3W1FA

Crystal structure of human mps1 catalytic domain in complex with 5-(5-ethoxy-6-(1-methyl-1h-pyrazol-4-yl)-1h-indazol-3-yl)-2-methylbenzenesulfonamide
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
280
structure length
259
Chain Sequence
ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Dual specificity protein kinase TTK
publication title Indazole-based potent and cell-active Mps1 kinase inhibitors: rational design from pan-kinase inhibitor anthrapyrazolone (SP600125)
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 259
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3w1fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w1fA01
5CU4A 2VTSA 4M0ZA 4R5SA 4GUBA 2R3KA 4FSYA 4OR5A 1JKSA 4UY9A 5IKWA 1UKIA 3TZ8A 1OMWA 2DQ7X 5IA4A 4GL9A 3EQBA 1JKKA 1OL1A 3QL8A 3T3UA 5AV3A 3VWAA 2C0IA 4F6WA 4O82A 3AD6A 3DDPA 3SX9A 1OKYA 2R3RA 3QUDA 3ORIA 4JDJA 2XK6A 5FP6A 2CCHA 2B9IA 3I6WA 4FMQA 5B0XA 4TZRA 3DBEA 4QP2A 5A14A 4EOPA 4RSSA 5M51A 3CJGA 5HE0A 2X2MA 4D4VA 3QA0A 5EDPA 4AE6A 4EHVA 3DB6A 4WSQA 4ENXA 3RK9A 4FOBA 4RGJA 3NLBA 5EH0A 2I0HA 3LFCA 3EQGA 4PQNA 5HVKA 1URCA 5H8EA 1TQMA 2YCFA 3DK3A 3WARA 2GQGA 3WI6A 3MVLA 4X2JA 3NS9A 3R8ZA 4AG8A 5HTBA 4UMPA 3L9MA 5B2MA 3TUBA 2OG8A 2UZLA 2RIOA 3QTQA 5HG9A 2YM8A 3ZO4A 1R1WA 2IZRA 4DH7A 5GZ8A 2ZDUA 3NUYA 3BBTB 5BMSA 4DGMA 1QPJA 2JDOA 4PMSA 3NPCA 3GUBA 2GS2A 4UBAA 4YJRA 4RZVA 4U40A 2IJMA 3QLFA 1MQ4A 4FL3A 3OEZA 4BIDA 5IDNA 3NNWA 3VUDA 2P55A 4FTAA 2BDJA 2XIYA 3E64A 4A9SA 4BDIA 3LIJA 5HG7A 5EM8A 3FQSA 5CEOA 3HUCA 4R77A 2OXXA 3F5UA 4FTTA 1LPUA 3OT8A 2IVVA 4LV5A 4AGDA 5GIPE 2PVJA 4FTRA 4GYIA 4I1ZA 3WILA 3FEGA 4RX9A 4O7NA 1PXJA 4NIFA 5HVJA 4FKRA 3UP7A 4C7TA 4O27B 1BMKA 2NRYA 3C4CA 4LGGA 4F7NA 3FMMA 4ACGA 2C6MA 2J0IA 2UZNA 3CTQA 4X6RA 2O64A 2ESMA 2QVSE 1H25A 5LJJA 5L6PA 2BTRA 2E9UA 3AMAA 2OK1A 3M1SA 3MPAA 4IZAA 4RQKA 3Q2MA 4APCA 5KMMA 5IQFA 3NAXA 3OY3A 3R1NA 1VYWA 3GFEA 3DT1A 4PY1A 4TW9A 3ULZA 5J1WA 1OIRA 1AD5A 1UNHA 3MWUA 5DE2A 5DN3A 2ETRA 4E6QA 1Q4LA 3A61A 3OBJA 4AOJA 4F9WA 5LVMA 4CT1A 2RFNA 4ZTLA 4FEXA 1BUHA 4ZP5A 4U6RA 3OC1A 4QD6A 3MFRA 2J0LA 1QPEA 4CMTA 5DFPA 3IQ7A 3KMWA 5EOLA 3HZTA 4FV7A 3ZFXA 5DGZA 3ZRLA 4EK5A 4WUAA 3BX5A 1U4DA 4OTPA 1KV1A 3PXFA 5HNBA 4TYJA 2OJJA 4FV9A 2J0KA 4P4CA 5HLPA 4FVRA 1KE7A 3H10A 4M69A 4UALA 3BE9A 4U44A 4X7QA 4JR3A 5CSWA 1J7UA 1CMKE 4ANNA 5HD4A 3QHWA 3FSFA 4IDVA 2V0DA 2C3IB 2IZSA 4EWHA 5AAFA 3P0MA 3QYZA 4MBLA 3HP5A 4MAOA 5D41A 1PYXA 5E90A 1PMUA 4PMTA 1J91A 4BYJA 5E8SA 1H1SA 3HAMA 3O7LB 2R3MA 4LV8A 3VBWA 2CN8A 4RJ4A 4JAIA 2YCSA 2C6DA 3N51A 1KWPA 5L2SA 1W98A 3TWJA 3HA8A 3I60A 3KB7A 4ACHA 5AR7A 4DG3E 1AQ1A 5AP3A 3VBTA 2V7OA 5BYZA 2RKUA 2ITXA 2PZYA 3D5XA 4IVDA 3SD0A 3U87A 4MD9E 2GQSA 4I24A 4C3PA 2BAQA 3KRXA 1IG1A 4O0YA 3DBCA 5FWKK 5HBHA 1PXNA 3RK7A 4GT3A 3BHUA 2I40A 4QMTA 4CZTA 4ZSEA 3QBNA 3KRRA 4RC4A 3PUPA 3TNWA 4A9TA 4DFYA 3UYTA 3D2KA 2BAJA 2J6MA 3F3WA 2VTMA 4C4IA 5ITAA 4AZWA 4YZNA 5LCKA 3SGCA 3HMMA 1H1QA 3NW5A 3ERKA 5HTCA 5HE3A 3RWQA 1YHWA 4G3DA 4MVFA 3UGCA 2NO3A 4D58A 2BDFA 4L7FA 2GTNA 3R63A 3CS9A 4KS8A 4AUAA 3AC3A 3A60A 1PMVA 2UZOA 3C5UA 4YZMA 4USFA 4TYGA 1UV5A 3C4XA 3CKXA 4ZK5A 3W18A 3A8WA 3L9NA 3D7ZA 2BRMA 3GQIA 3NMUF 2NRUA 4QPSA 5J7BA 3CCNA 5AUVA 2PVRA 3BYUA 2BRGA 4QP3A 2WXVA 2J51A 3RHKA 2CCIA 3OFMA 3FDNA 5TKDA 3PA3A 1JLUE 4WHZA 2B4SB 3CJFA 1IR3A 3Q9YA 4UMQA 2BFXA 4BBMA 5KCVA 2Z7LA 3NUAA 3TEIA 4Y73A 5IPJA 5GINE 5EI6A 4CTCA 1V0PA 5KMNA 5CI7A 3FYKX 3F5GA 4W8DA 3DTWA 3DOGA 3T8OA 2OH4A 3F3ZA 3VIDA 4IC7A 4RIOA 3EYGA 3VUMA 4C8BA 2I1MA 2R3JA 3IW8A 4NKSA 4PNIA 4MXOA 5HU9A 4YTHA 3D15A 3TN8A 3DJ7A 3P08A 4QTAA 2C69A 4Y72A 5AR4A 5ACKA 4EH4A 4I6QA 4F64A 4RLLA 4DH3A 3O8PA 4AQCA 4EH7A 2W1FA 4FR4A 3VO3A 1I44A 5JZNA 3HV5A 2XJ2A 3PVWA 3NUNA 3QU0A 4BDGA 3FXWA 2JFMA 4RFMA 5HU3A 2OKRA 2PWLA 3DV3A 3VRZA 4DGLC 5IQAA 2DS1A 5CAVA 5IEYA 3JS2A 1VJYA 2XVDA 2PULA 1GZ8A 4JBOA 3ODZX 4QPMA 2OXDA 3VS2A 2XIKA 1Q99A 4I22A 1DI9A 4JT3A 2UZVA 1YRPA 3WIKA 2YCQA 4KSQA 3EQCA 2XNPA 3WZKA 4ZJIA 4AAAA 3OG7A 5I9UA 3QQJA 4KUJA 2JGZA 3QQKA 3QD0A 5FRIA 4QTEA 4BZOA 4J1RA 5FG8A 2JD5A 3QQLA 4EHEA 5ANJA 5AA9A 1YDRE 4RPVA 5CXHA 4W4XA 4HPUE 2PU8A 3FZOA 3DNDA 5DEWA 3UYSA 3PJ2A 4WNMA 4JDHA 3Q04A 4KKHA 4U97A 2VX3A 4O0RA 1PHKA 4PF4A 1U5RA 3FLQA 1Q97A 2X8IA 3WF5A 4BCFA 4I41A 2Z7SA 3DBDA 3R1SA 2XJ0A 4FIFA 4BCIA 1SVEA 3CEKA 2WD1A 3VS7A 3A8XA 3R71A 4JX7A 4FE2A 3LPBA 3P23A 1KE5A 3PXZA 3T9TA 3C1XA 1A48A 4ACDA 2R3LA 5BVKA 5DPVA 1H4LA 4DTBA 2CHLA 3OOGA 4WG3A 3MTFA 3OWPA 3PZHA 2AYPA 2GNIA 2PVFA 4C33A 4C4JA 2W1HA 4H3PA 4D2PA 4UWCA 3HA6A 2E2BA 5J1VA 1OL2A 1OL5A 1Q8UA 3F61A 4RRVA 4IX6A 4DLIA 1U46A 4KIKB 4F9AA 5FM2A 4Q5HA 4ENYA 5HE2A 3Q4ZA 3MBLA 5CLPA 3OZ6A 1Q8ZA 2UW6A 4JI9A 3ENHA 3VNTA 4FTOA 2C6KA 4FV8A 1ZYLA 4RFYA 5E1EA 4ANBA 4X2GA 3FLYA 4XUFA 3VUKA 3RPVA 4Z7GA 4QYHA 1P4FA 5E8ZA 2V7AA 5DIAA 2QO9A 3PWYA 2YIXA 3H9RA 5LWMA 4CCBA 5BX0A 1BKXA 3FYJX 4DA5A 3D2IA 3KY2A 4HYSA 4JDIA 2GDOA 4JLCA 3UQCA 3NW7A 4L42A 2QKRA 3SV0A 5IEVA 2W5BA 3VBXA 1M2PA 3CXWA 4XG7A 2PVYA 3F66A 3G6HA 4YHTA 3PJ1A 2G01A 5IMXA 4EOLA 3U8WA 1UNLA 3LZBA 4IX5A 4NCTA 4FV3A 4RLKA 2YDIA 