4EKKA

Akt1 with amp-pnp
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
334
structure length
318
Chain Sequence
RVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMISERRPHFPQFDYSAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title An ATP-Site On-Off Switch That Restricts Phosphatase Accessibility of Akt.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 318
sequence length 334
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ekkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ekkA01
2QURA 4GG5A 1U54B 2R3QA 2A0CX 5AV3A 3R71A 3O0GA 3QQLA 3OVVA 4X0MA 3MY5A 4DG3E 3DQXA 4TKSA 2C0IA 4H3BA 4H58A 2YIQA 3OOMA 2J2IB 3ORZA 3P1AA 4K8AA 4Z7HA 3LMIA 1ZOHA 3ENHA 4LV5A 4MXZA 2XIRA 4ZTMA 5L2SA 5M09A 3ACKA 4J71A 2AYPA 4JQ8A 1TQPA 3R83A 4I24A 3D94A 4X6RA 1ZY5A 3NAXA 5CZHA 4IBMA 1XH9A 2PVJA 5GZ9A 1H25A 2R3MA 3WF7A 2X4ZA 2G1TA 3AMBA 4D4RA 1MRUA 4C4HA 1H07A 3C5UA 2XNPA 1GZNA 3PJ8A 5I9WA 4RJ8A 3F3TA 2BZHB 1WVWA 3RVGA 3FMJA 3VRZA 1UU9A 3MGYA 2UZOA 2Z7QA 3FLNC 5H3QA 4B9DA 4NFMA 3R8VA 5A4QA 3NIEA 4ITJA 5FTGA 5KBQA 2WMAA 2PUNA 4MD8E 1OUKA 3E8EA 3HMMA 3SGCA 4QP6A 4NJDA 4K9YA 1WBNA 2PMLX 4F6UA 5LMBA 1FMKA 3UQCA 3V01A 4D28A 2C5XA 3O8TA 1NVSA 2NO3A 4ITIA 5GNKA 2VNWA 4NJ3A 1FOTA 4YNOA 1YDTE 2BRBA 4A4XA 4F7SA 5K5NA 4O0VA 5AUUA 2PY3A 2EVAA 4F08A 2W9FB 5KZIA 4FV2A 1Z57A 5FD2A 4KKGA 5LVLA 1XWSA 4TYJA 4YMJA 3LFSA 4CSVA 3EZRA 3KB7A 2OIBA 3O71A 4O0YA 4NT4A 4RX9A 2B54A 2O2UA 4DE4A 3E5AA 4KRDA 4MWIA 4TPTA 3ZUVA 2IVSA 2DYLA 3TJDA 4EK3A 1OL5A 4L8MA 4MNEA 3HYHA 4L7SA 4BKYA 5KMKA 2O8YA 4I6BA 4F1OA 3UDBA 1WCCA 4F63A 5IA2A 5IQAA 4A4OA 4LYNA 3AGLA 5JH6A 1YXVA 3D83A 3Q5ZA 3R9OA 2OLCA 1YOLA 3BLHA 5F1ZA 3NRMA 4J1RA 3CJFA 3FY0A 2PVLA 4FTJA 4EUUA 4XS2A 3D5UA 3ZEWA 4CD0A 3T8OA 1J3HA 2CN5A 4EOSA 5TOZA 4PF4A 5HORA 4RFYA 2IO6A 3BYMA 2R3OA 3HA8A 5AMNA 3GC8A 4BBEA 4IH8A 3W1FA 2QLQA 5GJFA 1Y6BA 3ZEPA 3R7YA 3MH0A 4YSMA 3WF5A 3PSCA 2A2AA 3FI8A 4UMUA 3DK7A 4DCAA 3KC3A 2PPQA 4EOPA 2BZKB 1XH4A 2VO0A 3NAYA 3FUPA 2EXCX 1PXMA 4K6ZA 3I0OA 4XJ0A 2GNJA 4NIFB 3UP7A 4GKHA 3FSFA 2PVHA 2JFMA 4GL9A 1PRYA 5M53A 5AUWA 2YLEA 3NUAA 4JIAA 2W96B 4FT5A 3DJ7A 2EUFB 4PQNA 2BIYA 4TRLA 3UJGA 2A27A 3GC0A 2W7XA 4C35A 1PXNA 3CSVA 4QD6A 1M2PA 3DXQA 4OT5A 1Y57A 2WZJA 4GVAA 1WVXA 4IB1A 4OTWA 3WOWA 3TWJA 1YOMA 2QC6A 5FQDC 2HY81 4AT3A 3NUNA 4GJ2A 4A9RA 4ARKA 4BCIA 5EQPA 1YXSA 3W8LA 2VTHA 3EFWA 2BZIB 3F82A 1R39A 5DN3A 4DYMA 1M7QA 4MX9A 2F7EE 2W0JA 4NM5A 4HYSA 5IQFA 4FOBA 4AW5A 1Q8UA 4EH9A 4FUYA 3U6IA 5E91A 2HZ0A 2J6MA 3Q2MA 4IACA 2QOBA 3QRKA 2GMXA 1KE5A 3RM7A 2JBPA 4H3PA 2BZJA 2JIIA 4WD5A 3VO3A 1J7UA 2R7BA 3OWKA 4Z55A 3HV5A 3M42A 3NPCA 1Q5KA 3UOKA 1V0OA 4HVHA 5KMNA 2RFEA 4FZDB 5FM3A 3FEGA 4DFBA 2CCIA 2EU9A 4JRNA 4O0WA 4YHJA 2X8DA 1H1QA 3AC4A 3OY1A 4U3YA 2QKRA 5CLPA 3S95A 5CF6A 4R5SA 2BR1A 4CFXA 4J53A 2WMQA 1WBWA 2J90A 5EG3A 1Q24A 1OIUA 2BRHA 5EM6A 1YXUA 3LLTA 3N4TA 2H6DA 3E87A 4YHTA 5D7AA 4EQMA 5CXZA 2RFDA 1HCKA 3DAEA 1A9UA 4WT6A 3KXGA 4NWMA 5AAFA 2XYUA 3VBXA 4G1WA 4O0SA 4BWXA 3E7VA 3F5PA 4CMTA 5HBEA 3FMKA 4EOMA 4AOIA 3W2QA 4FL2A 2OXDA 3R01A 3DBEA 3PJ1A 5A4TA 4E5WA 2YN8A 3A99A 2XNGA 4IIRA 5ITAA 3VS2A 3EQDA 3KRLA 3MH3A 2PVNA 5AM7A 5DRDA 4EOLA 5HCYA 3VUMA 4CYIA 5IQIA 4I20A 5HNBA 5K4IA 2ITYA 2C69A 2ZAZA 1OBDA 1REKA 4FIIA 2G9XA 1BI8A 3DK3A 4PPAA 4QTEA 3ZU7A 1MRYA 2IW6A 4GU6A 4I0SA 4U80A 4QMTA 2PVYA 4CYJA 5GIOE 3GXLA 3R8LA 3V5WA 1PMVA 3MVHA 4AE9A 2IVVA 5J9LA 2A4LA 1ZARA 1XKKA 3GU4A 3ODZX 2Y7JA 5DHJA 5CU6A 5J8IA 3WI6A 4E3CA 1Q8WA 3PLAE 2V62A 3KXNA 4ANOA 1JKKA 2X7GA 4FBXA 3HMIA 3PUPA 3VHEA 3VVHA 4PDOA 4XYFA 3ZZWA 2I7QA 3RTPA 3H9RA 4QTDA 3TUBA 2VWYA 2Q83A 2VZ6A 2ONLC 1BKXA 4O96A 4AZEA 3RPVA 4E8AA 3QCSA 2P2HA 4E4MA 5CS6A 5EM5A 4AN3A 1R78A 3KXXA 1G5SA 3A7IA 3R30A 2ITNA 4DGGA 4IEBA 1V0BA 3BHTA 1TQMA 4ZZOA 1OL2A 4X21A 2WOTA 3ZLXA 4IJ9A 1OL1A 4RA5A 5C26A 2PUIA 3EL8A 2GSFA 5DEYA 5HVJA 3IOPA 1OKYA 3VIDA 5HU9A 4OAVB 3VJOA 3Q6WA 5EYCA 2XKDA 3Q4ZA 3FMEA 3D7ZA 4A9SA 4FV5A 5HGIA 4EK5A 5IPJA 5L2WA 4RVLA 2CCHA 4FSWA 4HCVA 1OVEA 3C5IA 3RPSA 4R3CA 3NNVA 3R28A 3H0ZA 5D12A 4FE2A 3P7CA 5AR7A 2WAJA 3KY2A 5HE1A 3LFBA 1FVTA 5FXSA 3GVUA 3PPZA 1ZOEA 4R3RA 3RZBA 2XNMA 4QMMA 4AW1A 2GNHA 3BV2A 4XHKB 3RNIA 2OKRA 4NCTC 3N4VA 3KL8A 3F3WA 1CDKA 4DEEA 4PPBA 2BMCA 3BHVA 2GNFA 2W1HA 3NCZA 4UY9A 4J95A 5HBJA 2ONLA 3RINA 3UOJA 2ETRA 1M14A 1ZYLA 2UW6A 4IQ6A 2JC6A 4X2GA 4NTSA 4JDHA 5CAVA 4PL5A 3SVVA 4RZWA 3EH9A 5HG7A 2QR8A 3LM5A 3TV7A 4RSSA 4TWPA 4BCFA 4DF3A 2QI8A 2C1BA 4H39A 4G5PA 4U6RA 5FLFA 2GQRA 4YJVA 4OW8A 4FSRA 4LV8A 2WMVA 4IMYA 4L9IA 1BLXA 2WTKC 3QQGA 3VJNA 3TNIA 4WNMA 4JXFA 4V0GB 4OLIA 5HQ0A 5HI2A 4EK6A 2UVXA 1DAYA 3WF6A 4CKJA 2IJMA 3HMNA 1ZRZA 5BVFA 3MA3A 5KMJA 3ORXA 3Q9XA 3O17A 1ZWSA 3VS7A 2ITXA 1BL6A 3ANQA 1ZYCA 2CGWA 2C1AA 3IS5A 1P5EA 4FGBA 1AGWA 5LVOA 2QU6A 3BWJA 3H9FA 4NCTA 4EH2A 4XG9A 3OCTA 1YHVA 3VUHA 1J91A 4PY1A 4P5ZA 2QKWB 4OTIA 4ZY4A 5HTIA 1J7IA 2ZM4A 4R7HA 5IQDA 3DB8A 1SVGA 4FYNA 3ZUUA 2WQBA 1OKWA 5AP3A 3C4ZA 5FDXA 1GIHA 1XBCA 3GQLA 4Q5HA 4HVIA 3RAWA 4D2RA 3CXWA 2QOFA 1QPCA 4JX7A 4DGNA 3ZDIA 3G9NA 4EONA 4CGAA 