3W1FA

Crystal structure of human mps1 catalytic domain in complex with 5-(5-ethoxy-6-(1-methyl-1h-pyrazol-4-yl)-1h-indazol-3-yl)-2-methylbenzenesulfonamide
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
280
structure length
259
Chain Sequence
ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Indazole-based potent and cell-active Mps1 kinase inhibitors: rational design from pan-kinase inhibitor anthrapyrazolone (SP600125)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 70
structure length 259
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3w1fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w1fA01
4HZRA 3K3JA 4HNIA 4DCEA 4FEWA 2IVVA 3MGYA 1PYEA 2OIDA 4BTMA 3DGKA 5GIOE 4K77A 2XCHA 3NPCA 3ZLWA 2QOKA 4RWKA 2EWAA 4EOSA 2YM4A 3JVRA 5I3RA 3PWYA 4OR5A 2BDJA 4D4VA 2XKCA 5I9YA 1JPAA 1CTPE 3UO4A 4IAYA 4CTCA 2YCSA 4O7WA 3CP9A 3MIYA 4C3FA 1U5RA 2PSQA 5CLPA 1H1WA 1OIUA 2WQMA 3LFBA 5EYDA 3TJDA 4JNWA 4FNWA 4DEDA 4GU9A 4XHKB 3MA3A 5G1XA 5L2QA 3REPA 4AT3A 2RFSA 3ATSA 3L8XA 4X0MA 5KHWA 2ETMA 3ANQA 3FAAA 4U40A 4W8EA 2RL5A 4FX3A 4DN5A 4NJ3A 1QMZA 2R3RA 4WSQA 4BDJA 3ETAA 5M57A 4DH3A 5CF6A 4TW9A 4GKIA 4YJVA 2GTNA 4GK2A 2XYNA 2JDRA 3PRFA 4CGAA 4QQTA 3UPZA 4EKLA 3P1AA 2BILB 2PMNX 4LV5A 1YHWA 2I0YA 1ZOEA 3AGMA 4R8QA 2RG5A 5IQAA 4O0VA 3SXSA 5ACKA 2X7FA 5AWMA 4AZEA 4WIHA 2B9JA 4ITHA 3LMGA 4MBIA 5H9BA 5KBQA 3GOPA 3GT8A 5HICA 3EMGA 4AZSA 1RE8A 3PYYA 2OH0E 1Q8ZA 3N4TA 3QRTA 3PSBA 4MHAA 4IW0A 4IB5A 4W9WA 3TWJA 4BDDA 2GU8A 4BVUA 4CG8A 4AS0A 3GC0A 3OWPA 2C47A 4FZ6A 2VWWA 3VS7A 3KXGA 1PXIA 5M4IA 2WPAA 3HMIA 4BTJA 3LFQA 4ZZMA 3OS3A 3PIXA 3T3UA 2VTMA 3W8LA 4JDKA 4QP1A 1IASA 2JDVA 4O0YA 4MWHA 2JGZA 2JKMA 3CXWA 4L7SA 3SOCA 2RFNA 4IC7A 3MY0A 3FSKA 5AR8A 3LQ5A 3W1FA 4CFVA 3PXFA 4XG6A 4ANOA 4CVAA 3NAXA 2JC6A 3HGKA 5IA0A 3R71A 1XWSA 3MVMA 1QCFA 2IW8A 4O7RA 3QALE 2O63A 5IU2A 4DEGA 4G9RA 2XKDA 3CGFA 4BDBA 2PMOX 2X7OA 1I44A 2YWPA 5EFQA 4NSTA 2YERA 2PZYA 3TUBA 4ZP5A 5CXHA 3F88A 5EDQA 3KL8A 3RALA 2GSFA 3FPMA 5E8YA 3G9LX 4LRJA 4V0GB 4DG0E 3QCYA 4YP8A 4Y73A 4L42A 3RK5A 1OGUA 4HGSA 4O96A 3ORMA 4LI5A 4O6LA 3MY5A 4QP9A 3FHRA 2JIVA 4LMUA 1W0XC 2OIBA 2ZV2A 4AZWA 2F2UA 4NJDA 3COIA 3DK3A 5BUEA 3AOXA 3N9XA 5HVKA 5FXSA 4FKJA 3RKBA 5JFSA 4BCNA 3W2SA 4JI9A 3CTHA 4FYNA 3W2OA 4RQKA 3A7JA 3TCPA 3VS2A 1M7QA 2JITA 5EW9A 4FZDB 3W2CA 5LWMA 5AX3A 3TTIA 4B6LA 4D2WA 5A4QA 1VYWA 4TYHA 3GFWA 3G33A 5AV1A 3L9LA 4MTAA 5K0XA 2B9HA 5LJJA 3EKNA 5IUGA 4LUEA 4O6EA 2X4ZA 3G5DA 4G3EA 3B8QA 4PV0A 2J5FA 5JRSA 3R83A 2XIRA 1NA7A 3CIKA 4PNKA 4IAKA 4O7TA 4X21A 4PPBA 2GHMA 3ORKA 1OL5A 5DFPA 3GOKA 5HLNA 1XHAA 2QOFA 5IDPA 5IISA 2VWZA 5AR4A 1K2PA 4D4RA 5IH5A 4L9IA 3ZSHA 4KIPA 3IW5A 1SVGA 4OW8A 4FT5A 2J0MB 4F9CA 4FTMA 3R7IA 4AXAA 4KS7A 2VTTA 4BDFA 2I0HA 3FPQA 4BR3A 5CVHA 2YM3A 1FVVA 1M7NA 3HV5A 2YHVA 2YM6A 4FI1A 3KN5A 2WMXA 5A14A 4Y8DA 2GS7A 2YISA 2C6IA 2V62A 4FNYA 1UWJA 3HMPA 5FG8A 4RRVA 2P2IA 2ERKA 4RGJA 3ZTXA 4EKKA 3HA6A 4UYNA 4K11A 3FJQE 5C8MA 2ITWA 4LQMA 2B4SB 1H1RA 3RNYA 2ITYA 3FWQA 3VBXA 3WE4A 3LHJA 3E64A 1H27A 4MNEB 5BYLA 3A99A 3PRIA 2XIZA 5IQDA 1WVWA 3MS9A 3PLSA 4FTKA 4G5JA 2X2KA 4IX4A 4X3FB 2X9FA 2YM8A 3LCTA 5HIEA 1YXVA 4E6QA 2PVNA 4II5A 5HE0A 3L8PA 3FLYA 3ITZA 3B2WA 3EQRA 3NCZA 5IPJA 1TQIA 2P3GX 1BLXA 5FGKA 1XBCA 4BI1A 4EH3A 1UNGA 3GU5A 3SHEA 3TNWA 4HVGA 3SW4A 3UVRA 4BDIA 5B2MA 4NFNA 5DT0A 3WBLA 3OBGA 4USDA 4QMWA 3QQKA 5CT0A 3MFSA 3LXPA 5HOAA 2C5NA 3EL8A 5BUIA 1JVPP 2ZV8A 4ZY6A 1J7LA 4IH8A 4EOMA 3M1SA 1DI8A 4N57A 4BCHA 3TDWA 5AM6A 2P33A 2V7OA 5DEWA 3T9IA 4ALVA 1OL7A 3MFRA 5BVDA 4AW1A 4EH9A 2FB8A 2XJ2A 3GBZA 4FNXA 4KBAA 3SLSA 2EXEA 3LM0A 1PXNA 3E7OA 4O27B 1VR2A 3RZBA 3IPHA 3UIMA 4HGEA 4BDGA 3DY7A 4G3FA 3LXNA 3R02A 1V0OA 1YXSA 2BUJA 2J90A 5CYIA 3PA5A 3RWQA 1K9AA 2Z7LA 4QMSA 4JOAA 4U81A 3RPYA 5E8ZA 4CT1A 3PXQA 5M08A 2CN8A 2XJ1A 3DQXA 5FWKK 2WTKB 3WE8A 5ANOA 3FLZA 2GNHA 2WTKC 4RIWA 3HA8A 5DGZA 2BZHB 3KKVA 3KRLA 2UW9A 3QUPA 4M14A 3EIDA 1URCA 2QLQA 3VRZA 4PL4A 4XEYA 2B0QA 5L8JA 2WHBA 4OTDA 5BVKA 2GQSA 1M2RA 3Q9WA 4NK9A 5BNJA 4R77A 2PU8A 4FG8A 2ZOQA 4LGDA 5HX8A 5GZ9A 3IGGA 3QC4A 3GQLA 2YIYA 3FMEA 4U43A 5E8TA 5K0KA 2GQRA 3QX4A 3QA8A 2YIWA 4S30A 2J0IA 3U8WA 4MF1A 3ZMMA 4GMYA 4H39A 5J9ZA 1LPUA 1GJOA 3P7AA 3A61A 3F5PA 1OBGA 3EJ1A 3AD4A 1OKVA 1P14A 2PVJA 3TKHA 5LQFA 1IAHA 4IDVA 2HENA 4FTNA 4OTHA 1OBDA 4W4XA 3S0OA 3DZOA 1SYKA 3NUAA 2YIRA 1Q61A 3QGYA 3NNWA 3AGLA 2UVZA 4JX7A 4MXZA 2PMLX 5AP5A 5LARA 3TNQB 4APCA 4E6DA 3SG9A 3GCVA 2O3PA 3KRJA 3UYSA 3F7ZA 3LCDA 4EH6A 5HBJA 4FSWA 2WB8A 4NUSA 2BZKB 5HESA 5EYKA 2UVYA 2VWIA 2OZOA 3DA6A 3COMA 4P5ZA 1STCE 4ASXA 3LLTA 4ANQA 5AP7A 3EHAA 1OPKA 4DLIA 3BEAA 3II5A 2JKOA 3R7YA 4HCTA 2HOGA 3D15A 3KRRA 4U80A 5IZFA 2ITZA 3EQHA 4D2SA 1KWPA 1W7HA 4BIDA 4S34A 2A19B 4GKHA 5IQFA 3GCQA 2CPKE 4FV5A 1O6LA 3QRJA 4ONAA 4FKUA 3G2FA 1FPUA 4YNOA 3TEIA 3QC9A 1YWRA 3BU5A 4UXLA 5I3OA 4EOPA 2JEDA 2J7TA 2JLDA 4C33A 3UZPA 4JL9A 5IKWA 3UC3A 4O2ZA 3VHEA 3LZBA 4FZFB 2BDWA 2W7XA 4EHVA 2GNLA 4A4LA 3OP5A 3TXOA 2X2MA 3U9CA 3H9FA 5JZNA 4BTKA 1AD5A 3OVVA 4PP9A 3FZRA 1PY5A 2RSVA 1YRPA 2WU7A 2GNJA 3EQDA 3RNIA 3C4CA 