4PP7A 2WTKC 1WBNA 4BCGA 2CGXA 2J2IB 3BYSA 3HNGA 1YI3A 5L8KA 4IWQA 2QLQA 2C68A 3HMIA 3ORPA 1PJKA 5KZIA 3UMXA 3KFAA 4O0SA 4ERKA 4E93A 4LGHA 2C0OA 2F7ZE 5CNNA 1ZZLA 4FZ6A 2VTPA 2B53A 4CV9A 3W1FA 3F69A 3MH2A 4M0YA 3FE3A 4GK4A 4LRKA 3RZFA 3F5XA 1B39A 2WQMA 5CY3A 5ANKA 5HD7A 1Q8WA 4I6HA 4BCPA 1FVTA 5CU0A 3WF7A 3VS5A 5J5SA 5KMJA 3ORLA 1YXTA 4FV2A 4RIYB 1VEBA 5J9LA 2YLFA 3VUTA 3C4WA 4KWPA 2EUFB 3RPYA 1EH4A 4IAZA 3R22A 1M2QA 3I0QA 5FQDC 2P4IA 1U54A 1TVOA 3ENMA 3Q5ZA 4NUSA 4XG2A 5IZFA 4U3YA 2HXQA 1L3RE 4AA5A 1PW2A 2HOGA 5JGDA 4MH7A 4MQ2A 4D9UA 2VX1A 3GENA 4F6UA 3VQUA 2CGWA 4LOPA 1H08A 4KKEA 4WIHA 4EHZA 1Q3WA 3DXNA 3CPBA 1OITA 4GCJA 5AR3A 3PPZA 4YC8A 5JQ8A 3NCGA 5J87A 2Y6OA 3OCGA 3QAME 4L6QA 2R7BA 3V8WA 1Y6AA 2RF9A 3UOJA 3KN5A 5KNJA 3V5JA 4II5A 3R8MA 1LUFA 4TYHA 2QODA 4WKQA 4J53A 1J7LA 4OLIA 4PDOA 2WIHA 4O84A 5JZJA 5AUUA 4V0GA 3GU7A 3KXXA 3QA8A 5J9YA 1XHAA 5I9VA 4R3RA 4MNFA 4J97A 3E88A 3UPXA 2VTTA 4AN9A 4EH2A 2UW0A 3C0HA 3LXPA 4DITA 2X7GA 3LQ3A 2JIIA 4KBKA 3F7WA 1Q5KA 4Q2AA 3RNYA 2VWWA 4EEVA 4QTCA 3ETAA 2YM3A 4KNBA 4HVHA 1OKWA 1P2AA 5HQ0A 3NW6A 4C4GA 3MJ2A 2BAKA 5IISA 4IC8A 5HO8A 4XG8A 4F0FA 4K8AA 3RAHA 3AG9A 5A4QA 4GIHA 4JRVA 5GJGA 1TKIA 3AC5A 4QMUA 3UZPA 3W8LA 3QRIA 3AC1A 5AA8A 2J9MA 5M06A 4AZEA 3HV3A 4NKAA 5JGBA 3DKFA 3MGYA 3MA3A 1CTPE 4K77A 4FZ7A 3ORXA 2Z8CA 4E4MA 5IUHA 4EI4A 4FT3A 4G3FA 4F9YA 2R3QA 4JL9A 3DKGA 3UC4A 4KABA 4O96A 5AV2A 3GEQA 4IADA 2BKKA 1M52A 2F49A 1FMOE 3QQGA 3PLSA 3SAYA 2OFUA 2REIA 1OKZA 3NUXA 2YITA 4IFGA 4P5QA 4EQMA 4HNIA 4RIXA 2B52A 2RL5A 3QRKA 4FSZA 3ZLWA 3UOLA 5IDPA 5JQ5A 1H0WA 3LMIA 3LLAA 5IH5A 3LCSA 4UMTA 1ZXEA 4J8NA 4EK3A 5KMLA 4F70A 3QZHA 3FQEA 1PRYA 4P90A 2XNEA 3ZXZA 4EK6A 4APPA 4ZTQA 1YDTE 3DFAA 3VUGA 3HMNA 4X3FA 1VR2A 3MTLA 3A4OX 2OJ9A 4IEBA 4A9RA 4IANA 3I79A 5AUYA 3WZJA 1MRYA 1PXMA 4QMWA 2VO3A 1HOWA 3DPKA 4FV0A 4PTEA 5K5NA 1OKVA 3PA5A 2O8YA 3PG1A 3GB2A 4BICA 2H34A 1E1XA 4OGRA 3U4WA 5HTIA 5EW3A 2KULA 3BWJA 3RAWA 3UJGA 4K18A 4PUZA 4GFGA 4YGAA 4O6EA 5BMMA 4OUCA 5C8NA 4EJ7A 5F95A 5F9EA 4ZSJA 4QMMA 5IH4A 3ZEWA 2R5TA 1YOMA 3MY1A 2XKCA 3KQ7A 3OWKA 2RSVA 3Q60A 5A4CA 1U59A 3CIKA 4Y83A 3VS6A 5HEZA 4F7LA 2HELA 3Q2JA 4EJNA 4MNEB 1H01A 3MS9A 3B2TA 5LMAA 3ATSA 5F94A 5EW8A 1JQHA 2XBAA 4FTMA 3LFDA 2EB3A 4CFVA 2G2HA 2JIUA 4FG8A 4C0TA 2WELA 4RX8A 4U79A 3W2PA 3O0GA 5M4IA 4EQCA 4WNKA 1OGUA 4UB7A 2A27A 4XYFA 3P9JA 2ITNA 5D7AA 2GHMA 1OIUA 3DJ5A 3PJ8A 4ONAA 2WNTA 2PUPA 4AA4A 5JFVA 4QYEA 5IQIA 3L8VA 2YM7A 3A62A 4A07A 4DGNA 2W5AA 2WEVA 2WMQA 3QWKA 5HIEA 3BV3A 4ZS0A 2CDZA 3HECA 3LM5A 1XJDA 3HUBA 3LFSA 3TNHA 2PVMA 3TUCA 5IQBA 5CEPA 3LFEA 3FI3A 2XP2A 3E7OA 3DZQA 4FIIA 4R7IA 1GY3A 5M55A 3UE4A 3ZO3A 5E4HA 2ZV8A 5TOZA 2QOCA 4ACMA 2PZRA 1H28A 4DEEA 4MD7E 5D1JA 4H1JA 1JOWB 3F82A 3S4QA 3ZO1A 5I9WA 4XP3A 3I4BA 2ZM3A 3R2BA 1BL7A 5J95A 4ZY6A 4ZEGA 3P7AA 4L8MA 5IEXA 3L1SA 3U9CA 4FBXA 2PYWA 3LOKA 2XRUA 4C3FA 3BIZA 4PL4A 2YN8A 1GJOA 3CKWA 4NSTA 2WTDA 4UYNA 2C5VA 4XV3A 3ZEPA 1Y8YA 3MIAA 4BCKA 5CQWA 3GCPA 3KMUA 5HORA 3QQUA 4OT6A 4D1XA 3TKHA 2VTNA 3SW4A 3MB6A 3NCZA 4I93A 3QTUA 3BGPA 2XKFA 4YBKA 4AZTA 3C51A 4CFWA 4DHFA 1QMZA 3FI4A 5IQEA 4OAVB 3BKBA 3R8UA 5JGAA 3R02A 3EN6A 4JG7A 2FA2A 3OVVA 1JBPE 4JRNA 4E6AA 1OL7A 4ZZNA 3K5UA 4NW5A 1IAJA 3N4UA 3A7FA 4QTBA 5AADA 2YJRA 2UW9A 3LQ5A 2QO7A 4MBJA 4AOTA 3F5PA 4C38A 4FGRA 1HCLA 2YEXA 3K54A 5IUIA 3GC7A 4JQ8A 4DEHA 3SW7A 1KE8A 2WQEA 3LW0A 2V22A 3HX4A 4ZLYA 5EM6A 2PZIA 1Z5MA 4FKWA 2QHNA 5ETAA 4D0WA 1T45A 4AZVA 1ZYDA 3KA0A 3ROCA 5CF5A 4EZ7A 5JSMA 2VD5A 4YHFA 2O3PA 4NU1A 3TG1A 3B8QA 4XLVA 4UYAA 4XV1A 4HGSA 4KD1A 4ACCA 2W99B 1YW2A 3TZ9A 4FKPA 4J71A 4NM5A 5CSHA 5A9UA 5BUIA 4FYOA 3TZ7A 4RC3A 3PXRA 4ZIMA 4WG4A 2IZUA 3BU5A 3GU6A 3I0OA 4MF1A 4AF3A 4L43A 4FV4A 5FGKA 2WKMA 2XK3A 2Z60A 3AGLA 4U5JA 4XS2A 4GV1A 4O38A 3HV6A 5ANDA 3R7OA 3QTIA 3PIZA 5BVOA 5J5TA 3GOPA 4FL1A 4FKIA 1SVGA 4JG8A 5J8IA 4E4LA 3ID6C 2R2PA 3PSBA 4O86A 5CVGA 4BTMA 4N70A 4OTWA 5LVOA 4DT8A 1ZLTA 2C1AA 3R01A 3L9PA 3MSSA 2UW4A 4AZFA 5CTPA 4U0IA 3I5ZA 5EI8A 2BZHB 2ERZE 2QO2A 1PXPA 2C5YA 2FGIA 3Q5IA 2H9VA 3BEGA 2WTIA 5FBNC 3W2RA 3SRVA 2H96A 3Q3BA 2Y4PA 4PNKA 4I5MA 3VS4A 3E5AA 3KF4A 4QT1A 4PPBA 3HLLA 2E9OA 5D10A 3LFAA 1OB3A 3LXNA 4FODA 1CKPA 4OTGA 3HRFA 4E7WA 5CENA 4AX8A 2SRCA 2B9JA 2QOQA 3D7TB 4EH8A 4G2FA 1M17A 3FPQA 4IX3A 4U41A 1QPCA 1YQJA 4LG4A 4BWXA 4WNPA 1U5QA 3R1QA 2J5EA 3Q52A 4CLIA 4DFXE 3TJCA 5LWNA 3CQWA 4O7TA 3ULIA 4FUYA 1BI7A 4D55A 4DFBA 1LP4A 4WBBB 3Q4UA 2UVZA 3LVPA 4BGGA 3ZLXA 1JVPP 4M97A 4DBXA 5A54A 4GEOA 3BGQA 3FMDA 3HKOA 4AW5A 4N57A 2CLXA 2YAKA 3U6JA 2OIDA 4ASEA 3FQHA 2QG5A 4JS8A 1GZOA 2Q0BA 3UPZA 1K3AA 5HBEA 3PY1A 4C59A 5DHJA 2VWBA 3A4PA 5AX9A 2YABA 4BKJA 4C4EA 2XIXA 4G6OA 2B1PA 3HRCA 2UZDA 3CQUA 3OWLA 3QLGA 4RJ3A 3EMGA 3ORNA 3QUEA 3POZA 1DM2A 4Y5HA 2BALA 2XJ1A 3GOKA 3LMGA 3Q4TA 4JXFA 4BWKA 4EYMA 3QRTA 3R73A 4KSPA 5EQPA 4W8EA 3NUSA 3KGAA 3NUUA 3DK7A 4AT5A 1Z9XA 1ERKA 4FX3A 4FF8A 4BKYA 4ZMFA 5GJDA 2G9XA 4EZ3A 2JAVA 2UVYA 3FHIA 5CZIA 5D12A 1M7QA 2ERKA 4RWJA 2C6LA 3DAKA 2XK8A 3OF0A 4NFMA 4R1YA 4WRSA 5H2UA 4RJ8A 4PX6A 2EVAA 3QKLA 3JPVA 3V8SA 1BYGA 4ZOGA 3MA6A 4J8MA 