4EKKA

Akt1 with amp-pnp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
334
structure length
318
Chain Sequence
RVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMISERRPHFPQFDYSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title An ATP-Site On-Off Switch That Restricts Phosphatase Accessibility of Akt.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 318
sequence length 334
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ekkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ekkA01
4EC8A 3NX8A 3R8LA 3RAHA 4PNKA 3FI3A 5ITAA 4R78A 1BL6A 1YDRE 4U3ZA 3P7AA 4EQCA 3QZIA 5CVHA 5H2UA 3TV7A 3NYOA 4FICA 2J0LA 1PXPA 4PDPA 3AMYA 5BYYA 3IECA 1VYZA 4W9XA 4BDBA 3SG8A 4W9WA 3RPSA 1XBAA 5DN3A 1R39A 2C6LA 4LUEA 3NPCA 3OTUA 4QTDA 2BTRA 2CNUA 2P55A 2BIKB 3AOXA 1OPKA 4NTSA 4UZDA 3VWAA 3V8SA 2Y7JA 2C0OA 4I6QA 2DS1A 2YCRA 5D7VA 5GZAA 4WSQA 2CNVA 4IWPA 1PXMA 3AD4A 5CNOA 3TUDA 4F1MA 3T3UA 1OM1A 4ERWA 4CRSA 4N6ZA 3REPA 3PRFA 4EOKA 3U9NA 4LGHA 2PY3A 1IEPA 1UU3A 5LVOA 3I6UA 4DGNA 2AC5A 4D4RA 4J8MA 3FXWA 3GEQA 4BGQA 1Q24A 3VS0A 4YJQA 5M09A 4GW8A 3QHRA 4FI1A 4I94A 3SGCA 4LRMA 3MY1A 5KHWA 5M44A 3IW4A 1YHVA 3P9JA 4Y46A 5E92A 4I4EA 4PV0A 2WMSA 2C6KA 4TY1A 1FBNA 2UZVA 3KA0A 2VX1A 4BFMA 2IVVA 3IG7A 4J53A 3C0IA 4PTGA 5AUXA 4H58A 1F5QA 2F49A 4H1JA 4IAYA 4QMUA 5DA3A 4BDAA 1IAJA 3MIAA 4IX3A 3P5KA 4D2TA 4CVAA 3TCPA 1DI9A 4U6RA 5D10A 3LVPA 4PY1A 3ZH8A 3AMBA 5I4NA 2PMLX 2QC6A 4I23A 4LUDA 5E8VA 4F6SA 2GSFA 2OO8X 3W32A 5HQ0A 5JN2A 4KBCA 3AD5A 4UYNA 4LG4A 4YGAA 4EH7A 1H27A 4CZTA 1OL7A 4KUJA 3QCYA 4FSRA 4EJNA 1PRYA 3HUBA 1YHSA 3NW6A 2UW7A 1YI3A 4AZFA 5K0KA 3GENA 2PTKA 4AZTA 5KNJA 3F69A 3HRBA 3KY2A 2RF9A 4EORA 2WOTA 5D12A 2KULA 5J1WA 2BRBA 4RPVA 4TXCA 1VJYA 3RKBA 4FMQA 3ZSIA 2RFNA 4MXYA 3SRVB 3NAYA 4U41A 1V1KA 3D5WA 3D83A 3NNWA 3DPKA 3QCQA 3LMHA 3MFSA 4ERKA 2IWIA 2PVRA 4O7YA 4XNEA 3QKKA 4TYJA 4O2ZA 5FXRA 2UZUE 5DBXA 1ZOHA 3E92A 3GGFA 3PXZA 4FK3A 3MJ1A 2R3FA 5DT3A 4WHZA 5A4QA 2W4OA 3HUCA 4RJ5A 3GNIB 4FL2A 2Y8OA 3BKBA 2YIRA 3E88A 3FI8A 5J87A 3TACA 2BAJA 5E4HA 4BKZA 2OLCA 4UY9A 5HLPA 4ZTSA 4G34A 4QQCA 2F57A 3VUMA 2YDIA 5EYDA 1REKA 1URWA 5FP6A 3KRRA 4QTBA 3U6IA 4NTTA 1WMKA 5EHOA 3U6HA 3DJ5A 4O91A 4RFZA 3VF9A 4ZLYA 4YP8A 1GIIA 3DTWA 1FMKA 2RL5A 3BHTA 3EB0A 4QPAA 3MTLA 3QQLA 2PUIA 1PF8A 2IG7A 4IM2A 1GNGA 1H1SA 3SDJA 2JDTA 3F2AA 4L00A 3ZONA 4DAWA 2J0JA 5D7AA 4LRKA 5J9ZA 3U9CA 5ACKA 4WBOA 3MFUA 3R7GA 4EZ7A 2X6DA 2H9VA 2P2HA 3FZOA 3ORMA 5CVFA 3FLZA 4IWDA 4HPUE 5LVMA 3ZFXA 4OTPA 4IZ7A 5CQWA 2ERKA 3QRUA 3DKFA 3E93A 2YM7A 4ASDA 1CM8A 4YZDA 2R2PA 3ZRKA 3DXQA 4YJRA 4X2KA 4BDFA 4RIWA 5AP1A 4E4MA 5AP2A 2GQRA 2B9HA 2YZLA 4IIRA 3D7TB 3DLZA 4O22A 1YI4A 1XBCA 3FYKX 2E2BA 5HBJA 2Q0BA 3G6HA 3I5NA 4GT4A 4AW5A 4AA4A 4FGRA 4EQMA 1DS5A 1OUYA 2QOLA 4DG2E 3E8EA 4E4LA 2GHGA 4LMUA 4NKAA 3RTPA 4F7LA 3G9LX 2ZJWA 5BUEA 4JBPA 3NUPA 3TZ7A 3H0YA 3S4QA 2A1AB 3R7IA 3TG1A 3E8DA 5LJJA 4C38A 3OC1A 4ZS4A 4IE9A 2ZMCA 3HKOA 4A7CA 2CSNA 2WQMA 4I6BA 4KBAA 4YC6A 5LWNA 4BC6A 2HWOA 2QI8A 5IH4A 4DEEA 2QHNA 4IVCA 4KNBA 1RDQE 5C4KA 4NSTA 3NUXA 4FEQA 4EONA 4CFXA 5CXHA 1R3CA 3QTUA 1JKSA 2UW3A 3DFAA 3WE8A 1OVEA 2QD9A 4G17A 2IO6A 3RWQA 4QP4A 2V5QA 3KRLA 3G15A 4K0YA 1PKDA 2Z7QA 3NYVA 3LCOA 1JSVA 4DG0E 4E93A 3WIKA 4APPA 4KIOA 4CCUA 4EK5A 3L8VA 4ZZMA 4J52A 3R00A 4XX9A 5FEEA 2OGVA 3TZ9A 3R22A 1NVQA 3ZUVA 1OZ1A 4YBKA 3ZSGA 4BGGA 3KFAA 3NUYA 4L3PA 4U9AA 3UOKA 3GT8A 4TNDA 3WZEA 4PL5A 4AU8A 3D5UA 5HIDA 3M1SA 4L44A 4X3JA 3K3IA 3FV8A 4ZMEA 3V6RA 4X2JA 2CCIA 4WNOA 1Y8GA 1Y57A 4YJTA 4F9CA 2XBAA 5L6WL 3EQDA 5A3XA 2UW4A 4DLJA 3UDBA 3ORLA 4LQMA 3A7GA 1PYXA 2PMNX 3BLQA 4GSBA 2W0JA 3IW5A 4Q2AA 5AA9A 4P5ZA 5E9EA 3QBNA 2ESMA 2WEVA 4X6QC 3RPYA 1FMOE 2BZKB 4YO6A 2R5TA 3UYSA 3RINA 3PUPA 2NRUA 1YXTA 3FUPA 4P2KA 3IGGA 3TNIA 4EOQA 4AXAA 1ZMVA 5CU2A 3QL8A 5CEKA 3FQSA 3V8WA 3EOCA 3KRWA 4MQ2A 2PZYA 3P1AA 5AM6A 5HO6A 2CMWA 3HRFA 4NJ3A 3UODA 5L4QA 5CS6A 3ZUTA 5FEQA 3EN4A 4MWIA 3H9OA 1JSTA 4FOCA 3P4KA 1PHKA 3I6WA 4JXFA 4XP0A 4UN0C 2XIZA 3LFBA 2DWBA 4RJ4A 4Q9ZA 3OWKA 3MTFA 1KOAA 1OIRA 4F1TA 4O0YA 4C37A 5CSPA 4B6LA 4AN9A 4ALVA 4RLLA 5KMLA 3GXLA 4JS8A 4HNFA 4IMYA 2XVDA 4JRNA 2OKRA 4A9TA 4IX5A 4NEUA 4FT3A 4LMNA 3NRMA 2UZLA 3O7LB 5DPVA 4AF3A 5TT7A 1Z5MA 3VQUA 5IQBA 3NGAA 5AJQA 3VS3A 2OG8A 3ROYA 1H08A 3PJ1A 2XA4A 4RX5A 4IVAA 3FE3A 4OUCA 4WRGA 3EQIA 1A06A 4M0ZA 3RPRA 2WKMA 1YOJA 1U59A 4BDHA 2C3IB 5TKDA 3FMLA 2AC3A 3SHEA 1YXXA 3TZ8A 3EL7A 3GC8A 3KMMA 2WTWA 5CU6A 3OZ6A 5FDXA 3TDVA 5ACBC 3FMNA 4RFMA 3QTRA 3UC3A 5KBRA 4UXLA 4FVPA 4DN5A 4IW0A 3PWYA 3W2SA 3LKMA 2BZIB 4KD1A 2BZJA 4FSTA 4QTAA 3DGKA 5IQGA 4C34A 3HV5A 4AGCA 3WF5A 3PVWA 4JIKA 4FSUA 4JDJA 5HIEA 4YC8A 4G6LA 3SOCA 3GP0A 1VZOA 2OJ9A 3OS3A 5E8WA 5DYJA 3JY0A 1JWHA 1NA7A 3LCKA 5AV1A 2RFDA 3FMEA 1Q8TA 4CFNA 4D4YA 2FVDA 4YPDA 1Y91A 2XCKA 4OBOA 2UZEA 2F9GA 1M52A 4M15A 3TM0A 4NFMA 4ZJVA 5IEVA 4BF2A 2OF2A 5CX9A 4IAFA 2VUWA 1O9UA 2WXVA 2GTNA 3MH3A 4FTAA 4XG6A 2ERZE 4FV3A 4TYGA 4H36A 1YW2A 3SXSA 3VAPA 5JZJA 4HVGA 3FMDA 3A8XA 4GU6A 3W55A 3Q5IA 2CKQA 2R3GA 1M14A 1PXOA 4XV1A 4C7TA 3I60A 5GINE 