4H05A 5L2TA 4DE4A 1P5EA 4HPUE 4BRXA 2C3KA 4BYIA 1OL6A 3O2MA 2XJ0A 4B8LA 4GH2A 3PJ1A 2PUNA 2VWVA 2CCIA 3BBWA 4IADA 3S95A 1OKZA 4PMTA 3LVPA 2W5HA 3QTSA 4ZEGA 4MBJA 4ZSLA 4YO4A 4YTFA 5TKDA 2BR1A 3IS5A 4I24A 4AACA 2VTLA 2FYSA 3BQRA 3LCOA 4RMZA 2PHKA 5EM5A 3SC1A 4FT9A 4AZFA 4RX9A 2JBOA 3R63A 5K5XA 5C03A 4RA5A 4EOJA 3O7LD 2BIKB 3PJCA 3NX8A 3GFEA 3KXZA 3D7TB 1NY3A 4O7SA 5EOLA 3GU4A 4NIFB 4W4VA 2ITPA 5DEYA 5AR3A 3S2PA 1HOWA 5IQBA 2ITQA 1MQ4A 3R1NA 4S2ZA 3NSZA 3VS6A 3A7GA 3PA4A 3OEZA 4BY9E 2XKEA 3ODYX 1H8FA 3E88A 2BALA 4KKHA 3FE3A 3UIBA 1KV2A 5AUWA 5CANA 4GK3A 4E6CA 2E9UA 3FZPA 1FMOE 5E90A 2P0CA 3KN6A 4BYJA 1Y8GA 4EH8A 2R0UA 4MXAA 5HCYA 4AE9A 1Q3WA 2IG7A 4FUXA 2W4JA 2KTYA 2JFMA 2PMIA 2WGJA 3D9VA 5BMMA 2B54A 3DAEA 3FHIA 4RLLA 3SDJA 3GP0A 3DKGA 3QD3A 5ITAA 4O81A 4I3ZA 3RGFA 1EH4A 2VO7A 1KE5A 1UV5A 2H96A 4DBNA 2XP2A 1WBOA 2YLFA 1HCKA 2VTIA 5B0XA 1SNUA 4KWPA 4EHEA 1FGKA 2OBJA 3EQPA 2ITTA 2QVSE 5DHJA 3ROCA 4BKJA 1OITA 4JG8A 5A54A 3HMOA 4AZTA 4FV8A 1BI7A 1M17A 3DNEA 4FIGA 2XM8A 4HOKA 4QP2A 4R3CA 2X8DA 2YDIA 1YDTE 3TACA 4CV8A 4IAAA 5CU3A 3RAHA 1MUOA 2Y4IB 4DF3A 2I7QA 4DT9A 5IH6A 2PTKA 4ZLYA 2Y4IC 1Y6AA 3O50A 4DGLC 3OT3A 4ZXTA 1QPJA 4E4LA 2OKRA 4F0IA 2IZUA 4EK8A 2EUFB 5CXZA 2W0JA 4FE2A 4X3FA 2UZTA 2XMYA 3RINA 3UNZA 5CSVA 3BYOA 2HAKA 4JDHA 3QL8A 5EYCA 2WTIA 1XH9A 3DTWA 3OHTA 2X81A 1OKWA 2VN9A 3QFVA 4KAOA 1ZYJA 2QOIA 1JKLA 1ZZLA 2O65A 2QKRA 4JAIA 4X2JA 5HIDA 3UNJA 4F1MA 3RK7A 3CPBA 4IMYA 2JKQA 3BLQA 4FKSA 5E8SA 3THBA 2I0VA 4USFA 3G0EA 3GU6A 4E73A 4Y85A 4TL0A 1OIYA 4PQNA 1XH5A 1FMKA 4F99A 2R64A 3QZIA 3OBJA 3PIZA 2W1DA 2E9VA 3LE6A 4MF0A 3C50A 3VBWA 1ZXEA 3TT0A 1CM8A 4DFYA 5HO7A 4CCUA 4W4YA 3SV0A 4ZSJA 5D7VA 3DFCB 4YO6A 2BDFA 2BMCA 3FQHA 4R3PA 4E26A 4EC8A 4DAWA 3MB6A 3WZDA 5DLSA 4D9UA 4NW6A 3AXWA 4NEUA 5EHYA 2CHLA 4BKZA 2UW8A 3H3CA 3DDQA 4FIHA 2C3LA 2BTRA 4AA0A 2QU6A 4YZCA 2J4ZA 3MVHA 1AGWA 4FGRA 5CU0A 4OTQA 4PMMA 4GSBA 3IOKA 5ETCA 4C38A 1YI4A 4I22A 3W2PA 3ZXTA 2Z7RA 4K18A 3TZMA 1YXTA 4FC0A 3TZ7A 5KX8A 3PY1A 3NUYA 5AUXA 4F64A 3AC1A 4GG5A 5JGBA 3QKLA 4BCOA 1KSWA 3BPRA 4A7CA 4ZY5A 3MIAA 3V5QA 2ITNA 4DGMA 5D12A 3VW6A 4H1JA 3EYGA 3FXXA 4L6QA 4D0XA 2A4LA 2XK8A 1PXOA 3TKUA 4ANSA 3KU2A 4CRSA 5DYJA 4PNIA 1KE8A 4D5KA 4DLJA 4MX9A 4WRGA 3NW7A 3RBWA 1M14A 4RIXB 3MY1A 3QLGA 2OFUA 3A7HA 3IKAA 3NGAA 3NW5A 3PZEA 4G5PA 4K9YA 3VIDA 4C4FA 5BVFA 4RPVA 3LMIA 1TQPA 4KRDA 5D1JA 4YJNA 4UX9A 3O0GA 4WUNA 3TN8A 2C0OA 3OWKA 3W8QA 3CSVA 4BFMA 3ACJA 5C1QB 3MJ1A 2X2LA 3CKXA 3QTWA 4XV3A 3TNHA 5HBEA 5TOZA 3VUDA 2QO2A 2YN8A 5GZ8A 2Y0AA 3FI8A 3QXPA 4KBCA 3EFWA 3FLWA 1J1CA 4L52A 4R7IA 4BWKA 2OW3A 3I1AA 2XBJA 4PY1A 2CMWA 3MH0A 3W33A 1H24A 3BHTA 5KMIA 1KE7A 4C3RA 3C5IA 5L6WL 2Y9QA 4YHFA 1YW2A 1M2QA 2HW6A 3PY0A 2QODA 3D83A 4M7IA 2ERZE 3RK9A 3RPSA 4EI4A 4TRLA 3VN9A 4FEXA 4YJPA 5L8KA 1H0VA 5LMKC 1YWNA 5AV0A 3ZCLA 3P4KA 3F2AA 3MFUA 2GCDA 2XVDA 4WRSA 3HDMA 3QKKA 3U54A 1IEPA 5EKNA 4ZZOA 3UMXA 4FOBA 4FOCA 4K2RA 4U97A 4E93A 4ANBA 4CFFA 1J3HA 4J1RA 4F9BA 4ANMA 2FSTX 5IEYA 2PVLA 4X2KA 1KOAA 3L8SA 1NXKA 4M0YA 5EOBA 1G8SA 4JAJA 2UZNA 2CNQA 3FXZA 3ATTA 4JQ7A 2C30A 4ZS4A 3EN6A 4XYFA 1Z9XA 3CC6A 5BX0A 1ZOGA 4IAIA 2WMAA 5HG7A 4PP7A 2C6OA 3NS9A 4YC3A 4I0RA 4R6VA 3CKWA 2X6DA 4DG2E 4CT2A 4FL1A 4XUFA 3V5WA 2WZJA 2YZLA 1UWHA 2BRNA 3OEFX 3VNTA 3ZC5A 4C2WA 4RX5A 3QYWA 4O7VA 4IACA 4QMLA 1VZOA 3MSSA 4KNBA 4CSVA 2GFSA 3E8EA 1LUFA 4A9RA 3SA0A 4ASDA 4FICA 2W1EA 3ORZA 3K5VA 4ACMA 5C4KA 3EFLA 4WNMA 4FTRA 3I81A 4C35A 2B52A 4I0SA 4DINA 4FEVA 1MRVA 2HYYA 5T68A 4LM5A 5BYYA 3GB2A 5EK7A 3C4FA 3SXRA 4XG8A 3DPKA 4KSQA 2XKFA 1P2AA 2BTSA 2VWUA 3NR9A 1JSTA 3R1YA 3ZLSA 4AOTA 4FKVA 5JFXA 4ZMFA 2ZMDA 3ACKA 1J7UA 3E8CA 3MPTA 3SXFA 3R01A 3CLYA 4M69B 4AE6A 1MP8A 4GU6A 3GI3A 4NIFA 4NT4A 1XH7A 1DS5A 4OGRA 3T9TA 5IA4A 3QTRA 1RDQE 1TKIA 3BGZA 3OXTA 2ACXA 1ZZ2A 2B9FA 2UW3A 5J5TA 3D5UA 3ZO3A 3LMHA 3EQGA 4CEGA 4CG9A 4FKWA 3E8DA 4I5MA 5LCKA 2YCFA 3Q52A 4BL1A 3VBQA 5CAOA 3H4JA 5FRIA 2XNMA 3V01A 3QD2B 4QNYA 4AW2A 3R0TA 3QZHA 4F7LA 1O6YA 2V55A 4DFNA 2C6LA 3ERKA 2JBPA 5CVGA 4L67A 5AV3A 3UQFA 2PE1A 4K33A 4WUAA 3LOKA 5KBRA 4KIKB 2YCRA 4RVLA 4O0XA 1Q24A 3UVQA 5AP1A 4ASEA 5KHXA 4GRBA 3ZXZA 3OCSA 4BDEA 5KKRB 5HEZA 5KKRC 4LUDA 3HV6A 5BMSA 4FSMA 4X2NA 4JDIA 4C61A 3GCUA 2OGVA 5J9LA 2VV9A 3IW6A 3DBDA 3ZRMA 2CGXA 5CU4A 3W16A 4I23A 1Q8TA 2R3QA 3IECA 3NEWA 4L43A 4D2PA 5ACBC 3E92A 2B7AA 4JS8A 3N4VA 1LEWA 1R78A 3PTGA 3TV6A 2C6TA 1UNLA 2C0TA 4I21A 5AP3A 3COHA 4BC6A 3FZTA 2HIWA 2P4IA 4HVHA 5D7AA 3VWAA 3ZRKA 4RZVA 2R4BA 4EWHA 5T3QA 2R3GA 3OWLA 2C5XA 5HO6A 4DYMA 4YBJA 3MTLA 4HJOA 3D2KA 4PMPA 5GJFA 4AFJA 1U54B 2XB7A 4M8TA 4R7HA 4YNEA 1YDRE 4WG4A 3I0OA 3BE2A 3G90X 4I6FA 4QRCA 2XBAA 2WEIA 3BBTB 4FKTA 4J99A 4RFMA 5J8IA 3R9RA 2PWLA 3SRVA 3F5XA 4O0WA 4LV8A 2QO9A 3PFQA 3UODA 4BICA 4YZBA 4CMOA 3I5ZA 4O38A 2WQOA 4KB8A 5IQCA 2IO6A 4DH5A 2UV2A 2WKMA 4GEOA 3AC5A 2WAJA 2CKQA 3SG8A 4AA5A 3OTUA 2IW6A 5ANDA 4EYMA 4MXXA 5K9IA 4JLCA 5JGDA 4RJ6A 2ZM3A 1JKSA 5I9XA 5M51A 4BWPA 3ZM9A 3F5UA 2BZJA 2I1MA 2C1BA 3RTPA 5HGIA 3DBQA 4BZOA 1H00A 3ET7A 5GJGA 3ZBXA 3F7WA 4FGBA 5F1ZA 3DNDA 4IB3A 5HIBA 4Y5QA 4G9CA 