4EKKA

Akt1 with amp-pnp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
334
structure length
318
Chain Sequence
RVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMISERRPHFPQFDYSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An ATP-Site On-Off Switch That Restricts Phosphatase Accessibility of Akt.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords RAC-alpha serine/threonine-protein kinase
total genus 92
structure length 318
sequence length 334
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ekkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ekkA01
4EORA 4DFUA 5E7RA 5BYZA 5ACKA 3ORMA 1IEPA 3WF9A 2LGCA 3LE6A 3R1QA 2OZAA 3LMIA 3W2OA 3FSFA 5BX0A 5J9YA 2J0KA 4KS7A 4LRJA 5AP1A 4QP4A 3JVSA 3KN6A 2F49A 4QMXA 2WB8A 5IUIA 1RW8A 5AR7A 4MKCA 2A2AA 2FO0A 3IPHA 2X1NA 3CLYA 2IO6A 3TXOA 3P79A 4PNKA 1MQBA 2OU7A 3IOKA 3N51A 1XBCA 5CSPA 5BVNA 3CEKA 1G3NA 2ZM3A 1M2RA 4DAWA 3EN5A 1R1WA 2OZOA 2B54A 3FZPA 4IC8A 4D0XA 2AYPA 2XK7A 4FIIA 3EFJA 3NW5A 5IQAA 2VTQA 4BTJA 3OWPA 3PA3A 2XUUA 4LI5A 4MX9A 1CSNA 1Y8GA 2ZV2A 1BLXA 4FKPA 2JAVA 2P2HA 2YLEA 4NM3A 5J5SA 5JZJA 3SW7A 5C4KA 5E1SA 3NWWA 4E6AA 4FTQA 5L6OA 1YOJA 3NVMB 3FKOA 4GEOA 2IVSA 5CU0A 3I4BA 5CYIA 5HLPA 1OKWA 3HLLA 3MTFA 5F94A 2H96A 2YABA 1LUFA 1WBPA 3TL8A 2A0CX 4BDAA 5EQYA 1QPJA 3BRBA 5JFXA 2Z7SA 2W05A 4ANQA 5IQHA 2I40A 4EOPA 5JT2A 3BEGA 2UUEA 3PXYA 1A9UA 4ALUA 4YTFA 3HEGA 3OWKA 3R2YA 3W2QA 4ZEGA 2PZ5A 2UZUE 3KMUA 3QD2B 4ACDA 1H08A 3I5NA 1XR1A 4WO5A 5A4LA 3PG1A 4YBJA 4C3FA 1IRKA 4XV1A 3UIXA 4K9YA 4X2KA 4F9BA 3LOKA 1WVWA 2QR8A 3A7IA 3L9LA 2GHMA 3TTIA 2BTSA 4R77A 4IX5A 1NVSA 3CGOA 2HZNA 3EN9A 4TPTA 5HLNA 2GQSA 2WZJA 1T45A 4O2ZA 1YRPA 2XEZA 4L9IA 3L8SA 3AC8A 4IDTA 1W7HA 2W9ZB 2Y8OA 3RJCA 4UYNA 4IB0A 5ETCA 2QVSE 4C3PA 1CMKE 2XK9A 1QMZA 4F09A 4RX5A 1ZMWA 4ANBA 3DQXA 4WSQA 2ZMCA 3F5XA 5KZ0A 3R8VA 4C2VA 3KULA 1OL7A 1KE9A 1AQ1A 4NK9A 3KK9A 4EKLA 4W4XA 3UG1A 4GJ3A 4U81A 3E8DA 2QO2A 4XYFA 4RVKA 1P2AA 2PMOX 3DXQA 1PXKA 2X7GA 5FXRA 1DAYA 4YZDA 2UW0A 3DJ5A 4XV3A 3MH0A 4YJTA 4CTBA 4R7IA 5D10A 2C5NA 4Y5QA 4O7RA 4L53A 4BZNA 5KBRA 4ANMA 2X8EA 4JQ7A 3FL4A 3CY2A 3UOLA 2WTVA 3KRJA 1WVYA 3P4KA 2CGWA 2WTJA 3OTUA 1WBSA 2BR1A 2QU6A 4FX3A 3BIZA 5LVPA 4YJNA 1H1PA 3V5PA 3IGOA 1TQPA 3C0IA 4IE9A 3D0EA 4K33A 1CDKA 3FWQA 2V7AA 3AGMA 4WSYA 1P5EA 4CZUA 1Q8ZA 3QWJA 1PYEA 1K3AA 5BVOA 3QCYA 3RZBA 1PMEA 4M15A 5DPVA 4LOOA 5JZNA 2SRCA 3PXRA 3ANRA 1XBAA 5HG9A 1HOWA 5IDPA 4KBAA 2RIOA 3HMIA 4RFMA 4LMNA 4WRSA 4EH6A 4U3ZA 4K8AA 4DFNA 4G17A 2R3NA 2CCHA 3MJ1A 1YDSE 3MA6A 3MPTA 4E5WA 2JFLA 4DE4A 5JQ8A 1PXPA 1BUHA 4TYGA 1Q8UA 2C4GA 3PLSA 4AGCA 5C9CA 2YWPA 2JIVA 3DXNA 5EHOA 3O2MA 5DRBA 4JR3A 5CF6A 5DOSA 5L8LA 1FQ1B 4A06A 3SLSA 1FPUA 4M84A 2B9JA 1WFCA 2GTNA 3OVVA 3Q2JA 4K11A 3VBWA 3SGCA 3PLAE 4CFVA 3FXXA 3MB6A 4OBPA 2BILB 3OMVA 1OZ1A 3VS6A 3KCKA 4BCJA 1NA7A 4OTGA 4EOMA 4FL1A 4PRJA 4TWCA 3QTXA 1ERKA 5HNGA 2J2IB 1MRYA 3K3JA 4EQUA 4FTUA 4YMJA 2OJGA 5EW3A 2OJ9A 1OM1A 3CD8A 4QP1A 2JKKA 4FF8A 2GQRA 1OVEA 4L3PA 3G51A 4FT5A 4II5A 2XBJA 5IH5A 4GKIA 4ZAUA 4YZCA 4A9YA 3RI1A 4EUTA 3GOPA 2VO7A 3MVHA 4IM0A 5TR6A 2BCJA 4EK4A 4ZY4A 3R83A 3LW0A 3W55A 1Q4LA 5D11A 5JKGA 4HJOA 1H1SA 1ZXEA 2C1AA 3S4QA 4OLIA 1PRYA 2XH5A 5DFPA 1UU8A 3FQEA 5LMAA 1WBOA 2XIYA 4IM2A 2IZRA 2VV9A 2IWIA 3GCUA 4QP8A 3VVHA 3CJGA 4M0YA 3DOGA 4H3PA 3U8WA 4F7SA 4RJ3A 3MYGA 2PVMA 4FSMA 4R78A 2OGVA 3FKNA 3EJ1A 2BRGA 3FE3A 2B9HA 2C68A 4FKRA 3N4VA 5BYLA 1JWHA 5HESA 4D4VA 2OXDA 5KMLA 3EQDA 3GU4A 1O6KA 2CSNA 2W1IA 2C1BA 3EZRA 3UTOA 5JK3A 5M4CA 2PE0A 1NT2A 4FV2A 4AT3A 3EYGA 2XB7A 5M4IA 4F0FA 2R2PA 2I7QA 4IHPA 2V5QA 4MD7E 2W1ZA 3FLNC 4DF3A 2UV2A 4JQ8A 2VNWA 4LYNA 4CCUA 5HLWA 3PXQA 3E5AA 4YHJA 3PVWA 4LGHA 4L3LA 1YXSA 1FVTA 4YJRA 4YP8A 1IAHA 4KUJA 4DBXA 3C9WA 3HUCA 5G6VA 4PDSA 4QTDA 1DM2A 3ZSIA 1PW2A 4AT4A 5CY3A 3R9HA 4A4XA 2OIBA 3DFCB 4QMLA 4FE2A 3D4QA 5E8UA 3P7AA 2WIPA 2J6MA 4G3GA 2G9XA 2XCHA 3F3WA 3VS5A 1WAKA 4CQGA 2QCSA 2X2MA 4O0TA 1UU7A 1JNKA 4FSYA 4FVQA 1KE5A 3NUYA 3OF0A 5C27A 2YM5A 3VBXA 4UZDA 1JPAA 4ERWA 4F9WA 5I3RA 3IO7A 3QAME 5H3QA 4C3RA 1YHSA 4ITHA 4BWPA 5K5XA 4FT7A 2EXCX 2I0YA 5EYMA 4ID7A 3ET7A 5AV2A 3C0GA 1FGIA 4S32A 3SXRA 4FKOA 4QRCA 2YZLA 3CS9A 2HIWA 2ZYBA 3DT1A 3OTVA 3QRTA 4PDPA 5EH0A 2UZVA 1V1KA 4AW5A 3R01A 4O22A 1KE7A 5CENA 4E26A 1Q8YA 4CKIA 3B8QA 3VF9A 1BX6A 3CKXA 3QKLA 3NUSA 2UW9A 1FMKA 4ORKA 1WBTA 3DTCA 1M7QA 3NIZA 3RAKA 3T9IA 3RWPA 5DE2A 4P7EA 2BMCA 2PUUA 3K5UA 2R3PA 5HE0A 3S00A 5GZ8A 2R3IA 4I6QA 4BDCA 4YZ9A 4CZTA 1J7LA 1XJDA 3RGFA 3WI6A 2UZTA 3L8XA 3H9FA 3IDCA 4FTIA 3FMNA 3TN8A 5DR2A 2ZM1A 4EK3A 4NL0A 1UU9A 5CU6A 3PTGA 5J5TA 1TKIA 1O6YA 3OZ6A 1ZY4A 1KV2A 5DR9A 4X3FA 4F1TA 1XH6A 4JRNA 1OIRA 2EB2A 3F2NA 3BGZA 2HW6A 2VGOA 2Z2WA 3NCGA 5IQBA 4F1OA 3SXSA 1Z5MA 3UVRA 3UOJA 4FZ7A 5IA4A 3BX5A 3KF4A 5CAOA 3L8VA 4QMVA 4GVAA 4FZ6A 3UODA 3G6HA 4QPAA 3MFRA 4I94A 1XKKA 4L6QA 4O7WA 4X7QA 2DQ7X 2GHGA 3DGKA 5CVGA 4QMUA 2RG6A 3KFAA 4RLKA 3HA8A 3LHJA 4HCVA 4L52A 4PL5A 3UYSA 4HNIA 4KBKA 5E8WA 3EKNA 5JGBA 4WKQA 3W2CA 5DIAA 4BDBA 5I9XA 1YXTA 2OZAB 4C35A 5JFVA 2QO9A 3O23A 4OBOA 