3OY1A 3PIYA 4RG0A 5HICA 4L8MA 3ZBXA 2JLDA 5CXZA 5FTGA 3P7CA 3V6SA 1NY3A 4CGAA 5EI6A 3BI6A 3R9HA 4KS7A 3WBLA 5J9LA 5BVWA 4OLIA 3BIZA 4HOKA 4GUEA 3EYGA 5D9HA 2HIWA 5HE3A 4YZMA 1KWPA 3Q96A 3I7BA 1LPUA 5GJGA 4DYMA 3IDPA 1KE9A 3HV6A 3CTHA 2EXEA 4FTMA 3MJ2A 4USDA 1GZKA 4YSMA 4ZTNA 4S34A 3SX9A 3GI3A 4RIOA 2E9PA 5IEYA 3GOKA 3N4TA 4AT3A 4YNOA 5HO7A 4LFIA 1CKJA 3LCSA 4ZZOA 4Z9LA 4YJUA 4BDDA 5AUVA 4CEGA 4KKHA 4I3ZA 4KIKB 3UBDA 3VUDA 3MV5A 4FG8A 5I9YA 2HY0A 5KBQA 1JBPE 3CQUA 2YM3A 4EHVA 4BDIA 1XO2B 3O71A 4F0IA 1ZYLA 3Q4ZA 3TV4A 5DRDA 4Z7HA 5C9CA 3BLHA 3BHUA 3LPBA 5EYMA 4BHZA 3W8QA 5D11A 3ZBFA 2XNMA 3KXXA 3RK7A 3C5IA 4FZAB 4RZVA 4PMPA 4BCQA 5AADA 2OU7A 2VU3A 2XRWA 5EM7A 3DBQA 4MBJA 1YWRA 3F9NA 2YCQA 3GUBA 4A9RA 4JR3A 4E20A 2VWUA 3DS6A 2DQ7X 5FXQA 2ETRA 4X21A 4XG2A 3HAVA 4FEVA 4RVLA 2QO7A 5AR3A 3I5ZA 4G6NA 1JKLA 3OW4A 3MWUA 4XV2A 4U43A 3N4VA 2UW0A 4EZ3A 4PTCA 3W2CA 2YACA 3BV2A 5K4JA 1WVXA 3NCZA 4OT6A 5G1XA 2XP2A 1RE8A 4FZDB 1SVGA 4IVBA 4W4YA 1TQIA 5F20A 3OMVA 2JDRA 3LM5A 2R0UA 3OUKA 3K2LA 2ONLC 2XRUA 1MUOA 1YDSE 4XYFA 4QMQA 4QMTA 4CKIA 4TYHB 2R3HA 3RP9A 4FEWA 3L9PA 1UNGA 4AGWA 3GCUA 3OT3A 3PSDA 4OTQA 1JSUA 3VBXA 4GIHA 2O2UA 3DQWA 4FIHA 1TKIA 4MF1A 4NJDA 3HLLA 5BMMA 2GQGA 3MI9A 5F9EA 4CCBA 5IA0A 3R83A 2HZ4A 2JDSA 3W18A 5AUWA 1UU9A 1OPLA 2VWIA 2HZNA 4DFXE 2CKPA 4EH3A 4NCTA 4TZRA 4MKCA 3E8CA 1OIYA 1OKWA 4F4PA 2OZOA 4C4GA 3OWLA 4FTJA 3NNUA 4AFEA 3LIJA 3KGAA 4M14A 5DRBA 1Q8UA 5ANOA 3DQXA 3ZS5A 4XH6A 4XG3A 4QT1A 3D7TA 4FIFA 2PZ5A 4ASXA 5HG8A 5KX8A 2O65A 3RAWA 3CEKA 3D5VA 5HORA 2G01A 2VTTA 3K5VA 2ITOA 4XP2A 4BDEA 2B7AA 1U5RA 2XIXA 3ZZEA 4H1MA 4JQEA 1ZYSA 4XS2A 3LE6A 3FC2A 3CCNA 1HOWA 2P3GX 1OI9A 3IOKA 3PYYA 4FNYA 5FLFA 5EOLA 4GS6A 2CN8A 5CAVA 3QUEA 2VO7A 5IA4A 3D0EA 3ORZA 3OOMA 4FG7A 4HJOA 4WD5A 4G31A 2VX0A 4WNPA 4CKJA 4JX7A 3ANQA 3F88A 4BY9E 3WOWA 1RW8A 4BZNA 3KF4A 2W4JA 5BX0A 4NM7A 3VBWA 4YSJA 2PMOX 4N6YA 3UPXA 2HXLA 3UIMA 4O7LA 1M2PA 2PK9A 4FTIA 4QMOA 2PUNA 3EMGA 4R5SA 3VO3A 2WFYA 2O0UA 2GNJA 1WVYA 5AR5A 2OWBA 2HW7A 4JDKA 2CHLA 3HL7A 4FSMA 4RVTA 2VZ6A 1PMUA 5CALA 4FR4A 5AIKA 4W8DA 4YTFA 3OCSA 2WGJA 3I7CA 3PVBA 3SKCA 1WBSA 2I0YA 4IHPA 4RIWB 3RCJA 3C5UA 3ZLXA 1ZMWA 3GVUA 4OBPA 3BWFA 2UW5A 3ODYX 2YZAA 3PE2A 2JFLA 1GJOA 3BYVA 4K33A 3EQFA 1YOLA 3SW4A 5J1VA 4ZIMA 2QCSA 4FSWA 3R1NA 2VTHA 3FZSA 3CR0A 1VEBA 4ORKA 3DBEA 4ZOGA 5IQDA 3WYYA 5EHLA 3C50A 3VS2A 5T3QA 4QP9A 5ETIA 1BX6A 4FSQA 3KN6A 4EK6A 3C4WA 1ZY5A 5CT0A 5HE1A 4F7JA 4FIIA 3CJGA 3DZQA 2PPQA 4MTAA 3FWQA 4EH2A 4C33A 4YZBA 4CRLA 5HGIA 4BCOA 4BTKA 4F65A 3NWWA 2C0TA 1AD5A 2A19B 4I5PA 4YJOA 5L2IA 4JIAA 2R9SA 3HMIA 4WKQA 2BDWA 3FL5A 2YISA 4XUFA 4BVUA 3NYXA 4G1WA 4PX6A 4G5PA 3VIDA 2B9JA 2WQNA 2XB7A 4BCPA 3R02A 5JQ5A 5D1JA 5KKRB 5KZIA 4FKVA 1YRPA 3EHAA 3DOGA 1QCFA 2WMQA 2XIKA 3COHA 3OVVA 3R2YA 5M56A 4D5HA 5AX3A 5LVPA 3EN5A 3Q60A 1PY5A 3NMUF 1W83A 3D94A 3HP5A 4FTRA 4X3FB 1PYEA 4RIYB 3ZM4A 2X7GA 2XNOA 4R3PA 3EQGA 2X1NA 3VHKA 1H0WA 2PSQA 2R4BA 2YDKA 5C8KA 2VTLA 4CYJA 2GS2A 4DH5A 3K5UA 4U42A 3DJ7A 5A46A 4X7QA 3O51A 4TL0A 2J90A 4AUAA 3MS9A 4F9BA 4A9YA 5HIBA 4G3CA 3DY7A 3C13A 4AQCA 2V62A 4EYMA 2WTVA 4QP1A 3FPQA 4D4SA 1Q62A 2OF4A 2VNYA 1BKXA 3LMGA 5CSXA 3WZUA 4FEXA 4O7VA 3HEGA 3BHHA 3CS9A 3MH2A 3DB6A 5CTPA 4TYEA 3BBWA 4QQ5A 5E8XA 4D2RA 4KRCA 4FV2A 4RBLA 1UNLA 3POOA 1MRVA 3QQJA 4RIXB 2VN9A 2YLFA 5FP5A 5T6KA 4BZDA 4JQ7A 2QOBA 4PTEA 1YHWA 5EG3A 4GG5A 5HD4A 3IONA 3F3UA 3OEZA 4FKLA 2Y9QA 4KWPA 3BQRA 5K3YA 3ZCLA 5JQ8A 3RWPA 2QLQA 3W2PA 4I41A 3BE2A 3AC3A 4C35A 5JFXA 2OJGA 2WB8A 4HYSA 4L46A 4FV1A 3T9TA 3LW0A 3RGFA 1V0OA 2HZIA 5DGZA 3ZUUA 5EKNA 3V5JA 3LFSA 3NW5A 3OWJA 1KUTA 1CKIA 2LAVA 3ZXTA 2BAKA 2IJMA 4V04A 5KMOA 4AOJA 4CNHA 5EYKA 4D0XA 2BMCA 4JDHA 4Y85A 3PJ8A 4FKQA 4X0MA 2V55A 5HE2A 1WBOA 4L43A 5TO8A 3BBTB 5IA3A 3ID6C 4IB1A 1FVVA 3QQKA 1U54B 2ZB0A 5K9IA 3AC8A 5JKGA 4AG8A 4Z7GA 4R3CA 1MRUA 3FMMA 3GB2A 4U79A 2C6EA 3PPJA 2WMXA 4DEDA 3HGKA 4TPTA 5LCKA 1DAYA 4KIPA 5C1QB 4MQ1A 4EHZA 4ZSAA 4W8EA 1UKIA 4O0XA 3FPMA 4RMZA 4DH1A 4F7SA 4FYNA 4O7TA 2YCSA 3R8UA 5AIRA 3QZFA 3QGYA 4IWQA 3KXMA 4NUSA 2Z02A 2FYSA 4RZWA 3WF7A 3EN6A 4D55A 1JNKA 4O86A 4A07A 3GFWA 2Z8CA 3QYWA 2WTJA 3RAKA 4JBVA 4W4VA 5EW8A 4MYGA 2HAKA 4A9SA 1H1RA 1YVJA 5BVOA 2JAMA 4KIKA 2PE1A 3DK6A 1J7IA 3IW8A 3LHJA 2OXDA 4D58A 3TI1A 4C4HA 4CMUA 5FBOA 3UOJA 1MQBA 1Q8ZA 2XJ1A 3QTIA 4M0YA 4Y95A 2PVLA 4U3YA 4YHFA 4CMTA 3I81A 5A4TA 5DHJA 2XS0A 5EI2A 3GCVA 2B0QA 4MXXA 2CKOA 3QTSA 4F63A 5DMZA 2RFSA 1PJKA 2QR8A 4FTKA 2WOUA 4M3QA 4UMUA 5H8EA 1WBPA 3SV0A 1QPDA 4RWLA 2UV2A 4O7RA 4ZTQA 2QONA 3G5DA 5CENA 4UYAA 5A6NA 4RJ6A 1G5SA 3TUBA 1Y6BA 4Y72A 4C57A 3P78A 2IZTA 4FVRA 4CFVA 4RWKA 4IB5A 3NEWA 3JR1A 4ZLZA 3Q9YA 2YITA 3G33A 4YLJA 4FTOA 4Y5QA 2DUVA 3PSBA 1G8SA 3R8ZA 5CT7A 2A27A 2J5EA 5HCYA 4G2FA 2X6EA 3V5PA 5L2TA 3CC6A 3TV6A 4ZSGA 4ANBA 2BZHB 4F6UA 2F7XE 3SA0A 5IU2A 4WA9A 4G3EA 4RFYA 3LJ1A 2J51A 3RMFA 3PSCA 3PWDA 1W82A 5F95A 3TTJA 2C47A 2R64A 2PMIA 5BVNA 4ZK5A 4FUYA 3PIZA 4GJ3A 4J8NA 4L52A 5EW3A 4YMJA 3R1SA 5TOZA 3AQVA 4OTGA 3D9VA 3MY0A 4FTNA 4TYHA 2WMAA 4ZY4A 4USEA 4E6QA 5E8TA 