3W1FA

Crystal structure of human mps1 catalytic domain in complex with 5-(5-ethoxy-6-(1-methyl-1h-pyrazol-4-yl)-1h-indazol-3-yl)-2-methylbenzenesulfonamide
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
280
structure length
259
Chain Sequence
ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Indazole-based potent and cell-active Mps1 kinase inhibitors: rational design from pan-kinase inhibitor anthrapyrazolone (SP600125)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Dual specificity protein kinase TTK
total genus 70
structure length 259
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3w1fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w1fA01
4EBWA 1GZKA 4HYSA 3FXZA 4HJOA 1JAMA 5A14A 5DEWA 4AN2A 3AGLA 4MXCA 4B0GA 4II5A 1Q62A 2FVDA 4K11A 1RQQA 4I41A 3VC4A 4FSMA 3SC1A 2WGJA 2EWAA 2UZVA 4HZSA 3UIXA 4RX5A 1ZMVA 4CCUA 2UZOA 3BE2A 4X3JA 3FLWA 3U9CA 5TR6A 1J7LA 1CSNA 3WZJA 1H0WA 4OLIA 1KE8A 3DAKA 4L3PA 3QZHA 5F20A 3F69A 1H24A 5GNKA 3JY9A 4BWKA 4ACMA 4GJ2A 1XH5A 4RZWA 3RM6A 2DUVA 3M11A 3ORPA 5FM3A 5LMKC 1UNGA 4CSVA 3E5AA 2QO7A 2J6MA 2WQOA 4BDJA 4AGUA 5EDPA 3RNIA 3L9NA 1UWHA 4GG5A 4RWKA 5AV1A 4NWMA 4YHJA 2CCIA 3GU8A 5CALA 3HLLA 1R1WA 4IAKA 5EM8A 2E9VA 3GC9A 4O0TA 4YBJA 5EKNA 5L2WA 4LGDA 5HU9A 4BGQA 3AD6A 2PK9A 4YO6A 1BMKA 1QMZA 2GTNA 3TKUA 3W2CA 3QTQA 3ZSIA 5HLNA 1MRYA 3AC5A 4X2GA 1WFCA 5LVOA 5DMZA 3FI3A 3HV6A 2AC3A 2F7EE 4D28A 5J9YA 2XF0A 4JNWA 2IVTA 3RZFA 2EU9A 4BHNA 3E62A 1OUKA 3P86A 5HKMA 5IQDA 5T68A 4F9BA 4KINA 3TUCA 5EDQA 2CGVA 4BCOA 3ERKA 3B2TA 4DEDA 4J95A 3ZU7A 2VWUA 4G6OA 1SYKA 4EH8A 5BVNA 3PSCA 4QMTA 2QKRA 4F6SA 2Z7SA 3OCBA 3WBLA 3DKOA 1OIYA 2BILB 2QQ7A 2X6DA 3OF0A 4B4LA 2VD5A 2GS6A 3O96A 4I93A 3BELA 4C4JA 4DF3A 3TXOA 4E1ZA 4MXZA 1L8TA 3UMXA 3ROCA 3PWYA 4FSWA 3SHEA 4C4EA 2VTHA 3KY2A 4JX7A 4KD1A 3VW6A 3WZDA 3AC8A 4AF3A 1PW2A 2O2UA 2YWPA 3F2NA 3SV0A 3OHTA 5FLFA 3NUUA 3BLQA 5IQCA 2PZRA 1J91A 3RCDA 3UO6A 2PVKA 3QKLA 2PUIA 4C34A 3Q60A 5KKRB 2VNYA 1ZMWA 3COIA 4YLJA 4Z16A 4ARKA 3BHVA 4E6CA 4BICA 2W5AA 3F7ZA 4AA5A 1GOLA 1SVHA 4UMQA 4C33A 3VUTA 5CSPA 2ZDUA 3O2MA 3FMKA 3AT2A 4O0VA 4BRXA 4QMWA 3PIXA 5KHXA 3AT3A 5J95A 4MD7E 4BZOA 1YHWA 1H1QA 1W98A 3EQDA 4FT9A 5EW8A 4TYHA 3RM7A 4GU9A 4TW9A 3WIGA 2C0OA 4FSZA 3E93A 5G1XA 3SRVA 4CD0A 5J1WA 5AP0A 3RK7A 1YOMA 1R0EA 2WMAA 4PL4A 3MYGA 4ZY5A 4FIGA 4WA9A 4BIBA 3QD0A 1WCCA 5TO8A 1W83A 3DLZA 4YJVA 3Q2MA 1H00A 2OIQA 4NZWB 1GZOA 2OU7A 4W4VA 2VRXA 5ACBC 1OITA 2GTMA 3ZRKA 2O8YA 3D4QA 3R1QA 5BUIA 5HEZA 1PMVA 4YSJA 3D0EA 3NYVA 1MUOA 3FLSA 2HIWA 3FLNC 3OROA 4GSBA 4YPSA 5L2TA 5M56A 4DFUA 3OY3A 3MH2A 4EL9A 1W84A 3TTJA 4YTCA 2XK7A 4H39A 4HYHA 5H2UA 4IDVA 1YWVA 4C4GA 4MBJA 3O17A 2PZ5A 3ODZX 3VBXA 2NO3A 2R3RA 4OTGA 2XH5A 4W4YA 4DGLC 3FWQA 4EEVA 2UW6A 3KGAA 4QMUA 3R9DA 4EK4A 2QOQA 3KL8A 1GZ8A 1WBVA 2UV2A 4XP0A 5L4QA 4RQVA 2R2PA 4IB3A 4U6RA 1Q8YA 5HCYA 3ATSA 2C69A 2KTYA 3ZLYA 1YOJA 4BFMA 4E4LA 3Q5IA 2R3GA 4Y8DA 3A99A 4ZY6A 4QPAA 1Y8GA 3OUKA 5CS6A 3ZM4A 1IA8A 2XNGA 4LYNA 4RFMA 4OTFA 5CEQA 3AC1A 3LW0A 2ITXA 5CY3A 4UXLA 4JR7A 1L3RE 2B52A 3UP2A 3RP9A 3UNZA 1H26A 3IW4A 1OBGA 4FSQA 4IAIA 3ZH8A 4F9YA 3MY0A 3ZDUA 4ERWA 3M42A 3DBDA 3FDNA 4F4PA 4LV8A 1MRVA 3E88A 4JBOA 3TZ9A 4BDGA 4DLIA 4FV7A 3D7ZA 1LR4A 5CSWA 5JEBA 3DDQA 2YCQA 4A9RA 5GZAA 3ATTA 4FR4A 4Q9ZA 2GNHA 3NUNA 3O7LB 2XCHA 4WT6A 5AP7A 3W10A 1M7QA 5LVMA 2IG7A 3OXIA 2R0UA 5F9EA 2G2HA 3F82A 3W2RA 3R71A 5BVOA 4GIIA 3P0MA 1XJDA 4P4CA 5C27A 3D7TA 4O21A 2WQMA 2BHEA 4C3FA 4OAUC 3R7IA 3DLSA 4HNIA 2Z8CA 5LMAA 2QI8A 2XZSA 3Q4TA 3WE4A 4ALWA 2I1MA 2XRWA 4EKLA 4OT5A 3BYUA 2R9SA 5J9LA 3SQQA 1IAHA 4XCUA 3S0OA 3DZOA 3FXXA 5E4HA 2V5QA 1YQJA 5CNNA 4FIFA 4IE9A 4FOCA 4I5CA 2JBOA 2JDSA 4U80A 3I0OA 3CIKA 3NUSA 4FKGA 4QYYA 3OT8A 2ERKA 4XH6A 4E73A 3ZXTA 3ZSGA 4AOJA 2XCKA 3LFAA 1KE5A 2SRCA 4Z7HA 3SOAA 3HUBA 4LFIA 4FK3A 4OTDA 3RAWA 3ZO3A 5FTGA 4IBMA 1NVRA 3PLSA 3FKLA 4L45A 1OKYA 3OTUA 3GCQA 4RVLA 1FBNA 3TL8A 4E4XA 2OBJA 2G01A 5EG3A 2HELA 2VTMA 4FL2A 4UXQA 4CV8A 3AMYA 3FMLA 3EQGA 2Y0AA 5BYZA 4BDFA 5EOLA 3E7VA 1OIUA 4I20A 2I6LA 2VWVA 4JQ7A 5IA2A 4GK4A 2YN8A 3EQBA 1OIRA 2PVLA 3D5WA 3NDMA 4KB8A 2XK8A 5KMKA 1IA9A 5CQUA 5HU3A 1XH8A 2WTVA 4DBNA 2CGWA 2EB2A 2ITOA 3OBGA 3QQUA 4OTIA 4C38A 4WNOA 4D2WA 2R3OA 4B6LA 5AV4A 3MY5A 4E5AX 3G2FA 4H1MA 1ZZ2A 3CR0A 4D1XA 5IA4A 4MHAA 3TJCA 1H1WA 4AGCA 5DPVA 3D9VA 3GU7A 3MIYA 3PIZA 4WUNA 3SVVA 3QUDA 4B9DA 3QQJA 3V51A 3Q4ZA 3KXZA 2B54A 1YWNA 2QVSE 4MVFA 2R7BA 3RWPA 3WI6A 2AYPA 2OFUA 2UZEA 3FUPA 3AQVA 1LEZA 3TDVA 2B53A 3NNUA 2J5EA 2RFNA 5D11A 4J52A 4DEHA 5BUJA 3NUAA 3HA6A 3PXZA 5HG5A 2JDOA 3PP1A 4YHFA 3QKMA 4MCVA 3DZQA 3Q52A 3FZTA 3GQLA 4EBVA 3C0GA 3MTLA 4LMNA 4QYEA 5G6VA 4FEWA 4P7EA 4OTWA 3LFBA 1XWSA 3C50A 4D2SA 2C0IA 4DH1A 4IB5A 2QNJA 5LOHA 1FMKA 2IVSA 1ZYSA 3FQHA 2QOLA 4BGGA 4L3JA 4F08A 3A8XA 3R8UA 3WF6A 5M08A 2ITQA 3NZ0A 3KA0A 4I0TA 4PDOA 3VS3A 4DT8A 3TN8A 4FZ7A 2G2FA 1A9UA 3GENA 3I79A 1ZOEA 1R0PA 1YOLA 2BAQA 3LJ1A 4TYGA 4XHKB 4BKJA 4DTBA 3C4FA 4FKWA 1AD5A 3VS6A 1B6CB 3L8VA 3OD6X 4P90A 2UW9A 2VTPA 2WU7A 3V04A 3W2OA 5FXQA 3UYTA 4FI1A 1URWA 3CD8A 4F0IA 4GJ3A 5IG1A 