3W1FA

Crystal structure of human mps1 catalytic domain in complex with 5-(5-ethoxy-6-(1-methyl-1h-pyrazol-4-yl)-1h-indazol-3-yl)-2-methylbenzenesulfonamide
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
280
structure length
259
Chain Sequence
b'ECISVKGRIYSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDGTVNYMPPEAIKDMSISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELLAHPYVQIQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dual specificity protein kinase TTK
publication title Indazole-based potent and cell-active Mps1 kinase inhibitors: rational design from pan-kinase inhibitor anthrapyrazolone (SP600125)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 70
structure length 259
sequence length 280
ec nomenclature ec 2.7.12.1: Dual-specificity kinase.
pdb deposition date 2012-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3w1fA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3w1fA01
3U8WA 4Y95A 2C1AA 4N70A 3LJ2A 2FSLX 4NCTC 3UG1A 5HX6A 5IA2A 3MSSA 1ZYLA 2WMTA 1JQHA 2J6MA 4GIIA 4CZYB 4RPVA 2JDRA 4U5JA 3FKLA 4DH7A 3E3BX 5DNRA 2F57A 2V55A 1HCLA 3A99A 4LOOA 3DT1A 2JDSA 4XH6A 4QP9A 4DH8A 3L8XA 5FXRA 2ZV7A 3JVSA 3LM0A 3P9JA 5KO1A 2OLCA 2V22A 4IB0A 2YACA 3DKCA 2BFYA 4KRCA 3HA6A 3FPQA 4XRJA 5DWRA 4FV2A 4Y72A 4JBVA 3UOLA 1ZYCA 4I1ZA 5CT7A 4G2FA 2IW6A 1SMHA 3ZLYA 4ZOGA 5DN3A 4ANSA 5M08A 5D7VA 3NUPA 4K1BA 4W4YA 4O7YA 2PZYA 2V7AA 4E5BA 4FIIA 2XH5A 2X7GA 4IX4A 4JQ8A 5C8KA 2DYLA 4XP2A 2R0IA 4AW2A 4D1SA 4UWBA 1R1WA 3BGZA 2C0OA 3FI3A 3W2QA 2YHVA 3O7LD 5B2MA 4N6ZA 3PSBA 3FLNC 4NFNA 4Q5HA 4X3JA 4XOZA 5IQCA 3LM5A 3O51A 4F7SA 1SVEA 4LOQA 3PP0A 4RGJA 5H8GA 4DAWA 3JS2A 2E9OA 4IWOA 4YHJA 3VUTA 2H9VA 4EJNA 4U3YA 4HW7A 4QPSA 3Q4CA 4FKVA 4RX8A 4MXAA 4R6VA 4K8AA 3LCDA 4UMTA 2WQMA 3MVJA 4JT3A 2VTSA 1OGUA 4FTTA 4MKCA 3ZFMA 4OTHA 4IFCA 3PPKA 4R1VA 3MTFA 