1H01A 2GU8A 2IZUA 3Q6UA 3F61A 3P0MA 5BVFA 4F99A 3ZM9A 3E63A 2B52A 4IAZA 4F9YA 3S1HA 3G90X 1NXKA 1QPJA 1ATPE 2YM6A 4MHAA 4DFNA 3TIYA 4U80A 1E9HA 5FEDA 5M57A 1ZYCA 4BHNA 4M84A 3U55A 2ITTA 3KCKA 3EQBA 3GU8A 5LMKC 3FZTA 2VRXA 3P79A 4QPMA 3UO5A 3KREA 3F5XA 4GVJA 5KHXA 4ACCA 1R1WA 2VTQA 3QQHA 1UKHA 3DNEA 4HYUA 4H3PA 3GQLA 4DA5A 2XMYA 1ZMUA 2OW3A 4HNIA 4GKHA 5E8ZA 3NNXA 1M2QA 5DEYA 2IW6A 4QRCA 5CZHA 4AP7A 4AW2A 3FMHA 5JGDA 3LM0A 2C6TA 2YM8A 3RPVA 3TJCA 3R7YA 2ITNA 3FJQE 4HW7A 4CQGA 4EOMA 4BBEA 3DK7A 4EOOA 3K54A 2EB2A 2X8EA 3ZDUA 3QD3A 3H30A 4I20A 3ZTXA 4C59A 2NNWB 1XWSA 1GZNA 3UPZA 3JY9A 3O96A 4CZYB 5CWZA 4RJ7A 1ZZ2A 3KXZA 5FTOA 4EWQA 4YLKA 2C6DA 2YJRA 4MNFA 4NCTC 4TTHB 3KULB 1KE7A 5IKWA 3QHWA 3BX5A 4EOPA 4WNMA 3PDTA 1SYKA 1Q97A 2G1TA 4YTCA 2XBJA 3W2QA 5F1ZA 2CGWA 2W1IA 3E8NA 5CI6A 1IRKA 2PVMA 3RVGA 2A2AA 1G3NA 3OW3A 4BKYA 2PVJA 1ZZLA 3PXQA 4GIIA 5M51A 3WF9A 5AP5A 4RJ8A 4QYFA 5D41A 3B2TA 4PPBA 1GIJA 3EKKA 1YXSA 3R21A 4YJNA 4GK4A 5FTQA 4BGHA 3QKLA 4TWNA 3ALNA 3LMIA 3CXWA 3R7VA 4F08A 2X8DA 4IX6A 1ZYJA 4JNWA 4LOQA 3UIBA 4ZMFA 5A54A 4CFFA 3NDMA 5HG9A 4EZ5A 4E73A 3SD0A 3VUIA 4BR3A 2H8HA 3NSZA 4NH1A 5AP6A 4XP3A 2WTDA 2OJJA 2UZNA 3PRIA 5EM6A 3FHRA 4HZRA 4YHJA 5B0XA 3HP2A 2O64A 4FEUA 3R8PA 4TWOA 3COIA 1GY3A 4KKEA 5CLPA 4JG7A 3HDMA 1SNXA 4CTCA 3BYSA 3DU8A 3TNPC 3A62A 1SM2A 3CKWA 3LAUA 4K1BA 4BBMA 4NU1A 4BIBA 3BYUA 2QOCA 4D1SA 5JFSA 3SOAA 4QNYA 3WILA 3W33A 3IS5A 4Q5HA 3GC9A 3SXFA 1SZMA 3F3VA 2WEIA 3PA4A 3MH0A 5CZIA 5HU9A 2GPHA 5GIPE 2E9VA 4CD0A 2C5NA 5KE0A 3FLSA 3C4XA 5DNRA 2BAQA 4GH2A 4ID7A 2WNTA 3F3WA 4M66A 2HENA 1WCCA 3GQIA 1H8FA 2JDVA 2V7AA 3ZEPA 4G6OA 4L01A 3M11A 5IQCA 3QUPA 3TEIA 4IEBA 2C69A 5BVDA 3A7IA 1YXVA 4NM0A 3NNVA 4EHGA 4PL4A 4TW9A 3Q04A 5E91A 3F5PA 1Z57A 5HNBA 3PLSA 4CFWA 4QP2A 4QTEA 4X3FA 4RLKA 5LVNA 2GTMA 4FSYA 4RIYA 4BB4A 5LCJA 2WAJA 2J9MA 3VRYA 1HCLA 4AT5A 5AV2A 4B8LA 5BUIA 2YAKA 3TIZA 3FLYA 4G3FA 5EM5A 4DEHA 3SQQA 2O8YA 3CPCA 4AFJA 1O6KA 2PUPA 3F3TA 3ZLWA 5DFPA 1FQ1B 2QU5A 3V01A 2IPXA 4JAIA 3AT2A 2HWPA 4NW6A 3QXPA 4KRDA 4ENYA 3B8RA 4ONAA 2W1HA 3MFTA 2ETKA 3MESA 4YU2A 3KU2A 3UO6A 3R63A 2C5XA 1XH9A 2YIXA 4DGMA 3ACKA 1GAGA 3TUCA 5DR9A 4UWBA 3TKHA 1H1PA 4O7SA 3G0EA 3RK5A 3PXYA 3GC7A 4GEOA 3MPAA 4RIXA 3U51A 3VUHA 4ASZA 4GUBA 3QCXA 3DXPA 3WARA 3QA8A 5FM3A 1ZLTA 2NP8A 2I40A 3VF8A 3ATSA 4O0SA 3IQ7A 5AR7A 4XV3A 4FKPA 3CD8A 2WTCA 4GG7A 4KB8A 4X2GA 2W7XA 3R01A 1PXNA 4AGDA 2XZSA 2YA9A 5C27A 5HTIA 4I5CA 2XNNA 3UQFA 2C5VA 3EQRA 2C3JA 2BKKA 1FOTA 4FV7A 4II5A 5CAUA 2CCHA 2FB8A 4V0GB 1WFCA 1Q5KA 2GHMA 4I5MA 2VGPA 4CXAA 4E5AX 2Y4IC 3DXNA 2G15A 3A2CA 2EU9A 4PNIA 3DKOA 3NR9A 4QNAA 4QYHA 3ZFYA 3VQHA 4K9YA 4L3JA 4OBQA 4ALUA 5FDPA 4Q9SA 2ZDUA 4UEUA 2F4JA 4BTMA 3KC3A 3F7ZA 2NO3A 2QO2A 5C8NA 2HELA 1U54A 3VUGA 3AC2A 2IN6A 2IW9A 5C4LA 2VTNA 3GOPA 5HCZA 1PW2A 2FSMX 4MXCA 3EFLA 3DDPA 4UB7A 2AYPA 2HW6A 4EWHA 5HTBA 4ZZNA 1T46A 1XJDA 4USFA 4R7BA 5BNJA 3EKNA 5I5ZA 4AA0A 4XLVA 3JS2A 5DVRA 3Q2JA 4J99A 4DCAA 3V5QA 4G3DA 3EFWA 1TQMA 4U7ZA 3GBZA 2GNGA 4GRBA 2WPAA 4H3BA 4F9WA 3BYOA 2ITQA 4IZYA 4RX9A 5ANIA 2R3NA 4RQVA 5HBHA 4DGOA 1XH6A 4I22A 2ZYBA 3ERKA 4NZWB 4E6DA 3L8SA 5LQFA 3QQFA 5AP4A 4ANNA 1BI8A 3LJ0A 4FOBA 4QQJA 2YHVA 4R7HA 4RVMA 5GZ8A 1R0EA 2WTKC 5FXSA 3KK8A 3LQ5A 4GT3A 2JKQA 2ZV2A 3P7BA 3BRBA 3OCGA 4KBKA 2XNPA 4O6EA 3LFDA 4X2NA 2FSOX 3JVRA 5AP3A 3FI4A 5AR4A 5IDPA 2YN8A 3QRTA 3MB6A 4O1PA 3OY3A 3CQWA 3UMXA 5JRSA 4BYIA 4DF3A 4DT9A 4FKUA 1FGKA 1XH5A 1BMKA 4I92A 5H8BA 2BALA 2JC6A 3FY2A 4YC3A 3A8WA 3TXOA 1UNHA 2YABA 5KMIA 4FL3A 2DYLA 5AUTA 2PVFA 3OF0A 4EH5A 5C26A 4O7NA 3VS1A 3VS7A 4XBUA 5CNNA 4D2PA 4DG3E 5L3AA 1FGIA 1UU7A 1H28A 3UZTA 2ETMA 4HCUA 4K11A 4A4OA 1IAHA 2PULA 2V7OA 2W1EA 4MXOA 3PXKA 4GYIA 4WUAA 4ENXA 4RA4A 3W16A 4M68A 3MBLA 3THBA 1WAKA 4PP9A 2J5FA 4FSZA 3W8LA 3E64A 4FSNA 5E90A 3V5LA 5GHVA 4FTUA 2W05A 3UP7A 3OHTA 5IH6A 4MD9E 2UW6A 5JEBA 2CGXA 2XUUA 2P0CA 3I1AA 2HK5A 3PA5A 3MSSA 4ZLOA 2W99B 1VR2A 2ITUA 1H1WA 4UBAA 1K3AA 4BDKA 4LOOA 3CY3A 4F7NA 5A4CA 2IZSA 3DFCB 2FA2A 2ZMDA 3EWHA 3QQUA 1GIHA 4S30A 4U8ZA 4LRJA 3COKA 5IUIA 4AN2A 3JPVA 2OFUA 4O0WA 4LL0A 5CEMA 2ZVAA 2QKRA 3H3CA 5HLWA 3FHIA 3QC9A 3LZBA 2XIRA 5IISA 2X9FA 2C0IA 3IO7A 2W1CA 2J7TA 2QOHA 1DI8A 2I0HA 2Z60A 3C4CA 4AZSA 4L3LA 3HV7A 3NIZA 3IW7A 4FK6A 3UNZA 2W06A 4HYIA 5DWRA 4OR5A 3IGOA 4PDSA 3W1FA 3ZXZA 5IA2A 4MXZA 3RM7A 3VN9A 4I6HA 3UQCA 2WMUA 2X2LA 4NT4A 4FC0A 5IDNA 2IVTA 4LOPA 3C51A 3RZFA 3FMJA 5HLNA 5HOAA 3MDYA 2Q0NA 4CZUA 3F7WA 3VJNA 3RALA 2RSVA 4JI9A 2EVAA 4U5JA 1J1BA 5BVEA 5JFVA 2Z7LA 3ZO4A 2ZV7A 5DG5A 2ZOQA 3FQHA 1M2RA 2WU6A 4BRXA 4Z3VA 4R77A 3EQHA 1IASA 2OK1A 4WSYA 3ZEWA 4EL9A 4OAUC 2HZ0A 4BWPA 3HVCA 4KS8A 3ITZA 3OTVA 5LVLA 3W2OA 4AZWA 2BIYA 4EK3A 5JGBA 4FF8A 2W9ZB 4FODA 1S9JA 5TR6A 1B6CB 4IAAA 4Y73A 1I09A 4RX8A 4F09A 2QOIA 3KF7A 4I0RA 2ITYA 4C3FA 5J9YA 4FVQA 4ITHA 5DR2A 3M42A 2AUHA 2VTOA 4C8BA 4AT4A 2YCFA 3KULA 2OZAB 3BEGA 4GFMA 3R9NA 3AC1A 3ZLSA 2HYYA 5A4LA 4BTJA 5IEXA 4CFUA 3EZRA 2O5KA 2PHKA 4I24A 2P33A 2I0EA 4BCKA 4W4WA 2ZM3A 4O7WA 4NM3A 3PXRA 5TF9A 3LCDA 3OBGA 4QMZA 2OH4A 3VBTA 