5HO6A 3TKUA 4BYIA 3KF7A 4EH4A 5M56A 2YISA 3RK7A 4CTCA 4YSJA 3TDWA 4A9SA 3C4WA 4BF2A 1OIYA 2AUHA 4H3QA 4AZFA 5AAEA 1BMKA 2BDJA 4UBAA 2DYLA 3UGCA 3UC3A 3BBTB 2GFCA 1P14A 3VF8A 3CQUA 5IISA 3PRIA 4HPTE 4UWBA 5D12A 3ETAA 2QURA 4FV6A 4A4LA 3QLGA 1IA8A 3BV2A 3SC1A 4F9AA 4IZYA 2H34A 4BZOA 3QF9A 3DAJA 4O0WA 5CI7A 4EQMA 1YI6A 2OH0E 2YEXA 5I4NA 3A7FA 3ALOA 1PXLA 5A4TA 2XRWA 3VS3A 4I0SA 2R3FA 4GUBA 4YPDA 3R22A 2WMWA 3VS1A 3FLSA 2WOTA 3CXWA 4FV0A 4BDHA 3CQWA 1OPLA 2JKOA 4GU6A 2WMRA 2XNGA 4QTAA 3UZRA 1OIUA 4J98A 3R9NA 3H4JA 3LJ1A 4D2PA 2WU7A 3F6XA 4DT9A 2W1DA 2OSCA 3V6RA 1YOMA 4WNMA 3PZHA 2BIYA 4IAIA 4RX9A 5C8KA 3ALNA 4JG8A 5A4CA 3ZLSA 1Q24A 4R7HA 3MFSA 4EONA 2O65A 1SZMA 4O7NA 4X6QC 3OY3A 1MQ4A 3KMWA 3P9JA 3NCZA 3O50A 3QLFA 3E88A 5IA3A 4D9TA 4FKJA 3C5UA 2Y9QA 5AAFA 3GFEA 3ZFXA 2WU6A 3FI4A 4DG3E 3KREA 3IW7A 3VO3A 3QRUA 5E8VA 3QZFA 2HK5A 1NVRA 3PPKA 1Y6BA 4WIHA 4C33A 2CN5A 4V0GA 5E1EA 5CEKA 4BIDA 4TXCA 3BQRA 1KV1A 4M3QA 4K6ZA 4O7YA 1OBDA 1KE8A 1JKLA 4L01A 4H3BA 3ZC5A 2VRXA 3UE4A 3OCGA 2BFXA 4W4VA 5C8MA 4E73A 2XKFA 2QG7A 1RDQE 3R04A 3JPVA 2GNFA 3SXFA 3TI1A 4OUCA 4DT8A 5CU3A 4DTBA 4I3ZA 1ZOEA 4FGBA 4J99A 2BAJA 4JNWA 3H30A 1ZZLA 1PXJA 5CSXA 4C38A 5LCJA 3LFDA 2HWPA 4OTFA 2VTAA 4OT5A 3GENA 3O96A 4O84A 4YUQA 4F6SA 4UALA 4XRJA 4MBLA 3ZEWA 2NO3A 3ZMMA 4MF1A 4BKJA 4EUUA 2PWLA 4XLVA 3DBEA 5EDQA 5IA0A 4L7FA 5D41A 4U97A 4B8MA 4HVIA 3A62A 4D4RA 4JS8A 1U5RA 2C5VA 4XCUA 3VC4A 4NH1A 4D4SA 4IFCA 4ZSGA 2GNIA 4GIHA 4C4IA 2WOUA 2Y6MA 3Q53A 3ZM4A 2DS1A 4PWNA 5CF4A 3UC4A 4FA2A 4USDA 2PULA 3TTJA 1ZOHA 1QPEA 4FL3A 1F5QA 4I5HA 4NW5A 4J1RA 4L46A 3EL8A 5AUTA 4CG9A 4EL9A 1DI8A 3MDYA 4IX6A 4FV1A 4G2FA 2VWVA 5FTQA 4XG7A 3BHYA 5A4QA 3FHRA 4KB8A 4E5BA 1V0BA 4PMTA 4LG4A 4EEVA 3WZEA 5CF8A 5JFWA 4NZWB 4B7TA 3ZRLA 2WELA 4ZJIA 5BVEA 5HZNA 4XX9A 3HV3A 1TQMA 1PF8A 2C6MA 2J0MB 4NIFA 4O91A 4MNFA 1H24A 3FKLA 1M14A 4FK6A 3ZDUA 3VWAA 4BCGA 4BCNA 4EOSA 4OAVB 4BDJA 1YHWA 1OL6A 3RNIA 4XJ0A 3R7OA 2QC6A 3F69A 4FIEA 3WIGA 2CKOA 2JKMA 4N0SA 1JSUA 5HIEA 4NCTA 2WKMA 2Z7QA 3BZ3A 3EQBA 5HVYA 4DLIA 5ANEA 5FQDC 4DEBA 3CTJA 1ZYLA 5CX9A 3ZHPC 4QMYA 3FQSA 3BV3A 4QT1A 5E8YA 3A99A 4OTPA 3SG9A 5IA2A 4C7TA 3ZO3A 4QQJA 2YIWA 3EN6A 2YCQA 2UW3A 3BYSA 3VS7A 3P23A 4M69B 2RGPA 1XH7A 3FMJA 4ZZMA 4AGDA 5IMXA 4RJ7A 3NUPA 3NRMA 1BKXA 5HE2A 4G6OA 5ETFA 3S3IA 4USEA 2ACXA 3FAAA 3HP2A 2HZ0A 4QMSA 3O8UA 2XRUA 3KA0A 3I1AA 2EWAA 3WIKA 4J96A 3D9VA 1W83A 3NNVA 4D2SA 3COHA 4X2NA 4FSZA 3FDNA 2BZJA 4DH5A 2WMQA 3M11A 3S0OA 5KMOA 1ZMVA 3H0ZA 2C3KA 3R71A 4EBWA 2F7ZE 1OECA 2HYYA 3AMAA 3LFBA 4HGSA 3W2RA 2BFYA 2A19B 2JDOA 3GU7A 5M55A 4AT5A 3D15A 4OTHA 3VULA 4BGHA 2W17A 4I41A 4TW9A 3SA0A 2IVVA 4G5PA 3PY1A 4MF0A 2Q0BA 4F99A 3R6XA 2OF4A 2EU9A 4XP3A 5CT0A 3C4FA 3LKMA 2XEYA 4CLJA 4AA0A 5GIPE 3VS0A 5B7VA 2V62A 4CVAA 2W5HA 3E63A 5AX3A 5JMSA 3SX9A 4BWKA 4U42A 4OGRA 3CPCA 4F70A 4PV0A 4W8EA 4CFXA 4K77A 4KABA 3ROCA 3R21A 4IXPA 2J0JA 4X6RA 3C7QA 5J8IA 2ESMA 5CALA 4PNIA 4PP9A 3VBQA 2ZV7A 4D28A 4DEGA 4RVMA 3HL7A 4U8ZA 5EI2A 3T9TA 4AP7A 3QKMA 4FODA 4LM5A 3M42A 3UVPA 4FIHA 3GQLA 3I0QA 4EOKA 5A6OA 5CEMA 1QPDA 1RJBA 2VTPA 3ZZEA 4IANA 3SAYA 4PUZA 4DEHA 4XG3A 4Z55A 4GYIA 3OOGA 1Q99A 3OROA 3E8EA 3W18A 3MN3A 4N6ZA 4RJ4A 5L3AA 4D2WA 4J8MA 4ASXA 3CTHA 4FIGA 2JBOA 3ZDIA 4TTHB 4C4HA 3Q4CA 3VBVA 4CNHA 1ND4A 4NJ3A 3Q6UA 3FZ1A 3NUNA 4PQNA 1RQQA 4DHFA 4LL0A 5JH6A 3ZZWA 1Z57A 5IA1A 1ZOGA 3CKWA 1DAWA 3WOWA 3VW6A 2XNEA 4MXZA 4B0GA 4E20A 5KO1A 5LARA 1CKJA 5CT7A 1OUKA 5ETAA 4BFMA 4FYOA 2YDIA 2YIRA 3R9OA 5C03A 1B6CB 3A60A 3AMYA 1JKTA 2X39A 3QQHA 1AGWA 1MRVA 2UZBA 5E8SA 1V0PA 4W4WA 4QYYA 4DEIA 2B0QA 3TZ8A 3GCVA 4CG8A 2ZV9A 4U79A 1Z9XA 2VZ6A 2NRYA 1PXIA 3Q4UA 4NKSA 3PDTA 5AMNA 3DNDA 2ZV8A 4ENYA 1WBWA 3W2PA 5EQEA 5LQFA 2B1PA 4PF4A 4JQEA 3PY3A 1WMKA 3QUEA 4APCA 3MBLA 4FTCA 3UPXA 3HRBA 4GCJA 3EHAA 5HHWA 3PXFA 1MP8A 4JDKA 4X2GA 4GS6A 5HCXA 4TL0A 3ZSGA 3QGWA 4XBRA 5FP6A 3MS9A 4Z3VA 2IVUA 4FT9A 4RGJA 5EQPA 4CGAA 4K1BA 5JEBA 3SOAA 3WBLA 4PDYA 1LEWA 5J7BA 4PP7A 2C5OA 3NW7A 5DMZA 4J52A 3O71A 5AP3A 3GQIA 3MA3A 5CEQA 3ZLWA 2WQOA 5EDRA 3TM0A 3DXPA 3IGGA 3Q9XA 2VTNA 1REKA 2R3OA 1W84A 4A07A 4C4EA 5CXZA 3NPCA 3QHWA 5IF1A 4DTAA 4QYHA 5KMIA 2WD1A 1YDTE 4FZDB 3PY0A 2Q83A 2IZTA 4MWHA 3ZRKA 1PJKA 5IDNA 3DK6A 5A14A 4RPVA 4L00A 3UP2A 3O8TA 2PUPA 4J95A 2W7XA 2XF0A 2JDTA 5EKOA 3KULB 4C02A 3R8PA 5KKRC 4R1VA 1H26A 2R64A 3QTIA 4FKIA 3QU0A 5FM3A 3FHIA 2CMWA 4IWDA 1YI4A 3DCVA 3D5WA 3OD6X 1ZY5A 1JVPP 2IW9A 3F66A 4QYEA 1Y8YA 4QMTA 4IB1A 2BRNA 4IIRA 5AV1A 2O3PA 4AX8A 1GIIA 2C0TA 2QOFA 4RFYA 2NRUA 4WG5A 4TT7A 3E3BX 4CV8A 3MB7A 4U6RA 1Y57A 5HNIX 4EHVA 5CVHA 2VWBA 2WXVA 5IMEA 4PMMA 3PWDA 3ZUVA 4I4EA 4U43A 3SRVA 3GXLA 4BL1A 4XMOA 3ORLA 2BZHB 3MVLA 4LOQA 4RC4A 5HU9A 5EHYA 3E8CA 3GB2A 2G2IA 4YJOA 5CLPA 3RPSA 2VTLA 4EBVA 4YO4A 2XIRA 3EL7A 2R4BA 2OH4A 4C34A 4E6CA 5FLFA 3ULIA 3PP0A 3H0YA 2Y4IB 3KRLA 3EFWA 4D5KA 4HCUA 4BCOA 4BGQA 3P86A 1UA2A 3FY0A 1SYKA 4GK4A 2XK8A 4ZTRA 4IX3A 4UWYA 4EKKA 3KRXA 3TV4A 5HQ0A 2V7OA 4FG9A 3UQFA 4PL3A 3SKCA 4I0TA 4EYMA 2ITYA 2R3KA 2W4OA 3NMUF 3BWJA 3G0EA 4FICA 2CLQA 3S2PA 1PMUA 2JIIA 