3PE1A 5AIRA 4QYHA 1WBVA 3O51A 4RFYA 3UVPA 1H08A 4ZK5A 1OMWA 5IQGA 4IWPA 2WQEA 3PY3A 4DT8A 4RG0A 4R3RA 3MA6A 2VX0A 3UOJA 2ONLC 3Q6UA 2FSLX 2JIIA 3MH3A 4IB0A 4Q5HA 4RJ5A 3V5LA 3Q2MA 5HTBA 3KC3A 2ZYBA 1Q62A 3QHWA 3HZTA 5M06A 3E87A 4RIXA 5IUHA 4RT7A 4IEBA 1U46A 2PZ5A 5K4JA 3FUPA 3EOCA 4ANLA 4I0TA 1O6KA 1OUYA 4TN6A 3UO6A 4M66A 4GW8A 3JVSA 4D0WA 5JGAA 2OG8A 4IZYA 4QTEA 3CEKA 3EQCA 2JKKA 2QOOA 4L68A 2A0CX 2QOBA 4BZNA 4UWYA 3PLAE 1YHVA 1GZNA 2F7ZE 2LGCA 1SMHA 3D14A 4FT0A 4NFMA 4BDKA 4C58A 5IA3A 5E8VA 5E8UA 2XEYA 3EZRA 2ESMA 1LP4A 3OWJA 3UOKA 5LMKA 4IM3A 4BGGA 1Q3DA 5L2SA 2QR7A 4IFCA 4QPAA 4OUCA 4MQ1A 5HNGA 3FLQA 3OUKA 3H9OA 4Z16A 5HU9A 4ACDA 4NL0A 2BAJA 2PUUA 2G01A 3MVJA 4FKPA 2XNOA 4NM3A 3DS6A 4CFXA 2IVUA 3D5WA 4E4MA 2XEZA 4FZ7A 3CTQA 3UJGA 1RJBA 1KE9A 3DK7A 2C5VA 5EHLA 4DEHA 4D58A 1IRKA 2YAAA 3CY3A 3DDPA 4BDCA 4FIEA 4F63A 2OJ9A 4LOQA 2B55A 3RHKA 2CSNA 4YJUA 4BIEA 1REKA 3PG3A 2V7AA 5FTOA 3UGCA 2I40A 1ZLTA 1Q41A 3RPOA 2NNWB 4FEQA 2F4JA 3QYZA 1O9UA 4G6OA 5CF4A 2W1ZA 4YZMA 2UW0A 3BE9A 3PXYA 2J0LA 3CS9A 1H01A 3NNVA 3WZJA 5D9HA 4BGQA 5FP6A 3NVKI 1B38A 4KBKA 3R2BA 4H3QA 5DN3A 2QG7A 3ELJA 4BBEA 4CD0A 2OZAB 3HMNA 5CEMA 5E9EA 3ZZWA 4Y72A 4O91A 5EI6A 4RWIA 4YLJA 5FTQA 1WMKA 2VTRA 3I4BA 5C01A 4YJTA 3VRYA 4JR7A 3MBLA 4QO9A 4FL3A 1CMKE 1E1XA 3VS5A 4YU2A 3P23A 4RZWA 3QTUA 4HZSA 4RJ8A 3IDCA 2CGVA 3QXOA 4F9WA 4A9TA 3Q4CA 4OTGA 3C0GA 3VO3A 4BCIA 3ZUTA 1Z5MA 4ZLOA 3DXNA 1JAMA 4TKSA 3ORLA 5CAVA 3Q5IA 3R28A 4RJ4A 4R78A 1PXJA 3DJ5A 3LAUA 4MKCA 5EDRA 4DH7A 3BWJA 2YJRA 3JYAA 1LEZA 4QMOA 3R7EA 3W2RA 3HMMA 3R1SA 4NM5A 5HKMA 4KKGA 2GDOA 4JIAA 4UALA 4DCAA 2BAKA 4NCTA 2W05A 4F7NA 1UVRA 4IQ6A 3HUBA 3Q6WA 3W2QA 4YUQA 5FEEA 5KMOA 1YHSA 3ZFXA 4E5AX 3E3PA 2XK3A 4XH6A 5EG3A 4Y95A 3MYGA 4FSTA 3BYSA 1OB3A 5AUVA 2ETRA 3DAJA 5L2WA 2EB3A 3BYUA 3LFEA 4L3PA 3LM5A 4ZLZA 1XH6A 2B53A 2ZV7A 5DT4A 2UW5A 4U6RA 5IH4A 4I6BA 2XA4A 4FF8A 4KINA 4RC4A 4XV2A 3OXIA 5D10A 4MXCA 4FV3A 3ZUVA 5M09A 4C02A 1HCLA 5A6NA 3NUXA 2VWXA 3LCSA 3LFCA 4MD9E 1I09A 3QKMA 4XRLA 2R3IA 3TNIA 4M12A 5CF8A 2ZM1A 4U0IA 4R7BA 3I60A 2YITA 1GNGA 2QR8A 4EZ7A 3Q60A 4C37A 4YJSA 5CI7A 2RGPA 4BCJA 3P9JA 4D1XA 1FINA 4BHNA 1WVYA 4FTJA 5CNNA 3HNGA 1V1KA 3UOLA 4X2FA 4BBFA 2BRMA 4XOZA 1WBSA 2C4GA 3FMMA 4UWCA 3HECA 3V51A 2PE2A 1J91A 2R3JA 2JD5A 4KIOA 3FKOA 4J96A 3RVGA 2JFLA 4DITA 3GGFA 3UZRA 2UZVA 4ZSGA 1JSUA 2WIPA 3MH2A 3NUNA 5CEOA 2G2HA 4QMXA 3BU3A 3PSCA 4IB1A 3KULB 5FQDC 2IZTA 2Q83A 2X8IA 4GUEA 3O96A 5ANKA 3LFFA 4L8MA 5AUYA 5AEPA 5TT7A 5LVLA 1PXPA 2GHGA 3FV8A 2W1GA 4P7EA 3G9NA 4IX5A 4FTLA 1ZMVA 3HDNA 5LMAA 4AOIA 5JKGA 5L8LA 2XH5A 5BQ0A 4CKRA 3UQGA 3QQUA 2RG6A 1BUHA 2QONA 4EK3A 5T6KA 4BKYA 4E3CA 3O71A 2HK5A 3GUBA 3OZ6A 2WTDA 1KE6A 3UOHA 2QU5A 2YAKA 3MV5A 4FTIA 3RM7A 3R73A 2JIUA 4C4HA 1PMNA 1WZYA 5F94A 4LG4A 1JKTA 4WSYA 3Q4ZA 3ENHA 5H3QA 3UE4A 5IA2A 4XLIA 4UMPA 3E3BX 1OM1A 4L3JA 3QTIA 3FBVA 2WMBA 4FV2A 4OBQA 5DPVA 2W1IA 4EWQA 2W4KA 3O8TA 3ZRLA 4AN9A 1UU9A 3Q4UA 3AMYA 4JQEA 1PYXA 2AUHA 4EHGA 2RIOA 3BU6A 1CDKA 3QLFA 4MYGA 5K5NA 2R3FA 3FMHA 4E1ZA 2GMXA 5EH0A 5F20A 2R3NA 4IZ7A 4E4NA 4TY1A 2VO6A 3ORTA 3R7GA 2VTJA 3C13A 4DBXA 3V3VA 4ASZA 1SM2A 5GZAA 3ZO4A 2X7GA 5FD2A 3ZEPA 3MJ2A 1J1BA 3HRFA 3OY3A 4JVGA 4LRKA 5HVJA 4EOKA 4QMNA 4MXYA 5CAQA 3NIZA 2ITUA 4E20A 1WVXA 2WQNA 2IJMA 2O0UA 2UZEA 1Q5KA 3L9NA 5EM8A 3P79A 3FMLA 1YQJA 2BAQA 3POZA 4X7QA 3W10A 3VUIA 3HLLA 4YSJA 1OPJA 4F09A 5KMKA 2B1PA 3AC8A 3AT2A 4MAOA 3MVLA 4P2KA 2REIA 2PVMA 3F2NA 4FK6A 4EYJA 4RVKA 5ANIA 3VS4A 3IONA 4AA4A 4F6SA 4O22A 3NAYA 4P90A 4MD7E 3RI1A 3UZTA 2BRHA 2XNPA 3G0FA 4V0GA 4YTCA 3IDBA 3VBVA 3WOWA 2A1AB 4Y83A 4FODA 4EOOA 3CJGA 1Z57A 2XNBA 3P78A 4ZJIA 4FSYA 4PMSA 2Q0NA 3NRMA 5DG5A 4U8ZA 3ZBFA 2YWVA 4J52A 5F95A 5HVYA 4DTKA 4NWMA 2VGPA 4GVAA 4GYGA 5CU2A 5HD7A 4XP2A 1OZ1A 1P4FA 2QCSA 2WMSA 2ETKA 4L44A 3DLZA 3FZSA 4JT3A 1S9JA 4CFUA 3CTJA 5JT2A 5CZIA 2NP8A 1ND4A 2GS6A 4UMTA 5J1WA 1ZYLA 4YPSA 2UZLA 3BHYA 4JBOA 3NYOA 3Q4TA 5JMSA 3G6HA 3O7LB 1XQZA 3Q5ZA 1IAJA 5B2KA 5B7VA 4AOJA 2YM5A 3Q96A 4I4FA 3GU7A 3GU8A 3IK3A 4OT5A 4WD5A 3TTJA 3TG1A 3KGAA 4Z3VA 3ZFYA 5IF1A 1GY3A 3JR1A 1XBAA 3MH1A 2PUIA 4RIYB 2CNUA 3M11A 3ALOA 2HZ4A 5I5ZA 3KY2A 4L01A 5FDPA 4ENXA 4YZDA 2AC5A 4JR3A 4XG7A 3OTVA 2PZRA 5HE2A 4HYIA 4ZTNA 3FC2A 3OOMA 5EYMA 2F7XE 4YSMA 3ZHPC 4RC2A 3FXWA 4XNEA 4EK6A 3NNXA 2YCQA 4BCKA 2WMRA 4IHPA 4OTIA 4P5QA 3PJ2A 5A3XA 1H0WA 2WNTA 3PE2A 3FLSA 1VEBA 4ITJA 1X8BA 3DV3A 4JBPA 3OF0A 5KNJA 5AFVA 3ZFMA 3GC7A 4WNPA 5CSHA 3WIKA 2W9ZB 3R00A 4AN2A 1OECA 3DTCA 3CJFA 5I0BA 4XG9A 2XF0A 4F1OA 3IDPA 4FSZA 4BGHA 3F6XA 2RFEA 3OUNB 3PA3A 2RF9A 4D2VA 3QTZA 4CQEA 5ETFA 4MNEA 4F6UA 4QP3A 4QP6A 4QP8A 2Q0BA 4IVAA 4MD8E 3ZU7A 5HD4A 2WOUA 3E63A 5KMNA 4TWPA 5B2LA 5LVMA 1H4LA 3ZSIA 5C8NA 2QKWB 2YZAA 2WD1A 4WNOA 3S4QA 4UMUA 1PMVA 1ZYDA 2BROA 2OXXA 1H26A 3OT8A 3TIZA 5TR6A 4J7BA 4CNHA 2XNNA 4LRMA 5GJDA 4K1BA 2EU9A 2QURA 2OICA 2C6DA 2IW9A 3A4PA 5CEIA 2WMUA 5J95A 3ENMA 4HYSA 4C59A 1YVJA 1Q8WA 1IA8A 2C6EA 4O7YA 3HRBA 2WTCA 3C4XA 3D94A 2R3LA 2H8HA 2WQBA 2UW7A 2W9FB 1PF8A 3PIYA 4GUBA 4EBVA 3F3UA 5DRBA 5CVFA 4QMZA 3BKBA 4RX8A 3RWPA 1OIRA 