3A7GA 5HNGA 3EN9A 4BC6A 4DLJA 2CKQA 1REKA 4R78A 2I0YA 2I6LA 4GKHA 3DKCA 4NH1A 2R9SA 3Q32A 2R0IA 4C4FA 3QHRA 4KA3A 3UQFA 4Z7HA 2ZOQA 3IW6A 4IB5A 3Q9XA 3TT0A 2BRBA 3WZUA 2X39A 2XK9A 1ZY4A 4GJ2A 5A4LA 4QP6A 4GT4A 1YWNA 3ALNA 5CSPA 3DBQA 4KINA 2YAAA 3TDWA 4QTDA 5AUWA 2Y8OA 2NP8A 3BRBA 2VTIA 3GC0A 5KHWA 2QU6A 1B38A 4UZDA 5CEKA 5K3YA 4G9RA 3S1HA 5A3XA 4TWNA 5BVFA 4GU6A 1YVJA 3LE6A 5CVHA 2QOIA 4M66A 3C13A 4BDAA 4YTCA 3FBVA 3C7QA 2PL0A 4GVAA 1UVRA 4OTIA 1VZOA 4UWBA 4G3CA 3VS3A 4ZSAA 2ZB1A 4LRMA 5AJQA 4OTQA 3AT4A 1XWSA 4P2KA 4O7ZA 3JY9A 5AP2A 2CMWA 3ZRKA 3MESA 4U8ZA 3ZM9A 5CASA 2C6OA 1WVYA 4FKLA 1WBWA 3TTIA 1WBVA 3PG3A 3BV2A 2B9FA 1GIHA 5C27A 5HG8A 4AA0A 2OF2A 3SG9A 3VW8A 1ZOHA 4XOYA 2R4BA 4OBPA 2XF0A 4RA5A 3ZC5A 5HCXA 4YJQA 1UKHA 1H8FA 2GTMA 4FZAB 3BLQA 1H1PA 2BFYA 3NEWA 4D2SA 4F7SA 3OROA 3P7CA 2P0CA 5AEPA 2IG7A 4MXXA 4C57A 4D4SA 1IEPA 1G5SA 4CFNA 2WMXA 3G5DA 4IH8A 5T6KA 2E9NA 5E7RA 4FTUA 5CX9A 4AWIA 4BVUA 3LMHA 4H3QA 3KMMA 4DBNA 2OO8X 2W7XA 1SNUA 2GNJA 4O0WA 3FC1X 3A7HA 5AP5A 2R3FA 3DY7A 2UUEA 4NJDA 4WO5A 3COMA 5HHWA 5KUPA 2GCDA 2PMOX 2EXCX 5E8UA 3UQGA 1XR1A 3KRWA 4MXZA 3UG1A 4AT3A 5BVNA 3FY0A 4V0GB 2YCRA 5M07A 5GHVA 1GNGA 3O96A 5M56A 2X8EA 3FI8A 3OUNB 3COKA 4IQ6A 5HCZA 4QMXA 2Y4IB 3S00A 2E9PA 3CPCA 4QQTA 4D2VA 4TT7A 3JVRA 5F20A 3R8LA 2B54A 5HNIX 1WFCA 2JITA 5ANIA 3QXOA 4D5HA 2JDRA 2R3HA 4DCAA 4FSMA 4YU2A 1Q62A 4CV8A 2W1CA 3N4VA 2OIQA 3QD4A 2UV2A 3R30A 4JBPA 5K0KA 2FVDA 4B0GA 3QXPA 4UN0C 4P7EA 4G6LA 4EH5A 5AP4A 2WZJA 3PVGA 3PXKA 3NVMB 3G33A 5CYIA 3G6GA 4DC2A 3OCSA 2QI8A 4R6VA 4RG0A 1JKLA 1B6CB 2A0CX 2JAMA 3H3CA 3P1AA 1ND4A 4ZY4A 4FKOA 3RNIA 5EHLA 1W0XC 4NJ3A 1ZRZA 5AP7A 4HNFA 1WBTA 2BIYA 3VJOA 2VWVA 3EFWA 2HY0A 2VTQA 4IM3A 5I3OA 4PPCA 4IVCA 1KOBA 3ZBXA 4IW0A 4X2FA 1YOLA 1YOJA 3BU6A 4FNXA 3RVGA 3UG2A 1XH7A 2WB8A 4XG3A 3LFQA 1G3NA 3VF9A 4RIXB 3K3JA 2PPQA 2F7EE 2YJSA 3UIMA 3S0OA 4BDFA 4FZDB 3EZVA 4C58A 3SVVA 2XCKA 2CKEA 4ALUA 4ARKA 5I9YA 2XYUA 3IONA 4EOSA 5T68A 4ZJJA 1UU8A 5IA5A 1STCE 3C4EA 3RPSA 4Q9ZA 4G16A 5HESA 4NM0A 4C02A 4N4SA 4X3FB 5CF8A 4L7SA 2W9ZB 3TXOA 5CAQA 2OICA 5JN2A 3EQFA 3OP5A 4Y46A 4IZYA 2EWAA 4E73A 3DS6A 2FYSA 2C5NA 4I4FA 4YPDA 2JLDA 5AUZA 3ODYX 4RWKA 3JY0A 4YJUA 4CLJA 4NL0A 3LM0A 4RA4A 4C2WA 3O7LD 4J98A 1R0PA 3QQHA 4I6BA 2R64A 4JG6A 3LXLA 4BCOA 4FKJA 1SYKA 4XP0A 2VGPA 3ZM4A 2GHGA 3SXRA 4I0TA 1J1CA 3PY0A 3PXQA 4LI5A 4CYIA 4AE9A 2GU8A 3EQRA 3IG7A 3IK3A 3OHTA 4MXAA 5FXQA 4E5AX 4Z3VA 3BI6A 4YO4A 3H30A 1YDSE 4FV1A 3VF8A 2IW9A 2XIRA 2F2CB 4PV0A 4AT4A 1FMKA 3KN6A 4W9WA 3R0TA 4XRLA 3UVRA 2F2UA 3PRIA 5CWZA 5HX8A 2WQBA 2BZJA 3ZHPC 2HENA 1UU9A 3BQRA 4A9YA 1F0QA 3CSVA 3HEGA 4I0RA 3VULA 5DRBA 2OH0E 2IN6A 4E6CA 4USDA 4LGDA 4BDJA 3ZONA 3TCPA 4WUNA 5J79A 5CEQA 5TT7A 4CVAA 4K9YA 5FEDA 4F1MA 4S34A 3RK5A 3NYXA 4NZWB 5CU2A 2QCSA 2Q0NA 4IM2A 4XCUA 4YLJA 4BCHA 1NA7A 4EK8A 1A9UA 4JIAA 4RVKA 3QFVA 2Y7JA 4OAUC 5IQCA 4DCEA 5ACBC 3W2CA 5AIRA 3HDMA 5ANGA 3UZRA 4GIIA 4C35A 4M3QA 4D2WA 2ZB0A 5K5XA 2CGVA 4GMYA 4O1OA 4YJSA 3QALE 4FNWA 4U9AA 3CY2A 3V5QA 3W8QA 4EH9A 2LAVA 4YMJA 2OZAB 2X6EA 4Z9LA 5E92A 4FSQA 3AC2A 2XMYA 4F65A 4FKUA 2CNQA 3GBZA 5LMBA 5KBQA 4EOIA 1CKIA 3QTRA 4I5PA 3GC9A 5AP0A 4JQEA 4EUTA 4B8MA 1OVEA 4BHNA 5BVEA 4RWIA 2QNJA 3OS3A 2VGOA 3KXHA 3QZFA 4IB0A 4H05A 4MHAA 2R3IA 1XH8A 4IIRA 3HMPA 4ZSGA 4EOJA 5KMOA 2QR8A 3VW6A 4D28A 4GT5A 4ZZOA 2X6DA 2HZ4A 3LQ8A 2XNOA 3W16A 5ICPA 5KE0A 4O7RA 4U7ZA 1O6KA 1K9AA 4IHPA 4JIKA 4UMRA 2IO6A 3TNPC 4YUQA 3QGYA 4XBRA 4BI2A 5I9XA 3S2PA 5F4NA 3KULB 4BDCA 3EN4A 3QZGA 4AU8A 4F9BA 2XNMA 3SOCA 3UDBA 4F6SA 3AGMA 3HGKA 4AN3A 3DA6A 4D2TA 5A4TA 2ZDTA 3ACJA 5FP5A 3RI1A 1CSNA 2XYNA 4XH6A 4EOQA 3GCUA 4F4PA 2BHHA 3FMKA 4G17A 4RJ5A 3E92A 3FUPA 4IM0A 3C0GA 3ANQA 3KXMA 4YJTA 4E6DA 2W1EA 3UO4A 4YJVA 3FLZA 4CG9A 3B8RA 4TWCA 3NRMA 4I6FA 4QYFA 2HW7A 5JRQA 4D1ZA 3NZ0A 2ZV7A 3TTJA 4F7JA 4USEA 1M7NA 2YFXA 5IA3A 3EOCA 4KRCA 2OLCA 1S9IA 2C6EA 3P79A 3QCSA 2R0UA 4IWDA 2VU3A 3EKNA 3HL7A 4BIBA 4F0GA 2ZMCA 4JR7A 5IF1A 3U6IA 2V5QA 5CEIA 4D1SA 1JSUA 2QKWB 3DB8A 4GG5A 5I3RA 4EUUA 5L6OA 3MH0A 4TYEA 5AWMA 3RP9A 3EQIA 1H26A 1ZMUA 3TIYA 3R7YA 5M44A 4M12A 5AP1A 5CAOA 1O6YA 5KHXA 4E4XA 4QP1A 3QC4A 3R9HA 3LXKA 2J0MB 1IA9A 2ITTA 4NEUA 2ZJWA 2J90A 2OI4X 2FSOX 5BVWA 2PSQA 3PVUA 5DA3A 5CANA 3DZOA 2HY81 2XNNA 1WVWA 3AOXA 4MEDA 2VWZA 5DVRA 4DEAA 1GZNA 3RWPA 3DLSA 2IW8A 3IDPA 1JSVA 5C4LA 4FKGA 4C2VA 2XB7A 3CGFA 3RJCA 4L3PA 5IG1A 4HYUA 4HOKA 2XUUA 1LEZA 3E63A 4EKLA 5LOHA 4D4YA 2YM5A 3RAIA 1W82A 1ZYCA 4QMLA 3E8NA 5HBJA 4IAKA 2OJIA 3GU8A 3NUPA 3PVBA 4F9CA 4ZLZA 5A46A 4IWPA 4AFJA 4W9XA 4TNDA 2CLQA 5B2LA 3BGZA 4LOQA 3R7UA 2OU7A 1DI8A 3MFSA 5LARA 4E1ZA 3KREA 2EU9A 3L9LA 4XHKB 4ZZMA 5EDRA 3NWWA 4J95A 1JPAA 1Q8YA 4ZXTA 5CAPA 2J50A 1WBSA 3D83A 3W2QA 4DFZE 1UU7A 2OF4A 2X4FA 3FZ1A 1SMHA 3MY0A 4AACA 1NW1A 1GAGA 4B6LA 4MK0A 3BPRA 2UW3A 4QQJA 1ZWSA 1H0VA 2C6TA 2YHVA 4YP8A 4YSJA 4FTQA 4K2RA 3G51A 1H07A 4R1VA 5HLWA 3OTVA 1JKTA 4UZHA 1FGIA 3LKMA 4DFLA 4GG7A 3SLSA 5EYMA 5CAUA 1KE9A 2EXMA 4BZDA 4H36A 4BBFA 4X2NA 5EK7A 4R3PA 2PUIA 3JVSA 3KC3A 2BMCA 4RWLA 5K4IA 4TNBA 5DNRA 4C36A 3V5WA 4W4WA 3Q6WA 3K5VA 