5DEWA 4G3FA 4BDAA 5E8TA 4A4OA 5FQDC 4BCFA 2OWBA 1UNLA 3NZ0A 4RZVA 5EHYA 3B2TA 4TYEA 1WVWA 4FEVA 5C1QB 4RBLA 3PIYA 1R78A 2UZNA 2W05A 3MH2A 4PV0A 3DXQA 1ERKA 3R6XA 5IQBA 3LHJA 5IA4A 5HBEA 2OF2A 3KULB 3NNVA 2Z8CA 3QCQA 5D9HA 4O0RA 3PP1A 5E8SA 3BLQA 1YKRA 3Q60A 4E6DA 4I5MA 5GZ8A 5JGBA 1XH8A 4ZSJA 4YTCA 4O21A 3FQHA 4IB1A 3ZO1A 1FGKA 3VUIA 5IQAA 4IM0A 4C7TA 4OTRA 1ZRZA 3KXXA 3TNWA 1E1XA 3NGAA 5JK3A 5J87A 3UYSA 3MY0A 4OTWA 2C3JA 4F7LA 4CV8A 4F9BA 3WIGA 1ZXEA 5BUEA 2A27A 4KB8A 3BEAA 4Z9LA 2XM9A 3PPJA 3CJGA 4WNPA 2WMAA 4O7NA 1H28A 4RWLA 4OAVB 2FVDA 3AC3A 4I41A 4DCEA 4M3QA 2R3JA 3AC2A 4ZLOA 5C8NA 1GIHA 3AOXA 3N9XA 4LRKA 1M14A 3TL8A 4FTOA 3QD0A 2W4OA 3SC1A 3EWHA 3NUSA 1ZLTA 3CLYA 3DXNA 1B6CB 3IK3A 4JDKA 4A9TA 3IDBA 2VTJA 3D0EA 4WG5A 4YC6A 5A6NA 4U8ZA 3UP7A 3AGLA 3MJ2A 2CGVA 4U7ZA 1BUHA 5DA3A 4W4XA 1OECA 5L2QA 2VTHA 5HBJA 5I9ZA 3UZRA 3CQEA 4BKYA 3PY3A 4EEVA 4YJRA 1QMZA 4BDJA 1XBAA 2IVVA 5HE3A 2ITZA 4D1ZA 3D2IA 3W2RA 2JAMA 2CLXA 2F7ZE 2BPMA 3SKCA 4YJVA 4C3FA 4D2PA 3NCZA 3RP9A 3D5XA 2Z60A 3C4CA 4IC7A 4P5ZA 5DOSA 2J2IB 3TIYA 5EYCA 3VBWA 3QTRA 1I09A 3H4JA 2UZTA 5GINE 5CWZA 2B4SB 2E9NA 2ETMA 4JI9A 5DPVA 4RJ4A 3O96A 3SQQA 2LGCA 4U43A 3V5LA 4XLVA 3LZBA 4HCVA 2EXMA 5L6PA 3DJ7A 3BGQA 3PFQA 3QF9A 3HMIA 2VWBA 3U6JA 3BHUA 3PXYA 1MQBA 5EI8A 4ZLYA 2W1DA 3TTJA 1CM8A 1UNGA 3AD5A 4YLLA 4X7QA 3BYMA 3QZIA 4MHAA 3DTCA 3MIYA 3NS9A 2PUIA 2PVKA 3WI6A 4KKEA 4XV9A 5LCJA 2Z02A 3BHHA 2RFNA 3C0GA 5AV1A 2B54A 4NM0A 1J1BA 1ZYSA 4FOBA 2IZTA 4M13A 4YJSA 2PUUA 4JG8A 3R8UA 4O96A 3MYGA 5CY3A 3CD3A 4IEBA 4KWPA 4I3ZA 4L52A 4MNEB 5AUZA 4CFMA 1FMKA 2XIYA 3DK7A 5AIRA 5BPYA 2R3NA 4J99A 3V6SA 3NNWA 5IQGA 4BCGA 4NM3A 3V51A 2HAKA 4BYIA 3PDTA 4X0MA 2XBJA 4OTIA 4YJNA 3HP2A 4HOKA 4EOIA 4RX5A 3ZOSA 2OK1A 3BZ3A 4NW5A 2FSMX 4ZS4A 4TXCA 3MPTA 4BRXA 3IOKA 4YZCA 2CDZA 5HO8A 2YLEA 5FDPA 5I4NA 3S95A 2QOCA 5L6OA 3AC4A 5CI7A 