4WBOA 4UV0A 2Y4PA 4WO5A 4UN0C 2FSTX 2W1ZA 5I9UA 3BYSA 4AFEA 3ZONA 3MFSA 3OCTA 3UOKA 2F4JA 4BBFA 2XEZA 5E9EA 3T9IA 3RINA 2XIKA 4JBVA 3TV7A 5AR8A 5I5ZA 3RZBA 3HX4A 1YHSA 3W18A 3BU5A 2OJJA 3UGCA 2X1NA 3PZHA 5CZHA 4O0RA 3F5GA 5H8BA 4BBMA 4WSQA 2PMIA 4KKEA 1H8FA 1FOTA 2C1AA 5KBQA 5JK3A 5HHWA 4NU1A 5AA9A 4FBXA 5IISA 4F0GA 2QOFA 4R78A 2OG8A 2NRUA 2P3GX 4MKCA 5CAPA 4PNIA 2BROA 3LQ8A 3RMFA 4BI2A 3P4KA 4O96A 2WQEA 4I92A 5HTCA 2OJFE 2W4JA 3V6RA 2OLCA 3ODYX 4GG7A 5HQ0A 3Q32A 1NVQA 4O38A 3QLGA 3QC9A 5KNJA 2P4IA 5CAUA 3JXWA 1V0BA 4MXAA 1VZOA 3ALOA 3PWDA 3RCJA 3LMGA 4DEGA 4XLIA 1JKSA 4RIWB 4F9CA 4U79A 3VUGA 3ZRLA 2C1BA 3ZHPC 3D14A 2RF9A 5IQGA 2RG6A 3FLQA 4O83A 3PVGA 1RDQE 4G5JA 4PF4A 2HXLA 4E6DA 4FV1A 3WZKA 4CFUA 4CRLA 2WQNA 4FG9A 4NFMA 5DRBA 3VBQA 2CCHA 4AZFA 5AX9A 4BKYA 2YCFA 3ZXZA 5L2SA 3H10A 3HV4A 4W9WA 2V22A 4AT4A 4Z3VA 5H8EA 1XH6A 2UZLA 2UW7A 1Q8WA 2VO6A 3E63A 3H30A 3NW6A 4J53A 3VQUA 3R1YA 4AZTA 4JG8A 2OW3A 3VS2A 2F7ZE 4MXYA 3P7AA 2XEYA 4UYAA 3VWAA 3MVMA 4IAFA 5CX9A 5JRSA 2BPMA 5EKOA 4QQTA 5KMLA 4QMYA 4N70A 1X8BA 1U5QA 4X2KA 1Q8ZA 4KNBA 2G9XA 2UZBA 4R1VA 4KA3A 1B38A 1ERKA 5E8VA 4D2VA 5ITAA 2C6EA 3CE3A 2WMQA 5K3YA 4EZ3A 4U0IA 4M13A 4D5HA 5CF6A 2EXCX 4W9XA 2W4OA 4DAWA 4GKHA 4DG0E 1SMHA 5HE3A 3R9HA 1NW1A 5AP5A 5IDPA 3DDPA 3KRRA 3GCVA 4BCJA 1YVJA 3IOPA 5CXHA 5EQPA 2H8HA 3RPSA 3TZ7A 4BIEA 3QA0A 3Q4UA 4PMTA 5JT2A 4FMQA 1GIHA 4IADA 3UOLA 1WVWA 2ESMA 4AT5A 5DBXA 3B8QA 4WRSA 5IKWA 2WEIA 4B99A 3M1SA 1OL7A 5EM5A 2X9FA 3NGAA 3HMIA 4HVSA 2F9GA 5JFVA 3R8ZA 3C0IA 3QQHA 3UYSA 4XMOA 4JLCA 4EH4A 4FIJA 4XNEA 4Y73A 5J79A 3HKOA 4OTHA 3R7VA 4EKKA 4PPCA 1SVEA 4D9UA 3AC4A 4ONAA 4EQCA 3RVGA 1JSTA 1J7IA 5ANDA 3OMVA 3TEIA 3R6XA 1XBBA 2RKUA 3VULA 1ZYDA 1JSUA 2R3HA 3GXLA 3HGKA 5HX8A 3LVPA 5CAOA 4EHEA 2FH9A 3BGZA 5GIPE 1R39A 2JIIA 2QOHA 5HI2A 1YXUA 4TKSA 4TT7A 3A62A 5F94A 4GYIA 3G6HA 3BZ3A 4K9YA 3QUEA 5DFPA 4ZSJA 3D94A 4BCHA 4WG3A 4C37A 4C59A 3L8PA 2XK4A 3OZ6A 4GFOA 1W82A 3I7CA 3KRLA 3PA5A 4TWNA 4JI9A 4X0MA 4U5JA 2BKKA 4JDKA 2VN9A 4K0YA 4C4FA 3ZTXA 3U4WA 3ZFXA 4I6BA 2E9OA 3KCKA 3HMOA 3EQHA 4AN9A 3VBWA 3OUNB 4AE6A 4D4YA 4FIEA 4TYEA 2GS2A 3VF9A 4CT2A 5KUPA 2C47A 4CLIA 3P1AA 3ZYAA 3CPCA 5HVYA 2X7OA 1OVEA 4QMPA 5M53A 3QA8A 4ACDA 5BQ0A 4RG0A 3GCUA 2QO2A 3R0TA 4RIYB 2Y7JA 2YA9A 1P14A 3GCPA 3VW8A 4WUAA 2Y6MA 1P4FA 4ZK5A 3UIBA 2GS7A 3W8QA 4DN5A 2R3LA 1HCKA 2W1HA 4MBLA 2WMXA 3G33A 1I09A 2C3JA 2J0MB 3KN6A 3VNTA 4OBOA 3POZA 4I4FA 2OH4A 4QP6A 5A4CA 3TNIA 3VS7A 3RAKA 3V5WA 5CQWA 1KSWA 2XA4A 3F5XA 4YPDA 4DEIA 4E93A 5L3AA 3JUHA 2WXVA 3W2SA 4XV2A 4U7ZA 5J87A 4KS8A 4UZDA 2ITUA 4ZP5A 5I4NA 4O86A 4D0WA 3NS9A 1G5SA 1ZXEA 4Y83A 4IX5A 4V0GA 3PP0A 4RJ3A 1CKJA 4XG8A 3EYHA 3WF8A 4N6ZA 5DOSA 2V62A 3R7EA 1Q3DA 2F49A 4G9RA 2BRGA 3F88A 3BQCA 2GU8A 4G3CA 1APME 3IPHA 1BUHA 4RIYA 4TYHB 5AUYA 4PPAA 5D7AA 4FZFB 2YJRA 4AW5A 3BU6A 3EHAA 4ZSLA 1FVTA 4RPVA 4YNOA 4XOZA 5IF1A 1UV5A 3V8SA 2IZSA 3ZC5A 1BKXA 3LCKA 4MD9E 1U4DA 5KMMA 3WF5A 4D2RA 1CKPA 3B2WA 2GHLA 3R8LA 3WZEA 4HNFA 5CT0A 4FL3A 5EM7A 5CEKA 2IVVA 4BCMA 5FGKA 2VU3A 3ZUTA 3C5IA 2YM5A 4CYJA 3FSKA 4IDTA 4I6HA 4G9CA 3MSSA 1CM8A 4YZ9A 2XNPA 3BV3A 4DG3E 3G15A 3FMJA 1BX6A 2G1TA 3FXWA 3S4QA 4A9TA 4BCGA 4CV9A 4DEBA 3UVPA 1B39A 1KWPA 3PPZA 5AR5A 4X3FB 5HD4A 2Y6OA 4MF0A 3UDBA 4GS6A 1V1KA 5D12A 2VTJA 4DH8A 2HAKA 2YIWA 4R7IA 1PMEA 2W1DA 4AXAA 2CN8A 3F2RA 3TNPC 4DGMA 3UOHA 3R8VA 3BV2A 4IWPA 4O7LA 3PPKA 3WE8A 5LXMA 3U6HA 3SXRA 3PVUA 4G17A 2GDOA 4O1OA 2QHNA 4ZTSA 4MXXA 3K5VA 3VUIA 4Y46A 5M4UA 4I5PA 2BRNA 3ZO2A 2BIYA 4I94A 2YM4A 1MQ4A 2WMSA 2BVAA 4Y85A 3UO5A 3DK6A 1FMOE 5CU6A 4I6QA 1YDSE 3V5JA 3MDYA 4JIAA 4LRMA 3QD3A 5KMJA 4FTJA 4LQMA 5LWMA 2P2IA 2OXYA 3FI8A 3S00A 4H36A 2BTRA 4BN1A 2X6EA 4G3FA 4P2KA 4X2FA 3E64A 2QOKA 3NIEA 5HLWA 4FNXA 5K0XA 5F95A 4IWDA 1G8SA 1BI8A 4AS0A 1ZAOA 2HY0A 2NRYA 4IC8A 4RWJA 4CMUA 3E8EA 4GMYA 4EH2A 2WMRA 3U54A 4FF8A 3I1AA 4IVDA 4E5BA 3EYGA 5KMNA 2JGZA 4AN3A 3TI1A 4O6LA 3QRKA 5L6PA 1PXJA 5BYLA 4C2VA 3PTGA 3DBFA 4MNFA 2I40A 2CNUA 4V04A 5AV3A 5CNOA 4G31A 3D5UA 1XH7A 2E9PA 4PTGA 3ORZA 2WIHA 3HDMA 4FTNA 4BC6A 4ZZNA 3HP5A 1M14A 5M51A 3TM0A 3DBCA 3QCQA 3ET7A 3UVRA 3FBVA 5FTQA 4QQCA 4XRLA 2X81A 3KRJA 4BZDA 3EQFA 1REJA 4HCTA 2Q0NA 4HVGA 4U42A 3NR9A 1TQMA 3ACJA 1JLUE 4M84A 5AM7A 4AG8A 4FKIA 4ZS0A 5AUTA 3QTSA 2R3MA 4O84A 5JN2A 1FINA 3PRIA 2F57A 3VVHA 3O8UA 2XUUA 4OAVB 1QPJA 4N6YA 3TNHA 4DTKA 1PMNA 3GU4A 5IEXA 1VYWA 1KE6A 3QRJA 2WKMA 2XK3A 4WNPA 4TNDA 5IA1A 3A8WA 2QOOA 4GUBA 4ANLA 4C0TA 2OK1A 3G0FA 4YZMA 3KFAA 3JY0A 3LKMA 4I22A 4MWIA 5E7RA 1HOWA 4UEUA 2X2MA 2YM8A 2C3LA 3QD2B 3HUCA 5EYMA 5HG7A 3SG9A 5KMIA 1VJYA 4BF2A 4DFXE 4AZVA 2XIXA 3G5DA 3IGOA 5J5SA 3KXGA 4I0RA 4WD5A 3LJ2A 3FY0A 3TNWA 5BNJA 5EK7A 3CTQA 5AR3A 5FEQA 3Q5ZA 3K3IA 5K0KA 3P9JA 5CENA 2GQSA 2PULA 5GIOE 5LJJA 3DXQA 3MBLA 2VX3A 5I9XA 5EFQA 5HE2A 2QOCA 4GH2A 3REPA 4LUDA 1WVXA 3KRXA 4WOVA 3OXTA 4LUEA 4H58A 5HO6A 3UQGA 4FA2A 1GJOA 4QP8A 4QTBA 1Q8UA 3UNJA 3AC3A 2I0YA 2XB7A 3P79A 2VGOA 2ACXA 2QLQA 2XK9A 3BYMA 3HMNA 4OBPA 4X6RA 5LVLA 3TIYA 1OMWA 3CP9A 4JOAA 1UWJA 2Y4IB 4EHVA 2YERA 2R3PA 4R1YA 3C4CA 2A4LA 3EH9A 5A4LA 4ZTLA 