3W1FA

Crystal structure of human mps1 catalytic domain in complex with 5-(5-ethoxy-6-(1-methyl-1h-pyrazol-4-yl)-1h-indazol-3-yl)-2-methylbenzenesulfonamide
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
280
structure length
259
Chain Sequence
ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Indazole-based potent and cell-active Mps1 kinase inhibitors: rational design from pan-kinase inhibitor anthrapyrazolone (SP600125)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Dual specificity protein kinase TTK
total genus 70
structure length 259
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3w1fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w1fA01
1U54B 3CGFA 3T9TA 4B99A 3NMUF 3D9VA 1IASA 5KZIA 3TKUA 4DT9A 4EJ7A 1CMKE 5IQEA 4MNEB 3FPMA 3RWPA 4C33A 4IAIA 5FP5A 5GIPE 3VUDA 3KREA 2GNGA 3RK7A 4O96A 4H36A 3OCBA 2QD9A 2OXYA 4MD9E 4U5JA 4AP7A 2ETKA 3PE1A 3L9NA 4MD8E 3ZBFA 4EKKA 2VTTA 2RL5A 3BHUA 3Q96A 4PDSA 4RX8A 3RHKA 3SC1A 3EQFA 1JWHA 3QQHA 3MWUA 4F08A 1J7UA 5DR6A 4XV3A 4GIHA 3BYUA 2OFVA 3AMAA 3IGOA 4AFJA 4W4VA 5CNOA 2YWPA 3GFWA 5DVRA 4ZXTA 4D28A 2J90A 2W5BA 4GU9A 4QPMA 3LAUA 2J5FA 4A7CA 4BIDA 5AX3A 4EH5A 4F9AA 5I9VA 5JMSA 4RLKA 3QA8A 5AIRA 4FG7A 4B0GA 4D4VA 3EYHA 4EHZA 2ONLC 3OTVA 5FDXA 4FTUA 2XF0A 4I41A 5FXSA 4OTWA 4XRJA 5ACKA 2YAAA 1LEWA 1H28A 3COIA 2IVUA 3QC4A 1IRKA 1CKJA 1OL6A 2R7BA 4YO6A 4AAAA 5AP4A 3W8QA 4F0IA 3OW3A 2P4IA 4FV1A 3DDQA 3I5ZA 2F2UA 3NIEA 4RVMA 2A27A 4DH1A 3UOJA 4G3FA 2BTRA 2WHBA 4IEBA 3Q52A 3W10A 2RGPA 4EYMA 5DYJA 3GVUA 3UP2A 3CPBA 5D41A 2Z7SA 4L3PA 2R3FA 4MAOA 5BVDA 2XK3A 3AOXA 3E7OA 2R3NA 2VO7A 4D1ZA 2FGIA 4N0SA 5JRSA 2A2AA 3T3UA 3NNWA 4FSYA 5LMBA 5EQYA 2VTLA 3PPJA 4BZDA 3VHKA 3GNIB 4FTQA 4OAUC 2BMCA 2I40A 3OT3A 2EB3A 3TKHA 3ZLSA 2C6KA 2P3GX 3HDMA 4FTOA 1QMZA 3UQGA 2ZMCA 3V8WA 4ANBA 4BTKA 5ITAA 4AE9A 3A62A 4OGRA 4QNYA 5DRDA 2SRCA 4I21A 4FIGA 4G3DA 2WAJA 4MBIA 3LJ2A 3QAME 4RFZA 3VUHA 3VS0A 3ZO3A 4ALVA 2IG7A 4FZFB 3VJOA 4F65A 2CKPA 2GSFA 3KN5A 2GNFA 4GCJA 3W8LA 5J8IA 4K2RA 2GNJA 3MS9A 1Y8YA 3QD3A 3THBA 2VX3A 3U54A 5LOHA 4UZDA 2OF2A 3U8WA 2PMLX 1H1RA 2C6MA 2W5HA 3KEXA 2ITOA 5EQPA 1WBPA 3MV5A 4U97A 4TYIA 5JRQA 2QOLA 3R8VA 3IECA 3R01A 4FYNA 1G3NA 3UODA 3Q9XA 3OTUA 5JK3A 4QYYA 2Y0AA 4P5QA 2YM8A 4TWOA 1WVWA 2GFCA 2EUFB 3JVSA 2PUNA 3LFDA 2A1AB 2A0CX 1KE8A 4O38A 3EFWA 3CSVA 4APPA 4DH7A 1IAHA 1KOBA 3FV8A 3HEGA 3MBLA 4W8EA 4UEUA 2FVDA 3KL8A 3LFSA 3P78A 4J97A 3KA0A 2WKMA 1GZKA 1A9UA 4BCJA 3B2WA 3W55A 4NW6A 3GC8A 3Q53A 4TNDA 5AR7A 3PE2A 4IWPA 1OUKA 5AJQA 2GU8A 3PJCA 2IZSA 3ZSGA 4FODA 4WNPA 3ZH8A 2IW8A 2YJSA 3HMIA 4ZAUA 3CQEA 1PMNA 3ORZA 5BVWA 4AT5A 4IVAA 3N4UA 4EQMA 2BTSA 4M69A 4LV5A 3E3PA 4DYMA 3LFEA 3PXRA 2PUUA 4QP4A 4CSVA 1YW2A 2UZBA 3JY9A 3EOCA 4U3YA 5L8LA 1XH4A 3D2KA 4B9DA 4CXAA 3OBJA 3FZOA 3R00A 3UQFA 5FM3A 2VX1A 2WMSA 2BFYA 5DE2A 3A7IA 4YO4A 4W4WA 2VO0A 5HG8A 4PQNA 3V51A 1NW1A 1KE7A 2YEXA 1FVVA 2VWUA 4B7TA 3F2AA 4BHNA 4PPBA 3LMHA 3WF7A 5A3XA 1SVEA 4KABA 2IVVA 3P79A 4AFEA 4O22A 3E63A 4KWPA 1JLUE 3R02A 5IZFA 3HECA 2PE0A 2RFDA 3FLQA 4E7WA 3D0EA 2UW3A 5FG8A 5T68A 3R8UA 4C38A 4LYNA 3A60A 4DG2E 1W84A 1Z9XA 3R7YA 4YC6A 4C4HA 3Q5IA 3NIZA 3NYVA 5BVEA 4BDEA 5CASA 2R0IA 3FZTA 3LHJA 3QF9A 4EK8A 3WI6A 1XQZA 1M2PA 3P7BA 4W4XA 3RPVA 3ZOSA 5LCJA 3PJ2A 3R0TA 5JEBA 1Y91A 2RFEA 4XP3A 4YJRA 1H08A 5FEDA 5LMKC 3EWHA 3IW6A 4X6QC 5EW3A 4AW2A 5BYLA 5FXQA 3VN9A 5EDQA 3OOMA 4RJ3A 1XH8A 1CSNA 2OFUA 4I20A 1H01A 1WCCA 3KY2A 2GNIA 1T46A 3UC4A 3VF9A 1CTPE 4ZLZA 1S9IA 2HW7A 3JPVA 5J7HA 5AR5A 1IA9A 2I0VA 4FIFA 4DEDA 3C51A 4MXCA 4FKQA 4U43A 3MI9A 5I0BA 3R6XA 3BBTB 3MPTA 3DFCB 3GC9A 4I5PA 5D10A 3BLHA 1UVRA 4MEDA 1WBSA 3OWKA 3TWJA 2W4KA 4EOSA 3H0YA 3U6IA 5A14A 5BX0A 3W33A 5M08A 3I6WA 2PVNA 4A06A 5D7AA 1OVEA 2P33A 3COMA 3C5UA 2CGUA 3VS3A 5E8SA 4J96A 3ZMMA 4WNMA 5A4CA 4GT3A 4FKUA 3QRKA 4FX3A 4JQ8A 4YJOA 5E8YA 3TJCA 3CR0A 3QFVA 3O8UA 3VUMA 4WD5A 5M57A 3QD2B 3LJ1A 2W9FB 5IDNA 3NNVA 3MYGA 4KBAA 4DGGA 3NYNA 3F2RA 3BYSA 4EOJA 5GJDA 3VRYA 4B8LA 4BBEA 3GU8A 3DK6A 3EN4A 4K8AA 5A46A 4CGAA 1X8BA 3EFJA 4FTKA 3FYJX 5EHYA 4S30A 3R9OA 3HV4A 3NNXA 2BPMA 1CKPA 4GK2A 2X81A 5AUTA 4GK4A 2PVJA 3QL8A 1HCKA 5EYCA 1J1CA 4FA2A 5KBQA 4O0TA 3G9LX 3H0ZA 4JG6A 4P90A 4X0MA 4FKJA 4AOIA 5G6VA 5IU2A 1BL6A 4CKRA 4F7JA 5FEEA 4GS6A 4BIEA 3HL7A 4F64A 3N4VA 4YC3A 4PPCA 4O2PA 5C26A 2XM8A 3QQKA 4FT3A 4EHVA 5IQBA 2OO8X 4PPAA 3A4PA 5EHOA 2OXXA 4PRJA 3MTFA 3PXQA 3R9HA 2QU5A 3AMBA 5CEQA 4FVRA 4ZS4A 4IZ7A 1BUHA 2JEDA 4AA0A 5M06A 3BEAA 3U87A 2QG7A 4U80A 4XUFA 4IX6A 1Z5MA 5CALA 5C8MA 3RJCA 4QQCA 4O86A 3RAIA 3LM0A 4D0WA 4FV4A 5AUXA 4EWHA 3ORPA 4FNZA 4WRSA 4FTIA 4AGUA 3R1YA 5IQIA 4KIPA 3L9LA 4CTBA 4M67A 4WRGA 4BHZA 3MJ2A 3QHWA 2JDSA 3NCZA 1OIUA 4P4CA 5KE0A 1U54A 5BNJA 5LVMA 1FGIA 2PYWA 4FF8A 1DM2A 4ZJJA 4B6LA 3VRZA 3D83A 5HOAA 4Z7HA 3LMIA 1H27A 4LQMA 3TM0A 2C5NA 2XA4A 5L2QA 5F1ZA 4BCOA 2F57A 4DINA 3F7ZA 5KMOA 3DPKA 4O1PA 4UMRA 5HIEA 4HVDA 3HVCA 3Q6WA 2OIDA 4RIXA 3H4JA 2UZTA 4BDAA 5GZ8A 2QC6A 1M52A 2YM4A 4FV5A 3L8PA 5EW9A 4AF3A 3MFRA 3UJGA 2XNEA 3IG7A 4FV6A 4KKGA 2ZB1A 3VBTA 3ZZWA 2WEIA 4NZWB 3GCPA 5HU3A 