4RVMA 3KCFA 1KV2A 2CMWA 3ENHA 4IWPA 3ZH8A 3JY0A 5AP0A 4FEXA 1HOWA 3HMOA 1BX6A 4I5PA 5BUIA 4TYIA 2NRYA 4EOLA 4GJ3A 4N57A 1IR3A 3CS9A 3TV7A 5CU3A 2X6EA 1NXKA 1JOWB 2O5KA 5E7RA 2C3KA 4F6UA 4WUAA 4BI0A 4EZ3A 1W82A 4C02A 4RWIA 2JKOA 5HCZA 4E26A 3TNHA 4F9CA 4J71A 4MXCA 3KMWA 2R3GA 3F2RA 3LFNA 3JY9A 4BKJA 4JBOA 1KOBA 2FH9A 4IJPA 4DEAA 3R21A 4KSQA 3N4VA 3OY1A 1ZY4A 5M4FA 3C9WA 2HXQA 2OJJA 2C68A 3PIZA 3VS4A 1JSTA 3AMYA 2JKKA 2O2UA 3FL4A 3QC9A 4O2PA 5AX3A 5HGIA 3W8LA 2CCHA 2YIRA 3L9PA 5CEPA 3FXXA 1K2PA 2R4BA 4I4EA 4FIGA 2GPHA 3C4XA 4USDA 3LMGA 4FT7A 3F3WA 3RAWA 5G1XA 3ZRMA 3BYUA 1QPDA 5DH3A 3GU8A 4DH1A 4UWYA 3ORKA 4CVAA 5E1EA 3G15A 5JFVA 5AUUA 5JFSA 4QT1A 4FZ6A 3C51A 3QBNA 4KBKA 2QR8A 3OW4A 3PUPA 5D11A 3HNGA 5K3YA 4PP9A 5D12A 2GFCA 4C4EA 5KZ0A 4X6RA 5CZHA 3BWFA 4AXAA 3GCUA 3F5XA 2OZOA 4D2SA 3UNZA 3HL7A 4QP4A 4TNBA 4F09A 3H0YA 2PWLA 2WU6A 2JDVA 3GI3A 4LMNA 3OWJA 2I7QA 4BY9E 4JRVA 4EOSA 2G1TA 1GIIA 1Q8YA 4PMTA 3BHVA 4H36A 2JBPA 3OXIA 1BI8A 4WO5A 3NUYA 3MB6A 1O6KA 2YERA 2X0GA 4X3FA 4QP1A 2UV2A 2SRCA 3KF7A 3DJ5A 1M2QA 3QU0A 5HG9A 3CTJA 3ETAA 1JAMA 4BB4A 4WOVA 4D9UA 5E1SA 2C6OA 4CLJA 3A2CA 4APCA 3GQLA 5JQ5A 2VTPA 3SW4A 3IGGA 2WAJA 1H0VA 3PJ2A 3E88A 2Q83A 3ZFYA 4FSRA 4A9SA 1K9AA 3W2CA 4C59A 3HAVA 3MGYA 2P0CA 4TT7A 2OJIA 4CFUA 3LW0A 1DI9A 5EM6A 3IKAA 3ORZA 4J98A 4X6QC 3V6RA 3ZCLA 4ZJIA 5HORA 1VEBA 2V0DA 2F7XE 3QC4A 3ZBFA 4O1PA 4MBIA 2BKKA 4YJUA 4ANNA 4L45A 5LVNA 5M4IA 5EM8A 4ACDA 2ZVAA 2VX1A 4H3PA 1AGWA 4ERKA 5FDXA 2VTLA 4D5KA 5KHXA 4B6LA 3GBZA 3WE4A 4DT9A 4YHFA 5EH0A 3PE1A 3CTHA 3PIXA 4GFOA 5CZIA 3CD8A 5JZNA 3RHXA 5B7VA 2XM8A 4BBMA 2WO6A 3R7YA 3K5VA 5D10A 4WD5A 3TV4A 3F82A 4ZP5A 3TNIA 4UMQA 4AAAA 4CYIA 5M51A 1KE9A 2GFSA 2QONA 3N4UA 4CG9A 5BVOA 1CSNA 5CS6A 5K9IA 5KMMA 4MF0A 3CE3A 4DH3A 2Q0BA 3HAMA 2VUWA 5FXQA 4C58A 3C50A 4MNEA 3V5QA 1H1PA 5AUYA 4I5HA 1P4OA 1S9JA 3GOPA 4MXXA 