRA 4D4YA 2YZAA 5KX8A 4LGGA 2V55A 2R3IA 4MEDA 4R3CA 2ITTA 3A60A 3OBJA 2OZOA 5J7HA 5DYJA 5FRIA 2UW9A 5EG3A 5B2KA 4GK3A 4TRLA 3BYVA 4JBVA 2EXEA 4EOOA 5J95A 2OFVA 1JNKA 3E3BX 3JR1A 3L8SA 1XHAA 4O7SA 3ANRA 4DE4A 4UMUA 5KO1A 2CHLA 1APME 4IAAA 4NIFB 4XG8A 3P78A 5ANGA 1H1PA 2YJRA 4EK5A 3E8NA 4FIIA 4OR5A 3HV3A 4AW0A 4DYMA 4FIEA 2UW5A 3QKKA 1AQ1A 4HNFA 4D2VA 4UMPA 3P79A 3ZZWA 4EQCA 2CDZA 4ALWA 4FGBA 1FVTA 3R7EA 4PNIA 5LMKA 4GFMA 3WYYA 3QRJA 3ZO3A 3EYGA 5IMEA 4MXXA 1Q8YA 1Z5MA 3QTZA 2QD9A 4WG4A 4YJRA 3VBYA 2VZ6A 3L9LA 4BBFA 3EFJA 5AUUA 1V1KA 4KD1A 4ENYA 4XOYA 4DEDA 4A4XA 1ZMWA 4Q9ZA 4D4SA 2W5HA 4YMJA 2ITYA 3DV3A 3IDPA 4EH2A 4X2JA 1OM1A 4JQ8A 2DYLA 1OKVA 3BHHA 2C69A 2BAJA 2QQ7A 3Q4TA 4FSMA 3V8SA 2X6EA 2XMYA 3VC4A 4A06A 4RVTA 2HY81 3A7JA 1CDKA 3MTLA 3QLGA 3EOCA 4BCHA 2JKMA 4CFWA 5C8KA 4DEBA 4XP0A 3RPYA 2PUUA 5AP5A 2XIZA 5E8ZA 3PP0A 3RI1A 3C7QA 4GFGA 2BZIB 3NDMA 2PZYA 4L3JA 3KC3A 2IZRA 3LM0A 3ODZX 4TYEA 2X39A 3ZEPA 4BDHA 2QOKA 1OL7A 4QTDA 4C02A 3RZBA 4O7WA 1R78A 3ORXA 1OIQA 1OPLA 4L00A 2B54A 3IDBA 5DE2A 5C4KA 4YNEA 4R8QA 3S4QA 4QP2A 3R8ZA 4EYMA 2RFNA 3FUPA 2UZDA 4EQMA 4ACMA 4FTCA 4ITHA 2Y4PA 4FIJA 1A9UA 3EZRA 4FVPA 3FL5A 2HELA 3QD2B 3GT8A 2QOHA 5BVKA 4DGNA 4K8AA 5LXMA 3U55A 5CAPA 4EHEA 3C51A 1YHVA 4QOXA 4LV5A 3DAEA 3MY0A 5AA8A 2O3PA 3N4TA 4BDKA 3TM0A 2XM9A 3W8QA 4AGDA 3UTOA 3GCSA 2XS0A 2GMXA 4G6LA 5CSWA 4RGJA 4EH8A 1VEBA 3C0IA 4XRLA 1XH9A 3LFDA 1LR4A 5IQCA 3TG1A 1R3CA 2QOIA 1SZMA 3NIEA 4JT3A 5LWNA 3LJ0A 2E9VA 4AZVA 3VVHA 4FTRA 4BCMA 4YJPA 3HV4A 3ZUVA 3DXQA 3SRVA 4DFBA 5F94A 3I81A 2JDTA 3ZXZA 1JWHA 4RIYA 4L3PA 4ANLA 3MH0A 4X3FB 3DQXA 5JQ8A 3WZJA 2C5OA 3A99A 4AGCA 2QOLA 1ZYDA 2VAGA 3FV8A 3F69A 3R7UA 3WOWA 5I5ZA 4JDKA 4M14A 3EQIA 4OTHA 4GIHA 3RCDA 5CU6A 4CCUA 4DLIA 3VQUA 5LOHA 4HOKA 3SGCA 2BMCA 4CYIA 5TE0A 4NCTC 5ETFA 1F0QA 5LVMA 3CJFA 4QNAA 3RPOA 5D7VA 5H3QA 3LLAA 1F3MC 5A4EA 2YLFA 2NO3A 2BROA 4EWHA 2V22A 5AJQA 1OZ1A 3LVPA 5CU4A 5AV4A 1XO2B 3TUDA 4CV9A 5DT3A 1V0BA 4PQNA 2FSTX 4FV6A 2JDVA 3QQLA 5CZHA 1YDSE 2J0KA 4TYHA 4LOOA 3W10A 1BL7A 2UZVA 3KRRA 4YPSA 3TTJA 1GY3A 3P5KA 5JFVA 5J5TA 3DTWA 1MP8A 4E93A 3F9NA 3OUKA 3R21A 2BUJA 2OLCA 5JRQA 3AC3A 4F64A 4Q5EA 3KXHA 3R8UA 3VS5A 5EDQA 1U5RA 2HY0A 5BVWA 4BI2A 3K5UA 4LFIA 1PYEA 3E87A 3OOGA 3TN8A 1KE8A 1U54A 4I24A 3W2CA 4MXAA 4RIWB 4XOZA 3PSDA 3QXOA 3UMWA 4XEYA 4BGQA 3DXPA 1WFCA 3ZLSA 5L2IA 2YHVA 4YJNA 4F9AA 3R30A 1BUHA 3LFCA 2QOOA 3DDQA 2OJFE 4NFNA 3V8WA 5BMSA 4DFNA 5HCYA 3TNWA 3FMMA 4FG8A 2GDOA 2H96A 3RAHA 1W7HA 5M55A 3QTRA 4I20A 2J4ZA 1PJKA 3SQQA 3K3IA 5ANIA 4L42A 3V8TA 3HDMA 5CAQA 4S2ZA 4TW9A 4H05A 4AW2A 4D2SA 5I9WA 4IMYA 3TNQB 1L8TA 4N0SA 3TZ7A 3U6JA 3B2WA 2HK5A 2VTHA 2YJSA 4C4FA 3M2WA 5HO8A 2A1AB 4CG9A 1Q4LA 1WBTA 4V05A 3ZYAA 3D5WA 2YAAA 1S9IA 5L8LA 5D7AA 1NA7A 4DFUA 4G3EA 3RINA 2YACA 5C8MA 2XJ2A 5LARA 4BDDA 4AN2A 5E7RA 3MH1A 3OUNB 2VRXA 4G1WA 4IEBA 4PWNA 4E4MA 3TZMA 2XVDA 4EK8A 3EQFA 3FI4A 2GFCA 2YAKA 3A2CA 3CIKA 3D7ZA 2ETKA 4YC6A 1JSVA 4WUNA 3SOCA 4YJVA 2WB8A 3SW7A 4NUSA 4U9AA 5DI1A 5F95A 2BALA 4QMOA 3Q9XA 4C37A 3RPRA 1YQJA 3U9NA 5EFQA 3VBWA 5CENA 5IEYA 4FZFB 1LPUA 3FLWA 1FMKA 4K33A 4EK4A 4QMNA 4QP4A 4IC8A 4IM0A 3POZA 3WF5A 2JKQA 4H1JA 3O50A 3QRIA 4XHKB 3LAUA 3OY3A 4FZDB 3FE3A 3GBZA 4UB7A 4WKQA 3TI1A 5E8YA 2YDIA 2WMSA 5ETAA 2XYNA 2B4SB 3R8LA 3UZPA 2QLQA 3OFMA 4CFNA 4BDGA 3FMHA 4AS0A 4U7ZA 2IJMA 2XKDA 4A9YA 3BKBA 5H8GA 4M67A 2O5KA 1FQ1B 3Q60A 3ZM9A 4DEEA 3M42A 3P1AA 3O0GA 5LWMA 4DT9A 2XBAA 4KUJA 2UVXA 4D55A 4BCGA 2RF9A 5FXSA 4CQEA 4YZCA 4D9TA 2C6IA 4E7WA 4CMUA 4JDJA 3DFAA 3VRYA 1BKXA 2XB7A 3UO4A 5AV2A 4WG3A 4H1MA 4EUUA 4HVSA 2IZSA 2QU6A 1TQMA 3R8VA 2VNYA 3Q4ZA 1GAGA 4W4YA 3EKKA 2JAVA 3D0EA 5AX9A 3L9PA 3ODYX 3F6XA 3BIZA 4RJ5A 4N4SA 3V04A 1GIIA 2W9ZB 3KN5A 3QD0A 2X81A 2WMTA 3Q5ZA 5AUVA 5GZAA 4QMMA 4F9CA 3VS1A 4MQ2A 5CZIA 3HV6A 3GENA 2R3NA 4OTFA 2HWOA 3GUBA 2X4ZA 1QMZA 4AZFA 5HG8A 2WAJA 3VBQA 3MVLA 2BDJA 3IGGA 5HG7A 4JBQA 3TZ8A 2GTNA 2XK6A 3EFLA 4UZHA 4WNMA 2H34A 4O86A 4YJOA 3RCJA 2ITZA 3CGOA 3F3TA 4Y46A 1ERKA 1LEZA 2BAQA 4AOTA 3MESA 1B38A 4LV8A 1KV1A 4XP2A 1YXUA 5TKDA 5L6OA 