2CGXA 2PE0A 5IU2A 3QCYA 3L9NA 4BKJA 4ALWA 4TN6A 2Z7RA 3DAJA 4BGQA 3WYYA 2Y0AA 1FQ1B 4NM3A 4EORA 2YM5A 2B0QA 3KFAA 2P3GX 4PTCA 3BHYA 3V5LA 5HTBA 3ZMMA 3GP0A 2R3FA 4JQ7A 4FIEA 4FTTA 4K2RA 2FSMX 4DFXE 2BIKB 5IDNA 4MBJA 3HZTA 5AIKA 3OBJA 4TYIA 5HE3A 5BVOA 3HP2A 5FP5A 1O6KA 3BHHA 5GJDA 4BN1A 4CT2A 1I44A 2C68A 4QRCA 5C4KA 4AN9A 4KABA 2JDOA 3F3ZA 4H1MA 2F9GA 5L8JA 1VEBA 2YM4A 3NYVA 4D2TA 1FBNA 3R9DA 4S31A 4GMYA 4RWLA 5D1JA 2GNIA 3T9IA 3AMYA 5KBRA 4V01A 3V5TA 4X2FA 5KE0A 3E64A 4YZMA 4DT9A 4YJUA 1P4FA 2J0MB 2W4OA 3OW4A 2LGCA 3QF9A 4II5A 5CEQA 4Q9SA 4BCHA 2OW3A 3CP9A 3RGFA 4O38A 2ZMDA 4EZ7A 4F4PA 4F6WA 1Z5MA 5CYIA 3I6WA 3DFCB 4TWCA 3BQCA 3TKHA 3Q9ZA 2H9VA 4CFMA 1RQQA 3E8DA 4QT1A 4UXQA 4PTGA 4U43A 3D5WA 3PXYA 5H8GA 3RAIA 1UWJA 3BLRA 3ODYX 3RAHA 4FKLA 4GFGA 3LFFA 4Z9LA 4Z3VA 5A4CA 2CHLA 3U4WA 3KRRA 4YSJA 4IAZA 5F4NA 4R1VA 4IZ7A 3UIXA 3ZC6A 2XJ2A 3DPKA 2JDSA 3FKNA 3UZRA 2C4GA 2YFXA 3FL4A 3QKMA 3TACA 3PFQA 4NZWB 5ETIA 3A7GA 3D14A 3U9NA 1XHAA 2EXEA 4F0IA 2PZ5A 5BVNA 5HG8A 3LCSA 5HNIX 1TQIA 3ATTA 4NKSA 1F0QA 3QXPA 5AP6A 3R2YA 2B4SB 4KBAA 2QO2A 2CLXA 2RG5A 4DEDA 4GCJA 4DFNA 4IVDA 3SHEA 1OPLA 4CMOA 4XRLA 3ALOA 2FYSA 3QHRA 1RE8A 4GH2A 3II5A 3EIDA 4ANLA 4ASZA 2UZEA 3O96A 4EYJA 5CSPA 4KIQA 5M4IA 3QQJA 3QD0A 4FIJA 4G9RA 3V3VA 4EJNA 2YM8A 3JVSA 4IADA 2VGPA 4KS7A 5IUGA 3QC9A 4IE9A 5JSMA 1FPUA 3OHTA 2WTKB 1M2QA 5CENA 3BCEA 4U79A 5CU4A 5FGKA 3CKWA 4XBRA 1JKTA 5C8NA 4U7ZA 3QTUA 3IK3A 4MK0A 5J79A 2PULA 3DBQA 5B0XA 3QGWA 5CU2A 3BU3A 3CPCA 2GTNA 1IRKA 4FVQA 3EQIA 2BFYA 4L6QA 3E7OA 4MBIA 5DR6A 1PXJA 1VYWA 3EQGA 5IQHA 3UE4A 5CF5A 4WNKA 2XCKA 4GT4A 5LQFA 2ZB0A 1U5RA 4QYFA 4EOOA 3LMHA 3P08A 4XCUA 3SC1A 3VNTA 2HYYA 4MBLA 4ZXTA 4CTBA 2Z60A 4A4LA 3QX2A 1BUHA 2UV2A 1NVQA 3OT8A 4D4VA 3BYOA 3CTHA 3ERKA 3NUUA 4LUDA 4OTFA 4UZDA 3SW4A 4BCQA 4DBXA 1RDQE 3ETAA 3R9NA 3MJ2A 2VTNA 4HYHA 3W2SA 4FNXA 3PXQA 3ZDUA 3QZHA 4DH3A 2X6DA 5A6NA 3FLYA 3DJ5A 2VWZA 4JR7A 3PY1A 3HMOA 3BRBA 3DKOA 4U81A 4ZLYA 4H36A 1GIIA 3WZEA 4Q9ZA 1OI9A 3UOHA 4FTUA 4D2SA 3L8PA 5I9YA 3C0IA 3KCFA 4YZBA 5AV2A 4L52A 4YBJA 5CY3A 3VBYA 4MXAA 3W16A 4ERKA 4C4JA 4UWBA 5ANDA 2JKOA 4KBKA 1ZOGA 3A60A 4L7FA 3KMWA 4V05A 2ITTA 3CQWA 3OWPA 4LUEA 3RMFA 3RPOA 3KULB 4WG3A 3OOGA 2C6DA 3CR0A 3C51A 5G6VA 4CLJA 3R9RA 5H9BA 3RBWA 5CXHA 4FSTA 3W2OA 3DGKA 4C38A 3R7EA 1A48A 4DHFA 4ZK5A 3TKIA 3CIKA 3DJ6A 1OPJA 4QMZA 4N6ZA 3WZJA 3ZLSA 4AZFA 4E1ZA 3PG3A 4B0GA 3ZS5A 3ZCLA 3Q04A 4YTFA 4GV1A 3RCJA 4JBQA 2ZM1A 3KN5A 3FZOA 3LXPA 4I1ZA 1KUTA 4ZP5A 4IW0A 4TT7A 4F7JA 3LCTA 3OEZA 2YIXA 5DA3A 2UZWE 2GPHA 3VW8A 5HO7A 3R1YA 1Q8TA 4OGRA 4TXCA 3HDNA 1OGUA 1RJBA 3DKFA 4IFGA 3ZC5A 4BIEA 1H8FA 2BVAA 3A61A 4D5KA 4PUZA 1KSWA 4ZS4A 4FVPA 2B9FA 4J8NA 5TO8A 3FZ1A 3NR9A 3R7UA 1FINA 4ZEGA 4O2ZA 5AUZA 4BTKA 3P4KA 2VTTA 3HUCA 2IPXA 3QZIA 1M17A 4LRKA 3CCNA 3BWFA 4BVUA 3NUYA 3GB2A 2HZ4A 4NEUA 2OI4X 3W2PA 4FUXA 2O0UA 5EI2A 2WMRA 2YDKA 4RVTA 5CT0A 4EI4A 5C8KA 3AC1A 2FO0A 3EN4A 2BTRA 5DR2A 3KMUA 4C62A 4U40A 2YIYA 4QQTA 2E9NA 2Y8OA 4K11A 3ZFXA 4C2WA 5IA1A 2XZSA 4AXAA 4CQEA 2JGZA 4IX5A 4CZYB 2B52A 3QTZA 3SOAA 4G3DA 2YACA 1FVVA 2YAKA 3F2RA 5A3XA 4ASDA 4A9UA 2P4IA 4DEBA 1ZXEA 4Y73A 4QMNA 3FHRA 3B2WA 3ORMA 3W10A 5BPYA 2YCFA 1U54A 3NNXA 4S32A 4C4GA 4ZLZA 2BDFA 5EQEA 4QPAA 4G3FA 3CGOA 4FV6A 4N0SA 1REJA 3DDQA 3MJ1A 3P5KA 3NUPA 4D0WA 4BY9E 4O1OA 4JS8A 4JJRA 4QP3A 5E8WA 3WBLA 4ACCA 4AA5A 1H1WA 3I5NA 5CQWA 1MP8A 5HTCA 5TE0A 3VUTA 1Q8ZA 4YURA 2OZOA 3UO5A 1PHKA 1XH8A 4FKRA 5H2UA 5M07A 1BI7A 4RX8A 3WARA 3HEGA 4IJPA 3NYXA 2QOHA 1H0VA 1H28A 3O8PA 3G0FA 4DCEA 5M44A 4NM0A 4NU1A 1NW1A 2VX3A 3JY0A 2QOCA 2VTJA 3K5VA 2UW3A 3KCKA 4M14A 3P7BA 3V51A 3ENMA 2X7FA 4OT6A 4QMWA 3QAME 4XV2A 2GHLA 2R7IA 2G01A 2HENA 2VU3A 4EQUA 4PWNA 2F4JA 1MRVA 3MFRA 4CKIA 2G15A 3OEFX 5M51A 4J7BA 2VX1A 4RGJA 5KMIA 3MPMA 4BDCA 2GNGA 4BCNA 4GUEA 4QP1A 1YHSA 3ZBFA 2QU5A 2ZMCA 4RQVA 2O63A 4EH3A 4XLIA 3F5UA 5KCVA 2B1PA 5BVDA 4RIXA 1VR2A 3TN8A 3FYKX 5IDPA 3P79A 4PX6A 2JLDA 2C3LA 4OUCA 3MB6A 3GU5A 4U41A 4PMPA 5CAOA 5LVNA 4IX3A 4DGLC 4EQCA 4ZTHA 3S1HA 3R6XA 3FKLA 3EHAA 2H8HA 4ALUA 5T6KA 5JK3A 5FXRA 1PXLA 3PE1A 3PJ3A 4AA0A 4EC8A 3R8PA 3ROCA 2QO9A 2WO6A 3KK8A 2VGOA 3OFMA 5L8LA 4JBOA 3KXMA 4EOIA 4YC6A 2PSQA 4IWOA 4O7ZA 1P14A 4QYHA 4EK4A 2WB8A 3D7TB 3HVCA 3M1SA 3MTLA 3C50A 2B9HA 3VS3A 1PKGA 4Y5QA 5DIAA 3U6HA 3RCDA 4C57A 5LCJA 4FTOA 4BTMA 2VO3A 4IB5A 3MA6A 4UMTA 5HEZA 2E9VA 2OFUA 3PE2A 3U4UA 3GGFA 1KOBA 3SW7A 4LM5A 5IF1A 2OF4A 4RX5A 3FE3A 3COMA 3KMMA 5DEWA 2RG6A 5AP0A 1NXKA 5FP6A 3UZTA 4YZ9A 5J1WA 5IQEA 3FMDA 2XK7A 4BYIA 2J50A 5GINE 2R64A 4B4LA 5AX9A 3ULIA 4NIFA 4USFA 3KGAA 2E2BA 3U51A 5IH4A 3NVMB 4OBPA 4JL9A 2VTRA 2UZDA 3TXOA 2Z02A 3QRUA 2UW4A 4RC4A 1UNLA 4XV3A 2B9JA 2ACXA 5DE2A 5J87A 2B9IA 4GS6A 4K0YA 4ANSA 5JFSA 4O7NA 4YTIA 4EHEA 2YITA 4YC8A 4FG8A 4KSQA 4FEQA 4ZLOA 5CT7A 5M08A 2CNUA 1URWA 4RIXB 3NMUF 3QZGA 1NY3A 3RZFA 5JN2A 5ANEA 3ZTXA 4FSZA 4IZYA 4F0FA 4FT3A 3NWWA 4DTBA 1H00A 3MN3A 4RC3A 3E92A 3LFAA 5DR9A 3H10A 5E90A 1WBPA 3K5UA 3VN9A 4YU2A 2BDJA 5EYKA 4F7LA 4UXLA 3V8TA 4ANNA 3G33A 4IX4A 2HK5A 4GFMA 2JDRA 3ZRMA 4FZ7A 