4YLKA 4EI4A 4AGCA 2YIYA 4MXZA 3R7OA 3CY2A 3EFJA 3RAHA 5I9XA 1R0PA 3UPZA 4ZLZA 4ONAA 3ATSA 2HZNA 5HI2A 1M17A 3GXLA 4BGHA 4C36A 2R3HA 2XJ0A 3Q9XA 1NA7A 2XJ1A 3WF7A 4O7LA 4DEHA 2BMCA 3QAME 1YHWA 3QYWA 3UP2A 4ZAUA 5H3QA 4UBAA 3O71A 5ANKA 5KMOA 1YI3A 2VGOA 4EOMA 4AN2A 3E7VA 2XUUA 3POZA 1W8CA 1P14A 4ARKA 3UGCA 2QHMA 4RIOA 2B7AA 4U97A 2VWUA 4BWXA 3DBEA 3V01A 4JG7A 3KRRA 2XMYA 3C0IA 5IQEA 4J96A 4ANLA 3LXNA 4I5CA 4BTFA 4KSPA 4CT2A 3VVHA 2DWBA 3FE3A 4RLKA 3G33A 3QUPA 2Z7LA 1XH7A 4E4NA 5EYDA 3AT2A 5LQFA 3CXWA 3PTGA 2Y4IC 3UVQA 4QP6A 5CNNA 4KIKA 3HP5A 4O7RA 1JSVA 4EUTA 5CEKA 3R00A 2X8DA 5M4CA 2YWVA 5BVDA 3D5VA 1XQZA 3LFBA 2JIIA 4GRBA 4AFJA 3I6UA 1A06A 4E4LA 4HVDA 4MD8E 4KAOA 1G3NA 4OT5A 4YLJA 5LOHA 2O8YA 4YNEA 2ITTA 5L8KA 2CSNA 3D5UA 4F70A 3KRJA 2DUVA 2VX0A 3L8SA 2I0EA 3GU4A 1KWPA 3GC8A 5AADA 5LXMA 3KKVA 4QOXA 4IAFA 4QTAA 3ZDUA 3AC1A 4W8DA 4Z3VA 2PSQA 2QVSE 4JL9A 4O7VA 2PVFA 1WZYA 3GQIA 2P33A 4X2FA 5H8EA 2C4GA 4QTCA 2YJRA 1U54A 4GW8A 4AQCA 3OVVA 2Z7RA 4CRSA 4R3CA 3P1AA 4JAJA 3U54A 4BCJA 4FG7A 3VBYA 4FSUA 3RPYA 2OJFE 3VBXA 5A14A 3DAEA 1H1WA 2C30A 2YM4A 2X9FA 5HLNA 1XBBA 2R2PA 3QLFA 3QTSA 1QL6A 4EHEA 3SG9A 5AAEA 4OW8A 3RBWA 3CIKA 3AMBA 1PXIA 4OTQA 3LMHA 3KMMA 4I23A 5GJDA 3U51A 5C4KA 4CD0A 4F6SA 3KL8A 3ZFXA 3E8CA 3E8EA 3MIAA 4KS7A 3KXHA 3RK7A 2C6EA 5CEOA 3QD4A 2Z7SA 1XKKA 4G17A 4APPA 3KREA 1JWHA 4PDSA 5AV2A 4QTBA 3DV3A 4ZTLA 3FMMA 2O65A 2RFSA 3NUNA 4M69B 4GL9A 4FKOA 3RI1A 3E64A 3V5JA 3VJNA 2ZM4A 4GKIA 3EYGA 4WNMA 3LFDA 4QPMA 1CMKE 1YXXA 4HPTE 3WF9A 4FR4A 3WF8A 2UW3A 4PQNA 2YWPA 5DI1A 4CKJA 3DDPA 5DRDA 2NP8A 3FZRA 4FTQA 3M42A 4M67A 4ALUA 3V04A 5T3QA 2JBOA 2UVXA 3IW7A 3PZHA 2IW9A 3TM0A 3FMEA 3JYAA 4O91A 4ZTRA 5IA3A 3PG1A 5E92A 4PMMA 2OW3A 4GYIA 3NRMA 5LVLA 4HVSA 5AUTA 3G9NA 4LYNA 4K77A 4D9TA 4TWPA 5FEDA 1ZAOA 4BDFA 5C9CA 2GNFA 5KBRA 3TUBA 3EL8A 3OF0A 4DN5A 5I0BA 2QO7A 3C4EA 