2BRBA 3HL7A 4LGHA 4HW7A 4ZLOA 2QURA 3E87A 3I0QA 4O81A 2P55A 5EW9A 4ANQA 1GY3A 2J7TA 4G34A 4DFZE 2R5TA 4WIHA 3HRCA 3IG7A 4R5SA 2VO3A 4PQNA 4PUZA 1H27A 4RA4A 4S32A 2GFSA 2XMYA 2XNEA 2CJMA 5DG5A 5LARA 4BWPA 5J7BA 1UU3A 3OOMA 3FHRA 1PRYA 3EMGA 4NW6A 4RVMA 2PVJA 4RQKA 1OI9A 4F64A 3VS5A 2PMNX 3BEGA 2GMXA 2JC6A 1KOBA 4ZMFA 2VO7A 5FUTA 2WELA 3ORLA 4FG7A 1F0QA 4EOOA 4O7ZA 2V7AA 3RPOA 2DYLA 2VX1A 4C2WA 3OT3A 3PA4A 5ANGA 3AOXA 3V3VA 2PVMA 4FTOA 4P5ZA 4YJNA 2XYNA 4LI5A 4QTAA 5M57A 1PXOA 3ZEPA 5I3RA 2Z60A 3PVWA 4QO9A 3VIDA 4M14A 4MAOA 2PVHA 4G3DA 3PUPA 3AD5A 4W4XA 3Q9ZA 2BDWA 4G2FA 4YTIA 2XK6A 5ANOA 4NIFA 5M4FA 4IWQA 4TY1A 5AR2A 4FVQA 3HECA 5JGAA 4IJPA 1Q4LA 2XIZA 1H1RA 2XBJA 1H25A 4XEYA 2C6MA 4C36A 4WBBB 2ZV2A 3KEXA 4I5MA 1YXSA 3QZIA 2BZJA 4GYGA 3D83A 5CEOA 3CCNA 4KRDA 1QCFA 2JKQA 3NAYA 4I23A 3WZUA 2B9FA 2OWBA 2YJSA 1YRPA 4XG3A 3PJ8A 3GFWA 1LEWA 1O6LA 3OCSA 4AW0A 2XNMA 3R2BA 3ZC6A 3CBLA 4R5YA 3TWJA 4C57A 1PKDA 1KOAA 3C9WA 4OTRA 4IAAA 4RC4A 4S33A 5GZ9A 1S9JA 4LRJA 3FY2A 3MA6A 3ORXA 3GU6A 4YJQA 5D7VA 4OW8A 3CQEA 4CQGA 4ANOA 2XNOA 4N4SA 4AW1A 4EOPA 4QT1A 4LOPA 4X6QC 3ZOSA 2HZIA 4M0ZA 4D5KA 2GNIA 2YACA 4FZAB 2A1AB 3MVHA 3NWWA 2YIRA 4L00A 4Y5QA 3GC7A 3PG3A 3R2YA 4IVCA 4AZWA 4IZ7A 3EFJA 4HPUE 3Q9YA 4BR3A 4FKRA 2Y9QA 5EI8A 4ZTHA 3W1FA 2VV9A 2PUUA 2W1CA 4TRLA 3W2QA 2R3JA 3GEQA 3QRUA 2Z7QA 3H9FA 3QZFA 5DYJA 2IW8A 1XBCA 2A2AA 2BZHB 2YHVA 4K2RA 1ATPE 3A7FA 4IB1A 4Z55A 2VAGA 4NYEA 3PJ3A 4QMQA 4MBIA 4QMOA 3VS4A 4J8NA 1HCLA 2PZPA 3QAME 4IVAA 3RJCA 1YDRE 1Z9XA 1K2PA 5IMXA 5M09A 5HNGA 2OICA 5A4QA 5FRIA 2CLQA 3OC1A 2W9FB 5CANA 2J9MA 2EUFB 4K18A 4I24A 2IZTA 2WEVA 3RHXA 5BYYA 2C3KA 3LZBA 3KF7A 3RPYA 3ID6C 4IJ9A 5EI2A 5AEPA 1SNXA 3QQFA 4IM0A 3EFWA 2X4ZA 3ZSHA 5ETIA 1Q61A 5CYIA 3QUPA 4NM0A 4A4XA 4E7WA 5AA8A 4BHZA 5J8IA 4AX8A 4FTCA 5IZFA 3LQ5A 4A06A 5L2IA 3HA8A 3A61A 1P4OA 5CVHA 5AIRA 5EHOA 3RGFA 4RGJA 2CKPA 4HCUA 4Q9SA 5JQ5A 3OWPA 1QPDA 1SNUA 1R78A 1ZRZA 3FE3A 2PMLX 3NUPA 4B8LA 4BCNA 4EOLA 1WBPA 3VHEA 3OTVA 4BCQA 1I44A 4F6WA 4RX8A 3BBWA 4BB4A 2GQRA 1O6KA 4APPA 4FKLA 4JX3A 3U87A 4L42A 4XRJA 1REKA 3UBDA 1T46A 4O2ZA 4AQCA 2OFVA 1DAWA 5I9WA 2PPQA 3VF8A 2C5XA 4C3PA 4EQMA 5EM6A 2UW0A 5CSVA 2A19B 2R0IA 3NAXA 2WPAA 4ZTNA 1U5RA 2AC5A 4E6QA 4M3QA 3RAIA 4U45A 2H96A 3MPTA 4PNKA 3AXWA 4IB0A 4EHGA 3ORNA 1XH9A 2GPHA 2PZIA 3F61A 3BCEA 1WBWA 1KV2A 4L53A 2ZB1A 4X7QA 4O7NA 4DBXA 3TV6A 3LXNA 3QHWA 5DNRA 2RL5A 2ITYA 2BALA 3V5TA 4CFMA 3JYAA 3VUMA 3IO7A 3NMUF 5IQBA 3MY1A 4O0SA 3TNQB 4JL9A 4Q2AA 3HP2A 3I6WA 2QOBA 2RGPA 4FG8A 4RWIA 1YWRA 2HCKA 3KKVA 5AJQA 3QYWA 3L8SA 4FTUA 5T6KA 1O6YA 3WF7A 4QP4A 4F1TA 3MVLA 2W1IA 2CKOA 3TDWA 1YW2A 2DS1A 3MPAA 1Z5MA 3LE6A 4J71A 4QP2A 1OBDA 4BGHA 2ETRA 4DH3A 5ETFA 3CY2A 4PRJA 1M7NA 3EB0A 4F9AA 3F9NA 4DITA 3QTWA 4FVRA 5A54A 3K3JA 3ACKA 4KIKB 2C6KA 3GT8A 4UMTA 5AFVA 4JAJA 2CPKE 2FA2A 2PE0A 3R73A 3I4BA 3LCTA 2VWWA 3DNDA 3QTIA 3BHYA 4NSTA 2XIRA 1IAJA 3CKWA 3OVVA 4BI1A 3LPBA 4RIXA 4R7HA 4DC2A 4RRVA 2RFEA 5TF9A 3FZPA 3CC6A 3O8TA 4MF1A 4CXAA 2F2CB 2ZMDA 4DE4A 4FZDB 1PY5A 4NTSA 1G8AA 5BVFA 4OUCA 2O0UA 4IFGA 3BU3A 3Q4CA 1DS5A 4QQ5A 3C4XA 3ZZWA 1K3AA 2WOUA 4IW0A 1E1XA 1W0XC 2PE1A 3PJ1A 3QZGA 1H28A 3MPMA 4EH6A 3P7CA 3PRFA 4FEXA 3QGYA 3KN5A 3MJ1A 2EVAA 4FODA 3UC4A 3HZTA 4FKSA 5JKGA 5LCJA 4YR8A 4UWBA 3A4OX 3RALA 5HBHA 2BHHA 5A46A 5L6OA 3ZDIA 3CTHA 3HRBA 5FP5A 1ZARA 2PMOX 2GFCA 3DTCA 4KIKA 4PDSA 5JZNA 3HV5A 4RSSA 1NY3A 4I3ZA 4D58A 5JGBA 1Q41A 3ZMMA 3LCSA 3F66A 4JQ8A 4ALVA 3EQRA 2CNQA 2X0GA 3AMAA 2YAAA 2XKFA 4L52A 1BLXA 2B7AA 4IHPA 4XG9A 3S3IA 2JEDA 3BBTB 3NRMA 3T9TA 2YZLA 4UMRA 4USEA 4AAAA 2BAJA 4RIXB 4HPTE 4GRBA 5KZIA 4QP7A 4PDYA 3HYHA 3AT4A 4ZJIA 2XM9A 3UPZA 5CI7A 2YIQA 4ORKA 4ZLYA 4JQEA 1Q5KA 4EOQA 5IQIA 1OL5A 3EL7A 2VTAA 3FPQA 4RJ8A 3U4UA 3U51A 5FBNC 5CEMA 3F3VA 2UUEA 4UZHA 3ZCLA 3KB7A 4XV1A 5ANJA 5AAEA 4RJ5A 2IPXA 2QG7A 4UWYA 1JKTA 1GZNA 4KSQA 2CLXA 4DH7A 4F6UA 4YU2A 4LL0A 3PDTA 2FB8A 3FYKX 4FNWA 4KIOA 4NJ3A 5AAFA 4BYIA 4YTFA 1FPUA 5HNIX 3MGYA 1FVVA 4JBPA 5CU2A 5DWRA 5BVKA 5AADA 4QTDA 2CNVA 4ZSAA 4EOSA 1YXVA 3DPKA 3JVSA 3NW7A 3OCGA 3PY0A 4IM3A 4X3FA 3BYVA 5J1VA 3AD4A 4IC7A 3EWHA 3Q53A 4TTHB 2YIXA 2PVYA 2WIPA 2XYUA 3P5KA 3C4ZA 3EIDA 2ITNA 2OJ9A 1H0VA 3KULA 3L9PA 4U97A 5DR2A 2O65A 2PSQA 3CGOA 1WBOA 2B9HA 1H1PA 3L1SA 1K9AA 3EL8A 5HIBA 3A7GA 4F09A 5IUGA 2YM7A 3RNYA 4EONA 5TT7A 4BDCA 3FV8A 4IX6A 4FTIA 3LFFA 4J1RA 3FEGA 3E8DA 3QTZA 3CEKA 3UTOA 3UZTA 5IEYA 3C1XA 1JWHA 3ALNA 2YLFA 3L9MA 2A0CX 3OY1A 2Y8OA 3PXQA 4PL3A 3UIMA 4X2NA 5AR4A 4DEEA 4O7RA 4EWQA 2KULA 3FL4A 4D4VA 3DS6A 2JLDA 3BX5A 5IQAA 3LLTA 4DCAA 2ONLC 3NPCA 2WOTA 2C6TA 2QO9A 3KK9A 1BL7A 2JKMA 5AIKA 4RX7A 4EC9A 4TN6A 5A4TA 1WBNA 2OJGA 1TKIA 3BRBA 1U54A 1Y91A 3U9NA 3PJ2A 4QYHA 4EJNA 3P7BA 4IIRA 3Q9XA 1CDKA 2WTWA 5JFSA 3F5UA 3OBJA 4Z7GA 4EYJA 2X8EA 4ASEA 2R3KA 3D15A 4D1SA 5C8KA 2CMWA 3W32A 5F4NA 5HOAA 4FIHA 3E3PA 5FXSA 3A7IA 5DR6A 5E8TA 2PTKA 4WG5A 3LIJA 4EK8A 4O0YA 3ZBXA 1YI4A 3DKCA 5HTIA 5CF5A 2C4GA 3A60A 3DJ6A 5FEEA 4D2PA 2GCDA 1URCA 2BFXA 4FKOA 3OP5A 3QX2A 3R8PA 4FV3A 1YHVA 3U8WA 4ZZOA 1UVRA 5CVFA 4UMUA 3HMPA 4ASXA 5DRDA 1VR2A 4AOIA 