3V6SA 4QMZA 2O5KA 2VO6A 5JT2A 5HX6A 2XNBA 1XO2B 4ZS4A 2C47A 3O8TA 2BCJA 3I81A 2R3GA 3OMVA 4B99A 5E9EA 4HVSA 4CFFA 5C4KA 2BDWA 5IU2A 5DH3A 3RZBA 1JSTA 4GFMA 2VWIA 3K2LA 4HCTA 3DQXA 3H0ZA 1JWHA 2GMXA 4C37A 2OJGA 2V62A 1F3MC 2F4JA 4M84A 4E20A 2RFSA 4FG7A 1MRVA 3KL8A 4EWQA 3GFWA 5KBRA 3VQHA 1WZYA 1VYZA 2QLUA 2YERA 1FBNA 4OTFA 1ZAOA 1OUYA 3E3PA 3G0FA 4XV9A 3ZLSA 2P3GX 2BZIB 4E26A 2YIQA 1Q41A 4XOZA 1XH5A 3TNQB 1XH4A 5JRSA 4HCUA 4DYMA 1QCFA 3QX4A 3C4ZA 4ASXA 2JDTA 4CYJA 1YI4A 4QYYA 4D4RA 4M67A 1OM1A 4G31A 4PTCA 5IA1A 4NIFB 1J7IA 4ANLA 4BWPA 2WO6A 3OCBA 2I0VA 2WAJA 4FL2A 3WF8A 3U4UA 4FSNA 3TL8A 4RT7A 1OPKA 3DTCA 1V1KA 4MD8E 3H0YA 3QWJA 2XEYA 3FAAA 5CSXA 3THBA 2QOKA 4OBQA 4B4LA 4C4HA 2OW3A 4U80A 4FIEA 3P4KA 4C62A 2P33A 2GFCA 3H4JA 4FTLA 4FSTA 2XKDA 3UBDA 3OXZA 4XLIA 3S95A 3CLYA 3PPKA 4OBOA 3VS0A 5M4FA 5CI6A 3H9FA 5HE1A 3RKBA 4XV2A 5HKMA 5C9CA 4GVJA 3BLHA 3PIYA 3BHVA 4HZRA 2HZIA 2H8HA 5M4UA 5EKOA 2E9VA 3PLAE 3AMBA 4IZ7A 1XQZA 3PSCA 3BZ3A 4QO9A 3QCYA 4BCMA 4JVGA 4QMYA 4FTIA 4IBMA 3BYOA 4FC0A 4L53A 5DOSA 5HZNA 2CNUA 4M69B 3FWQA 3T3VA 4WT6A 3LLTA 4GYGA 5C8KA 4GFOA 3FHRA 1URWA 1YHVA 2Y0AA 5BUJA 4LM5A 4Y95A 2WIPA 5EM5A 4F1OA 3U55A 3RCJA 1PYEA 3UO6A 4IJ9A 5JEBA 4YNEA 4IE9A 4I20A 4QMSA 2JDVA 3KRJA 4FTNA 1OECA 3LCOA 4YBJA 2WMTA 4DG0E 4OTRA 2IVTA 2P2IA 4QMNA 2G2FA 2PZ5A 3ZS5A 4WRGA 3EJ1A 2BRNA 3Q96A 3LFFA 3AXWA 1NVSA 4CTBA 4RVTA 1CKJA 3UC3A 4DFUA 5EKNA 4QQ5A 4E5WA 1PXOA 2BR1A 3ZC6A 2I0EA 4AS0A 3G0EA 4BIEA 3MVJA 4EORA 5FUTA 1FVRA 3R7VA 4XG9A 3GQLA 4CFXA 5KKRB 3PIXA 4IB1A 4O2PA 3BBWA 5FEQA 1PY5A 3ATTA 1XH9A 3ZBFA 4YZ9A 1V0BA 5IA2A 3M11A 2VRXA 2WOTA 4L00A 2HAKA 5HLNA 3R9OA 5L4QA 1JNKA 5FEEA 3UIUA 4IXPA 4EK4A 2OGVA 4R8QA 4IAAA 4IAFA 4DEBA 5GZAA 4GK2A 3QUPA 3WOWA 2XK7A 4XBUA 4MYGA 4ZTRA 2HK5A 1OL6A 4I4EA 4O0TA 2OXYA 3W2SA 4ANMA 3FMHA 4FZFB 4WD5A 5AX3A 1A06A 2W5HA 2GS7A 5H9BA 3PXYA 2B7AA 3O23A 4I0SA 4ZTNA 4DFNA 3CD3A 2WPAA 3F6XA 5AUTA 3KKVA 4ALWA 3O50A 4L68A 5AM7A 3UZTA 1R0EA 4GJ3A 3ZFYA 4CFMA 2RFEA 2CSNA 4W4YA 2IWIA 3BELA 3P86A 4IX4A 4RZWA 5LXMA 5M4CA 4JJRA 4UX9A 2W4OA 1WCCA 2GNHA 3OEFX 3EZRA 2W1DA 5M09A 2A19B 3PYYA 2X2LA 4YURA 4RIYA 4WSYA 3E8CA 4ZY5A 3UODA 4TRLA 2C4GA 4TL0A 3QKKA 4NWMA 4XP2A 4QNAA 4EC9A 3R28A 2A1AB 4CCUA 2GNFA 3CBLA 4DH1A 4BF2A 1H00A 3CR0A 3DXPA 4CG8A 1I09A 2C3LA 5CT0A 3W2OA 3EN5A 4WG5A 4PL3A 4QQCA 2C3JA 4BYIA 4F08A 4LL5A 4B7TA 4HW7A 3N4TA 1PXKA 4ZTHA 3Q6UA 3ORKA 4FSUA 2FSLX 3GI3A 3JXWA 1OIYA 4MF0A 5LVLA 4UXLA 4YTFA 3ZCLA 4JQ7A 4FKSA 4CMOA 4ITIA 2W9FB 3IS5A 2CJMA 5L2QA 3QTXA 1IA8A 2P2HA 3E8DA 4YJPA 3KU2A 5I0BA 4CGAA 3RHXA 3MI9A 2QOLA 5IQHA 2CGUA 4M14A 2X81A 5BYLA 1YXSA 4BN1A 3Q53A 2W4KA 5CXZA 2CPKE 4BI1A 1SVHA 4M7IA 3MV5A 4K33A 4AOIA 4LUDA 2RG5A 3ACKA 2JKMA 2IW6A 4K1BA 2XH5A 5KMKA 4BL1A 5CZHA 4CRLA 4QYGA 2DWBA 5TO8A 3WIGA 2QR7A 2YZAA 4MCVA 3VJNA 4Y5QA 3GU4A 1YXXA 3DXQA 5FLFA 2ITOA 3ZMMA 4KBCA 3EKKA 3QYWA 5DI1A 4FA2A 3W55A 4A4XA 3UP2A 2JKKA 3MIYA 4NM3A 4EBVA 2XZSA 4MWHA 4F1TA 4ORKA 4U45A 4GKIA 3SA0A 4D2RA 1S9JA 3EQDA 1E9HA 5CVFA 2YISA 4ASZA 4F99A 2GNGA 3FY2A 3FMJA 3PE2A 4JBQA 4XMOA 1M14A 1XH6A 3FPMA 3AD4A 4V01A 2WOUA 2UW7A 4ERWA 3NDMA 3RTPA 3A2CA 1APME 3UOHA 4RJ7A 5CQUA 4OTDA 4F0IA 3DDQA 4AW2A 2BUJA 4BDDA 3HVCA 2ZM4A 4Z16A 2JBOA 3PA4A 3DAJA 4L46A 4S30A 5EOBA 3RBWA 4HCVA 4W4VA 3QX2A 5AV1A 4CKJA 2FUMA 2PVNA 2W4JA 1Y57A 5CS6A 5D7VA 1W84A 3F2AA 3FV8A 3ROYA 4CSVA 3WE4A 1Q24A 5ETCA 4CFUA 1Y6BA 4C3RA 3L8PA 2QHMA 3KVWA 5J7HA 4X21A 3AC4A 2J7TA 5LMKC 4X3JA 4R3CA 2W0JA 1YWVA 3QQFA 5FTOA 3VN9A 3RGFA 3RINA 3QTZA 4FEVA 3VRYA 1XKKA 1UNGA 2JFLA 4HYHA 2BZKB 3MDYA 4Y8DA 3MFTA 2X0GA 4DF3A 2YM6A 3CGOA 1YWRA 4HVDA 2XKEA 5C8MA 1GOLA 3E93A 2PVKA 2G2IA 1YKRA 5TE0A 4BGQA 4NT4A 4BDHA 4KIPA 2CKPA 3D5UA 5BNJA 5A6OA 4P5ZA 4WA9A 5DT0A 3U51A 4B8LA 1NXKA 1UU3A 2BVAA 3FZPA 4FIGA 4RVMA 2EB2A 2WMSA 3MPTA 1ZY5A 3TJDA 5BQ0A 3O17A 3EFJA 5BVDA 5BYYA 1NVQA 3UOKA 1PMNA 1OIQA 2LGCA 2VUWA 2QG7A 4GH2A 4AXAA 1W7HA 4BBEA 4I92A 4N6ZA 3PZEA 4ID7A 5LVNA 3N9XA 3ZSIA 4PL5A 5LCJA 3R2YA 3NVKI 3VHKA 1G8AA 3VVHA 4O81A 4MNEA 2C6IA 4QP9A 3QGWA 3NYNA 3MYGA 1OUKA 3LCTA 1KE6A 4QP8A 3KVXA 2VO7A 2YACA 3OTUA 1U54B 5KO1A 4CZUA 2FO0A 4FT5A 2ITYA 4KS7A 1XBAA 3D94A 3L8XA 5F1ZA 3F3TA 3ZUUA 3DKOA 2RG6A 2X8DA 2ZYBA 4CQGA 4U43A 1FINA 1DS5A 3ZZWA 3SG8A 5FDXA 3TNIA 1WBPA 3RPRA 2WMRA 5CEMA 1P14A 5AR2A 4TY1A 5EYKA 5HO7A 3IDCA 4FT7A 3KEXA 2C30A 3O71A 3NSZA 4NTSA 5I4NA 3R6XA 2IVSA 5IUGA 3LFNA 4FICA 1KV2A 2PY3A 3PJCA 4JAJA 5CF6A 5DYJA 4TYHB 3O8UA 5DR6A 3ZYAA 4ZAUA 4L3JA 4YPSA 2PK9A 1FVVA 4YHJA 2VZ6A 1O6LA 2C1BA 4OTHA 4XJ0A 3R7IA 3ZSHA 3SC1A 4BY9E 4I5CA 2JBPA 3ELJA 2VTOA 5AR8A 5HOAA 2J4ZA 4YLKA 4XRJA 4G3GA 3DU8A 5FM3A 1ZOGA 1FOTA 5HCYA 3UNJA 3H9OA 3NNXA 4BHZA 3PE1A 3Q4CA 4J7BA 3HYHA 5G6VA 4DGOA 5DEYA 3PJ3A 3DNEA 4EZ5A 4LFIA 2XRWA 4YZBA 4Z55A 2OJFE 5EQEA 4FVQA 4N0SA 3FLNC 4G34A 3FZSA 2X9FA 2YDKA 4ITHA 5EYDA 3R9DA 3NNUA 4BZNA 2G15A 4IWOA 4E8AA 3FMEA 4GS6A 3RAKA 4DTAA 2GS6A 3QC9A 2PMLX 3UNZA 2HZNA 4ZTSA 3U54A 4NCTC 2YIYA 3HRBA 3UVQA 3VS1A 2UZTA 4TPTA 5JKGA 2YLEA 1J1BA 3FL4A 4CMUA 4Y85A 4G1WA 3DBFA 2A4LA 5C26A 3W10A 3HDNA 3ZUTA 3LAUA 3UIXA 