5EDQA 5L2TA 4FTRA 4HGLA 3VUIA 1ZMWA 5M57A 3ZXZA 3FLQA 5IQGA 4XMOA 4EUTA 1APME 2C47A 3HL7A 4GYIA 5A14A 4O7SA 4C4FA 3A7JA 5GZAA 4E93A 3GFEA 5FEEA 5KZ0A 3ORNA 2X4FA 3A62A 1IEPA 4D2VA 4Y85A 2NP8A 3QLGA 4B7TA 2YIRA 3PZHA 4BYJA 3TIZA 4ID7A 2OZAA 5FDPA 2QD9A 4LGGA 4GG7A 5AIRA 3H4JA 4BBFA 5LWMA 5BVEA 4D1SA 3UIMA 5LWNA 2CN8A 4BF2A 2OIQA 4W4VA 2FH9A 3DY7A 4U8ZA 4XG4A 4OR5A 3CC6A 2WNTA 3O7LD 3I81A 3PA4A 4GW8A 3MBLA 4L67A 4E5AX 4HGTA 3IGOA 3ZM9A 2BFXA 4O91A 4DTAA 2FUMA 2IVTA 2YWPA 5DOSA 2X9FA 3PRIA 3AMAA 3VUDA 1IA9A 4FIFA 5FWKK 3MFSA 5JRSA 2WIPA 5TT7A 3Q9YA 3VHKA 3MVLA 2P33A 3B2TA 4HCTA 1YKRA 4CNHA 3T9TA 4F9CA 2ZDTA 4ZTSA 4TWOA 5GIPE 3PXKA 2VWXA 3ORIA 5CX9A 2QOKA 5IQBA 2OJGA 1K3AA 3G9LX 1WVYA 3A4OX 4IANA 1YI3A 2WMBA 4JNWA 5CEMA 5K5XA 1KOAA 4LFIA 4ACHA 4EOQA 4ASEA 4E4NA 4RLLA 4EH7A 2DS1A 4UYNA 5DT3A 3VC4A 3NVKI 4RC2A 3NLBA 4D4YA 4GT5A 3AG9A 4QYGA 3O23A 2F2UA 4CG9A 4BBMA 4RVMA 2PMIA 3ZZEA 5CNOA 3R63A 4PL4A 3DTWA 4FVRA 2QOOA 3RK9A 5EHYA 4NK9A 3QKKA 4C3FA 3P78A 5IZFA 4GT3A 3BELA 2OXYA 5HLWA 4F9AA 5BYYA 3JPVA 4DBNA 1PF8A 2GHGA 4DG0E 4JOAA 2W5BA 3FXXA 3FZSA 4O0TA 4FK6A 3U9CA 3GC9A 4MXXA 2XKCA 3CS9A 3DLSA 3FXZA 1B38A 4H1JA 3FMLA 2IN6A 4FMQA 4WNOA 5BUIA 4BDBA 4IHPA 3F6XA 3P23A 3EB0A 4LOPA 3PLSA 4Y8DA 2J9MA 3E63A 3BGZA 2ZYBA 5I9ZA 4HNFA 3RM6A 3FDNA 3IECA 5ANIA 5EK7A 2XH5A 4NUSA 3PVBA 2I0YA 4J52A 2XNBA 3OROA 4NH1A 5BUEA 2OZAB 2WEVA 3A7HA 3GNIB 1U59A 3IW5A 4UEUA 4XG7A 3M11A 4AACA 5CEOA 5HBHA 3L9LA 4YJQA 3PWYA 5DT0A 3PVUA 5AX3A 2WMXA 3DQWA 2CKOA 3AC2A 4Y5HA 3EWHA 4ACMA 3CD3A 5CVFA 5H8EA 4FV0A 4CT1A 5JGAA 3ZO4A 3KK9A 3R2BA 4C34A 4D55A 3S0OA 3IW8A 4HJOA 5KNJA 2DWBA 3RK7A 1STCE 5HCZA 4RWKA 1SMHA 2FSTX 4A07A 4FTKA 3C7QA 2OJJA 3ROYA 4RPVA 5HLNA 5JKGA 3FLWA 4IX6A 3ZO3A 3AD6A 3FQHA 4YJNA 2R3GA 3DNEA 3NDMA 3BGPA 4LI5A 1T46A 5D7VA 2C5NA 4EZ5A 3VBVA 2HXLA 4OTDA 2YA9A 2EB2A 2O65A 1WFCA 3L9PA 3VWAA 3FSKA 3TDWA 3MPAA 4CFWA 3FZPA 3I60A 1H24A 3F66A 3SRVB 2XK3A 4FSMA 4RJ4A 3ZOSA 4V0GA 5A46A 3GEQA 4IZ5A 3WE4A 4FL3A 4FTMA 5EM8A 1Q41A 1XBAA 2UZBA 5FEDA 2E9UA 5JRQA 5JGBA 1JKSA 2ERKA 3EYHA 2X0GA 3AT2A 5CSWA 3KRJA 5IH6A 1PKDA 4FV7A 5A54A 3UIBA 2R4BA 4WNPA 4FX3A 4IVAA 5CAQA 3JR1A 4O82A 4FF8A 2E9OA 3PA5A 2XBJA 4FC0A 1OBGA 2YZAA 2XEYA 4PV0A 4K33A 2CJMA 3VUKA 4V04A 3ORKA 5HIEA 3FY2A 4IXPA 1HCLA 1YVJA 4YUQA 2YCSA 2CKEA 3E3PA 3E62A 5J9YA 5JFXA 2XIZA 5HHWA 3R02A 4KBCA 3PXFA 5KMMA 2HZIA 2VO7A 2CLQA 2RIOA 3DOGA 4WSYA 3TEIA 5KMOA 4YR8A 4XX9A 1R0EA 3TUCA 2C5YA 5AUYA 4EHZA 4OBQA 4GSBA 4ZY6A 4LRJA 4PNIA 4MYGA 2XYNA 3BYSA 4ACDA 4R7IA 5CNNA 3BQRA 4I5CA 4B99A 1YWVA 3LCKA 1E1VA 1OL7A 3PP1A 2JAVA 3KN6A 2VTMA 3LIJA 3R8ZA 3ET7A 4KRCA 1OIRA 2ZVAA 4ORKA 5F95A 4P4CA 4TNDA 3F3VA 2VTPA 4C59A 3QKLA 5J95A 2HXQA 1PMEA 4BKZA 3L8VA 4BTJA 1PMUA 4YJPA 2G2FA 2ITOA 3FMMA 4L44A 4R78A 4L01A 4D9UA 4YC3A 4YLKA 4FTAA 2XS0A 4I21A 4OTGA 1OM1A 4PP9A 4ZMEA 3UNJA 3MYGA 4CKRA 4DFUA 4O86A 5FM2A 1CM8A 1E9HA 3P7AA 4JX3A 5F94A 1DS5A 2XCHA 3DXNA 5I3OA 5E1SA 3C4XA 2ZDUA 1DAWA 3BIZA 5ANJA 3G5DA 5CAPA 2W4KA 1Q4LA 3V6SA 4XRJA 2C6IA 4QQJA 1FMOE 4C8BA 3A8WA 5K0XA 4MEDA 2BRNA 1T45A 2BAQA 3BYUA 4WOVA 4M7IA 4RWIA 4EH5A 5BNJA 3U54A 3V5PA 2ZOQA 2ZV7A 4CQGA 3PIYA 4BCMA 4CRLA 3QLFA 4WBOA 5EI6A 4ALVA 5EDRA 2HWPA 1BX6A 2YDJA 3PPJA 3PJCA 2W1FA 4HGEA 5DH3A 3HRBA 2GNLA 5JMSA 4AZVA 4BDKA 4UMQA 4HCUA 2HW7A 4X2JA 4F9BA 5LVPA 2C5VA 1O6LA 1YDRE 3R00A 3UG2A 3PVWA 4DFLA 4DITA 5B7VA 5I5ZA 1ZLTA 4CFNA 3CE3A 1ZMUA 2OSCA 5E4HA 4GIIA 2FVDA 3CJGA 4P90A 4MNFA 3EN7A 2WOUA 1JPAA 3KREA 4TZRA 4R1YA 4GFOA 5CAUA 2GS2A 4AZWA 4WBBB 3OT3A 2EB3A 2JFLA 2XIXA 4QP7A 4S30A 4TY1A 4BR3A 3ANRA 5EW3A 3TZ8A 3W33A 3BPRA 2ZV2A 3AT3A 4FV4A 4XG2A 3RWQA 4D4SA 4CFUA 3B8RA 4D1XA 3RWPA 5AP1A 2WEIA 5A6OA 2YZLA 3HDMA 4FKOA 5HE2A 5AUTA 4FK3A 3QX4A 2C6KA 3A4PA 5D41A 2PMOX 3TI1A 2QOQA 4C36A 3GT8A 2OJ9A 2R5TA 3QD3A 4L3JA 3U8WA 5DVRA 1OKVA 3VAPA 2GQSA 1PXKA 3QFVA 4JI9A 1UKHA 4M69B 2HCKA 3AOXA 3NX8A 4QP2A 5C01A 5A9UA 3L8SA 4BCOA 2YCRA 4J8MA 3SD0A 3ZBXA 5HO6A 4BHZA 5IEXA 5JT2A 2W1IA 4N57A 1ND4A 3SV0A 2A19B 4P2KA 4AWIA 1H0WA 2WTIA 4BDAA 4E6DA 3F88A 4GU9A 1J7LA 5B2LA 3G0EA 4EHGA 4HPTE 3E3BX 5DMZA 3TM0A 5K3YA 4FI1A 1AQ1A 4C2VA 3HRCA 4FOCA 2GFCA 2I40A 3LCDA 3QQHA 3ZHPC 3O50A 2F57A 4EK8A 2NPQA 5FTQA 2BTSA 4ZTNA 2O64A 2PUPA 3SXFA 4ZTQA 1BYGA 4K18A 2FGIA 4CFFA 2W06A 3LQ5A 3R22A 4IAFA 3BZ3A 3VF9A 3FQEA 3NGAA 2G2IA 3KULA 3U6JA 1ZYSA 3OUKA 4IB3A 3FI4A 4AGWA 3ORPA 4JR3A 2R0IA 3QRTA 3MFUA 1Q62A 3DKCA 2O5KA 3QYZA 2ZJWA 4YZNA 2QHMA 2YEXA 1Y91A 4Y46A 3QYWA 3W55A 1Q3WA 3GU7A 2XIKA 2I0HA 3GI3A 3HV3A 5I9VA 5DLSA 4FV3A 2GFSA 3ACJA 5TR6A 4LOOA 1Y8YA 1K9AA 4DAWA 2R3PA 3UNZA 4C02A 3VUGA 3H9OA 3NS9A 4TNBA 5BQ0A 4W4WA 3OTUA 4L68A 4G17A 4M84A 4IWPA 4WG4A 4YO4A 2RFSA 4QMUA 4RRVA 3WE8A 3P86A 4RG0A 3QQUA 3RHXA 2VO6A 2VWBA 1IAHA 1UNGA 2CNQA 1B6CB 4FKIA 4NYEA 3LOKA 3RPRA 2GQGA 1QL6A 3HX4A 3KU2A 3QC4A 4UZHA 3VBTA 4BI2A 3HA6A 3ZRLA 2JITA 5IMEA 3IG7A 4MF0A 4ZSEA 2A1AB 3SLSA 2ZV9A 3UVQA 4DC2A 4ZY5A 1E1XA 5E8UA 3Q32A 3OC1A 4O7RA 3IKAA 4PTEA 2I1MA 4ITHA 3OBGA 3GFWA 2YIWA 4X6QC 4IAAA 3OD6X 4X3FB 5EOBA 2XUUA 2OWBA 