4ENYA 3UZPA 4USFA 1ZOHA 2VZ6A 4L67A 3TIZA 5DR9A 2WMTA 5HVJA 4K77A 3GUBA 3TG1A 2V7OA 5EQYA 3QWKA 3ZO1A 3W2PA 2FSMX 3DQXA 3R22A 4FIIA 4GIHA 3R30A 3DFCB 3NEWA 3VS0A 2BDFA 5DVRA 4BTKA 3LMHA 4U3ZA 2VTRA 2E9UA 4O0WA 1XO2B 2WB8A 4KS7A 3NVKI 4U44A 3ZLXA 4FSTA 4ZTQA 3ZBFA 2FYSA 2Z2WA 3I81A 2PVRA 4LGGA 3TZ8A 4IACA 2YABA 4NK9A 4NM5A 3FZOA 4C58A 4FTRA 1W8CA 2QHMA 3LFSA 3V8WA 3UODA 4L8MA 5HIDA 2BRMA 3QHRA 4KUJA 3A7JA 5B2LA 2REIA 4FGBA 2C3IB 4CG8A 5DN3A 1OB3A 3Q3BA 3G9NA 4EZ7A 1VEBA 4KRCA 4CTCA 2GNJA 3N4UA 4FTKA 1OPLA 4FNYA 3WOWA 5EHYA 3DXPA 2B4SB 4O6EA 4YBKA 4ZY4A 1GIJA 4MH7A 5TKDA 2BZIB 4DFBA 3QXPA 2YM3A 3PZEA 4JR3A 5AV0A 4RIWA 3GC8A 4GV1A 4GK2A 5E1SA 2IVUA 3SGCA 3OWLA 5GJDA 3EKKA 4NM7A 5I9ZA 5AP2A 2CHLA 2C5NA 2I0HA 2ZOQA 3HV3A 3QALE 2P2HA 4I6FA 4QMNA 1BL6A 4BVUA 2RIOA 3R28A 4L9IA 4QOXA 4ZZMA 3ORTA 3HV7A 3KC3A 5AV2A 3OS3A 4Y5HA 1UU7A 2B55A 3G51A 4ALUA 5EOBA 2Z7RA 4IQ6A 4EH3A 1OUYA 4EUUA 1UU9A 3C4EA 4ANBA 2VGPA 4RC2A 2HOGA 4CMTA 1V0OA 3KMWA 1W7HA 2QU6A 2IJMA 1JVPP 3OOGA 4G6NA 5DH3A 4E8AA 5K4JA 3CSVA 3UMWA 3TUDA 3BI6A 2ZYBA 3B8RA 3OG7A 5AMNA 1GNGA 5ANEA 4F70A 2Q0BA 4V01A 5EI6A 3IDCA 5A4EA 2OSCA 3HMMA 3QF9A 5HBJA 2VTOA 3QXOA 5DIAA 4CZYB 4AWIA 3DFAA 3R01A 2W1FA 4O82A 5J5TA 4QQJA 2QU5A 2I7QA 4MD8E 4LM5A 2C6OA 5HD7A 3KU2A 2ERZE 2BIKB 4JXFA 2XKDA 4AT3A 5AP6A 3SKCA 4LOQA 3CLYA 4S31A 5HTBA 3VO3A 4MWHA 1JQHA 4GCJA 5BPYA 2HYYA 5LMBA 4XP2A 4MTAA 5F1ZA 1UNHA 4AUAA 2BTSA 1ZOGA 3NLBA 4MEDA 4YZDA 3CXWA 2YITA 3MH1A 5HVKA 3P23A 4IXPA 5JGDA 2QR7A 4J97A 4CFFA 3CQWA 2W0JA 1JKLA 3R8MA 4JS8A 4O7YA 3F3ZA 1PXIA 3IDBA 4FVPA 4MXOA 4RVTA 4R7BA 4BTFA 2UW8A 4RA5A 3DU8A 4FT5A 4L68A 4V0GB 5IH6A 4G3GA 4RJ7A 3Q6WA 1MQBA 2WAJA 3SXSA 2LGCA 3IW7A 4BDDA 2GNGA 4L44A 1BYGA 4XG4A 2JFMA 3GI3A 3M2WA 5CT7A 4OTQA 3RAHA 3TUBA 3O23A 5KBRA 4FC0A 3QX4A 5JQ8A 2X4FA 4FKUA 2X2KA 4CYIA 3DT1A 4BCKA 3LFNA 4U9AA 4YHTA 4C3RA 4RJ4A 4ZOGA 4FTMA 4U8ZA 2HXQA 3QGWA 3EN6A 4R3RA 4C61A 5LVNA 2J2IB 5AUXA 2ZMCA 3KXHA 5ICPA 3FZSA 2F2UA 3I60A 3BLHA 3KQ7A 3F7WA 3Q2JA 4TWPA 4RLLA 2DQ7X 4W8DA 5FTOA 3OWJA 4ZSEA 4C4IA 4N0SA 4MNEA 2PVFA 5HX6A 3NUYA 4EOKA 4XS2A 4AZSA 5C9CA 3BE9A 3ETAA 1U59A 5E8SA 4PP9A 5HESA 5HNBA 4ANMA 3ORKA 2XJ2A 3NSZA 4AZEA 3GP0A 4CKIA 1M2PA 4EK3A 4KKHA 2XKEA 4OR5A 4XV3A 5AAGA 3EN7A 5HZNA 4UWCA 1GIIA 3FL5A 3QRTA 3UNKA 2YDIA 4XP3A 3ZZEA 3KRWA 3ZS5A 3UP7A 4IZ5A 4AGDA 3FJQE 2UZWE 4CRSA 3ZLWA 4TL0A 2OJIA 3PFQA 4F1MA 4XV9A 4U81A 5CI6A 2OXDA 2OZOA 5CSXA 3NW5A 1R3CA 2NPQA 3UG1A 2J90A 1OPJA 3K54A 4IMYA 4KBKA 4ANNA 3QQGA 3GBZA 4YJPA 5HICA 2XNNA 2FSLX 2LAVA 4HCVA 4QMXA 5LWNA 4H05A 1FVRA 4ZXTA 2UVZA 4IZYA 5ANIA 3IOKA 5EYDA 4QMVA 3W55A 4C4HA 4DHFA 2BUJA 2VWBA 2ITZA 4ITJA 5E8UA 3UO4A 5D1JA 5K5NA 4BYJA 3U6IA 1TVOA 5CASA 3TKIA 4DA5A 1G3NA 3OFMA 3FMNA 2VO0A 2AUHA 5M07A 4ZIMA 1RW8A 2WMBA 1J7UA 2HZNA 2NNWB 2C6LA 2WTCA 3NYOA 2JD5A 1DI9A 1PHKA 3LHJA 5BVWA 2QR8A 4FICA 3U55A 4JG7A 1TQPA 2J0LA 1PKGA 4PMSA 1WZYA 2W4KA 3E8CA 4IZAA 2CKEA 4D55A 3KREA 3QWJA 3MH3A 1LPUA 2CGUA 1KV1A 4FKPA 4EC8A 3DGKA 4H3QA 3WILA 2ZM4A 4PX6A 3UPXA 2I0EA 1IR3A 3V6SA 4DFYA 3I7BA 3RK9A 1XHAA 4PP7A 3KCFA 2H6DA 5C8NA 4ACHA 3QYZA 4HVHA 3FPMA 1Y6BA 3LFDA 3VN9A 3VRYA 1M52A 5CVGA 4YMJA 3DB8A 2XM8A 1A48A 3Q6UA 3DBQA 2WD1A 5H9BA 2ZVAA 5E8WA 3VUDA 5C01A 3TACA 4E26A 1S9IA 4XOYA 5FDPA 4YC6A 3ZUUA 2W9ZB 5L6WL 4ANSA 2BAKA 2W5BA 3UZRA 2HW6A 1PYEA 5E90A 3DOGA 5A6NA 3QFVA 4FZ6A 3L9LA 4ZJJA 5GZ8A 1LUFA 4D9TA 4O7WA 4EOIA 1IEPA 4YLLA 3V5QA 4EH9A 2ZV9A 3K2LA 3MB7A 4DCEA 2ZV8A 4DH5A 4E20A 1AGWA 1JNKA 2WO6A 4TZRA 2WMVA 1J3HA 1Q3WA 3COKA 4G1WA 4M69B 4NM3A 3R7YA 5EQEA 4XUFA 4O1PA 3FC1X 2O64A 4HZRA 3R63A 1IASA 4FEQA 4BDEA 3R7OA 4CFVA 3D7TB 2CN5A 4IM2A 4I1ZA 1H07A 2R64A 4RLKA 5KMOA 1CTPE 2W05A 3D2KA 2HWOA 3R7GA 5EW3A 3LQ3A 3SRVB 2EB3A 4DGGA 2HWPA 4CFNA 1STCE 4ID7A 4XG7A 4CKJA 1KE9A 4G6LA 4XG2A 2BFYA 3LM0A 5JFXA 3QTRA 1ZYJA 2VWIA 2JAMA 2ITVA 2IZRA 3R04A 2YDJA 3RI1A 5BUEA 2B9IA 2C5OA 5J9ZA 3VQHA 3AMBA 4CLJA 4TYIA 2O5KA 3QC4A 4FV6A 4M68A 2NP8A 2ITPA 3IW5A 2ZM3A 4QRCA 2VWZA 4XYFA 3CY3A 5D10A 2B9JA 5HE1A 3JR1A 4OGRA 4Y95A 2ZDTA 4EK5A 3PY3A 3DK7A 4ITHA 5GHVA 3WARA 3E3BX 4I0SA 3CGFA 3PSDA 3R9OA 3Q04A 2PY3A 2UZDA 2YLEA 1UNLA 4H3BA 4BDKA 4DEAA 5JZJA 5HLPA 2BRHA 4CNHA 4FV9A 4AFJA 3U6JA 3IDPA 4M67A 4APCA 5I3OA 4JG6A 4LRKA 3QCSA 3QL8A 4NKSA 4YSMA 2VWXA 3N4TA 5CTPA 3DQWA 3VJNA 4PWNA 5DT0A 3EJ1A 3UQCA 4BDBA 4E6AA 4RVKA 5EHLA 4MYGA 5FD2A 3QD4A 3W16A 2DWBA 5CEIA 3VJOA 4CTBA 4K8AA 4YURA 5BX0A 1JSVA 1OL1A 3GB2A 1ZY5A 4GT5A 1NA7A 1M17A 1Z57A 1ZY4A 3AGMA 5KE0A 3RPVA 4F1OA 3SG8A 2R3QA 3G6GA 5DGZA 1KUTA 5J7HA 1AQ1A 2OH0E 4FT3A 2YWVA 3FI2A 2W17A 4DYMA 3N4VA 5HBEA 4I21A 1YXXA 4G3EA 3GNIB 2YISA 1T45A 2J0JA 3BEAA 5E8XA 4EYMA 4HVIA 2UW4A 4GU6A 4LOOA 4NL0A 5HG9A 4NH1A 4JIKA 4BDHA 2XBAA 4TNBA 4JT3A 4WSYA 4U40A 3TKHA 4E3CA 2QOIA 2C30A 3DK3A 2H9VA 5IQEA 5HIEA 3EOCA 3ZFYA 4FE2A 1ZYCA 2PZYA 4NEUA 3KXNA 3CQUA 5FBOA 4BDIA 4XJ0A 3NUXA 2HY81 1P5EA 5FG8A 2IN6A 3OWKA 4BCFA 4FEVA 1ZYLA 2ZJWA 4K1BA 4EK6A 4YZCA 4MK0A 5M06A 1F3MC 3VRZA 5JSMA 4JJRA 5DA3A 4A4LA 4FYOA 4U41A 2HZ4A 3CJGA 2J0KA 2QLUA 4FV2A 2Z7LA 4UALA 4XBUA 4ZAUA 5B7VA 4GVJA 