2Y4IC 2C6LA 4USDA 5EOLA 5I0BA 1O6YA 4PP7A 4QTEA 3GQIA 4I4EA 3EN6A 1WBPA 3G5DA 3DNEA 1FBNA 4WOVA 4M13A 4QTCA 3S2PA 4DAWA 2BHEA 4J53A 4JQEA 3IDCA 5AR4A 3LMIA 1SNUA 4A9SA 4CRSA 2C6DA 5CEPA 2HAKA 1XBBA 3HMIA 2BZJA 3R63A 3DZOA 4NW5A 4E6DA 3PLAE 2ZDUA 5CQUA 4A07A 5J7BA 5J87A 2JDSA 3FC1X 3BI6A 4YO4A 5HLWA 3PE2A 3MVJA 4U6RA 5JKGA 2BIKB 3C4ZA 4TN6A 4WT6A 4IFCA 4AT3A 3IPHA 3M1SA 2P4IA 2VX3A 3EJ1A 5IA3A 2Z8CA 3DDPA 3R71A 3BU6A 5HE0A 3SXFA 4Z55A 3QD3A 4Z3VA 3NYVA 3FLQA 2VO3A 4G16A 3HRFA 3VF9A 2HXLA 3UNJA 2UZLA 3FKLA 5IQIA 4DTAA 4D2PA 1SM2A 4AGUA 3G15A 1LUFA 2JIVA 4ZTQA 2WU7A 5FG8A 4O7VA 4F9BA 3KULB 1XBAA 2XKEA 5KBQA 3KKVA 3C4WA 2F7XE 3FPQA 2F4JA 3AG9A 4F9WA 5HTBA 5M08A 3PA5A 4R7BA 5HE1A 3I0QA 3LMGA 4FTTA 3BHVA 5K0XA 4TT7A 5AUWA 1PXJA 4AUAA 5TOZA 4DN5A 3D9VA 3OD6X 1WCCA 4LMUA 5TR6A 2PMIA 4XMOA 2QOFA 1B39A 5I4NA 3ORIA 1R1WA 4YC3A 5EI2A 4DG2E 4FV5A 5IA0A 3AD4A 4EORA 3N4VA 3S95A 3CQWA 1H26A 4RJ4A 4ZJVA 2YWPA 3LXNA 2XEZA 4DHFA 4MD8E 4E6CA 4FKUA 4TY1A 3AOXA 5DGZA 5HORA 4ACHA 3NW7A 4MH7A 4ZAUA 2YM7A 5E4HA 2JD5A 2W1ZA 4JR3A 3FSKA 1M7QA 3IG7A 4W9WA 2JAMA 4JL9A 3VS3A 5IA1A 2IW8A 1WZYA 4IZAA 3G51A 3VN9A 1IA8A 2X8EA 4IM2A 2CCHA 1KSWA 1CKPA 2GHGA 3VUGA 5M57A 4B6LA 1WMKA 5KMJA 3BQCA 2JBPA 2O8YA 4OAUC 1F5QA 3UG1A 2C0OA 4IJPA 4AOJA 4H39A 4J71A 3R1NA 4IIRA 5E8WA 2WNTA 4XV9A 1MUOA 3W16A 4EHVA 3ZUUA 2HOGA 4ALVA 4O2ZA 2GQRA 5EKOA 2WTCA 3DJ6A 4JIKA 4XS2A 3R7YA 2C6OA 4AQCA 3FMDA 4RX7A 4B0GA 3QGWA 3Q5IA 3ENHA 3W2RA 4EZ7A 3ZMMA 1YI6A 3HECA 5L2TA 4GK4A 3MB6A 3C50A 3VUIA 4BCFA 2WTWA 3BZ3A 2NPQA 2WMRA 4M97A 3KU2A 5EYKA 3C0GA 3ZBFA 2R3KA 3KL8A 3MY5A 5HBJA 4K6ZA 2OH0E 2PVRA 4U80A 5EYDA 2ITVA 3EKNA 3O23A 5CVGA 3DBFA 4D2RA 3NNUA 3JVRA 4UEUA 4WBOA 2GS2A 1OL5A 3P9JA 3OTVA 4C2WA 3JY0A 2ESMA 3RP9A 1NT2A 4FUXA 4G9CA 4R7HA 2QG5A 2XIYA 3D5UA 4ZTRA 2H8HA 3D2IA 3RALA 1DM2A 2CGVA 2XYUA 1ZRZA 4I6FA 4QYGA 4L8MA 1ZYJA 4QYEA 2YFXA 4WSQA 3EYHA 4EH4A 3NYNA 1FVRA 1ZXEA 5CWZA 5CYIA 3ZU7A 5DPVA 2XK4A 4JDIA 5ANKA 3DZQA 4E4NA 2XCKA 1OGUA 5D11A 2R0UA 4TKSA 5LVLA 3NRMA 3NW6A 4RWLA 4RMZA 4IACA 1WBSA 3KXNA 4YTCA 3ORZA 3I7BA 4M84A 3NUNA 4DCAA 3QX4A 5BX0A 3C1XA 4BIBA 4ITIA 3V5WA 5I3RA 1Q3WA 3RJCA 1GIJA 3G90X 3MIAA 2PVKA 4E20A 4F1MA 1ZOHA 1JKTA 3F7WA 3FPMA 2HW7A 2PMOX 4M66A 4RX9A 3ZFYA 4F1OA 4B4LA 1UU9A 5LMKC 5FTOA 4D1SA 3DBEA 2ITXA 2QLUA 3E88A 5C26A 1W84A 2EB2A 1PXNA 4EONA 3Q4UA 4ZMFA 5I9UA 3ZFXA 4J7BA 3EQDA 4IZ5A 2R3JA 4XV2A 2WFYA 1YHSA 4K1BA 5C1QB 3MW1A 2HIWA 2FH9A 4F1TA 4C4HA 5ANOA 2XM8A 2UVZA 4LQMA 3G0EA 4X6RA 3TACA 5DEYA 4M7IA 1P14A 4EZ3A 2J0MB 3MGYA 5DT4A 4HNIA 4MVFA 2PVLA 5K0KA 2EVAA 3HA8A 3BE2A 2BVAA 4AGWA 4GG5A 1GIHA 3V51A 2Z7SA 2BDWA 2JDOA 2VO7A 1WAKA 2C3JA 4DLJA 4ZIMA 2HZ0A 3Q2MA 1Q5KA 5A6OA 1PXMA 3QAME 3UO6A 4ZS4A 2ZAZA 4NSTA 4AG8A 1IG1A 3ERKA 3GGFA 4QYYA 4UXLA 2XZSA 3RBWA 4G5JA 4MNEA 3TTIA 2QG7A 4G31A 5GHVA 3F5UA 4PMSA 4ZMEA 3DKGA 4PL4A 3GEQA 5HESA 2JKOA 2FYSA 4G34A 5JEBA 1XQZA 2R3OA 2VX1A 4II5A 5F20A 3NUSA 3CTJA 3TDWA 4L6QA 4N6ZA 3WZEA 4KIOA 4FT7A 1IEPA 1WBNA 3CTQA 4I21A 2GNLA 3C0HA 3WARA 3CSVA 4AZEA 4JNWA 2B9IA 4FT0A 4FSTA 4BWXA 4NTTA 4DEGA 5JGAA 1URCA 3OXZA 2CLXA 3VQHA 2YWVA 1JVPP 2O63A 4P90A 5ANEA 1ZAOA 4WNKA 5CLPA 4ACGA 4HVHA 2UZNA 3L9NA 4FSZA 5LQFA 2YCRA 3HA6A 2A0CX 2JFLA 4RRVA 2Q0NA 4BL1A 4FEWA 4HZRA 4D0WA 4IXPA 4EH9A 3MJ2A 3RMFA 2Z60A 4ZTLA 4FL2A 4BTKA 4RJ6A 3QA8A 5J79A 4KAOA 3UBDA 2QHNA 3SX9A 3BGQA 3PIYA 4Y73A 3PVGA 4GJ2A 4FEUA 3O96A 5JZNA 2OXYA 1PKDA 2WELA 4LG4A 4YZMA 4N57A 4UN0C 4I0RA 2J50A 3AQVA 4EK6A 1YOJA 5CSPA 3BE9A 4CMOA 5FEDA 5EI8A 2JKKA 2C47A 5DLSA 4EOJA 2ITUA 4C3FA 5CF6A 3GU5A 1WBWA 3CD3A 2YIRA 3KF4A 4JXFA 3RVGA 4HPTE 3FEGA 1JQHA 4RQKA 5EHOA 3UIXA 2XRUA 3NIZA 3GOPA 4EI4A 4FG9A 1OIRA 1CSNA 1E9HA 2GNGA 5JGBA 2F9GA 3O71A 2PE1A 5KZ0A 2HZNA 2WKMA 4D5KA 5I9ZA 2P0CA 4UV0A 3CTHA 4BC6A 1SVHA 4QMVA 5KUPA 3UG2A 2VX0A 4ZSGA 4JDHA 4KIKB 4QO9A 5IEVA 2XBJA 3ULIA 4AA0A 2BTRA 4YR8A 3HNGA 3PA4A 5LVPA 2Y7JA 4F6WA 3TJCA 4A9TA 3K5VA 3PYYA 5IPJA 4AF3A 5DBXA 2QC6A 4EOIA 4S34A 4P2KA 5GIOE 1OL2A 3AGMA 3F5GA 3KA0A 1PYXA 3GU4A 4HGLA 3DB6A 5LCJA 3P86A 1H28A 4FZAB 