4D5HA 3RK5A 2ZB1A 5LJJA 4FG7A 3EKKA 4U45A 3ZLWA 5M06A 2IW8A 2OICA 4L53A 4NL0A 1LEWA 2QR7A 3FAAA 4LOQA 3UYTA 2V0DA 1JKLA 2OJIA 3PZEA 1IA8A 4RA4A 2RF9A 3RNYA 1UVRA 3CD8A 2WTWA 4U97A 4WSQA 4LMNA 4CTCA 3HV7A 3OWJA 4BDHA 4CV9A 3OG7A 4M13A 1PMNA 3KVWA 4R8QA 5CSVA 3RJCA 4M8TA 4BIBA 4DLIA 1DI9A 3QXOA 5I0BA 3UO4A 4DA5A 4MH7A 4O27B 4BZOA 1OZ1A 3MY0A 3QWJA 2PTKA 1JSTA 2X1NA 3SAYA 4XP0A 3UOLA 4KIKA 5IQCA 3VF8A 3QTQA 2BUJA 4XBUA 3QUPA 5DT4A 2PE2A 2B7AA 3EMGA 5HO8A 4I0TA 4IVCA 3R0TA 4PDSA 3O8UA 5AAEA 4CEGA 4CFVA 3PXZA 4GEOA 3TZ9A 3ALNA 3HV6A 2CGVA 3DBDA 1ZZLA 2H96A 3K2LA 3Q52A 1Y8GA 3UBDA 5AP2A 2Z8CA 3QQFA 4ACGA 1H01A 4WKQA 2WTVA 3MY1A 2WMWA 3QTXA 4JG6A 2OU7A 4MD7E 4QPSA 5ANGA 4XP2A 1ZZ2A 4XUFA 4ZSJA 5LARA 4AFEA 1PY5A 4F1MA 3HUBA 4YJOA 2XNOA 4FIHA 1GOLA 1YWNA 3V6RA 3EQCA 3CEKA 2B55A 3HLLA 4AOJA 5AR8A 4USDA 4BTFA 3WZKA 2PE1A 3PYYA 5L6PA 3DS6A 3Q6UA 4ZTLA 4FKTA 4RFZA 3FYJX 4AOTA 2WHBA 5HZNA 3SX9A 3Q4UA 4LGDA 4C4IA 3IQ7A 2JKQA 2EWAA 5EOLA 3LJ0A 4WRGA 4E20A 4FA2A 2EXMA 2NRUA 2XJ0A 2YLFA 4EH8A 3C1XA 4F1TA 3TTJA 4TYHA 4EKKA 2AUHA 4GK2A 4X3JA 5CSXA 5AAGA 4QTAA 5T3QA 1XH6A 5CF8A 3PPKA 5I9XA 4BHNA 5HX6A 2XNNA 3TJCA 2WKMA 3GCUA 5AP7A 4ZIMA 4IAYA 3E8NA 5AP4A 5C9CA 3TL8A 4D2PA 4DGMA 5I4NA 1GIJA 4D58A 3QCXA 1W84A 4I22A 4NSTA 4QTBA 2IZTA 2XM8A 4HYIA 4TTHB 3AD5A 3T3UA 2FSLX 4WG5A 4DFYA 3GCPA 4Y72A 3LFDA 2Y4PA 2F49A 3THBA 1OECA 1QPJA 3DDPA 4ANQA 3MW1A 4QMLA 1YI6A 2XJ1A 4AT4A 3VRYA 3OWLA 2REIA 3QGYA 1ZYDA 4G31A 3V8SA 2XKEA 5AADA 4G34A 5B2MA 5M4UA 4FTLA 4IZAA 3EFLA 3DKGA 4UWYA 2PYWA 3QL8A 3OXTA 3EN6A 4AP7A 4KIKB 4BDEA 3HP5A 2W1EA 3D7TA 3DU8A 4E73A 4U0IA 4WHZA 2UW7A 3VQUA 5A4EA 5CU3A 5IMXA 3N4UA 1TVOA 3FZTA 2CKQA 3JS2A 4I94A 4IC7A 4FL1A 5BYLA 4IWDA 4IB0A 5HICA 2QCSA 5H8BA 2YM7A 4A9YA 4LMUA 3FL5A 4FKGA 2JD5A 3MV5A 5L4QA 1KV2A 2VNYA 5IUIA 1GY3A 3VBQA 4C58A 4GYGA 4OTPA 4JVGA 3DB6A 1XBBA 3QTIA 3GU8A 3TNQB 4EBWA 5HU3A 3DA6A 4ZSAA 2BAJA 3QQKA 4CZUA 1AD5A 5HG5A 3G51A 2H34A 5LCKA 3BYVA 3ZFYA 2BRMA 2C3KA 5C8MA 3UPXA 2C6LA 4J98A 4CVAA 3QALE 5L2QA 4UB7A 3I6UA 4GVJA 4F09A 2HW6A 3CTQA 4PRJA 3AT4A 4CV8A 4P7EA 5ACKA 4GKIA 3LQ8A 5KX8A 3LQ3A 4O7VA 3W32A 5DGZA 5KHWA 2ERZE 3D15A 1NT2A 4JLCA 2XK6A 4AGUA 3KXHA 3TTIA 5CU0A 5AV4A 4C33A 4KWPA 1MQBA 3BU6A 4TYHB 4W9XA 2XK9A 1FVRA 3D4QA 3DZOA 1R1WA 1JOWB 3TT0A 3KRWA 3CQEA 4L46A 2XNEA 4QMQA 5GZ8A 5J9ZA 1P4OA 3FC1X 4QMOA 3WZDA 4FV9A 3WF9A 3OS3A 3TDVA 5JQ8A 3NUXA 3VS5A 2CSNA 5ICPA 4Z16A 4QNYA 3LHJA 5CVHA 3G15A 3MSSA 4B6LA 3GUBA 5M4CA 5M55A 4KIPA 4BGGA 4D0XA 3I4BA 3NYNA 2OBJA 3POOA 2PU8A 2CMWA 2UZTA 2WTJA 3H0YA 2R0UA 1Q99A 4C4EA 4QTCA 3R21A 5KHXA 4O7YA 3UGCA 3V5QA 1PXOA 3DBFA 4FT0A 3ZH8A 2HOGA 5I9UA 4AA4A 4RFMA 1WBTA 4L00A 1XQZA 2O3PA 4XEYA 3ZONA 4O22A 2VTQA 2HIWA 3MH1A 5KKRB 4EZ3A 3JUHA 1WAKA 4FSQA 2IZRA 4XV9A 3REPA 5IA0A 2OIDA 2JKKA 1UU3A 2R3LA 1PXIA 3LE6A 3QZFA 2WGJA 1YWRA 4IM2A 3AQVA 4U3ZA 2C0TA 4IDVA 4N6YA 4TYEA 2OJFE 4L3PA 5EW8A 4IVBA 3RPYA 2PK9A 4FTIA 1O9UA 2CKPA 5AA8A 3HV4A 2WMSA 3FI2A 3QD4A 5CEPA 5HE0A 4DN5A 3CTJA 3R7OA 4BL1A 3LXKA 2YJSA 2Z7LA 2WFYA 2Z2WA 4BCKA 2QQ7A 4O7WA 1Q61A 1S9IA 2PZYA 4TW9A 3BGQA 3IGGA 3LJ1A 2J7TA 5J7HA 2J51A 4M0ZA 3FHIA 4S2ZA 4O0UA 5M4FA 2UZVA 4PPCA 1OIQA 4RIWA 3AC8A 5ETCA 3LZBA 3C13A 3HMPA 4IM3A 1PYXA 4ENYA 4RJ6A 1IAJA 5EM7A 4I6FA 4EHVA 3MB7A 4QMVA 4X2NA 3MVJA 3PSDA 4F0GA 4OTRA 3BEGA 3DZQA 4QP4A 4I6HA 4M3QA 5HD4A 2R3NA 2X2MA 1YOJA 3W2RA 4EH6A 4ZSGA 5M56A 4DH8A 1WMKA 3Q5IA 3QA0A 2JEDA 3LM0A 1R0PA 3UVPA 1OIYA 2YM3A 3C4EA 4N4SA 1R3CA 5J5SA 2BKZA 5AEPA 2DUVA 3IPHA 1CKPA 1WZYA 4FG9A 1WBOA 5CEIA 3D5VA 2C6OA 2Y4IC 2WPAA 3H30A 2XM9A 3O2MA 5HCXA 1MUOA 3PSBA 3U55A 1KWPA 2PL0A 2XB7A 4MXCA 1YRPA 4CCUA 4U9AA 3FMHA 4BZDA 2WD1A 2C3JA 4FSUA 4L45A 4FNWA 5J7BA 3PXRA 1QPDA 3L1SA 3QUDA 4PMMA 2QHNA 4R3PA 5CSHA 4UN0C 4G9CA 3WIGA 1QCFA 5EYMA 3PDTA 1M2RA 4AS0A 2FA2A 3NW5A 3DXPA 4M15A 2JKMA 2UW5A 1UNHA 3N51A 4R5YA 4IC8A 3WZUA 4B8MA 4FKWA 5AR4A 2GS6A 2X8IA 4XH6A 2X2LA 3F61A 3HAMA 4O1PA 3D0EA 3R1NA 1Y6AA 5DI1A 4PP7A 1GZKA 1JQHA 4O21A 1PJKA 4CRSA 5AFVA 3IO7A 2WU7A 4FKQA 4HZRA 2RGPA 2GU8A 4F64A 3GBZA 3QUEA 4MVFA 1OB3A 4XV1A 2OH0E 4CG8A 2PVKA 4M97A 3PP0A 2LAVA 2UW9A 4JAJA 4G5JA 3SG9A 5CQUA 2Z7SA 3OW3A 3UQFA 4AE6A 2QG5A 2GCDA 2I6LA 5ETFA 3KRXA 5IISA 3H3CA 2FSOX 4ZS0A 3FMNA 4W8EA 3Q4TA 3MIYA 4DEIA 4KAOA 3HRFA 4FKPA 1CMKE 2G2HA 2WMTA 5EDPA 5FBNC 5HG9A 2R3RA 3DT1A 2XA4A 4P5QA 3VS0A 4XOYA 1SVHA 5E8TA 3SA0A 2BROA 4RIWB 2WTDA 1UU8A 1Z9XA 2PHKA 5G1XA 4JIKA 4PMSA 2RSVA 4IDTA 3SRVA 2WQEA 5CTPA 2CGUA 3DK6A 3BE9A 4G3EA 4YZCA 4S34A 4O0RA 4RMZA 1OL6A 1U4DA 2VTOA 4G3CA 4NTTA 4QMXA 5D10A 3UG1A 3Q2JA 2OG8A 3EFJA 2XK4A 2QOIA 2XP2A 3KKVA 4ZSLA 4RX7A 4JAIA 3FKOA 1ATPE 4PDPA 4HW7A 3TCPA 3OMVA 4PMTA 3OF0A 4Q2AA 3EZVA 4RLKA 4W4YA 3M2WA 2OF2A 5E92A 1GJOA 5L6WL 4G3GA 3ORTA 5CASA 2VWIA 4MKCA 3OCBA 2ETMA 5TF9A 4O7TA 2VUWA 3OCGA 3QU0A 2R3JA 4BDIA 1NA7A 4GRBA 4MAOA 5DWRA 3SXSA 4AT5A 5E9EA 3R73A 1LPUA 1KE9A 1Q97A 2C0OA 4F70A 1SM2A 4Y83A 2VTLA 2XRWA 3TV6A 3ZRKA 1H27A 1PYEA 2UVYA 4FIGA 5AJQA 2PZRA 5DPVA 1H4LA 1U5QA 4EJ7A 5BX0A 3QA8A 2JDTA 4M67A 4Q5EA 4EBVA 