4EJ7A 3NCZA 2JKOA 3HNGA 4RT7A 2ETMA 3LM5A 4KWPA 2O63A 3MVJA 1E9HA 2YDKA 4Q5EA 1NXKA 3LXLA 3TTIA 3MJ2A 2B0QA 3KVWA 4C7TA 2W5HA 3R1NA 3V01A 3GOPA 2GHMA 2J0IA 3QTUA 3RBWA 3FC2A 4AA4A 1PXMA 3C0HA 4DTAA 3F3WA 2JDTA 2YM6A 4EOJA 4JDJA 3GQIA 3DJ5A 1U54B 5DHJA 5A6OA 5IQFA 3C4WA 3SD0A 5M4IA 4WNKA 3FLYA 2UZNA 3MV5A 1J1BA 4TPTA 1DAYA 3QKKA 1TQIA 4RJ6A 2PUPA 2YFXA 2OKRA 4NUSA 4LV5A 3FMDA 5DT3A 3BWFA 3JPVA 2UVYA 3MFUA 2X8DA 4FX3A 4NT4A 3V5PA 3R1SA 5C8MA 3SAYA 4M97A 5IPJA 3OEZA 4WHZA 2VTQA 4PL5A 4PV0A 5C26A 3MH0A 3H9RA 4CEGA 3LMIA 5LQFA 2UZUE 4XLVA 1RE8A 5HE0A 4MQ1A 5BMMA 5C03A 4JDIA 3ANQA 2QKWB 3PE1A 3IQ7A 4TYJA 5TOZA 5HORA 3PXRA 4BTJA 2WTKC 4L01A 4JRVA 1PXKA 5M4CA 4M0YA 4QMMA 3R21A 4O0XA 2HZ0A 5KO1A 3DV3A 3MB6A 4UY9A 2WNTA 3TZMA 1F5QA 2WTJA 3KMMA 4CKRA 4RBLA 5HO8A 3LXKA 3MWUA 2V0DA 2W7XA 4GUEA 4V05A 4ACGA 3PLAE 4H1JA 4HVDA 2B1PA 4KAOA 4D0XA 4FUXA 2WHBA 2OF4A 2XVDA 4C02A 4NJDA 1OKZA 1YI3A 4QNYA 3C5UA 5L8LA 4FV5A 5CLPA 1OIQA 4PY1A 4TWCA 4C35A 1MP8A 3MN3A 4NIFB 5KZ0A 4PMPA 1J1CA 4O7VA 3GU5A 4J98A 4KABA 4FKJA 3AC2A 4AACA 4L7FA 4N57A 2OXXA 4O91A 5H8GA 3ULZA 4EH5A 3P08A 3ZUVA 5IA3A 1Q8TA 4DFLA 1Y6AA 4R77A 2G15A 2PU8A 5FXRA 3DBEA 4HGSA 3HAMA 5KHWA 2RG5A 1WVYA 3QCXA 1H01A 2V55A 3DA6A 3P78A 5BVDA 3UE4A 4O27B 1O9UA 3FMMA 1SZMA 3V8TA 2C6DA 4GFGA 4IX4A 4GT4A 2WZJA 3UIUA 4QP3A 2R3IA 4BY9E 4HYIA 5AP3A 3MESA 3MIAA 3ZM9A 2F7XE 3G0EA 2C68A 5LMKA 1QPEA 3IS5A 4FT7A 5T3QA 3PG1A 5FDXA 5AX3A 4OT6A 3QLFA 5AUVA 4WRGA 4P5QA 2PVNA 3IK3A 4AOTA 5KKRC 1OM1A 2BZKB 2IWIA 2IZUA 3T8OA 4EWHA 3ANRA 4L7SA 3ZFMA 2FUMA 1XR1A 3FKOA 1IG1A 4ZSGA 5CXZA 4FGRA 3ELJA 4GFMA 4NTTA 5IH4A 4O7SA 5CU3A 4X21A 3Q96A 5ANKA 2JDRA 4YO4A 3FMHA 3JVRA 1A06A 1FGKA 1E1VA 1M2QA 2VTSA 4GKIA 3PVBA 4O7TA 3PJCA 4ZLZA 4CZTA 2P33A 3EN5A 4IX3A 3R00A 3NCGA 4YJRA 5C4KA 1YDTE 3BYOA 3LLAA 1JPAA 4KBAA 3QTXA 5CWZA 5D9HA 4A4OA 4D1ZA 1IRKA 2JAVA 3SLSA 5AUUA 1PXPA 4FTAA 4F7LA 4BTMA 4YJTA 3H0ZA 4YJUA 3A4PA 3UJGA 1Y8YA 4ZTRA 5IA5A 2YIYA 4JDHA 3BHUA 4F0FA 4IFCA 4IWOA 1SVGA 3OXZA 4M12A 5E91A 3D5VA 1CKIA 3FYJX 3OEFX 4FV8A 2ITWA 4TXCA 5TE0A 4CMOA 4HGLA 3HDNA 5C4LA 3MA3A 4AGWA 3PXKA 2JIUA 3DKFA 2C6IA 4FT0A 4BIDA 4JBQA 4UBAA 2UW5A 4L6QA 3TT0A 2XS0A 3CS9A 4X2JA 5H3QA 2BR1A 3S95A 1V0PA 5B2MA 2XJ0A 2XJ1A 3GC0A 3LCDA 3PPJA 4A9YA 4QMLA 4U3YA 3F3TA 4RMZA 2YAKA 4DGNA 2OI4X 3COMA 4I4EA 4M66A 4RFYA 5M44A 3DAJA 4BZNA 5EH0A 1JKKA 3FHIA 3O51A 2XIYA 3EQCA 5JH6A 4QMZA 1NVSA 3RWQA 3EQIA 2JITA 5IU2A 3HVCA 2PL0A 1WMKA 1ND4A 3R02A 5KX8A 5E92A 2P0CA 2R3NA 3NIZA 3TJDA 4IANA 4HGEA 1PXNA 4UMPA 2OIBA 4J8MA 4E4MA 1FGIA 3BGQA 3F2AA 5AP1A 1OL2A 2YZAA 3PYYA 5HGIA 4EOMA 3HAVA 2CSNA 4CT1A 1QPCA 3EKNA 1Q97A 3PXYA 4FYNA 1XBAA 5A3XA 4E4NA 2WTKB 4RWLA 4YTHA 5DEYA 2OO8X 5DT4A 1LP4A 5HCXA 4PTCA 4QP1A 4WG4A 4M15A 2QCSA 3GFEA 4EH7A 4AA0A 4L3LA 5CF4A 2BDJA 4JRNA 2I0VA 3CTJA 4ZS4A 3UOJA 3ITZA 4EQUA 5L8KA 2VTLA 5LCKA 4K6ZA 1P2AA 3W8LA 2WTIA 3VHKA 3MW1A 3EFKA 3IGGA 3R9RA 2PUNA 5IQHA 2CKQA 5I9YA 2YEXA 3DB6A 2CGXA 3ORMA 4NCTA 4NW5A 4M8TA 3V5LA 5BMSA 4S34A 5E8YA 4PDPA 4ZJVA 3IW6A 4YGAA 4W4WA 1RJBA 4QPMA 5CU4A 3CJFA 3QRIA 3FKNA 3PXFA 2X9EA 5EYCA 3ULIA 1YI6A 4BBEA 2C5VA 2O3PA 3OW3A 5CF8A 2EXEA 4F63A 3LOKA 1Y57A 4GK3A 4A9SA 2R7IA 2BKZA 4QPSA 3PIYA 1WBTA 2OZAA 4OTPA 1YXTA 4R8QA 4KKGA 3E7OA 3DKGA 3FZ1A 3MFTA 4ASZA 1OGUA 1PYXA 5GJGA 2PE2A 5GJFA 3N9XA 5JFWA 3E92A 3LCOA 4FSRA 4J96A 4B8MA 5FEDA 4J99A 3DNEA 3FZRA 5E1EA 4QTEA 2VTIA 2ITTA 1Q24A 3VUKA 5AM6A 2E2BA 4DLJA 5K9IA 4NFNA 1PMUA 3G9LX 1XKKA 2H34A 4PMMA 5ETAA 4FTLA 1H08A 2JKKA 2WMUA 3BHHA 5AWMA 4ACCA 4S2ZA 4G16A 3UC3A 4EUTA 5JRQA 3GCSA 4JAIA 5KCVA 4OBQA 4LL5A 1YKRA 4USDA 3C51A 5IUHA 2ONLA 4MX9A 5K5XA 4JVGA 4YUQA 4YC8A 4YP8A 4FKVA 3VBYA 2A27A 3F6XA 3O0GA 4HYUA 3VS1A 2OGVA 3ZLSA 3UVQA 1OL6A 2XKCA 3R9NA 3ENHA 3SW7A 4RX9A 3H3CA 4CQEA 2YCRA 4AP7A 3TCPA 5I0BA 1FQ1B 3G90X 3I5ZA 3NNXA 2OZAB 3GVUA 5AR7A 5HG8A 5M55A 3VBVA 5CZIA 1OKWA 5K4IA 4L46A 4FV0A 1ZWSA 2WFYA 2J51A 5B2KA 3JS2A 4FTQA 2VWYA 1ZLTA 4NCTC 1DI8A 1VYZA 1PJKA 3D2IA 3FSFA 4R6VA 2JFLA 2QODA 4DFNA 3ZEWA 1PXLA 3R7UA 3T3VA 4BI0A 4QMSA 4UYNA 1XQZA 2VTNA 2GSFA 2ZV7A 3IKAA 4HOKA 1EH4A 3FQEA 4FKTA 4XBRA 1DM2A 5DE2A 1H1SA 3BIZA 3EQPA 4QYFA 5FQDC 3R83A 3EZRA 4UX9A 4O0UA 2WMWA 3OW4A 1XH4A 3QCYA 3MFRA 4CG9A 2JBPA 4FV4A 3O7LD 4QTCA 2ZAZA 3F5PA 4FL1A 4Z9LA 2EXMA 5CEPA 2X8IA 3I6UA 4IAZA 3MI9A 1M2RA 4PPBA 4FSYA 3CPBA 3EFLA 2X7GA 4D4RA 4DGOA 2PHKA 2VTTA 4GEOA 1KE7A 5ETCA 4F99A 5GINE 2VNWA 3LJ0A 3BKBA 4GL9A 4TWOA 4EZ5A 4FSUA 3BGPA 1NT2A 4YJOA 4EORA 3NYNA 3A2CA 4H3PA 4AW2A 3UQFA 3PY1A 4Q5HA 4YJSA 5LVPA 5AUWA 4X3FC 4ENXA 1JOWB 1OPKA 3SX9A 3COHA 2RFSA 4ZMEA 2HENA 4KBCA 4BL1A 4LMUA 5ACKA 5B0XA 3MS9A 2UVXA 4BWXA 2Q83A 1Q99A 4HGTA 4BKZA 3RK5A 3QU0A 5FP6A 3A7HA 3KK8A 2R3FA 4KIPA 4F65A 3KULB 3UG2A 2GQGA 3BLRA 4M69A 4W8EA 5E8ZA 3S2PA 4BCIA 4FOBA 4IH8A 4YLKA 4ASDA 4ERKA 3L8XA 3NX8A 2W1EA 3WIKA 4YZBA 4FEUA 3SDJA 3KMUA 3NNWA 2JDVA 2UZTA 3O71A 4CFWA 3ENMA 1WBSA 3KXXA 4GVAA 3EZVA 4YNEA 3ORIA 3SOCA 2RSVA 3IECA 4GW8A 3I5NA 4KIQA 1JBPE 3QQKA 4XG6A 2VX0A 5FM2A 4UB7A 3FQSA 5AUZA 3O8PA 3IONA 4CVAA 4EI4A 4A07A 3LFCA 3C13A 3W33A 3DCVA 