2IVTA 2WZJA 1ZWSA 4G17A 4JX7A 4MBJA 2XCHA 4TNDA 5L2SA 4FKLA 4IWQA 2BIYA 2RFEA 5EHLA 1PMNA 3OROA 3BWFA 5HIBA 1P2AA 2YABA 4WNPA 4CT2A 3KVXA 4JIAA 5A14A 4BBMA 5AR5A 3FQEA 4YHFA 4RA5A 3DK3A 3SRVB 4Z7GA 3VUDA 2AUHA 4C3PA 5K5XA 4IWPA 5CX9A 5HGIA 2DS1A 1RQQA 5BNJA 2PVHA 1BLXA 2PHKA 4FR4A 3VULA 3W2PA 2WTIA 4EH3A 5HE2A 4ZZOA 2EUFB 2BTSA 3WIGA 1Q99A 5FM2A 2GS6A 4OT6A 5CAVA 3TDVA 1PXIA 4CFMA 5A9UA 4AFEA 1Q24A 3QQFA 1W0XC 3W8LA 4XLIA 3DA6A 5AIKA 3RK5A 5HLNA 5M09A 3R73A 4OBOA 2R3FA 3ZO4A 4YBJA 2J5FA 3FHIA 4IB3A 2BZHB 3BYOA 4RFZA 5GJGA 4XYFA 4ZY4A 4RJ7A 3RPSA 3NW5A 1OECA 4GU9A 5HOAA 4BF2A 5A6NA 2X2LA 3VIDA 4FNXA 3WE8A 4YJQA 4EQUA 4F6SA 5M44A 2WEIA 2OIDA 1ZMUA 4IX5A 4U0IA 3WZUA 2C0TA 4XG6A 2OK1A 3UVPA 4F65A 4F63A 2HZ4A 4XP3A 3CE3A 2QI8A 3L8XA 2IO6A 2WQOA 5CVFA 5H9BA 1RDQE 2W1HA 2ZV9A 4M3QA 4MYGA 4IHPA 2BRNA 5FLFA 4F4PA 5CXZA 4IZYA 3KXXA 5D10A 3HL7A 2YCFA 2BKZA 3FSFA 1UV5A 4F7NA 5HU9A 2XNOA 4UZDA 4APPA 4C4IA 4QP1A 2OJ9A 4BCNA 3G2FA 3T8OA 4EOKA 2E2BA 3KGAA 4PTGA 3AXWA 3F5XA 4BTFA 5HI2A 3COIA 4YU2A 1YXTA 3WIKA 4DFXE 1URWA 3BWJA 2GS7A 4KRDA 4QP9A 4YLKA 5F9EA 1OMWA 2WTKC 2J9MA 4N70A 1SVEA 4UYNA 4DGMA 2VGOA 4O6LA 3UGCA 1YKRA 4TYJA 3T3VA 4YPDA 5T3QA 4ANOA 4RZVA 2VTSA 3H10A 3A62A 3QQGA 5DRBA 3RM6A 2ZB1A 3OBGA 3D83A 4ZP5A 1O6LA 4FBXA 3CEKA 4FTMA 1U46A 3U4UA 4L68A 3LZBA 1YI3A 4LM5A 3B8QA 3EN9A 4E6QA 1CTPE 3U6HA 2X8DA 4FZ6A 3BQRA 3QQJA 1S9JA 4FTNA 2CKEA 3ORNA 4ID7A 4TNBA 5IKWA 1IRKA 2C3KA 3VHEA 4AACA 3H9FA 3V5PA 3QWKA 3TUBA 3LQ5A 4A4LA 1NVSA 3UNKA 2DUVA 4C59A 5KMLA 1Z57A 3DQWA 4IVBA 4CFUA 4F0GA 4I1ZA 1KUTA 5ETIA 4USEA 2PMLX 2RGPA 2ETMA 4DG0E 2C3LA 1JAMA 2QR7A 4H36A 4WG5A 5E9EA 4OTQA 3GC7A 4LUDA 4CD0A 3IKAA 2BCJA 3KMWA 2R0IA 5CEQA 3U9CA 4EOSA 4EZ5A 3HUBA 3LFAA 5JT2A 4MBIA 3TV7A 3NNWA 3QRUA 4OTGA 2CKOA 2FSLX 2VTMA 1X8BA 1KE6A 3KXGA 3UDBA 4GRBA 1GZNA 3A8XA 4FNZA 3LFSA 4HCTA 4IAYA 4E26A 5TT7A 2PK9A 4ZTNA 5IQGA 3DFCB 2W0JA 3RKBA 4UYAA 3Q4CA 4OW8A 2ITPA 2OI4X 2VTOA 2W99B 1VR2A 4QP8A 4TWNA 4V01A 2C5NA 3ULZA 4NU1A 4U40A 1G8SA 2NRUA 3MDYA 2IG7A 2X9EA 5JFSA 3MBLA 3EQBA 4CG8A 3WBLA 5IDPA 5J9YA 3SLSA 5DR6A 2C5XA 1XR1A 4IQ6A 5E8VA 5BYZA 3ZBXA 3G33A 4S30A 3F61A 2X0GA 3VW6A 4L52A 5T68A 4K11A 3IECA 5DVRA 3DBQA 5EM6A 3R7VA 4PV0A 2PE0A 2YM6A 5HU3A 3TNPC 2XKCA 2PPQA 2QOBA 3PXYA 1YDTE 3C5UA 4OUCA 4I4FA 4L01A 4O1PA 2ACXA 3KRWA 4JBPA 5B0XA 2O65A 3W33A 4O7NA 4J8NA 4X2FA 3E62A 5L2WA 4UX9A 4FTJA 4L7SA 4MXYA 2W4JA 2XK3A 3PTGA 2B52A 2J0LA 3FJQE 2UZTA 2A19B 2BRHA 3H30A 3PWDA 4QMSA 3QTXA 1TQPA 2XUUA 2PVJA 4YO6A 3GXLA 4X2GA 3RAWA 2JITA 2XNEA 5HIEA 4A4OA 3BX5A 1PHKA 3CQEA 1CKJA 5DEWA 2R3PA 3F2NA 5GZ8A 2R4BA 3VF8A 4ASXA 3ET7A 4MWIA 5AFVA 3A61A 5AR8A 4BTJA 2CLQA 1M2QA 5B7VA 4WHZA 4I22A 1U5QA 2J2IB 3FYJX 4RIXA 5DNRA 4ZTSA 3U8WA 2QOQA 2WQBA 5JK3A 1DAWA 4ZS0A 2W05A 5IQAA 4OBPA 3VS6A 5DN3A 4S31A 5BMMA 3JXWA 2W17A 3IOPA 5GJDA 3UZTA 4C3RA 5FP6A 1G3NA 3N51A 2VD5A 4FKOA 3MVHA 4CFXA 2QO9A 4O0WA 5A4QA 5IF1A 1SNXA 5T6KA 5IISA 4D0XA 2BKKA 1UU7A 5CT0A 3NAYA 4EJNA 2GU8A 3IW4A 4Q5HA 4ARKA 4FK3A 1MQ4A 5HG5A 2VWUA 1QPJA 1H08A 1ATPE 3E8DA 3KY2A 5BVEA 1Q8UA 4A9UA 4CTBA 4DGLC 4YUQA 2Q83A 2GNFA 2JFMA 3OEFX 3PJ1A 5G6VA 1PXKA 2W4KA 4QTAA 4ACCA 1Q97A 3TKHA 2W1EA 3V01A 4JOAA 1BL6A 1DS5A 5JQ5A 3NUAA 1R0EA 1JPAA 1JOWB 3NYXA 2YM5A 2VU3A 4TWOA 5I3OA 2ETRA 4BVUA 4D5HA 3FY2A 4OTRA 5DHJA 3FI3A 5E92A 4O1OA 3I79A 2BZKB 5JFWA 2QR8A 3PXKA 2GTMA 4YZ9A 1J1CA 5HO6A 5KZIA 3SG8A 1H01A 4KKGA 1H24A 3ZLYA 4F7SA 2CMWA 4ZY5A 3FKOA 1H8FA 4LGDA 2UVYA 4Q9SA 4AZWA 4H3BA 4I0TA 4BCQA 5AR7A 4EJ7A 3IS5A 5EM7A 4IB0A 3HMNA 1XH8A 4RQVA 2R3GA 2J5EA 1GNGA 5EI6A 4M15A 4NZWB 4P7EA 3FZSA 3OP5A 3TWJA 2PTKA 4RX5A 4NT4A 2YCSA 3VAPA 4PUZA 2HCKA 4XJ0A 1JLUE 4O7YA 4FL3A 5J1VA 2GNJA 4QP7A 3OOMA 3ROCA 2QU5A 2PZPA 4EOQA 3NEWA 4NFMA 2CKQA 3CLYA 1H00A 4GH2A 2W1DA 5H8EA 4QQTA 3FXZA 3OCGA 3RHKA 3ZFMA 2GFSA 1ZZLA 3FZTA 4FV0A 2WTDA 2UZBA 4W4VA 2PZRA 4YGAA 4Q2AA 4XH6A 4ZZMA 4NKAA 2AYPA 2C0IA 3NAXA 4FIHA 3PY1A 5IUHA 5ANDA 4FICA 3BGZA 3COMA 4BYJA 4IH8A 3V5TA 4CTCA 1NW1A 1J91A 2NRYA 4JBOA 1UA2A 1PF8A 2WMUA 5AUXA 4IB5A 4BIDA 2CPKE 4UMQA 