3A2CA 5DFPA 2W1ZA 3HUBA 2CN5A 4GL9A 1M14A 4I23A 4QYEA 4WBBB 4CFUA 5IEYA 1MQ4A 3COKA 3ZEWA 3K54A 3KXMA 2XIXA 5KMLA 3QUPA 1QPCA 2UVYA 4TT7A 3F5PA 3OCSA 4OTRA 5EM8A 2UZUE 3MTLA 3BIZA 3MB6A 4NTTA 3PWYA 4IQ6A 3DNDA 2LGCA 4TW9A 4ASEA 4DH3A 5HCYA 4ONAA 4BC6A 4CFXA 4YTCA 5CU0A 3EJ1A 5DT3A 2GDOA 3QX2A 4IZAA 5CZHA 3TG1A 5KX8A 2W0JA 4RFYA 4BDKA 1MRYA 3AT2A 4FT9A 4JXFA 1KE5A 5E8ZA 3SKCA 2BIKB 3F3WA 4D2TA 3DCVA 3EH9A 2WTWA 1JKTA 4RQKA 3ZFXA 1OKZA 4KAOA 4CNHA 3OCTA 3CC6A 4X6RA 1ZZ2A 4ANQA 2VZ6A 3MH2A 3WE8A 1E1VA 3BQRA 4E26A 3HMOA 3MY1A 3N9XA 4FIIA 4B4LA 4L01A 4MK0A 4FKGA 4PL4A 2E9OA 2E9UA 4ACGA 3R9RA 4AX8A 4FEQA 4RQVA 4WA9A 4LV8A 3VS1A 3OROA 4L8MA 4RG0A 4GJ3A 4PWNA 5E92A 4ZSLA 1O6KA 5TO8A 2XVDA 4H05A 2CLQA 4OLIA 4ASZA 2OIBA 4G34A 2VTIA 2ITUA 2WTDA 3AT3A 2X4FA 3V5WA 4EH7A 4YJPA 2XK9A 1FINA 2JAMA 2GHGA 4LM5A 3R7OA 4FTMA 4AN3A 5JN2A 4DEBA 4GYIA 4ZTRA 1OGUA 2CDZA 1OL7A 2PUPA 4LGGA 4AOJA 4OAVB 2P2IA 4P2KA 3C4FA 3OC1A 5AP7A 5E8UA 4G5PA 3HNGA 3ZONA 4WG5A 4XCUA 4E6QA 4WIHA 1NY3A 3WOWA 1OPJA 4RFMA 4FV9A 4BN1A 3EQCA 4RC3A 3CXWA 4M84A 5I9YA 2WQEA 1SVGA 4BTJA 3UNKA 4FEXA 4XMOA 2HZ4A 2J0JA 3UMWA 3D7TB 4QTEA 3ERKA 4MCVA 4HCTA 4J8NA 3H30A 5ANJA 4O7NA 4BWXA 3LKMA 4Z9LA 3ZFMA 2GTNA 2Z60A 2Q0BA 3RMFA 5C01A 3TUDA 4KS8A 2JBOA 2CGWA 2X1NA 5HI2A 4MNEA 1A48A 2C6LA 3FLYA 5HVKA 1G8AA 1FOTA 4Y83A 5AEPA 5J5SA 2PVLA 4O0WA 4CZYB 3MVHA 4IM0A 2HYYA 1W0XC 1YWVA 3FMDA 3OXTA 3VAPA 4F6SA 4HPUE 3FL4A 4XRLA 2H6DA 1YOJA 4DGNA 2ONLA 4IMYA 2BILB 4BCHA 4CMTA 2YAKA 5JQ5A 5HCXA 4KBCA 1H0WA 4PDPA 1YHVA 4PMTA 3G6HA 3QWKA 5IUGA 2WTVA 3NW7A 4L68A 2RIOA 4Y85A 2YM3A 1V0OA 2UZDA 4JDHA 4MQ2A 1ZOHA 4OBOA 5CSXA 3SDJA 3PLSA 3ORMA 2REIA 2XNBA 4F1TA 1KE6A 1QPJA 3R22A 5C4LA 2FO0A 3I0OA 1GIHA 4EK3A 2XNNA 5HBJA 5CT0A 3PY0A 4KSPA 4AZVA 3VO3A 3QXOA 5AM7A 2F7EE 3UIUA 4Z16A 4E4LA 5IISA 4ZY5A 4F6UA 3MY5A 3RZFA 1OKYA 4HCVA 4XBUA 4BI2A 2XIRA 2YERA 1VJYA 4AZEA 5KKRC 5IA2A 2HZIA 3W32A 5HORA 4W8DA 4C3PA 5CY3A 4PMPA 4U45A 3NLBA 4FOCA 4X2JA 2VTNA 5HICA 4D2VA 1RQQA 2JBPA 2WB8A 2XBJA 4TPTA 5CEIA 5HBEA 5J5TA 3KRJA 5C03A 3SX9A 3O17A 5HD7A 3U9CA 2JKQA 2X7FA 5FGKA 1PXNA 2J7TA 3KFAA 3R7UA 2R3MA 2WTJA 5AR8A 5L8JA 4G3CA 4RBLA 3ZLYA 3C1XA 5J87A 3E87A 3KN6A 4PP7A 2X9FA 4AA4A 1QPEA 2PL0A 4EUUA 5JT2A 2JKKA 1Q3WA 4R6VA 4E5WA 4BZOA 2ZDTA 2HOGA 4FKPA 4MD7E 5CSHA 3PPZA 2PMNX 3ACJA 3KVWA 3HLLA 4X21A 4ZY6A 4ACMA 5J9YA 3DY7A 2YCRA 3MVJA 4AW1A 2OI4X 2GS6A 4HYUA 3PSDA 4R5YA 5HBHA 4BCNA 1UU3A 3Q9ZA 3EB0A 4R3RA 2Z8CA 3LFQA 4FNXA 4TKSA 2ITPA 2YZAA 5I9UA 4BCKA 1IAJA 3R83A 2BZJA 3EIDA 1PXKA 5EQEA 3M42A 4BCPA 4EEVA 3PVWA 5E8WA 4FR4A 4AZSA 2R3GA 4NU1A 3BU3A 5F4NA 4DH8A 1YWNA 1YXSA 4IFGA 4AU8A 1LR4A 1YHSA 1UU9A 4U8ZA 3I79A 2VX0A 2VO6A 4AA5A 4X2KA 4C2WA 2YIQA 4RIYA 2EU9A 3LM5A 3QYWA 3KXNA 1KV1A 5GINE 4IAYA 1LEZA 4CEGA 2WMBA 4A9RA 4J98A 1TKIA 5HCZA 4BYIA 3IPHA 1Q8UA 2UW9A 4JBQA 4HGSA 3W2QA 3OVVA 4IXPA 3QWJA 2ZB0A 4TN6A 2GQRA 3QTIA 3W16A 3TIYA 1H1WA 2R3PA 3CTHA 5ANDA 2E9PA 2XIYA 4ZZNA 5BVFA 3HAVA 2OBJA 3C4CA 4QMMA 4RVKA 2Q0NA 2Y6OA 4JX3A 3BZ3A 4UB7A 4LOQA 3KXXA 4MF1A 3E8NA 2V62A 4FKTA 5J79A 4O0VA 2XP2A 3WE4A 3CJGA 3O7LD 4E93A 4DA5A 3H9FA 5HE2A 3DNEA 1YOLA 3LXKA 3OWJA 4FKWA 4QTBA 1UU8A 4LUDA 4X2GA 4FK3A 4ALUA 4WSYA 5I9WA 3ELJA 1URWA 4NIFB 3DAKA 2HIWA 3U51A 4RWIA 1P14A 2YABA 4UXQA 2OJ9A 5E1EA 3ZU7A 5HTCA 1PXMA 3MESA 3G33A 4X2FA 5HTBA 4CFWA 3OG7A 3GOKA 4GRBA 4OT6A 5HIBA 3O23A 4ZK5A 4AT3A 2WIHA 4CQGA 4QP3A 5IH5A 3NVMB 1OPLA 4MXYA 4FT0A 3OF0A 4LMNA 4S33A 2WO6A 4DH5A 3OEZA 3NUPA 1XH7A 4D4RA 2IWIA 2ZJWA 3KULA 4QP9A 5BPYA 5I9ZA 4J53A 3ID6C 4DFLA 4IVBA 3FLZA 4YU2A 4E6CA 4IVCA 4L00A 4WBOA 1GOLA 3SRVA 4FEVA 3LCDA 2W5AA 5IEXA 2G2FA 2BKKA 3AD5A 5IPJA 3RAHA 5DR9A 5LMKA 1PKGA 3C4ZA 4BIBA 4Z7GA 1ZAOA 1WBVA 3NAYA 2XNGA 2E9NA 4ZMFA 3QKKA 1PJKA 1H07A 2WQBA 1REKA 3F2NA 2J4ZA 2W7XA 2IW6A 2BFXA 4NTSA 4ACCA 3DB6A 3E8EA 4ZOGA 4X7QA 2VWXA 2OJJA 4U7ZA 3FHIA 1BX6A 1ZYLA 2KULA 5CWZA 2QQ7A 3IDCA 4F09A 3AQVA 3BEGA 3C4EA 3DBDA 4HOKA 3PA4A 3DJ5A 4UZHA 3W1FA 4DGOA 3ZC5A 1BI8A 2QVSE 4G6NA 4OW8A 2W05A 5EDPA 3P23A 4BTMA 3WF6A 2OG8A 2BDFA 5ETCA 1TQMA 3CQWA 4OTFA 3L1SA 4OBPA 5HESA 4G1WA 3PTGA 4I4FA 4K33A 4LOPA 3WZDA 4BCFA 4UMPA 5CX9A 3C0GA 1PKDA 3UPXA 3HA6A 3QKMA 4V04A 3FI4A 4M97A 2QO2A 5KUPA 3QQUA 4M69B 4DCAA 3KF4A 2RG5A 1OMWA 4ZSEA 1RW8A 5HO6A 1XBAA 5HLPA 4FIJA 5M51A 2O3PA 1ATPE 3ALNA 3T9IA 3BCEA 2FSLX 4M8TA 2W1CA 4D1XA 4FKVA 2X6EA 4YC8A 5C27A 4F63A 3FMHA 4NH1A 5AV4A 3V5QA 5DMZA 3TDVA 1H24A 3LQ5A 5H8BA 2R3RA 2ZYBA 4FSZA 3G90X 2XUUA 3P7AA 4JI9A 3ZTXA 2AYPA 3FZSA 1SVHA 1FPUA 2H9VA 4L46A 1ZARA 1VYZA 4IAAA 4R7HA 4EKLA 5I3OA 3ZM4A 1Q3DA 3KRWA 1H4LA 4NM7A 1KV2A 5IQAA 1UV5A 2PSQA 4XV1A 2C30A 5KBRA 3B8RA 2IO6A 2ZDUA 3O8TA 3KQ7A 3FY0A 4BF2A 5A4TA 4UV0A 1WMKA 4QQTA 4O82A 3G51A 3QHRA 2KTYA 3VS6A 4MTAA 3DDPA 4OTQA 3QCSA 4TTHB 4I4EA 4PV0A 5LWNA 5M09A 3F5XA 2C5YA 1P5EA 4YTIA 3HX4A 4R1YA 2H34A 4R1VA 5FTQA 4O0UA 2PUIA 1WBTA 3SHEA 4G3GA 2XCHA 1JSVA 3P0MA 3RWQA 2Y7JA 3L8VA 2BRNA 3OBGA 1ZYDA 3QTXA 3DXQA 3EFKA 3WIGA 3AT4A 3C4XA 4II5A 3HV3A 2HW6A 4U81A 3UVPA 3TXOA 5GIOE 4NEUA 3AC3A 3ORNA 4AZWA 4E3CA 4PTGA 3V5PA 2BDJA 3MSSA 