1CKIA 4NTTA 5DT3A 2PVJA 2WO6A 3HP5A 3FUPA 5CXHA 4F4PA 2PUNA 3ORIA 4BR3A 1J1CA 3CSVA 2HOGA 2JFMA 3AOXA 3PXKA 4R5YA 5F1ZA 1PKDA 3NS9A 3RCDA 2CNQA 2R3LA 3C4XA 3F5PA 5DT4A 2PYWA 3ZUTA 4ANNA 4V0GB 5B2KA 1ZRZA 4AZVA 5IPJA 4E4LA 2BPMA 2H9VA 1YQJA 5HVKA 4EK6A 4PY1A 3EQHA 3OCSA 2HCKA 5D7AA 4FOCA 4C62A 2YITA 2QLUA 4HVSA 4GUEA 4QTEA 5AUXA 2IPXA 2LAVA 2PTKA 3HNGA 2F2CB 5CQWA 3ZC6A 4AOIA 4DBNA 2XNOA 3HDNA 4ANSA 4FVRA 4DH1A 2B9FA 3NGAA 4V05A 4BDDA 4D5HA 4H58A 2QI8A 4I0RA 3U87A 4RX7A 3V3VA 3R9RA 4DG0E 4N4SA 3DTWA 2FSLX 2Z8CA 4ALWA 3VN9A 1SVHA 2XK4A 4IBMA 3RPVA 3FBVA 5LVNA 4EOIA 3ENMA 4OW8A 4C2WA 2KULA 4ZS4A 3BLRA 3I81A 2O2UA 3OW3A 4FG7A 3CD3A 2JIUA 3A7HA 1GAGA 4W9XA 1STCE 4JX3A 5CZHA 1K9AA 2W1EA 3Q32A 4DEDA 4E6DA 3SHEA 2EB3A 2QQ7A 4EI4A 4I20A 4ZZNA 4GH2A 4I5PA 2WQMA 4OT6A 5HICA 3B2TA 3CR0A 3E3PA 5KKRB 3PIXA 3IDBA 2YJRA 4YZBA 5J87A 3UIUA 5H9BA 4J71A 5ANGA 4AZWA 4LFIA 2PZPA 1OITA 3D5UA 4UY9A 4AFJA 5ANDA 1GZ8A 4GT3A 5M09A 4FTOA 5EM7A 3E7VA 3ZSHA 5FWKK 5ANIA 5KNJA 5IQGA 2FA2A 4Z7HA 3G9LX 3U6IA 4RZVA 3D7TB 3POZA 2R3QA 4CMTA 5F9EA 3N9XA 1GOLA 1ZAOA 2YIYA 3OBGA 5AR8A 5HG7A 4JAJA 5HO8A 1H07A 3LFNA 5DGZA 2XMYA 4J7BA 1APME 4IADA 3DA6A 4BKYA 1A48A 3QTWA 4RIOA 3V51A 3U9NA 4BCPA 3BKBA 5E90A 3ZO4A 5KE0A 4CCBA 3BYMA 4FSTA 5TO8A 3RPRA 2XKDA 5ANKA 5EFQA 4A9RA 3FXZA 4O6LA 4MH7A 2C3LA 4XG8A 2I1MA 4QO9A 3WYXA 2VWWA 4I92A 4YTHA 2QU5A 4UN0C 2OFUA 3F7WA 1W98A 4B4LA 4Z9LA 3VQHA 4M69A 4QMMA 4S31A 4E6QA 5D1JA 1XO2B 4RIYB 2GSFA 4YNOA 4AZEA 2YJSA 2GPHA 3WF7A 3W10A 4E4XA 2WTKC 3MY1A 4B8LA 4O2PA 3HKOA 3D7TA 3CTQA 4EHEA 3HA6A 4I6HA 2PVLA 4L68A 4XBUA 2Q0NA 2WMTA 3LMGA 5HE3A 3V8WA 2RF9A 3TIZA 3A8WA 3R1SA 3OP5A 4C57A 3G5DA 4YSMA 5BMMA 3ZXTA 4YZNA 4IWOA 2ZB0A 4QD6A 2YN8A 2OICA 4M0ZA 4FKGA 2PVRA 3QXPA 2JAMA 4KSQA 3U6JA 2HXLA 2PSQA 4RJ6A 5D7VA 3ZONA 4CT2A 4DH3A 5HTIA 2C6KA 3GC9A 3ZFMA 3U4UA 5E91A 5KZIA 3S1HA 4X3FB 3OXZA 4YC6A 4ARKA 4TYJA 4FKVA 4NW6A 3BE2A 4YZMA 3UO6A 3KXXA 5FM2A 5FP5A 2FB8A 5K9IA 3ATTA 1VYZA 1R0EA 1PXMA 2X7OA 3HDMA 3NZ0A 4FZFB 4IAFA 3Q04A 4ZS0A 4ZJJA 3WYYA 4BGGA 5I0BA 2HZ4A 2QOIA 4QTCA 2PVFA 4FTTA 3CBLA 4XH6A 5L8KA 3DAKA 3F7ZA 3MIAA 3EKKA 4JLCA 5IKWA 2XM8A 3FZSA 2B4SB 3LJ0A 1KE6A 4MQ1A 4PMPA 1PMNA 2WEIA 2WQBA 4H36A 3BHVA 4K0YA 3EYHA 2VD5A 3KL8A 2XS0A 4CQEA 1U54A 2WGJA 4UMUA 5KHXA 2RFEA 4A9TA 4BCMA 3GVUA 4MBJA 3QRIA 3ZM9A 3LQ5A 4EWHA 4YHFA 5EG3A 4E8AA 4U7ZA 3K3IA 2CN8A 2X8IA 4K18A 3FC1X 5I5ZA 2OBJA 2GNGA 4O96A 3QXOA 3V8SA 2YIQA 4QP2A 3R28A 2WTWA 1YKRA 1YW2A 4U45A 4P5QA 5HBHA 2CKQA 4YU2A 2JGZA 3M1SA 4USFA 2XYUA 5CVFA 4ZSJA 3PVUA 5I9ZA 3UO5A 2YLFA 1FGKA 3GP0A 1XH5A 3ZYAA 4E93A 2DWBA 4AOTA 3F2RA 3I5ZA 4ZSLA 4J97A 1SM2A 2AC3A 2VTIA 2WMSA 1QPCA 4HOKA 4S2ZA 4AAAA 3PJCA 3PG3A 1EH4A 3HV5A 4L8MA 2ETMA 5EM6A 5LVLA 4F7LA 3ZTXA 4JXFA 3T3VA 3OOMA 5DRDA 2IJMA 4AW1A 4RG0A 1OBGA 5AUWA 5AR3A 1H1RA 4QP3A 4CFMA 2H6DA 4F7NA 3P7CA 5ITAA 4KKEA 4LOPA 4G31A 2XCKA 3BGQA 4TYEA 3DZOA 4ASZA 3EWHA 3KCFA 5IUGA 3E93A 3RALA 3RHXA 4AXAA 1NW1A 2PL0A 4E7WA 3QL8A 4Q5HA 1IA9A 2W9FB 4TNBA 3LVPA 4IC7A 4R8QA 5HG8A 5CNOA 4O86A 4GKHA 2O8YA 2NNWB 3MVJA 2BRMA 4FUYA 4JAIA 2GS7A 5DNRA 4D2RA 4FR4A 5K3YA 2OO8X 3IECA 4U3YA 3UMXA 4KIPA 4JDHA 1SMHA 4C58A 2W5BA 4HCTA 2WIHA 1UVRA 3I60A 4U41A 2ZMDA 3VJOA 4CLIA 4HVHA 4O6EA 4EJ7A 3Q3BA 2PMLX 4O38A 4X21A 5JSMA 3QA0A 2WMXA 5AR2A 3OT3A 3H10A 4L43A 5DWRA 4ACGA 2YA9A 1BL7A 3THBA 4GVJA 3NW6A 3ZBFA 1X8BA 3NYXA 1YVJA 4YC8A 5HI2A 4FEVA 3A7GA 4NT4A 2V0DA 1U5QA 4I21A 4N70A 4KRDA 2IW8A 4KAOA 4MQ2A 2R3GA 5LVOA 1GY3A 3QUDA 5ETIA 4GT4A 3ORXA 5L8JA 4AG8A 5AWMA 3FZTA 4AZSA 1YWRA 3FMEA 4Q9ZA 3RCJA 4XV2A 2IW6A 4NU1A 3HMNA 4F64A 4AE6A 4NEUA 4AZTA 5GNKA 2PY3A 5DR6A 1GZOA 1Q61A 1YXVA 2OIDA 4FTKA 4Y73A 3HECA 4EH7A 5HG5A 4FGRA 4PPBA 4AACA 4M97A 4EHZA 3I7CA 3UJGA 3L9MA 4LMUA 5AP6A 1LPUA 1OKVA 3RK9A 3G6GA 1CKPA 2G1TA 5DG5A 2P2IA 3IW8A 2X0GA 5KMMA 3NUXA 5J9ZA 2E9NA 3OUKA 2QHNA 4RX8A 4O1PA 2VX3A 2F7EE 5L6WL 2QD9A 5K4IA 4BRXA 1HCKA 2UW4A 2E2BA 3LCKA 3GT8A 4LUEA 3SD0A 2VWUA 5F20A 4EHGA 3CY3A 5M06A 5B2LA 2ZM4A 3PWYA 2YZAA 3WE4A 3GCQA 3CIKA 3DB6A 3C1XA 4M12A 3BWFA 4EZ7A 1H4LA 2UZOA 3AD5A 3BBWA 3JXWA 4AWIA 1PY5A 2BDFA 3BGPA 3AD4A 2PZIA 2C5YA 3PE2A 4CKRA 3VUGA 2XNPA 3ORPA 3F3UA 5DBXA 4DTKA 5T6KA 5LOHA 4GFOA 4EH9A 4QOXA 4ZLYA 5J79A 2Z7RA 5FEEA 4RZWA 4Y95A 4UEUA 3RK5A 4JBQA 5HE1A 3QTSA 4ZXTA 3EFLA 4IJPA 2X4FA 3DB8A 4LGDA 4QNYA 3C50A 4M13A 4OTDA 3CCNA 1QL6A 3EZVA 3NLBA 3GBZA 3MGYA 4GSBA 3NYVA 4N6YA 4R3RA 5A3XA 3VW8A 4F6WA 3BLHA 3PJ1A 5IQIA 1UNHA 5AV0A 4HYUA 1JBPE 5EW9A 3KKVA 4MAOA 4JDIA 4MNEA 2QG5A 4UMQA 2ZAZA 5AP2A 3TUDA 4JVGA 4XNEA 5BUIA 2NPQA 2IN6A 3ULZA 2BVAA 3O51A 5AIKA 4GJ2A 4EJNA 4UXLA 2VX0A 3TEIA 3DY7A 4DGLC 4O0VA 4BICA 1OB3A 3OFMA 4H1MA 4QMZA 4AGWA 4EWQA 2C3IB 5HEZA 4JL9A 3LJ2A 3H9RA 2VTTA 1WBVA 1CM8A 4AA5A 4FVPA 2XBAA 3R02A 4RWJA 4W4YA 4Y5HA 3BI6A 3IK3A 2OK1A 1VJYA 4HPUE 3REPA 4FV5A 3KC3A 1BI7A 4G9RA 3D94A 4RIXA 4B9DA 4IAKA 3LCDA 3PSDA 1JKKA 2R0IA 3U51A 2GTMA 3PIYA 3PZEA 4HNFA 3BEAA 2HWOA 4LRKA 4RC2A 1ZLTA 2RFSA 3VUDA 3WARA 2OJJA 4EZ3A 4YGAA 1L8TA 4RIWA 4IM3A 3ZXZA 4ZY5A 3P78A 4Z7GA 3NNXA 4AE9A 