3ELJA 3EQHA 3NYOA 4QOXA 4BI1A 4CLIA 4D9TA 5I3RA 4LL0A 1IR3A 4APCA 2V22A 4OTHA 3LKMA 3BEAA 2BILB 3ORLA 4DG2E 4MNEB 4EYMA 4NM7A 2PVMA 4BZNA 4DH5A 4C61A 5E7RA 3G2FA 3I0QA 4RVKA 2C30A 4U44A 4CZTA 1VJYA 3Q96A 4IM0A 4I93A 1H1RA 2KTYA 2X81A 3CGFA 3A8XA 5JFVA 4DT8A 2AC3A 2V55A 3EQPA 3MVMA 3CKXA 5EYDA 4UALA 3VS4A 4R7BA 1YHWA 3EN9A 4M0YA 4FKSA 3NIZA 4PL3A 5CANA 4ZOGA 4FSNA 4H05A 3LXNA 4BIDA 4YNEA 3FI3A 2OH4A 4TYGA 3TG1A 2YM6A 3UODA 2Y4IB 1DM2A 3DV3A 2P55A 3FLSA 4KS8A 4IAIA 2IZSA 4AZSA 4EC9A 1YI4A 1GZ8A 3R1SA 2QODA 2W1CA 4AF3A 4LGHA 4FZAB 2W17A 3FPQA 4FGRA 4QNAA 5JZJA 4FYOA 4YJTA 2UW8A 4BI0A 1SVEA 4FKJA 2F7ZE 1W98A 4Z7GA 5C03A 3R8MA 4E6AA 3MS9A 4KD1A 5DYJA 4EKLA 4XOZA 4BICA 3FXWA 4JG8A 1SNUA 3SOCA 4FNYA 4UYAA 4F65A 2BKKA 5AUVA 3SDJA 3CQUA 3KVXA 1JBPE 3BI6A 3V04A 4WUNA 2Y6MA 3JYAA 3DTCA 4AW2A 5CWZA 3BBTB 1UKIA 3Q53A 4M12A 4DEHA 5CVGA 5K0KA 1H08A 4DLJA 4AFJA 2GS7A 5AM6A 4WO5A 4EEVA 2X6EA 3F7ZA 1KV1A 2J0LA 1YXTA 1H1PA 1LUFA 5FUTA 3UC4A 3F5GA 3EFKA 3LFNA 5EW9A 4M68A 4YZDA 2OGVA 5GHVA 3K3IA 1G3NA 2XMYA 2ZV8A 1F3MC 4KKHA 5D11A 4X7QA 2W5HA 1ZY4A 3BKBA 2SRCA 3HGKA 3IW4A 5FEQA 1KE8A 3DLZA 4FNZA 4HOKA 4LG4A 2X8EA 2CDZA 4YLLA 2ITZA 3MH2A 2YISA 5E8ZA 4DH1A 4LRMA 1YQJA 2PZPA 1SNXA 4W9WA 4F9WA 4BC6A 4EL9A 1G8AA 2W1ZA 4RZVA 2CPKE 1PW2A 4I6QA 3TV4A 3BBWA 4ERWA 4S33A 2OXXA 1MQ4A 2C6EA 2V7AA 4AGDA 2VWUA 1YDSE 2JBOA 3BHUA 3CY3A 3DCVA 3GENA 3NNUA 4YGAA 4DINA 5C4LA 2X9EA 4ASXA 2BRGA 4UMRA 3BU5A 3LFCA 2QG7A 1OUYA 2P0CA 4IAKA 2PZIA 3PVGA 4M69A 2BPMA 1H26A 3S00A 2JIVA 1GZOA 5L3AA 4GUBA 3GU6A 3LFEA 1JSVA 3Q60A 3R1QA 1M7NA 1CKJA 4XNEA 4K77A 5LXMA 3TNPC 3LVPA 5KO1A 3V8WA 3OY3A 3SQQA 3RP9A 2YERA 3E88A 3NUSA 4FEWA 3SG8A 2VAGA 4O0XA 2IW9A 5AA9A 5JEBA 2BCJA 2ITUA 3IONA 1K2PA 3Q4CA 4O2PA 4BGHA 2QVSE 3PJ2A 4C3PA 5C27A 3P9JA 4RJ3A 1ZAOA 4ZAUA 3LW0A 4DTKA 1BMKA 2JDVA 5AUXA 3VQHA 4BCGA 4EWHA 4HZSA 3E93A 5AWMA 3CPBA 2PVFA 2UZNA 3GOKA 3LJ2A 4FEXA 4QQ5A 4AN2A 2XK8A 1FGIA 1P2AA 2GHMA 2Q0NA 1GNGA 3O7LB 3DBCA 3G6HA 4TWNA 2J0KA 4PDYA 1J1BA 5DBXA 2R3IA 2HY0A 4JDJA 4BDDA 5CZIA 2UUEA 5LMKC 4KUJA 4BDFA 3COKA 4HPUE 3UMXA 3W18A 2I0EA 4X3FC 4RWJA 1CTPE 1W7HA 4JBVA 1JLUE 1M52A 4UWCA 4HGSA 2VTIA 4FV8A 3RALA 3TUDA 4RIYA 5FG8A 1VYZA 4B8LA 4QYYA 4JBPA 4EOKA 3A7FA 4WIHA 3MWUA 4XP3A 5J5TA 4AG8A 3S2PA 1Q8YA 2AC5A 2RKUA 2YJRA 2JIUA 5IA3A 5IEVA 3NW7A 4D1ZA 3B8QA 4I4FA 1PXPA 4NFNA 5E1EA 2OK1A 1XR1A 4JG7A 4LL5A 5JZNA 4TL0A 5CALA 4ZZNA 4C7TA 5D9HA 5AP5A 4I0RA 5EHLA 4ZZMA 5F20A 2WXVA 5CEKA 1OITA 2J0JA 3EN5A 2YWVA 5BVWA 4QMYA 4L42A 3L8XA 5CI7A 1UV5A 2RL5A 3T3VA 1Q3DA 4RT7A 1YW2A 2WU6A 4YLJA 3FBVA 3GCVA 5DRBA 3DAKA 2W99B 2XIYA 2IVUA 5ANOA 1HOWA 4L43A 3RKBA 2KULA 5AV0A 4JQEA 4G6NA 4U42A 3QTRA 3SKCA 3OTVA 5L8KA 5LMKA 3EQBA 1JAMA 3KEXA 2BHHA 3FQSA 2J4ZA 3C4FA 3QTSA 4O6EA 5HKMA 4X3FA 3ZM4A 2QLUA 4AUAA 4E26A 3GQIA 3F9NA 3KF4A 3UIUA 3ZSGA 5IUHA 3MTFA 4KKEA 3ZLYA 4MHAA 4FTQA 4ZMFA 1V0PA 3TZ7A 3DNDA 3UVRA 4HNIA 3MIAA 4BDGA 1SYKA 3AXWA 3ZO2A 2BAKA 4YPSA 3CBLA 4GK4A 4FSYA 3O51A 3COIA 3FC2A 5EFQA 5HIDA 4C3RA 1XO2B 4YPDA 2W9ZB 5GJGA 1VZOA 5CF4A 4OBOA 4UMPA 4BCJA 4QPMA 3ZYAA 2HZNA 4D2WA 4ANMA 4KB8A 1DI8A 3L9MA 5FRIA 3CY2A 3ZO1A 3NZ0A 4RJ5A 4QP9A 2YHVA 4JRVA 4RIOA 1KE6A 5HNGA 4EWQA 3PA3A 4FT9A 5DFPA 1LEZA 2W1GA 2OO8X 1W0XC 4DEGA 4QQCA 5LOHA 4G6LA 2F7XE 4RIYB 3UO6A 3UYSA 3MDYA 2PWLA 5EH0A 2UVZA 4FTCA 2Q0BA 3RAKA 4I23A 3D2IA 5FXQA 3A2CA 3ZXTA 3EL7A 5J1VA 3ULZA 3PWDA 5DNRA 2C6MA 3UQGA 4DGOA 5IA4A 3HKOA 3UP2A 4HVDA 1H1SA 4AQCA 4O83A 2XRUA 2Y9QA 3FPMA 3KQ7A 1XH5A 1YXXA 5HX8A 2C3IB 2J0IA 4KA3A 2VTAA 1O6YA 3BX5A 3COHA 3PRFA 4W4XA 4Y95A 1B39A 3VS1A 4G6OA 4CMUA 4DFZE 4RQKA 4FODA 2XKFA 3PIZA 1X8BA 2R2PA 2X2KA 3PG1A 4MCVA 2JAMA 1JVPP 2VN9A 3OXZA 2WTCA 2VWWA 4I3ZA 2B53A 4NW5A 4ZJIA 2W5AA 3GOPA 4OAUC 4AZTA 4C0TA 5HLPA 2BHEA 3IOKA 4JT3A 2UZUE 3R7VA 3WYXA 2VTSA 2R3HA 3C9WA 3K3JA 3FWQA 3QRIA 2FB8A 4FZFB 3RI1A 2VRXA 2X39A 4BCPA 4HVSA 3NCGA 4A06A 4O6LA 3R8UA 2XF0A 4E6CA 1LP4A 4ENXA 3CLYA 3TIYA 5KMLA 3LCOA 1L8TA 1CSNA 3BE2A 3I5ZA 4FKUA 4QMSA 2R3KA 2W4JA 4YTCA 4GK3A 3FJQE 2Y6OA 4F99A 3F5XA 3IDBA 3QBNA 4DEAA 3BLQA 4XG3A 3OUNB 4FTNA 5ACBC 3LAUA 4BWPA 4UBAA 4PNKA 4FEUA 1RW8A 4HVGA 2HELA 4F6SA 4FZ6A 4NW6A 3NNWA 4I5MA 4BFMA 4EH4A 4E4LA 5E8XA 3W2CA 1S9JA 1IASA 2ITVA 5HESA 2QOLA 5CI6A 4R77A 2E9PA 2WQMA 4J96A 1KE7A 1BL7A 4XG6A 3TZMA 3GC7A 4RBLA 4W8DA 1W8CA 2R9SA 3UNKA 1LR4A 2CNVA 3R9HA 4GIHA 4YJRA 4UV0A 4I5HA 5E8SA 1L3RE 1QPEA 3AGMA 3LPBA 4ZTRA 3EKNA 2PUUA 4HYUA 3C4WA 2I0VA 4FT7A 3UZPA 1F5QA 3IDCA 3ITZA 1OKZA 3BV3A 4KNBA 5FTOA 2WQNA 4AW0A 5JFWA 4AAAA 4EOJA 1UWHA 2GTMA 1G8SA 1UA2A 3PIXA 3QRJA 5ANKA 3HECA 3PY0A 1UU7A 3F2AA 3VW6A 3C0HA 5BMSA 3E8CA 4I5PA 2F2CB 5AR2A 4M66A 4G2FA 4AU8A 5KKRC 2J5EA 3QCQA 3QWKA 4E7WA 3F3UA 4ZJVA 1XJDA 4NKAA 2C5OA 3F2NA 4FEVA 5T68A 3C4CA 5HIBA 4USEA 4MXYA 3WILA 3FLZA 4A7CA 4K1BA 1URCA 2W1DA 3QTWA 1V1KA 4BB4A 3F69A 4OTQA 2ZM3A 3VS6A 5ETAA 4CXAA 3PTGA 5AR3A 4ZJJA 3Q3BA 3VULA 2ETKA 4AGCA 3QD2B 4QO9A 5FBOA 2QNJA 3UPZA 3F7WA 5JQ5A 1JSUA 2NRYA 1WBSA 4BDJA 3JVRA 5DG5A 4L3LA 4F7NA 3QHWA 5HD7A 2YAAA 5HVYA 3KXZA 5LMAA 2XVDA 