4HYSA 2W5BA 3PZHA 3CJGA 4AN3A 4U3YA 2C4GA 3RM7A 2I0VA 4J99A 4RWJA 4RFYA 5FXQA 4F9YA 2A4LA 4KS7A 3O8TA 4U5JA 3W55A 2JDRA 1M17A 5HIDA 3QC9A 4MXZA 3NUYA 3ZM4A 1AGWA 1Q8WA 3DS6A 4E73A 3QCXA 3Q52A 3HKOA 3R2BA 5E8XA 3WF7A 3FZ1A 3UQCA 4FX3A 3ZLWA 3I60A 4X3FA 3UPXA 4FSWA 4AN9A 4Y5HA 4YTIA 2PUIA 3CGFA 3PPKA 4JX3A 4U8ZA 2WIPA 4L67A 4NM7A 3ZRLA 1REKA 5DG5A 4RZWA 5JFXA 3V6SA 4O38A 2OO8X 5AMNA 4XUFA 2PZIA 3FKNA 3NVKI 5HNIX 4M0YA 4GT3A 4C8BA 4EKKA 1H1QA 4AZTA 3NVMB 2G9XA 4IWOA 1YHWA 2J51A 3QLFA 4L43A 5FUTA 2OBJA 5CS6A 2I0HA 3PFQA 4I94A 3D7TB 4K2RA 3G9LX 4X3JA 4LRMA 1XH6A 5EKNA 2WQNA 5CXHA 1OUYA 1KE5A 2CCIA 3TCPA 3MWUA 3GC9A 4YZBA 3OT8A 4UY9A 2IPXA 4PTEA 3UMXA 1K2PA 5ITAA 3W1FA 3FI8A 2P55A 3PG1A 5K4IA 5M07A 2RKUA 2Z7QA 4BDFA 2XNNA 4PNKA 1V0PA 4UALA 3BV3A 4GUEA 2ITWA 4OTIA 2G2IA 3DJ7A 3EB0A 3F66A 3NGAA 4H3QA 2F7EE 3QCYA 4BFMA 4KBAA 4W9XA 4I41A 3ROYA 5KE0A 5KKRC 5E1SA 3HAMA 5L8JA 2XK7A 5AR3A 4AE6A 5DIAA 2ZJWA 3GCUA 3UOJA 4LI5A 5K3YA 4C34A 5HCXA 4G5PA 4MK0A 4FT3A 4B7TA 2J0JA 4S32A 3QF9A 4FTQA 1PXOA 5IZFA 2A27A 2BILB 3LLTA 3OCBA 4MD9E 1Q61A 3RHXA 3OTUA 5GNKA 4WO5A 3MN3A 3QUPA 4PDYA 4NJ3A 4JAIA 3VUMA 3LJ2A 4FZ7A 3NCZA 2WIHA 4QYFA 3TV6A 1W98A 2OU7A 2JC6A 4U44A 4ZSLA 5HVKA 2C1AA 4CMTA 5CALA 4DEHA 3GC0A 1HCKA 3P7AA 2ERZE 5ACKA 3LMHA 3K2LA 4BZDA 2PVFA 3A7GA 2AC5A 5ETCA 4K77A 2VWYA 2WMVA 1R39A 2OJJA 4MNFA 2YM3A 1MRVA 4NKSA 2QO7A 3ZDIA 4UBAA 4D1ZA 2XIRA 5ICPA 2DWBA 3EL8A 3GCQA 1M14A 5AUZA 4KSPA 2CN8A 3UP2A 1H0WA 3R02A 3C4FA 4QT1A 1ZZ2A 3BELA 4XBUA 4Y5QA 2WMAA 2Y4IB 3QUEA 4HW7A 3DY7A 2V7OA 4IVCA 1W8CA 4QMUA 1NVRA 3OCSA 4MTAA 2PSQA 1JKLA 3FHRA 3KXMA 2XIKA 4MWHA 2YITA 2IWIA 3A8WA 4I3ZA 2C6TA 4YZDA 2H6DA 4EWQA 3ATSA 1OI9A 2VTQA 3D4QA 3QTIA 1DAYA 1UNGA 4KS8A 3FMEA 4EOPA 4QRCA 3PJ8A 5IUGA 1LP4A 1XWSA 2YDKA 4JG7A 3ZDUA 5K9IA 2I7QA 1IR3A 4EH6A 4H58A 1ZARA 2QHMA 3CY2A 3PY0A 4HPUE 5F1ZA 4IAIA 4IDTA 2BAKA 1QPDA 3GOKA 4E6AA 2JIUA 3WF8A 4G3FA 5M4CA 3NWWA 2RFSA 4U45A 3V5JA 4E4LA 2PU8A 3BU3A 4J97A 3PRFA 3QRTA 4E1ZA 4O84A 1P4FA 2YLEA 3OHTA 2A2AA 1OVEA 5CTPA 2W4OA 1SMHA 3QGYA 4FK6A 4IB1A 4EC9A 5HVJA 3CP9A 3KMUA 4BCPA 4IWDA 2VTAA 3MA6A 2JEDA 4V0GA 5J9LA 4NWMA 4PMTA 4X21A 2J90A 1WBVA 1NXKA 4PPBA 4QMPA 4KBCA 3AMYA 2UZEA 3AMAA 5CU3A 5CEOA 5FGKA 3R9DA 2XNGA 3BBTB 4GL9A 3UIUA 4CSVA 4CZUA 5AAGA 4CEGA 4FEVA 4X7QA 5EW3A 4JS8A 1PXPA 4AT5A 3E92A 2OIBA 4WRGA 4FKSA 3N9XA 3QCQA 5AA9A 3AMBA 2IVSA 3FMKA 4I6BA 4L53A 1YDRE 3EFWA 2FVDA 4AA5A 4ENXA 2G2HA 5BUJA 4RSSA 1P4OA 3MS9A 1GZOA 4ZEGA 3Q2JA 1OBDA 4PMPA 1LEWA 4IDVA 1IA9A 5IQEA 1H25A 4X0MA 3ZUTA 3P0MA 3R01A 3AD6A 4GIIA 1J7LA 3H4JA 3TKUA 3HP2A 5AP7A 4AOIA 4FV1A 1BI7A 3WILA 3ZC6A 3Q9YA 3O51A 5CAOA 3W2OA 4J52A 3C4EA 4W4WA 2SRCA 3UVQA 2RL5A 2W1GA 2PVMA 1A48A 4CYJA 3RK7A 3S0OA 5FEEA 3DBCA 4BDEA 1JBPE 4JRNA 3BLRA 3R9HA 4CLIA 4QTBA 3PPZA 3R9OA 3ZEWA 3CD8A 3LCSA 5GZ9A 1DI8A 4FE2A 2H9VA 4O0SA 2F49A 2FSOX 2HW6A 2IVUA 4FL1A 4JI9A 2VTJA 4O81A 4IFGA 3ENMA 3R0TA 4AP7A 3RWPA 4ACDA 3R9RA 2GHLA 3QU0A 3R1YA 5AP6A 3DPKA 3B8RA 2LAVA 3G6HA 5IEXA 2C30A 3ZH8A 1AD5A 2R5TA 2EU9A 4FTIA 2QKWB 3MH2A 5L8KA 1ZY5A 3QUDA 5M4FA 5M51A 4Z16A 3QYZA 2CNUA 5M06A 1YI4A 4YP8A 4BKJA 5CEKA 3E8EA 4YC8A 3UPZA 4EK3A 5CVHA 5CI7A 2I0EA 3BBWA 5AIRA 1GZ8A 4FSYA 2ZM3A 3SKCA 3TV4A 3VS4A 2PY3A 1Y91A 3I6UA 3HGKA 4QMXA 2W96B 2OH4A 3ZCLA 3U87A 5BVNA 3KULA 3QZHA 4PX6A 3UQFA 3MFRA 2Z7RA 2I6LA 5HNBA 4BDBA 2B1PA 5E91A 5HO7A 4FKPA 2XRWA 5AR2A 2VWBA 4TXCA 3PVBA 4ZJIA 3SAYA 3F82A 5E8TA 3R7IA 1OITA 2DQ7X 3B2TA 2RSVA 2X2KA 4KKEA 2QKRA 3GP0A 2XF0A 4FSRA 3R1SA 5BVFA 2PULA 2AC3A 4CVAA 5C4LA 3BEAA 2ONLA 2YIQA 2WMQA 4YJUA 3PSCA 4WA9A 2PZ5A 4F09A 4FUYA 2FB8A 4EEVA 2B55A 4M69A 4GG7A 4HCVA 4BBEA 2YDJA 4BTMA 4W4XA 4QMLA 3KMMA 4F0IA 4RJ3A 4BN1A 3IW5A 4YURA 3A7HA 5DWRA 3R83A 1T45A 1SVGA 3DBDA 5DRDA 4LGHA 1Q3DA 4B9DA 4AU8A 4R6VA 3CKWA 2OXXA 2X4FA 4YNOA 1VYWA 5BQ0A 3AD5A 3DNDA 3JY9A 3UOLA 4PL3A 3UODA 2CJMA 2XJ1A 4ANMA 3SV0A 4EYJA 4HVIA 4Y83A 4IAKA 2QODA 3LFNA 1UNLA 4MD7E 4YLLA 2VUWA 2XNPA 2OJGA 3VS2A 5EDPA 4BKZA 2YIXA 3WYXA 1KOBA 3VS7A 2G15A 2X1NA 3ZS5A 2QO2A 3UOKA 1QPEA 2UV2A 4C57A 