3COHA 3PP1A 4IACA 1GIIA 1KSWA 4FEUA 1ZMWA 3SHEA 5AV4A 2UVXA 4DH8A 4RIWA 2FH9A 3AQVA 3RALA 4AGWA 4I5HA 4BGHA 5I5ZA 5L8JA 4EONA 3F2RA 4A7CA 5FXRA 1Z57A 4BRXA 4G9CA 3EHAA 4BFMA 4YJOA 4K6ZA 4ZTMA 2UZBA 1PKGA 4CKRA 2HIWA 3WZEA 4PPAA 3SQQA 3GVUA 4HZSA 2UZUE 5ANOA 3ZTXA 4UV0A 3W32A 4DT9A 2H6DA 4D0XA 3G9NA 2QC6A 5H3QA 5M08A 3R83A 5L2WA 1YXVA 4H39A 5CT7A 3GXLA 2QOBA 4FTCA 3V3VA 1IASA 5TF9A 1UA2A 1RE8A 5JK3A 4LYNA 2YDJA 2WMVA 4V05A 2XM8A 2XNGA 4MWIA 5A4EA 3FC2A 3LFBA 5JFSA 4YC6A 5DMZA 3MJ1A 3KXNA 5E1SA 2BTSA 3GCQA 1ZMVA 3KCKA 4UXQA 5FDPA 1SM2A 3CY3A 2WMAA 1OBDA 3Q9WA 4GUEA 3DLZA 3QD3A 2VTJA 3FZTA 4MBIA 4NK9A 2WMWA 5LMKA 3LJ1A 4J52A 2VTAA 2PMNX 3VHEA 3FKLA 3FLWA 4HGTA 5HI2A 3C5IA 3I5NA 4FKQA 2J0JA 4S31A 4U3ZA 3REPA 4OW8A 2VAGA 2WU6A 3FMNA 5AV0A 3QKMA 2PUUA 4FEWA 2Y6MA 4PRJA 2Z7RA 3KXZA 3BE2A 2WTKB 2O63A 5HIDA 4YTIA 2ONLC 2YIWA 4JDKA 2Y4IC 2PVLA 1MP8A 2X4ZA 3QD2B 1W83A 1X8BA 2WTJA 3CE3A 1WVXA 3DAEA 3MVHA 4LMNA 2X7FA 3D7TA 4X6QC 3AT2A 5EG3A 5DG5A 2VNYA 4K0YA 5BPYA 4NM7A 3FXXA 5IQDA 3R21A 2Z2WA 2WMBA 2QOFA 4DG2E 3QCQA 3QTSA 2XA4A 5JFXA 3QTWA 1KUTA 3PY3A 3ZFMA 3A7IA 4RX5A 2WTVA 1V0OA 4XG6A 2VNWA 3W33A 4A06A 2AUHA 4FG9A 3V5LA 5LVPA 4L67A 3ZSGA 2ETKA 3EIDA 3OT3A 2OIBA 5H8GA 3DCVA 3FL5A 2UW8A 5E8WA 2A2AA 3G2FA 4FNZA 3QRJA 4FNYA 4FOCA 5L8LA 3M2WA 2JC6A 2GQRA 4R7BA 4S32A 2BPMA 4YSMA 3V8TA 3GNIB 1OBGA 2G1TA 3E8EA 4NFNA 4O7VA 4QMPA 4CXAA 3BYVA 2HYYA 4D9TA 1SZMA 5HGIA 1SNXA 2UZWE 2PHKA 1JAMA 2BROA 1PF8A 2F57A 3ANRA 3A99A 3ITZA 5E8XA 5L2IA 5M53A 4FKTA 3MH1A 1NVRA 2X7OA 3I7CA 3D9VA 4NW6A 3UVPA 3VBQA 4C34A 2ETMA 3ZH8A 3IPHA 5CALA 4V04A 4DTKA 4F63A 4FV6A 3JR1A 4XEYA 3KRLA 3OY1A 3EB0A 4PMPA 4X3FC 4IJPA 4CZYB 3FXZA 3WYXA 5L2TA 2YWVA 4HGLA 4A4LA 3CC6A 4Q9SA 1PMEA 3G90X 4O1PA 5E8TA 1W8CA 4U81A 3GCSA 4G5JA 4IDTA 1REJA 4UEUA 4PDYA 3EL7A 3TV7A 3RPOA 3IW7A 4B9DA 2BIKB 2DYLA 4EHGA 3M42A 4L3LA 3ZUVA 3D5VA 5HG5A 3E62A 4AN2A 4CRSA 1H27A 5DR9A 4DN5A 3BYMA 3IOPA 4ANOA 2VTLA 5ETFA 3TDVA 5D9HA 4YNOA 3BWFA 3F9NA 2IVUA 2Y9QA 3ZZEA 4ZMEA 5E8VA 3EN7A 5HO6A 1RW8A 1BX6A 3NAYA 2C0TA 4IAYA 3BLRA 4ZLOA 1ZARA 2WGJA 3WBLA 3IGGA 4GW8A 3OD6X 5T3QA 1OPJA 4LQMA 3R9NA 3IO7A 3MPMA 2W17A 1ZYJA 3VC4A 2GSFA 4YZDA 3FKOA 2XEZA 2PE0A 3ALOA 3NYOA 3P5KA 4O6LA 3EFLA 4BCNA 5E91A 2GPHA 4ITJA 2XK4A 3IECA 4O22A 4BDEA 3NIEA 3GU5A 3ZXTA 4FT0A 3PTGA 3C50A 4RVLA 5BUEA 2PUNA 1TQPA 1YI6A 3BHYA 4BCQA 5JMSA 3IDBA 2WMUA 4MTAA 2YWPA 4KKGA 3RCDA 3RM6A 3UO5A 2X2KA 4FV5A 2AC3A 4IVBA 5AUXA 4O7SA 2C5XA 1PKDA 3OOMA 3WF9A 2B9HA 1AGWA 2CKOA 2IPXA 5B2KA 1RDQE 4PMMA 5L3AA 3ORZA 3FMLA 1QL6A 2CNVA 4H1MA 4YZCA 1WAKA 1OI9A 4QMQA 3BCEA 4QPAA 4D5KA 4FI1A 4RMZA 5AMNA 3R8PA 3SRVB 4DINA 1E1VA 3TZMA 1ATPE 3IW4A 3CQEA 4FEQA 4O7YA 2OWBA 3BHTA 3HAVA 5JFWA 1RJBA 3COIA 4TXCA 4IMYA 3DGKA 4QNYA 2RGPA 1H1RA 2HZ0A 4BCJA 4I94A 1XBBA 2VTHA 2X1NA 5EW9A 3VUIA 4EC8A 3NR9A 4TKSA 2Z02A 3EH9A 3TUDA 4RQVA 2ITUA 3DK6A 4J96A 3V51A 4J99A 3IOKA 3ORMA 3PFQA 4A9UA 3D14A 3R8VA 5I9ZA 4G3EA 4O7LA 3R1YA 4OT5A 3LCKA 5EDQA 3U6HA 4LOOA 4WBOA 4R5YA 4AFEA 4PDSA 1P4OA 2ONLA 2W1IA 2QOOA 3WE8A 3BEAA 4RJ6A 5D11A 5TR6A 3ZOSA 1MQBA 4EL9A 5EM7A 3EWHA 2FSTX 3OW3A 4WOVA 1Y91A 1R3CA 3KF7A 3POOA 3LJ2A 2R3PA 3VBYA 3ZDUA 1LR4A 4QMVA 4E3CA 4JOAA 1FPUA 3TKUA 2WTCA 3CTJA 2YM4A 4AW1A 3EQPA 2ITVA 4F09A 2W06A 3C9WA 4M68A 2W05A 1Y8GA 5DT4A 2W1GA 5EYCA 2YIRA 3UMWA 3QF9A 2PE2A 2PVHA 4PTGA 3PSDA 5DR2A 4O83A 4L9IA 2X9EA 3SXSA 3ZDIA 2JKOA 3HV7A 2JKQA 3AT3A 2BKZA 3FZRA 3OUKA 3TV6A 4QP7A 3EYHA 4GSBA 3UTOA 4XG4A 4KIQA 3ZLYA 3KCFA 4IFCA 4JBVA 3SDJA 1Q3DA 4KB8A 4UMUA 3IKAA 3RM7A 3ZO2A 4FKVA 1FQ1B 3KXGA 4MXYA 3OWJA 5EI2A 1YHSA 3D4QA 3FJQE 1FGKA 1GIJA 4LL0A 3WYYA 3BQCA 4DAWA 3UIBA 3NIZA 3C0IA 4O21A 4HVGA 4O0UA 5FTQA 4ANQA 5DT3A 2J5FA 5EFQA 1NY3A 1OPLA 3GGFA 4QMOA 4QP4A 5GZ9A 4BKZA 5AM6A 5EQYA 2FSMX 2QOHA 2WFYA 2ZMDA 3I1AA 1HCKA 3R00A 4GU9A 5AIKA 1K2PA 4BDKA 1MRUA 3O2MA 5IMEA 2ZAZA 4H3BA 4QRCA 4FK3A 3VAPA 5JH6A 3DQWA 3DJ6A 4FUXA 2HXLA 3SOAA 4DEGA 4FT9A 3F3VA 2B0QA 4KAOA 5B7VA 3E7VA 3LJ0A 3WZDA 3MH3A 3QCXA 3JYAA 5E8YA 3O51A 1H1WA 2QURA 2ITWA 5J9ZA 3E87A 4CNHA 4TWOA 4R7HA 4BB4A 4U42A 4ZSLA 4PDPA 2F9GA 5GIOE 4DEIA 4EH6A 4G6NA 4PWNA 5C1QB 2I7QA 3AD5A 4N6YA 3WF6A 2WQNA 3A7JA 3QRUA 4O0XA 4I21A 2JDSA 4EKKA 4JNWA 5CNOA 1Q61A 3RMFA 3MY5A 1R39A 1QPDA 2V55A 3K3IA 1DAYA 2VV9A 2WHBA 2WQOA 5KZ0A 2JEDA 2EXEA 4EBWA 5EHYA 2C3KA 3TM0A 5CU6A 4GRBA 4L01A 4HPTE 2WEIA 5M57A 3R04A 5CU3A 3L8SA 3S3IA 4BTFA 5FXSA 3B2WA 2O2UA 5FD2A 3TI1A 4K11A 3FI2A 1L8TA 3II5A 3CD8A 4IAIA 4AGCA 3GP0A 3Q9ZA 4I3ZA 4MQ1A 3VBVA 3R7EA 5AFVA 1WMKA 3FLSA 3HV4A 2Q83A 3AMYA 2VX0A 4QOXA 4AW0A 4NYEA 4FSWA 2ZV9A 4IZ5A 2HWPA 4RBLA 4YLLA 3V01A 3HP2A 1T46A 4FIHA 2DUVA 3G15A 2ITZA 4FYNA 1UWHA 5HVYA 4NTTA 4FK6A 2O65A 5DLSA 3MFUA 5L6WL 5K4JA 3TACA 3P7BA 3HMOA 1R78A 1RQQA 2OZOA 2PZPA 2XM9A 5GNKA 1G8SA 3E3BX 1O9UA 1XBCA 3VUHA 4RX7A 4AGUA 3TKIA 2XS0A 2VTRA 3PPJA 4RFZA 4TN6A 5C03A 5FTGA 2ITQA 1ZYSA 3R9RA 1NT2A 2HCKA 3EL8A 4KIKA 2VO0A 3OBGA 2OZAA 3CTHA 4PP9A 4FSRA 3EQHA 3ZRMA 2Z7QA 4BI0A 2WU7A 3ZU7A 1F5QA 3CP9A 2R3OA 3NYVA 5AP6A 5HICA 3I6UA 2AC5A 2PMIA 2GNLA 1IRKA 4L52A 3V5TA 