4O1OA 1XBBA 3Q4TA 4RRVA 4PTCA 5FXQA 3SOCA 3CE3A 4I22A 3C4EA 5AP0A 4BN1A 2UZLA 4B99A 1PKGA 3FMKA 3TKIA 3ZLXA 4GIIA 2WQEA 4Y83A 2JDRA 3VUIA 1WCCA 4ONAA 2IZUA 5FDPA 2BAQA 4GMYA 3BLQA 3ODYX 3SDJA 3TZMA 4S34A 4RVTA 2QOKA 4YJPA 2A4LA 4GK2A 4IACA 5I9VA 5J7HA 5JQ5A 4DFXE 1H01A 5GJFA 3JVRA 4ZY6A 5AUVA 3B2WA 5BVKA 3V5QA 3OHTA 3PE1A 4O83A 3NSZA 4FL2A 4EH8A 3QQUA 5E8ZA 4ZTSA 5HBEA 3DLZA 4FT0A 4WG3A 3EN4A 4PPCA 2R3HA 3QZHA 5H8EA 3UNJA 4KWPA 4E1ZA 2GS6A 3Q4ZA 2GDOA 4HYHA 4L7SA 4C8BA 2Y0AA 3FPMA 3Q9WA 4I4FA 2WTKB 3PYYA 4M67A 4OTRA 2RKUA 3PJ3A 4RC3A 4RQKA 4E4MA 4UMPA 4JDJA 3TNHA 1Q3DA 2HAKA 3GC7A 4AW0A 1H27A 1SNXA 3BYUA 5B2MA 3NEWA 3UZTA 2FH9A 1XH9A 1ZYSA 4QMWA 5AP7A 5M07A 4ZZOA 3ZOSA 2ONLC 4CD0A 3KQ7A 3LFCA 3UYTA 5L2QA 4TYIA 4EYJA 3MH1A 4NM0A 3QALE 4BCHA 3SW4A 3QTUA 4WUNA 3MH2A 4E4NA 4WBOA 4DFYA 4F1MA 4DFBA 3Q2MA 4NTSA 2R3RA 2QLQA 3QRKA 3SV0A 5AFVA 3PUPA 3P0MA 1JQHA 1L3RE 4FSQA 2W1FA 3IDPA 3MIYA 3QWKA 4G3CA 4BWXA 4G9CA 2GMXA 5ICPA 4EH3A 4A9UA 1JAMA 1SVEA 3DKCA 5EOLA 3RPOA 4U0IA 4QPSA 5M4UA 3D2KA 1M2PA 4NSTA 3VUTA 2OJIA 1U46A 4LRMA 3R7YA 3V5WA 5T3QA 4BY9E 5KBQA 2E9PA 1SNUA 4XG2A 3QCSA 2YWVA 4DINA 5JGAA 3LM0A 4RFZA 3DV3A 4QP7A 3E7OA 4RA5A 4WUAA 3QX4A 1O9UA 2W99B 4RBLA 1YWNA 3E64A 5EOBA 2XK6A 4FTMA 4CFFA 2BRBA 5AUYA 3VUHA 5F95A 2EXEA 3W32A 2QOBA 3KXGA 3NNUA 4ACCA 2XJ1A 4BB4A 2PU8A 3KVWA 4FK3A 4FTJA 4XLIA 2NP8A 3KU2A 3LCSA 4JI9A 3VBYA 3AGLA 4EOOA 2WTDA 3IS5A 5EW8A 5I9WA 3NYOA 3F3TA 4NM7A 4CRSA 4DC2A 2XIZA 2OF2A 2HXQA 3OW4A 3GI3A 5L2SA 2RFNA 2IG7A 1Q8WA 5HIDA 3ACJA 3HMOA 3BHHA 5DT0A 5K0XA 3PP1A 5M57A 3ZBXA 3K54A 3EQRA 3KRRA 1A06A 4GV1A 5FEQA 5DEWA 3RMFA 2X9EA 3FI8A 3N4UA 4ACMA 3F3VA 1ZWSA 1XWSA 3QX2A 4HGLA 5HTBA 4XP0A 5GZ9A 4OAUC 2QKRA 4GK3A 4MEDA 4JG7A 3BE9A 1DI9A 3GU8A 4I5CA 5CEOA 2YCSA 4XG6A 2ZB1A 3UDBA 3KXMA 5FBNC 1REJA 3R7VA 3R7EA 4TWOA 5BVDA 4DH8A 3HAMA 4ACHA 3DBCA 2GFSA 1UKHA 2QOQA 2RFDA 2Z60A 4S30A 3TNWA 2A27A 2YACA 4LUDA 3TNIA 3VHEA 3VNTA 2YM8A 4AF3A 3ORZA 4MXOA 4KKGA 2KTYA 3QC9A 5EI6A 4CMUA 2JKQA 1S9JA 4EC8A 1M7NA 4F63A 3VS4A 5HTCA 4O0RA 4XP2A 1W82A 3QD0A 3JS2A 5IEYA 2G01A 2VWZA 3B8RA 5GJGA 3HV7A 2V22A 5H2UA 4ZTMA 4HGTA 1JSVA 4P4CA 4R3CA 4NIFB 3PVGA 3RPYA 2AC5A 3KY2A 4F0GA 1R0PA 4BDFA 3TUBA 3WZJA 5AM6A 2UVYA 2O64A 3LFEA 5CEPA 2J7TA 2VTHA 4O81A 4DGGA 4BCQA 1YWVA 3ZCLA 2W96B 1IAJA 5FTGA 3OWLA 5HIBA 2ITQA 2BROA 2BHHA 3LFSA 3LPBA 2BUJA 3V5LA 5BPYA 1P4FA 2UW5A 3HVCA 3GC0A 3Q60A 4IJ9A 4BYJA 3LXNA 3QBNA 2I6LA 3QTRA 4O0SA 4HVDA 5KMJA 4AU8A 3LIJA 1F0QA 1NXKA 4D1ZA 4U9AA 2RSVA 2IVTA 2VO0A 1OKZA 3R8LA 3Q96A 3QRJA 3GNIB 3N4TA 3KVXA 4YLLA 2QNJA 3CJFA 2WQNA 3KXNA 5ANJA 2PE1A 4CZYB 2C6EA 4FV7A 5EM8A 4KA3A 4ZSEA 5J95A 4ZTQA 2PMNX 4ITIA 3EQPA 4H05A 4MK0A 3BCEA 3MESA 3O0GA 3FMHA 3OXIA 2H8HA 5IU2A 1KUTA 3GCSA 2P0CA 5FDXA 3EOCA 3D14A 4IVBA 3DS6A 2ITWA 4Y85A 2J4ZA 4Z16A 1P4OA 3GU6A 2BHEA 5TOZA 5AUUA 3TIYA 3GGFA 2B9IA 4WHZA 3DKFA 1WZYA 5A9UA 5E9EA 2X2LA 5C1QB 3OXTA 4U44A 4O0YA 5AR4A 4GRBA 5L4QA 4ANOA 5A46A 4CV9A 4C4JA 4RWLA 2CKPA 3ZFYA 1J91A 4YTCA 1DS5A 1YI3A 4L3JA 5CU4A 1G8SA 2GNHA 2J51A 4EQCA 2W4JA 3CC6A 3V5TA 3AQVA 4YJQA 4BIEA 5K5NA 3BQCA 2HZIA 3GFWA 5HO7A 4NYEA 3G9NA 1S9IA 5GZAA 1FBNA 4CYJA 4NJDA 3VIDA 4MNEB 4O7ZA 2QKWB 4O0XA 4QMNA 2XM9A 3DDPA 3NX8A 3QHRA 4ERKA 3F9NA 5HVJA 4MCVA 3TV6A 2VNYA 4TRLA 3ZUUA 3DKGA 3V01A 3DNEA 3NAXA 4ASEA 2B7AA 3TNPC 2VTRA 4M7IA 3AC3A 2XJ0A 4G3EA 5K0KA 5ACBC 3ACKA 2R0UA 3BYOA 3FJQE 5HCYA 2C6IA 3LFFA 3R8UA 1R39A 4IWQA 4X3FC 4BBEA 2X6EA 4H39A 4DEAA 4WNOA 5HORA 1W0XC 3WZDA 1G8AA 2PHKA 4RIXB 3U54A 5KX8A 5M51A 5I9YA 4L45A 5CAUA 1H1WA 1W8CA 1J1BA 3AMBA 3QTQA 2C0OA 1E9HA 5AR5A 3FZOA 2J0LA 4APPA 4FKLA 3R00A 2O0UA 3IQ7A 4NCTC 3A4OX 4AFEA 5FUTA 3DKOA 3ELJA 3OEFX 3DZQA 4GYGA 4IAYA 1R78A 2C0IA 3EQFA 4WBBB 2YDKA 1ZARA 3EH9A 4YNEA 4DG2E 4JOAA 3T3UA 4BI2A 2CKEA 3DDQA 3ZEPA 3LCTA 2XP2A 3U9CA 3FLWA 3TKHA 1ATPE 2BKKA 2G15A 2R3JA 2UW7A 2ITXA 3G0FA 5AA8A 3AC4A 2CNUA 4AQCA 4CYIA 3G90X 4DCEA 1OMWA 5CF5A 3ODZX 5EK7A 3RZFA 5HU3A 4DGNA 4RSSA 2RL5A 5HX6A 4NUSA 1YOLA 3PPZA 4ZIMA 4O27B 4DFZE 5DYJA 3ID6C 5C4LA 5L6PA 3IW6A 1E1VA 3OWJA 5HKMA 3TT0A 2OG8A 3ENHA 4OR5A 4F9YA 4QQTA 1GJOA 4E5AX 3BYVA 1OL5A 3O7LB 2J9MA 5AV3A 4ZTNA 1OPJA 4FKWA 5TT7A 5LMBA 3K2LA 4AN3A 2VN9A 1CTPE 4GFMA 4CSVA 3LZBA 1GIJA 3QZIA 4LV8A 3ZS5A 2QONA 4ZJVA 4XUFA 2ITUA 3ATSA 2WTIA 3D5VA 2B55A 3GCPA 4V01A 2QO7A 2ZVAA 3WF8A 4AN9A 4CRLA 5AV4A 4K2RA 4QNAA 3ZO1A 2I0VA 2UVZA 5T68A 2ZOQA 5IQDA 1GZKA 2OKRA 2YFXA 4LV5A 4FYNA 3PSCA 3HV6A 4Y72A 1U4DA 4I93A 4IFGA 4YO6A 3W8QA 4A4OA 3FMLA 4ZSAA 2HW7A 4RIWB 3JY0A 5JN2A 3F2AA 4EK5A 4TWNA 3HYHA 3NAYA 3QQFA 4QTBA 2G2FA 2PZRA 3R7GA 2YDJA 1H25A 3VAPA 1MRUA 3WILA 5DH3A 4G6NA 3EMGA 4BDGA 5LCKA 4TKSA 4YURA 4UV0A 3UP7A 5HOAA 4FNZA 4L67A 2XK3A 2XKCA 4NFNA 4A7CA 4FEXA 3RTPA 2UZEA 2C6DA 4BCKA 4FTLA 4EH5A 2WHBA 1Q41A 4M66A 3RM7A 3VHKA 4AW2A 3EQGA 3UO4A 4NFMA 2O63A 4PTGA 4RVLA 2R7IA 1ZYJA 3RINA 4ZLOA 4XEYA 5KUPA 4HGEA 3DLSA 3R7IA 3P1AA 4PMSA 4PTEA 2YAAA 1JSTA 1R3CA 3OBJA 4Y8DA 3P08A 4IB5A 4F9CA 2ITTA 1OUYA 3FSKA 3OY1A 4O0UA 4X2FA 5KHWA 3P5KA 4D4YA 2Y4PA 2C3JA 4P2KA 3COMA 