2Q0BA 5C01A 3O8PA 5BPYA 5BVOA 4D28A 2C6EA 4RBLA 2F57A 3QXPA 4L7FA 3NPCA 5HEZA 4ANSA 4EUTA 5IMXA 5KMMA 4RIOA 1PMVA 4KA3A 4LOPA 3GCPA 3Q04A 4XG2A 3WF9A 3O8UA 1CKIA 4I5CA 3JYAA 4D1XA 5AADA 4H3PA 3UC4A 1FGIA 4IVDA 4L9IA 2VTRA 2ITQA 3RZFA 3RTPA 3COHA 3ETAA 3ZTXA 5HCZA 2R7BA 2OF2A 3R9NA 4F08A 2ERKA 4FSQA 5IQHA 4PDOA 5HQ0A 5IUIA 4XX9A 4C61A 4CV8A 5LVOA 1O9UA 3A4PA 3FLSA 3DLSA 4Y95A 2I1MA 4PY1A 2UUEA 2C5VA 4JLCA 2Z02A 4C33A 3E93A 3JVSA 3LKMA 4AX8A 1JKSA 2Y0AA 4GMYA 5EOBA 3TEIA 4ANQA 3U4WA 5J9ZA 3E8CA 5L6WL 2J6MA 1YXSA 1H27A 4QNYA 3O17A 5A4LA 5HKMA 4LL0A 3CS9A 3GU7A 2VN9A 3UOHA 5HBEA 1ZYLA 3MJ1A 3LXKA 5M56A 3MPMA 5AX3A 3ACJA 3NZ0A 1CM8A 4CKJA 1G8AA 5AM7A 5DH3A 3SC1A 4E3CA 3HEGA 3BHYA 1KE9A 4KABA 4YTFA 5DFPA 3OWKA 2OSCA 4RIYB 3MV5A 3D14A 4D2WA 5KNJA 1XH5A 4IANA 2IN6A 4G9RA 4IW0A 4HGTA 1ZY4A 4PMMA 5FP5A 2W9FB 4L45A 4RWIA 5KMIA 4RVMA 3ALOA 3HMMA 4CZYB 4Z7HA 2V0DA 4ZSEA 4QMZA 4Y8DA 3P08A 1Y6BA 3THBA 3E63A 4Y72A 5AV1A 2PWLA 3LCDA 2ZMDA 2QONA 3DAJA 3BYMA 4OT5A 1KWPA 3PA3A 4QP6A 2LGCA 3FQSA 4U97A 4R1YA 5CU0A 1M2PA 1XBCA 3OMVA 3FY0A 4C58A 1OB3A 2R3QA 4BZNA 2WMXA 4DH8A 1H1WA 4G2FA 4F70A 2B9JA 2WXVA 2IW9A 1PXLA 3OS3A 5M4IA 5AV3A 1UWHA 2GNIA 3R8MA 1YWVA 3W18A 4BCJA 3QFVA 4TYHB 2UW7A 3PVWA 3D15A 3VHKA 1E1XA 3F7ZA 3GNIB 4ZTHA 3LHJA 3SOAA 1XH7A 3H9RA 5AV0A 4TL0A 4GCJA 2X7FA 3LE6A 5EK7A 2OKRA 4WSYA 3DKFA 1ZYCA 5CF8A 4XBRA 1YVJA 2B53A 3LFEA 1OIYA 3FYKX 5LJJA 4F7LA 2YERA 3QKMA 3Q6WA 5KCVA 2RG6A 3F3UA 5HZNA 1U54B 2Z7LA 2V5QA 1QCFA 1HOWA 5FXRA 4IAFA 3Q32A 3EFKA 3VWAA 2XNBA 3ORLA 2J7TA 4MQ1A 1PY5A 4ALUA 3ZONA 2YM8A 3FZOA 4XV3A 5CNNA 3U51A 3FI2A 4JG6A 1MQBA 3ZSIA 3F2AA 2QURA 3QTSA 2C6KA 2CN5A 3ALNA 3G9NA 4YSJA 3Q9ZA 4K0YA 5EHYA 5LMBA 4HZSA 4GYIA 4E4XA 3QRKA 2F2CB 5EQPA 4YJTA 4IJ9A 4GT5A 4U81A 5CF4A 1W83A 1Q8TA 5AM6A 4PDSA 1Y8GA 3PE1A 3QZGA 3EN4A 2YEXA 4IVAA 4HJOA 4AAAA 4GSBA 4PDPA 3WI6A 3PIXA 4UMTA 4ZLOA 3PJCA 5E90A 2UZUE 2VO0A 5HTIA 2IW6A 3ZSGA 1SYKA 3I5ZA 3TIZA 1H1SA 1STCE 4PRJA 4U41A 4X3FC 4YLJA 2IVVA 3AC4A 1FVVA 5EW8A 2BRMA 4P5ZA 2XA4A 4FNYA 1FMOE 3CKXA 5DA3A 4FV8A 3CY3A 3E64A 4OBQA 2JLDA 3PY3A 4DGGA 4RC3A 3CXWA 3KB7A 3ZO2A 1TKIA 4CXAA 3E7VA 4O91A 4HYUA 3H0YA 3KN6A 1H07A 1KE7A 5JN2A 4AZSA 2CGUA 3QHRA 4A9RA 4DBNA 4YBKA 2NNWB 4FV7A 4XG3A 4R77A 1YOLA 4FTUA 3QA0A 2ZMCA 3AC8A 4XLVA 2PE2A 1KV2A 2GQSA 4CLJA 4ORKA 1Z9XA 3E5AA 4ZY6A 2CKPA 4KIKA 3IW8A 1NVQA 4F6UA 2X7GA 3C4CA 3LW0A 5AWMA 2KULA 3HYHA 3TNIA 1GJOA 2WMWA 4DBXA 3PXQA 3EN7A 5ACBC 3PIZA 2VWIA 2WTKB 4HYIA 2KTYA 3LCOA 4M8TA 5AAEA 2W1CA 4ZSAA 2C1BA 4AW5A 5EM8A 5AP1A 3RK9A 3V6RA 5IH6A 3QC4A 2WEVA
chains in the Genus database with same CATH superfamily
4BI0A 1TZDA 3EZVA 5LMAA 2B7AA 3LQ8A 1BI8A 3HV7A 4UXQA 4XG9A 2WTVA 3E7OA 4GVJA 4NM3A 4ANBA 3MTFA 4BJJB 1U59A 4FKTA 4L46A 3LCTA 4O83A 2ZDTA 4WIHA 4WRSA 2G01A 2OFUA 5JGDA 2XK9A 3ID6C 3ZRKA 4FTLA 4J98A 2BRBA 4IX6A 3QBNA 3CR0A 3TJDA 5CF5A 3I0OA 4QD6A 4DH3A 3F5PA 4DITA 3DK6A 5A46A 3PJ3A 3GU8A 3PP1A 1OUKA 4JVGA 4AE9A 2PYWA 5JMSA 3PDTA 2WGJA 3NUXA 3C4XA 1IASA 2OZAA 4I5HA 4ZSJA 3QQHA 2X8IA 3KRJA 4N6YA 2WOTA 2P33A 4HGSA 3OXTA 3VBXA 5KHWA 3BYUA 2E9NA 3W2SA 2UW8A 3PJ2A 5FBNC 4QMTA 3DU8A 2E9OA 3I4BA 5JRSA 3GFWA 3HRBA 4IM3A 2GNHA 4MBLA 4BGGA 4U79A 4BKYA 1Y8YA 3Q6UA 4FYNA 4MUQA 5EW9A 1WVYA 2PUPA 4TYIA 4GKIA 3LM5A 1RW8A 3DJ5A 4IADA 4DGOA 3SA0A 4NL0A 2PVYA 4G3GA 4V04A 1M52A 3C5IA 3SHEA 2BR1A 1M2RA 4DFYA 3LXPA 4FKRA 3GVUA 2O0UA 2QCSA 3NCGA 5D41A 4D4VA 2I40A 3EN5A 2B9FA 2W1IA 3KQ7A 2GHMA 4BY9E 4EL9A 3VBTA 1ZLTA 2ZM1A 2XAOA 4NIFA 2BPMA 3FMJA 4CKRA 3FXXA 3I1AA 3NNXA 1BYGA 3NYOA 4PL5A 4B8MA 4YHTA 4E5AX 3W0QA 3CCNA 4PP9A 2OG8A 4KRCA 4O7RA 3Q3BA 5F4NA 4EHZA 3U6IA 2XK8A 4KINA 5L2QA 1JSTA 1BMKA 4EOMA 2UZWE 4AT4A 1ND4A 1FPUA 3GCVA 4QMYA 3F2RA 2PVNA 5KMNA 1H0VA 3AC5A 3ZHPC 4LOQA 3BLQA 5D9HA 4QPSA 2OF4A 3V5QA 3NMUF 3R7OA 4BDJA 3W32A 4RJ8A 3IO7A 4DINA 3KF7A 4P5QA 2IZTA 3MA3A 1IAJA 3H0ZA 5AP3A 1REJA 2XKFA 4FGRA 3FZRA 1J7IA 2GSFA 2OJIA 4FOBA 5K4JA 3VBVA 4X2KA 4DC2A 4EH5A 4RC4A 1FGKA 2C5YA 2R3RA 2QOCA 3E3PA 5G1XA 4FTKA 4OGRA 1HCLA 2REIA 4FOCA 3DK7A 2ZV8A 3OC1A 4BHNA 