4MXXA 4O21A 5TKDA 5IMEA 4K1BA 3ODYX 4XX9A 4HVHA 5JZJA 4MHAA 5HE3A 4TWNA 2XK4A 3BGPA 3HP2A 4AG8A 1J1BA 4IBMA 3FMEA 4YPDA 4IM2A 2PE2A 2J0KA 2C1AA 2XMYA 2XYNA 2VWZA 4V0GB 3IOPA 3RPOA 3ZRKA 1FMKA 3GU4A 4DBXA 3O51A 4MNFA 2QKRA 4BY9E 5CQUA 3LFBA 2JDVA 3GENA 4F9WA 4Y46A 4YZCA 5BYZA 4EJNA 2WQNA 4BDIA 4QYHA 4UY9A 1PXLA 1PXPA 4W4YA 3L9MA 2B9FA 1OIRA 4CZTA 1J7LA 4O6EA 4FSWA 3O8PA 5ANOA 3FUPA 2ZM1A 2QONA 3HGKA 4FOBA 4HVGA 3CE3A 3S4QA 3IW8A 4HYSA 3PVGA 3VWAA 4ZJIA 2ERZE 5E1SA 3GXLA 4RIOA 5HO8A 4FUXA 3HV5A 2YLFA 4EH8A 4PF4A 4EOIA 3PLAE 4L43A 1PHKA 2OICA 5BVOA 5C1QB 2J2IB 3CD3A 2C6IA 1FQ1B 2AUHA 2UVZA 3H10A 1UWHA 3GFEA 4RVTA 1Q5KA 4Y5QA 1WVXA 5JGAA 5KNJA 4QP6A 2W06A 4QD6A 3AGLA 4U42A 3ZCLA 5L2SA 4AWIA 3DK7A 3W2OA 4ZEGA 3R1NA 3W2CA 5B2LA 3I1AA 5CSPA 4I0RA 3UGCA 2EB2A 3KCKA 4BWPA 4JIAA 4LRMA 1Q97A 3UOHA 3QZHA 3LFNA 1V0PA 5AV1A 4AGCA 3ZDIA 3FKLA 4KS7A 4CKJA 3KRXA 4WNOA 5KKRB 3BU6A 3ZSIA 2V7OA 3IQ7A 4BKZA 3VBWA 4YMJA 3ZBXA 1R0EA 2VWIA 4CLJA 2JDTA 1OECA 2C4GA 3GUBA 3I7BA 4H3PA 4EQUA 4HCUA 4PL5A 4ZTMA 4JLCA 2YCSA 4C58A 3OXZA 1H00A 5IA5A 3ROYA 3PJ8A 5BUEA 4K6ZA 5AAGA 3NUSA 1REJA 3OOGA 5DEYA 3D15A 2VWWA 5M44A 3O2MA 3BLQA 2QOKA 1JOWB 3V8SA 3HMNA 2B9HA 3RAKA 5H9BA 4ASXA 4KSQA 4IX5A 2IW9A 4DEIA 4R77A 4RT7A 3QTUA 1G5SA 2UZWE 2CJMA 3DA6A 4A9UA 2YM7A 4Q5HA 2VUWA 4FZ7A 4A9YA 3E62A 2J0MB 4RZWA 4DEGA 5B2KA 5IMXA 4U6RA 2R5TA 3LOKA 4N6ZA 1PRYA 4EZ5A 5CEKA 2XJ0A 1YI3A 4D2RA 2XKEA 4EOOA 4RWKA 2X9EA 1WBNA 3AG9A 2W99B 4GG7A 3QUEA 4MVFA 4FTRA 1S9JA 4UYNA 3V6SA 1PF8A 3WYXA 1W98A 5AV0A 4FGRA 2C6OA 4L44A 3R9DA 4DTKA 4XNEA 1J7IA 4F9CA 2CCIA 2F49A 3M11A 4RIWB 4C4EA 2QODA 4MWIA 3CKWA 2VRXA 3F3TA 5ANIA 4WNKA 5LVPA 2VWYA 5AP3A 2DYLA 3LZBA 3Q4CA 5IUIA 5M4FA 3SRVB 3GGFA 3H3CA 4ORKA 4PL3A 5AMNA 3B8QA 2CGXA 1P2AA 3R63A 4GK3A 4ENXA 3MPAA 3I0QA 3ORLA 3C50A 3I4BA 4F7LA 3MA3A 2CKOA 4DF3A 2WMWA 3NUAA 5HIDA 3EMGA 2LAVA 4I22A 5CF5A 5CS6A 3FL5A 5CI7A 3ZXTA 3VQUA 3BGZA 2YITA 3IOKA 3Q6UA 4IDVA 3S95A 4KA3A 3UVQA 4ANSA 5A6NA 2VTRA 2WFYA 2HXQA 2YM6A 1OPKA 4HGLA 4CRSA 2HWOA 4EBVA 1LUFA 4LGHA 3UO5A 2BR1A 4I1ZA 5EK7A 4RJ4A 3TT0A 1WAKA 4JAIA 2WMRA 4QMUA 2HWPA 4BBFA 1W8CA 5EH0A 4IC8A 5F95A 4EZ3A 5IQCA 5IA0A 3T3VA 4U79A 3TZ8A 4LL5A 2GS7A 4AN9A 4LGDA 1OKWA 2F4JA 2R9SA 2XJ1A 3FI2A 4QP1A 4MBLA 4YZDA 3CIKA 4JBOA 2DS1A 4USDA 4XOZA 4Q5EA 4AUAA 3OY1A 4DITA 1SNXA 3AD4A 4EOKA 3LLAA 4NM3A 5CVGA 5JGDA 4I3ZA 2QHNA 1R39A 2OH4A 3QTSA 3WILA 2W1FA 3TNWA 3ZO4A 4FZDB 3WF9A 3ENHA 4CYIA 1GIJA 2WPAA 3KRRA 1XR1A 4BDBA 3PJ3A 4ALWA 1XBCA 3PP1A 3NUUA 3BHHA 2BHEA 3NUXA 4JT3A 2XS0A 2WTIA 2ETRA 3O50A 2HENA 4DT8A 4IDTA 3PXFA 4QMLA 5EM5A 4UN0C 3ET7A 4NL0A 4EH4A 3LPBA 3UG1A 4O7LA 1OL1A 3KF7A 4OT5A 2CPKE 4E4MA 3MVLA 1YXTA 4XEYA 2UW7A 4OTHA 1M7QA 1ZWSA 2W9ZB 3DBQA 3KXGA 3UTOA 3HV6A 5CAOA 4QMYA 2PVKA 3VJNA 4F1OA 2B0QA 1VYWA 2HCKA 3F3VA 4QMWA 4GT5A 3M2WA 4P7EA 3ULZA 3EQGA 3QRIA 1YWRA 1U46A 3FQEA 3T8OA 2ETMA 3CGOA 4E20A 2BIYA 5L2WA 5HE1A 5CU3A 3AC8A 1ERKA 5FQDC 1NT2A 2AC5A 3FE3A 3MGYA 4FSMA 3Q4UA 3GB2A 3POZA 4RA5A 4TWPA 3WZKA 1YHWA 2OH0E 4ANOA 1CKIA 2Y4PA 2GNHA 3PUPA 4FIEA 3FDNA 3SXFA 3QUDA 3ETAA 3H9RA 4G17A 4IADA 2VTOA 3A7FA 4DFUA 3PY3A 3Q2JA 4C59A 3RPYA 2WMXA 3CTJA 1H26A 1Z57A 4EH9A 4QMQA 1PMUA 2YDJA 4IB1A 2P55A 1NVRA 4IVDA 3V5JA 3SG8A 3NEWA 4XLVA 3HAMA 3KXZA 3QRJA 3UYTA 2PVMA 5CAUA 3K5VA 2EXMA 4UMUA 3RNYA 1H1SA 4R3PA 5TE0A 2BHHA 3OCGA 4IB3A 5HVJA 3WBLA 2DUVA 2OK1A 1ZMUA 1FGKA 2XBAA 3O71A 4YLJA 3W2RA 1ZY4A 3FSFA 3IW5A 3II5A 4N4SA 2UW6A 3QTWA 3GU7A 4QTCA 2ERKA 4GV1A 5HHWA 5L6PA 4M15A 2W1EA 4F7NA 1H0VA 3Q2MA 4BZNA 4CD0A 3MW1A 2ZMDA 3UDBA 3ZS5A 4Q9SA 2VTHA 2BCJA 3MA6A 3AGMA 4CQEA 3UIXA 5E9EA 5H3QA 2O0UA 2QNJA 2IZRA 5ICPA 4EOMA 1SYKA 4C2VA 2EXEA 5FWKK 3DKOA 5KMNA 3BE9A 3O0GA 4OTIA 5HNBA 1Q8WA 3POOA 3E7VA 5HGIA 3DQXA 1CM8A 5CF8A 1OKVA 3MPMA 1DAWA 2FA2A 4PP9A 2ZAZA 3OWLA 4IW0A 3REPA 2BALA 5AADA 1Q24A 5HG7A 3R8MA 4F1MA 5AA8A 2B53A 5DLSA 4ZLYA 4XOYA 3RM7A 5JQ8A 2UW4A 2WQMA 4ID7A 5DHJA 1U59A 2OZAB 3KKVA 4KB8A 4YJTA 2WMTA 1G8SA 3HMMA 4KKEA 4IE9A 3LQ3A 3VS4A 4YJVA 3TDWA 5KO1A 3VUTA 5IA4A 4G6OA 4GKHA 3R1QA 4MYGA 3UOKA 3FAAA 3QTRA 3P1AA 2OIQA 4CG9A 3OMVA 4WUNA 4ZSAA 5TOZA 2VGPA 4ZTLA 5DA3A 4EK6A 3EQPA 3DAJA 4DFZE 3NW6A 3BHTA 3F9NA 3ANQA 4NKAA 3R7GA 3EHAA 3MB7A 2I1MA 5IQDA 1Q8YA 4ACHA 5LVNA 2OLCA 4FZAB 2GQGA 2ACXA 2R64A 2X4ZA 3ALOA 4CFVA 3C9WA 3IDBA 2W4JA 4L45A 3QC9A 3VQHA 4EOQA 4KUJA 3LCTA 4JBPA 3PA5A 4D2SA 4FKOA 3UQCA 3SVVA 4JVGA 4A9TA 5TR6A 2F7XE 1IA8A 4C4GA 4RX5A 5HLNA 3FMLA 3PIZA 3CPCA 3KC3A 1KSWA 2BDWA 4I92A 4RGJA 2XNMA 3PIYA 4O0RA 4E4XA 1MQBA 4J7BA 4FZ6A 1YDSE 3DK3A 3C13A 3PYYA 3BKBA 4K11A 2W4OA 2XH5A 3R1SA 4BFMA 5HG9A 3DS6A 4S2ZA 1Y6AA 4TWCA 4H39A 2XNPA 4PDOA 3EL7A 5AUWA 3JR1A 3KULB 5JGBA 4F6WA 2E9VA 3IGGA 3Q9WA 5AR4A 2PZ5A 2C3KA 2EXCX 4GH2A 2VAGA 2X8DA 3ZRLA 1F5QA 2FSMX 3QALE 3NRMA 4DC2A 3I6UA 5BMMA 2JIVA 2HK5A 2YWVA 4M12A 1PXIA 4FNWA 3JVRA 4APCA 4BDHA 3NZ0A 3BELA 3TNQB 3AC4A 4KIQA 3FWQA 4L7SA 3BU5A 2C0OA 5D7VA 3WZJA 5GJFA 3SOCA 3RPRA 3RCJA 1XO2B 1UNGA 4TNBA 4XG6A 2VTQA 1GZOA 4L7FA 5EYDA 2I0YA 2VNYA 1BI7A 1V1KA 3DAEA 3C0IA 3SD0A 4EI4A 5HNIX 4ZMEA 3DJ7A 4O81A 