2HY0A 3FI3A 4ITJA 2ERZE 3SRVB 3I79A 3SVVA 3A8XA 3HZTA 3MY5A 2QOCA 1GNGA 3KMMA 4MVFA 3PA4A 4RLLA 4F08A 1T46A 3C4CA 2BZIB 4ZP5A 4FKQA 4G3FA 1M2QA 3QZGA 4Q9SA 3MSSA 5IEVA 3LFAA 1J7IA 4NWMA 2R9SA 4BKZA 4R5SA 2P33A 3PFQA 3TG1A 5EHLA 1BYGA 3UBDA 2F9GA 1OI9A 4MXCA 3ZLYA 4BI0A 5IZFA 4ZMFA 4FIJA 1H8FA 1ZZ2A 2UZDA 4QMQA 4D2TA 4MYGA 4TY1A 4FT3A 3TZ7A 5FGKA 4TZRA 4NKAA 3DJ6A 4EH2A 5HBJA 3FC2A 4JBVA 2O5KA 3VUKA 4YHTA 3GC8A 2E9VA 2Y4IC 4DA5A 3F3ZA 3NVKI 4MD9E 5E8TA 4EK8A 5IQEA 4G16A 3ROYA 4F65A 5IA5A 3I6UA 3TJCA 2WMUA 4BHNA 3CPBA 3R63A 3OCBA 4I5MA 2V55A 3W2SA 4FSRA 4KINA 4D2VA 4FG8A 4QMOA 2REIA 4E3CA 4N57A 2I0EA 2PMIA 3HRCA 3D5XA 3FMMA 3I6WA 4FNXA 2ITVA 2C5XA 5JFSA 1GZNA 3COKA 3DK3A 4CFWA 4DEEA 4XG9A 3EB0A 5CU2A 5BVFA 1BI8A 4U80A 5CANA 1U59A 3F61A 3II5A 4OTQA 2PVNA 3L9PA 4YR8A 4IZAA 1JLUE 3KXZA 3V8TA 5EYDA 2XIKA 3OC1A 3OS3A 2VWYA 2WFYA 3JYAA 5DN3A 3FY2A 4O82A 3R8ZA 5AAGA 2PVHA 5CSWA 3PJ8A 4IMYA 5CSHA 3LLAA 2BALA 3O7LD 2ETKA 4YPSA 3KB7A 3T8OA 5CQUA 4RJ8A 4D0WA 3WE8A 2R7BA 4P90A 2BRHA 3HMPA 5BUEA 2QOHA 3AXWA 1YXXA 5J1VA 2GNJA 1PHKA 2C6OA 2J50A 2EXMA 4F7JA 3C0HA 5TKDA 5CAVA 2G2HA 4OBQA 1O6LA 2QR7A 2GCDA 1FVRA 3QD4A 3BU6A 4HZSA 5L2IA 2GU8A 3L8PA 5BUJA 3E92A 2VGPA 3G15A 5CAQA 5HNBA 4XHKB 5M4FA 4G6LA 3JUHA 4Q2AA 4IAZA 5DA3A 3R9DA 3HV4A 5HGIA 4BCFA 4G3DA 2EUFB 3R7UA 3TACA 3TDVA 3FEGA 1UU3A 4AUAA 4QPMA 4ZK5A 2XA4A 4HVGA 3QTZA 4PL4A 3C51A 1IG1A 3DFAA 3R1YA 1G5SA 3UMWA 3F88A 2P4IA 4GW8A 3D7ZA 4MXAA 4QMPA 5A6NA 2PUIA 3MI9A 2YAKA 2QHMA 4FIFA 4IVCA 3RAWA 3SG8A 5KCVA 5HCZA 4ZTHA 2OXXA 4AGUA 4KKHA 2ONLA 3ORNA 2XNBA 3FLZA 5CSVA 3VQUA 2DUVA 3MFUA 1H1QA 4JG6A 1UNLA 4RA4A 5CI6A 4L44A 5GHVA 3VBTA 4BI1A 3A7JA 2ITNA 3EIDA 4BHZA 2BZKB 4BBFA 2UZNA 4J53A 4FTNA 3FL5A 2W1HA 2BDWA 3PJ2A 5E92A 4O7SA 1Q5KA 4BDEA 3BELA 2YHVA 2I0HA 5EDPA 3TNQB 1FINA 3VJNA 4I23A 3BHTA 3R2BA 4DCAA 3R30A 3OCTA 1UKIA 4D55A 5L2TA 1XHAA 3L1SA 3W33A 3WF5A 5A4EA 4FEWA 3FMDA 3OG7A 4HZRA 2XKEA 2Y7JA 3S95A 2WMBA 2F4JA 2OFVA 4WOVA 1ZMUA 1VYWA 4X3JA 3UPZA 2WMAA 3BU5A 4KS8A 3H3CA 4RIYA 2QOLA 5TF9A 3WZKA 1OL2A 3DBQA 3MV5A 5EYKA 3LMHA 5AA9A 1Q8TA 4MD8E 4D1XA 4PDOA 3MVMA 4FSUA 4TWPA 3PA5A 4FMQA 3RNYA 2PK9A 2JC6A 3QD3A 3KRWA 2YM7A 3F82A 3LXPA 5DEYA 3HAVA 3G2FA 3E87A 3QCXA 3QFVA 1RE8A 3K5VA 2XNMA 4ENXA 2X8DA 3PIZA 4KBCA 2CCIA 5TE0A 3RAIA 3ORKA 2GNLA 3AC1A 5FRIA 3W16A 5LWMA 3MWUA 4UMTA 2ITZA 3RWQA 4AA4A 4G34A 5LXMA 2CGXA 5BYYA 3KN5A 5IQCA 3ERKA 3QQJA 4BCIA 4C37A 1IR3A 5BNJA 4FTAA 3HRFA 5KMKA 1Y6AA 2R5TA 1HCLA 2X7FA 5LWNA 2YM6A 3G33A 4FBXA 1Q62A 2YM4A 3OEZA 4FEQA 5CASA 4EOQA 2JDVA 3FLYA 4GG5A 4UZHA 5I9UA 3IW5A 3RBWA 4UMRA 3CQEA 5FXSA 4C4GA 1UWJA 4QP9A 4LQMA 4WRGA 4G5JA 3AD6A 1Q97A 3R0TA 3A2CA 2CPKE 4DYMA 4HYSA 4YLJA 4MXXA 3QQGA 1OKYA 3V5JA 4AOJA 5CAPA 4BC6A 3F5GA 2BKZA 2C47A 3V04A 3V6SA 4DH7A 4CEGA 2VTOA 2W5AA 3Q5ZA 1H28A 4IWPA 2VWIA 3COIA 2A1AB 3HUBA 3A61A 5IEXA 3HGKA 3POOA 3EQIA 5G1XA 4YLKA 2W4KA 1PMVA 4MHAA 4ZLZA 5JRQA 4O7TA 5JGDA 4BDKA 2X9FA 3FPQA 4FV3A 4DFLA 3AC5A 3HMMA 1OIQA 4FKSA 3MJ2A 2OJFE 2Y6OA 3DJ7A 4G1WA 3VUMA 2CGVA 3LXKA 5IG1A 3UNKA 4MTAA 3F5UA 4UXQA 4DITA 3L9NA 2FSMX 4BVUA 2YCFA 2HENA 4YJVA 5E4HA 3R1NA 1KOAA 2J5FA 3KEXA 1JKSA 2VAGA 4FV4A 4W8DA 1NY3A 4R7BA 3NIEA 5CZIA 5EI8A 3W8LA 2W06A 4DLJA 3CP9A 2IZSA 4MBIA 3DK7A 3O17A 4IQ6A 1QCFA 2XIXA 3Q52A 4RWKA 3PXZA 3UQCA 4UB7A 5D9HA 1XQZA 3QYZA 3GU5A 5FEDA 3U4WA 1KSWA 5F4NA 3JR1A 1OL1A 4QQCA 1MUOA 3C4ZA 3LQ8A 4KIKB 2XNNA 5M08A 5J9LA 3BPRA 4C0TA 4UYAA 2BTRA 3DBFA 4KD1A 4EOJA 3UOHA 1OGUA 3DAEA 4XV9A 2E9UA 4BTKA 1J3HA 4D58A 4OTWA 3DPKA 2ITOA 3EFKA 4ASDA 3AG9A 3U55A 4QYGA 3TV7A 1VZOA 3LM5A 4IH8A 4MXYA 4FV8A 4D1SA 4TYHA 4DGMA 3IOPA 4AS0A 5CNNA 5JRSA 4ZOGA 5A54A 4IVAA 4ANLA 1XH4A 4JBPA 5C8NA 3P7BA 5FG8A 2J5EA 4JR7A 3BHUA 2F2UA 4FSNA 4FKUA 5AP4A 3ZRMA 3TWJA 3RP9A 1URCA 4F6UA 3W1FA 2XYNA 2E9OA 1SVGA 2CNVA 3FLQA 1U54B 3ITZA 4BIBA 4EC9A 5LJJA 1B38A 3PVBA 4CXAA 4XS2A 3U6HA 4XOZA 1I44A 4RWIA 3IKAA 5BVWA 5IH4A 4Q5EA 4LGGA 1H0VA 2QODA 2X81A 3AT4A 4KRCA 4KIKA 3RM6A 2F57A 4WNPA 2C6LA 5FBOA 3DBDA 4DN5A 3TUCA 1FOTA 3O8PA 2WEVA 4FZAB 4XRLA 3ZU7A 3RAHA 3LXLA 5IH6A 5GINE 3H9OA 1UNGA 4CMOA 2CGUA 3GOKA 2HELA 2F7XE 1NVQA 3OT8A 4UWCA 3NUUA 4WT6A 4GU9A 4QYFA 1M52A 3UG2A 2C69A 5CWZA 2UW6A 4NM5A 2PPQA 5CTPA 2CLXA 2PE2A 3MPMA 2YCRA 1GIHA 4WD5A 3NUAA 3PSBA 3A4PA 3KXHA 4H1JA 4FSWA 4EOLA 5M53A 5HX8A 3Q9YA 4CFNA 4BDIA 4FKTA 2J90A 4QQ5A 4Y46A 4R1YA 5AIRA 5B0XA 3VS2A 3LFQA 5GJDA 1FVVA 2CHLA 3QGYA 2OXYA 4PX6A 4HYIA 4BBMA 2YERA 1J7UA 4J8NA 4R6VA 3LCOA 3KGAA 3UNZA 1Y91A 4O21A 4DGOA 2OW3A 4IAAA 4YJUA 2YIXA 2BAKA 2ITPA 4RMZA 1VEBA 3MH3A 4GL9A 5I3OA 2VWXA 1UWHA 4I6BA 4TN6A 3UIBA 4C59A 4C61A 4EZ5A 5LMKA 4IDVA 4X2JA 3TJDA 3ZO2A 3Q5IA 1H00A 2FSOX 3OUNB 4BTMA 2ETRA 4P5ZA 2W0JA 3GEQA 4JRVA 1LEZA 1UV5A 2OIQA 1Q3WA 4XOYA 4BZDA 2WNTA 4GG7A 2PVKA 2JDSA 3WZUA 3LLTA 1YHVA 4FC0A 3FZRA 1JOWB 5LMKC 4YBKA 3QYWA 3QQLA 3Q6WA 1PXNA 4IW0A 4U40A 4CKJA 3QCQA 1E1XA 3D83A 2HY81 4WG4A 4IZ5A 2R3MA 3TCPA 1V0OA 3NDMA 1XH8A 3EN7A 3FYJX 4FNWA 4XG4A 4IEBA 2UZWE 3IW4A 1YDRE 2VO3A 4FNYA 4C4FA 2X6DA 5AM7A 3QC4A 3VRZA 2PZYA 5CS6A 