4CT2A 3MW1A 3PRFA 4EQUA 1LEWA 3JUHA 3NGAA 4GK3A 1YXUA 4S2ZA 4ZJVA 2OFVA 2RFDA 4LMUA 4EYJA 5IQGA 3SKCA 3F88A 4X0MA 5DBXA 3IW5A 1GZKA 5ETIA 1J3HA 1PXLA 1ZOEA 3GCVA 4L45A 4FTKA 2WTWA 1KOAA 4EOMA 4BDBA 2OSCA 3GC8A 4IVAA 4TTHB 5C01A 4AP7A 4IB3A 3BU3A 2W96B 3R7GA 2GFSA 2ZM1A 4O91A 4BTKA 2FB8A 3FSKA 3D5WA 3DFCB 3KK8A 2ZV2A 4I23A 4XNEA 3BHHA 5H8BA 4BTJA 5G1XA 4CQEA 3KULA 2XCHA 2JIVA 4TYIA 4CKIA 4MKCA 2XBJA 4O2ZA 2VWXA 2ZVAA 2W1ZA 1ZZ2A 4LUEA 5A6NA 5AAEA 3SXFA 4TWPA 2QU5A 4XX9A 3V5PA 5CF4A 2HW6A 4YO6A 5K9IA 2HWOA 5ANEA 4UWYA 3P78A 4FVPA 4YC3A 3TV4A 3U9NA 4H58A 3V6RA 3ET7A 4RIWB 2XIZA 1IAHA 2GHLA 4A4OA 4C61A 5KX8A 4EOOA 1OZ1A 3EFKA 3OW4A 4S33A 3F7ZA 4JX3A 4M8TA 1MUOA 2C5OA 5GJFA 4HVIA 4YR8A 3PDTA 5CSVA 3ORTA 3MN3A 1H24A 2R3NA 3OXIA 4AZSA 3QZIA 4DGGA 4O7WA 4ANSA 3GT8A 4BR3A 3F2NA 2B55A 2BHEA 4O0VA 4MXCA 4FGBA 1PXIA 4WNOA 2BRHA 2CN5A 4EH3A 5HIBA 1CDKA 1BL6A 2KTYA 3IGOA 2QONA 1UWJA 3NX8A 4X2KA 4M15A 2ACXA 2O0UA 2QD9A 4EOKA 2F7XE 4RC2A 4HYIA 4FIJA 5LQFA 2NNWB 3FKNA 1M2RA 2YA9A 3OCTA 4KBAA 3G9LX 3D0EA 3I7BA 2UZEA 2NPQA 2PE1A 4Q5EA 4HJOA 4KRDA 2YZLA 1BI8A 2R7IA 3OXTA 2VWUA 5AR5A 5EHOA 5AAGA 5DWRA 5IH6A 4CD0A 5KMIA 3T9IA 4E5BA 2OBJA 2UW5A 4FTJA 3V04A 4CEGA 3LCDA 4DH5A 1BLXA 2ITPA 4L44A 3PP0A 3UNKA 3LHJA 4M13A 1DAWA 1TQIA 1CM8A 2VWYA 3F3UA 4HGEA 5IA0A 2BILB 4DE4A 3MVMA 4DEDA 4KIOA 3TIZA 5K0XA 3AC8A 2PTKA 4LRJA 2IZTA 2QQ7A 3NNVA 4G5PA 4MX9A 3MB7A 1P5EA 4YJNA 1Q8TA 5KKRC 2VN9A 1WBOA 5FBOA 3C4FA 4ASDA 4ALVA 4E4NA 5DRDA 3KK9A 3PWDA
chains in the Genus database with same CATH superfamily
5CU4A 2VTSA 4M0ZA 4R5SA 4GUBA 2R3KA 4FSYA 4OR5A 1JKSA 4UY9A 5IKWA 1UKIA 3TZ8A 1OMWA 2DQ7X 5IA4A 4GL9A 3EQBA 1JKKA 1OL1A 3QL8A 3T3UA 5AV3A 3VWAA 2C0IA 4F6WA 4O82A 3AD6A 3DDPA 3SX9A 1OKYA 2R3RA 3QUDA 3ORIA 4JDJA 2XK6A 5FP6A 2CCHA 2B9IA 3I6WA 4FMQA 5B0XA 4TZRA 3DBEA 4QP2A 5A14A 4EOPA 4RSSA 5M51A 3CJGA 5HE0A 2X2MA 4D4VA 3QA0A 5EDPA 4AE6A 4EHVA 3DB6A 4WSQA 4ENXA 3RK9A 4FOBA 4RGJA 3NLBA 5EH0A 2I0HA 3LFCA 3EQGA 4PQNA 5HVKA 1URCA 5H8EA 1TQMA 2YCFA 3DK3A 3WARA 2GQGA 3WI6A 3MVLA 4X2JA 3NS9A 3R8ZA 4AG8A 5HTBA 4UMPA 3L9MA 5B2MA 3TUBA 2OG8A 2UZLA 2RIOA 3QTQA 5HG9A 2YM8A 3ZO4A 1R1WA 1OGYA 2IZRA 4DH7A 5GZ8A 2ZDUA 3NUYA 3BBTB 5BMSA 4DGMA 1QPJA 2JDOA 4PMSA 3NPCA 3GUBA 2GS2A 4UBAA 4YJRA 4RZVA 4U40A 2IJMA 3QLFA 1MQ4A 4FL3A 3OEZA 4BIDA 5IDNA 3NNWA 3VUDA 2P55A 4FTAA 2BDJA 2XIYA 3E64A 4A9SA 4BDIA 4JMQA 3LIJA 5HG7A 5EM8A 3FQSA 5CEOA 3HUCA 4R77A 2OXXA 3F5UA 4FTTA 1LPUA 3OT8A 2IVVA 4LV5A 4AGDA 5GIPE 2PVJA 4FTRA 4GYIA 4I1ZA 3WILA 3FEGA 4RX9A 4O7NA 1PXJA 4NIFA 5HVJA 4FKRA 3UP7A 4C7TA 4O27B 1BMKA 2NRYA 3C4CA 4LGGA 4F7NA 3FMMA 4ACGA 2C6MA 2J0IA 2UZNA 3CTQA 4X6RA 2O64A 2ESMA 2QVSE 1H25A 5LJJA 3AKKA 5L6PA 2BTRA 2E9UA 3AMAA 2OK1A 3M1SA 3MPAA 4IZAA 4RQKA 3Q2MA 4APCA 5KMMA 5IQFA 3NAXA 3OY3A 3R1NA 1VYWA 3GFEA 3DT1A 4PY1A 4TW9A 3ULZA 5J1WA 1OIRA 1AD5A 1UNHA 3MWUA 5DE2A 5DN3A 2ETRA 4E6QA 1Q4LA 3A61A 3OBJA 4AOJA 4F9WA 5LVMA 4CT1A 2RFNA 4ZTLA 4FEXA 1BUHA 4ZP5A 4U6RA 3OC1A 4QD6A 3MFRA 2J0LA 1QPEA 4CMTA 5DFPA 3IQ7A 3KMWA 5EOLA 3HZTA 4FV7A 3ZFXA 5DGZA 3ZRLA 4EK5A 4WUAA 3BX5A 1U4DA 4OTPA 1KV1A 3PXFA 5HNBA 4TYJA 2OJJA 4FV9A 2J0KA 4P4CA 5HLPA 4FVRA 1KE7A 3H10A 4M69A 4UALA 3BE9A 4U44A 4X7QA 4JR3A 5CSWA 1J7UA 1CMKE 4ANNA 5HD4A 3QHWA 3FSFA 4IDVA 2V0DA 2C3IB 2IZSA 4EWHA 5AAFA 3P0MA 3QYZA 4MBLA 3HP5A 4MAOA 5D41A 1PYXA 5E90A 1PMUA 4PMTA 1J91A 3BLAA 4BYJA 5E8SA 1H1SA 3HAMA 3O7LB 2R3MA 4LV8A 3VBWA 2CN8A 4RJ4A 4JAIA 2YCSA 2C6DA 3N51A 1KWPA 5L2SA 1W98A 3TWJA 3HA8A 3I60A 3KB7A 4ACHA 5AR7A 4DG3E 1AQ1A 5AP3A 3VBTA 2V7OA 5BYZA 2RKUA 2ITXA 2PZYA 3D5XA 4IVDA 3SD0A 3U87A 4MD9E 2GQSA 4I24A 4C3PA 2BAQA 3KRXA 1IG1A 4O0YA 3DBCA 5FWKK 5HBHA 1PXNA 3RK7A 4GT3A 3BHUA 2I40A 4QMTA 4CZTA 4ZSEA 3QBNA 3KRRA 4RC4A 3PUPA 3TNWA 4A9TA 4DFYA 3UYTA 3D2KA 2BAJA 2J6MA 3F3WA 2VTMA 4C4IA 5ITAA 4AZWA 4YZNA 5LCKA 3SGCA 3HMMA 1H1QA 3NW5A 3ERKA 5HTCA 5HE3A 3RWQA 1YHWA 4G3DA 4MVFA 3UGCA 2NO3A 4D58A 2BDFA 4L7FA 2GTNA 3R63A 3CS9A 4KS8A 4AUAA 3AC3A 3A60A 1PMVA 2UZOA 3C5UA 4YZMA 4USFA 4TYGA 1UV5A 3C4XA 3AKJA 3AKLA 3CKXA 4ZK5A 3W18A 3A8WA 3L9NA 3D7ZA 2BRMA 3GQIA 3NMUF 2NRUA 4QPSA 5J7BA 3CCNA 5AUVA 2PVRA 3BYUA 2BRGA 4QP3A 2WXVA 2J51A 3RHKA 2CCIA 3OFMA 3FDNA 5TKDA 3PA3A 1JLUE 4WHZA 2B4SB 3CJFA 1IR3A 3Q9YA 4UMQA 2BFXA 4BBMA 5KCVA 2Z7LA 3NUAA 3TEIA 4Y73A 5IPJA 5GINE 5EI6A 4CTCA 1V0PA 5KMNA 5CI7A 3FYKX 3F5GA 4W8DA 3DTWA 3DOGA 3T8OA 2OH4A 3F3ZA 3VIDA 4IC7A 4RIOA 3EYGA 3VUMA 4C8BA 2I1MA 2R3JA 3IW8A 4NKSA 4PNIA 4MXOA 5HU9A 4YTHA 3D15A 3TN8A 3DJ7A 3P08A 4QTAA 2C69A 4Y72A 5AR4A 5ACKA 4EH4A 4I6QA 4F64A 4RLLA 4DH3A 1XMMA 3O8PA 4AQCA 4EH7A 2W1FA 4FR4A 3VO3A 1I44A 5JZNA 3HV5A 2XJ2A 3PVWA 3NUNA 3QU0A 4BDGA 3FXWA 2JFMA 4RFMA 5HU3A 2OKRA 2PWLA 3DV3A 3VRZA 4DGLC 5IQAA 2DS1A 5CAVA 5IEYA 3JS2A 1VJYA 2XVDA 2PULA 1GZ8A 4JBOA 3ODZX 4QPMA 2OXDA 3VS2A 2XIKA 1Q99A 4I22A 1DI9A 4JT3A 2UZVA 1YRPA 3WIKA 3W0SA 2YCQA 4KSQA 3EQCA 2XNPA 3WZKA 1ST4A 4ZJIA 4AAAA 3OG7A 5I9UA 3QQJA 4KUJA 2JGZA 3QQKA 3QD0A 5FRIA 4QTEA 4BZOA 4J1RA 5FG8A 2JD5A 3QQLA 4EHEA 5ANJA 5AA9A 1YDRE 4RPVA 5CXHA 4W4XA 4HPUE 2PU8A 3FZOA 3DNDA 5DEWA 3UYSA 