3IW8A 2GNFA 4IAYA 3C7QA 3BHTA 4XX9A 3D5XA 1PF8A 3LAUA 2Y4IC 3QBNA 2HW7A 2QONA 2X2LA 5DI1A 3RPRA 3ZO4A 4FK6A 4RZVA 4CFXA 3LXPA 3BPRA 1SM2A 5DLSA 3DJ7A 4E5WA 2XP2A 3DXNA 5C1QB 2ZB0A 2IW9A 2WQBA 1UU8A 4CCBA 4FKQA 4R3CA 4F9WA 3WYYA 5EDRA 4J7BA 4BCPA 3KF4A 3N51A 5IEVA 3CKXA 4CGAA 2J5FA 4C8BA 4MQ2A 5IA0A 3H0YA 1UKIA 4WKQA 2WTDA 2JIVA 2J4ZA 4A9UA 4F7NA 4Y72A 3BQRA 1OECA 3DAEA 5EYKA 2C5YA 4D2TA 3T3UA 4S30A 4NKAA 4G5PA 1U46A 3KVXA 3S1HA 3RTPA 2FO0A 2ETKA 2QG5A 3HRFA 3AG9A 3NNVA 3FI4A 2GHGA 2G2IA 1OKVA 2W06A 3H4JA 2OIDA 3WF9A 3ZRMA 3MTFA 1CMKE 2VUWA 3VAPA 4F7JA 3EN4A 2PWLA 4ITIA 2QD9A 4AE9A 3VUHA 4QYGA 4DINA 5IUIA 4C62A 4IVBA 1ZMUA 4M7IA 4QD6A 3K5UA 4KSPA 2W1GA 2WU6A 4D4SA 4F7SA 2BCJA 5BVEA 2HK5A 3DY7A 3VBTA 3EN9A 3FAAA 4AU8A 2R4BA 3II5A 4DG2E 4DT9A 5IDNA 3HEGA 5CAQA 4YZNA 2X39A 1QL6A 3BWJA 2PYWA 2UW3A 1UKHA 4R3PA 2IW6A 3CD3A 4K33A 5L2QA 3RHKA 5HO7A 4FTTA 2XRUA 3DTWA 2GNLA 3E8NA 3LFEA 3LFQA 3GGFA 4ZTMA 3SA0A 3QQLA 3THBA 3SXFA 3O50A 4I5HA 5IH5A 3Q9WA 3ROYA 4LG4A 3SW4A 1MRUA 2YCSA 2ZM1A 5CAVA 4A7CA 2FSOX 3FMEA 1UA2A 2BMCA 4YC3A 4GT3A 1WAKA 4FSNA 1OZ1A 2E9NA 4RIOA 4EHZA 3GOKA 5AP4A 4ZEGA 4PTEA 4RFZA 5CU0A 3FLZA 1GAGA 5D41A 3RKBA 4FNZA 2W96B 2C0TA 5JMSA 4IEBA 4FUYA 2X7FA 4QP9A 5A9UA 1H4LA 5FWKK 3POOA 3WYXA 2W99B 3NVMB 2XNBA 2J50A 5I9VA 3TV4A 2IO6A 4RC3A 2CDZA 3KXMA 4MNEB 2OF2A 5L8JA 1BI7A 4L43A 4QNAA 2QC6A 3H9OA 5CSHA 5HCZA 4O22A 3F3UA 4O2PA 4CZUA 1ZZLA 3PA3A 2Z02A 4U43A 4B7TA 2FGIA 5IMEA 3PE2A 3PSBA 2RFDA 4WNMA 4BDAA 3NYXA
chains in the Genus database with same CATH superfamily
4EBWA 1GZKA 4HYSA 3FXZA 4HJOA 1JAMA 5A14A 5DEWA 4AN2A 3AGLA 4MXCA 4B0GA 4II5A 1Q62A 4QDEA 2FVDA 4K11A 1RQQA 4I41A 3VC4A 4FSMA 3SC1A 2WGJA 2EWAA 2UZVA 4HZSA 3UIXA 4RX5A 1ZMVA 4CCUA 2UZOA 3BE2A 4X3JA 3FLWA 3U9CA 5TR6A 1J7LA 1CSNA 3WZJA 1H0WA 4OLIA 1KE8A 3DAKA 4L3PA 2X0QA 3QZHA 5F20A 3F69A 1H24A 5GNKA 3JY9A 4BWKA 4MUQA 4ACMA 4GJ2A 1XH5A 4RZWA 3RM6A 2DUVA 3M11A 3ORPA 5FM3A 5LMKC 1UNGA 4CSVA 3E5AA 2QO7A 2J6MA 2WQOA 4BDJA 3PUFC 4AGUA 5EDPA 3RNIA 3L9NA 1UWHA 4GG5A 4RWKA 5AV1A 4NWMA 4YHJA 2CCIA 3GU8A 5CALA 3HLLA 1R1WA 4IAKA 5EM8A 2E9VA 3GC9A 4O0TA 4YBJA 5EKNA 5L2WA 4LGDA 5HU9A 4BGQA 3AD6A 2PK9A 4YO6A 1BMKA 1QMZA 2GTNA 3TKUA 3W2CA 3QTQA 3ZSIA 5HLNA 1MRYA 3AC5A 4X2GA 1WFCA 5LVOA 5DMZA 3FI3A 3HV6A 2AC3A 2F7EE 4D28A 5J9YA 2XF0A 4JNWA 2IVTA 3RZFA 2EU9A 4BHNA 3E62A 1OUKA 3P86A 5HKMA 5IQDA 5T68A 4F9BA 4KINA 3TUCA 5EDQA 2CGVA 4BCOA 3ERKA 3B2TA 4DEDA 4J95A 3ZU7A 2VWUA 4G6OA 1SYKA 4JMQA 4EH8A 5BVNA 3PSCA 4QMTA 2QKRA 4F6SA 2Z7SA 3OCBA 3WBLA 3DKOA 1OIYA 2BILB 2QQ7A 2X6DA 3OF0A 4B4LA 2VD5A 2GS6A 3O96A 4I93A 3BELA 4C4JA 4DF3A 3TXOA 4E1ZA 4MXZA 1L8TA 3UMXA 3ROCA 2IF8A 3PWYA 4FSWA 3SHEA 2VTHA 3KY2A 4JX7A 4KD1A 3VW6A 3WZDA 3AC8A 4AF3A 1PW2A 2O2UA 2YWPA 3F2NA 3SV0A 3OHTA 5FLFA 3NUUA 3BLQA 5IQCA 2PZRA 1J91A 3RCDA 3UO6A 2PVKA 3QKLA 2PUIA 4C34A 3Q60A 5KKRB 2VNYA 1ZMWA 3COIA 4YLJA 4Z16A 4ARKA 3BHVA 4E6CA 4BICA 2W5AA 3F7ZA 4AA5A 1GOLA 1SVHA 4UMQA 4C33A 3VUTA 5CSPA 2ZDUA 3O2MA 3FMKA 3AT2A 4O0VA 4BRXA 4QMWA 3PIXA 5KHXA 3AT3A 5J95A 4MD7E 4BZOA 1YHWA 1H1QA 1W98A 3EQDA 4FT9A 5EW8A 4TYHA 3RM7A 4GU9A 4TW9A 3WIGA 2C0OA 4FSZA 3E93A 5G1XA 3SRVA 4CD0A 5J1WA 5AP0A 3RK7A 1YOMA 1R0EA 2WMAA 4PL4A 3MYGA 4ZY5A 4FIGA 4WA9A 4BIBA 3QD0A 1WCCA 5TO8A 1W83A 3DLZA 4YJVA 3Q2MA 1H00A 2OIQA 4NZWB 1GZOA 2OU7A 4W4VA 2VRXA 5ACBC 1OITA 2GTMA 3ZRKA 2O8YA 3D4QA 3R1QA 5BUIA 5HEZA 1PMVA 4YSJA 1W2CA 3D0EA 3NYVA 1MUOA 3FLSA 2HIWA 3FLNC 3OROA 4GSBA 4YPSA 5L2TA 5M56A 4DFUA 3OY3A 3MH2A 4EL9A 1W84A 3TTJA 4YTCA 2XK7A 4H39A 4HYHA 5H2UA 4IDVA 1YWVA 4C4GA 4MBJA 3O17A 2PZ5A 3ODZX 3VBXA 2NO3A 2R3RA 4OTGA 2XH5A 4W4YA 4DGLC 3FWQA 4EEVA 2UW6A 3KGAA 4QMUA 3R9DA 4EK4A 2QOQA 3KL8A 1GZ8A 1WBVA 2UV2A 4XP0A 5L4QA 4RQVA 2R2PA 4IB3A 4U6RA 1Q8YA 5HCYA 3ATSA 2C69A 2KTYA 3ZLYA 1YOJA 4BFMA 4E4LA 3Q5IA 2R3GA 4Y8DA 3A99A 4ZY6A 4QPAA 1Y8GA 3OUKA 5CS6A 3ZM4A 1IA8A 2XNGA 4LYNA 4RFMA 4OTFA 5CEQA 3AC1A 3LW0A 2XAMA 2ITXA 5CY3A 4UXLA 4JR7A 1L3RE 2B52A 3UP2A 3RP9A 4DHJA 3UNZA 1H26A 3IW4A 1OBGA 4FSQA 4IAIA 3ZH8A 4F9YA 3MY0A 3ZDUA 4ERWA 3M42A 3DBDA 3FDNA 4O4DA 4F4PA 4LV8A 1MRVA 3E88A 4JBOA 3TZ9A 1W2FA 4BDGA 4DLIA 4FV7A 3D7ZA 1LR4A 5CSWA 5JEBA 3DDQA 2YCQA 4A9RA 5GZAA 3ATTA 4FR4A 4Q9ZA 2GNHA 3NUNA 3O7LB 2XCHA 4WT6A 5AP7A 3W10A 1M7QA 5LVMA 2IG7A 3OXIA 2R0UA 5F9EA 2G2HA 3F82A 3W2RA 3R71A 5BVOA 4GIIA 3P0MA 1XJDA 4P4CA 5C27A 3D7TA 3BL7A 4O21A 2WQMA 2BHEA 4C3FA 4OAUC 3R7IA 3DLSA 4HNIA 2Z8CA 5LMAA 2AEGA 2QI8A 2XZSA 3Q4TA 3WE4A 4ALWA 2I1MA 2XRWA 4EKLA 4OT5A 3BYUA 2R9SA 5J9LA 3SQQA 1IAHA 4XCUA 3S0OA 3DZOA 3FXXA 5E4HA 2V5QA 1YQJA 5CNNA 4FIFA 4IE9A 4FOCA 4I5CA 2JBOA 2JDSA 4U80A 3I0OA 3CIKA 3NUSA 4FKGA 4QYYA 3OT8A 2ERKA 4XH6A 4E73A 3ZXTA 3ZSGA 4AOJA 2XCKA 3LFAA 1KE5A 2SRCA 4Z7HA 4LV7A 3SOAA 3HUBA 4LFIA 4FK3A 4OTDA 3RAWA 3ZO3A 5FTGA 4IBMA 1NVRA 3PLSA 3FKLA 4L45A 1OKYA 3OTUA 3GCQA 4RVLA 1FBNA 3TL8A 4E4XA 2OBJA 2G01A 5EG3A 2HELA 2VTMA 4FL2A 4UXQA 4CV8A 4DHIB 3AMYA 3FMLA 3EQGA 2Y0AA 5BYZA 4BDFA 5EOLA 3E7VA 1OIUA 4I20A 2I6LA 2VWVA 4JQ7A 5IA2A 4GK4A 2YN8A 3EQBA 1OIRA 2PVLA 3D5WA 3NDMA 4KB8A 2XK8A 5KMKA 1IA9A 5CQUA 