4L42A 2QOOA 1AD5A 2ZDTA 5DHJA 4YTIA 5CEIA 1BL6A 3FXWA 4CT1A 5IUHA 2C6TA 2WMVA 4O7VA 2FVDA 1TVOA 2VUWA 3PRFA 4S33A 2XZSA 2GQGA 5AX9A 1I09A 2JLDA 2P55A 4IVDA 3CGFA 1YXUA 3UOKA 2CJMA 5KMNA 2Z7LA 4PPAA 1TQIA 4W9WA 5C26A 2JD5A 5LVMA 1WBNA 2FSTX 4YJSA 5IQFA 1LP4A 3VRYA 4RT7A 3SQQA 3LQ3A 3PPJA 4UX9A 3UZPA 1FMOE 4C36A 2BIKB 4F0IA 3E8NA 4FUXA 4I6FA 2VO6A 2WAJA 4KNBA 3ORTA 1KOBA 1M17A 4ZTLA 3TZ9A 3NNWA 4WNKA 1OPKA 2GS2A 3DU8A 1ZYDA 3QQKA 4JIAA 4TNDA 2VU3A 2YM3A 3ANQA 3IONA 4R3PA 5EKNA 4JX7A 5EYCA 1VR2A 3AT2A 1PYXA 2UW8A 5H8BA 3FV8A 3MY0A 2JITA 3E62A 3EQCA 3RHKA 3UQGA 4O7LA 3NR9A 4FV9A 3FQHA 4BTFA 4OTIA 2JBPA 3UIMA 5HD4A 2J0IA 4GFGA 4JBOA 1IASA 5GIOE 4CFUA 4X0MA 2GHLA 3MW1A 2XVDA 3D2IA 5DLSA 4WA9A 1F3MC 4ALVA 3KK8A 3R73A 2UVXA 2W1GA 4IX4A 5E8XA 3Q9ZA 5K4JA 2FGIA 3MFTA 4KIQA 2X4ZA 5FD2A 4RQVA 3AC2A 1KWPA 4U5JA 3JY9A 1LR4A 5AP5A 4GT5A 2JEDA 4D9UA 3DQWA 4M8TA 4M14A 4IZ7A 3UVQA 4HW7A 4FOBA 4LL5A 2RG5A 4FEUA 3I7BA 4MWIA 2VTSA 2OI4X 4JJRA 4M68A 2B52A 5AADA 2Z02A 2ZJWA 4I1ZA 5C01A 5FTOA 3QUPA 4QP6A 3LAUA 2WTCA 3BU3A 2ERKA 3FYKX 1K2PA 3FI2A 5DI1A 5AUZA 3I0OA 4V04A 4AN2A 4IB3A 5EM5A 4KIOA 2P3GX 2FUMA 5H8GA 1H0WA 3RVGA 2B53A 2ZDUA 3ZH8A 5BMSA 2CDZA 3HX4A 4B6LA 3QKKA 4TYHB 3QA8A 3M2WA 5AJQA 1PXOA 2W1CA 3AT3A 4FI1A 4FTRA 1WVXA 5DVRA 3NYNA 2EVAA 5M44A 5AEPA 1URWA 5ANOA 2X2KA 4JIKA 3WF6A 2FYSA 4JT3A 4KSPA 2C30A 2VX1A 3C13A 3MPAA 1ZYCA 2VTJA 2OWBA 3GUBA 2VTMA 4ZMEA 3C5IA 4I24A 2WPAA 1B39A 3RKBA 4YC3A 2PVYA 4RJ5A 5HD7A 3R8MA 3MTLA 5J1WA 2OLCA 2XJ2A 5L2WA 5BQ0A 3IG7A
chains in the Genus database with same CATH superfamily
4EORA 4DFUA 5E7RA 5BYZA 5ACKA 3ORMA 1IEPA 3WF9A 2LGCA 3LE6A 3R1QA 2OZAA 3LMIA 3W2OA 3FSFA 5BX0A 5J9YA 2J0KA 4KS7A 4LRJA 5AP1A 4QP4A 3JVSA 3KN6A 2F49A 4QMXA 2WB8A 5IUIA 1RW8A 5AR7A 4MKCA 2A2AA 2FO0A 3IPHA 2X1NA 3CLYA 2IO6A 3TXOA 3P79A 4PNKA 1MQBA 2OU7A 3IOKA 3N51A 1XBCA 5CSPA 5BVNA 3CEKA 1G3NA 2ZM3A 1M2RA 4DAWA 3EN5A 1R1WA 2OZOA 2B54A 3FZPA 4IC8A 4D0XA 2AYPA 2XK7A 4FIIA 3EFJA 3NW5A 5IQAA 2VTQA 4BTJA 3OWPA 3PA3A 2XUUA 4LI5A 4MX9A 1CSNA 1Y8GA 2ZV2A 1BLXA 4FKPA 2JAVA 2P2HA 2YLEA 4NM3A 5J5SA 5JZJA 3SW7A 5C4KA 5E1SA 3NWWA 4E6AA 4FTQA 5L6OA 1YOJA 3NVMB 3FKOA 4GEOA 2IVSA 5CU0A 3I4BA 5CYIA 5HLPA 1OKWA 3HLLA 3MTFA 5F94A 2H96A 4LV7A 2YABA 1LUFA 1WBPA 3AKJA 3TL8A 2A0CX 4BDAA 5EQYA 1QPJA 3BRBA 5JFXA 2Z7SA 2W05A 4ANQA 5IQHA 2I40A 4EOPA 5JT2A 3BEGA 2UUEA 3PXYA 1A9UA 4ALUA 4YTFA 3HEGA 3OWKA 3R2YA 3W2QA 4ZEGA 2PZ5A 2UZUE 3KMUA 3QD2B 4ACDA 1H08A 3I5NA 1XR1A 4WO5A 5A4LA 3PG1A 4YBJA 4C3FA 1IRKA 4XV1A 3UIXA 4K9YA 4X2KA 4F9BA 4FRFA 4QDEA 3LOKA 1WVWA 2QR8A 3A7IA 3L9LA 2GHMA 3TTIA 2BTSA 4R77A 4IX5A 1NVSA 3CGOA 2HZNA 3EN9A 4TPTA 5HLNA 2GQSA 2WZJA 1T45A 4O2ZA 1YRPA 2XEZA 4L9IA 3L8SA 3AC8A 4IDTA 1W7HA 2W9ZB 2Y8OA 3RJCA 4UYNA 4IB0A 5ETCA 2QVSE 4C3PA 1CMKE 2XK9A 1QMZA 4F09A 4RX5A 1ZMWA 4ANBA 3DQXA 4WSQA 2ZMCA 3F5XA 5KZ0A 3R8VA 4C2VA 3KULA 1OL7A 1KE9A 1AQ1A 4NK9A 3KK9A 4EKLA 4W4XA 3UG1A 4GJ3A 4U81A 3E8DA 2QO2A 4XYFA 4RVKA 1P2AA 2PMOX 3DXQA 1PXKA 2X7GA 5FXRA 1DAYA 4YZDA 2UW0A 3DJ5A 4XV3A 3MH0A 4YJTA 4CTBA 4R7IA 5D10A 2C5NA 4Y5QA 4O7RA 4L53A 4BZNA 5KBRA 4ANMA 2X8EA 4JQ7A 3FL4A 3CY2A 3UOLA 4AAYA 2WTVA 3KRJA 1WVYA 3P4KA 2CGWA 2WTJA 3OTUA 1WBSA 2BR1A 2QU6A 4FX3A 3BIZA 5LVPA 4YJNA 1H1PA 3V5PA 3IGOA 1TQPA 3C0IA 4IE9A 3D0EA 4K33A 1CDKA 3FWQA 2V7AA 3AGMA 4WSYA 1P5EA 4CZUA 1Q8ZA 3QWJA 1PYEA 1K3AA 5BVOA 3QCYA 3RZBA 1PMEA 4M15A 5DPVA 4LOOA 5JZNA 2SRCA 1OGYA 3PXRA 3ANRA 1XBAA 5HG9A 1HOWA 5IDPA 4KBAA 2RIOA 3HMIA 4RFMA 4LMNA 4WRSA 3PFYA 4EH6A 4U3ZA 4K8AA 4DFNA 4G17A 2R3NA 2CCHA 3MJ1A 1YDSE 3MA6A 3MPTA 4E5WA 2JFLA 4DE4A 5JQ8A 1PXPA 1BUHA 4TYGA 1Q8UA 2C4GA 3PLSA 4AGCA 5C9CA 2YWPA 2JIVA 3DXNA 5EHOA 3O2MA 5DRBA 4JR3A 5CF6A 5DOSA 5L8LA 1FQ1B 4A06A 3SLSA 1FPUA 4M84A 2B9JA 1WFCA 2GTNA 3OVVA 3Q2JA 4K11A 3VBWA 3SGCA 3PLAE 4CFVA 3FXXA 3MB6A 4OBPA 2BILB 3OMVA 1OZ1A 3VS6A 3KCKA 4BCJA 1NA7A 4OTGA 4EOMA 4FL1A 4PRJA 4TWCA 3QTXA 1ERKA 5HNGA 2J2IB 1MRYA 3K3JA 4EQUA 4FTUA 4YMJA 2OJGA 5EW3A 2OJ9A 1OM1A 3CD8A 4QP1A 2JKKA 4FF8A 2GQRA 1OVEA 4L3PA 3G51A 1XMLA 4FT5A 4II5A 2XBJA 5IH5A 4GKIA 4ZAUA 4YZCA 4A9YA 3RI1A 4EUTA 3GOPA 2VO7A 3MVHA 4IM0A 5TR6A 2BCJA 4EK4A 4ZY4A 3R83A 3LW0A 3W55A 1Q4LA 5D11A 5JKGA 4HJOA 1H1SA 1ZXEA 2C1AA 4QDVA 3S4QA 4OLIA 1PRYA 2XH5A 5DFPA 1UU8A 2IF8A 3FQEA 1WBOA 2XIYA 5LMAA 4IM2A 2IZRA 2VV9A 2IWIA 3GCUA 4QP8A 3VVHA 3CJGA 4M0YA 3DOGA 4H3PA 3U8WA 4F7SA 4RJ3A 3MYGA 2PVMA 4FSMA 4R78A 2OGVA 1W2FA 3FKNA 3EJ1A 2BRGA 3FE3A 2B9HA 2C68A 4FKRA 3N4VA 5BYLA 1JWHA 5HESA 4D4VA 2OXDA 5KMLA 3EQDA 3GU4A 1O6KA 2CSNA 2W1IA 2C1BA 3EZRA 3UTOA 5JK3A 5M4CA 2PE0A 1NT2A 4FV2A 4AT3A 3EYGA 2XB7A 5M4IA 4F0FA 2R2PA 2I7QA 4IHPA 2V5QA 4MD7E 2W1ZA 3FLNC 4DF3A 2UV2A 4JQ8A 2VNWA 4LYNA 4CCUA 4O4EA 3PXQA 5HLWA 3E5AA 4YHJA 3PVWA 4LGHA 4L3LA 1YXSA 1FVTA 4YJRA 4YP8A 1IAHA 4KUJA 3UDTA 3C9WA 4DBXA 3HUCA 5G6VA 4PDSA 4QTDA 1DM2A 3ZSIA 1PW2A 4AT4A 5CY3A 3R9HA 4A4XA 2OIBA 3DFCB 4QMLA 4FE2A 3D4QA 5E8UA 3P7AA 2WIPA 2J6MA 4G3GA 2G9XA 2XCHA 3F3WA 3VS5A 1WAKA 4CQGA 2QCSA 2X2MA 4O0TA 1UU7A 1JNKA 4FSYA 4FVQA 1KE5A 3NUYA 3OF0A 5C27A 