2ITWA 1R78A 5CLPA 3MN3A 5LQFA 1ND4A 4FSRA 3D7ZA 1H1PA 3EQRA 3HP5A 5HLWA 3S1HA 1TQIA 2Z7QA 5M4IA 1OBGA 4N70A 4AT4A 2P0CA 3GCQA 3UNJA 3ANRA 1J3HA 1EH4A 1JSUA 3IONA 5K0XA 3RM6A 1GZ8A 4CFFA 3TNPC 4F9BA 2C68A 3LVPA 3P7CA 2W17A 2ZV2A 1JNKA 4FNYA 2BKZA 4YHJA 3UZTA 4G3EA 2Z02A 3KRLA 5JZNA 3VUKA 4AOTA 3DOGA 3L8SA 2XCKA 3CLYA 5HO7A 4CT2A 5EYMA 5JFSA 3K2LA 4C61A 3SG9A 2C5OA 2X2LA 2X6DA 5HQ0A 1WZYA 5M07A 4LOOA 1OITA 2G2HA 2Y8OA 4Y95A 2OSCA 1H25A 1KWPA 4GYGA 4O2ZA 4S32A 4F0GA 4ZLOA 4DE4A 4FL3A 3H9OA 4BBMA 4NJDA 4C36A 3PSCA 3TUBA 4FTAA 2B55A 2AC3A 5L6OA 3IW4A 5IUHA 5CEPA 4YZMA 5KMMA 3RVGA 3SQQA 2QO9A 2QOIA 4BDGA 1BYGA 3RGFA 3WF8A 2VGOA 3ENMA 3NR9A 4NCTA 5M4CA 5HVYA 2XK7A 4JNWA 3SA0A 3A8XA 4JBVA 4KRDA 4QT1A 3ORTA 4EH6A 1MRUA 4DEHA 4FV8A 3NVKI 3WYYA 4FTNA 3PXYA 5CEOA 3JXWA 3FYKX 1QCFA 3AD6A 2H8HA 1U5QA 4EOPA 4ENYA 4EL9A 3FZRA 3F69A 3QRTA 3NX8A 4BKJA 4WO5A 4IWQA 2BRMA 4FEWA 4QQJA 4ZS0A 4O0SA 4NM0A 3Q04A 4QP7A 3F6XA 2NO3A 5IH4A 2OW3A 4KIKB 4IJPA 5EOBA 3QCYA 2PK9A 4O7ZA 3PWDA 1ZLTA 3QLGA 5JFVA 5IQGA 3NNUA 3MH0A 1VZOA 4ASDA 3LE6A 4R3CA 3EQIA 2C3LA 4QYGA 5KHXA 4IX3A 4K18A 3C4WA 3ODZX 5DNRA 4FTJA 2UW0A 5HX8A 3QXPA 4RIWA 4RX7A 3GCUA 2YIWA 5AUUA 5B7VA 4O7TA 4QMNA 5EI2A 1JKLA 2YCQA 3D5VA 5KZ0A 5G1XA 3F3UA 4TYEA 1J91A 3KK9A 3S3IA 4D5HA 5I5ZA 3QZIA 3DKGA 2ITZA 4CLIA 4D2WA 4M66A 4RJ8A 4Y73A 1YDRE 3GEQA 4O0XA 3MJ1A 2PZPA 4AS0A 4FV2A 5IKWA 4IC7A 1GY3A 4C37A 4DEAA 5BUIA 4FG9A 5GZAA 5CU6A 4IJ9A 4U0IA 1XJDA 5CNNA 4GG5A 1WBOA 2YHVA 4O6LA 1B39A 3ZDUA 5IF1A 1AD5A 4GMYA 4BYJA 3S00A 4G9RA 1PYEA 3RBWA 4CVAA 3E88A 2BRBA 4FTLA 4FTTA 1ZY5A 3SXRA 4BB4A 5AFVA 3TTJA 3KCFA 2O8YA 4B8MA 3ATSA 1DS5A 2BUJA 2XNOA 3C7QA 4F99A 4I5MA 1JAMA 2PPQA 5KMIA 3E3BX 5FTOA 3MVMA 3PY1A 2IPXA 3RI1A 1XBBA 4RVLA 2R3QA 3QD0A 2WU6A 3VUGA 2WTKB 3FXZA 1Y57A 1YI6A 4RJ7A 4G31A 5CENA 3U55A 1UKIA 3WIKA 5L2IA 5CT7A 3SGCA 2BAKA 3BYVA 4YJQA 2WIPA 4S31A 4GUEA 4ITHA 4NKSA 5J1VA 1OB3A 3TCPA 3ZUTA 2HY0A 2R3LA 2WMAA 3EL8A 3Q60A 4L42A 3I60A 3HZTA 3ZSHA 3BI6A 4HZSA 2UVXA 2VU3A 2PZRA 3GQLA 4DGLC 2YACA 4MKCA 4EUTA 3CY3A 3EN6A 4M0ZA 4A07A 3IDPA 3QX4A 4A9SA 3Q5ZA 5DN3A 3TACA 2G2IA 4MXZA 4EC9A 5DRBA 4BKYA 1KUTA 3R7IA 3D5XA 2R0UA 5AP6A 5CQWA 1HOWA 3QU0A 3ZO1A 3G9NA 3VUIA 5AV3A 5I4NA 4ANLA 2JDRA 3MFTA 3MIYA 3CP9A 4O1OA 4DFXE 1KOAA 3EZRA 3HKOA 4BGQA 4TY1A 2GQSA 4OTPA 4CMOA 2F7ZE 4CZUA 5A54A 2WELA 3EKKA 3VS2A 4UBAA 4BI0A 4ZZMA 3RALA 1SNUA 3Q9YA 3D4QA 4DFYA 3PA3A 3BV3A 2Y6MA 5T6KA 4F0FA 2JD5A 3VS7A 1NVQA 4EC8A 4XG8A 5LARA 3QKLA 1GJOA 1WVYA 3E5AA 5D9HA 2FUMA 4QP8A 1E1XA 3DTWA 3TTIA 4D1SA 4ZJVA 3ROCA 4RRVA 2CSNA 2GTMA 2QOOA 4I0TA 2B52A 4PNKA 3JUHA 4XG3A 1YXXA 3QD4A 2GFSA 1LP4A 2C0TA 5GJGA 4BCQA 4K0YA 1ZRZA 3FKNA 5CSVA 5DR2A 3FJQE 4XBRA 4CYJA 4IB0A 1FMOE 2JGZA 4EK5A 2O63A 4TL0A 2XRWA 4DG3E 1WBWA 1OL5A 4IZYA 3CKXA 1Q41A 5BVNA 1O6YA 2NP8A 2O5KA 4D5KA 4ZTNA 3SOAA 4NWMA 5CF6A 3D2IA 4OBQA 3NUYA 3BWJA 3TZMA 1ZMWA 3FC1X 4ERKA 4LUEA 2IVTA 4X3JA 4YTFA 5C9CA 3R71A 5K5XA 2QKWB 4BRXA 4R8QA 5ETAA 3R7VA 4FT5A 5BUJA 4HYHA 3UG2A 3LCOA 3ZRMA 2Z7RA 1Q8ZA 5D12A 3OP5A 4J71A 4O7VA 4L53A 5FDPA 3SV0A 2QHMA 2V55A 3GP0A 2IZTA 4BDFA 2QCSA 5M56A 4EK4A 5C8KA 4LRKA 4E4NA 3I7CA 3CQUA 4QQ5A 3NPCA 4RWLA 3U6JA 2I7QA 3DFAA 1LPUA 3N51A 4MXAA 2OWBA 2J0LA 3R2BA 4U40A 4BDCA 3C0HA 3V5LA 4YNOA 1M2QA 2YIRA 3FZPA 2UW5A 3RPSA 2ZV8A 2WQOA 4FSNA 3KMUA 3EKNA 5E4HA 5FEQA 3BHYA 4H3QA 3RP9A 3PVBA 2F2CB 5CF4A 4QRCA 2JITA 1URCA 3DLZA 1HCLA 5FBNC 1FBNA 4FSTA 2FYSA 4JR7A 2VTPA 4BL1A 2UZNA 2QO7A 3LXPA 1P4OA 2GPHA 3DZQA 3KVXA 4WHZA 5B0XA 2VWVA 4ANNA 5FLFA 3OXIA 3BPRA 3LCKA 5E8XA 2ITYA 1NA7A 3LMGA 4KIOA 1GNGA 2PMOX 3HYHA 3LW0A 5K3YA 5CZIA 5I9XA 1ZYSA 4M14A 5EHLA 2X39A 4G6LA 5CAVA 4HGTA 5AP2A 3GC7A 3NYXA 4YHTA 5AUVA 2QR7A 1UU7A 4DBNA 2V0DA 4C4JA 2BZHB 3G6GA 1YQJA 5DT0A 3MFUA 3VBXA 4OTDA 5AAFA 4RSSA 5LJJA 4IAZA 4R78A 3A7JA 3PXZA 4NUSA 2I6LA 2JFMA 4I94A 4EYJA 2UW8A 3R21A 4IWDA 1OL2A 3A8WA 4QTAA 2JDOA 5CEMA 5J1WA 3NW5A 4H58A 4C3FA 2BAJA 3ZUUA 3SW4A 4GKIA 4JRVA 4NT4A 3LFFA 3CCNA 5J9ZA 3FBVA 4J95A 4G2FA 3RZBA 2P2HA 2A4LA 3PRFA 1Q62A 1XKKA 1XWSA 3F5UA 4JDJA 4RC4A 3TI1A 5BYYA 4L67A 4C57A 1JSTA 5AP5A 5CAQA 2Q83A 3W18A 1Q4LA 3HRFA 1JPAA 4E6DA 5FM2A 5HNGA 2XYUA 3NDMA 3QTQA 2XRUA 2JAVA 3KB7A 2Y4IC 2J9MA 2X2MA 3Q3BA 5LCKA 3AC1A 3KMWA 4M0YA 4EH2A 3R8ZA 5HG5A 4FEUA 4JL9A 4PNIA 4TYHB 3UP7A 3VC4A 1OZ1A 4AQCA 2WD1A 4Q9ZA 4JDKA 2PMIA 4NM5A 2YA9A 2VWBA 5HE0A 3DXNA 2C6EA 4U41A 2RKUA 5IQFA 4BVUA 1DI8A 4UMTA 5BQ0A 5KMJA 4O7WA 1JKKA 2R2PA 4N6YA 3AC2A 4AXAA 2XKCA 4ZTSA 2OZOA 5J9LA 4ARKA 2GNLA 3OWPA 2FSTX 2RFNA 1L8TA 2YCFA 2C0IA 2DWBA 1UKHA 3JYAA 1W83A 3KGAA 5EI8A 5CU4A 3UOLA 4JG7A 1H8FA 4YGAA 3ZLXA 4U44A 4E5AX 4IIRA 4PMSA 3QCQA 3G5DA 3PFQA 1MRVA 2YLEA 3DV3A 3K3IA 4I93A 4K77A 1QPDA 2W1GA 5CSWA 4BCGA 4GSBA 4YJUA 4JIKA 1JKSA 5KHWA 2CKQA 4JR3A 2QR8A 4C8BA 1OIYA 1SMHA 4IB5A 5HKMA 5CANA 3GOPA 2HY81 5T3QA 1XH6A 4F9YA 1V0BA 3ZXZA 2ZOQA 4R7BA 4O7RA 1UA2A 3PP0A 3QZFA 3DKCA 2R3KA 4ZTQA 4GT4A 2X7GA 2PHKA 4UX9A 1W7HA 3V5TA 2PVYA 2Z7LA 1YI4A 4K9YA 2YM5A 4F4PA 3GQIA 2CN8A 5AR2A 2WZJA 2ITQA 5FXRA 5AV2A 4CV8A 4DHFA 4C62A 3IO7A 3RK5A 4A4LA 2WTKC 