3OCSA 4JDIA 4O7LA 1WBVA 3NW6A 5BMMA 1SZMA 3ZFMA 2ITWA 3D9VA 4J99A 3DFAA 4YP8A 3IW6A 3LXLA 4MF1A 3GCSA 3VBWA 1NVRA 4I41A 4FKVA 3AC5A 4GJ3A 5IKWA 3JY9A 2VX0A 2VV9A 4QP8A 2ITPA 4N70A 3EJ1A 4QYEA 3TKUA 4CCBA 2PMNX 3PY3A 5K9IA 3AC3A 5EQYA 4I92A 5JGDA 4O81A 3Q9WA 5LVMA 2NNWB 4YTHA 3IW7A 4YHFA 5L2IA 3V5JA 4E5BA 3RHKA 3MFTA 4QMPA 3NSZA 3WIKA 1JWHA 4F9YA 3ID6C 4FICA 2XEZA 3IDPA 4WUAA 3R7IA 4FV1A 5L6OA 2WIHA 5AV1A 2HWOA 1CKIA 3FV8A 4E6QA 4YJSA 2IWIA 4MTAA 5AR5A 1ERKA 4IWQA 2DQ7X 3KF7A 4RJ7A 5EKOA 4ANBA 4UX9A 3KA0A 4MQ2A 3AD4A 3GCQA 1ZYJA 4MQ1A 1OMWA 3OP5A 5KUPA 3EYGA 2C6TA 3G90X 2V5QA 4LQMA 3P0MA 5TKDA 2WELA 3HAVA 5IH5A 4AX8A 3G6GA 1J1CA 5B2KA 5IEYA 3EQFA 3MESA 3UMWA 3EQRA 5E8YA 3I7BA 2UZLA 1FGKA 5BVKA 4E4XA 1EH4A 1OPKA 4WRSA 2ESMA 4BRXA 2P2IA 3I79A 4R6VA 4APPA 2HAKA 2UW0A 4FR4A 3WF8A 3LFQA 5F9EA 3ZUTA 4U5JA 3OZ6A 4MXOA 2X7OA 2W05A 3TNHA 4IFCA 4YBKA 2ITQA 2RFNA 5HOAA 3LLAA 5HVKA 2XBAA 5IG1A 4G16A 5EKNA 4DH7A 2YDIA 3FZRA 2BDWA 4KINA 1QMZA 4XLVA 4A9TA 3MI9A 5BUJA 5EHOA 3ATSA 4KSPA 4C37A 2QO7A 5A4LA 3UTOA 1W83A 2WQOA 3HNGA 3POZA 5BYZA 3UC3A 3ZSIA 4BWKA 3I7CA 1W82A 4MD9E 1A06A 3TNWA 3W8QA 2BALA 4H3QA 3LMGA 1JNKA 5E8VA 5IA5A 1GAGA 2J5FA 4J97A 2V7OA 3OXIA 4I4EA 4WA9A 4O84A 4XG8A 2WMUA 3R04A 2PVRA 4KIOA 3SXRA 5K4JA 4ONAA 1I09A 3NEWA 2IG7A 2VD5A 3D5XA 3N9XA 4JDKA 2YCQA 3I1AA 2QONA 3D2KA 3ZSHA 1XH7A 3JXWA 2GDOA 2YABA 1ZMVA 3C0GA 1TKIA 2IZUA 3EOCA 4MWHA 5C1QB 4YO6A 2OFVA 2VWVA 5EI8A 3S3IA 3S4QA 3K54A 4X2KA 1U46A 1IG1A 3U87A 3R7GA 3MPTA
chains in the Genus database with same CATH superfamily
2QURA 4GG5A 1U54B 2R3QA 2A0CX 5AV3A 3R71A 3O0GA 3QQLA 3OVVA 4X0MA 3MY5A 4DG3E 3DQXA 4TKSA 2C0IA 4H3BA 4H58A 2YIQA 3OOMA 2J2IB 3ORZA 3P1AA 4K8AA 4Z7HA 3LMIA 1ZOHA 3ENHA 4LV5A 4MXZA 2XIRA 4ZTMA 5L2SA 5M09A 3ACKA 4J71A 2AYPA 4JQ8A 1TQPA 3R83A 4I24A 3D94A 4X6RA 1ZY5A 3NAXA 5CZHA 4IBMA 1XH9A 2PVJA 5GZ9A 1H25A 2R3MA 3WF7A 2X4ZA 2G1TA 3AMBA 4D4RA 1MRUA 4C4HA 1H07A 3C5UA 2XNPA 1GZNA 3PJ8A 3UDSA 5I9WA 4RJ8A 3F3TA 2BZHB 1WVWA 3RVGA 3FMJA 3VRZA 1UU9A 3MGYA 2UZOA 2Z7QA 3FLNC 5H3QA 4B9DA 4NFMA 3R8VA 5A4QA 3NIEA 4ITJA 5FTGA 5KBQA 2WMAA 2PUNA 4MD8E 1OUKA 3E8EA 3HMMA 3SGCA 4DDIA 4QP6A 4NJDA 4K9YA 1WBNA 2PMLX 4F6UA 5LMBA 1FMKA 3UQCA 3V01A 4D28A 2C5XA 3O8TA 1NVSA 2NO3A 4ITIA 5GNKA 2VNWA 4NJ3A 1FOTA 4YNOA 1YDTE 2BRBA 4A4XA 4F7SA 5K5NA 4O0VA 5AUUA 2PY3A 2EVAA 4F08A 2W9FB 5KZIA 4FV2A 1Z57A 5FD2A 4KKGA 5LVLA 1XWSA 4TYJA 4YMJA 3LFSA 4CSVA 3EZRA 3KB7A 2OIBA 3O71A 4O0YA 4NT4A 4RX9A 2B54A 2O2UA 4DE4A 3E5AA 4KRDA 4MWIA 4TPTA 3ZUVA 2IVSA 2DYLA 3TJDA 4EK3A 1OL5A 4L8MA 4MNEA 3HYHA 4L7SA 4BKYA 5KMKA 2O8YA 4I6BA 4F1OA 3UDBA 1WCCA 4F63A 5IA2A 5IQAA 4A4OA 4LYNA 3AGLA 5JH6A 1YXVA 3D83A 3Q5ZA 3R9OA 2OLCA 1YOLA 3BLHA 5F1ZA 3NRMA 4J1RA 3CJFA 3FY0A 2PVLA 4FTJA 4EUUA 4XS2A 3D5UA 3ZEWA 4CD0A 3T8OA 1J3HA 2CN5A 4EOSA 5TOZA 4PF4A 5HORA 4RFYA 2IO6A 4QEBA 3BYMA 2R3OA 3HA8A 5AMNA 3GC8A 4BBEA 4IH8A 3W1FA 2QLQA 5GJFA 1Y6BA 3ZEPA 3R7YA 3MH0A 4YSMA 3WF5A 3PSCA 2A2AA 3FI8A 4UMUA 3DK7A 4DCAA 3KC3A 2PPQA 4EOPA 2BZKB 1XH4A 2VO0A 3NAYA 3FUPA 2EXCX 1PXMA 4K6ZA 3I0OA 4XJ0A 2GNJA 4NIFB 3UP7A 4GKHA 3FSFA 2PVHA 2JFMA 4GL9A 1PRYA 5M53A 5AUWA 2YLEA 3NUAA 4JIAA 2W96B 4FT5A 3DJ7A 2EUFB 4PQNA 2BIYA 4TRLA 3UJGA 2A27A 3GC0A 2W7XA 4C35A 1PXNA 3CSVA 4QD6A 1M2PA 3DXQA 4OT5A 1Y57A 2WZJA 4GVAA 1WVXA 4IB1A 4OTWA 3WOWA 3TWJA 1YOMA 2QC6A 5FQDC 4QDEA 2HY81 4AT3A 3NUNA 4GJ2A 4A9RA 4ARKA 4BCIA 5EQPA 1YXSA 3W8LA 2VTHA 3EFWA 2BZIB 3F82A 1R39A 5DN3A 4DYMA 1M7QA 4MX9A 2F7EE 2W0JA 4NM5A 4HYSA 5IQFA 4FOBA 4AW5A 1Q8UA 4EH9A 4FUYA 3U6IA 5E91A 2HZ0A 2J6MA 3Q2MA 4IACA 2QOBA 3QRKA 2GMXA 1KE5A 3RM7A 2JBPA 4H3PA 2BZJA 2JIIA 4WD5A 3VO3A 1J7UA 2R7BA 3OWKA 4Z55A 3HV5A 3M42A 3NPCA 1Q5KA 3UOKA 1V0OA 4HVHA 5KMNA 2RFEA 4FZDB 5FM3A 3FEGA 4DFBA 2CCIA 2EU9A 4JRNA 4O0WA 4YHJA 2X8DA 1H1QA 3AC4A 3OY1A 4U3YA 2QKRA 5CLPA 3S95A 5CF6A 4R5SA 2BR1A 4CFXA 4J53A 2WMQA 1WBWA 2J90A 5EG3A 1Q24A 1OIUA 2BRHA 5EM6A 1YXUA 3LLTA 3N4TA 2H6DA 3E87A 4YHTA 5D7AA 4EQMA 5CXZA 2RFDA 1HCKA 3DAEA 1A9UA 4WT6A 3KXGA 4NWMA 5AAFA 2XYUA 3VBXA 4G1WA 4O0SA 4BWXA 3E7VA 3F5PA 4CMTA 5HBEA 3FMKA 4EOMA 4AOIA 3W2QA 4FL2A 2OXDA 3R01A 3DBEA 3PJ1A 5A4TA 4E5WA 2YN8A 3A99A 2XNGA 4IIRA 5ITAA 3VS2A 3EQDA 3KRLA 3MH3A 2PVNA 5AM7A 5DRDA 4EOLA 5HCYA 3VUMA 4CYIA 5IQIA 4I20A 5HNBA 5K4IA 2ITYA 2C69A 2ZAZA 1OBDA 1REKA 4FIIA 2G9XA 1BI8A 3DK3A 4PPAA 4QTEA 3ZU7A 1MRYA 2IW6A 4GU6A 4I0SA 4U80A 4QMTA 2PVYA 4CYJA 5GIOE 3GXLA 3R8LA 3V5WA 4BJJA 1PMVA 3MVHA 4F78A 4AE9A 2IVVA 5J9LA 2A4LA 1ZARA 1XKKA 3GU4A 3ODZX 2Y7JA 5DHJA 5CU6A 5J8IA 3WI6A 4E3CA 1Q8WA 3PLAE 2V62A 3KXNA 4ANOA 1JKKA 2X7GA 4FBXA 3HMIA 3PUPA 3VHEA 3VVHA 4PDOA 4XYFA 3ZZWA 2I7QA 3RTPA 3H9RA 4QTDA 3TUBA 2VWYA 2IF8A 2VZ6A 2ONLC 1BKXA 4O96A 4AZEA 2Q83A 3RPVA 4AXFA 4E8AA 3QCSA 2P2HA 4E4MA 5CS6A 5EM5A 4AN3A 1R78A 3KXXA 1G5SA 3A7IA 3R30A 2ITNA 4DGGA 4IEBA 1V0BA 3BHTA 1TQMA 4ZZOA 1OL2A 4X21A 2WOTA 3ZLXA 4IJ9A 1OL1A 4RA5A 5C26A 2PUIA 3EL8A 2GSFA 5DEYA 5HVJA 3IOPA 1OKYA 3VIDA 5HU9A 4OAVB 3VJOA 3Q6WA 5EYCA 2XKDA 3Q4ZA 3FMEA 3D7ZA 4A9SA 4FV5A 5HGIA 4EK5A 5IPJA 5L2WA 