4D4RA 4FIFA 4GFOA 4RVKA 4OTWA 5CU2A 4FT5A 4I6QA 2YN8A 4MAOA 4WD5A 5CASA 1MRYA 1WVWA 3I7CA 3CC6A 3FZPA 4APCA 4O82A 4O96A 2AEGA 2WQEA 3BCEA 1OBGA 2UW0A 1TVOA 4ASDA 5L6PA 4TTHB 4FA2A 4O2PA 5L4QA 3OWJA 5D1JA 2XANA 2F2UA 2ITNA 2VV9A 5CSHA 4O27B 4CQGA 1YRPA 3KRLA 4BCKA 4FKJA 3QD4A 1L3RE 2FA2A 2OICA 1A06A 3ELJA 4ZZNA 4QQ5A 4F78A 3ZRMA 3IW7A 3QQUA 4DEAA 2EXMA 3FMLA 1PW2A 4DH5A 1MRUA 2WTJA 3HV5A 3QCSA 4IX4A 2VGPA 5E1EA 4QYHA 3O2MA 4J8MA 1UU3A 1YW2A 1VJYA 3QL8A 2R64A 5CQWA 4KIPA 4BDCA 2OXDA 5JH6A 3REPA 1Q62A 1OPJA 3R28A 1U4DA 3C9WA 1OL1A 2R3LA 2O2UA 4KBKA 5EQYA 4AAYA 2VTIA 1W82A 3F3ZA 4CT1A 1FOTA 3DAKA 1J7UA 3H3CA 4QP3A 2ZVAA 4ZTMA 3TL8A 2VWXA 4I23A 4RWKA 1ZYSA 3V5LA 3MPAA 5AUTA 5CSXA 2CGWA 3AGLA 4I5MA 1J3HA 3QKLA 3QTWA 4KB8A 4V0GB 4YSMA 3UZRA 5AP4A 4U42A 3CQUA 4GK2A 4TWPA 3COKA 3KVWA 5C27A 5JZJA 1OKZA 3UO5A 3H9OA 3BV2A 4FT9A 4P4CA 3GB2A 3ACKA 3QZFA 4IE9A 4LRJA 3POOA 1V0OA 3PLSA 4PF4A 3RPVA 3VW8A 4BWKA 1XKKA 3TNHA 5E8UA 4FV2A 3AT4A 4OTPA 5BUEA 3MFSA 3EQGA 4I92A 5FQDC 2XNMA 3UYTA 4FVRA 5FM3A 2QNJA 4PTCA 4MF1A 4R78A 3MY1A 3BL7A 3UE4A 4KNBA 1H4LA 2ZM4A 3ZLXA 3NLBA 3MI9A 3OY1A 2XH5A 5IH4A 3KREA 2WD1A 2OIQA 5CANA 3MFTA 2X7OA 3CBLA 3BRBA 3OF0A 4ZLYA 3FLZA 2WHBA 4FODA 3DCVA 3D5VA 5EYMA 2XIXA 4C7TA 1Q41A 3QTQA 2ONLC 4O0VA 3UYSA 3ZSHA 3OWLA 4FV3A 5HVYA 3EQPA 2WPAA 5AAFA 4DF3A 2X6DA 5GIPE 3ATTA 4FKGA 4DEIA 3FL4A 4RLLA 4GEOA 4NM0A 5ANJA 5IA5A 3SW4A 3ZZEA 4DFZE 4OLIA 1GZKA 5B2LA 2WU6A 4EOLA 3R00A 4AA4A 1UWJA 4A7CA 5C8NA 4RIWA 2JGZA 5A4CA 4O22A 4BRXA 3HUCA 1OIUA 2W1FA 4C38A 5FD2A 3MSSA 4FVQA 2UW4A 5BYLA 2RFDA 3AT3A 3LOKA 1OKWA 4RLKA 4CKIA 3L8VA 3IQ7A 5C9CA 2W06A 2Y6MA 4XRJA 3GU6A 3UJGA 1IAHA 4D2TA 4JQ7A 4QPAA 4ZOGA 4X6QC 5FBOA 3TUCA 3R1QA 2VTNA 3AC1A 3ANQA 4EBVA 4O7TA 4CRLA 4RVLA 5EYCA 4DTBA 3MIYA 4FIGA 3QZIA 3BGPA 3HMOA 4FSUA 4UWYA 4JG8A 3EL7A 3LCKA 4U43A 5HHWA 3UIMA 3IK3A 3FMNA 3LIJA 4Y85A 4DH7A 4MNEB 4NJDA 4NK9A 4FTOA 2C3IB 1YWNA 2ZV7A 4GV1A 3HVCA 3R04A 4IBMA 1I44A 3CPCA 4R5SA 1Q8ZA 4NCTA 4O0TA 3ITZA 3RNIA 4AXAA 4UWCA 5HD4A 5D12A 4EHGA 2VWWA 2XJ0A 3TXOA 2GQGA 3VUHA 4W8DA 5IQFA 5JSMA 4CZTA 2Z2WA 4LMNA 4ANNA 4NYEA 2UZOA 1YWRA 3FDNA 3P7BA 1UKHA 3A4OX 2E9UA 3M11A 2GPHA 4CGAA 3HRCA 2PMNX 2XEYA 3GFEA 1Y6AA 3HLLA 4EBWA 4IZ7A 3V3VA 4BR3A 3L9MA 4FI1A 3FLYA 3KRXA 4O0RA 2R2PA 5IG1A 3PWYA 2UW3A 4M69B 4ASEA 4FJVA 2HZIA 4O0YA 3F3WA 5J5SA 3BPRA 3IONA 2V7AA 2P3GX 4NEUA 4ZLZA 5HX8A 4AXCA 4YTHA 2IZUA 2VWZA 3OWPA 2FGIA 4RC2A 4BI1A 4GKHA 2VO6A 5KKRB 1XH4A 3FBVA 3UQGA 4KKHA 4CFFA 3PG3A 1CMKE 4X2NA 4XCUA 3LFBA 3U54A 5FWKK 1UNHA 4PPCA 5DT0A 5KMKA 3NSZA 3A7IA 2QVSE 3ORPA 2WOUA 5IU2A 2B0QA 5DMZA 4W8EA 3TKIA 3KCFA 3QWJA 4R5YA 4JJRA 2YA9A 3JS2A 4BYIA 3W0NA 4QMWA 3QYWA 4AWIA 5AEPA 3I5NA 2W7XA 3OZ6A 3ZOSA 3EHAA 4PPAA 5EH0A 3KXZA 4AW1A 3GQLA 5IQDA 3DB8A 3PXFA 4E5WA 3CPBA 3II5A 5I9XA 2HXQA 5HE3A 4BICA 3PPJA 4LUEA 1JSUA 4HYHA 3T3UA 3VUKA 3P7CA 4AFJA 3LXLA 5E8SA 4O4CA 4ZXTA 1OGYA 4FTAA 4GS6A 4LYNA 4HCUA 4BCIA 3GC8A 4NW6A 3OXIA 3VNTA 5BV3A 2Y8OA 5I9YA 4BZOA 3Q53A 2AQXA 4D58A 4NM5A 3WZDA 3NFGB 1UVRA 3DKCA 3VUTA 1RE8A 3VJNA 3N4UA 2G1TA 5EM5A 4ITJA 4DHZA 5CEIA 4FEQA 2R3MA 2R7IA 1G8JA 5HLPA 5TF9A 4K9YA 3AKKA 5HNGA 3ZO1A 4BB4A 5M4UA 4F7JA 4DTKA 1H1RA 1ZOGA 2BHHA 3BLHA 3EQRA 2BRGA 3VRZA 2X9FA 4AXFA 3D7TA 3FLNC 4QPMA 1FINA 3Q9WA 2OWBA 2VTLA 1BX6A 5I9VA 3HMPA 3K54A 5EQEA 4DA5A 1G5SA 4LRKA 2BFXA 3HAVA 3P4KA 3QTUA 3D2KA 3R7GA 4YHJA 1DI9A 4F0FA 4RX8A 4UMRA 2FSMX 4FV9A 4MCVA 2GCDA 1UKIA 5LVNA 4MXCA 4BHZA 4RT7A 1PMUA 5FDXA 3I6WA 2OW3A 4KSQA 1W2FA 3HP5A 2ZV2A 3DXNA 3PUPA 3EQCA 4IAZA 4MX9A 2ZYBA 4ONAA 3F3VA 5EDRA 3SDJA 2BDFA 3MYGA 3OEZA 4L44A 4M12A 4RFMA 1J1BA 3UNZA 1PRYA 2YIWA 4RPVA 3DKOA 5BUIA 4C4GA 3A7FA 4YJSA 3O7LB 3RGFA 1KOAA 1ZOEA 3ORTA 2ITOA 4M0ZA 3NUPA 3R22A 4R1VA 3BHUA 4GT4A 2VNWA 5AUYA 4DCEA 4B8LA 4C4EA 1TQIA 5DR2A 5HTCA 3F88A 4WBBB 5AP2A 4XG4A 3W0SA 1ZMVA 5TO8A 3LFFA 1YXVA 2O64A 2PUNA 1GOLA 5CI6A 3KFAA 4I5PA 3SD0A 3KK8A 3K3JA 3TZ9A 2E9PA 5KBRA 2HENA 5FEQA 5IA2A 3ORKA 1YOMA 1UU8A 4XNEA 2J0IA 4GJ3A 2YM4A 3BYSA 4K18A 4DG3E 1K3AA 2WO6A 2YCQA 4FKWA 5J1WA 3SG9A 