2C4GA 5F4NA 5H3QA 3UVPA 4FV0A 1MQ4A 3ORPA 4DTBA 2OJIA 5FUTA 3KRXA 4U44A 3Q6WA 4CTBA 2B1PA 3FMKA 1MP8A 3BWJA 3PZHA 4Y5HA 5AUUA 5EDPA 4R1VA 1GZ8A 3HX4A 4U40A 4C3PA 5IG1A 4DFYA 3VRZA 4IAKA 1A48A 1H07A 3IW6A 2UVXA 2WD1A 4E4XA 4D2SA 4DGLC 2H96A 4UMTA 4C2WA 5ANKA 3ROCA 2VTRA 4ZXTA 3A4OX 4O1OA 3ZSHA 4DH8A 1LEZA 4YZNA 4PL3A 5M07A 4YBJA 1GOLA 1URCA 5AUZA 5AWMA 5IPJA 4WNKA 4WOVA 4CT1A 1IA9A 4L45A 5DIAA 4RC4A 4YHTA 3G9NA 5HCXA 3UMWA 1L8TA 4GU9A 2ITVA 5GNKA 2ITWA 4RWIA 2BRHA 4PPCA 3NUNA 1CMKE 4L9IA 2C6MA 3A99A 5CY3A 2NPQA 2YIWA 4FX3A 5BYZA 2GS6A 3VS6A 4S33A 4D2WA 4G9CA 3QF9A 2BHEA 1KOBA 3QTQA 5F94A 5HG5A 2XYNA 4QYGA 3FXZA 3WF6A 2Q83A 3HMMA 3GU7A 4ZTRA 3MPMA 5JGAA 1LR4A 2VWBA 1M7QA 2UVYA 3RAIA 3CIKA 2VTIA 2X7FA 4QP3A 4FKJA 5H9BA 1WBNA 4AAAA 3EFJA 3C7QA 4O2PA 3OUNB 4PWNA 4GMYA 1DM2A 4M7IA 3KEXA 4M13A 3RHKA 5CAPA 5KO1A 2VTMA 3R30A 2UZWE 2R3JA 3ET7A 3T9IA 4F1OA 4D1ZA 3AT4A 2UZBA 2GNIA 4MEDA 1H25A 2BUJA 4FTLA 3EH9A 2QR7A 4LGDA 2OFVA 4IVDA 3IPHA 4RRVA 2BCJA 2J4ZA 4AE6A 3ZRLA 4FYOA 4GKIA 2BILB 1AQ1A 3KKVA 3MA3A 3VUKA 2JIUA 3HMPA 4GCJA 2WMTA 3O0GA 3KMWA 4FT0A 3LFEA 5AP0A 3C0HA 4BDJA 1PXJA 2WQOA 4N70A 4BDGA 4B4LA 2XKFA 4ASEA 2XKEA 4QMWA 4XJ0A 4FL1A 3LFNA 4A4XA 3C0GA 2UUEA 3R1YA 4BZOA 2VTPA 3HNGA 4E5BA 1JKKA 4MWHA 1J7LA 2PWLA 5HBEA 3PP0A 3CD3A 5KZ0A 2B54A 3VBYA 3EFKA 5DH3A 4ARKA 4C2VA 4D28A 3ZO2A 3UZRA 3E3BX 5IQHA 5M53A 2F2UA 4IQ6A 3MIYA 4ZS0A 2CLQA 3V04A 5BPYA 3BV3A 3KXHA 4C36A 4UV0A 5ETAA 2C68A 5IF1A 4F0FA 3C9WA 4C0TA 3MPTA 2EB3A 5I9WA 1H0VA 5L6PA 2G2IA 5AAEA 2YIQA 3HV3A 3KXGA 3D2IA 4JX3A 4V0GA 4DBXA 4IADA 3GCPA 2RIOA 1PXIA 4OTWA 2HY81 2ZDTA 1P5EA 4XG9A 4YPSA 2IVSA 3LLTA 3FZPA 4FV4A 2VO6A 3MN3A 4MCVA 5BUJA 3QRKA 5J5TA 2F7EE 2W5BA 3AGLA 3VULA 4HPTE 2IW8A 2B9IA 4R5YA 3Q9ZA 4LV5A 4FV6A 3CJFA 5JT2A 4BWXA 2Y4PA 4AS0A 3QFVA 4QP7A 2VWVA 3EN9A 3Q2MA 3Q4CA 4ITIA 4WUNA 3UVRA 4CT2A 4WG4A 2RKUA 4QMXA 2VD5A 2JKKA 2QURA 2XKDA 3DV3A 4GK2A 5AX9A 3PVGA 3NVMB 1GZOA 4QOXA 2WHBA 5CSWA 4AW0A 3HRCA 4XOYA 5L2SA 3OP5A 4MAOA 3OCBA 4MBLA 3FZRA 4XG7A 4FG9A 4U81A 3ZC6A 4B99A 4WIHA 2I7QA 3O17A 2C6IA 4EOLA 5CF6A 3ELJA 1YWNA 1CDKA 1W0XC 4O96A 4DT8A 5E8SA 5CAOA 3QD4A 1S9IA 1XQZA 2Z7RA 3RBWA 5K5XA 4EKLA 5IQIA 2OIQA 2GNHA 3QRIA 4MVFA 2W17A 3F66A 3ULZA 4ANLA 4JLCA 4O83A 1OECA 1XH7A 5HE0A 4BWKA 4YLLA 2JIIA 3QZGA 5JFWA 4DH3A 4S32A 3MVJA 4YJSA 3G51A 5IA5A 4RSSA 3RCDA 3UJGA 1NVSA 4OW8A 2J0KA 1W84A 1WVWA 4XG4A 2VV9A 2GQSA 3QALE 3N51A 1Q4LA 4DLIA 3MH1A 4AZVA 4FBXA 4RC2A 3NS9A 3A4PA 4D4VA 4TWCA 2CLXA 4WBBB 2ITPA 3E3PA 4C4FA 2X4FA 5CQUA 4UMQA 3DK3A 3VNTA 1BYGA 2OICA 4A9UA 3D14A 4YZ9A 4MK0A 4AOIA 5I3RA 3TJDA 1SVHA 4MBIA 3ENMA 4PMMA 3FLWA 3PTGA 4FIGA 4BBFA 3PY0A 4FKTA 3VHEA 1V0PA 4IWOA 1NW1A 4CG9A 3DAJA 2WMRA 4DITA 1IA8A 5IQEA 4XV9A 4U97A 3BGPA 5C03A 5HD7A 4C4JA 3N4UA 4KABA 2QHMA 4I0SA 5CEOA 4JG6A 4OTIA 4KIQA 1ERKA 3DLSA 3UC4A 4EK4A 3R8VA 4H05A 3UGCA 2W5HA 1ZOGA 2C5OA 2OIBA 1APME 3POZA 4L53A 1NVRA 3BGQA 3KVWA 3UIUA 4D0WA 3Q32A 4G3GA 4L42A 4NM5A 1KE8A 4S31A 4O0VA 1V0BA 2CDZA 3TL8A 4EOSA 2XK3A 4XOZA 4CKRA 3V8TA 5M4UA 1E1VA 2X39A 4FV9A 3FL4A 2QOQA 3FAAA 4TWPA 4MNEB 4QMVA 5FG8A 4EH6A 4AACA 4NL0A 2XNBA 1PXLA 1SNUA 4QYYA 4YR8A 5KUPA 3G2FA 1W98A 4MF0A 4TYIA 4AZEA 3C1XA 3R9OA 1OMWA 4FT5A 4ZTHA 1Z9XA 3DBDA 3O2MA 1YOMA 5CU3A 3RZBA 3ATTA 3MYGA 3VBVA 4CSVA 2UZOA 3CKXA 4FZ7A 3OCTA 3R0TA 3TNHA 4MD8E 2A0CX 3MB7A 2R7BA 1EH4A 3LLAA 1FVRA 5IUHA 5ANJA 5AFVA 4L7SA 5G6VA 4J98A 4FKIA 4X2FA 3QKMA 4P7EA 4RX7A 3FKOA 3FC1X 4K18A 4FTQA 3I0QA 4DE4A 2YDJA 4KINA 4EUUA 5GIOE 1VYWA 3ZMMA 4TRLA 2JFMA 2RG5A 3L1SA 4EJ7A 3NW7A 3ZZWA 4WG5A 1BUHA 5GJFA 3FZ1A 2BKZA 2YFXA 2JDOA 3RK9A 4FTCA 2CGUA 4BCMA 1W8CA 1QPCA 1OKYA 3R7UA 2NRYA 3KCFA 4N0SA 4K8AA 3R7EA 3LXPA 3MGYA 2CKEA 3KRJA 4ZJJA 3LFAA 4GFOA 3PJCA 3H0ZA 1Q99A 2OZAA 5CEQA 2IZRA 4YJPA 3DKCA 3EQPA 2G9XA 3I79A 1IG1A 4Z55A 3PY1A 2O3PA 3AD6A 3GCSA 5CSHA 4KKGA 4BCNA 2QOFA 3OXZA 2WQEA 4NKSA 5C01A 4APCA 4HVHA 5CF5A 3UTOA 3CBLA 1ZRZA 4A06A 3IOPA 3K3JA 3P08A 4IACA 4EHEA 5J5SA 2GFSA 4C61A 3SW7A 1OL6A 3D5XA 4F70A 2R3PA 2REIA 2OXYA 3ZLYA 2X7OA 4RT7A 5HEZA 5IQFA 3DBFA 4J1RA 2WELA 4XMOA 3PLAE 4FKWA 3VC4A 3BHYA 4BL1A 3ZDIA 4EOIA 2QG5A 4O0TA 2XH5A 2J0MB 1UVRA 2UZTA 2ZM4A 1PMVA 3DAKA 2B4SB 1XR1A 4BN1A 5AR8A 5GJDA 5AP7A 2Y0AA 3LQ3A 2RFEA 3HA8A 1XBBA 3GCQA 4C62A 4E8AA 3FEGA 1PKGA 3HDNA 3R7OA 2BDJA 4L67A 2UVZA 3ACJA 5FQDC 4BCIA 3BPRA 3PXFA 5IUGA 3CY2A 3KN5A 5E1EA 2BTSA 1Q8YA 2ONLA 4OTHA 3V3VA 4O7ZA 4NIFA 2XJ0A 4EH8A 5AV3A 1Q3DA 3TNWA 2R3RA 3KL8A 1OL1A 2SRCA 4HGTA 4TKSA 3VS4A 2LGCA 2PVNA 4HGEA 4ZTLA 3CE3A 3BHVA 4H3QA 5FBNC 4XHKB 3UZPA 4F0GA 5J79A 3RNYA 5EQYA 4AW1A 2FO0A 3S3IA 2G2HA 3ULIA 4WG3A 5HVKA 2PE0A 3UOHA 5JZNA 4UALA 2VGOA 5A14A 3BE9A 3PG3A 4O38A 3WF8A 4QMPA 3MVHA 3PIXA 3Q5ZA 4H39A 4Y8DA 4MX9A 1JLUE 3O8UA 5T68A 3F3ZA 4EQUA 4DINA 1QPEA 3FLNC 1U46A 4BICA 4C3RA 3ZC5A 1JVPP 2PVYA 3GFEA 3LOKA 4OAVB 3ETAA 2C5YA 4IAIA 5EI8A 2BFXA 2E9UA 4FNZA 5AMNA 3IDBA 4AWIA 4IH8A 1A9UA 3ZYAA 3DCVA 4JVGA 3WZKA 3MVLA 2C6OA 3R1QA 2R3IA 4QPSA 3SC1A 4AGUA 3ORNA 4YUQA 4DEBA 4BIDA 2PVHA 5J7HA 3QX4A 4D2VA 4HZSA 2KTYA 