3DZQA 4QYYA 4X3JA 5KUPA 5ETIA 4WG3A 3UPXA 3BZ3A 3OOGA 4U3ZA 3DXPA 4J98A 4D4SA 2J6MA 3ANRA 3I7BA 5FDXA 3BRBA 4QP4A 3S00A 3Q32A 3LPBA 3PVGA 3EB0A 4CFNA 3NIEA 2VX3A 2Y7JA 3KF7A 2BPMA 4G3CA 4S31A 5E7RA 5DR2A 3EQIA 4QOXA 5AV2A 4EH2A 3QQFA 1E9HA 1SVEA 2UZWE 4CKIA 1NT2A 2KULA 2J9MA 3M2WA 4UB7A 3C4EA 4UV0A 3QGWA 1PJKA 4NM0A 4RIOA 5K3YA 3ODZX 3KMMA 3UIUA 3RAKA 4L3LA 3MB7A 4QQ5A 4S33A 3VQUA 3PZHA 2CN5A 2PZPA 5TF9A 3Q04A 3BHVA 4RSSA 3WYYA 2QD9A 1BL7A 5DE2A 3TV7A 4E8AA 1NVRA 1DAWA 2YJSA 3C9WA 3I6UA 3ZOSA 3T3VA 3SW7A 3D5VA 2QI8A 3L9PA 2XK9A 4JG6A 2G9XA 4GV1A 3VJOA 5L6PA 4YZ9A 3N4UA 3ORIA 4A07A 4ZSEA 3GXLA 1W83A 1B6CB 3EFKA 3OFMA 3QAME 5AP2A 4EQMA 2ZJWA 4BBMA 2CKPA 3O17A 3KRXA 4YJQA 1U5QA 4AF3A 1FVRA 4TNBA 4OTRA 1K3AA 3QBNA 3P0MA 5KCVA 3RMFA 4CZTA 4FTCA 2VTSA 3EN9A 4XS2A 4XX9A 1ATPE 2WEVA 5CF5A 4CFMA 3Q53A 4F9YA 3FY0A 1CKIA 2OJGA 2ZM4A 3DU8A 3R8MA 4RJ3A 3QWKA 4CZYB 5L6OA 3LJ0A 1CKJA 3UDBA 4FSNA 2RFDA 5A4TA 4IAZA 3BX5A 3W18A 4GFOA 4AT5A 5KO1A 4I4EA 3W32A 5E8XA 3PVBA 3CD8A 4J95A 4CYJA 4HGLA 2FGIA 5AP4A 3QWJA 2WIHA 4GT5A 4RQVA 3HYHA 3MPAA 1SZMA 3OCBA 3VS1A 4CKJA 4FA2A 2IPXA 4PDOA 3FQSA 2W1CA 3IO7A 2IWIA 1F0QA 5HO8A 4C4EA 2YDJA 4FV0A 4E5WA 4U3YA 4RC3A 5HG9A 3QCSA 4HNFA 4XV9A 5D11A 4DFUA 4UWBA 3ZLXA 2VTHA 4EQCA 5EW8A 3BHUA 2I0EA 3BLHA 3KK8A 2JAMA 4XBRA 4YMJA 5IMXA 2OJFE 5CZHA 4KUJA 4DGGA 2VTOA 3OCTA 5GIPE 2E9PA 3JY0A 3Q9YA 2CLQA 4O7NA 3DXQA 3VW8A 4FG7A 3GNIB 3PJ3A 4O2PA 4IM2A 4WOVA 3HX4A 2H9VA 2VU3A 3C0IA 4YHJA 5E91A 4ZTRA 1TQMA 1P4OA 3QD4A 3ID6C 2HXLA 4YJRA 5AP0A 4CYIA 3EQBA 3P7CA 4FK3A 5BYZA 4DGNA 5I4NA 4F0FA 5IEVA 1WFCA 4YPDA 5LMBA 2XS0A 2XIXA 4AU8A 5KE0A 4XCUA 4TTHB 3OC1A 2P55A 4U45A 5CNOA 4B0GA 4BZDA 4EUUA 5JEBA 2HWPA 1REJA 5CWZA 5FM2A 2YIQA 3WF9A 2W1HA 1BYGA 2HCKA 5A4LA 2QOLA 4AWIA 3DBCA 4FIJA 3C51A 1AQ1A 3LFAA 5DT3A 2DYLA 5CSWA 3GVUA 3U6HA 3QZFA 2W5BA 2W96B 4V01A 1ZMUA 4EL9A 3LJ1A 2PK9A 4PTCA 2VWYA 5M4UA 4HVIA 2PVHA 4BCMA 3QZGA 4EH4A 3F5GA 1ZOHA 5CALA 3TZ9A 4UBAA 2C6KA 2W06A 2QOHA 4EOLA 1XKKA 4K8AA 5AR7A 5CS6A 1IA9A 3GQIA 4ACHA 5A4CA 4U5JA 4O7ZA 2UW4A 1BL6A 3KXHA 4GT3A 3D7TA 4FR4A 2Y8OA 3PSDA 3F69A 4YGAA 5C8KA 2H34A 1H25A 4GL9A 3NYNA 3F82A 3U6JA 4XP0A 2AYPA 4GJ2A 3F9NA 1WBTA 2YLEA 3QRUA 3FKLA 4UZHA 3UIXA 4OTPA 5J7BA 3R9HA 3AD6A 5AMNA 3PG1A 3B2TA 2ZV9A 3R8UA 3QRKA 4RIYA 5ANGA 1Y6BA 4L7FA 5EKOA 3MPMA 4F65A 4F1TA 2VTAA 5C27A 4M15A 4RWLA 3R9OA 4R1YA 3QCQA 4Q2AA 5A9UA 3BHHA 5DMZA 4DA5A 3ZZEA 3TIYA 4DGOA 1KOBA 1F3MC 1Q97A 1RQQA 3DBFA 3SQQA 4D2TA 4ITIA 1WBNA 2CKEA 5DI1A 1OUKA 3LLAA 3FI4A 3LQ8A 4MK0A 3MESA 4YJOA 2VUWA 1GZKA 2WELA 1MQBA 5AAGA 2X8EA 1IG1A 4CLJA 3R9NA 4J97A 4TWNA 4EHZA 3NLBA 2ITXA 5I9ZA 2OO8X 3UP7A 3UG1A 2UZDA 5CEKA 2GPHA 2JDTA 4JIKA 4N70A 4XP3A 2ZDUA 5DR6A 4U79A 3RPVA 1ZWSA 3FY2A 3NUUA 3K5UA 4FKIA 4Q9SA 4TYIA 4TXCA 2VX1A 5DWRA 4QP7A 4ARKA 2G15A 5GNKA 4RIWB 3PVWA 1ZRZA 5C9CA 4AGWA 3P5KA 3ORPA 3SOAA 4JXFA 2I6LA 4IVBA 1ERKA 1W84A 4F4PA 4GVJA 4XMOA 4C8BA 2OI4X 3DFAA 3EZVA 2O8YA 2CNVA 4HYHA 4XG3A 4UMRA 4KIQA 2GNIA 2G2IA 4A9SA 3JXWA 5EW3A 4C4IA 4G6NA 1NVQA 2CCHA 4WBBB 4JG7A 5KZ0A 5LVPA 5A4EA 3HV4A 3R7VA 3OG7A 3DKOA 2B9IA 3KCFA 2OWBA 1OI9A 3CQUA 4JX3A 4B9DA 5FEDA 2QC6A 4QMQA 3E93A 5CEQA 2BKKA 5AUUA 3C1XA 1RW8A 2F49A 3ZSGA 1F5QA 1B39A 1LR4A 2Z60A 3HRCA 4IM0A 2ZMCA 4V04A 2PVFA 3WILA 3QCXA 3F61A 1DM2A 5HE1A 3A7IA 3C0HA 1MRYA 1G8AA 3DJ7A 4G3GA 3BYVA 4W9XA 2PE0A 4N0SA 3AD5A 4O84A 3AMAA 4O1OA 3WARA 3MDYA 4IWOA 3UO5A 3HAVA 1Q8YA 1ZARA 3TI1A 2W1FA 3AQVA 3RCJA 4M84A 4N6ZA 5AAFA 5LVNA 3EKKA 2EXCX 4DH1A 5BUJA 3G15A 4A06A 4N4SA 4OTWA 4W4WA 1OL1A 1YWVA 2FSOX 3V5JA 5DBXA 5JZJA 3NUPA 2W5AA 2DWBA 4XG2A 3PXZA 3WZKA 4L53A 5AR2A 2PZIA 3VUMA 2XM9A 1ZYCA 1L8TA 1YI3A 2R3PA 4U44A 2IZSA 4NM7A 4H3PA 2XK4A 5AAEA 4IBMA 3AT3A 2XNEA 1PXLA 3V5TA 3H10A 3V8TA 4XG4A 4D1ZA 5IQHA 5L4QA 4C7TA 4ALWA 1SVHA 4O0SA 2F7EE 5E1EA 2OSCA 2J0JA 1R1WA 4PX6A 4B7TA 4UEUA 3P86A 3O8PA 5DRDA 4PTEA 4E7WA 3PP0A 2HXQA 2WMQA 3ZDIA 4DTAA 3E5AA 3C7QA 4QT1A 3PPJA 2ZDTA 4IANA 4CRLA 4EBWA 4ZY4A 4Z55A 3N51A 1JOWB 3F3WA 3CCNA 4M67A 4X6RA 3HV7A 4PPCA 3A8WA 3EL7A 2WMVA 2WTJA 5KMJA 4Z9LA 3KVWA 4J53A 2HELA 4I6HA 5AP6A 4TYEA 2C3JA 2E2BA 3TV4A 1H1SA 2VTQA 3CD3A 5GHVA 1VJYA 2HWOA 3LCKA 4FBXA 5L2IA 3ZC6A 3Q3BA 4QMTA 3VHKA 3UBDA 2R3KA 2UUEA 1T46A 2QHNA 4G31A 3M42A 4GS6A 4PDYA 3IG7A 1T45A 1DI9A 4KD1A 1PHKA 1UKHA 1URWA 4RJ7A 5AUTA 3DBEA 4CFWA 4D1SA 3FMJA 5IG1A 3TZ8A 1TVOA 3ULIA 4P4CA 5E8WA 4H58A 3BLRA 3GCPA 4QTCA 3PXRA 2YA9A 3U51A 1WBWA 4OTFA 1SNXA 4D9TA 4PWNA 1UU7A 3A60A 3V6SA 3OCGA 4CLIA 4F70A 4C4JA 1FBNA 5AA9A 2BHEA 2QNJA 2BFXA 4GFGA 3MFTA 4BWXA 3CGOA 3OD6X 2JAVA 3UYTA 1ZAOA 3LIJA 4O82A 5D41A 3OXZA 5J1VA 3IGOA 3R8ZA 3KFAA 3AT4A 4ERWA 3FL4A 5HBHA 4XV1A 1UU8A 4YHTA 2YABA 3VF9A 2F57A 3KF4A 4EQUA 1ZY5A 5BVEA 4I5PA 5HCXA 5BPYA 4UN0C 1JWHA 1JBPE 4ID7A 3RP9A 5CSPA 4R1VA 3TJCA 3POOA 4D2RA 4D5HA 1ZYSA 4YURA 4ZOGA 4AAAA 3TDVA 3ZDUA 2UZOA 4FKLA 4IXPA 3DK6A 5FBNC 4BTFA 2Y6MA 4X2GA 3VF8A 3ZYAA 3ZM4A 3A8XA 3LJ2A 4ZMEA 2CLXA 1GIIA 2J50A 1OVEA 4V05A 2C69A 1XH8A 4WO5A 3NYVA 1W8CA 3QQGA 4MBLA 5TO8A 4EOQA 3GC8A 4ZJVA 3PWDA 4CQGA 5HG5A 4FZAB 2IVTA 