5HU3A 1XH8A 2WTVA 4DBNA 2CGWA 2EB2A 2ITOA 3OBGA 3QQUA 4OTIA 4C38A 4WNOA 4D2WA 2R3OA 4B6LA 5AV4A 1VLRA 3MY5A 4E5AX 3G2FA 4H1MA 1ZZ2A 3CR0A 4D1XA 5IA4A 4MHAA 3TJCA 1H1WA 4AGCA 5DPVA 3D9VA 3GU7A 3MIYA 4BJJB 3PIZA 4WUNA 3SVVA 3QUDA 4B9DA 3QQJA 3V51A 3Q4ZA 3KXZA 2B54A 1YWNA 2QVSE 4MVFA 2R7BA 3RWPA 3WI6A 2AYPA 2OFUA 2UZEA 3FUPA 4AXFA 3AQVA 1LEZA 3TDVA 2B53A 3NNUA 2J5EA 2RFNA 5D11A 4J52A 4DEHA 5BUJA 3NUAA 3HA6A 3PXZA 5HG5A 2JDOA 3PP1A 4YHFA 3W0MA 3QKMA 4MCVA 3DZQA 3Q52A 3FZTA 3GQLA 4EBVA 3C0GA 3MTLA 4LMNA 4QYEA 5G6VA 4FEWA 4P7EA 4OTWA 3LFBA 1XWSA 3C50A 4D2SA 2C0IA 4DH1A 4IB5A 2QNJA 5LOHA 1FMKA 2IVSA 1ZYSA 3FQHA 2QOLA 4BGGA 4L3JA 4F08A 3A8XA 3R8UA 3WF6A 5M08A 2ITQA 3NZ0A 3KA0A 4I0TA 4PDOA 3VS3A 4DT8A 3TN8A 4FZ7A 2G2FA 1A9UA 3GENA 3I79A 1ZOEA 1R0PA 1YOLA 2BAQA 3LJ1A 4TYGA 4XHKB 4BKJA 4DTBA 3C4FA 4FKWA 1AD5A 3VS6A 1B6CB 3L8VA 3OD6X 4AAYA 4P90A 2UW9A 2VTPA 2WU7A 3V04A 3W2OA 5FXQA 3UYTA 4FI1A 1URWA 3CD8A 4F0IA 4GJ3A 5IG1A 4WBOA 4UV0A 2Y4PA 4WO5A 4UN0C 2FSTX 2W1ZA 5I9UA 3BYSA 4AFEA 3ZONA 3MFSA 3OCTA 3UOKA 2F4JA 4BBFA 2XEZA 5E9EA 3T9IA 3RINA 2XIKA 4JBVA 3TV7A 5AR8A 5I5ZA 3RZBA 3HX4A 1YHSA 3W18A 3BU5A 2OJJA 3UGCA 2X1NA 3PZHA 5CZHA 4O0RA 3F5GA 5H8BA 4BBMA 4WSQA 2PMIA 4KKEA 1H8FA 1FOTA 2C1AA 5KBQA 5JK3A 5HHWA 4NU1A 5AA9A 4FBXA 5IISA 4F0GA 2QOFA 4R78A 2OG8A 2NRUA 2P3GX 4MKCA 5CAPA 4PNIA 3W0OA 2BROA 3LQ8A 3RMFA 4BI2A 3P4KA 4O96A 2WQEA 4I92A 5HTCA 2OJFE 2W4JA 3V6RA 2OLCA 3ODYX 4GG7A 5HQ0A 3Q32A 1NVQA 4O38A 3QLGA 3QC9A 5KNJA 2P4IA 5CAUA 1TZDA 3JXWA 1V0BA 4MXAA 1VZOA 3ALOA 3PWDA 3RCJA 3LMGA 4DEGA 4XLIA 1JKSA 4RIWB 4F9CA 4U79A 3VUGA 3ZRLA 2C1BA 3ZHPC 3D14A 2RF9A 5IQGA 2RG6A 3FLQA 4O83A 1G8KA 3PVGA 1RDQE 4G5JA 4PF4A 2HXLA 4E6DA 4FV1A 3WZKA 4CFUA 4CRLA 2WQNA 4FG9A 4NFMA 5DRBA 3VBQA 2CCHA 4AZFA 5AX9A 4BKYA 2YCFA 3ZXZA 5L2SA 3H10A 3HV4A 4W9WA 2V22A 4AT4A 4Z3VA 5H8EA 1XH6A 2UZLA 2UW7A 1Q8WA 2VO6A 3E63A 3H30A 3NW6A 4J53A 3VQUA 3R1YA 4AZTA 4JG8A 2OW3A 3VS2A 2F7ZE 4MXYA 3P7AA 2XEYA 4UYAA 3VWAA 3MVMA 4IAFA 5CX9A 5JRSA 2BPMA 5EKOA 4QQTA 5KMLA 4QMYA 4N70A 1X8BA 1U5QA 4X2KA 1Q8ZA 4KNBA 2G9XA 2UZBA 4R1VA 4KA3A 1B38A 1ERKA 5E8VA 4D2VA 5ITAA 4DDGA 2C6EA 3CE3A 2WMQA 5K3YA 4EZ3A 4U0IA 4M13A 4D5HA 5CF6A 2EXCX 4W9XA 2W4OA 4DAWA 4GKHA 4DG0E 1SMHA 5HE3A 3R9HA 1NW1A 5AP5A 5IDPA 3DDPA 3KRRA 3GCVA 2IEWA 4BCJA 1YVJA 3IOPA 5CXHA 5EQPA 2H8HA 3RPSA 3TZ7A 4BIEA 3QA0A 3Q4UA 4PMTA 5JT2A 4FMQA 1GIHA 4IADA 3UOLA 1WVWA 2ESMA 4AT5A 5DBXA 3B8QA 4O4CA 4WRSA 2WEIA 5IKWA 3M1SA 1OL7A 5EM5A 4B99A 2X9FA 3NGAA 3HMIA 4HVSA 2F9GA 5JFVA 3R8ZA 3C0IA 3QQHA 3UYSA 4XMOA 4JLCA 4EH4A 4FIJA 4XNEA 4Y73A 5J79A 3HKOA 4OTHA 3R7VA 4EKKA 4PPCA 1SVEA 4D9UA 3AC4A 4ONAA 4EQCA 3RVGA 1JSTA 1J7IA 5ANDA 3OMVA 3TEIA 3R6XA 4O4FA 1ST0A 1XBBA 2RKUA 3VULA 1ZYDA 1JSUA 2R3HA 3GXLA 1XMMA 3HGKA 5HX8A 3LVPA 5CAOA 4EHEA 2FH9A 3BGZA 5GIPE 1R39A 2JIIA 2QOHA 5HI2A 1YXUA 4TKSA 4TT7A 3A62A 5F94A 4GYIA 3G6HA 3BZ3A 4K9YA 3QUEA 5DFPA 4ZSJA 3D94A 4BCHA 4WG3A 4C37A 4C59A 3L8PA 2XK4A 3OZ6A 4GFOA 1W82A 3I7CA 3KRLA 3PA5A 4TWNA 4JI9A 4X0MA 4U5JA 2BKKA 4JDKA 2VN9A 4K0YA 4C4FA 3ZTXA 3U4WA 3ZFXA 4I6BA 2E9OA 3KCKA 3HMOA 3EQHA 4AN9A 3VBWA 3OUNB 4AE6A 4D4YA 4FIEA 4TYEA 2GS2A 3VF9A 4CT2A 5KUPA 2C47A 4CLIA 3P1AA 3ZYAA 3CPCA 5HVYA 2X7OA 1OVEA 4QMPA 5M53A 3QA8A 4ACDA 5BQ0A 4RG0A 3GCUA 2QO2A 3R0TA 4RIYB 2Y7JA 2YA9A 1P14A 3GCPA 3VW8A 4WUAA 2Y6MA 1P4FA 4ZK5A 3UIBA 2GS7A 3W8QA 4DN5A 2R3LA 1HCKA 2W1HA 4MBLA 2WMXA 3G33A 1I09A 2C3JA 2J0MB 3KN6A 3VNTA 4OBOA 3POZA 4I4FA 2OH4A 4QP6A 5A4CA 3TNIA 3VS7A 3RAKA 3V5WA 5CQWA 1KSWA 2XA4A 3F5XA 4YPDA 4DEIA 4E93A 5L3AA 2XANA 3JUHA 2WXVA 3W2SA 4XV2A 4U7ZA 5J87A 4KS8A 4UZDA 2ITUA 4ZP5A 5I4NA 4O86A 4D0WA 3NS9A 1G5SA 1ZXEA 4Y83A 4IX5A 4V0GA 3PP0A 4RJ3A 1CKJA 3BLAA 4XG8A 3EYHA 3WF8A 4N6ZA 5DOSA 2V62A 3R7EA 1Q3DA 2F49A 4G9RA 2BRGA 3F88A 3BQCA 2GU8A 4G3CA 1APME 3IPHA 1BUHA 4RIYA 4TYHB 5AUYA 4PPAA 5D7AA 4FZFB 2YJRA 4AW5A 3BU6A 3EHAA 4ZSLA 1FVTA 4RPVA 4YNOA 4XOZA 5IF1A 1UV5A 3V8SA 2IZSA 3ZC5A 1BKXA 3LCKA 4MD9E 1U4DA 5KMMA 3WF5A 4D2RA 1CKPA 3B2WA 2GHLA 3R8LA 3WZEA 4HNFA 5CT0A 4FL3A 5EM7A 5CEKA 2IVVA 4BCMA 5FGKA 2VU3A 3ZUTA 3C5IA 2YM5A 4CYJA 3FSKA 4IDTA 4I6HA 4G9CA 3MSSA 1CM8A 4YZ9A 2XNPA 3BV3A 4DG3E 3G15A 3FMJA 1BX6A 2G1TA 3FXWA 3S4QA 4A9TA 4BCGA 4CV9A 4DEBA 3UVPA 1B39A 1KWPA 3PPZA 5AR5A 4X3FB 5HD4A 3AKJA 2Y6OA 4MF0A 3UDBA 4GS6A 1V1KA 5D12A 2VTJA 4DH8A 2HAKA 2YIWA 4R7IA 1PMEA 2W1DA 4AXAA 2CN8A 3F2RA 3TNPC 4DGMA 3UOHA 3R8VA 3BV2A 4IWPA 4O7LA 3PPKA 3WE8A 5LXMA 3U6HA 3SXRA 3PVUA 4G17A 2GDOA 4O1OA 2QHNA 4ZTSA 4MXXA 3K5VA 3VUIA 4Y46A 5M4UA 4I5PA 2BRNA 3ZO2A 4C4EA 2BIYA 4I94A 2YM4A 1MQ4A 2WMSA 2BVAA 4Y85A 3UO5A 3DK6A 1FMOE 5CU6A 4I6QA 1YDSE 3V5JA 3MDYA 4JIAA 4LRMA 3QD3A 5KMJA 4FTJA 4LQMA 5LWMA 2P2IA 2OXYA 3FI8A 3S00A 4H36A 2BTRA 4BN1A 2X6EA 4G3FA 4P2KA 4X2FA 3E64A 2QOKA 3NIEA 5HLWA 4FNXA 5K0XA 5F95A 4IWDA 1G8SA 1BI8A 4AS0A 1ZAOA 2HY0A 2NRYA 4IC8A 4RWJA 4CMUA 3E8EA 4GMYA 4EH2A 2WMRA 3U54A 4FF8A 3I1AA 4IVDA 4E5BA 3EYGA 5KMNA 2JGZA 4AN3A 3TI1A 4O6LA 3QRKA 5L6PA 1PXJA 5BYLA 4C2VA 3PTGA 3DBFA 4MNFA 2I40A 2CNUA 4V04A 5AV3A 5CNOA 4G31A 3D5UA 1XH7A 2E9PA 4PTGA 3ORZA 