3OEFX 3QQGA 1X8BA 5FM2A 3EJ1A 4FUXA 4ITJA 3FDNA 4QD6A 3ZOSA 2X8IA 1FINA 1HCKA 1OIQA 4ZP5A 3AC4A 3QLFA 5L8JA 2BPMA 4ALWA 5HG7A 1Q41A 2P2IA 2I0VA 3MY5A 4MD7E 3OG7A 3TWJA 4DCEA 5AUYA 2YLEA 4O82A 4CLJA 2OIDA 3DT1A 5EW9A 2XYUA 1SVEA 3BU3A 3UQGA 4D9UA 3RPOA 5B2LA 3ODZX 2UZDA 3NUSA 4FNXA 5DI1A 3S0OA 3QD2B 1ZARA 4DBNA 2PE2A 4XCUA 4CQEA 4E5WA 1Q61A 2B53A 2JEDA 3ZO1A 4B8MA 3Q53A 4O6LA 4PPAA 3HAMA 4YZCA 3FSFA 4RWJA 3LQ8A 4BTFA 2QG7A 1M7NA 4S2ZA 2R3MA 2VWWA 4B9DA 5K5NA 5L8KA 5M55A 2JKMA 2O63A 2VWZA 3VBQA 5AR2A 1H4LA 4BKJA 5A9UA 2Y6OA 3FY0A 3T3VA 3AG9A 1ZOEA 3LFFA 2WZJA 1P14A 4IFCA 5BQ0A 5CU4A 4J71A 3IK3A 1U4DA 2BFYA 3AC5A 2YAAA 2YIYA 3EQCA 5IZFA 4IZ5A 1MRYA 4C4EA 3KB7A 2EXMA 3F82A 4TNBA 5K4IA 1K9AA 5LXMA 5M4CA 3L8PA 2HXQA 5CVGA 3V5WA 4OTRA 3OXTA 4FTTA 4HVSA 2ZM1A 3LFCA 3QAME 5LARA 3TKUA 2OH0E 3SXRA 3PY3A 4FT7A 1STCE 2GNLA 2W5AA 3QGWA 4IJ9A 4M69A 3MA6A 4TN6A 4NW5A 3GU6A 3WI6A 2ITXA 2BROA 2XM9A 5FWKK 5AEPA 5EH0A 5A4EA 4LYNA 3NIEA 3U4WA 2BR1A 4PMSA 4R1YA 3BZ3A 3FYJX 3BELA 3EIDA 3NLBA 2X9EA 4EKKA 4ZY6A 3E87A 2VTJA 4M67A 4A4LA 3FSKA 2PZPA 4FE2A 4UXQA 2YEXA 2EUFB 3CLYA 2VAGA 4JRVA 3QWJA 4ZAUA 5IA1A 4IDTA 1B39A 4FIEA 5HU3A 3ZFMA 2PUUA 4HYHA 2EXCX 2XK8A 4KA3A 3S2PA 3VUTA 3ZU7A 4AE9A 4JJRA 3NZ0A 3H9FA 4DFLA 4YTIA 1TVOA 5AA8A 3QTXA 5L8LA 3HYHA 4QO9A 5EK7A 3U54A 3QU0A 3SAYA 3DZOA 4X6RA 4ACMA 3QX2A 4IB3A 3R9DA 2XK4A 4ZSJA 3LXLA 3A60A 1WBVA 3VW6A 2BRGA 5AAFA 4K6ZA 4JDIA 4Q5EA 4J95A 3P23A 2JIVA 2WIPA 2Z7SA 3QWKA 4J96A 4J97A 3ANRA 3TN8A 2PVKA 3QYZA 3ZO3A 5DE2A 4Z16A 3L9MA 1OL2A 4BDCA 4PDYA 2JAVA 4GFGA 3V5TA 4D1XA 2ACXA 2VO0A 4FZ6A 3CQEA 4NFNA 2YJSA 4AA5A 2C30A 4HVDA 5HO8A 5A6OA 3UG1A 2CPKE 5CEPA 5M06A 4P5QA 2B9FA 2CNQA 1J3HA 5BVKA 5HESA 2GFCA 3D4QA 2ZAZA 4PF4A 4F9AA 2UW8A 2VTAA 1RJBA 3DDQA 2Z2WA 2VWXA 2XF0A 3EN7A 4FKSA 1G8AA 4YJVA 2G2FA 5K0XA 1ND4A 1H1QA 2W1FA 4MXAA 4KSPA 2I1MA 4F6WA 2Y4IB 2BDFA 3CSVA 5DOSA 3JUHA 3DBCA 1ZXEA 4EH9A 5GZ9A 5H8GA 5HVYA 4O27B 5JMSA 2W1GA 4YURA 4CG8A 5TE0A 4M8TA 5DLSA 3TNQB 3CGFA 5C8MA 4OTDA 5DEWA 3R2BA 4IC8A 1OUKA 4MNEA 3Q9WA 3D15A 4RVKA 3FLQA 5HVJA 2VWYA 2I6LA 3IDCA 3V51A 5E1SA 1UWHA 2WIHA 5KMNA 2X4ZA 5M4IA 4HCTA 4NWMA 3DJ6A 3KVXA 5HNIX 2UW9A 2FSTX 3Q4TA 3F6XA 3KQ7A 4DFBA 4DEGA 2BRMA 1OKVA 1F0QA 2HCKA 2XK6A 1PMNA 1OGUA 1PXKA 4E4NA 5IMXA 3C4EA 2ZB1A 2PL0A 4NYEA 3NAXA 1K2PA 4BI2A 1R0PA 3Q52A 1QMZA 2WTIA 5EQEA 4JBQA 2WTKB 4DTAA 1YQJA 3II5A 4GT5A 3RJCA 3LXNA 4E7WA 4FKGA 5BYLA 4FKOA 4IJPA 5CF4A 1U5QA 2C3LA 4R3RA 3NUUA 2PYWA 3DKGA 3BU5A 3ZRMA 2X2KA 2OBJA 4LGGA 4GVAA 2YWVA 1CSNA 1F3MC 4E1ZA 5FRIA 3BGZA 4PQNA 3BU6A 3JYAA 1T45A 3WIGA 1CKPA 4WT6A 4OT5A 1JOWB 3EL8A 4IM3A 3AXWA 4I4FA 4DC2A 5E8YA 4AN3A 4I5HA 4M97A 4BCHA 3HA6A 4P4CA 3N9XA 3ORTA 4I93A 1JPAA 4JG8A 3U4UA 2YERA 2W96B 3A7HA 3R04A 4N4SA 4FV8A 5FD2A 1KE5A 5CAQA 3G0FA 3QC4A 4BI1A 3KMUA 3W10A 4ZEGA 4PDOA 5M4FA 4UMRA 1OBDA 3JXWA 2CGVA 3BQCA 4UX9A 3TDWA 4UMPA 4F64A 3C4FA 4XRJA 3U87A 3TZMA 5AV0A 3KXNA 1ZWSA 4QYEA 5HTCA 3B8QA 5ETFA 2XJ2A 3ORXA 4OTFA 1WBTA 3AT3A 1JAMA 4DH7A 4EK8A 4QTCA 5E7RA 5LMBA 3ORIA 5HNGA 5JK3A 3PJ2A 3PP1A 2YM5A 3ZHPC 5KMMA 3OFMA 4RGJA 3QTWA 3CPBA 2XEYA 4C02A 5CEIA 4ACGA 3ORKA 1OB3A 3OXIA 3PZEA 3QRJA 1Y8YA 4JT3A 4K77A 1WZYA 3SRVA 3HMNA 4HGSA 4CYIA 2V0DA 1BI7A 2QU6A 3E7OA 4I1ZA 5B2KA 5LWMA 4C58A 1E1XA 3GU5A 1XH8A 4KAOA 4CV9A 4ANOA 4D5KA 3R71A 3NYNA 4JL9A 2R3LA 5CYIA 3C4ZA 4ANMA 1RQQA 4B0GA 4RA5A 3QTZA 3F5GA 1KV2A 2QOOA 3QZHA 4QMSA 2VO3A 3TKIA 3S95A 2QLUA 5EOBA 1JKTA 1OKZA 4GL9A 3LCTA 5L2WA 2J6MA 3F5UA 5LMAA 3Q9XA 1OBGA 2P4IA 3FKLA 2WMVA 5LMKA 3VW8A 1YDTE 1H26A 5KMJA 2GNFA 2FH9A 3BCEA 3MVMA 4HVIA 3RNIA 3HMOA 4C4IA 3VVHA 1XH4A 4YNEA 2WMBA 4O84A 1UWJA 2W1DA 2WO6A 3OROA 4GYGA 2YM4A 3R9RA 3PG1A 2JBPA 4O21A 4E6CA 3KK9A 4E26A 5EYCA 2X0GA 1BLXA 2FSLX 2OXXA 2PZIA 3FQEA 3L8XA 4JAJA 4PMTA 5CI7A 5HHWA 4ACDA 4BI0A 4G5JA 4IX4A 3S00A 4FGBA 4CMOA 2QKWB 2W1ZA 5EQPA 4LM5A 1UU8A 2B55A 3PFQA 3Q3BA 4QP8A 4ZSLA 4DTKA 3PPKA 4IFGA 1IR3A 2OI4X 2VTSA 4EH4A 4BCFA 2E9NA 2GCDA 2YWPA 3AMAA 3DA6A 1Q8WA 4FT9A 4GV1A 4M12A 4JQ8A 1J91A 4QP6A 1ZAOA 5HX6A 5EFQA 1H24A 1P4OA 3GU4A 3QD0A 3OT8A 4ZSEA 1JQHA 3BYMA 1YXUA 5HI2A 4B7TA 1KSWA 4L7FA 2GHLA 1W7HA 4NIFB 3I0OA 2WU7A 4U45A 5HX8A 1OL5A 4RC3A 4XLIA 2E9OA 3UE4A 4EYJA 2HOGA 2H34A 2QOKA 1AGWA 3PE1A 3LFQA 5ANDA 5BMSA 3I4BA 3D7ZA 4IXPA 3UG2A 5CASA 1P2AA 5I3OA 3RI1A 4K2RA 5EDRA 3NVKI 3A7FA 1OIUA 2GMXA 2IVUA 4BIEA 4CLIA 1FVTA 2CN5A 2J0IA 4EUTA 4G16A 4ANQA 2GDOA 4AOTA 1DAWA 5IH5A 3TTIA 4BYJA 3O50A 3Q4UA 2XIYA 5DT0A 3UO4A 5J7BA 3FBVA 3QLGA 1Q3WA 5FGKA 3H10A 1FPUA 4W4XA 1SMHA 4R6VA 1I44A 3TT0A 2QQ7A 3A61A 1QL6A 1OITA 3PPZA 1LEWA 1OPJA 2EWAA 4G9RA 1XHAA 4L68A 4PRJA 3OOGA 4KSQA 5J8IA 3M2WA 5AV4A 2GS7A 5HZNA 4MH7A 5DR6A 3H9RA 2QNJA 3QXOA 5EKOA 3WZDA 4EEVA 4IBMA 3MW1A 4DFZE 3HECA 3MFRA 4HCVA 3QA0A 5IMEA 3CTJA 3IKAA 5CU0A 2FGIA 3NUAA 4EBWA 3OWPA 3SLSA 1CTPE 3DB8A 4FZFB 2XM8A 2C1AA 4J7BA 4XG8A 4FA2A 4ZTMA 3D2KA 2XEZA 3P86A 4LL5A 5B7VA 4DGGA 4I6FA 3PVUA 2A4LA 2R0IA 4WO5A 2BVAA 1KE6A 2R3KA 4HGLA 3HZTA 3EZVA 4EOJA 5JRQA 5KKRC 4LV8A 4GK3A 2C3KA 3U8WA 1UV5A 2BRNA 