4RVLA 2CCHA 4FSWA 4HCVA 1OVEA 3C5IA 3RPSA 3AKKA 4R3CA 3NNVA 3R28A 3H0ZA 5D12A 4FE2A 3P7CA 5AR7A 2WAJA 3KY2A 5HE1A 4DDGA 3LFBA 1FVTA 5FXSA 3GVUA 3PPZA 1ZOEA 4R3RA 3RZBA 2XNMA 4QMMA 4AW1A 2GNHA 3BV2A 4XHKB 3RNIA 2OKRA 4NCTC 3N4VA 3KL8A 3F3WA 1CDKA 4DEEA 4PPBA 2BMCA 3BHVA 2GNFA 2W1HA 3NCZA 4UY9A 4J95A 5HBJA 2ONLA 3RINA 3UOJA 2ETRA 1M14A 1ZYLA 2UW6A 4IQ6A 2JC6A 4X2GA 4NTSA 4JDHA 3BL9A 5CAVA 4PL5A 3SVVA 4RZWA 3EH9A 5HG7A 2QR8A 3LM5A 3TV7A 4RSSA 4TWPA 4BCFA 4DF3A 2QI8A 2C1BA 4H39A 4G5PA 4U6RA 5FLFA 2GQRA 4YJVA 4OW8A 4FSRA 4LV8A 2WMVA 4IMYA 2XALA 4L9IA 1BLXA 2WTKC 3QQGA 3VJNA 3TNIA 4WNMA 4JXFA 4V0GB 4OLIA 5HQ0A 5HI2A 4EK6A 2UVXA 1DAYA 3WF6A 4CKJA 2IJMA 3HMNA 1ZRZA 5BVFA 3MA3A 5KMJA 3ORXA 3Q9XA 3O17A 2ZFYA 1ZWSA 3VS7A 2ITXA 1BL6A 3ANQA 1ZYCA 2CGWA 2C1AA 3IS5A 1P5EA 4FGBA 1AGWA 5LVOA 2QU6A 3BWJA 3H9FA 4NCTA 4EH2A 3PUFC 4XG9A 3OCTA 1YHVA 3VUHA 1J91A 4PY1A 4P5ZA 2QKWB 4OTIA 4ZY4A 5HTIA 1J7IA 2ZM4A 4R7HA 5IQDA 3DB8A 1SVGA 4FYNA 3ZUUA 2WQBA 1OKWA 5AP3A 3C4ZA 5FDXA 1GIHA 1XBCA 3GQLA 4Q5HA 4HVIA 3RAWA 4D2RA 3CXWA 2QOFA 1QPCA 4JX7A 4DGNA 3ZDIA 3G9NA 4EONA 2XAOA 2CGXA 2PE0A 5IU2A 3QCYA 3L9NA 3W0RA 4BKJA 4ALWA 4TN6A 2Z7RA 3DAJA 4BGQA 3WYYA 2Y0AA 1FQ1B 4NM3A 4EORA 2YM5A 2B0QA 3KFAA 2P3GX 4PTCA 3BHYA 3V5LA 5HTBA 3ZMMA 3GP0A 2R3FA 4JQ7A 4FIEA 4FTTA 4K2RA 2FSMX 4DFXE 2BIKB 5IDNA 4MBJA 3HZTA 4O4CA 5AIKA 3OBJA 4TYIA 5HE3A 5BVOA 3HP2A 5FP5A 1O6KA 3BHHA 5GJDA 4BN1A 4CT2A 1I44A 2C68A 4QRCA 5C4KA 4AN9A 4KABA 2JDOA 3F3ZA 4H1MA 2F9GA 5L8JA 1VEBA 2YM4A 3NYVA 4D2TA 1FBNA 3R9DA 4S31A 4GMYA 4RWLA 5D1JA 2GNIA 3T9IA 3AMYA 5KBRA 4V01A 3V5TA 4X2FA 5KE0A 3E64A 4YZMA 4DT9A 4YJUA 1P4FA 2J0MB 2W4OA 3OW4A 2LGCA 3QF9A 4II5A 5CEQA 4Q9SA 4BCHA 2OW3A 3CP9A 3RGFA 4O38A 2ZMDA 4EZ7A 4F4PA 4F6WA 1Z5MA 5CYIA 3I6WA 3DFCB 4TWCA 3BQCA 3TKHA 3Q9ZA 2H9VA 4CFMA 1RQQA 3E8DA 4QT1A 4UXQA 4PTGA 4U43A 3D5WA 3PXYA 5H8GA 3RAIA 1UWJA 3BLRA 3ODYX 3RAHA 4FKLA 4GFGA 3LFFA 4Z9LA 4Z3VA 5A4CA 2CHLA 1TZDA 3KRRA 3U4WA 4YSJA 4IAZA 5F4NA 4R1VA 4IZ7A 3UIXA 3ZC6A 2XJ2A 3DPKA 2JDSA 3FKNA 3UZRA 2C4GA 2YFXA 3FL4A 3QKMA 3TACA 3PFQA 4NZWB 5ETIA 3A7GA 3D14A 3U9NA 1XHAA 2EXEA 4F0IA 2PZ5A 5BVNA 5HG8A 3LCSA 5HNIX 1TQIA 3ATTA 4NKSA 1F0QA 3QXPA 5AP6A 3R2YA 2B4SB 4KBAA 2QO2A 2CLXA 2RG5A 4DEDA 4GCJA 4DFNA 4IVDA 3SHEA 1OPLA 4CMOA 3W0OA 4XRLA 3ALOA 2FYSA 3QHRA 1RE8A 4GH2A 3II5A 3EIDA 4ANLA 4ASZA 2UZEA 3O96A 4EYJA 5CSPA 4KIQA 5M4IA 3QQJA 3QD0A 4FIJA 4G9RA 3V3VA 4EJNA 2YM8A 3JVSA 4IADA 2VGPA 4KS7A 5IUGA 3QC9A 4IE9A 5JSMA 1FPUA 3OHTA 2WTKB 1M2QA 5CENA 3BCEA 4U79A 5CU4A 5FGKA 3CKWA 4XBRA 1JKTA 5C8NA 4U7ZA 3QTUA 3IK3A 4MK0A 5J79A 2PULA 3DBQA 5B0XA 3QGWA 5CU2A 3BU3A 4MUQA 3W0SA 3CPCA 2GTNA 1IRKA 4FVQA 3EQIA 2XANA 2BFYA 4L6QA 3E7OA 4MBIA 5DR6A 1PXJA 1VYWA 3EQGA 5IQHA 3UE4A 5CF5A 4WNKA 2XCKA 4GT4A 5LQFA 2ZB0A 1U5RA 4QYFA 4EOOA 3LMHA 3P08A 4XCUA 3SC1A 1ST4A 3VNTA 2HYYA 4MBLA 4ZXTA 4CTBA 2Z60A 4A4LA 3QX2A 1BUHA 2UV2A 1NVQA 3OT8A 4D4VA 3BYOA 3CTHA 3ERKA 3NUUA 4LUDA 4OTFA 4UZDA 3SW4A 4BCQA 4DBXA 1RDQE 3ETAA 3R9NA 3MJ2A 2VTNA 4HYHA 3W2SA 4FNXA 3PXQA 3ZDUA 3QZHA 4DH3A 2X6DA 5A6NA 3FLYA 3DJ5A 2VWZA 4JR7A 3PY1A 3HMOA 3BRBA 3DKOA 4U81A 4ZLYA 4H36A 1GIIA 3WZEA 4Q9ZA 1OI9A 3UOHA 4FTUA 4D2SA 3L8PA 5I9YA 3C0IA 3KCFA 4YZBA 5AV2A 4L52A 4YBJA 5CY3A 3VBYA 4MXAA 3W16A 4ERKA 4C4JA 4UWBA 5ANDA 2JKOA 4KBKA 1ZOGA 3A60A 4L7FA 3KMWA 4V05A 2ITTA 3CQWA 3OWPA 4LUEA 3RMFA 3RPOA 3KULB 4WG3A 3OOGA 2C6DA 3CR0A 3C51A 5G6VA 4CLJA 3R9RA 4AQKA 5H9BA 3RBWA 5CXHA 4FSTA 3W2OA 3DGKA 4C38A 3R7EA 1A48A 4DHFA 4ZK5A 3TKIA 3CIKA 3DJ6A 1OPJA 4QMZA 4N6ZA 3WZJA 3ZLSA 4AZFA 4E1ZA 3PG3A 4B0GA 3ZS5A 3ZCLA 3Q04A 4YTFA 4GV1A 3RCJA 4JBQA 2ZM1A 3KN5A 3FZOA 3LXPA 4I1ZA 1KUTA 4ZP5A 4IW0A 4TT7A 4F7JA 3LCTA 3OEZA 2YIXA 5DA3A 2UZWE 2GPHA 3VW8A 5HO7A 3R1YA 1Q8TA 4OGRA 4TXCA 3HDNA 1OGUA 1RJBA 3DKFA 4IFGA 3ZC5A 4BIEA 3BL7A 1H8FA 2BVAA 3A61A 4D5KA 4PUZA 1KSWA 4ZS4A 4FVPA 2B9FA 4J8NA 5TO8A 3FZ1A 3NR9A 3R7UA 1FINA 4ZEGA 4O2ZA 5AUZA 4BTKA 3P4KA 2VTTA 3HUCA 2IPXA 3QZIA 1M17A 4LRKA 3CCNA 3BWFA 4BVUA 3NUYA 3GB2A 2HZ4A 4NEUA 2OI4X 3W2PA 4FUXA 2O0UA 5EI2A 2WMRA 2YDKA 4RVTA 5CT0A 4EI4A 5C8KA 3AC1A 2FO0A 3EN4A 2BTRA 5DR2A 3KMUA 4C62A 4U40A 2YIYA 4QQTA 2E9NA 2Y8OA 4K11A 3ZFXA 4C2WA 5IA1A 2XZSA 4AXAA 4CQEA 2JGZA 4IX5A 4CZYB 2B52A 3QTZA 3SOAA 4G3DA 2YACA 1FVVA 2YAKA 3F2RA 5A3XA 4ASDA 4A9UA 2P4IA 4DEBA 1ZXEA 4Y73A 4QMNA 3FHRA 3B2WA 3ORMA 3W10A 5BPYA 2YCFA 1U54A 3NNXA 4S32A 4C4GA 4ZLZA 1VLRA 2BDFA 5EQEA 4QPAA 4G3FA 3CGOA 4FV6A 4N0SA 1REJA 3DDQA 3MJ1A 3P5KA 3NUPA 4D0WA 3W0PA 4BY9E 4O1OA 4JS8A 4JJRA 4QP3A 5E8WA 3WBLA 4ACCA 3NFFB 4AA5A 1H1WA 3I5NA 5CQWA 1MP8A 5HTCA 5TE0A 3VUTA 1Q8ZA 4YURA 2OZOA 3UO5A 1PHKA 1XH8A 4FKRA 5H2UA 5M07A 1BI7A 4RX8A 3WARA 3HEGA 4IJPA 3NYXA 2QOHA 1H0VA 1H28A 3O8PA 3G0FA 4DCEA 5M44A 4NM0A 4NU1A 1NW1A 2VX3A 3JY0A 2QOCA 2VTJA 3K5VA 2UW3A 3KCKA 4M14A 3P7BA 3V51A 3ENMA 2X7FA 4OT6A 4QMWA 3QAME 4XV2A 2GHLA 2R7IA 2G01A 2HENA 2VU3A 4EQUA 4FJVA 4PWNA 2F4JA 1MRVA 3MFRA 4CKIA 2G15A 3OEFX 5M51A 4J7BA 2VX1A 4RGJA 5KMIA 3MPMA 4BDCA 2GNGA 4BCNA 4GUEA 4QP1A 1YHSA 3ZBFA 2QU5A 2ZMCA 4RQVA 