2W96B 3TZ7A 4QMSA 5HEZA 5E90A 1MP8A 3ULIA 3G0FA 2QOBA 3ZLWA 2X2KA 4DEEA 3DT1A 4XV9A 2OGVA 5C4KA 2HZ0A 5C8NA 4QO9A 5FP6A 2CCHA 2OXDA 2PZIA 4NFMA 4YLLA 5AX9A 3CY2A 4D4SA 2A19B 3R30A 4WOVA 5AP0A 4IHPA 5E7RA 3KXHA 1E9HA 3FQSA 4GFMA 3PDTA 4IZ5A 5L4QA 2JC6A 1ZYCA 3UVRA 4CRLA 4Q2AA 2G9XA 3FLWA 2G01A 3QYZA 4FL2A 3UZPA 5JKGA 4KNBA 4YPSA 5AR3A 3QBNA 3PVUA 3R7EA 1O6LA 3U6HA 3EZVA 2RF9A 3P4KA 3G2FA 5CVHA 3U9NA 5L3AA 4IX4A 5AAEA 1YXVA 4CFNA 5JSMA 3UZRA 2WNTA 2XB7A 3FZ1A 4A4OA 3U4UA 4E1ZA 5IA3A 4J1RA 2QG5A 2PVHA 3UE4A 4J99A 3BHVA 4RZVA 4BTFA 4D58A 3GC0A 2NRUA 5DEWA 1OUYA 4DFNA 2OJFE 5F94A 2YDKA 3BRBA 3TV7A 4G9CA 4NK9A 3D5WA 4XHKB 1NXKA 3A4OX 5CXHA 3DJ6A 2BRGA 3COHA 3UIBA 4LG4A 4CKIA 3R8LA 4WKQA 1OIQA 3EQHA 4HZRA 3VF8A 2YZLA 2UV2A 1YKRA 2B54A 4RMZA 2W1HA 1A06A 3OUKA 3AXWA 1L3RE 2R3IA 4FL1A 3TV4A 3UBDA 2BRHA 2W1DA 2RG6A 4XG9A 2YN8A 1K2PA 3ATTA 4NFNA 3CD8A 3PZHA 4YZBA 3M1SA 3ZC6A 4E8AA 4UALA 3EYGA 4FVPA 4I5CA 4RLLA 3VS5A 4C3RA 2EWAA 5HX6A 5K9IA 3C5IA 5B2MA 4TYJA 1F3MC 4I6FA 2NPQA 4JX7A 3HRCA 4PX6A 1YVJA 4X2NA 5J7BA 2XM9A 2NNWB 4R7IA 2JKOA 3FC2A 1AGWA 3UC3A 3OS3A 4OUCA 1M2RA 4J8MA 2YISA 3S0OA 4NCTC 3OT8A 2R3OA 2IZUA 2QU6A 5FUTA 1PMVA 1PXJA 5GNKA 1DAYA 2Y4IB 4IH8A 4QP2A 4W9WA 3UYSA 1R1WA 1UWJA 4YTHA 4CFMA 5H2UA 4AGDA 5EOLA 5A4QA 4PUZA 4YJSA 4YJNA 2GMXA 4JDIA 4YHFA 4IFCA 4X3FC 4QMTA 4E6AA 3F5GA 3PZEA 3S2PA 4EWQA 3FMJA 4Z3VA 4PTCA 2JFLA 2JIUA 4FV0A 4G16A 1P4FA 2CHLA 3RK9A 4PTEA 2QOFA 2C69A 3QLFA 4Y5HA 5EDRA 3DZOA 3ORKA 4DFBA 5EI6A 4I6HA 1Y8GA 3DBFA 1I09A 5CU2A 1B6CB 1R0PA 4BCIA 4DTBA 5M53A 4GFOA 2VV9A 3GCSA 4NIFA 3NS9A 3PG3A 3JY0A 2JIIA 2PVRA 4BDDA 2VN9A 1Q8TA 4KIKA 1APME 3QQLA 4ITIA 2OU7A 4UWCA 2X0GA 4ERWA 3TIZA 2VTJA 4HNIA 2C5XA 3DKFA 2YIYA 3IW7A 5EW8A 4ZSJA 4YR8A 2PZYA 4XV2A 3OFMA 4A4XA 3BX5A 2PULA 2CNVA 5HU9A 5LXMA 2UZVA 4NSTA 2R3HA 1K9AA 2XKFA 3F7WA 4CT1A 3OD6X 3VW6A 3QA0A 2BZIB 2YIXA 4YNEA 4ACDA 1PXOA 1ZMVA 2FSOX 3E64A 4FKRA 2ZVAA 2QURA 4XYFA 5D11A 4ZTHA 3VNTA 4AW0A 2B9IA 4HJOA 3IK3A 4YBKA 3GU6A 3BWFA 3V01A 3VHEA 4QYFA 4BI1A 2J5EA 3F88A 4YSMA 5JFWA 2I0EA 3B2TA 3E92A 2O64A 3ORXA 3PG1A 4RIYB 4QPSA 5F20A 2ITVA 3NWWA 4Z55A 4XP0A 2WXVA 3F3ZA 3DLSA 3FLSA 4IM3A 5ANGA 1XH5A 2J6MA 3LJ0A 3EN7A 3OHTA 4V05A 2C6DA 5IH6A 4L6QA 4LFIA 4JS8A 2QOCA 4DAWA 4DCEA 4KKHA 3TV6A 1JBPE 2GHMA 1WFCA 2V5QA 4QMPA 5K5NA 5HTIA 1XHAA 1YXUA 2I0HA 4XLIA 5CI6A 5BMSA 4CV9A 4UYAA 5LMAA 4BGHA 4ZY4A 4I0SA 3O7LB 1UNHA 4F70A 4UMQA 4HPTE 4DLIA 3TNIA 2HAKA 5IEVA 3D5UA 2G15A 5ETIA 4DTAA 1RDQE 3I81A 3NSZA 4OTGA 3U4WA 3VBQA 4CCBA 3HDNA 2PU8A 4FSUA 3Q4TA 5H8EA 3QQGA 1JVPP 2X8IA 3KU2A 4I5HA 3FXXA 1DI9A 2E2BA 4QMXA 3E93A 4YZNA 4MX9A 1CDKA 5DBXA 5DWRA 2C47A 3LIJA 5GZ9A 2Z2WA 3WZEA 3TKIA 3FY2A 4OR5A 1IG1A 3D14A 3FMKA 4U3ZA 5AIKA 3ZUVA 3VIDA 4MQ1A 4HVIA 3FEGA 2F9GA 3IS5A 4H3BA 2ITNA 4GVAA 5K4JA 2C3IB 2WTCA 2HELA 3UO6A 4AACA 2OJGA 2VD5A 2VTAA 3ZM9A 2R3JA 4PDYA 3F61A 2VO3A 1OM1A 2X7OA 2ZV7A 3QTZA 1OBDA 2YJRA 4V0GA 5F9EA 4CG8A 4XG2A 2R4BA 3CS9A 4O7YA 1B38A 4GU6A 3ZFYA 1H1QA 3LQ8A 2OJIA 3PIXA 3PPKA 3SXSA 4MH7A 4QMVA 3VW8A 4Y8DA 3L8XA 3KK8A 4YLKA 2PY3A 5E8TA 1VR2A 4E73A 3HA8A 5IDPA 3UIMA 4C4FA 4PMMA 3OY3A 4H1JA 5CTPA 3EN5A 5DI1A 4DGMA 4FYOA 4FKLA 4YURA 3F82A 4FKIA 1GAGA 5EFQA 3W2PA 2IN6A 4AZTA 5LWMA 4DN5A 3I5NA 3P08A 2BZKB 2CGVA 5L6WL 4O7SA 4UXLA 5CVFA 4AGWA 3WF5A 2WU7A 4O27B 5EM6A 2EVAA 3DU8A 3ITZA 4M3QA 5FD2A 5BVKA 1ZZLA 3NYOA 3MIAA 1W82A 2X8EA 3TUCA 2QOQA 2CLXA 4XG7A 1ZOGA 1U4DA 4HYIA 3R8PA 3V8TA 4JG8A 3N4TA 3VBVA 4FVQA 5ANKA 3CEKA 1RE8A 2XJ2A 3DTCA 4AE6A 2B7AA 5K0KA 3D94A 3P9JA 5DG5A 1BLXA 3R73A 4EOLA 2UZEA 3BGQA 4ANMA 1Y6BA 3DQWA 3BYMA 1JQHA 3MDYA 5M55A 4O0YA 3WZUA 4FK6A 4FIHA 4FG8A 4AZFA 1IR3A 4Y72A 3SLSA 3Q4ZA 5TT7A 3G0EA 4IWOA 3HRBA 5DGZA 3R28A 4L3JA 3FLNC 2GCDA 3D7TA 4NYEA 2PE1A 3PRIA 2DQ7X 4FKSA 2V7AA 4GFGA 4TZRA 3R9NA 2B1PA 3OZ6A 4EONA 3MY0A 1GIIA 5L2TA 4ZIMA 4JQ7A 3KMMA 1XH9A 2CNQA 4C7TA 2CKEA 5TF9A 3VBYA 4YSJA 2CNUA 3A7HA 4F7SA 4I6BA 5AUZA 2YFXA 5EKNA 5IQHA 3FMMA 2QLQA 3ACKA 4KD1A 4UWYA 4FSQA 3DB8A 3W2SA 3VVHA 4NJ3A 4BICA 5CAPA 4CCUA 5A6OA 2JKMA 5LVLA 4TRLA 4YBJA 4M68A 3FXWA 2XKDA 4QPAA 4X3FB 5EKOA 4X3FA 5FRIA 3JS2A 1QL6A 3R2YA 3RNIA 4GVJA 3TNHA 5AP1A 4YUQA 2VTMA 3QGWA 3QCXA 4JRNA 5IG1A 5KMKA 2OZAA 3F66A 3HUCA 3FMNA 2UUEA 4EHEA 3ZYAA 3CBLA 4KBKA 4JQEA 1U5RA 4O91A 4WG4A 2WMQA 5EG3A 4FI1A 3IKAA 2H96A 3OUNB 4FGBA 4M7IA 4XP2A 5DT4A 1GZNA 4RPVA 4DLJA 3RHXA 4GEOA 2FB8A 5ACBC 3EQBA 4FE2A 2JLDA 4EQCA 5HZNA 3L9PA 5GHVA 1TQPA 4C4IA 4HGEA 2PWLA 3NGAA 4D55A 4EBWA 4RJ6A 3TZ9A 2G1TA 2IJMA 3V04A 3CJFA 5HD4A 3QZGA 1STCE 2RSVA 1R3CA 4LRJA 4XH6A 4QTDA 3EN9A 4G5JA 3LFAA 4FUYA 1Q99A 2PTKA 1BKXA 1KE9A 2XIZA 4W9XA 4BDJA 5L8KA 2B4SB 3BQCA 4TXCA 5LVOA 4QMZA 3DBCA 4MWHA 2UZLA 1MUOA 2O65A 1M7NA 3LXNA 4XS2A 5CXZA 3GCVA 2WOTA 3QGYA 3BLRA 3NUNA 4IAKA 5AWMA 4O83A 5A4EA 5EYKA 4IAFA 1YOMA 2XZSA 4JJRA 4IACA 4USEA 4D0XA 4O84A 3GU5A 1TVOA 3A61A 4AW5A 5DOSA 3TL8A 4USFA 4WG3A 3V6RA 3A99A 3SW7A 4CMUA 3ZHPC 3UO4A 4R5SA 4RC2A 4ZZOA 1UNLA 2WMVA 2QLUA 3BYOA 4TYHA 5A9UA 4LL0A 3GT8A 2XK8A 4E5BA 2XK6A 4QMOA 2O2UA 3HV7A 4WT6A 3ZO2A 3CTQA 1ZYJA 5KCVA 4DG0E 