3FI2A 5ANGA 1XKKA 3QCSA 1UA2A 3VS5A 1J7UA 2XNEA 4NK9A 5I9XA 3OD6X 3UVQA 5EHYA 3E7VA 3ENHA 4ACHA 5JSMA 5I9VA 2JGZA 5EM8A 3R73A 4X3FC 3GC0A 2VX3A 3PA3A 3UP2A 4FIJA 2CJMA 5E8UA 1REJA 5IQAA 5I9UA 4BCJA 2QVSE 4IZAA 3T8OA 4I0TA 2WMWA 3LJ2A 3F2NA 4XRLA 3O8TA 5CSVA 3PJ3A 3RM6A 1ZY4A 3O7LD 3WYXA 2R3QA 4L6QA 3DAEA 3G6GA 3DNDA 4R7IA 2F2CB 1P4FA 3L9NA 4LI5A 3F2RA 3WZJA 2QO9A 3NCGA 4ZY5A 4PP7A 5M08A 4YTHA 4IANA 2JBOA 2W4KA 2XNGA 3COMA 4U0IA 2XKCA 4FV5A 3U6JA 3OBJA 4IDVA 3E5AA 5HKMA 1LUFA 3QUDA 2FUMA 3JVSA 4E3CA 4JOAA 1O6LA 4EC9A 2X81A 2XK7A 5L6OA 1H00A 3UOLA 1NT2A 2R3OA 5KMKA 3R28A 4BCGA 3FKNA 4JR7A 2RG6A 4V01A 3VJOA 5I0BA 4D9TA 4M69B 2ITZA 3ALOA 4OGRA 5CANA 1O6YA 3SVVA 2J50A 5CF8A 3B2WA 5EDQA 4QMMA 3CGOA 4IM0A 2OJFE 2PU8A 2XCHA 4CFMA 3BEAA 3DTCA 3O23A 1PMEA 4XEYA 1ZYDA 2JD5A 4DFUA 2OSCA 3UIXA 5LOHA 4O81A 2H6DA 2V22A 2BHHA 2X2MA 4RQKA 4PUZA 2ZV8A 1YWVA 4Y83A 1Y6AA 3AGMA 2W9FB 4DEIA 1R78A 1B38A 3L9LA 4IB0A 5ETCA 4XBRA 2C1BA 4YO4A 5ICPA 2RGPA 4QMNA 1TQPA 2Y6MA 4I21A 1M17A 3O8PA 4AX8A 5KCVA 1KV1A 3CTQA 4UWCA 5J95A 4ZJIA 5ANEA 3H4JA 2WQBA 5JH6A 2ZV9A 4EI4A 3R6XA 1YI6A 3FXXA 4E6AA 4N57A 3SG9A 4V05A 1YKRA 2F7ZE 2JKOA 4QMLA 3R8MA 3A7JA 4QQTA 4GJ2A 3LXKA 5DT4A 5B2MA 3CP9A 4WRSA 4R8QA 2J2IB 4FKRA 3RHXA 3BLRA 4FNWA 4QMYA 2QODA 4CV8A 1LP4A 4DEAA 4ANSA 4UZHA 4DHFA 4EBVA 3UNJA 1WBWA 3W2RA 2PZRA 1L3RE 2JITA 1J1CA 4O0RA 3UYTA 4IC7A 4P90A 2VNWA 2XK9A 3UNKA 5AM7A 5L2QA 3EYHA 3WE4A 4UWYA 5AAGA 1BL7A 4O0UA 5I9ZA 4RJ3A 3HV4A 4TT7A 4JBOA 3E62A 2R7IA
chains in the Genus database with same CATH superfamily
4EC8A 3NX8A 3R8LA 3RAHA 4PNKA 3FI3A 5ITAA 4R78A 1BL6A 1YDRE 4U3ZA 3P7AA 4EQCA 3QZIA 5CVHA 3AKLA 5H2UA 3TV7A 3NYOA 4FICA 2J0LA 1PXPA 4PDPA 3AMYA 5BYYA 3IECA 1VYZA 4W9XA 4BDBA 3SG8A 4W9WA 3RPSA 1XBAA 5DN3A 1R39A 2C6LA 4LUEA 3NPCA 3OTUA 4QTDA 2BTRA 2CNUA 2P55A 2BIKB 3AOXA 1OPKA 4NTSA 4UZDA 3VWAA 3V8SA 2Y7JA 2C0OA 4I6QA 2DS1A 2YCRA 5D7VA 5GZAA 4WSQA 2CNVA 4FRFA 4IWPA 1PXMA 3AD4A 5CNOA 3TUDA 4F1MA 3T3UA 1OM1A 4ERWA 4CRSA 4N6ZA 3REPA 3PRFA 4EOKA 3AKJA 3U9NA 4LGHA 2PY3A 1IEPA 1UU3A 5LVOA 3I6UA 4DGNA 2AC5A 4D4RA 4J8MA 3FXWA 3GEQA 4BGQA 1Q24A 3VS0A 4YJQA 5M09A 4GW8A 3QHRA 4FI1A 4I94A 3SGCA 4LRMA 3MY1A 5KHWA 5M44A 3IW4A 1YHVA 3P9JA 4Y46A 5E92A 4I4EA 4PV0A 2WMSA 2C6KA 4TY1A 1FBNA 2UZVA 3KA0A 2VX1A 4BFMA 2IVVA 3IG7A 4J53A 3C0IA 4PTGA 5AUXA 4H58A 1F5QA 2F49A 4H1JA 4IAYA 4QMUA 5DA3A 4BDAA 1IAJA 3MIAA 4IX3A 3P5KA 4D2TA 4CVAA 4JMQA 3TCPA 1DI9A 4U6RA 5D10A 3LVPA 4PY1A 3ZH8A 3AMBA 5I4NA 2PMLX 2QC6A 4I23A 4LUDA 5E8VA 4F6SA 2GSFA 2OO8X 3W32A 1ST0A 5HQ0A 5JN2A 4KBCA 3AD5A 4UYNA 4LG4A 4YGAA 4EH7A 1H27A 4CZTA 1OL7A 4KUJA 3QCYA 4FSRA 4EJNA 1PRYA 3HUBA 1YHSA 3NW6A 2UW7A 1YI3A 4AZFA 5K0KA 3GENA 2PTKA 4AZTA 5KNJA 3F69A 3HRBA 3KY2A 2RF9A 4EORA 2WOTA 5D12A 2KULA 5J1WA 2BRBA 4RPVA 4TXCA 1VJYA 3RKBA 4FMQA 3ZSIA 2RFNA 4MXYA 3SRVB 3NAYA 4U41A 1V1KA 3D5WA 3D83A 3NNWA 3DPKA 3QCQA 3LMHA 3MFSA 4ERKA 2IWIA 2PVRA 4O7YA 4XNEA 3QKKA 4TYJA 4O2ZA 5FXRA 2UZUE 5DBXA 1ZOHA 3E92A 3GGFA 3PXZA 4FK3A 3MJ1A 2R3FA 5DT3A 4WHZA 5A4QA 2W4OA 3HUCA 4RJ5A 3GNIB 4FL2A 2Y8OA 3BKBA 2YIRA 3E88A 3FI8A 5J87A 3TACA 2BAJA 5E4HA 4BKZA 2OLCA 4UY9A 5HLPA 4ZTSA 4G34A 4QQCA 2F57A 3VUMA 2YDIA 5EYDA 1REKA 1URWA 5FP6A 3KRRA 4QTBA 3U6IA 4NTTA 1WMKA 5EHOA 3U6HA 3DJ5A 4O91A 4RFZA 3VF9A 4ZLYA 4YP8A 1GIIA 3DTWA 1FMKA 2RL5A 3BHTA 3EB0A 4QPAA 3MTLA 3QQLA 2PUIA 1PF8A 2IG7A 4IM2A 1GNGA 1H1SA 3SDJA 2JDTA 3F2AA 4L00A 3ZONA 4DAWA 2J0JA 5D7AA 4LRKA 5J9ZA 3U9CA 5ACKA 4WBOA 3MFUA 3R7GA 4EZ7A 2X6DA 2H9VA 2P2HA 3FZOA 3ORMA 5CVFA 3FLZA 4IWDA 4HPUE 5LVMA 3ZFXA 4OTPA 4IZ7A 5CQWA 2ERKA 3QRUA 3DKFA 3E93A 2YM7A 4ASDA 1CM8A 4YZDA 2R2PA 3ZRKA 3DXQA 4YJRA 4X2KA 4BDFA 4RIWA 5AP1A 4E4MA 5AP2A 2GQRA 2B9HA 2YZLA 4IIRA 3D7TB 3DLZA 4O22A 1YI4A 1XBCA 3FYKX 2E2BA 3PUFC 3BLAA 5HBJA 2Q0BA 3G6HA 3I5NA 4GT4A 4AW5A 4AA4A 4FGRA 4EQMA 1DS5A 1OUYA 2QOLA 4DG2E 3E8EA 4E4LA 2GHGA 4LMUA 4NKAA 3RTPA 4F7LA 3G9LX 2ZJWA 5BUEA 4JBPA 3NUPA 3TZ7A 3H0YA 3ML1A 2XAMA 3S4QA 2A1AB 3R7IA 3TG1A 3E8DA 5LJJA 4C38A 3OC1A 4ZS4A 4IE9A 2ZMCA 3HKOA 4A7CA 2CSNA 2WQMA 4I6BA 4KBAA 4YC6A 5LWNA 4BC6A 2HWOA 2QI8A 5IH4A 4DEEA 2QHNA 4IVCA 4KNBA 1W2FA 1RDQE 5C4KA 4NSTA 3NUXA 4FEQA 4EONA 4CFXA 5CXHA 1R3CA 3QTUA 1JKSA 2UW3A 3DFAA 3WE8A 1OVEA 2QD9A 4G17A 2IO6A 3RWQA 4QP4A 2V5QA 3KRLA 3G15A 4LDTA 4K0YA 1PKDA 2Z7QA 3NYVA 3LCOA 1JSVA 4DG0E 4E93A 3WIKA 4APPA 4KIOA 4CCUA 4EK5A 3L8VA 4ZZMA 4J52A 3R00A 4XX9A 5FEEA 2OGVA 3TZ9A 3R22A 1NVQA 3ZUVA 1OZ1A 4YBKA 3ZSGA 4BGGA 3KFAA 3NUYA 4L3PA 4U9AA 3UOKA 3GT8A 4TNDA 3WZEA 4PL5A 4AU8A 3D5UA 5HIDA 3M1SA 4L44A 4X3JA 3K3IA 3FV8A 4ZMEA 3V6RA 4X2JA 2CCIA 4WNOA 1Y8GA 1Y57A 4YJTA 4F9CA 2XBAA 5L6WL 3EQDA 5A3XA 2UW4A 4DLJA 3UDBA 3ORLA 4LQMA 3A7GA 1PYXA 2PMNX 3BLQA 4GSBA 2W0JA 3IW5A 4Q2AA 5AA9A 4P5ZA 1ST4A 5E9EA 3QBNA 2ESMA 2WEVA 4X6QC 3RPYA 1FMOE 2BZKB 4YO6A 2R5TA 3UYSA 3RINA 3PUPA 2NRUA 1YXTA 3FUPA 4P2KA 3IGGA 3TNIA 4EOQA 4AXAA 1ZMVA 5CU2A 3QL8A 5CEKA 3FQSA 3V8WA 3EOCA 3KRWA 4MQ2A 2PZYA 3P1AA 5AM6A 5HO6A 2CMWA 3HRFA 4NJ3A 3UODA 5L4QA 5CS6A 3ZUTA 5FEQA 3EN4A 4MWIA 3H9OA 1JSTA 