3R22A 4M69A 4QMUA 3AG9A 3HP2A 2ZB0A 4QYFA 4R5SA 3U9NA 3TUDA 4EZ5A 5EI2A 4ZTQA 3AMBA 2CJMA 3ZLYA 5IUIA 3HL7A 2O5KA 3V6RA 5FBOA 3CBLA 2Z02A 2Z7QA 3PDTA 4UY9A 4FVQA 2OK1A 2LAVA 3NZ0A 3QTQA 4Q5EA 4G34A 3Q2JA 4FV7A 4NTTA 5CQUA 2C6MA 3I0QA 4ENYA 4EORA 3KMWA 4X3FC 3DLSA 2CGWA 2A27A 3F3ZA 4ZTSA 1WBPA 3GENA 4QYEA 5IA5A 3ZH8A 4YC6A 2EB2A 4EEVA 2WMTA 2Y6OA 2VD5A 3CY2A 3QRIA 5DNRA 4WT6A 4QPMA 3MN3A 4ZS0A 3C4ZA 3LXLA 3IW8A 4KIKA 3QTXA 3QF9A 4U7ZA 5E92A 4O21A 4CTBA 2VGOA 1YI6A 3OROA 4G2FA 4C34A 4CMTA 5J5SA 2WTWA 3DOGA 3UQCA 2R7IA 4CCBA 2P2HA 5FXQA 1BMKA 2E9OA 1BX6A 2QQ7A 1FGIA 1E1VA 2DQ7X 2FUMA 3R04A 4IJ9A 5FTGA 2OLCA 1PKGA 2XCKA 2XRWA 4IC8A 4I5HA 2PVRA 2YACA 4KS8A 4RWJA 4YC8A 3A7FA 5DIAA 2PPQA 4FL2A 2O64A 4UZDA 2A2AA 3VQHA 2X9EA 4DEEA 3VS0A 2PY3A 4GIIA 4MH7A 5HE3A 4OBOA 5AX9A 2QLUA 4QNAA 1JQHA 4DFBA 3NCGA 1XH4A 3FL5A 2R2PA 2V22A 2XIKA 1H1QA 4OBPA 3ZS5A 4ALUA 2PL0A 3KB7A 3I6WA 3TUCA 4YLLA 1OL2A 4JQ8A 3FYJX 1G5SA 4ZZNA 1YDSE 3TNPC 3RJCA 4AGUA 4BCQA 3C4WA 3CPCA 1U54A 3LQ3A 3FZ1A 5FLFA 3KVXA 3MI9A 4I93A 3HP5A 5CAUA 1IR3A 4FSUA 3U55A 4GG7A 4TPTA 3QHRA 3JUHA 5BVOA 4YZNA 2XYUA 4YBKA 4B99A 5JN2A 4XRJA 2C1AA 4WHZA 2OFVA 4FEUA 4LYNA 5HLPA 3QD0A 3RHXA 4Y5HA 4G3DA 4PUZA 4QMPA 2ZB1A 1APME 4XLVA 4NKSA 4FTUA 3HUCA 1PKDA 4G1WA 4I1ZA 3PPZA 1QPEA 3G6GA 1W98A 1WCCA 3HV3A 4JBVA 3EH9A 3HEGA 4KA3A 3EN4A 4IVDA 5HU3A 5CQWA 1H1PA 3WI6A 4QTBA 3H30A 4LOOA 3U4UA 5BVNA 4FT3A 1Y8YA 4FT7A 2OXDA 3CE3A 4FSRA 4ANNA 4G6LA 4JBQA 5LVOA 1GZOA 2ONLA 3PXKA 2UW6A 4DH8A 2V5QA 4M13A 4WKQA 4F08A 3U4WA 1Y91A 2G2FA 2HZIA 3HVCA 4MNFA 2VZ6A 4D28A 3FDNA 1QL6A 3QUEA 4BI0A 5CY3A 5EM6A 3RAIA 3WZEA 3PJ8A 4ACCA 3V8WA 4HYUA 5AIKA 4KKEA 4KRCA 4FUYA 4IX3A 4BIBA 4D55A 4EJ7A 3FYKX 5F9EA 4TT7A 3F2RA 3IOPA 5IA1A 3AC3A 3NNUA 3P08A 3C5UA 5CU6A 4M97A 2OJIA 3ROYA 3S1HA 4QMYA 2XUUA 4CXAA 4H1MA 2GNGA 4G17A 3SVVA 2X1NA 4IIRA 3WF6A 2YDKA 3KEXA 1UKIA 1FVTA 4R5YA 1PRYA 2GFCA 2BHHA 1YOLA 3BGPA 2CKOA 1Q99A 2PVKA 2UZUE 3EN5A 3LFDA 4KSPA 5JFWA 5FUTA 3R6XA 1L3RE 2J0KA 2WXVA 1U59A 3O8UA 3LW0A 2CDZA 3FI2A 3VBTA 2WOTA 5CSXA 3WYXA 1KV1A 3K2LA 3Q9XA 4O1PA 4FKRA 4DEAA 3FC1X 4BI2A 1V0PA 4U41A 2XNGA 1OIQA 3QX2A 2BKZA 1GIJA 4HPTE 5AJQA 5HORA 3SKCA 2F9GA 5JQ5A 5KZIA 1BI8A 1WAKA 4YTHA 5EQPA 3CQEA 1XR1A 2UZBA 2VAGA 3I79A 4J8MA 4AQCA 5IEXA 4ERKA 4APPA 1A48A 1JNKA 2C0IA 3GCSA 5ANJA 5I9WA 4FTQA 3DKCA 4NZWB 5AR5A 3ZUUA 5ICPA 5CT7A 5DA3A 1R3CA 4XOYA 5IMEA 2GQGA 3FLNC 2W99B 4I92A 5J7HA 4FIFA 4X6QC 1BKXA 2J51A 4C36A 2HZNA 4AP7A 3VS3A 3I7CA 4FIIA 4C3PA 3NDMA 4LL5A 3JY9A 3QA0A 4PRJA 5F4NA 3KXXA 3EWHA 4PDPA 2IVSA 4L46A 3BEGA 3BGQA 4A9YA 4IE9A 4OT6A 3KRWA 4E4XA 1YXUA 4RLKA 3UG2A 5G6VA 4BF2A 5JSMA 2QOQA 2VWBA 1R0PA 1R0EA 3DB6A 2OF4A 3SX9A 2WTVA 3ZEWA 3COKA 2V0DA 4RVMA 2RKUA 2ITOA 3WF8A 2X0GA 3R21A 3UP2A 1YOJA 4GK4A 1CSNA 4U9AA 3ALNA 3T8OA 3RM6A 1XO2B 3D5XA 1GIHA 5HHWA 3RZFA 5HZNA 4FKOA 1W82A 2GHLA 4RVTA 4EOIA 1JKKA 3NVMB 3FI3A 4CZUA 1Q4LA 3OMVA 4GFMA 4IJPA 4WA9A 4TWCA 3HAMA 2OZAA 3AC4A 3ORNA 1PXKA 5HNBA 4ACGA 4TYGA 4BDHA 5JRQA 3L8VA 1H07A 3W55A 2H6DA 3DJ6A 3ORXA 2OH4A 4IX6A 3NWWA 4EJNA 5M07A 3EQFA 1FOTA 3ULZA 4PL3A 2BZIB 3BV2A 4PPAA 1KUTA 3KK9A 5HG8A 3JS2A 5HQ0A 2NPQA 2R3OA 2CGUA 3U87A 2VNYA 3K3IA 3RCDA 3QUDA 4QTAA 3WIGA 4GJ3A 5A6OA 4G16A 4K6ZA 4M0ZA 3V8SA 5DOSA 3B8RA 4KABA 4ZTMA 4QTDA 3R9DA 4O0RA 4IVCA 5C4LA 2XIYA 2C5OA 3EYHA 4XBUA 3O23A 4QQCA 3ZO2A 3OW3A 4N6YA 2JDOA 3FSFA 2Z8CA 3VC4A 4IDTA 1UA2A 4O83A 2DUVA 4FV9A 5ETAA 3VJNA 2JDSA 4HGTA 2WFYA 4AFEA 4UYAA 3D4QA 3R1QA 4JDJA 3R7UA 1H28A 3R7OA 1YXXA 3FQEA 3FMNA 3VUTA 4IFGA 4UMQA 3A62A 3GEQA 5J87A 4B4LA 3DB8A 4CV9A 2UVXA 4DFXE 4Z7HA 5HLWA 3E8NA 3RPRA 3CR0A 2FA2A 4RFZA 4ZJJA 4O0TA 4EH5A 2OIQA 4MCVA 2C5YA 2F2CB 2R9SA 5CEPA 4K0YA 3R8VA 2R0IA 3S3IA 3CQWA 3SAYA 4I6QA 2G1TA 4NYEA 2X6EA 5AM7A 4DFZE 3D7ZA 1PXMA 3I5NA 3R2YA 5DR9A 4EONA 4DEBA 2WO6A 4FVPA 2XK7A 3SRVB 2R5TA 5CTPA 1R39A 3MTFA 4I94A 3E62A 3VULA 2WMWA 3AC2A 5M56A 3UNKA 1VYZA 3ZONA 5E1SA 4PF4A 1PMEA 3F3VA 2BRBA 4M3QA 4E5BA 1V0BA 4F6WA 2W4OA 4QMMA 2PYWA 4PTGA 3VAPA 4O7LA 2X4FA 5J9YA 1NVSA 1S9IA 3FKNA 3Q9ZA 2SRCA 4AW5A 4L45A 4IZAA 5H2UA 2BRGA 2FH9A 3VUKA 1NW1A 3U6IA 4LGHA 4JRVA 4YLKA 3KULA 4FTTA 4GT4A 4BCPA 4MWIA 3LXKA 4HCUA 4C4GA 5H8EA 5M4CA 2OF2A 4IZ5A 5HCZA 4NU1A 5KMMA 3QQHA 4PL5A 2IN6A 5M53A 4GYIA 3FEGA 2FVDA 5FEQA 2XK6A 3NW6A 5EM7A 4DHFA 2NRYA 3TM0A 1PW2A 1Q8UA 2Z7SA 4WG5A 5DVRA 4F7JA 1CKPA 1DAYA 2E9NA 2R7BA 5LXMA 4NTSA 4QD6A 3FMDA 3V5PA 4F0GA 4BDAA 3BWFA 3QU0A 5FXRA 2J5EA 4LMNA 1UNHA 4TZRA 5J79A 1MRUA 3BCEA 2VNWA 4MXOA 3ZO1A 4HVSA 4M68A 3V04A 4TYJA 3P7BA 2OU7A 3LFSA 4F9AA 5HNIX 5E4HA 2FSMX 4AN3A 2BVAA 4ORKA 3IW7A 2Y4PA 4FVRA 3PUPA 4MVFA 4C57A 4FMQA 4PDSA 2AC3A 5CX9A 4ZTLA 4C2VA 4EK5A 4BHZA 4XJ0A 4ZSAA 3SGCA 4NH1A 5K4IA 2QG5A 5HTIA 5FM3A 5EHOA 2EVAA 4C62A 3TL8A 4TWOA 1M2PA 1YOMA 4OLIA 4U42A 4RBLA 3GC9A 3BYMA 4J8NA 4FV1A 4I5CA 2NO3A 3OY1A 4GCJA 3R30A 3E7VA 4HVDA 5IQEA 2GTMA 5JQ8A 3A4OX 4QMVA 1FQ1B 1OPLA 3VUHA 5AADA 5M4FA 4EC9A 4FYOA 4FKGA 3NUSA 4LOPA 1XJDA 5LCJA 4FSQA 2OXYA 3DAKA 4AUAA 4JJRA 2PULA 1M52A 4FKQA 5HX6A 4BN1A 2YM7A 5CI6A 4BCGA 2QHMA 3L1SA 4TYHB 