4RX9A 2XEZA 3NAXA 5AUYA 2HXLA 3Q32A 4ITJA 1YRPA 3K3JA 5I3RA 5AM6A 4ZSGA 3HMPA 4GIIA 5FTGA 4MBJA 5DIAA 2YDIA 4HNFA 4RA4A 4V01A 1PYXA 5AA9A 1F0QA 4WSQA 3PJ1A 3FQHA 3UMXA 4HVSA 3SAYA 3OW4A 4C35A 4RJ5A 5DPVA 4BGGA 4EZ7A 3MFSA 5K4IA 3G15A 4MF0A 5ANEA 2CMWA 3EFLA 1T45A 4EORA 1AQ1A 3A7GA 1OI9A 3LFCA 3RINA 4D4YA 2FH9A 3DBEA 4L9IA 1I44A 4QNAA 3FI8A 4LI5A 4LMUA 4XG4A 2C6TA 3BE2A 4GJ2A 2HZNA 1FVTA 3R04A 4FTCA 4GW8A 3O96A 3UPZA 1PY5A 1IEPA 4WUAA 4BCMA 2ITTA 2BROA 5ETFA 4YP8A 3TN8A 4C02A 4FICA 2ESMA 2UZOA 4BWKA 3RCDA 4FBXA 5FBOA 2XEYA 4XJ0A 2J51A 2J50A 3FI3A 2BVAA 1NVSA 2NRYA 4KRCA 4I24A 4C0TA 4P5ZA 2QOHA 3MH3A 3V3VA 4FV3A 4AN2A 5E91A 3GBZA 2C3JA 1PMEA 2IVSA 4EHGA 3FKOA 1RJBA 4RWJA 3LCSA 3VULA 4FT7A 1Q61A 4D9TA 3UNZA 3LXLA 5H8GA 3FPQA 4UWBA 2B9JA 4L3LA 4MXOA 5D1JA 3DXPA 2ZV9A 1O9UA 2WMUA 3AMYA 3BBWA 4J52A 5E8VA 4N57A 2V22A 2ZM3A 3P5KA 2GHLA 3E8CA 1ZOEA 2WOUA 3ORIA 3PXKA 4H1MA 4ZP5A 3RAWA 1BL7A 3FSKA 2J0IA 2W1IA 3ZEPA 4I6QA 4D2PA 2RFSA 1ZXEA 3LLTA 3MH1A 1M17A 1SM2A 3OEFX 3BV2A 3NCGA 4S34A 5CYIA 5EM7A 3WARA 5A4LA 2OKRA 4FMQA 4FV7A 1VEBA 5JFXA 4BR3A 2WGJA 3RKBA 4L52A 4M13A 4IANA 3AC5A 4C34A 4HW7A 4QOXA 2VNWA 3GI3A 3PSBA 1PW2A 3EQDA 4JAJA 4CTCA 4EH3A 5DH3A 3QQFA 2ZM4A 3FHRA 2Y9QA 1BMKA 2BAQA 5J95A 4TYGA 3DGKA 1K3AA 2ITXA 4D9UA 4PY1A 3RTPA 3ZZEA 1YDTE 2C5VA 5IA1A 4FC0A 2XIKA 4KINA 3QQJA 4JOAA 4RIXB 2QI8A 5JH6A 1FVRA 4YZ9A 3P86A 4GUBA 2WEVA 3K5UA 2GS2A 2PVFA 2OF4A 2R7IA 2C1BA 4U9AA 1SZMA 2VTSA 4NW5A 3TJDA 3TEIA 3E8DA 3QRUA 5M4UA
chains in the Genus database with same CATH superfamily
1U54B 3CGFA 3T9TA 4B99A 3NMUF 1W2DA 3D9VA 1IASA 5KZIA 3TKUA 4DT9A 4EJ7A 1CMKE 5IQEA 3PUFC 4MNEB 3FPMA 3RWPA 4C33A 4IAIA 5FP5A 5GIPE 3VUDA 3KREA 2GNGA 3RK7A 4O96A 4H36A 3OCBA 2QD9A 2OXYA 4MD9E 4U5JA 4AP7A 2ETKA 3PE1A 3L9NA 4MD8E 3ZBFA 4DHIB 4EKKA 2VTTA 2RL5A 3BHUA 3Q96A 4PDSA 4RX8A 3RHKA 3SC1A 3EQFA 1JWHA 3QQHA 3MWUA 4F08A 1J7UA 5DR6A 4XV3A 4GIHA 3BYUA 2OFVA 3AMAA 3IGOA 4AFJA 4W4VA 5CNOA 2YWPA 3GFWA 5DVRA 4ZXTA 4D28A 2J90A 2W5BA 4GU9A 4QPMA 3LAUA 2J5FA 4A7CA 4BIDA 5AX3A 4EH5A 4F9AA 5I9VA 5JMSA 4RLKA 3QA8A 5AIRA 4FG7A 4B0GA 4D4VA 3EYHA 4EHZA 2ONLC 3OTVA 5FDXA 4FTUA 2XF0A 4I41A 5FXSA 4OTWA 4XRJA 5ACKA 2YAAA 1LEWA 1H28A 3COIA 2IVUA 3QC4A 1IRKA 1CKJA 1OL6A 2R7BA 4YO6A 4AAAA 5AP4A 3W8QA 4F0IA 3OW3A 2P4IA 4FV1A 3DDQA 3I5ZA 2F2UA 3NIEA 4RVMA 2A27A 4DH1A 3UOJA 4AXFA 4G3FA 2BTRA 2WHBA 4IEBA 3Q52A 3W10A 2RGPA 4EYMA 5DYJA 3GVUA 3UP2A 3CPBA 5D41A 2Z7SA 4L3PA 2R3FA 4MAOA 5BVDA 2XK3A 3AOXA 3E7OA 2R3NA 2VO7A 4D1ZA 2FGIA 4N0SA 5JRSA 2A2AA 3T3UA 3NNWA 4FSYA 5LMBA 5EQYA 2VTLA 3PPJA 4BZDA 3VHKA 3GNIB 4FTQA 4OAUC 2BMCA 2I40A 3OT3A 2EB3A 3TKHA 3ZLSA 2C6KA 2P3GX 3HDMA 4FTOA 1QMZA 3UQGA 2ZMCA 3V8WA 4ANBA 4BTKA 5ITAA 4AE9A 3A62A 4OGRA 4QNYA 5DRDA 2SRCA 4I21A 4FIGA 4G3DA 2WAJA 4MBIA 3LJ2A 3QAME 4RFZA 3VUHA 3VS0A 3ZO3A 4ALVA 2IG7A 4FZFB 3VJOA 4F65A 2CKPA 2GSFA 3KN5A 2GNFA 4GCJA 3W8LA 5J8IA 4K2RA 2GNJA 3MS9A 1Y8YA 3QD3A 3THBA 2VX3A 3U54A 5LOHA 4UZDA 2OF2A 3U8WA 2PMLX 1H1RA 2C6MA 2W5HA 3KEXA 2ITOA 4LV7A 5EQPA 1WBPA 3MV5A 4U97A 4TYIA 5JRQA 2QOLA 3R8VA 3IECA 3R01A 4FYNA 1G3NA 3UODA 3Q9XA 3OTUA 5JK3A 4QYYA 2Y0AA 4P5QA 2YM8A 4TWOA 1WVWA 2GFCA 2EUFB 3JVSA 2PUNA 3LFDA 2A1AB 2A0CX 1KE8A 4O38A 3EFWA 3CSVA 4APPA 4DH7A 1IAHA 1KOBA 3FV8A 3HEGA 3MBLA 4W8EA 4UEUA 2FVDA 3KL8A 3LFSA 3P78A 4J97A 3KA0A 2WKMA 1GZKA 1A9UA 4BCJA 3B2WA 3W55A 4NW6A 3GC8A 3Q53A 4TNDA 5AR7A 3PE2A 4IWPA 1OUKA 5AJQA 2GU8A 3PJCA 2IZSA 3ZSGA 4FODA 4WNPA 3ZH8A 2IW8A 2YJSA 3HMIA 4ZAUA 3CQEA 1PMNA 3ORZA 5BVWA 4AT5A 4IVAA 3W0RA 3N4UA 4EQMA 2BTSA 4M69A 4LV5A 3E3PA 4DYMA 3LFEA 3PXRA 2PUUA 4QP4A 4CSVA 1YW2A 2UZBA 3JY9A 3EOCA 4U3YA 5L8LA 1XH4A 3D2KA 4B9DA 4CXAA 3OBJA 3FZOA 3R00A 3UQFA 5FM3A 2VX1A 2WMSA 2BFYA 5DE2A 3A7IA 4YO4A 4W4WA 2VO0A 5HG8A 4PQNA 3V51A 1NW1A 1KE7A 2YEXA 1FVVA 2VWUA 4B7TA 3F2AA 4BHNA 4PPBA 3LMHA 3WF7A 5A3XA 1SVEA 4KABA 2IVVA 3P79A 4AFEA 4O22A 3E63A 4KWPA 1JLUE 3R02A 5IZFA 3HECA 2PE0A 2RFDA 3FLQA 4E7WA 3D0EA 2UW3A 5FG8A 5T68A 3R8UA 4C38A 4LYNA 3A60A 4DG2E 1W84A 1Z9XA 3R7YA 4YC6A 4C4HA 3Q5IA 3NIZA 3NYVA 5BVEA 4BDEA 5CASA 2R0IA 3FZTA 3LHJA 3QF9A 4EK8A 3WI6A 1ST0A 1XQZA 1M2PA 3P7BA 4W4XA 3RPVA 3ZOSA 5LCJA 3PJ2A 3R0TA 5JEBA 3PFYA 1Y91A 2RFEA 4XP3A 4YJRA 1H08A 5FEDA 5LMKC 3EWHA 3IW6A 4X6QC 5EW3A 4AW2A 5BYLA 4AQKA 5FXQA 3VN9A 5EDQA 3OOMA 3NFFB 4RJ3A 1XH8A 1CSNA 2OFUA 4I20A 1H01A 1WCCA 3KY2A 2GNIA 1T46A 3UC4A 3VF9A 1CTPE 4ZLZA 1S9IA 2HW7A 3JPVA 5J7HA 5AR5A 1IA9A 2I0VA 4FIFA 4DEDA 3C51A 4MXCA 4FKQA 4U43A 3MI9A 5I0BA 3VONA 3R6XA 3BBTB 3MPTA 3DFCB 3GC9A 4I5PA 5D10A 3BLHA 1UVRA 4MEDA 1WBSA 3OWKA 3TWJA 2W4KA 4EOSA 3H0YA 3U6IA 5A14A 5BX0A 3W33A 5M08A 3I6WA 2PVNA 4A06A 5D7AA 4O4BB 1OVEA 2P33A 3COMA 3C5UA 2CGUA 3VS3A 5E8SA 4J96A 3ZMMA 4WNMA 5A4CA 4GT3A 4FKUA 3QRKA 4FX3A 4JQ8A 4YJOA 5E8YA 3TJCA 3CR0A 3QFVA 3O8UA 3VUMA 4WD5A 5M57A 3QD2B 3LJ1A 2W9FB 5IDNA 3NNVA 3MYGA 4KBAA 4DGGA 3NYNA 3F2RA 3BYSA 4EOJA 5GJDA 3VRYA 4B8LA 4BBEA 3GU8A 3DK6A 3EN4A 4K8AA 5A46A 4CGAA 1X8BA 3EFJA 4FTKA 3FYJX 5EHYA 4S30A 3R9OA 3HV4A 3NNXA 2BPMA 1CKPA 4GK2A 2X81A 5AUTA 4GK4A 2PVJA 3QL8A 1HCKA 5EYCA 