4I93A 4QQCA 4JRVA 2F7ZE 3LPBA 1I09A 4BDIA 3MVMA 4I0SA 4HVGA 4L3LA 4NTSA 5H8BA 5A54A 3DOGA 3OW4A 4XG7A 1NY3A 4J95A 4WNOA 3EIDA 1VZOA 4M68A 2X2MA 3T9IA 3PSBA 3D94A 3BL9A 2EWAA 5C03A 3ZC5A 4ZJJA 2YISA 4D9UA 3EH9A 3PZEA 3R6XA 4OAVB 3HZTA 3R2YA 4O0UA 3FC2A 3RNYA 5CAUA 4UWBA 2ZOQA 1B6CB 2C6MA 4WUAA 4IC7A 1OL6A 4JAJA 4KIQA 4BDAA 3W2QA 2EXCX 4C35A 3PRIA 1QL6A 2R9SA 4F99A 4EC8A 1WBOA 3MH3A 3S00A 4C4JA 3PXRA 4G3CA 3DLZA 4DH1A 5DOSA 3SVVA 3OVVA 4BCOA 1PKGA 1M7NA 2C68A 4C62A 4FG7A 4E8AA 5KHXA 3IGOA 2HWPA 4FC0A 2HYYA 2BFYA 2CNVA 3UVRA 2B9HA 1EH4A 3JUHA 4HVDA 4G6NA 3L8PA 3BU5A 4ASZA 4CNHA 4U3ZA 4R3PA 4XV1A 4O6EA 2VTPA 3LJ1A 3D5XA 4RG0A 3R8PA 3FAAA 5IQBA 3BEGA 3MPTA 1OPKA 3BHTA 3RWQA 3EWHA 3S1HA 4DT8A 5GINE 5BYYA 2Y9QA 1JKKA 5IDNA 5FTQA 4FEXA 4TWCA 3TT0A 5J8IA 3VO3A 4C0TA 4EH7A 3HDNA 3RAIA 4C36A 3S3IA 3LFQA 3AT2A 1VLRA 3KEXA 1E1VA 4FMQA 1T46A 4FF8A 3DTCA 5KMOA 2EB3A 2NP8A 3AC2A 3P23A 4USFA 5AP0A 4QQJA 4OTDA 3ZXTA 3ORMA 2YZLA 3NNVA 4FNWA 4IX3A 4O7LA 5DR9A 5FDPA 3HX4A 4HGEA 5CEMA 2CSNA 5IA4A 1WVXA 4BGHA 3VJOA 4GW8A 3MFUA 2RIOA 5LCKA 5CT7A 2P2IA 4E5BA 2OGVA 3NFFB 4FKIA 4I6HA 4TPTA 1QPCA 5K5NA 4MF0A 1O6KA 2XP2A 3VS0A 4GUBA 3Q96A 4LL5A 4ERWA 1Y57A 3QX2A 3DGKA 2CNQA 3WZKA 4YZNA 4GYGA 4O0XA 2V62A 3UP7A 5IH5A 4O7ZA 4R3RA 4DFLA 5A4TA 4BIEA 2WMBA 3FQHA 3TIYA 4FKQA 3T9TA 4MKCA 3LQ3A 3IOKA 2ZB0A 4G3DA 3WE4A 4B99A 3NS9A 3KCKA 3L1SA 3RAKA 3UC3A 4FSNA 3VONA 5HICA 1K9AA 2PL0A 5CY3A 2FO0A 3C13A 1ST0A 4GVAA 3O7LD 5HBHA 3OG7A 2VTTA 2UW6A 4G6OA 3DT1A 3GI3A 5HX6A 4C2VA 3OW3A 3FWQA 3QQKA 4ZK5A 4BWPA 4QMQA 3NR9A 3WF6A 4TZRA 3EMGA 1VYZA 3FXWA 2RG5A 4GU6A 5HG9A 2CGXA 2VWVA 5GJFA 2R3HA 4ERKA 4CCBA 4AXDA 1W2CA 4KWPA 3JPVA 2W5AA 5CNOA 3TMOA 4FKVA 4O21A 3G6GA 4FV4A 4NH1A 2OZAB 5H2UA 5FTGA 3NX8A 4RA4A 1OKYA 3UIBA 1PMEA 5HD7A 1P5EA 2JBOA 2JIIA 4J1RA 5M53A 3PVUA 3AKJA 2WQMA 1R0PA 2I0YA 4JR7A 4R7IA 3MB7A 1XJDA 4MHAA 4CFVA 3QHWA 5BVDA 5L3AA 2P2HA 3SXSA 5B2MA 3OCTA 2FUMA 3G0FA 3OT3A 3PXZA 5A3XA 5CSVA 4EKLA 4DDGA 1RJBA 3EQHA 2G2FA 4TYGA 4S33A 2Y6OA 4J96A 3NUUA 4RIXB 2YIYA 3QALE 3KK9A 1YXXA 4MXOA 3IW6A 4FYOA 4Z9LA 3SXRA 4D4YA 2YZAA 5KX8A 4LGGA 2V55A 2R3IA 4MEDA 4R3CA 2ITTA 3A60A 3OBJA 2OZOA 5J7HA 5DYJA 5FRIA 2UW9A 5EG3A 5B2KA 4GK3A 4TRLA 3BYVA 4JBVA 2EXEA 4EOOA 5J95A 2OFVA 1JNKA 3E3BX 3JR1A 3L8SA 1XHAA 4O7SA 3ANRA 4DE4A 4UMUA 5KO1A 2CHLA 1APME 4IAAA 4NIFB 4XG8A 3P78A 5ANGA 1H1PA 2YJRA 4EK5A 3E8NA 4FIIA 4OR5A 3HV3A 4AW0A 4DYMA 4FIEA 2UW5A 3QKKA 1AQ1A 4HNFA 4D2VA 4UMPA 3P79A 3ZZWA 4EQCA 2CDZA 4ALWA 4FGBA 1FVTA 3R7EA 4PNIA 5LMKA 4GFMA 3WYYA 3QRJA 3ZO3A 3EYGA 5IMEA 4MXXA 1Q8YA 1Z5MA 3QTZA 2QD9A 4WG4A 4YJRA 3VBYA 2VZ6A 3L9LA 4BBFA 3EFJA 5AUUA 1V1KA 4KD1A 4ENYA 4XOYA 4DEDA 4A4XA 1ZMWA 4Q9ZA 4D4SA 2W5HA 4YMJA 2ITYA 3DV3A 3IDPA 4EH2A 4X2JA 1OM1A 4JQ8A 2DYLA 1OKVA 3BHHA 2C69A 2BAJA 2QQ7A 3Q4TA 4FSMA 3V8SA 2X6EA 2XMYA 3VC4A 4A06A 4RVTA 2HY81 3A7JA 1CDKA 3MTLA 3QLGA 3EOCA 4BCHA 2JKMA 4CFWA 5C8KA 4DEBA 4XP0A 3RPYA 2PUUA 5AP5A 4QEBA 2XIZA 5E8ZA 3PP0A 3RI1A 3C7QA 4GFGA 2BZIB 3NDMA 2PZYA 4L3JA 3KC3A 2IZRA 3LM0A 3ODZX 4TYEA 2X39A 3ZEPA 4BDHA 2QOKA 1OL7A 4QTDA 4C02A 3RZBA 4O7WA 1R78A 3ORXA 1OIQA 1OPLA 4L00A 2B54A 3IDBA 5DE2A 5C4KA 4YNEA 4R8QA 3S4QA 4QP2A 3R8ZA 4EYMA 2RFNA 2X0QA 2UZDA 3FUPA 4EQMA 4ACMA 4FTCA 4ITHA 2Y4PA 4FIJA 1A9UA 3EZRA 4FVPA 3FL5A 2HELA 3QD2B 3GT8A 2QOHA 5BVKA 4DGNA 4K8AA 5LXMA 3U55A 5CAPA 4EHEA 3C51A 1YHVA 4QOXA 4LV5A 3DAEA 3MY0A 5AA8A 2O3PA 3N4TA 4BDKA 3TM0A 2XM9A 3W8QA 4AGDA 3UTOA 3GCSA 2XS0A 2GMXA 4G6LA 5CSWA 4RGJA 4EH8A 1VEBA 3C0IA 4XRLA 1XH9A 3LFDA 1LR4A 5IQCA 3TG1A 1R3CA 2QOIA 1SZMA 3W0OA 3NIEA 4JT3A 5LWNA 3LJ0A 2E9VA 4AZVA 3VVHA 4FTRA 4BCMA 4YJPA 3HV4A 3ZUVA 3DXQA 3SRVA 4DFBA 5F94A 3I81A 2JDTA 3ZXZA 1JWHA 4RIYA 4L3PA 4ANLA 3MH0A 4X3FB 3DQXA 5JQ8A 3WZJA 2C5OA 3A99A 4AGCA 2QOLA 1ZYDA 2VAGA 3FV8A 3F69A 3R7UA 3WOWA 5I5ZA 4JDKA 4M14A 3EQIA 4OTHA 4GIHA 3RCDA 5CU6A 4CCUA 4DLIA 3VQUA 5LOHA 4HOKA 3SGCA 2BMCA 4CYIA 5TE0A 4NCTC 5ETFA 1F0QA 5LVMA 3CJFA 4QNAA 3RPOA 5D7VA 5H3QA 3LLAA 1F3MC 5A4EA 2YLFA 2NO3A 2BROA 4EWHA 2V22A 5AJQA 1OZ1A 3LVPA 5CU4A 5AV4A 1XO2B 