5H8BA 2X39A 1ZY4A 5EI8A 4AG8A 5M55A 3F66A 3MWUA 2QO7A 1A06A 4I41A 3WF5A 4ZIMA 3KA0A 3IQ7A 4EZ3A 3QQLA 4L00A 4MEDA 3DT1A 3LFNA 2R3MA 5FP5A 5I9UA 4AGCA 5LOHA 3FMKA 2C68A 3KMUA 2YEXA 3H9RA 5LWNA 4O0UA 4RA4A 3KREA 1GZ8A 5AV4A 4AZVA 1U4DA 4MQ2A 1PMUA 5JH6A 2VO0A 5L3AA 2ITVA 3WZUA 4AGDA 4BB4A 4DEIA 4QYGA 1JSVA 3R8LA 4FV4A 4CMUA 4GIHA 5JK3A 4DC2A 2QOCA 1JLUE 5H8GA 4BCFA 1G3NA 2GNFA 3R8PA 3BV3A 3DKFA 5AUZA 3LKMA 4HCVA 2WU6A 3L9MA 2BIYA 2FO0A 4OAVB 2VTPA 3VVHA 4A4OA 2HW7A 1OKYA 3DCVA 4DG3E 4DFLA 4LFIA 5IDNA 4QQJA 3EFJA 3HKOA 2BCJA 4RX7A 3BELA 4A4XA 2XZSA 3KXNA 5C26A 5JFVA 3KQ7A 5CENA 4EK4A 4AW0A 4D4YA 4FG9A 5CAPA 2Z2WA 3BI6A 4WBOA 3KCKA 3UTOA 2VTNA 5ANEA 4YTIA 4ZTHA 5BVWA 3NMUF 4QPSA 5CASA 2HY0A 5EDPA 4AT4A 1XBBA 4Q9ZA 3PP1A 4AX8A 5HI2A 3KXMA 3NYXA 3UC4A 3BQCA 3K54A 4FNZA 4USEA 4ZAUA 1A9UA 3H0ZA 2GS2A 2VO3A 3D2IA 3A2CA 2XRUA 4I20A 1QPCA 3RAWA 5I9VA 3IW4A 3WF7A 3FZOA 2OJJA 4S32A 3VBYA 2PUPA 4NCTC 4TNDA 4W8DA 3VUGA 4EH7A 2IZRA 3TKIA 2BFYA 3MW1A 4E6AA 5GINE 2HY81 4NW5A 4IWQA 4O86A 4WNKA 4LL0A 5AA8A 5EQYA 4IWDA 1Y57A 2O2UA 2W17A 3PVUA 4FV6A 1YKRA 1QPDA 2YFXA 3DQWA 5M44A 4YR8A 2VRXA 5DH3A 5TE0A 3JPVA 4JRNA 3PPKA 3OW4A 4OAUC 2PVYA 4LGGA 4HW7A 4A9UA 4IAFA 2ZAZA 1J7IA 4F7SA 2R3HA 2NRUA 4Z7GA 1UU3A 2HZ0A 3QQJA 3H0YA 4UXQA 4DTBA 1ZMWA 5IQIA 3G51A 3F3TA 2J2IB 3D0EA 4H36A 2EXMA 4C0TA 3EN7A 2DS1A 4J71A 5A46A 2YIXA 4H3BA 1GAGA 3UMWA 4Y46A 3SD0A 2ZVAA 4NKAA 5KMLA 4FTAA 5HTCA 5EQEA 4FTOA 4EUTA 4B8MA 2C3IB 1GOLA 3BIZA
chains in the Genus database with same CATH superfamily
4HZRA 3K3JA 4HNIA 4DCEA 4FEWA 2IVVA 3MGYA 1PYEA 2OIDA 4BTMA 3DGKA 5GIOE 4K77A 2XCHA 3NPCA 3ZLWA 2QOKA 4RWKA 2EWAA 4EOSA 2YM4A 3JVRA 5I3RA 3PWYA 4OR5A 2BDJA 4D4VA 2XKCA 5I9YA 1JPAA 1CTPE 3UO4A 4IAYA 4CTCA 2YCSA 4O7WA 3CP9A 3MIYA 4C3FA 1U5RA 2PSQA 5CLPA 1H1WA 1OIUA 2WQMA 3LFBA 5EYDA 3TJDA 4JNWA 4FNWA 4DEDA 4GU9A 4XHKB 3MA3A 5G1XA 5L2QA 3REPA 4AT3A 2RFSA 4LDTA 3ATSA 3L8XA 4X0MA 5KHWA 2ETMA 3ANQA 3FAAA 4U40A 4W8EA 2RL5A 4FX3A 4DN5A 4NJ3A 1QMZA 2R3RA 4WSQA 4BDJA 3ETAA 5M57A 4DH3A 5CF6A 4TW9A 4GKIA 4YJVA 2GTNA 4GK2A 2XYNA 2JDRA 3PRFA 4CGAA 4QQTA 3UPZA 4EKLA 3P1AA 2BILB 2PMNX 4LV5A 1YHWA 2I0YA 1ZOEA 3AGMA 4R8QA 2RG5A 5IQAA 4O0VA 3SXSA 5ACKA 2X7FA 5AWMA 4AZEA 4WIHA 2B9JA 4ITHA 3LMGA 4MBIA 5H9BA 5KBQA 3GOPA 3GT8A 5HICA 3EMGA 4BJJA 4AZSA 1RE8A 3PYYA 2OH0E 1Q8ZA 3N4TA 3QRTA 3PSBA 4MHAA 4IW0A 4IB5A 4W9WA 3TWJA 4BDDA 2GU8A 4BVUA 4CG8A 4AS0A 3GC0A 3OWPA 2C47A 4FZ6A 2VWWA 3VS7A 3KXGA 1PXIA 5M4IA 2WPAA 3HMIA 4BTJA 3LFQA 4ZZMA 4ZMFA 3OS3A 3PIXA 3T3UA 2VTMA 3W8LA 4JDKA 4QP1A 1IASA 2JDVA 4O0YA 4MWHA 2JGZA 2JKMA 3CXWA 4L7SA 3SOCA 2RFNA 4IC7A 3MY0A 3FSKA 5AR8A 3LQ5A 3W1FA 4CFVA 3PXFA 4XG6A 4ANOA 4CVAA 3NAXA 2JC6A 3HGKA 5IA0A 3R71A 1XWSA 3MVMA 1QCFA 2IW8A 4O7RA 3QALE 2O63A 5IU2A 4DEGA 4G9RA 2XKDA 3CGFA 4BDBA 2PMOX 2X7OA 1I44A 2YWPA 5EFQA 4NSTA 2YERA 2PZYA 3TUBA 4ZP5A 5CXHA 3W0OA 3O5AA 3F88A 5EDQA 3KL8A 3RALA 2GSFA 3FPMA 5E8YA 3G9LX 4LRJA 4V0GB 4DG0E 3QCYA 4YP8A 4Y73A 4L42A 3RK5A 1OGUA 4HGSA 4O96A 3ORMA 4LI5A 4O6LA 3MY5A 4QP9A 3FHRA 2JIVA 4LMUA 1W0XC 2OIBA 2ZV2A 4AZWA 2F2UA 4NJDA 3COIA 3DK3A 5BUEA 3AOXA 3N9XA 5HVKA 5FXSA 4QDEA 4FKJA 3RKBA 5JFSA 4BCNA 3W2SA 4JI9A 3CTHA 4FYNA 3W2OA 4RQKA 3A7JA 3TCPA 3VS2A 1M7QA 2JITA 5EW9A 4FZDB 3W2CA 5LWMA 5AX3A 3TTIA 4B6LA 4D2WA 3UDZA 5A4QA 1VYWA 4TYHA 3GFWA 3G33A 5AV1A 3L9LA 4MTAA 5K0XA 2B9HA 5LJJA 3EKNA 5IUGA 4LUEA 4O6EA 2X4ZA 3G5DA 4G3EA 3B8QA 4PV0A 2J5FA 5JRSA 3R83A 2XIRA 1NA7A 3CIKA 4PNKA 4IAKA 4O7TA 4X21A 4PPBA 2GHMA 3ORKA 1OL5A 5DFPA 3GOKA 5HLNA 1XHAA 2QOFA 5IDPA 5IISA 2VWZA 5AR4A 1K2PA 4D4RA 5IH5A 4L9IA 3ZSHA 4KIPA 3IW5A 1SVGA 4OW8A 4FT5A 2J0MB 4F9CA 4FTMA 3R7IA 4AXAA 4KS7A 2VTTA 4BDFA 2I0HA 3FPQA 4BR3A 5CVHA 2YM3A 1FVVA 1M7NA 3HV5A 2YHVA 2YM6A 4FI1A 3KN5A 2WMXA 5A14A 4Y8DA 2GS7A 2YISA 3BL9A 2C6IA 2V62A 4FNYA 1UWJA 3HMPA 5FG8A 4RRVA 2P2IA 2ERKA 4RGJA 3ZTXA 4EKKA 3HA6A 4UYNA 4K11A 3FJQE 5C8MA 2ITWA 4LQMA 2B4SB 1H1RA 3RNYA 2ITYA 3FWQA 3VBXA 3WE4A 3LHJA 3E64A 1H27A 4MNEB 5BYLA 3A99A 3PRIA 2XIZA 5IQDA 1WVWA 3MS9A 3PLSA 4FTKA 4G5JA 2X2KA 4IX4A 4X3FB 2X9FA 2YM8A 3LCTA 5HIEA 1YXVA 4E6QA 2PVNA 4II5A 5HE0A 3L8PA 3FLYA 3ITZA 3B2WA 3EQRA 3NCZA 5IPJA 1TQIA 2P3GX 1BLXA 5FGKA 1XBCA 4BI1A 4EH3A 1UNGA 3GU5A 3SHEA 3TNWA 4HVGA 3SW4A 3UVRA 4BDIA 5B2MA 4NFNA 5DT0A 3WBLA 3OBGA 4USDA 4QMWA 3QQKA 5CT0A 3MFSA 3LXPA 5HOAA 2C5NA 3EL8A 5BUIA 1JVPP 2ZV8A 4ZY6A 1J7LA 4IH8A 4EOMA 3M1SA 1DI8A 4N57A 4BCHA 3TDWA 5AM6A 2P33A 2V7OA 5DEWA 3T9IA 4ALVA 1OL7A 3MFRA 5BVDA 4AW1A 4EH9A 2FB8A 2XJ2A 3GBZA 4FNXA 4KBAA 3SLSA 2EXEA 3LM0A 1PXNA 3E7OA 4O27B 1VR2A 3RZBA 3IPHA 3UIMA 4HGEA 4BDGA 3DY7A 4G3FA 3LXNA 3R02A 1V0OA 1YXSA 2BUJA 2J90A 5CYIA 3PA5A 3RWQA 1K9AA 2Z7LA 4QMSA 4JOAA 4U81A 3RPYA 5E8ZA 4CT1A 3PXQA 1VLRA 5M08A 2CN8A 2XJ1A 3DQXA 5FWKK 2WTKB 3WE8A 5ANOA 2XARA 3FLZA 2GNHA 2WTKC 4RIWA 3HA8A 5DGZA 2BZHB 3KKVA 3KRLA 2UW9A 3QUPA 4M14A 3EIDA 1URCA 2QLQA 3VRZA 4PL4A 4XEYA 2B0QA 5L8JA 2WHBA 4OTDA 5BVKA 2GQSA 1M2RA 3Q9WA 4NK9A 5BNJA 4R77A 2PU8A 4FG8A 2ZOQA 4LGDA 5HX8A 5GZ9A 3IGGA 3QC4A 3GQLA 2YIYA 3FMEA 4U43A 5E8TA 5K0KA 2GQRA 3QX4A 