4FOCA 3P4KA 1PHKA 3I6WA 4JXFA 4XP0A 4UN0C 2XIZA 3LFBA 2DWBA 4RJ4A 4Q9ZA 3OWKA 3MTFA 1KOAA 1OIRA 4F1TA 4O0YA 4C37A 5CSPA 4B6LA 4AN9A 4ALVA 4RLLA 5KMLA 3GXLA 4JS8A 4HNFA 4IMYA 2XVDA 4JRNA 2OKRA 3NFGB 4A9TA 4IX5A 4NEUA 4FT3A 4LMNA 3NRMA 2UZLA 3O7LB 1OGYA 5DPVA 4AF3A 5TT7A 1Z5MA 3VQUA 5IQBA 3NGAA 5AJQA 3VS3A 2OG8A 3ROYA 1H08A 3PJ1A 2XA4A 4RX5A 4IVAA 3FE3A 4OUCA 4WRGA 3EQIA 1A06A 4M0ZA 3RPRA 2WKMA 1YOJA 1U59A 4BDHA 2C3IB 5TKDA 3FMLA 2AC3A 3W0MA 3SHEA 1YXXA 3TZ8A 3EL7A 3GC8A 3KMMA 2WTWA 5CU6A 3OZ6A 5FDXA 3TDVA 5ACBC 3FMNA 4RFMA 3QTRA 3UC3A 5KBRA 4UXLA 4FVPA 4DN5A 4IW0A 3PWYA 3W2SA 3LKMA 2BZIB 4I6LA 4KD1A 2BZJA 4FSTA 4QTAA 3BL7A 3DGKA 5IQGA 4C34A 3HV5A 4AGCA 3WF5A 3PVWA 4JIKA 4FSUA 4JDJA 5HIEA 4YC8A 4G6LA 3SOCA 3GP0A 1VZOA 2OJ9A 3OS3A 5E8WA 2ZFYA 3NFFB 5DYJA 3JY0A 1JWHA 1NA7A 3LCKA 5AV1A 2RFDA 3FMEA 1Q8TA 4CFNA 4D4YA 2FVDA 4YPDA 1Y91A 2XCKA 4OBOA 2UZEA 2F9GA 1M52A 4M15A 3TM0A 4NFMA 4ZJVA 5IEVA 4BF2A 2OF2A 5CX9A 4IAFA 2VUWA 1O9UA 2WXVA 2GTNA 3MH3A 4FTAA 4XG6A 2ERZE 4FV3A 4TYGA 4H36A 1YW2A 3SXSA 3VAPA 5JZJA 4HVGA 3FMDA 3A8XA 4GU6A 3W55A 3Q5IA 2CKQA 2R3GA 1M14A 1PXOA 4XV1A 4C7TA 3I60A 5GINE 3OY1A 3PIYA 4RG0A 5HICA 4L8MA 3ZBXA 2JLDA 5CXZA 5FTGA 3P7CA 3V6SA 1NY3A 4CGAA 5EI6A 3BI6A 3R9HA 4KS7A 3WBLA 5J9LA 5BVWA 4OLIA 3BIZA 4HOKA 4GUEA 3EYGA 5D9HA 2HIWA 4O4FA 4YZMA 1KWPA 5HE3A 3Q96A 3I7BA 1LPUA 5GJGA 4DYMA 3IDPA 1KE9A 3HV6A 3CTHA 2EXEA 4FTMA 3MJ2A 4USDA 1GZKA 4YSMA 4ZTNA 4S34A 3SX9A 3GI3A 4RIOA 2E9PA 5IEYA 3KIOC 3GOKA 3N4TA 4AT3A 4YNOA 5HO7A 4LFIA 1CKJA 3LCSA 4ZZOA 4Z9LA 4YJUA 4BDDA 5AUVA 4CEGA 4KKHA 4I3ZA 4KIKB 3UBDA 3VUDA 3MV5A 4FG8A 5I9YA 2HY0A 5KBQA 1JBPE 3CQUA 2YM3A 4EHVA 4BDIA 1XO2B 3O71A 4F0IA 1ZYLA 3Q4ZA 3TV4A 5DRDA 4Z7HA 3TYKA 5C9CA 3BLHA 3BHUA 3LPBA 5EYMA 4BHZA 3W8QA 5D11A 3ZBFA 2XNMA 3KXXA 3RK7A 3C5IA 4AAYA 4FZAB 4RZVA 4PMPA 4BCQA 5AADA 2OU7A 2VU3A 2XRWA 5EM7A 3DBQA 4MBJA 1YWRA 3F9NA 2YCQA 3GUBA 4A9RA 4JR3A 4E20A 2VWUA 3DS6A 2DQ7X 5FXQA 2ETRA 4X21A 4XG2A 3HAVA 4FEVA 4RVLA 2QO7A 5AR3A 3I5ZA 4G6NA 1JKLA 3OW4A 3MWUA 4XV2A 4U43A 3N4VA 2UW0A 4EZ3A 4PTCA 3W2CA 2YACA 3BV2A 5K4JA 1WVXA 3NCZA 4OT6A 5G1XA 2XP2A 1RE8A 4FZDB 1SVGA 4IVBA 4W4YA 1TQIA 5F20A 3OMVA 2JDRA 3LM5A 3O5AA 2R0UA 3OUKA 3K2LA 2ONLC 2XRUA 1MUOA 1YDSE 4XYFA 4QMQA 1TFFA 4QMTA 4CKIA 4TYHB 2R3HA 3RP9A 3TMOA 4FEWA 3L9PA 1UNGA 4AGWA 3GCUA 3OT3A 3PSDA 4OTQA 1JSUA 3VBXA 4GIHA 2O2UA 3DQWA 4FIHA 1TKIA 4MF1A 4NJDA 3HLLA 5BMMA 2GQGA 3MI9A 5F9EA 4CCBA 5IA0A 3R83A 2HZ4A 2JDSA 3W18A 5AUWA 1UU9A 1OPLA 2VWIA 2HZNA 4DFXE 2CKPA 4EH3A 4NCTA 4TZRA 4MKCA 3E8CA 1OIYA 1OKWA 4DDGA 4F4PA 2OZOA 4C4GA 3OWLA 4FTJA 3NNUA 4AFEA 3LIJA 3KGAA 4M14A 5DRBA 1Q8UA 5ANOA 3DQXA 3ZS5A 4XH6A 4XG3A 4QT1A 3D7TA 4FIFA 2PZ5A 4ASXA 5HG8A 5KX8A 2O65A 3RAWA 1W2CA 2XAOA 3CEKA 3D5VA 5HORA 2G01A 2VTTA 3K5VA 2ITOA 4XP2A 4BDEA 2B7AA 1U5RA 2XIXA 3ZZEA 4H1MA 4JQEA 1ZYSA 4XS2A 3LE6A 3FC2A 3CCNA 1HOWA 2P3GX 1OI9A 3IOKA 3PYYA 4FNYA 5FLFA 5EOLA 4GS6A 2CN8A 5CAVA 3QUEA 2VO7A 5IA4A 3D0EA 3ORZA 3OOMA 4FG7A 4HJOA 4WD5A 4G31A 2VX0A 4WNPA 4CKJA 4JX7A 3ANQA 3F88A 4BY9E 4O4EA 3WOWA 1RW8A 4BZNA 3KF4A 2W4JA 5BX0A 4NM7A 3VBWA 4YSJA 2PMOX 4N6YA 3UPXA 2HXLA 3UIMA 4O7LA 1M2PA 2PK9A 4FTIA 4QMOA 2PUNA 3EMGA 4R5SA 3VO3A 2WFYA 2O0UA 3W0PA 2GNJA 1WVYA 5AR5A 2OWBA 2HW7A 4JDKA 2CHLA 3HL7A 4FSMA 4RVTA 2VZ6A 1PMUA 5CALA 4FR4A 5AIKA 4W8DA 4YTFA 1W2DA 3OCSA 2WGJA 3I7CA 3PVBA 3SKCA 1WBSA 2I0YA 4IHPA 4RIWB 3RCJA 3C5UA 3ZLXA 1ZMWA 3GVUA 4OBPA 3BWFA 2UW5A 3ODYX 2YZAA 3PE2A 2JFLA 1GJOA 3BYVA 4K33A 3EQFA 1YOLA 3SW4A 5J1VA 4ZIMA 2QCSA 4FSWA 3R1NA 2VTHA 3FZSA 3CR0A 1VEBA 4ORKA 3DBEA 4ZOGA 5IQDA 3WYYA 5EHLA 3C50A 3VS2A 5T3QA 4QP9A 5ETIA 1BX6A 4FSQA 3KN6A 4EK6A 3C4WA 1ZY5A 5CT0A 5HE1A 4F7JA 4FIIA 3CJGA 3DZQA 2PPQA 4MTAA 3FWQA 4EH2A 4C33A 4YZBA 4CRLA 5HGIA 4BCOA 4BTKA 4F65A 1TZDA 3NWWA 2C0TA 1AD5A 2A19B 4I5PA 4YJOA 5L2IA 4JIAA 2R9SA 3HMIA 4WKQA 2BDWA 3FL5A 2YISA 4XUFA 4BVUA 3NYXA 4G1WA 4PX6A 4G5PA 3VIDA 2B9JA 2WQNA 2XB7A 4BCPA 3R02A 5JQ5A 5D1JA 5KKRB 5KZIA 4FKVA 1YRPA 3EHAA 3DOGA 1QCFA 2WMQA 2XIKA 3COHA 3OVVA 3R2YA 5M56A 4D5HA 5AX3A 5LVPA 3EN5A 3Q60A 1PY5A 3NMUF 1W83A 3D94A 3HP5A 4FTRA 4X3FB 1PYEA 4RIYB 3ZM4A 2X7GA 2XNOA 4R3PA 3EQGA 2X1NA 3VHKA 1H0WA 3W0OA 2PSQA 2R4BA 2YDKA 5C8KA 2VTLA 4CYJA 2GS2A 4DH5A 3K5UA 4U42A 3DJ7A 5A46A 4X7QA 3O51A 4TL0A 2J90A 4AUAA 3MS9A 4F9BA 4A9YA 5HIBA 4G3CA 3DY7A 3C13A 4AQCA 2V62A 4EYMA 2WTVA 4QP1A 3FPQA 4D4SA 1Q62A 2OF4A 2VNYA 1BKXA 3LMGA 5CSXA 3WZUA 4FEXA 4O7VA 3HEGA 5BV3A 2X0QA 3BHHA 3CS9A 3MH2A 3DB6A 5CTPA 4TYEA 3BBWA 4QQ5A 5E8XA 4D2RA 4KRCA 4FV2A 4RBLA 1UNLA 3POOA 1MRVA 3QQJA 4RIXB 2VN9A 2YLFA 5FP5A 5T6KA 4BZDA 4JQ7A 4MUQA 2QOBA 4PTEA 1YHWA 5EG3A 4GG5A 5HD4A 3IONA 3F3UA 3OEZA 4FKLA 2Y9QA 4KWPA 3BQRA 5K3YA 3ZCLA 5JQ8A 3RWPA 2QLQA 3W2PA 4I41A 3BE2A 3AC3A 4C35A 5JFXA 2OJGA 2WB8A 4HYSA 4L46A 4FV1A 3T9TA 3LW0A 3RGFA 1V0OA 2HZIA 5DGZA 3ZUUA 5EKNA 3V5JA 3LFSA 3NW5A 3OWJA 1KUTA 1CKIA 2LAVA 3ZXTA 2BAKA 2IJMA 4V04A 5KMOA 4AOJA 4CNHA 5EYKA 4D0XA 2BMCA 4JDHA 4Y85A 3PJ8A 4FKQA 4X0MA 2V55A 5HE2A 1WBOA 4L43A 5TO8A 3BBTB 5IA3A 3PFYA 3ID6C 