1J1CA 4FA2A 5KBQA 4O0TA 3G9LX 3H0ZA 4JG6A 4P90A 4X0MA 4FKJA 4AOIA 5G6VA 5IU2A 1BL6A 4CKRA 4F7JA 5FEEA 4GS6A 4BIEA 3HL7A 4F64A 3N4VA 4YC3A 4PPCA 4O2PA 5C26A 2XM8A 3QQKA 4FT3A 4EHVA 4O4DA 5IQBA 2OO8X 4PPAA 3A4PA 5EHOA 2OXXA 4PRJA 3MTFA 3PXQA 3R9HA 2QU5A 3AMBA 5CEQA 4FVRA 4ZS4A 4IZ7A 1BUHA 2JEDA 4AA0A 5M06A 3BEAA 3U87A 2QG7A 4U80A 4XUFA 4IX6A 1Z5MA 5CALA 5C8MA 3RJCA 4QQCA 4O86A 3RAIA 3LM0A 4D0WA 4FV4A 5AUXA 4EWHA 2IF8A 3ORPA 4FNZA 4WRSA 4FTIA 4AGUA 3R1YA 5IQIA 4KIPA 3L9LA 4CTBA 4M67A 4WRGA 4BHZA 3MJ2A 3QHWA 2JDSA 3NCZA 1OIUA 4AAYA 4P4CA 5KE0A 1U54A 5BNJA 5LVMA 1FGIA 2PYWA 4FF8A 1DM2A 4ZJJA 4B6LA 3VRZA 3D83A 5HOAA 4Z7HA 3LMIA 1H27A 4LQMA 3TM0A 2C5NA 2XA4A 5L2QA 5F1ZA 4BCOA 2F57A 4DINA 3F7ZA 5KMOA 3DPKA 4O1PA 4UMRA 5HIEA 4HVDA 3HVCA 3Q6WA 2OIDA 4RIXA 3H4JA 2UZTA 4BDAA 5GZ8A 2QC6A 1M52A 2YM4A 4FV5A 3L8PA 5EW9A 4AF3A 3MFRA 3UJGA 2XNEA 3IG7A 4FV6A 4KKGA 2ZB1A 3VBTA 3ZZWA 2WEIA 4NZWB 3GCPA 5HU3A 3A2CA 5DFPA 2W1ZA 3HUBA 2CN5A 4GL9A 1M14A 4I23A 4QYEA 4WBBB 4CFUA 5IEYA 1MQ4A 3COKA 3ZEWA 3K54A 3KXMA 2XIXA 5KMLA 3QUPA 1QPCA 2UVYA 4TT7A 3F5PA 3OCSA 4OTRA 5EM8A 2UZUE 3MTLA 3BIZA 3MB6A 4NTTA 3PWYA 4IQ6A 3DNDA 2LGCA 4TW9A 4ASEA 4DH3A 5HCYA 4ONAA 4BC6A 4CFXA 4YTCA 5CU0A 3EJ1A 5DT3A 2GDOA 3QX2A 4IZAA 5CZHA 3TG1A 5KX8A 2W0JA 4RFYA 4BDKA 1MRYA 4I6LA 3AT2A 4FT9A 4JXFA 1KE5A 5E8ZA 3SKCA 2BIKB 3F3WA 4D2TA 3DCVA 3EH9A 2WTWA 1JKTA 4RQKA 3ZFXA 1OKZA 4KAOA 4CNHA 3OCTA 2NYAA 3CC6A 4X6RA 1ZZ2A 4ANQA 2VZ6A 3MH2A 3WE8A 1E1VA 3BQRA 4E26A 3HMOA 3MY1A 3N9XA 4FIIA 4B4LA 4L01A 4MK0A 4FKGA 4PL4A 2E9OA 2E9UA 4ACGA 3R9RA 4AX8A 4FEQA 4RQVA 4WA9A 4LV8A 3VS1A 3OROA 4L8MA 4RG0A 4GJ3A 4PWNA 5E92A 4ZSLA 1O6KA 5TO8A 2XVDA 4H05A 2CLQA 4OLIA 4ASZA 2OIBA 4G34A 2VTIA 2ITUA 2WTDA 3AT3A 4QDVA 2X4FA 3V5WA 4EH7A 4YJPA 2XK9A 1FINA 2JAMA 2GHGA 4LM5A 3R7OA 4FTMA 4AN3A 5JN2A 4DEBA 4GYIA 4ZTRA 1OGUA 2CDZA 1OL7A 2PUPA 4LGGA 4AOJA 4OAVB 2P2IA 4P2KA 3C4FA 3OC1A 5AP7A 5E8UA 4G5PA 3HNGA 3ZONA 4WG5A 4XCUA 4E6QA 4WIHA 1NY3A 3WOWA 1OPJA 4RFMA 4FV9A 4BN1A 3EQCA 4RC3A 3CXWA 4M84A 5I9YA 2WQEA 1SVGA 4BTJA 3UNKA 4FEXA 4XMOA 2HZ4A 2J0JA 3UMWA 3D7TB 4QTEA 3ERKA 4MCVA 4HCTA 4J8NA 3H30A 5ANJA 4O7NA 4BWXA 3LKMA 4Z9LA 3ZFMA 2GTNA 2Z60A 2Q0BA 3RMFA 5C01A 3TUDA 4KS8A 2JBOA 2CGWA 2X1NA 5HI2A 4MNEA 1A48A 2C6LA 3FLYA 5HVKA 1G8AA 1FOTA 4Y83A 5AEPA 5J5SA 2PVLA 4O0WA 4CZYB 3MVHA 4IM0A 2HYYA 1W0XC 1YWVA 3FMDA 3OXTA 3VAPA 4F6SA 4HPUE 3FL4A 4XRLA 2H6DA 1YOJA 4DGNA 2ONLA 4IMYA 2BILB 4BCHA 4CMTA 2YAKA 5JQ5A 5HCXA 4KBCA 1H0WA 4PDPA 1YHVA 4PMTA 3G6HA 3QWKA 5IUGA 3O5AA 4LDTA 2WTVA 3NW7A 4L68A 2RIOA 4Y85A 2YM3A 1V0OA 2UZDA 4JDHA 4MQ2A 1ZOHA 4OBOA 5CSXA 3SDJA 3PLSA 3ORMA 2REIA 2XNBA 4F1TA 1KE6A 1QPJA 3R22A 5C4LA 2FO0A 3I0OA 1GIHA 4EK3A 2XNNA 5HBJA 5CT0A 3PY0A 4KSPA 4AZVA 3VO3A 3QXOA 5AM7A 2F7EE 3UIUA 4Z16A 4E4LA 5IISA 4ZY5A 4F6UA 3MY5A 3RZFA 1OKYA 4HCVA 4XBUA 4BI2A 2XIRA 2YERA 1VJYA 4AZEA 5KKRC 5IA2A 2HZIA 3W32A 5HORA 4W8DA 4C3PA 5CY3A 4PMPA 4U45A 3NLBA 4FOCA 4X2JA 2VTNA 5HICA 4D2VA 1RQQA 2JBPA 2WB8A 2XBJA 4TPTA 5CEIA 5HBEA 5J5TA 3KRJA 5C03A 3SX9A 3O17A 5HD7A 3U9CA 2JKQA 2X7FA 5FGKA 1PXNA 2J7TA 3KFAA 3R7UA 2R3MA 2WTJA 5AR8A 5L8JA 4G3CA 4RBLA 3ZLYA 3C1XA 5J87A 3E87A 3KN6A 4PP7A 2X9FA 4AA4A 1QPEA 2PL0A 4EUUA 5JT2A 2JKKA 1Q3WA 4R6VA 4E5WA 4BZOA 2ZDTA 2HOGA 4FKPA 4MD7E 5CSHA 3PPZA 2PMNX 3ACJA 3KVWA 3HLLA 4X21A 4ZY6A 4ACMA 5J9YA 3DY7A 2YCRA 3MVJA 4AW1A 2OI4X 2GS6A 4HYUA 3PSDA 4R5YA 5HBHA 4BCNA 1UU3A 3Q9ZA 3EB0A 4R3RA 2Z8CA 3LFQA 4FNXA 4TKSA 2ITPA 2YZAA 5I9UA 4BCKA 1IAJA 3R83A 2BZJA 3EIDA 1PXKA 5EQEA 3M42A 4BCPA 4EEVA 3PVWA 5E8WA 4FR4A 4AZSA 2R3GA 4NU1A 3BU3A 5F4NA 4DH8A 1YWNA 1YXSA 4IFGA 4AU8A 1LR4A 1YHSA 1UU9A 4U8ZA 3I79A 2VX0A 2VO6A 4AA5A 4X2KA 4C2WA 2YIQA 4RIYA 2EU9A 3LM5A 3QYWA 3KXNA 1KV1A 5GINE 4IAYA 1LEZA 4CEGA 2WMBA 4A9RA 4J98A 1TKIA 5HCZA 4BYIA 2X0OA 3IPHA 1Q8UA 2UW9A 4JBQA 4HGSA 3W2QA 3OVVA 4IXPA 3QWJA 2ZB0A 4TN6A 2GQRA 3QTIA 3W16A 3TIYA 1H1WA 2R3PA 4BJJA 3CTHA 5ANDA 2E9PA 2XIYA 4ZZNA 5BVFA 3HAVA 2OBJA 3C4CA 4QMMA 4RVKA 2Q0NA 2Y6OA 4JX3A 3BZ3A 4UB7A 4LOQA 3KXXA 4MF1A 3E8NA 2V62A 4FKTA 5J79A 4O0VA 2XP2A 3WE4A 3CJGA 3O7LD 4E93A 3UDTA 4DA5A 3H9FA 5HE2A 3DNEA 1YOLA 3LXKA 3OWJA 4FKWA 4QTBA 1UU8A 4LUDA 4O4EA 4FK3A 4X2GA 4WSYA 4ALUA 5I9WA 3ELJA 1URWA 4NIFB 3DAKA 2HIWA 3U51A 4RWIA 1P14A 2YABA 4UXQA 2OJ9A 5E1EA 3ZU7A 5HTCA 1PXMA 3MESA 3G33A 4X2FA 5HTBA 4CFWA 3OG7A 3GOKA 4GRBA 4OT6A 5HIBA 3O23A 4ZK5A 4AT3A 2WIHA 4CQGA 4QP3A 5IH5A 3NVMB 1OPLA 4MXYA 4FT0A 3OF0A 4LMNA 4S33A 2WO6A 4DH5A 3OEZA 3NUPA 1XH7A 4D4RA 2IWIA 2ZJWA 3KULA 4QP9A 5BPYA 5I9ZA 4J53A 3ID6C 4DFLA 4IVBA 4QDEA 3FLZA 4YU2A 4E6CA 4IVCA 4L00A 4WBOA 1GOLA 3SRVA 4FEVA 4AXCA 4DDGA 3LCDA 2W5AA 5IEXA 2G2FA 2BKKA 3AD5A 5IPJA 3RAHA 5DR9A 5LMKA 1PKGA 3UDSA 3C4ZA 4BIBA 4Z7GA 1ZAOA 1WBVA 3NAYA 2XNGA 2E9NA 4ZMFA 3QKKA 1PJKA 1H07A 2WQBA 1REKA 3F2NA 2J4ZA 2W7XA 2IW6A 2BFXA 4NTSA 4ACCA 3DB6A 3E8EA 4ZOGA 4X7QA 2VWXA 2OJJA 4U7ZA 3FHIA 1BX6A 1ZYLA 2KULA 5CWZA 2QQ7A 3IDCA 4F09A 3AQVA 3BEGA 3C4EA 3DBDA 4HOKA 3PA4A 3DJ5A 4UZHA 3W1FA 4DGOA 3ZC5A 1BI8A 2QVSE 4G6NA 4OW8A 2W05A 5EDPA 3P23A 4BTMA 3WF6A 2OG8A 2BDFA 5ETCA 