3QA8A 2YIWA 4O4EA 4S30A 3W0NA 2J0IA 3U8WA 4MF1A 3ZMMA 4GMYA 4H39A 5J9ZA 1LPUA 2IF8A 1GJOA 3P7AA 3A61A 3F5PA 1OBGA 3EJ1A 3AD4A 1OKVA 1P14A 2PVJA 3TKHA 5LQFA 1IAHA 4IDVA 2HENA 4FTNA 4OTHA 1OBDA 4W4XA 3S0OA 3DZOA 1SYKA 3NUAA 2YIRA 1Q61A 3QGYA 3NNWA 3AGLA 2UVZA 4JX7A 4MXZA 2PMLX 5AP5A 5LARA 3TNQB 4APCA 4E6DA 3SG9A 3GCVA 2O3PA 3KRJA 3UYSA 3F7ZA 3LCDA 4EH6A 5HBJA 4FSWA 2WB8A 4NUSA 2BZKB 5HESA 5EYKA 2UVYA 2VWIA 2OZOA 3DA6A 3COMA 4P5ZA 1STCE 4ASXA 3LLTA 4ANQA 5AP7A 3EHAA 1OPKA 4DLIA 3BEAA 3II5A 2JKOA 3R7YA 4HCTA 2HOGA 3D15A 3KRRA 4U80A 5IZFA 2ITZA 3EQHA 4D2SA 1KWPA 1W7HA 4BIDA 4S34A 2A19B 4GKHA 5IQFA 3GCQA 2CPKE 4FV5A 1O6LA 3QRJA 4ONAA 4FKUA 3G2FA 1FPUA 4YNOA 3TEIA 3QC9A 1YWRA 3BU5A 4UXLA 5I3OA 4EOPA 2JEDA 2J7TA 2JLDA 4C33A 3UZPA 4JL9A 5IKWA 3UC3A 4O2ZA 3VHEA 3LZBA 4FZFB 2NYAA 2BDWA 2W7XA 4EHVA 2GNLA 4A4LA 3OP5A 3TXOA 2X2MA 3U9CA 3H9FA 5JZNA 4BTKA 1AD5A 3OVVA 4PP9A 3FZRA 1PY5A 2RSVA 1YRPA 2WU7A 2GNJA 3EQDA 3RNIA 3C4CA 4H05A 5L2TA 2X0QA 4DE4A 2AQXA 1P5EA 4HPUE 4BRXA 2C3KA 4BYIA 1OL6A 3O2MA 2XJ0A 4B8LA 4GH2A 3PJ1A 2PUNA 2VWVA 2CCIA 3BBWA 4IADA 3S95A 1OKZA 4PMTA 3LVPA 2W5HA 3QTSA 4ZEGA 4MBJA 4ZSLA 4YO4A 4YTFA 5TKDA 2BR1A 3IS5A 4I24A 4AACA 2VTLA 2FYSA 3BQRA 3LCOA 4RMZA 2PHKA 5EM5A 3SC1A 4FT9A 4AZFA 4RX9A 2JBOA 3R63A 5K5XA 5C03A 4RA5A 4EOJA 3O7LD 2BIKB 3PJCA 3NX8A 3GFEA 3KXZA 3D7TB 1NY3A 4O7SA 5EOLA 3GU4A 4NIFB 4W4VA 2ITPA 5DEYA 5AR3A 3S2PA 1HOWA 5IQBA 2ITQA 1MQ4A 3R1NA 4S2ZA 3NSZA 3VS6A 3A7GA 3PA4A 3OEZA 4BY9E 2XKEA 3ODYX 1H8FA 3E88A 2BALA 4KKHA 3FE3A 3UIBA 1KV2A 5AUWA 5CANA 4GK3A 4E6CA 2E9UA 3FZPA 1FMOE 5E90A 2P0CA 3KN6A 4BYJA 1Y8GA 4EH8A 2R0UA 4MXAA 5HCYA 4AE9A 1Q3WA 2IG7A 4FUXA 2W4JA 2KTYA 2JFMA 2PMIA 2WGJA 3D9VA 5BMMA 2B54A 3DAEA 3FHIA 4RLLA 3SDJA 3GP0A 3BLAA 3DKGA 3QD3A 5ITAA 4O81A 4I3ZA 3RGFA 1EH4A 2VO7A 1KE5A 1UV5A 2H96A 4DBNA 2XP2A 1WBOA 2YLFA 1HCKA 2VTIA 5B0XA 1SNUA 4KWPA 4EHEA 1FGKA 2OBJA 3EQPA 2ITTA 2QVSE 5DHJA 3ROCA 4BKJA 1OITA 4JG8A 5A54A 3HMOA 4AZTA 4FV8A 1BI7A 1M17A 3DNEA 4FIGA 2XM8A 4HOKA 4QP2A 4R3CA 2X8DA 2YDIA 1YDTE 3TACA 4CV8A 4IAAA 5CU3A 3RAHA 1MUOA 2Y4IB 4DF3A 2I7QA 4DT9A 5IH6A 2PTKA 4ZLYA 2Y4IC 1Y6AA 3O50A 4DGLC 3OT3A 4ZXTA 1QPJA 4E4LA 2OKRA 4F0IA 2IZUA 4EK8A 2EUFB 5CXZA 2W0JA 4FE2A 4X3FA 2UZTA 2XMYA 3RINA 3UNZA 5CSVA 3BYOA 2HAKA 4JDHA 3QL8A 5EYCA 2WTIA 1XH9A 3DTWA 3OHTA 2X81A 1OKWA 2VN9A 3QFVA 4KAOA 1ZYJA 2QOIA 1JKLA 1ZZLA 2O65A 2QKRA 4JAIA 4X2JA 5HIDA 3UNJA 4F1MA 3RK7A 3CPBA 4IMYA 2JKQA 3BLQA 4FKSA 5E8SA 3THBA 2I0VA 4USFA 3G0EA 3GU6A 4E73A 4Y85A 4TL0A 1OIYA 4PQNA 3NFGB 1XH5A 1FMKA 4F99A 2R64A 3QZIA 3OBJA 3PIZA 2W1DA 2E9VA 3LE6A 4MF0A 3C50A 3VBWA 1ZXEA 3TT0A 1CM8A 4DFYA 5HO7A 4CCUA 2XAMA 4W4YA 3SV0A 4ZSJA 5D7VA 3DFCB 4YO6A 2BDFA 2BMCA 3FQHA 4R3PA 4E26A 4EC8A 4DAWA 3MB6A 3WZDA 5DLSA 4D9UA 4NW6A 3UDSA 3AXWA 4NEUA 5EHYA 2CHLA 4BKZA 2UW8A 3H3CA 3DDQA 4FIHA 2C3LA 2BTRA 4AA0A 2QU6A 4YZCA 2J4ZA 3MVHA 1AGWA 4FGRA 5CU0A 4OTQA 4PMMA 4GSBA 3IOKA 5ETCA 4C38A 1YI4A 4I22A 3W2PA 3ZXTA 2Z7RA 4K18A 3TZMA 1YXTA 4FC0A 3TZ7A 5KX8A 3PY1A 3NUYA 5AUXA 4F64A 3AC1A 4GG5A 5JGBA 3QKLA 4BCOA 1KSWA 3BPRA 4A7CA 4ZY5A 3MIAA 3V5QA 2ITNA 4DGMA 5D12A 3VW6A 4H1JA 4F78A 3EYGA 3FXXA 4L6QA 4D0XA 2A4LA 2XK8A 1PXOA 3TKUA 4ANSA 3KU2A 4CRSA 5DYJA 4PNIA 1KE8A 4D5KA 4DLJA 4MX9A 3BL7A 4WRGA 3NW7A 3RBWA 1M14A 4RIXB 3MY1A 3QLGA 2OFUA 3A7HA 3IKAA 3NGAA 3NW5A 3PZEA 4G5PA 4K9YA 3VIDA 4C4FA 5BVFA 4RPVA 3LMIA 1TQPA 4KRDA 5D1JA 4YJNA 4UX9A 3O0GA 4WUNA 3TN8A 2C0OA 3OWKA 3W8QA 3CSVA 4BFMA 3ACJA 5C1QB 3MJ1A 2X2LA 3CKXA 3QTWA 4XV3A 3TNHA 5HBEA 5TOZA 3VUDA 2QO2A 2YN8A 5GZ8A 2Y0AA 3FI8A 3QXPA 4KBCA 3EFWA 3FLWA 1J1CA 4L52A 4R7IA 4BWKA 2OW3A 3I1AA 2XBJA 4PY1A 2CMWA 3MH0A 3W33A 1H24A 3BHTA 5KMIA 1KE7A 4C3RA 3C5IA 5L6WL 2Y9QA 4YHFA 1YW2A 1M2QA 2HW6A 3PY0A 2QODA 3D83A 4M7IA 2ERZE 3RK9A 3RPSA 4EI4A 4TRLA 3VN9A 4FEXA 4YJPA 5L8KA 1H0VA 5LMKC 1YWNA 5AV0A 3ZCLA 3P4KA 3F2AA 3MFUA 2GCDA 3AKKA 2XVDA 4WRSA 3HDMA 3QKKA 3U54A 1IEPA 5EKNA 4ZZOA 3UMXA 4FOBA 4FOCA 4K2RA 4U97A 4E93A 4ANBA 4CFFA 1J3HA 4J1RA 4F9BA 4ANMA 2FSTX 5IEYA 2PVLA 2AEGA 4X2KA 1KOAA 3L8SA 1NXKA 4M0YA 5EOBA 1G8SA 4JAJA 2UZNA 2CNQA 3FXZA 3ATTA 4JQ7A 2C30A 4ZS4A 4AXCA 3EN6A 4XYFA 1Z9XA 3CC6A 5BX0A 1ZOGA 4IAIA 2WMAA 5HG7A 4PP7A 2C6OA 3NS9A 4YC3A 4I0RA 4R6VA 3CKWA 2X6DA 4DG2E 4CT2A 4FL1A 4XUFA 3V5WA 2WZJA 2YZLA 1UWHA 2BRNA 3OEFX 3VNTA 3ZC5A 4C2WA 4RX5A 3QYWA 4O7VA 4IACA 4QMLA 1VZOA 3MSSA 4KNBA 4CSVA 2GFSA 3E8EA 1LUFA 4A9RA 3SA0A 4ASDA 4FICA 2W1EA 3ORZA 3K5VA 4ACMA 5C4KA 3EFLA 4WNMA 4FTRA 3I81A 4C35A 2B52A 4I0SA 4DINA 4FEVA 1MRVA 2HYYA 5T68A 4LM5A 5BYYA 3GB2A 5EK7A 3C4FA 3SXRA 4XG8A 3DPKA 4KSQA 2XKFA 1P2AA 2BTSA 2VWUA 3NR9A 1JSTA 3R1YA 3ZLSA 4AOTA 4FKVA 5JFXA 3W0QA 2ZMDA 3ACKA 1J7UA 3E8CA 3MPTA 3SXFA 4O4FA 3R01A 3CLYA 4M69B 4AE6A 1MP8A 4GU6A 3GI3A 4NIFA 4NT4A 1XH7A 1DS5A 4OGRA 3T9TA 5IA4A 3QTRA 1RDQE 1TKIA 3BGZA 3OXTA 2ACXA 1ZZ2A 2B9FA 2UW3A 5J5TA 3D5UA 3ZO3A 3LMHA 3EQGA 4CEGA 4CG9A 4FKWA 3E8DA 4I5MA 5LCKA 2YCFA 3Q52A 4BL1A 1ST0A 3VBQA 5CAOA 3H4JA 5FRIA 2XNMA 3V01A 3QD2B 4QNYA 4AW2A 3R0TA 3QZHA 4F7LA 1O6YA 2V55A 4DFNA 2C6LA 3ERKA 2JBPA 3AKLA 5CVGA 