3TUDA 4CV9A 5DT3A 1V0BA 4PQNA 2FSTX 4FV6A 2JDVA 3QQLA 5CZHA 1YDSE 2J0KA 4TYHA 4LOOA 3W10A 1BL7A 2UZVA 3KRRA 4YPSA 3TTJA 1GY3A 3P5KA 5JFVA 5J5TA 3DTWA 1MP8A 4E93A 3F9NA 3OUKA 3R21A 2BUJA 2OLCA 5JRQA 3AC3A 4F64A 4Q5EA 3KXHA 3R8UA 3VS5A 5EDQA 1U5RA 2HY0A 5BVWA 4BI2A 3K5UA 4LFIA 1PYEA 3E87A 3OOGA 3TN8A 4O4FA 1KE8A 1U54A 4I24A 3W2CA 4MXAA 4RIWB 4XOZA 3PSDA 3QXOA 3UMWA 4XEYA 4BGQA 3DXPA 1WFCA 3ZLSA 5L2IA 2YHVA 4YJNA 4F9AA 3R30A 1BUHA 3LFCA 2QOOA 3DDQA 2OJFE 4NFNA 3V8WA 5BMSA 4DFNA 5HCYA 3TNWA 3FMMA 4FG8A 2GDOA 2H96A 3RAHA 1W7HA 5M55A 3QTRA 4I20A 2J4ZA 1PJKA 3SQQA 3K3IA 5ANIA 4L42A 3V8TA 3HDMA 5CAQA 4S2ZA 4TW9A 4H05A 4AW2A 4D2SA 5I9WA 4IMYA 3TNQB 1L8TA 4N0SA 3TZ7A 3U6JA 3B2WA 2HK5A 2VTHA 2YJSA 4C4FA 3M2WA 5HO8A 2A1AB 4CG9A 1Q4LA 1WBTA 4V05A 3ZYAA 3D5WA 2YAAA 1S9IA 5L8LA 5D7AA 1NA7A 4DFUA 4G3EA 3RINA 2YACA 5C8MA 2XJ2A 5LARA 4BDDA 4AN2A 5E7RA 3W0PA 3MH1A 3OUNB 2VRXA 4G1WA 4IEBA 4PWNA 4E4MA 3TZMA 2XVDA 4EK8A 3EQFA 3FI4A 2GFCA 2YAKA 3A2CA 3CIKA 3D7ZA 2ETKA 4YC6A 1JSVA 4WUNA 3SOCA 4YJVA 2WB8A 3SW7A 4NUSA 4U9AA 5DI1A 5F95A 2BALA 4QMOA 3Q9XA 4C37A 1ST4A 3W0MA 3RPRA 1YQJA 3U9NA 5EFQA 3VBWA 5CENA 5IEYA 3O5AA 4FZFB 1LPUA 3FLWA 1FMKA 4K33A 4EK4A 4QMNA 4QP4A 4IC8A 4IM0A 3POZA 3BLAA 3WF5A 2JKQA 4H1JA 3O50A 3QRIA 4XHKB 3LAUA 3OY3A 4FZDB 3FE3A 3GBZA 4UB7A 4WKQA 3TI1A 5E8YA 2YDIA 2WMSA 5ETAA 2XYNA 2B4SB 3R8LA 3UZPA 2QLQA 3OFMA 4CFNA 4BDGA 3FMHA 4AS0A 4U7ZA 2IJMA 2XKDA 4A9YA 3BKBA 5H8GA 4M67A 2O5KA 1FQ1B 3Q60A 3ZM9A 4DEEA 3M42A 3P1AA 3O0GA 5LWMA 4DT9A 2XBAA 4KUJA 2UVXA 4D55A 4BCGA 2RF9A 5FXSA 4CQEA 4YZCA 4D9TA 2C6IA 4E7WA 4CMUA 4JDJA 3DFAA 3VRYA 1BKXA 2XB7A 3UO4A 5AV2A 4WG3A 4H1MA 4EUUA 4HVSA 2IZSA 2QU6A 1TQMA 3R8VA 2VNYA 3Q4ZA 1GAGA 4W4YA 3EKKA 2JAVA 3D0EA 5AX9A 3L9PA 3ODYX 3F6XA 3BIZA 4RJ5A 4N4SA 3V04A 1GIIA 2W9ZB 3KN5A 3QD0A 2X81A 2WMTA 3Q5ZA 5AUVA 5GZAA 4QMMA 4F9CA 3VS1A 4MQ2A 5CZIA 3HV6A 3GENA 2R3NA 4OTFA 2HWOA 3GUBA 2X4ZA 1QMZA 4AZFA 5HG8A 2WAJA 2A98A 3VBQA 3MVLA 2BDJA 3IGGA 5HG7A 4JBQA 3TZ8A 2GTNA 2XK6A 3EFLA 4UZHA 4WNMA 2H34A 4O86A 4YJOA 3RCJA 2ITZA 3CGOA 3F3TA 4Y46A 1ERKA 1LEZA 2BAQA 4AOTA 3MESA 1B38A 4LV8A 1KV1A 4XP2A 1YXUA 5TKDA 5L6OA 2Y4IC 2C6LA 4USDA 5EOLA 5I0BA 1O6YA 4PP7A 4QTEA 3GQIA 4I4EA 3EN6A 1WBPA 3G5DA 3DNEA 1FBNA 4WOVA 4M13A 4QTCA 3S2PA 4DAWA 2BHEA 4J53A 4JQEA 3IDCA 5AR4A 3LMIA 1SNUA 4A9SA 4CRSA 2C6DA 5CEPA 2HAKA 1XBBA 3HMIA 2BZJA 3R63A 3DZOA 2IF8A 4NW5A 4E6DA 3PLAE 2ZDUA 5CQUA 4A07A 5J7BA 5J87A 2JDSA 3FC1X 3BI6A 4YO4A 5HLWA 3PE2A 3MVJA 4U6RA 5JKGA 2BIKB 3C4ZA 4TN6A 4WT6A 4IFCA 4AT3A 3IPHA 3M1SA 2P4IA 2VX3A 3EJ1A 5IA3A 2Z8CA 1TFFA 1XMLA 3DDPA 3R71A 3BU6A 5HE0A 3SXFA 4Z55A 3QD3A 4Z3VA 3NYVA 3FLQA 2VO3A 4G16A 3HRFA 3VF9A 2HXLA 3UNJA 2UZLA 3FKLA 5IQIA 4DTAA 4D2PA 1SM2A 4AGUA 3G15A 1LUFA 2JIVA 4ZTQA 2WU7A 5FG8A 4O7VA 4F9BA 3KULB 1XBAA 2XKEA 5KBQA 3KKVA 3C4WA 2F7XE 3FPQA 2F4JA 3AG9A 4F9WA 5HTBA 5M08A 3PA5A 4R7BA 5HE1A 3I0QA 3LMGA 4FTTA 3BHVA 5K0XA 4TT7A 5AUWA 1PXJA 4AUAA 5TOZA 4DN5A 3D9VA 3OD6X 1WCCA 4LMUA 5TR6A 2PMIA 4XMOA 2QOFA 1B39A 5I4NA 3ORIA 1R1WA 4YC3A 5EI2A 4DG2E 4FV5A 5IA0A 3AD4A 4EORA 3N4VA 3S95A 3CQWA 1H26A 4RJ4A 4ZJVA 2YWPA 3LXNA 2XEZA 4DHFA 4MD8E 4E6CA 4FKUA 4TY1A 3AOXA 4FRFA 5DGZA 5HORA 4ACHA 3NW7A 4MH7A 4ZAUA 2YM7A 5E4HA 2JD5A 2W1ZA 4JR3A 3FSKA 1M7QA 3IG7A 4W9WA 2JAMA 4JL9A 3VS3A 5IA1A 2IW8A 1WZYA 4IZAA 3G51A 3VN9A 1IA8A 2X8EA 4IM2A 2CCHA 1KSWA 1CKPA 2GHGA 3VUGA 5M57A 4B6LA 1WMKA 5KMJA 3BQCA 2JBPA 2O8YA 4OAUC 1F5QA 3UG1A 2C0OA 4IJPA 4AOJA 4H39A 4J71A 3R1NA 4IIRA 5E8WA 2WNTA 4XV9A 1MUOA 3W16A 4EHVA 3ZUUA 2HOGA 4ALVA 4O2ZA 2GQRA 5EKOA 2WTCA 3DJ6A 4JIKA 4XS2A 3R7YA 2C6OA 4AQCA 3FMDA 4RX7A 4B0GA 3QGWA 3Q5IA 3ENHA 3W2RA 4EZ7A 3PFYA 3ZMMA 1YI6A 3HECA 5L2TA 4GK4A 3MB6A 3C50A 3VUIA 4BCFA 2WTWA 3BZ3A 2NPQA 2WMRA 4M97A 3KU2A 5EYKA 3C0GA 3ZBFA 2R3KA 3KL8A 3MY5A 5HBJA 4K6ZA 2OH0E 2PVRA 4U80A 5EYDA 2ITVA 3EKNA 3O23A 5CVGA 3DBFA 4D2RA 3NNUA 3JVRA 4UEUA 4WBOA 2GS2A 1OL5A 3P9JA 3OTVA 4C2WA 3JY0A 2ESMA 3RP9A 1NT2A 4FUXA 4G9CA 4R7HA 1G8KA 2QG5A 2XIYA 3D5UA 4ZTRA 2H8HA 3D2IA 3RALA 1DM2A 2CGVA 2XYUA 1ZRZA 4I6FA