2YM5A 3VBXA 4UZDA 1JPAA 4ERWA 4F9WA 5I3RA 3IO7A 3QAME 5H3QA 4C3RA 1YHSA 4ITHA 4BWPA 5K5XA 4FT7A 2EXCX 2I0YA 5EYMA 4ID7A 3ET7A 5AV2A 3C0GA 1FGIA 4S32A 3SXRA 4FKOA 4QRCA 2YZLA 3CS9A 2HIWA 2ZYBA 3DT1A 3OTVA 3QRTA 4PDPA 5EH0A 2UZVA 1V1KA 4AW5A 3R01A 4O22A 1KE7A 5CENA 4E26A 1Q8YA 4CKIA 3B8QA 3VF9A 1BX6A 3CKXA 3QKLA 3NUSA 2UW9A 1FMKA 4ORKA 1WBTA 3DTCA 1M7QA 3NIZA 3RAKA 3T9IA 3RWPA 5DE2A 4P7EA 2BMCA 2PUUA 3K5UA 2R3PA 5HE0A 3S00A 5GZ8A 2R3IA 4LDTA 4I6QA 4BDCA 4YZ9A 4CZTA 1J7LA 1XJDA 3RGFA 3WI6A 2UZTA 3L8XA 3H9FA 3IDCA 4FTIA 3FMNA 3TN8A 5DR2A 2ZM1A 4EK3A 4NL0A 1UU9A 5CU6A 3PTGA 2ZFYA 5J5TA 1TKIA 1O6YA 3OZ6A 1ZY4A 1KV2A 5DR9A 4X3FA 4F1TA 1XH6A 4JRNA 1OIRA 2EB2A 3F2NA 3BGZA 2HW6A 2VGOA 2Z2WA 3NCGA 5IQBA 4F1OA 3SXSA 1Z5MA 3UVRA 3UOJA 4FZ7A 5IA4A 3BX5A 3KF4A 5CAOA 1W2CA 3L8VA 4QMVA 4GVAA 4FZ6A 3UODA 3G6HA 4QPAA 3MFRA 4I94A 1XKKA 4L6QA 4O7WA 4X7QA 2DQ7X 2GHGA 3DGKA 5CVGA 4QMUA 2RG6A 3KFAA 4RLKA 3HA8A 3LHJA 4HCVA 4L52A 4PL5A 3UYSA 4HNIA 4KBKA 5E8WA 3EKNA 5JGBA 4WKQA 3W2CA 5DIAA 4BDBA 5I9XA 1YXTA 2OZAB 4C35A 5JFVA 2QO9A 3O23A 4OBOA 5HO6A 3TKUA 4BYIA 3KF7A 4EH4A 5M56A 2YISA 3RK7A 4CTCA 4YSJA 3TDWA 4A9SA 3C4WA 4BF2A 1OIYA 2AUHA 4H3QA 4AZFA 5AAEA 1BMKA 2BDJA 4O4DA 2DYLA 4UBAA 3UGCA 3UC3A 3BBTB 2GFCA 1P14A 3VF8A 3CQUA 5IISA 3PRIA 4HPTE 4UWBA 5D12A 3ETAA 2QURA 4FV6A 4A4LA 3QLGA 1IA8A 3BV2A 3SC1A 4F9AA 4IZYA 2H34A 4BZOA 3QF9A 3DAJA 4O0WA 5CI7A 4EQMA 1YI6A 2OH0E 2YEXA 5I4NA 3A7FA 3ALOA 1PXLA 5A4TA 2XRWA 3VS3A 4I0SA 2R3FA 4GUBA 4YPDA 3R22A 2WMWA 3VS1A 3FLSA 2WOTA 3CXWA 4FV0A 4BDHA 3CQWA 1OPLA 2JKOA 4GU6A 2WMRA 2XNGA 4QTAA 3UZRA 1OIUA 4J98A 3R9NA 3H4JA 3LJ1A 4D2PA 2WU7A 3F6XA 4DT9A 2W1DA 2OSCA 3V6RA 1YOMA 4WNMA 3PZHA 2BIYA 4IAIA 4RX9A 5C8KA 3ALNA 4JG8A 5A4CA 3ZLSA 1Q24A 4R7HA 3MFSA 4EONA 2O65A 1SZMA 4O7NA 4X6QC 3OY3A 1MQ4A 3KMWA 3P9JA 3NCZA 3O50A 3QLFA 3E88A 5IA3A 4D9TA 4FKJA 3C5UA 2Y9QA 5AAFA 3GFEA 3ZFXA 2WU6A 3FI4A 4DG3E 3KREA 3P5JC 3IW7A 3VO3A 3QRUA 5E8VA 3QZFA 2HK5A 1NVRA 3PPKA 1Y6BA 4WIHA 4C33A 2CN5A 4V0GA 5E1EA 5CEKA 4AXDA 4BIDA 5BV3A 4TXCA 3BQRA 1KV1A 4M3QA 4K6ZA 4O7YA 1OBDA 1KE8A 1JKLA 4L01A 4H3BA 3ZC5A 2VRXA 3UE4A 3OCGA 2BFXA 4W4VA 5C8MA 4E73A 2XKFA 4BJJA 2QG7A 1RDQE 3R04A 3JPVA 2GNFA 3SXFA 3TI1A 4OUCA 4DT8A 5CU3A 4DTBA 4I3ZA 1ZOEA 4FGBA 4J99A 2BAJA 4JNWA 3H30A 1ZZLA 1PXJA 5CSXA 4C38A 5LCJA 3LFDA 2HWPA 4OTFA 2VTAA 4OT5A 3GENA 3O96A 4O84A 4YUQA 4F6SA 4UALA 4XRJA 4MBLA 3ZEWA 2NO3A 3ZMMA 4MF1A 4BKJA 4EUUA 2PWLA 4XLVA 3DBEA 5EDQA 5IA0A 3O5AA 4L7FA 5D41A 4U97A 4B8MA 4HVIA 3A62A 4D4RA 4JS8A 1U5RA 2C5VA 4XCUA 3VC4A 4NH1A 4D4SA 4IFCA 4ZSGA 2GNIA 4GIHA 4C4IA 2WOUA 2Y6MA 3Q53A 3ZM4A 2DS1A 4PWNA 5CF4A 3UC4A 4FA2A 4USDA 2PULA 3TTJA 1ZOHA 1QPEA 4FL3A 1F5QA 4I5HA 4NW5A 4J1RA 4L46A 3EL8A 5AUTA 4CG9A 4EL9A 1DI8A 3MDYA 4IX6A 4FV1A 4G2FA 2VWVA 5FTQA 4XG7A 3BHYA 5A4QA 3FHRA 4KB8A 4E5BA 1V0BA 4PMTA 4LG4A 4EEVA 3WZEA 5CF8A 5JFWA 4NZWB 4B7TA 4AQKA 3ZRLA 2WELA 4ZJIA 5BVEA 5HZNA 4XX9A 3HV3A 1TQMA 1PF8A 2C6MA 2J0MB 4NIFA 4O91A 4MNFA 1H24A 3FKLA 1M14A 4FK6A 3ZDUA 3VWAA 4BCGA 4BCNA 4EOSA 4OAVB 3UDSA 3W0OA 4BDJA 1YHWA 1OL6A 3RNIA 4XJ0A 3R7OA 2QC6A 3F69A 4FIEA 3WIGA 2CKOA 2JKMA 4N0SA 1JSUA 5HIEA 4NCTA 2WKMA 2Z7QA 3BZ3A 3EQBA 5HVYA 4DLIA 5ANEA 5FQDC 4DEBA 3CTJA 1ZYLA 5CX9A 3ZHPC 4QMYA 3FQSA 3BV3A 4QT1A 5E8YA 3A99A 4OTPA 3SG9A 5IA2A 4C7TA 3ZO3A 4QQJA 2YIWA 3EN6A 2YCQA 2UW3A 3BYSA 3VS7A 3P23A 4M69B 2RGPA 1XH7A 3FMJA 4ZZMA 4AGDA 5IMXA 4RJ7A 3NUPA 3NRMA 1BKXA 5HE2A 4G6OA 5ETFA 3S3IA 4USEA 2ACXA 3FAAA 3HP2A 2HZ0A 4QMSA 3O8UA 2XRUA 3KA0A 3I1AA 2EWAA 3WIKA 4J96A 3D9VA 1W83A 3NNVA 4D2SA 3COHA 4X2NA 4FSZA 3FDNA 2BZJA 4DH5A 2WMQA 3M11A 3S0OA 5KMOA 1ZMVA 3H0ZA 2C3KA 3R71A 4EBWA 2F7ZE 1OECA 2HYYA 3AMAA 3LFBA 4HGSA 3W2RA 2BFYA 2A19B 2JDOA 3GU7A 5M55A 4AT5A 4DHJA 3D15A 4OTHA 3VULA 4BGHA 2W17A 4I41A 4TW9A 3SA0A 2IVVA 4G5PA 3PY1A 4MF0A 2Q0BA 4F99A 3R6XA 2OF4A 2EU9A 4XP3A 5CT0A 3C4FA 3LKMA 2XEYA 4CLJA 4AA0A 5GIPE 3VS0A 5B7VA 2V62A 4CVAA 2W5HA 3E63A 5AX3A 5JMSA 3SX9A 4BWKA 4U42A 4OGRA 3CPCA 4F70A 4PV0A 4W8EA 4CFXA 4K77A 4KABA 3ROCA 3R21A 4IXPA 2J0JA 4X6RA 3C7QA 5J8IA 2ESMA 5CALA 4PNIA 4PP9A 3VBQA 2ZV7A 4D28A 4DEGA 4RVMA 3HL7A 4AXEA 4U8ZA 5EI2A 3T9TA 4AP7A 3QKMA 4FODA 4LM5A 3M42A 3UVPA 4FIHA 3GQLA 3I0QA 4EOKA 5A6OA 5CEMA 2XAMA 1QPDA 1RJBA 2VTPA 3ZZEA 4IANA 3SAYA 4PUZA 4DEHA 4XG3A 4Z55A 4GYIA 3OOGA 1Q99A 3OROA 3E8EA 3W18A 3MN3A 4N6ZA 4RJ4A 5L3AA 4D2WA 4J8MA 4ASXA 3CTHA 4FIGA 2JBOA 3ZDIA 4TTHB 4C4HA 3Q4CA 3VBVA 4CNHA 1ND4A 4NJ3A 3Q6UA 3FZ1A 3NUNA 4PQNA 2A98A 1RQQA 4DHFA 4LL0A 5JH6A 3ZZWA 1Z57A 5IA1A 1ZOGA 3CKWA 1DAWA 3WOWA 3VW6A 2XNEA 4MXZA 4B0GA 4E20A 5KO1A 5LARA 1CKJA 5CT7A 1OUKA 5ETAA 4BFMA 4FYOA 2YDIA 2YIRA 3R9OA 5C03A 1B6CB 3A60A 3AMYA 4F78A 1JKTA 2X39A 3QQHA 1AGWA 1MRVA 2UZBA 5E8SA 1V0PA 4W4WA 4QYYA 4DEIA 2B0QA 3TZ8A 3GCVA 4CG8A 2ZV9A 4U79A 1Z9XA 2VZ6A 2NRYA 1PXIA 3Q4UA 4NKSA 3PDTA 5AMNA 3DNDA 2ZV8A 4ENYA 1WBWA 3W2PA 2X0OA 5EQEA 5LQFA 2B1PA 4PF4A 4JQEA 3PY3A 1WMKA 3QUEA 2XARA 4APCA 3MBLA 4FTCA 3UPXA 3HRBA 4GCJA 3EHAA 5HHWA 3PXFA 1MP8A 4JDKA 4X2GA 4GS6A 5HCXA 4TL0A 3ZSGA 3QGWA 4XBRA 5FP6A 