3PJ2A 4WNMA 4JDHA 3Q04A 4KKHA 4U97A 2VX3A 4O0RA 1PHKA 4PF4A 1U5RA 3FLQA 1Q97A 2X8IA 3WF5A 4BCFA 4I41A 2Z7SA 3DBDA 3R1SA 2XJ0A 4FIFA 4BCIA 1SVEA 3CEKA 2WD1A 3VS7A 3A8XA 3R71A 4JX7A 4FE2A 3LPBA 3P23A 1KE5A 3PXZA 3T9TA 3C1XA 1A48A 4ACDA 2R3LA 5BVKA 5DPVA 1H4LA 4DTBA 2CHLA 3OOGA 4WG3A 3MTFA 3OWPA 3PZHA 2AYPA 2GNIA 2PVFA 4C33A 4C4JA 2W1HA 4H3PA 4D2PA 4UWCA 3HA6A 2E2BA 5J1VA 1OL2A 1OL5A 1Q8UA 3F61A 4RRVA 4IX6A 4DLIA 1U46A 4KIKB 4F9AA 5FM2A 4Q5HA 4ENYA 5HE2A 3Q4ZA 3MBLA 5CLPA 3OZ6A 1Q8ZA 2UW6A 4JI9A 3ENHA 3VNTA 4FTOA 2C6KA 4FV8A 1ZYLA 4RFYA 5E1EA 4ANBA 4X2GA 3FLYA 4XUFA 3VUKA 3RPVA 4Z7GA 4QYHA 1P4FA 5E8ZA 2V7AA 5DIAA 2QO9A 3PWYA 2YIXA 3H9RA 5LWMA 4CCBA 5BX0A 1BKXA 3FYJX 4DA5A 3D2IA 3KY2A 4HYSA 4JDIA 2GDOA 4JLCA 3UQCA 3NW7A 4L42A 2QKRA 3SV0A 5IEVA 2W5BA 3VBXA 1M2PA 3CXWA 4DHJA 4XG7A 2PVYA 3F66A 3G6HA 4YHTA 3PJ1A 2G01A 5IMXA 4EOLA 3U8WA 1UNLA 3LZBA 4IX5A 4NCTA 4FV3A 4RLKA 2YDIA 4PP7A 2WTKC 1WBNA 4BCGA 2CGXA 2J2IB 3BYSA 3HNGA 1YI3A 5L8KA 4IWQA 2QLQA 2C68A 3HMIA 3ORPA 1PJKA 5KZIA 3UMXA 3KFAA 4O0SA 4ERKA 4E93A 4LGHA 2C0OA 2F7ZE 5CNNA 1ZZLA 4FZ6A 2VTPA 2B53A 4CV9A 3W1FA 3F69A 3MH2A 4M0YA 3FE3A 4GK4A 4LRKA 3RZFA 3F5XA 1B39A 2WQMA 5CY3A 5ANKA 5HD7A 1Q8WA 4I6HA 4BCPA 1FVTA 5CU0A 3WF7A 3VS5A 5J5SA 5KMJA 4LV7A 3ORLA 1YXTA 4FV2A 4DHIB 4RIYB 1VEBA 5J9LA 2YLFA 3VUTA 3C4WA 4KWPA 2EUFB 3RPYA 1EH4A 4IAZA 3R22A 1M2QA 3I0QA 5FQDC 2P4IA 1U54A 1TVOA 3ENMA 3Q5ZA 4NUSA 4XG2A 5IZFA 4U3YA 2HXQA 1L3RE 4AA5A 1PW2A 2HOGA 5JGDA 4MH7A 4MQ2A 4D9UA 2VX1A 3GENA 4F6UA 3VQUA 2CGWA 4LOPA 1H08A 4KKEA 4WIHA 4EHZA 1Q3WA 3DXNA 3CPBA 1OITA 4GCJA 5AR3A 3PPZA 4YC8A 5JQ8A 3NCGA 5J87A 2Y6OA 3OCGA 3QAME 4L6QA 2R7BA 3V8WA 1Y6AA 2RF9A 3UOJA 3KN5A 5KNJA 3V5JA 4II5A 3R8MA 1LUFA 4TYHA 2QODA 4WKQA 4J53A 1J7LA 4OLIA 4PDOA 2WIHA 4O84A 5JZJA 5AUUA 4V0GA 3GU7A 3KXXA 3QA8A 5J9YA 1XHAA 5I9VA 4R3RA 4MNFA 4J97A 3E88A 3UPXA 2VTTA 4AN9A 4EH2A 2UW0A 3C0HA 3LXPA 4DITA 2X7GA 3LQ3A 2JIIA 4KBKA 3F7WA 1Q5KA 4Q2AA 3RNYA 2VWWA 4EEVA 4QTCA 3ETAA 2YM3A 4KNBA 4HVHA 1OKWA 1P2AA 5HQ0A 3NW6A 4C4GA 3MJ2A 2BAKA 5IISA 4IC8A 5HO8A 4XG8A 4F0FA 4K8AA 3RAHA 4AXEA 3AG9A 5A4QA 4GIHA 4JRVA 5GJGA 1TKIA 3AC5A 4QMUA 3UZPA 3W8LA 3QRIA 3AC1A 5AA8A 2J9MA 5M06A 4AZEA 3HV3A 4NKAA 5JGBA 3DKFA 3MGYA 3MA3A 1CTPE 4K77A 4FZ7A 3ORXA 2Z8CA 4E4MA 5IUHA 4EI4A 4FT3A 4G3FA 4F9YA 2R3QA 4JL9A 3DKGA 3UC4A 4KABA 4O96A 5AV2A 3GEQA 4IADA 2BKKA 1M52A 2F49A 1FMOE 3QQGA 3PLSA 3SAYA 2OFUA 2REIA 1OKZA 3NUXA 2YITA 4IFGA 4P5QA 4EQMA 4HNIA 4RIXA 2B52A 2RL5A 3QRKA 4FSZA 3ZLWA 3UOLA 5IDPA 5JQ5A 1H0WA 3LMIA 3LLAA 5IH5A 3LCSA 4UMTA 1ZXEA 4J8NA 4EK3A 5KMLA 4F70A 3QZHA 3FQEA 1PRYA 4P90A 2XNEA 3ZXZA 4EK6A 4APPA 4ZTQA 1YDTE 3DFAA 3VUGA 3HMNA 4X3FA 1VR2A 3MTLA 3A4OX 2OJ9A 4IEBA 4A9RA 4IANA 3I79A 5AUYA 3WZJA 1MRYA 1PXMA 4QMWA 2VO3A 1HOWA 3DPKA 4FV0A 4PTEA 5K5NA 1OKVA 3PA5A 2O8YA 3PG1A 3GB2A 4BICA 2H34A 1E1XA 4OGRA 3U4WA 5HTIA 5EW3A 2KULA 3BWJA 3RAWA 3UJGA 4K18A 4PUZA 4GFGA 4YGAA 4O6EA 5BMMA 4OUCA 5C8NA 4EJ7A 5F95A 5F9EA 4ZSJA 4QMMA 5IH4A 3ZEWA 2R5TA 1YOMA 3MY1A 2XKCA 3KQ7A 3OWKA 2RSVA 3Q60A 5A4CA 1U59A 3CIKA 4Y83A 3VS6A 5HEZA 4F7LA 2HELA 3Q2JA 4EJNA 4MNEB 1H01A 3MS9A 3B2TA 5LMAA 3ATSA 5F94A 5EW8A 1JQHA 2XBAA 4FTMA 3LFDA 2EB3A 4CFVA 2G2HA 2JIUA 4FG8A 4C0TA 2WELA 4RX8A 4U79A 3W2PA 3O0GA 5M4IA 4EQCA 4WNKA 1OGUA 4UB7A 2A27A 4XYFA 3P9JA 2ITNA 5D7AA 2GHMA 1OIUA 3DJ5A 3PJ8A 4ONAA 2WNTA 2PUPA 4AA4A 5JFVA 4QYEA 5IQIA 3L8VA 2YM7A 3A62A 4A07A 4DGNA 2W5AA 2WEVA 2WMQA 3QWKA 5HIEA 3BV3A 4ZS0A 2CDZA 3HECA 3LM5A 1XJDA 3HUBA 3LFSA 3TNHA 2PVMA 3TUCA 5IQBA 5CEPA 3LFEA 3FI3A 2XALA 2XP2A 3E7OA 3DZQA 4FIIA 4R7IA 1GY3A 5M55A 3UE4A 3ZO3A 5E4HA 2ZV8A 5TOZA 2QOCA 4ACMA 2PZRA 1H28A 2X0OA 4DEEA 4MD7E 5D1JA 4H1JA 1JOWB 3F82A 3S4QA 3ZO1A 5I9WA 4XP3A 3I4BA 2ZM3A 3R2BA 1BL7A 5J95A 4ZY6A 4ZEGA 3P7AA 4L8MA 5IEXA 3L1SA 3U9CA 4FBXA 2PYWA 3LOKA 2XRUA 4C3FA 3BIZA 4PL4A 2YN8A 1GJOA 3CKWA 4NSTA 2WTDA 4UYNA 2C5VA 4XV3A 3ZEPA 1Y8YA 3MIAA 4BCKA 5CQWA 3GCPA 3KMUA 5HORA 3QQUA 4OT6A 4D1XA 3TKHA 2VTNA 3SW4A 3MB6A 3NCZA 4I93A 3QTUA 3BGPA 2XKFA 4YBKA 4AZTA 3C51A 4CFWA 4DHFA 1QMZA 3FI4A 5IQEA 4OAVB 3BKBA 3R8UA 5JGAA 3R02A 3EN6A 4JG7A 2FA2A 3OVVA 1JBPE 4JRNA 4E6AA 1OL7A 4ZZNA 3K5UA 4NW5A 1IAJA 3N4UA 3A7FA 4QTBA 5AADA 2YJRA 2UW9A 3LQ5A 2QO7A 4MBJA 4AOTA 3F5PA 4C38A 4FGRA 4BJJA 1HCLA 2YEXA 3K54A 5IUIA 3GC7A 4JQ8A 4DEHA 3SW7A 1KE8A 2WQEA 3LW0A 2V22A 3HX4A 4ZLYA 5EM6A 2PZIA 1Z5MA 4FKWA 2QHNA 5ETAA 4D0WA 1T45A 4AZVA 1ZYDA 3KA0A 3ROCA 5CF5A 4EZ7A 5JSMA 2VD5A 4YHFA 2O3PA 4NU1A 3TG1A 3B8QA 4XLVA 4UYAA 4XV1A 4HGSA 4KD1A 4ACCA 2W99B 1YW2A 3TZ9A 4FKPA 4J71A 4NM5A 5CSHA 5A9UA 5BUIA 4FYOA 3TZ7A 4RC3A 3PXRA 4ZIMA 4WG4A 2IZUA 3BU5A 3GU6A 3I0OA 4MF1A 4AF3A 4L43A 4FV4A 5FGKA 2WKMA 2XK3A 2Z60A 3AGLA 4U5JA 4XS2A 4GV1A 4O38A 3HV6A 5ANDA 3R7OA 3QTIA 3PIZA 5BVOA 5J5TA 3GOPA 4FL1A 4FKIA 1SVGA 4JG8A 5J8IA 4E4LA 3ID6C 2R2PA 3PSBA 4O86A 5CVGA 4BTMA 4N70A 4OTWA 5LVOA 4DT8A 1ZLTA 2C1AA 3R01A 3L9PA 3MSSA 2UW4A 4AZFA 5CTPA 4U0IA 3I5ZA 5EI8A 2BZHB 2ERZE 2QO2A 1PXPA 2C5YA 2FGIA 3Q5IA 2H9VA 3BEGA 2WTIA 5FBNC 3W2RA 3SRVA 2H96A 3Q3BA 2Y4PA 4PNKA 4I5MA 3VS4A 3E5AA 