4IB1A 1FVVA 3QQKA 1U54B 2ZB0A 5K9IA 3AC8A 5JKGA 4AG8A 4Z7GA 4R3CA 1MRUA 3FMMA 3GB2A 4U79A 2C6EA 3PPJA 2WMXA 4DEDA 3HGKA 4TPTA 5LCKA 1DAYA 4KIPA 5C1QB 4MQ1A 4EHZA 4ZSAA 4W8EA 1UKIA 4O0XA 3FPMA 4RMZA 4DH1A 4F7SA 4FYNA 4O7TA 2YCSA 3R8UA 5AIRA 3QZFA 3QGYA 4IWQA 3KXMA 4NUSA 2Z02A 2FYSA 4RZWA 3WF7A 3EN6A 4D55A 1JNKA 4O86A 4A07A 3GFWA 2Z8CA 3QYWA 2WTJA 3RAKA 4JBVA 4W4VA 5EW8A 4MYGA 2HAKA 4A9SA 1H1RA 1YVJA 5BVOA 2JAMA 4KIKA 2PE1A 3DK6A 1J7IA 3IW8A 3LHJA 2OXDA 4D58A 3TI1A 4C4HA 4CMUA 5FBOA 3UOJA 1MQBA 1Q8ZA 2XJ1A 3QTIA 4M0YA 4Y95A 2PVLA 4U3YA 4YHFA 4CMTA 3I81A 5A4TA 5DHJA 2XS0A 5EI2A 3GCVA 2B0QA 4MXXA 2CKOA 3QTSA 4F63A 5DMZA 2RFSA 1PJKA 2QR8A 4FTKA 2WOUA 4M3QA 4UMUA 5H8EA 1WBPA 3SV0A 1QPDA 4RWLA 2UV2A 4O7RA 4ZTQA 2QONA 3G5DA 5CENA 4UYAA 5A6NA 4RJ6A 1G5SA 3TUBA 1Y6BA 4Y72A 4C57A 3P78A 2IZTA 4FVRA 4CFVA 4RWKA 4IB5A 3NEWA 3JR1A 4ZLZA 3Q9YA 2YITA 4AXEA 3G33A 4YLJA 4FTOA 4Y5QA 2DUVA 3PSBA 1G8SA 3R8ZA 5CT7A 2A27A 2J5EA 5HCYA 4G2FA 2X6EA 3V5PA 5L2TA 3CC6A 3TV6A 4ZSGA 4ANBA 2BZHB 4F6UA 2F7XE 3SA0A 5IU2A 4WA9A 4G3EA 4RFYA 3LJ1A 2J51A 4DHIB 3RMFA 3PSCA 3PWDA 1W82A 5F95A 3TTJA 2C47A 2R64A 2PMIA 5BVNA 4ZK5A 4FUYA 3PIZA 4GJ3A 4J8NA 4L52A 5EW3A 4YMJA 3R1SA 5TOZA 3AQVA 4OTGA 3D9VA 3MY0A 4FTNA 4TYHA 2WMAA 4ZY4A 4USEA 4E6QA 5E8TA 1H01A 2GU8A 2IZUA 3Q6UA 3F61A 3P0MA 5BVFA 4F99A 3ZM9A 3E63A 2B52A 4IAZA 4F9YA 3S1HA 3G90X 1NXKA 1QPJA 1ATPE 2YM6A 4MHAA 4DFNA 3TIYA 4U80A 1E9HA 5FEDA 5M57A 1ZYCA 4BHNA 4M84A 3U55A 2ITTA 3KCKA 3EQBA 3GU8A 5LMKC 3FZTA 2VRXA 3P79A 4QPMA 3UO5A 3KREA 3F5XA 4GVJA 5KHXA 4ACCA 1R1WA 2VTQA 3QQHA 1UKHA 3DNEA 4HYUA 4H3PA 3GQLA 4DA5A 2XMYA 1ZMUA 2OW3A 4HNIA 4GKHA 5E8ZA 3NNXA 1M2QA 5DEYA 2IW6A 4QRCA 5CZHA 4AP7A 4AW2A 3FMHA 5JGDA 3LM0A 2C6TA 2YM8A 3RPVA 3TJCA 3R7YA 2ITNA 3FJQE 4HW7A 4CQGA 4EOMA 4BBEA 3DK7A 4EOOA 3K54A 2EB2A 2X8EA 3ZDUA 3QD3A 3H30A 4I20A 3ZTXA 4C59A 2NNWB 1XWSA 1GZNA 3UPZA 3JY9A 3O96A 4CZYB 2IF8A 5CWZA 4RJ7A 1ZZ2A 3KXZA 5FTOA 4EWQA 4YLKA 2C6DA 2YJRA 4MNFA 4NCTC 4TTHB 3KULB 1KE7A 5IKWA 3QHWA 3BX5A 4EOPA 4WNMA 3PDTA 1SYKA 1Q97A 2G1TA 4YTCA 2XBJA 3W2QA 5F1ZA 2CGWA 2W1IA 3E8NA 5CI6A 1IRKA 2PVMA 3RVGA 2A2AA 1G3NA 3OW3A 4BKYA 2PVJA 1ZZLA 3PXQA 4GIIA 5M51A 3WF9A 5AP5A 4RJ8A 4QYFA 5D41A 3B2TA 4PPBA 1GIJA 3EKKA 1YXSA 3R21A 4YJNA 4GK4A 5FTQA 4BGHA 3QKLA 4TWNA 3ALNA 3LMIA 3CXWA 3R7VA 4F08A 2X8DA 4IX6A 1ZYJA 4JNWA 4LOQA 3UIBA 4ZMFA 5A54A 4CFFA 3NDMA 5HG9A 4EZ5A 4E73A 3SD0A 3VUIA 4BR3A 2H8HA 3NSZA 4NH1A 5AP6A 4XP3A 2WTDA 2OJJA 2UZNA 3PRIA 1J7LA 5EM6A 3FHRA 4O4DA 4HZRA 4YHJA 5B0XA 3HP2A 2O64A 4FEUA 3R8PA 4O4CA 4TWOA 3COIA 1GY3A 4KKEA 5CLPA 4JG7A 3HDMA 1SNXA 4CTCA 3BYSA 3DU8A 3TNPC 3A62A 1SM2A 3CKWA 3LAUA 4K1BA 4BBMA 4NU1A 4BIBA 3BYUA 2QOCA 4D1SA 5JFSA 3SOAA 4QNYA 3WILA 3W33A 3IS5A 4Q5HA 3GC9A 3SXFA 2X0PA 1SZMA 3F3VA 2WEIA 3PA4A 3MH0A 5CZIA 5HU9A 2GPHA 1XMLA 5GIPE 2E9VA 4CD0A 2C5NA 5KE0A 3FLSA 3C4XA 5DNRA 3VONA 2BAQA 4GH2A 4ID7A 2WNTA 3F3WA 4M66A 2HENA 1WCCA 3GQIA 1H8FA 2JDVA 2V7AA 3ZEPA 4G6OA 4L01A 3M11A 5IQCA 3QUPA 3TEIA 4IEBA 2C69A 5BVDA 3A7IA 1YXVA 4NM0A 3NNVA 4EHGA 4PL4A 4TW9A 3Q04A 5E91A 3F5PA 1Z57A 5HNBA 3PLSA 4CFWA 4QP2A 4QTEA 4X3FA 4RLKA 5LVNA 2GTMA 4FSYA 4RIYA 4BB4A 5LCJA 2WAJA 2J9MA 3VRYA 1HCLA 4AT5A 5AV2A 4B8LA 5BUIA 2YAKA 3TIZA 3FLYA 4G3FA 5EM5A 4DEHA 3SQQA 2O8YA 3CPCA 4AFJA 1O6KA 2PUPA 3F3TA 3ZLWA 5DFPA 1FQ1B 2QU5A 3V01A 2IPXA 4JAIA 3AT2A 2HWPA 4NW6A 3QXPA 4KRDA 4ENYA 3B8RA 4ONAA 2W1HA 3MFTA 2ETKA 1VLRA 3MESA 4YU2A 3KU2A 3UO6A 3R63A 2C5XA 1XH9A 2YIXA 4DGMA 3ACKA 1GAGA 3TUCA 5DR9A 4UWBA 3TKHA 1H1PA 4O7SA 3G0EA 3RK5A 3PXYA 3GC7A 4GEOA 3MPAA 4RIXA 3U51A 3VUHA 4ASZA 4GUBA 3QCXA 3DXPA 3WARA 3QA8A 5FM3A 1ZLTA 2NP8A 2I40A 3VF8A 3ATSA 4O0SA 3IQ7A 5AR7A 4XV3A 4FKPA 3CD8A 2WTCA 4GG7A 4KB8A 4X2GA 2W7XA 3R01A 1PXNA 4AGDA 2XZSA 2YA9A 5C27A 5HTIA 4I5CA 2XNNA 3UQFA 2C5VA 3EQRA 2C3JA 2BKKA 1FOTA 4FV7A 4II5A 5CAUA 2CCHA 2FB8A 4V0GB 1WFCA 1Q5KA 2GHMA 4I5MA 2VGPA 4CXAA 4E5AX 2Y4IC 3DXNA 2G15A 3A2CA 2EU9A 4PNIA 3DKOA 3NR9A 4QNAA 4QYHA 3ZFYA 3VQHA 4K9YA 4L3JA 4OBQA 4ALUA 5FDPA 4Q9SA 2ZDUA 4UEUA 2F4JA 4BTMA 3KC3A 4QDEA 3F7ZA 2NO3A 2QO2A 5C8NA 2HELA 1U54A 3VUGA 3AC2A 2IN6A 2IW9A 5C4LA 2VTNA 3GOPA 5HCZA 1PW2A 2FSMX 4MXCA 3EFLA 3DDPA 4UB7A 2AYPA 2HW6A 4EWHA 5HTBA 4ZZNA 1T46A 1XJDA 4USFA 4R7BA 5BNJA 3EKNA 5I5ZA 4AA0A 4XLVA 3JS2A 5DVRA 3Q2JA 4J99A 4DCAA 3V5QA 4G3DA 3EFWA 1TQMA 4U7ZA 3GBZA 2GNGA 4GRBA 2WPAA 4H3BA 4F9WA 3BYOA 2ITQA 4IZYA 4RX9A 5ANIA 2R3NA 4RQVA 5HBHA 4DGOA 1XH6A 4I22A 2ZYBA 3ERKA 4NZWB 4E6DA 3L8SA 5LQFA 3QQFA 5AP4A 4ANNA 1BI8A 3LJ0A 4FOBA 4QQJA 2YHVA 4R7HA 4RVMA 5GZ8A 1R0EA 2WTKC 5FXSA 3KK8A 3LQ5A 4GT3A 2JKQA 2ZV2A 3P7BA 3BRBA 3OCGA 4KBKA 2XNPA 4O6EA 3LFDA 4X2NA 2FSOX 3JVRA 5AP3A 3FI4A 5AR4A 5IDPA 2YN8A 3QRTA 3MB6A 4O1PA 3OY3A 3CQWA 3UMXA 5JRSA 4BYIA 4DF3A 4DT9A 4FKUA 1FGKA 1XH5A 1BMKA 4I92A 5H8BA 2BALA 3BL9A 2JC6A 3FY2A 4YC3A 3A8WA 3TXOA 1UNHA 2YABA 5KMIA 4FL3A 2DYLA 5AUTA 2PVFA 3OF0A 4EH5A 5C26A 4O7NA 3VS1A 3VS7A 4XBUA 5CNNA 4D2PA 4DG3E 5L3AA 1FGIA 1UU7A 1H28A 3UZTA 2ETMA 4HCUA 4K11A 4A4OA 1IAHA 2PULA 2V7OA 2W1EA 4MXOA 3PXKA 4GYIA