1TQMA 3CQWA 4OTFA 3L1SA 4OBPA 5HESA 4G1WA 3PTGA 4I4FA 4K33A 4LOPA 4O4FA 3WZDA 4BCFA 4UMPA 5CX9A 3C0GA 1PKDA 3UPXA 3HA6A 3QKMA 4V04A 3FI4A 4M97A 2QO2A 5KUPA 3QQUA 4M69B 4DCAA 5BV3A 3KF4A 2RG5A 1OMWA 4ZSEA 1RW8A 5HO6A 1XBAA 5HLPA 4FIJA 5M51A 4BJJB 2O3PA 1ATPE 3ALNA 3T9IA 3BCEA 2FSLX 4M8TA 2W1CA 4D1XA 4FKVA 2X6EA 4YC8A 5C27A 4F63A 3FMHA 4NH1A 5AV4A 3V5QA 5DMZA 3TDVA 1H24A 3LQ5A 5H8BA 2R3RA 2ZYBA 4FSZA 3G90X 2XUUA 3P7AA 4JI9A 3ZTXA 2AYPA 3FZSA 1SVHA 1FPUA 2H9VA 4L46A 1ZARA 1VYZA 4IAAA 4R7HA 4EKLA 4DDIA 5I3OA 3ZM4A 1Q3DA 3KRWA 1H4LA 4NM7A 1KV2A 5IQAA 1UV5A 2PSQA 4XV1A 2C30A 5KBRA 3B8RA 2IO6A 2ZDUA 3O8TA 3KQ7A 3FY0A 4BF2A 5A4TA 4UV0A 1WMKA 4QQTA 4O82A 3G51A 3QHRA 2KTYA 3VS6A 4MTAA 3DDPA 4OTQA 3QCSA 4TTHB 4I4EA 4PV0A 5LWNA 5M09A 3F5XA 2C5YA 1P5EA 4YTIA 3HX4A 4R1YA 2H34A 4R1VA 5FTQA 4O0UA 2PUIA 1WBTA 3SHEA 4G3GA 2XCHA 1JSVA 3P0MA 3RWQA 2Y7JA 3L8VA 2BRNA 3OBGA 1ZYDA 3QTXA 3DXQA 3EFKA 3WIGA 3AT4A 3C4XA 4II5A 3HV3A 2HW6A 4U81A 3UVPA 3TXOA 5GIOE 4NEUA 4F78A 3UDZA 3AC3A 3ORNA 4AZWA 4E3CA 4PTGA 3V5PA 2BDJA 3MSSA 4MXXA 4O21A 5TKDA 5IMEA 4K1BA 3ODYX 4XX9A 4HVHA 5JZJA 4MHAA 5HE3A 4TWNA 2XK4A 3BGPA 3HP2A 4AG8A 1J1BA 4IBMA 3FMEA 4YPDA 3W0MA 4IM2A 2PE2A 2J0KA 2C1AA 2XMYA 2XYNA 2VWZA 4V0GB 3IOPA 3RPOA 3ZRKA 1FMKA 3GU4A 4DBXA 3O51A 4MNFA 2QKRA 4BY9E 5CQUA 3LFBA 2JDVA 3GENA 4F9WA 4Y46A 4YZCA 5BYZA 4EJNA 2WQNA 4BDIA 4QYHA 4UY9A 1PXLA 1PXPA 4W4YA 3L9MA 2B9FA 1OIRA 4CZTA 1J7LA 4O6EA 4FSWA 3O8PA 5ANOA 3FUPA 2ZM1A 2QONA 4FJVA 3HGKA 4FOBA 4HVGA 3CE3A 3S4QA 3IW8A 4HYSA 3PVGA 3VWAA 4ZJIA 2ERZE 5E1SA 3GXLA 4RIOA 5HO8A 4FUXA 3HV5A 2YLFA 4EH8A 4PF4A 4EOIA 3PLAE 4L43A 1PHKA 2OICA 5BVOA 5C1QB 2J2IB 3CD3A 2C6IA 1FQ1B 2AUHA 2UVZA 3H10A 1UWHA 3GFEA 4RVTA 1Q5KA 4Y5QA 1WVXA 5JGAA 5KNJA 4QP6A 2W06A 4QD6A 3AGLA 4U42A 3ZCLA 5L2SA 4AWIA 3DK7A 3W2OA 4ZEGA 3R1NA 3W2CA 5B2LA 3I1AA 5CSPA 4I0RA 3UGCA 2EB2A 3KCKA 4BWPA 4JIAA 1W2FA 4LRMA 1Q97A 3UOHA 3QZHA 3LFNA 1V0PA 5AV1A 4AGCA 3ZDIA 3FKLA 4KS7A 4CKJA 3KRXA 4WNOA 5KKRB 3BU6A 3ZSIA 2V7OA 3IQ7A 4BKZA 3VBWA 4YMJA 3ZBXA 1R0EA 2VWIA 4CLJA 2JDTA 1OECA 2C4GA 3GUBA 3I7BA 4H3PA 4EQUA 4HCUA 4PL5A 4ZTMA 4JLCA 2YCSA 4C58A 3OXZA 1H00A 5IA5A 3ROYA 3PJ8A 5BUEA 4K6ZA 5AAGA 3NUSA 1REJA 3OOGA 5DEYA 3D15A 2VWWA 5M44A 3O2MA 3BLQA 2QOKA 1JOWB 3V8SA 3HMNA 2B9HA 3RAKA 5H9BA 4ASXA 4KSQA 4IX5A 2IW9A 4DEIA 4R77A 4RT7A 3QTUA 1G5SA 2UZWE 2CJMA 3DA6A 4A9UA 2YM7A 4Q5HA 2VUWA 4FZ7A 4A9YA 3E62A 2J0MB 4RZWA 4DEGA 5B2KA 5IMXA 4U6RA 2R5TA 2A98A 3LOKA 4N6ZA 1PRYA 4EZ5A 5CEKA 2XJ0A 1W2CA 4AXDA 1YI3A 4D2RA 2XKEA 4EOOA 3BL9A 4RWKA 2X9EA 1WBNA 3AG9A 2W99B 4GG7A 3QUEA 4MVFA 4DHJA 4FTRA 1S9JA 4UYNA 3V6SA 1PF8A 3WYXA 1W98A 5AV0A 4FGRA 2C6OA 4L44A 3R9DA 4DTKA 4XNEA 1J7IA 3KIOC 3TYKA 4F9CA 2CCIA 2F49A 3M11A 4RIWB 4C4EA 2QODA 4MWIA 3CKWA 2VRXA 3F3TA 5ANIA 4WNKA 5LVPA 2VWYA 5AP3A 2DYLA 3LZBA 3Q4CA 5IUIA 5M4FA 3SRVB 3GGFA 3H3CA 4ORKA 4PL3A 5AMNA 3B8QA 2CGXA 1P2AA 3R63A 4GK3A 4ENXA 3MPAA 3I0QA 3ORLA 3C50A 3I4BA 4F7LA 3MA3A 2CKOA 4DF3A 2WMWA 3NUAA 5HIDA 3EMGA 2LAVA 4I22A 5CF5A 5CS6A 3FL5A 5CI7A 3ZXTA 3VQUA 3BGZA 2YITA 3IOKA 3Q6UA 4IDVA 3S95A 4KA3A 3UVQA 4ANSA 5A6NA 2VTRA 2WFYA 2HXQA 2YM6A 1OPKA 4HGLA 4CRSA 2HWOA 4EBVA 1LUFA 4LGHA 3UO5A 2BR1A 4I1ZA 5EK7A 4RJ4A 3TT0A 1WAKA 4JAIA 2WMRA 4QMUA 2HWPA 4BBFA 1W8CA 5EH0A 4IC8A 5F95A 4EZ3A 5IQCA 5IA0A 3T3VA 4U79A 3TZ8A 4LL5A 2GS7A 4AN9A 4LGDA 1OKWA 2F4JA 2R9SA 2X0QA 2XJ1A 3FI2A 4MBLA 4QP1A 3CIKA 4JBOA 2DS1A 4USDA 4XOZA 4YZDA 4Q5EA 2AEGA 4AUAA 3OY1A 4DITA 1SNXA 3AD4A 4EOKA 2AQXA 3LLAA 4NM3A 5CVGA 5JGDA 4I3ZA 2QHNA 1R39A 2OH4A 3QTSA 3WILA 2W1FA 3TNWA 3ZO4A 4FZDB 3WF9A 3ENHA 4CYIA 1GIJA 2WPAA 3KRRA 1XR1A 4BDBA 3PJ3A 4ALWA 1XBCA 3PP1A 3NUUA 3BHHA 2BHEA 2X0PA 3NUXA 4JT3A 2XS0A 2WTIA 2ETRA 3O50A 2HENA 4DT8A 4IDTA 3PXFA 4QMLA 5EM5A 4UN0C 3ET7A 4NL0A 4EH4A 3LPBA 3UG1A 4O7LA 1OL1A 3KF7A 4OT5A 2CPKE 4E4MA 3MVLA 1YXTA 4XEYA 2UW7A 4OTHA 1M7QA 1ZWSA 2W9ZB 3DBQA 3KXGA 3UTOA 3HV6A 5CAOA 4QMYA 2PVKA 3VJNA 4F1OA 2B0QA 1VYWA 2HCKA 3F3VA 4QMWA 4GT5A 3M2WA 4P7EA 3ULZA 3EQGA 3QRIA 1YWRA 1U46A 3FQEA 3T8OA 2ETMA 3CGOA 4E20A 2BIYA 5L2WA 5HE1A 5CU3A 3AC8A 1ERKA 5FQDC 1NT2A 2AC5A 3FE3A 3MGYA 4FSMA 3Q4UA 3GB2A 3POZA 4RA5A 4TWPA 3WZKA 1YHWA 2OH0E 4ANOA 1CKIA 2Y4PA 2GNHA 1OGYA 3PUPA 4FIEA 3FDNA 3SXFA 3QUDA 3ETAA 3H9RA 4G17A 4IADA 2VTOA 3A7FA 4DFUA 3PY3A 3Q2JA 4C59A 3RPYA 2WMXA 3CTJA 1H26A 1Z57A 4EH9A 4QMQA 1PMUA 2YDJA 4IB1A 2P55A 1NVRA 4IVDA 3V5JA 3SG8A 3NEWA 4XLVA 3HAMA 3KXZA 3QRJA 3UYTA 2PVMA 5CAUA 3K5VA 2EXMA 4UMUA 3RNYA 1H1SA 4R3PA 5TE0A 2BHHA 3OCGA 4IB3A 5HVJA 3WBLA 2DUVA 2OK1A 1ZMUA 1FGKA 2XBAA 3O71A 4YLJA 3W2RA 1ZY4A 3FSFA 3IW5A 3II5A 4N4SA 2UW6A 3QTWA 3GU7A 4QTCA 2ERKA 4GV1A 5HHWA 5L6PA 4M15A 2W1EA 4F7NA 1H0VA 3Q2MA 4BZNA 4CD0A 3MW1A 2ZMDA 3UDBA 3ZS5A 4Q9SA 2VTHA 2BCJA 3MA6A 3AGMA 4CQEA 3UIXA 5E9EA 5H3QA 2O0UA 2QNJA 2IZRA 5ICPA 4EOMA 1SYKA 4C2VA 2EXEA 5FWKK 3DKOA 5KMNA 3BE9A 3O0GA 4OTIA 5HNBA 1Q8WA 3POOA 3E7VA 5HGIA 3DQXA 1CM8A 5CF8A 1OKVA 3MPMA 1DAWA 2FA2A 4PP9A 2ZAZA 3OWLA 4IW0A 3REPA 2BALA 5AADA 1Q24A 5HG7A 3R8MA 4F1MA 5AA8A 2B53A 5DLSA 4ZLYA 4XOYA 3RM7A 5JQ8A 2UW4A 2WQMA 4ID7A <