3KF4A 4QT1A 4PPBA 3HLLA 2E9OA 5D10A 3LFAA 1OB3A 3LXNA 4FODA 1CKPA 4OTGA 3HRFA 4E7WA 5CENA 4AX8A 2SRCA 2B9JA 2QOQA 3D7TB 4EH8A 4G2FA 1M17A 3FPQA 4IX3A 4U41A 1QPCA 1YQJA 4LG4A 4BWXA 4WNPA 1U5QA 3R1QA 2J5EA 3Q52A 4CLIA 4DFXE 3TJCA 5LWNA 3CQWA 4O7TA 3ULIA 4FUYA 1BI7A 4D55A 4DFBA 1LP4A 4WBBB 3Q4UA 2UVZA 1XMLA 3LVPA 4BGGA 3ZLXA 1JVPP 4M97A 4DBXA 5A54A 4GEOA 3BGQA 3FMDA 3HKOA 4AW5A 4N57A 2CLXA 2YAKA 3U6JA 2OIDA 4ASEA 3FQHA 2QG5A 4JS8A 1GZOA 2Q0BA 3UPZA 1K3AA 5HBEA 3PY1A 4C59A 5DHJA 2IEWA 2VWBA 3A4PA 5AX9A 2YABA 4BKJA 4C4EA 2XIXA 4G6OA 2B1PA 3HRCA 2UZDA 3CQUA 3OWLA 3QLGA 4RJ3A 3EMGA 3ORNA 3QUEA 3POZA 1DM2A 4Y5HA 2BALA 2XJ1A 3GOKA 3LMGA 3Q4TA 4JXFA 4BWKA 4EYMA 3UDTA 3QRTA 3R73A 4KSPA 5EQPA 4W8EA 3NUSA 3KGAA 3NUUA 3DK7A 4AT5A 1Z9XA 1ERKA 4FX3A 4FF8A 4BKYA 4ZMFA 5GJDA 2G9XA 4EZ3A 2JAVA 2UVYA 3FHIA 5CZIA 5D12A 1M7QA 2ERKA 4RWJA 2C6LA 3DAKA 2XK8A 3OF0A 4NFMA 4R1YA 4WRSA 5H2UA 4RJ8A 4PX6A 2EVAA 3QKLA 3JPVA 3V8SA 1BYGA 4ZOGA 3MA6A 4J8MA 3A7GA 5HNGA 3EN9A 4BC6A 4DLJA 2CKQA 1REKA 4R78A 2I0YA 2I6LA 4GKHA 3DKCA 4NH1A 2R9SA 3Q32A 2R0IA 4C4FA 3QHRA 4KA3A 3UQFA 4Z7HA 2ZOQA 3IW6A 4IB5A 3Q9XA 3TT0A 2BRBA 3WZUA 2X39A 2XK9A 1ZY4A 4GJ2A 5A4LA 4QP6A 4GT4A 1YWNA 3ALNA 5CSPA 3DBQA 4KINA 2YAAA 3TDWA 4QTDA 4QDVA 5AUWA 2Y8OA 2NP8A 3BRBA 2VTIA 3GC0A 5KHWA 2ZFYA 2QU6A 1B38A 4UZDA 5CEKA 5K3YA 4G9RA 3S1HA 5A3XA 4TWNA 5BVFA 4GU6A 1YVJA 3LE6A 5CVHA 2QOIA 4M66A 3C13A 4BDAA 4YTCA 3FBVA 3NFGB 3C7QA 2PL0A 4GVAA 1UVRA 4OTIA 1VZOA 4UWBA 4G3CA 3VS3A 4ZSAA 2ZB1A 4LRMA 5AJQA 4OTQA 3AT4A 1XWSA 4P2KA 4O7ZA 3JY9A 5AP2A 4DDIA 2CMWA 3ZRKA 3MESA 4U8ZA 3ZM9A 5CASA 2C6OA 1WVYA 4FKLA 1WBWA 3TTIA 1WBVA 3PG3A 3BV2A 2B9FA 1GIHA 5C27A 5HG8A 4AA0A 2OF2A 3SG9A 3VW8A 1ZOHA 4XOYA 2R4BA 4OBPA 2XF0A 4RA5A 3ZC5A 5HCXA 4YJQA 1UKHA 1H8FA 2GTMA 4FZAB 4LDTA 3BLQA 1H1PA 2BFYA 3NEWA 4D2SA 4F7SA 3OROA 3P7CA 2P0CA 5AEPA 2IG7A 4MXXA 4C57A 4D4SA 3BL9A 1IEPA 1G5SA 4CFNA 2WMXA 3G5DA 4IH8A 5T6KA 2E9NA 5E7RA 4FTUA 5CX9A 4AWIA 4BVUA 3LMHA 4H3QA 3KMMA 4DBNA 2OO8X 2W7XA 1SNUA 2GNJA 4O0WA 3FC1X 3A7HA 5AP5A 2R3FA 3DY7A 2UUEA 4NJDA 4WO5A 3COMA 5HHWA 5KUPA 2GCDA 2PMOX 2EXCX 5E8UA 3UQGA 1XR1A 3KRWA 4MXZA 3UG1A 4AT3A 5BVNA 2XAOA 3PUFC 3FY0A 4V0GB 2YCRA 5M07A 5GHVA 1GNGA 3O96A 5M56A 2X8EA 3FI8A 3OUNB 3COKA 4IQ6A 5HCZA 4QMXA 2Y4IB 3S00A 2E9PA 3CPCA 4QQTA 3W0NA 4D2VA 4TT7A 3JVRA 5F20A 3R8LA 2B54A 5HNIX 1WFCA 2JITA 5ANIA 3QXOA 4D5HA 2JDRA 2R3HA 4DCAA 4FSMA 4YU2A 1Q62A 4CV8A 2W1CA 3N4VA 2OIQA 3QD4A 2UV2A 3R30A 4JBPA 5K0KA 2FVDA 4B0GA 3QXPA 4UN0C 4P7EA 4G6LA 4EH5A 5AP4A 2WZJA 3PVGA 3PXKA 3NVMB 3G33A 5CYIA 3G6GA 4DC2A 3OCSA 2QI8A 4R6VA 4RG0A 1JKLA 1B6CB 2A0CX 2JAMA 3H3CA 3P1AA 1ND4A 4ZY4A 4FKOA 3RNIA 5EHLA 1W0XC 4NJ3A 1ZRZA 5AP7A 4HNFA 1WBTA 2BIYA 3VJOA 2VWVA 3EFWA 2HY0A 2VTQA 4IM3A 5I3OA 4PPCA 4IVCA 1KOBA 3ZBXA 4IW0A 4X2FA 1YOLA 1YOJA 3BU6A 4FNXA 3RVGA 3UG2A 1XH7A 2WB8A 4XG3A 3LFQA 1G3NA 3VF9A 4RIXB 3K3JA 2PPQA 2F7EE 2YJSA 3UIMA 3S0OA 4BDFA 4FZDB 3EZVA 4C58A 3SVVA 2XCKA 2CKEA 4ALUA 4ARKA 5I9YA 2XYUA 3IONA 4EOSA 5T68A 4ZJJA 1UU8A 5IA5A 1STCE 4O4CA 3C4EA 3RPSA 4Q9ZA 4G16A 5HESA 4NM0A 4C02A 4N4SA 4X3FB 5CF8A 4L7SA 2W9ZB 3TXOA 5CAQA 2OICA 5JN2A 3EQFA 3OP5A 4Y46A 4IZYA 2EWAA 4E73A 3DS6A 2FYSA 2C5NA 4I4FA 4YPDA 2JLDA 5AUZA 3ODYX 4RWKA 3JY0A 4YJUA 4CLJA 4NL0A 3LM0A 4RA4A 4C2WA 3O7LD 4J98A 1R0PA 3QQHA 4I6BA 2R64A 4JG6A 3LXLA 4BCOA 4FKJA 1SYKA 4XP0A 2VGPA 3ZM4A 2GHGA 3SXRA 4I0TA 1J1CA 3PY0A 3PXQA 4LI5A 4CYIA 4AE9A 2GU8A 3EQRA 3IG7A 3IK3A 3OHTA 4MXAA 5FXQA 4E5AX 4Z3VA 3BI6A 4AXFA 4YO4A 3H30A 1YDSE 4FV1A 3VF8A 2IW9A 2XIRA 2F2CB 4PV0A 4AT4A 1FMKA 3KN6A 4W9WA 3R0TA 4XRLA 3UVRA 2F2UA 3PRIA 5CWZA 5HX8A 2WQBA 2BZJA 3ZHPC 2HENA 1UU9A 3BQRA 4A9YA 1F0QA 3CSVA 3HEGA 4I0RA 3VULA 5DRBA 2OH0E 2IN6A 4E6CA 4USDA 4LGDA 4BDJA 3ZONA 3TCPA 4WUNA 5J79A 5CEQA 5TT7A 4CVAA 4K9YA 5FEDA 4F1MA 4S34A 3RK5A 3NYXA 4NZWB 5CU2A 2QCSA 2Q0NA 4IM2A 4XCUA 4YLJA 4BCHA 1NA7A 4EK8A 1A9UA 4JIAA 4RVKA 3QFVA 2Y7JA 4OAUC 5IQCA 4DCEA 5ACBC 3W2CA 5AIRA 3HDMA 5ANGA 3UZRA 4GIIA 4C35A 4M3QA 4D2WA 2ZB0A 5K5XA 2CGVA 4GMYA 4O1OA 4YJSA 3QALE 4FNWA 4U9AA 3CY2A 3V5QA 3W8QA 4EH9A 2LAVA 4YMJA 2OZAB 2X6EA 4Z9LA 5E92A 4FSQA 3AC2A 2XMYA 4F65A 4FKUA 2CNQA 3GBZA 5LMBA 5KBQA 4EOIA 1CKIA 3QTRA 4I5PA 3GC9A 5AP0A 4JQEA 4EUTA 4B8MA 1OVEA 1VLRA 4BHNA 3BL7A 5BVEA 4RWIA 2QNJA 3OS3A 2VGOA 3KXHA 3QZFA 4IB0A 4H05A 4MHAA 2R3IA 1XH8A 4IIRA 3HMPA 4ZSGA 4EOJA 5KMOA 2QR8A 3VW6A 4D28A 4GT5A 4ZZOA 2X6DA 2HZ4A 3LQ8A 2XNOA 3W16A 5ICPA 5KE0A 4O7RA 4U7ZA 1O6KA 1K9AA 4IHPA 4JIKA 4UMRA 2IO6A 3TNPC 4YUQA 3QGYA 4XBRA 4BI2A 5I9XA 3S2PA 5F4NA 3KULB 4BDCA 3EN4A 3QZGA 4AU8A 4F9BA 3TYKA 2XNMA 3SOCA 3UDBA 4F6SA 3AGMA 3HGKA 4AN3A 3DA6A 4D2TA 5A4TA 2ZDTA 3ACJA 5FP5A 3RI1A 4BHZA 1CSNA 3UDZA 2XYNA 4XH6A 4EOQA 3GCUA 4F4PA 2BHHA 3FMKA 4G17A 4RJ5A 3E92A 3FUPA 4IM0A 3C0GA 3ANQA 3KXMA 4YJTA 4E6DA 2W1EA 3UO4A 4YJVA 3FLZA 4CG9A 3B8RA 4TWCA 3NRMA 4I6FA 4QYFA 2HW7A 5JRQA 4D1ZA 3NZ0A 2ZV7A 3TTJA 4F7JA 4USEA 1M7NA 2YFXA 5IA3A 3EOCA 4KRCA 2OLCA 1S9IA 2C6EA 3P79A 3QCSA 2R0UA 4IWDA 2VU3A 3EKNA 3HL7A 4BIBA 4F0GA 2ZMCA 4JR7A 5IF1A 3U6IA 2V5QA 5CEIA 4D1SA 1JSUA 2QKWB