2WIHA 3HDMA 4FTNA 4BC6A 4ZZNA 3HP5A 1M14A 5M51A 3TM0A 3DBCA 3QCQA 3ET7A 4I6LA 3UVRA 3FBVA 5FTQA 4QQCA 4XRLA 2X81A 3KRJA 4BZDA 3EQFA 1REJA 4HCTA 2Q0NA 4HVGA 4U42A 3NR9A 1TQMA 3ACJA 1JLUE 4M84A 5AM7A 4AG8A 4FKIA 4ZS0A 5AUTA 3QTSA 2R3MA 4O84A 5JN2A 1FINA 3PRIA 2F57A 3VVHA 4LDTA 3O8UA 2XUUA 4OAVB 1QPJA 4N6YA 3TNHA 4DTKA 3W0NA 1PMNA 3GU4A 5IEXA 1VYWA 1KE6A 3QRJA 2WKMA 2XK3A 4WNPA 4TNDA 5IA1A 3A8WA 2QOOA 4GUBA 4ANLA 4C0TA 2OK1A 3G0FA 4YZMA 3KFAA 3JY0A 3LKMA 4I22A 4MWIA 5E7RA 1HOWA 4UEUA 2X2MA 2YM8A 2C3LA 3QD2B 3HUCA 5EYMA 5HG7A 3SG9A 5KMIA 1VJYA 4BF2A 4DFXE 4AZVA 2XIXA 3G5DA 3IGOA 5J5SA 3KXGA 4I0RA 4WD5A 3LJ2A 3FY0A 3TNWA 5BNJA 5EK7A 3CTQA 5AR3A 5FEQA 3Q5ZA 3K3IA 5K0KA 3P9JA 5CENA 2GQSA 2PULA 5GIOE 5LJJA 3DXQA 3MBLA 2VX3A 5I9XA 5EFQA 5HE2A 2QOCA 4GH2A 3REPA 4LUDA 1WVXA 3KRXA 4WOVA 3OXTA 4LUEA 4H58A 5HO6A 3UQGA 4FA2A 1GJOA 4QP8A 4QTBA 1Q8UA 3UNJA 3AC3A 2I0YA 2XB7A 3P79A 2VGOA 2ACXA 2QLQA 2XK9A 3BYMA 3HMNA 4OBPA 4X6RA 5LVLA 3TIYA 1OMWA 3CP9A 4JOAA 1UWJA 2Y4IB 4EHVA 2YERA 2R3PA 4R1YA 3C4CA 2A4LA 3EH9A 5A4LA 4ZTLA 2BRBA 3HL7A 4LGHA 4HW7A 4ZLOA 2QURA 3W0SA 3E87A 3I0QA 4O81A 2P55A 5EW9A 4ANQA 1GY3A 2J7TA 4G34A 4DFZE 1G8JA 2R5TA 4WIHA 3HRCA 3IG7A 4R5SA 2VO3A 4PQNA 4PUZA 1H27A 4RA4A 4S32A 2GFSA 2XMYA 2XNEA 2CJMA 5DG5A 5LARA 4BWPA 5J7BA 1UU3A 3OOMA 3FHRA 1PRYA 3EMGA 4NW6A 4RVMA 2PVJA 4RQKA 1OI9A 4F64A 3VS5A 2PMNX 3BEGA 2GMXA 2JC6A 1KOBA 4ZMFA 2VO7A 5FUTA 2WELA 3ORLA 4FG7A 1F0QA 4EOOA 4O7ZA 2V7AA 3RPOA 2DYLA 2VX1A 4C2WA 3OT3A 3PA4A 5ANGA 3AOXA 3V3VA 2PVMA 4FTOA 4P5ZA 4YJNA 2XYNA 4LI5A 4QTAA 5M57A 1PXOA 3ZEPA 5I3RA 2Z60A 3PVWA 4QO9A 3VIDA 4M14A 4MAOA 2PVHA 4G3DA 3PUPA 3AD5A 4W4XA 3Q9ZA 2BDWA 4G2FA 4YTIA 2XK6A 5ANOA 4NIFA 5M4FA 4IWQA 4TY1A 5AR2A 4FVQA 3HECA 5JGAA 4IJPA 1Q4LA 2XIZA 1H1RA 2XBJA 1H25A 4XEYA 2C6MA 4C36A 4WBBB 2ZV2A 3KEXA 4I5MA 1YXSA 3QZIA 2BZJA 4GYGA 3D83A 5CEOA 3CCNA 4KRDA 1QCFA 2JKQA 3NAYA 4I23A 3WZUA 2B9FA 2OWBA 2YJSA 1YRPA 4XG3A 3PJ8A 3GFWA 1LEWA 1O6LA 3OCSA 4AW0A 2XNMA 3R2BA 3ZC6A 3CBLA 4R5YA 3TWJA 4C57A 1PKDA 1KOAA 3C9WA 4OTRA 4IAAA 4RC4A 4S33A 5GZ9A 1S9JA 4LRJA 3FY2A 3MA6A 3ORXA 3GU6A 4YJQA 5D7VA 4OW8A 3CQEA 4CQGA 4ANOA 2XNOA 4N4SA 4AW1A 4EOPA 4QT1A 4LOPA 4X6QC 3ZOSA 2HZIA 4M0ZA 4D5KA 2GNIA 2YACA 4FZAB 2A1AB 3MVHA 3NWWA 2YIRA 4L00A 4Y5QA 3GC7A 3PG3A 3R2YA 4IVCA 4AZWA 4IZ7A 3EFJA 4HPUE 3Q9YA 4BR3A 4FKRA 2Y9QA 5EI8A 4ZTHA 3W1FA 2VV9A 2PUUA 2W1CA 4TRLA 3W2QA 2R3JA 3GEQA 3QRUA 2Z7QA 3H9FA 3QZFA 5DYJA 2IW8A 1XBCA 2A2AA 2BZHB 2YHVA 4K2RA 1ATPE 3A7FA 4IB1A 4Z55A 2VAGA 4NYEA 3PJ3A 4QMQA 4MBIA 4QMOA 3VS4A 4J8NA 1HCLA 2PZPA 3QAME 4IVAA 3RJCA 1YDRE 1Z9XA 1K2PA 5IMXA 5M09A 5HNGA 2OICA 5A4QA 5FRIA 2CLQA 3OC1A 2W9FB 5CANA 2J9MA 2EUFB 4K18A 4I24A 2IZTA 2WEVA 3RHXA 5BYYA 2C3KA 3LZBA 3KF7A 3RPYA 3ID6C 4IJ9A 5EI2A 5AEPA 1SNXA 3QQFA 4IM0A 3EFWA 2X4ZA 3ZSHA 5ETIA 1Q61A 5CYIA 3QUPA 4NM0A 4A4XA 4E7WA 5AA8A 4AXCA 4BHZA 5J8IA 4AX8A 4FTCA 5IZFA 3LQ5A 4A06A 5L2IA 3HA8A 3A61A 1P4OA 5CVHA 5AIRA 5EHOA 3RGFA 4RGJA 2CKPA 4HCUA 4Q9SA 5JQ5A 3OWPA 1QPDA 1SNUA 1R78A 1ZRZA 3FE3A 2PMLX 3NUPA 4B8LA 4BCNA 4EOLA 1WBPA 3VHEA 3OTVA 4BCQA 1I44A 4F6WA 4RX8A 3BBWA 4BB4A 2GQRA 1O6KA 4APPA 4FKLA 4JX3A 3U87A 4L42A 4XRJA 1REKA 3UBDA 1T46A 4O2ZA 4AQCA 2OFVA 1DAWA 5I9WA 2PPQA 3VF8A 2C5XA 4C3PA 3VONA 4EQMA 5EM6A 2UW0A 5CSVA 1OGYA 2A19B 2R0IA 3NAXA 2WPAA 4ZTNA 1U5RA 2AC5A 4E6QA 4M3QA 3RAIA 4U45A 2H96A 3MPTA 4PNKA 3AXWA 4IB0A 4EHGA 3ORNA 1XH9A 2GPHA 2PZIA 3BCEA 3F61A 1WBWA 1KV2A 4L53A 2ZB1A 4X7QA 3UDSA 4O7NA 4DBXA 3TV6A 3LXNA 3QHWA 5DNRA 2RL5A 2ITYA 2BALA 3V5TA 4CFMA 3JYAA 3VUMA 3IO7A 3NMUF 5IQBA 3MY1A 4O0SA 3TNQB 4JL9A 4Q2AA 3HP2A 3I6WA 2QOBA 2RGPA 4FG8A 4RWIA 1YWRA 2HCKA 1W2DA 3KKVA 5AJQA 3QYWA 3L8SA 4FTUA 5T6KA 1O6YA 3WF7A 4QP4A 4F1TA 3MVLA 2W1IA 2CKOA 3TDWA 1YW2A 2DS1A 3MPAA 1Z5MA 3LE6A 4J71A 4QP2A 1OBDA 4BGHA 2ETRA 4DH3A 5ETFA 3CY2A 4PRJA 1M7NA 3EB0A 4F9AA 3F9NA 4DITA 3QTWA 4FVRA 5A54A 3K3JA 3ACKA 4KIKB 2C6KA 3GT8A 4UMTA 5AFVA 4QDVA 4JAJA 2CPKE 2FA2A 2PE0A 3R73A 3I4BA 3LCTA 2VWWA 3DNDA 3QTIA 3BHYA 4NSTA 2XIRA 1IAJA 3CKWA 3OVVA 4BI1A 3LPBA 4RIXA 4R7HA 4DC2A 4RRVA 1XMLA 2RFEA 5TF9A 3FZPA 3CC6A 3O8TA 4MF1A 4CXAA 2F2CB 2ZMDA 4DE4A 4FZDB 1PY5A 4NTSA 1G8AA 5BVFA 4OUCA 2O0UA 4IFGA 3BU3A 3Q4CA 1DS5A 4QQ5A 3C4XA 3ZZWA 1K3AA 2WOUA 4IW0A 1E1XA 3W0QA 1W0XC 2PE1A 3PJ1A 3QZGA 1H28A 3MPMA 4EH6A 3P7CA 3PRFA 4FEXA 3QGYA 3KN5A 3MJ1A 2EVAA 4FODA 3UC4A 3HZTA 4FKSA 5JKGA 5LCJA 4YR8A 4UWBA 3A4OX 3RALA 5HBHA 2BHHA 5A46A 5L6OA 3ZDIA 3CTHA 3HRBA 5FP5A 1ZARA 2PMOX 2GFCA 3DTCA 4KIKA 4PDSA 5JZNA 3HV5A 4RSSA 1NY3A 4I3ZA 4D58A 5JGBA 1Q41A 3ZMMA 3LCSA 3F66A 4JQ8A 4ALVA 3EQRA 2CNQA 2X0GA 3AMAA 2X0OA 2YAAA 2XKFA 4L52A 1BLXA 2B7AA 4IHPA 4XG9A 3S3IA 2JEDA 3BBTB 3NRMA 3T9TA 2YZLA 4UMRA 4USEA 4AAAA 2BAJA 4RIXB 4HPTE 4GRBA 5KZIA 4QP7A 4PDYA 3HYHA 3AT4A 4ZJIA 2XM9A 3UPZA 3PFYA 5CI7A 2YIQA 4ORKA 4ZLYA 4JQEA 1Q5KA 4EOQA 2ZFYA 5IQIA 1OL5A 3EL7A 2VTAA 3FPQA 4RJ8A 3U4UA 3U51A 5FBNC 5CEMA 3F3VA 2UUEA 4UZHA 3ZCLA 3KB7A 4XV1A 5ANJA 5AAEA 4RJ5A 2IPXA 2QG7A 4UWYA 1JKTA 1GZNA 4KSQA 2CLXA 4DH7A 4F6UA 4YU2A 4LL0A 3PDTA 2FB8A 3FYKX 4FNWA 4KIOA 4NJ3A <