3MS9A 4Z3VA 2IVUA 4FT9A 4RGJA 5EQPA 4CGAA 4K1BA 5JEBA 3SOAA 3WBLA 4PDYA 1LEWA 5J7BA 4PP7A 2C5OA 3NW7A 5DMZA 4J52A 3O71A 5AP3A 3GQIA 3MA3A 5CEQA 3ZLWA 2WQOA 5EDRA 3TM0A 3DXPA 3IGGA 3Q9XA 2VTNA 1REKA 2R3OA 1W84A 4A07A 4C4EA 5CXZA 3NPCA 3QHWA 5IF1A 4DTAA 4QYHA 5KMIA 2WD1A 1YDTE 1W2DA 3PY0A 4FZDB 2Q83A 2IZTA 4MWHA 3ZRKA 1PJKA 5IDNA 3DK6A 5A14A 4RPVA 4L00A 3UP2A 3O8TA 2PUPA 4J95A 2W7XA 2XF0A 2JDTA 5EKOA 3KULB 4C02A 3R8PA 5KKRC 4R1VA 1H26A 2R64A 3QTIA 4FKIA 3QU0A 5FM3A 3FHIA 2CMWA 4IWDA 1YI4A 3DCVA 3D5WA 3OD6X 3NFGB 1ZY5A 1JVPP 2IW9A 3F66A 4QYEA 1Y8YA 4QMTA 4IB1A 2BRNA 4IIRA 5AV1A 2O3PA 4AX8A 1GIIA 2C0TA 2QOFA 4RFYA 2NRUA 4WG5A 4TT7A 3E3BX 4CV8A 3MB7A 4U6RA 1Y57A 5HNIX 4EHVA 5CVHA 2VWBA 2WXVA 5IMEA 4PMMA 3PWDA 3ZUVA 4I4EA 4U43A 3SRVA 3GXLA 4BL1A 4XMOA 3ORLA 2BZHB 3MVLA 4LOQA 4RC4A 5HU9A 5EHYA 3E8CA 3GB2A 2G2IA 4YJOA 5CLPA 3RPSA 2VTLA 4EBVA 4YO4A 2XIRA 3EL7A 2R4BA 2OH4A 4C34A 4E6CA 5FLFA 3ULIA 3PP0A 3H0YA 2Y4IB 3KRLA 3EFWA 4D5KA 4HCUA 4BCOA 4BGQA 3P86A 1UA2A 3FY0A 1SYKA 4GK4A 2XK8A 4ZTRA 4IX3A 4UWYA 4EKKA 3KRXA 3UDZA 3TV4A 5HQ0A 2V7OA 4FG9A 3UQFA 4PL3A 3SKCA 4I0TA 4EYMA 2ITYA 2R3KA 2W4OA 3NMUF 3BWJA 3G0EA 4FICA 2CLQA 3S2PA 1PMUA 2JIIA 1CKIA 4NTTA 5DT3A 2PVJA 2WO6A 3HP5A 3FUPA 5CXHA 4F4PA 2PUNA 3ORIA 4BR3A 1J1CA 3CSVA 2HOGA 2JFMA 3AOXA 3PXKA 4R5YA 5F1ZA 1PKDA 3NS9A 3RCDA 2CNQA 2R3LA 3C4XA 3F5PA 5DT4A 2PYWA 3ZUTA 4ANNA 4V0GB 5B2KA 1ZRZA 4AZVA 5IPJA 4E4LA 2BPMA 2H9VA 1YQJA 5HVKA 4EK6A 4PY1A 3EQHA 3OCSA 2HCKA 5D7AA 4FOCA 4C62A 2YITA 2QLUA 4HVSA 4GUEA 4QTEA 5AUXA 2IPXA 2LAVA 2PTKA 3HNGA 2F2CB 5CQWA 3ZC6A 4AOIA 4DBNA 2XNOA 3HDNA 4ANSA 4FVRA 4DH1A 2B9FA 3NGAA 4V05A 4BDDA 4D5HA 4H58A 2QI8A 4I0RA 3U87A 4RX7A 3V3VA 3R9RA 4DG0E 4N4SA 3DTWA 2FSLX 2Z8CA 4ALWA 3VN9A 1SVHA 2XK4A 4IBMA 3RPVA 3FBVA 5LVNA 4EOIA 3ENMA 4OW8A 4C2WA 2KULA 4ZS4A 3BLRA 3I81A 2O2UA 3OW3A 4FG7A 3CD3A 2JIUA 3A7HA 1GAGA 4W9XA 1STCE 4JX3A 5CZHA 1K9AA 2W1EA 3Q32A 4DEDA 4E6DA 3SHEA 2EB3A 2QQ7A 4EI4A 4I20A 4ZZNA 4GH2A 4I5PA 2WQMA 4OT6A 5HICA 3B2TA 3CR0A 3E3PA 5KKRB 3PIXA 3IDBA 2YJRA 4YZBA 5J87A 3UIUA 5H9BA 4J71A 5ANGA 4AZWA 4LFIA 2PZPA 1OITA 3D5UA 4UY9A 4AFJA 5ANDA 1GZ8A 4GT3A 5M09A 4FTOA 5EM7A 3E7VA 3ZSHA 5FWKK 4DDIA 5ANIA 5KNJA 5IQGA 2FA2A 4Z7HA 3G9LX 3U6IA 4RZVA 3D7TB 3POZA 2R3QA 4CMTA 5F9EA 3N9XA 1GOLA 1ZAOA 2YIYA 3OBGA 5AR8A 1TFFA 1VLRA 5HG7A 4JAJA 5HO8A 1H07A 3LFNA 5DGZA 2XMYA 4J7BA 1APME 4IADA 3DA6A 4BKYA 1A48A 3QTWA 4RIOA 3V51A 3U9NA 4BCPA 4DHZA 3BKBA 5E90A 3ZO4A 5KE0A 4CCBA 3BYMA 4FSTA 5TO8A 3RPRA 2XKDA 5ANKA 5EFQA 4A9RA 3FXZA 4O6LA 4MH7A 2C3LA 4XG8A 2I1MA 4QO9A 3WYXA 2VWWA 4I92A 4YTHA 2QU5A 4UN0C 2OFUA 3F7WA 1W98A 4B4LA 4Z9LA 3VQHA 4M69A 4QMMA 4S31A 4E6QA 5D1JA 1XO2B 4RIYB 2GSFA 4YNOA 4AZEA 2YJSA 2GPHA 3WF7A 3W10A 4E4XA 2WTKC 3MY1A 4B8LA 4O2PA 3HKOA 3D7TA 3CTQA 4EHEA 3HA6A 4I6HA 2PVLA 4L68A 4XBUA 2Q0NA 2WMTA 3LMGA 5HE3A 3V8WA 1TZDA 2RF9A 3TIZA 3A8WA 3R1SA 3OP5A 4C57A 3G5DA 4YSMA 5BMMA 3ZXTA 4YZNA 4IWOA 2ZB0A 4QD6A 2YN8A 2OICA 4I6LA 4M0ZA 4FKGA 2PVRA 3QXPA 2JAMA 4KSQA 3U6JA 2HXLA 2PSQA 4RJ6A 5D7VA 3ZONA 4CT2A 4DH3A 5HTIA 2C6KA 3GC9A 3ZFMA 3U4UA 3W0NA 5E91A 5KZIA 3S1HA 4X3FB 3OXZA 4YC6A 4ARKA 4TYJA 4FKVA 4NW6A 3BE2A 4YZMA 3UO6A 3KXXA 5FM2A 5FP5A 2FB8A 5K9IA 3ATTA 1VYZA 1R0EA 1PXMA 2X7OA 3HDMA 3NZ0A 4FZFB 4IAFA 3Q04A 4ZS0A 4ZJJA 3WYYA 4BGGA 5I0BA 2HZ4A 2QOIA 4QTCA 2PVFA 4FTTA 3CBLA 4XH6A 5L8KA 3DAKA 3F7ZA 3MIAA 3EKKA 4JLCA 1ST4A 5IKWA 2XM8A 3FZSA 2B4SB 3LJ0A 1KE6A 3KIOC 4MQ1A 4PMPA 1PMNA 2WEIA 2WQBA 4H36A 3BHVA 4K0YA 3EYHA 2VD5A 3KL8A 2XS0A 4CQEA 1U54A 2WGJA 4UMUA 5KHXA 4O4FA 2RFEA 4A9TA 4BCMA 3GVUA 4MBJA 3QRIA 4MUQA 3LQ5A 4EWHA 3AKKA 3ZM9A 4YHFA 5EG3A 4E8AA 4U7ZA 3K3IA 2CN8A 2X8IA 4K18A 3FC1X 5I5ZA 2OBJA 2GNGA 4O96A 3QXOA 3V8SA 2YIQA 4QP2A 3R28A 2WTWA 1YKRA 1YW2A 4U45A 4P5QA 5HBHA 2CKQA 4YU2A 2JGZA 3M1SA 4USFA 2XYUA 5CVFA 4ZSJA 3PVUA 5I9ZA 3UO5A 2YLFA 1FGKA 3GP0A 1XH5A 3ZYAA 4E93A 2DWBA 4AOTA 3F2RA 3I5ZA 4ZSLA 4J97A 3BL9A 1SM2A 2AC3A 2VTIA 2WMSA 1QPCA 4HOKA 4S2ZA 4AAAA 3PJCA 3PG3A 1EH4A 3HV5A 4L8MA 2ETMA 5EM6A 5LVLA 4F7LA 3ZTXA 4JXFA 3T3VA 3OOMA 5DRDA 2IJMA 4AW1A 4RG0A 1OBGA 5AUWA 5AR3A 1H1RA 4QP3A 4CFMA 2H6DA 4F7NA 3P7CA 5ITAA 4KKEA 4LOPA 4G31A 2XCKA 3BGQA 4TYEA 3DZOA 4ASZA 3EWHA 3KCFA 5IUGA 3E93A 3RALA 3RHXA 4AXAA 1NW1A 2PL0A 4E7WA 3QL8A 4Q5HA 1IA9A 2W9FB 4TNBA 3LVPA 4IC7A 4R8QA 5HG8A 5CNOA 4O86A 4GKHA 2O8YA 2NNWB 3MVJA 2BRMA 4FUYA 4JAIA 2GS7A 5DNRA 4D2RA 3AKLA 4FR4A 5K3YA 2OO8X 3IECA 4U3YA 3UMXA 4KIPA 4JDHA 1SMHA 4C58A 2W5BA 4HCTA 2WIHA 1UVRA 3I60A 4U41A 2ZMDA 3VJOA 4CLIA 4HVHA 4O6EA 4EJ7A 3Q3BA 2PMLX 4O38A 4X21A 5JSMA 3QA0A 2WMXA 5AR2A 3OT3A 3H10A 4L43A 5DWRA 4ACGA 2YA9A 1BL7A 3THBA 4GVJA 3NW6A 3ZBFA 1X8BA 3NYXA 1YVJA 4YC8A 5HI2A 4FEVA 3A7GA 4NT4A 2V0DA 1U5QA 4I21A 4N70A 4KRDA 2IW8A 4KAOA 4MQ2A 2R3GA 5LVOA 1GY3A 3QUDA 5ETIA 4GT4A 3ORXA 5L8JA 4AG8A 5AWMA 3FZTA 4AZSA 1YWRA 3FMEA 4Q9ZA 3RCJA 4XV2A 2IW6A 4NU1A 3HMNA 4F64A 4AE6A 4NEUA 4AZTA 5GNKA 2PY3A 5DR6A 1GZOA 1Q61A 1YXVA 2OIDA 4FTKA 4Y73A 3HECA 4EH7A 5HG5A 4FGRA 4PPBA 4AACA 4M97A 4EHZA 3I7CA 3UJGA 3L9MA 4LMUA 5AP6A 1LPUA