2O63A 4EH3A 4XLIA 3F5UA 5KCVA 2B1PA 5BVDA 4RIXA 1VR2A 3TN8A 3FYKX 5IDPA 3P79A 4PX6A 2JLDA 2C3LA 4OUCA 3MB6A 3GU5A 4U41A 4PMPA 5CAOA 5LVNA 4IX3A 4DGLC 4EQCA 3PFYA 4ZTHA 3S1HA 3R6XA 3FKLA 3EHAA 2H8HA 4ALUA 5T6KA 5JK3A 5FXRA 1PXLA 3PE1A 3PJ3A 4AA0A 4EC8A 3R8PA 3ROCA 2QO9A 2WO6A 3KK8A 2VGOA 3OFMA 5L8LA 4JBOA 3KXMA 4EOIA 4YC6A 2PSQA 4IWOA 4O7ZA 1P14A 4QYHA 4EK4A 2WB8A 3D7TB 3HVCA 3M1SA 3MTLA 3C50A 2B9HA 3VS3A 1PKGA 4Y5QA 5DIAA 3U6HA 3RCDA 4C57A 5LCJA 4FTOA 4DHJA 4BTMA 2VO3A 4IB5A 3MA6A 4UMTA 5HEZA 2E9VA 2OFUA 3PE2A 3U4UA 3GGFA 1KOBA 3SW7A 4LM5A 5IF1A 2OF4A 4RX5A 3FE3A 3COMA 3KMMA 5DEWA 2RG6A 5AP0A 1NXKA 5FP6A 3UZTA 4YZ9A 5J1WA 5IQEA 3FMDA 2XK7A 4BYIA 2J50A 5GINE 2R64A 4B4LA 5AX9A 3ULIA 4NIFA 4USFA 3KGAA 2E2BA 3U51A 5IH4A 3NVMB 4OBPA 4JL9A 2VTRA 2UZDA 3TXOA 2Z02A 3QRUA 2UW4A 4RC4A 1UNLA 4XV3A 2B9JA 2ACXA 5DE2A 5J87A 4DHIB 2B9IA 4GS6A 4K0YA 4ANSA 5JFSA 4O7NA 4YTIA 4EHEA 2YITA 4YC8A 4FG8A 4KSQA 4FEQA 4ZLOA 1W2FA 5CT7A 5M08A 2CNUA 1URWA 4RIXB 3NMUF 3QZGA 1NY3A 3RZFA 5JN2A 5ANEA 3ZTXA 4FSZA 4IZYA 4F0FA 4FT3A 3NWWA 4DTBA 1H00A 3MN3A 4RC3A 3E92A 3LFAA 5DR9A 3H10A 5E90A 1WBPA 3K5UA 3VN9A 4YU2A 2BDJA 5EYKA 4F7LA 4UXLA 3V8TA 4ANNA 3G33A 4IX4A 2HK5A 4GFMA 2JDRA 3ZRMA 4FZ7A 5EDQA 5L2TA 4FTRA 4HGLA 3VUIA 1ZMWA 5M57A 3ZXZA 3FLQA 5IQGA 4XMOA 4EUTA 1APME 2C47A 3HL7A 4GYIA 5A14A 4O7SA 4C4FA 3A7JA 4O4BB 5GZAA 4E93A 3GFEA 5FEEA 5KZ0A 3ORNA 2X4FA 3A62A 1IEPA 4D2VA 4Y85A 2NP8A 3QLGA 4B7TA 2YIRA 3PZHA 4BYJA 3TIZA 4ID7A 2OZAA 5FDPA 2QD9A 4LGGA 4GG7A 5AIRA 3H4JA 4BBFA 5LWMA 5BVEA 4D1SA 3UIMA 5LWNA 2CN8A 4BF2A 2OIQA 4W4VA 2FH9A 3DY7A 4U8ZA 4XG4A 4OR5A 3CC6A 2WNTA 3O7LD 3I81A 3PA4A 4GW8A 3MBLA 4L67A 4E5AX 4HGTA 3IGOA 3ZM9A 2BFXA 4O91A 4DTAA 2FUMA 2IVTA 2YWPA 5DOSA 2X9FA 3PRIA 3AMAA 3VUDA 1IA9A 4FIFA 5FWKK 3MFSA 5JRSA 2WIPA 5TT7A 3Q9YA 3VHKA 3MVLA 2P33A 3B2TA 4HCTA 1YKRA 4CNHA 3T9TA 4F9CA 2ZDTA 4ZTSA 4TWOA 5GIPE 3PXKA 2VWXA 3ORIA 5CX9A 2QOKA 5IQBA 2OJGA 1K3AA 3G9LX 1WVYA 3A4OX 4IANA 1YI3A 2WMBA 4JNWA 5CEMA 5K5XA 1KOAA 4LFIA 4ACHA 4EOQA 4ASEA 4E4NA 4RLLA 4EH7A 2DS1A 4UYNA 5DT3A 3VC4A 3NVKI 4RC2A 3NLBA 4D4YA 4GT5A 3AG9A 4QYGA 3O23A 2F2UA 4CG9A 4BBMA 4RVMA 2PMIA 3ZZEA 5CNOA 3R63A 4PL4A 3DTWA 4FVRA 2QOOA 3RK9A 5EHYA 4NK9A 3QKKA 4C3FA 3P78A 5IZFA 4GT3A 3BELA 2OXYA 5HLWA 4F9AA 5BYYA 3JPVA 4DBNA 1PF8A 2GHGA 4DG0E 4JOAA 2W5BA 3FXXA 3FZSA 4O0TA 4FK6A 3U9CA 3GC9A 4MXXA 2XKCA 3CS9A 3DLSA 3FXZA 1B38A 4H1JA 3FMLA 2IN6A 4FMQA 4WNOA 5BUIA 4BDBA 4IHPA 3F6XA 3P23A 3EB0A 4LOPA 3PLSA 4Y8DA 2J9MA 3E63A 3BGZA 2ZYBA 5I9ZA 4HNFA 3RM6A 3FDNA 3IECA 5ANIA 5EK7A 2XH5A 4NUSA 3PVBA 2I0YA 4J52A 2XNBA 3OROA 4NH1A 5BUEA 2OZAB 2WEVA 3A7HA 3GNIB 1U59A 3IW5A 4UEUA 4XG7A 3M11A 4AACA 5CEOA 5HBHA 3L9LA 4YJQA 3PWYA 5DT0A 3PVUA 5AX3A 2WMXA 3DQWA 2CKOA 3AC2A 4Y5HA 3EWHA 4ACMA 3CD3A 5CVFA 5H8EA 4FV0A 4CT1A 5JGAA 3ZO4A 3KK9A 3R2BA 4C34A 4D55A 3S0OA 3NFGB 3IW8A 4HJOA 5KNJA 2DWBA 3RK7A 1STCE 5HCZA 4RWKA 1SMHA 2FSTX 4A07A 4JMQA 4FTKA 3C7QA 2OJJA 3ROYA 4RPVA 5HLNA 5JKGA 3FLWA 4IX6A 3ZO3A 3AD6A 3FQHA 4YJNA 2R3GA 3DNEA 3NDMA 2X0PA 3BGPA 1T46A 4LI5A 2C5NA 5D7VA 4EZ5A 3VBVA 2HXLA 4OTDA 2YA9A 2EB2A 2O65A 1WFCA 3L9PA 3VWAA 3FSKA 3TDWA 3MPAA 4CFWA 3FZPA 3I60A 1H24A 3F66A 3SRVB 2XK3A 4FSMA 4RJ4A 3ZOSA 4V0GA 5A46A 3GEQA 4IZ5A 3WE4A 4LDTA 4FL3A 4FTMA 5EM8A 1Q41A 1XBAA 2UZBA 5FEDA 2E9UA 5JRQA 5JGBA 1JKSA 2ERKA 3EYHA 2X0GA 3AT2A 5CSWA 3KRJA 5IH6A 1PKDA 4FV7A 5A54A 3UIBA 2R4BA 4WNPA 4FX3A 4IVAA 5CAQA 3JR1A 4O82A 4FF8A 2E9OA 3PA5A 2XBJA 4FC0A 1OBGA 1TFFA 2YZAA 2XEYA 4PV0A 4K33A 2CJMA 3VUKA 4V04A 3ORKA 5HIEA 3FY2A 4IXPA 1HCLA 1YVJA 4YUQA 2YCSA 2CKEA 3E3PA 3E62A 5J9YA 5JFXA 2XIZA 5HHWA 3R02A 3AKJA 4KBCA 3PXFA 5KMMA 2HZIA 2VO7A 2CLQA 2RIOA 3DOGA 4WSYA 3TEIA 5KMOA 4YR8A 4XX9A 1R0EA 3TUCA 2C5YA 5AUYA 4EHZA 4OBQA 4GSBA 4ZY6A 4LRJA 4PNIA 3P5JC 4MYGA 2XYNA 3BYSA 4ACDA 4R7IA 5CNNA 3BQRA 4I5CA 4B99A 1YWVA 3LCKA 1E1VA 1OL7A 3PP1A 2JAVA 3KN6A 2VTMA 3LIJA 3R8ZA 3ET7A 4KRCA 1OIRA 2ZVAA 4ORKA 5F95A 4P4CA 4TNDA 3F3VA 2VTPA 4C59A 3QKLA 5J95A 2HXQA 1PMEA 4BKZA 3L8VA 4BTJA 1PMUA 4YJPA 2G2FA 2ITOA 3FMMA 4L44A 4R78A 4L01A 4D9UA 4YC3A 4YLKA 4FTAA 2XS0A 4I21A 4OTGA 1OM1A 4PP9A 4ZMEA 3UNJA 1OGYA 3MYGA 4CKRA 4DFUA 4O86A 5FM2A 1CM8A 1E9HA 3P7AA 4JX3A 5F94A 1DS5A 2XCHA 3DXNA 5I3OA 5E1SA 3C4XA 2ZDUA 1DAWA 3BIZA 5ANJA 3G5DA 5CAPA 2W4KA 1Q4LA 3V6SA 4XRJA 2C6IA 4QQJA 1FMOE 4C8BA 3A8WA 5K0XA 4MEDA 2BRNA 1T45A 2BAQA 3BYUA 4WOVA 4M7IA 4RWIA 4EH5A 5BNJA 3U54A 3V5PA 2ZOQA 2ZV7A 4CQGA 3PIYA 4BCMA 4CRLA 3QLFA 4WBOA 5EI6A 4ALVA 5EDRA 1ST0A 2HWPA 1BX6A 2YDJA 3PPJA 3PJCA 2W1FA 4HGEA 5DH3A 3HRBA 2GNLA 5JMSA 4AZVA 4BDKA 4UMQA 4HCUA 2HW7A 4X2JA 4F9BA 5LVPA 2C5VA 1O6LA 1YDRE 3R00A 3UG2A 3PVWA 4DFLA 4DITA 5B7VA 5I5ZA 1ZLTA 4CFNA 3CE3A 1ZMUA 2OSCA 5E4HA 4GIIA 2FVDA 3CJGA 4P90A 4MNFA 3EN7A 2WOUA 1JPAA 3KREA 4TZRA 4R1YA 4GFOA 5CAUA 2GS2A 4AZWA 4WBBB 3OT3A 2EB3A 2JFLA 2XIXA 4QP7A 4S30A 4TY1A 4BR3A 3ANRA 5EW3A 3TZ8A 3W33A 3BPRA 2ZV2A 3AT3A 4FV4A 4XG2A 3RWQA 4D4SA 4CFUA 3B8RA 4D1XA 3RWPA 5AP1A 2WEIA 5A6OA 2YZLA 3HDMA 4FKOA 5HE2A 5AUTA 4FK3A 3QX4A 2C6KA 3A4PA 5D41