4L67A 5AV3A 3UQFA 2PE1A 4K33A 4WUAA 3LOKA 5KBRA 4KIKB 2YCRA 4RVLA 4O0XA 1Q24A 3NFFB 3UVQA 5AP1A 4ASEA 5KHXA 4GRBA 3ZXZA 3OCSA 4BDEA 5KKRB 5HEZA 5KKRC 4LUDA 3HV6A 1TZDA 5BMSA 4FSMA 3P5JC 4X2NA 4JDIA 4C61A 3GCUA 2OGVA 5J9LA 2VV9A 3IW6A 3DBDA 3ZRMA 2CGXA 5CU4A 3W16A 4I23A 1Q8TA 2R3QA 3IECA 3NEWA 4L43A 4D2PA 4DHZA 5ACBC 1XMLA 3E92A 2B7AA 4JS8A 1OGYA 3N4VA 1LEWA 1R78A 3PTGA 3TV6A 2C6TA 1UNLA 2C0TA 4I21A 5AP3A 3COHA 4BC6A 3FZTA 2HIWA 2P4IA 4HVHA 5D7AA 3VWAA 3ZRKA 4RZVA 2R4BA 4EWHA 5T3QA 2R3GA 3OWLA 2C5XA 5HO6A 4DYMA 4YBJA 3MTLA 4HJOA 3D2KA 4PMPA 5GJFA 4AFJA 1U54B 2XB7A 4M8TA 4R7HA 4YNEA 1YDRE 4WG4A 3I0OA 3BE2A 3G90X 4I6FA 4QRCA 2XBAA 2WEIA 3BBTB 4FKTA 4J99A 4RFMA 5J8IA 3R9RA 2PWLA 3SRVA 3F5XA 4O0WA 4LV8A 4JMQA 2QO9A 3PFQA 3UODA 4BICA 4YZBA 4CMOA 3I5ZA 4O38A 2WQOA 4KB8A 5IQCA 2IO6A 4DH5A 2UV2A 2WKMA 4GEOA 3AC5A 2WAJA 2CKQA 3SG8A 4AA5A 3OTUA 2IW6A 5ANDA 4EYMA 4MXXA 5K9IA 4JLCA 5JGDA 4RJ6A 2ZM3A 1JKSA 5I9XA 5M51A 4BWPA 3ZM9A 3F5UA 2BZJA 2I1MA 2C1BA 3RTPA 5HGIA 3DBQA 4BZOA 1H00A 3ET7A 5GJGA 3ZBXA 3F7WA 4FGBA 5F1ZA 3DNDA 4IB3A 5HIBA 4Y5QA 4G9CA 3PE1A 5AIRA 4QYHA 1WBVA 3O51A 4RFYA 3UVPA 1H08A 4ZK5A 1OMWA 5IQGA 4IWPA 2WQEA 3PY3A 4DT8A 4RG0A 4R3RA 3MA6A 2VX0A 3UOJA 2ONLC 3Q6UA 2FSLX 2JIIA 3MH3A 4IB0A 4Q5HA 4RJ5A 3V5LA 3Q2MA 5HTBA 3KC3A 2ZYBA 1Q62A 3QHWA 3HZTA 5M06A 3E87A 3W0MA 4RIXA 5IUHA 4RT7A 4IEBA 1U46A 2PZ5A 5K4JA 3FUPA 3EOCA 4ANLA 4I0TA 1O6KA 1OUYA 4TN6A 3UO6A 4M66A 4AXEA 4GW8A 3JVSA 4D0WA 5JGAA 2OG8A 4IZYA 4QTEA 3CEKA 3EQCA 2JKKA 2QOOA 4L68A 2A0CX 2QOBA 4BZNA 4UWYA 3PLAE 1YHVA 1GZNA 2F7ZE 2LGCA 1SMHA 3D14A 4FT0A 4NFMA 4BDKA 4C58A 5IA3A 5E8VA 5E8UA 2XEYA 3EZRA 2ESMA 1LP4A 3OWJA 3UOKA 5LMKA 4IM3A 4BGGA 1Q3DA 5L2SA 2QR7A 4IFCA 4QPAA 4OUCA 4MQ1A 5HNGA 3FLQA 3OUKA 3H9OA 4Z16A 5HU9A 4ACDA 4NL0A 2BAJA 2PUUA 2G01A 3MVJA 4FKPA 2XNOA 4NM3A 3DS6A 4CFXA 2IVUA 3D5WA 4E4MA 2XEZA 4FZ7A 3CTQA 3UJGA 1RJBA 1KE9A 3DK7A 2C5VA 5EHLA 4DEHA 4D58A 1IRKA 2YAAA 3CY3A 3DDPA 4BDCA 4FIEA 4F63A 2OJ9A 4LOQA 2B55A 3RHKA 2CSNA 4YJUA 4BIEA 1REKA 3PG3A 2V7AA 5FTOA 3UGCA 2I40A 1ZLTA 1Q41A 3RPOA 2NNWB 4FEQA 2F4JA 3QYZA 1O9UA 4G6OA 5CF4A 2W1ZA 4YZMA 2UW0A 3BE9A 3PXYA 2J0LA 3CS9A 1H01A 3NNVA 3WZJA 5D9HA 4BGQA 5FP6A 3NVKI 1B38A 4KBKA 3R2BA 4H3QA 5DN3A 2QG7A 3ELJA 4BBEA 4CD0A 2OZAB 3HMNA 5CEMA 5E9EA 3ZZWA 4Y72A 4O91A 5EI6A 4RWIA 4YLJA 5FTQA 1WMKA 2VTRA 3I4BA 5C01A 4YJTA 3VRYA 4JR7A 3MBLA 4QO9A 4FL3A 1CMKE 1E1XA 3VS5A 4YU2A 3P23A 4RZWA 3QTUA 4HZSA 4RJ8A 3IDCA 2CGVA 3QXOA 4F9WA 4A9TA 3Q4CA 4OTGA 3C0GA 3VO3A 4BCIA 3ZUTA 1Z5MA 4ZLOA 3DXNA 1JAMA 4TKSA 3ORLA 5CAVA 3Q5IA 3R28A 4RJ4A 4R78A 1PXJA 3DJ5A 3LAUA 4MKCA 5EDRA 4DH7A 3BWJA 2YJRA 3JYAA 1LEZA 4QMOA 3R7EA 3W2RA 3HMMA 3R1SA 4NM5A 5HKMA 4KKGA 2GDOA 4JIAA 4UALA 4DCAA 2BAKA 4NCTA 2W05A 4F7NA 1UVRA 4IQ6A 3HUBA 3Q6WA 3W2QA 4YUQA 5FEEA 5KMOA 1YHSA 3ZFXA 4E5AX 3E3PA 2XK3A 4XH6A 5EG3A 4Y95A 3MYGA 4FSTA 3BYSA 1OB3A 5AUVA 2ETRA 3DAJA 5L2WA 2EB3A 3BYUA 3LFEA 4L3PA 3LM5A 4ZLZA 1XH6A 2B53A 2ZV7A 5DT4A 1G8KA 2UW5A 4U6RA 5IH4A 4I6BA 2XA4A 4FF8A 4KINA 4RC4A 4XV2A 3OXIA 5D10A 4MXCA 4FV3A 3ZUVA 5M09A 4C02A 1HCLA 5A6NA 3NUXA 2VWXA 3LCSA 3LFCA 4MD9E 1I09A 3QKMA 4XRLA 2R3IA 3TNIA 4M12A 5CF8A 2ZM1A 4U0IA 4R7BA 3I60A 2YITA 1GNGA 2QR8A 4EZ7A 3Q60A 4C37A 4YJSA 5CI7A 2RGPA 4BCJA 3P9JA 4D1XA 1FINA 4BHNA 1WVYA 4FTJA 5CNNA 3HNGA 1XMMA 1V1KA 3UOLA 4X2FA 4BBFA 2BRMA 4XOZA 1WBSA 2C4GA 3FMMA 4UWCA 3HECA 3V51A 2PE2A 1J91A 2R3JA 2JD5A 4KIOA 3FKOA 4J96A 3RVGA 2JFLA 4DITA 3GGFA 3UZRA 2UZVA 4ZSGA 1JSUA 2WIPA 3MH2A 3NUNA 5CEOA 2G2HA 4QMXA 3BU3A 3PSCA 4IB1A 3KULB 5FQDC 2IZTA 2Q83A 2X8IA 4GUEA 3O96A 5ANKA 3LFFA 4L8MA 5AUYA 5AEPA 5TT7A 5LVLA 1PXPA 2GHGA 3FV8A 2W1GA 4P7EA 3G9NA 4IX5A 4FTLA 1ZMVA 3HDNA 5LMAA 4AOIA 5JKGA 5L8LA 2XH5A 5BQ0A 4CKRA 3UQGA 3QQUA 2RG6A 1BUHA 2QONA 4EK3A 5T6KA 4BKYA 4E3CA 3O71A 2HK5A 3GUBA 3OZ6A 2WTDA 1KE6A 3UOHA 2QU5A 2YAKA 3MV5A 4FTIA 3RM7A 3R73A 2JIUA 4C4HA 1PMNA 1WZYA 5F94A 4LG4A 1JKTA 4WSYA 3Q4ZA 3ENHA 5H3QA 3UE4A 5IA2A 4XLIA 4UMPA 3E3BX 1OM1A 4L3JA 3QTIA 3FBVA 2WMBA 4FV2A 4OBQA 5DPVA 2W1IA 4EWQA 2W4KA 3O8TA 3ZRLA 4AN9A 1UU9A 3Q4UA 3AMYA 4JQEA 1PYXA 2AUHA 4EHGA 2RIOA 3BU6A 1CDKA 3QLFA 4MYGA 5K5NA 2R3FA 3FMHA 4E1ZA 2GMXA 4DHIB 5EH0A 5F20A 2R3NA 4IZ7A 4E4NA 4TY1A 2VO6A 3ORTA 3R7GA 2VTJA 3C13A 4DBXA 3V3VA 4ASZA 1SM2A 5GZAA 3ZO4A 2X7GA 5FD2A 3ZEPA 3MJ2A 1J1BA 3HRFA 3OY3A 4JVGA 4LRKA 5HVJA 4EOKA 4QMNA 4MXYA 5CAQA 3NIZA 3VONA 2ITUA 4E20A 1WVXA 2WQNA 2IJMA 2O0UA 2UZEA 1Q5KA 3L9NA 5EM8A 3P79A 3FMLA 1YQJA 2BAQA 3POZA 4X7QA 3W10A 3VUIA 3HLLA 4YSJA 1OPJA 4F09A 5KMKA 2B1PA 3AC8A 3AT2A 4MAOA 3MVLA 4P2KA 2REIA 2PVMA 3F2NA 4FK6A 4EYJA 4RVKA 1G8JA 5ANIA 3VS4A 3IONA 4AA4A 4F6SA 4O22A 3NAYA 4P90A 4MD7E 3RI1A 3UZTA 2BRHA 2XNPA 3G0FA 4V0GA 4YTCA 3IDBA 3VBVA 3WOWA 2A1AB 4AXDA 4Y83A 4FODA 4EOOA 3CJGA 1Z57A 2XNBA 3P78A 4ZJIA 4FSYA 4PMSA 2Q0NA 3NRMA 5DG5A 4U8ZA 3ZBFA 2YWVA 4J52A 5F95A 5HVYA 4DTKA 4NWMA 2VGPA 4GVAA 4GYGA 5CU2A 5HD7A 4XP2A 1OZ1A 1P4FA 2QCSA 2WMSA 2ETKA 4L44A 3DLZA 3FZSA 4JT3A 2XAOA 1S9JA 4CFUA 3CTJA 5JT2A 5CZIA 2NP8A 1ND4A 2GS6A 4O4BB 4UMTA 5J1WA 1ZYLA 4YPSA 2UZLA 3BH