2R3LA 3P7BA 4JDHA 4OTDA 5TOZA 3RTPA 5FTGA 5E91A 4YGAA 4Y83A 2BR1A 5AV4A 5J7BA 5L6WL 1REKA 3KXGA 4A7CA 1UU3A 4HGSA 3TXOA 4B7TA 3Q52A 3LFCA 1SVGA 3UNJA 2R7IA 4OGRA 4JQEA 2GQSA 4R1YA 2GCDA 3R0TA 2F4JA 3HVCA 3LFSA 4IMYA 1UKHA 3R8LA 3RCDA 5A4LA 4A07A 3LE6A 2Y6OA 4E4MA 4FMQA 1DAWA 4FSMA 4NUSA 2CN8A 3VC4A 5IEYA 5CTPA 5M44A 4BDEA 2R3RA 5ACKA 2CKEA 2ZV2A 4NTTA 4QYYA 3GUBA 3Q5IA 3BHTA 5CQWA 1RJBA 5TT7A 3R9HA 4TW9A 4IVAA 5DRBA 3O17A 3R1QA 5J95A 4FV3A 5I3OA 3UTOA 3OP5A 5AV0A 2WD1A 5E9EA 3S1HA 3PVUA 3R7EA 2I40A 5CEQA 4F99A 5CAUA 3CEKA 3FBVA 4MVFA 3OXZA 4YTIA 5AEPA 3ENMA 4MBLA 4WBOA 2UZUE 4HYHA 1YI6A 4U41A 2NO3A 4FNZA 4Q9ZA 3Q32A 4O82A 1OIYA 5C8MA 4EK8A 5HIEA 5J5TA 3QXPA 2ETKA 4L7FA 2YM3A 2FB8A 4X3FC 1J91A 3RAIA 4HYIA 3H0ZA 4GH2A 3HV3A 3F6XA 3GNIB 3UVPA 2C1BA 3ZO4A 4FV7A 4FZ7A 4I20A 3DDQA 2XNOA 4L3PA 4M8TA 4MQ2A 4HVHA 4RJ5A 3E92A 4IM2A 3H3CA 1YDSE 2R9SA 1AQ1A 3HYHA 3BLRA 3UE4A 1JKSA 2W1FA 4YZDA 2BCJA 3P0MA 4FT3A 4BCIA 1KOAA 4C2WA 4FBXA 3R01A 4U80A 2V7OA 5IEXA 4P5QA 4AOJA 4U44A 4CSVA 3EJ1A 3PVBA 4L67A 2X2LA 2YJSA 4E8AA 4LQMA 4DFXE 4FT5A 4DTAA 4F9YA 4PNIA 3MFUA 3CGFA 3MA6A 2G15A 4ZIMA 2IVTA 3BQRA 4K33A 4BKZA 3ET7A 2WTKC 3V3VA 3THBA 3RKBA 3ZONA 1PXLA 4OUCA 2QKWB 5HQ0A 3R8VA 4I4FA 2GQGA 3BV2A 3HV7A 2E9PA 4RSSA 3H9OA 5ANOA 4RJ3A 4M14A 3UQGA 4K0YA 4KIQA 4F08A 2WQOA 1V0PA 2A0CX 5I9WA 4RG0A 4PDYA 1Y91A 3ZHPC 1IEPA 5ANEA 2UZDA 1WBOA 3FWQA 4O0SA 4UX9A 2REIA 4WSQA 2W9FB 4D0XA 3TZ7A 2A19B 3EQBA 5FLFA 1Q8UA 1U5QA 5BVNA 3UO5A 4QYFA 1WBWA 4LOPA 2OIBA 4JNWA 5J1VA 4O0XA 5ICPA 2GHMA 3RPRA 3FLQA 1FINA 4FKIA 3WZJA 4J8NA 4EBWA 4XG9A 4BDDA 5TE0A 3VJOA 1YRPA 4DFUA 1ZARA 4I0RA 3QTXA 3OROA 1F0QA 4M69A 4IB5A 5HESA 1CDKA 4DG3E 1IAHA 3R9NA 4UWCA 3CQWA 3AT4A 4DBNA 4AN3A 1U5RA 1J1CA 4AG8A 1NY3A 4FKQA 5BNJA 5AR3A 2IN6A 3ZTXA 4AF3A 4DGMA 3CPBA 4BI2A 4Y5QA 3MVHA 2PK9A 3UJGA 3MI9A 2VWIA 4J1RA 5EYMA 5HNIX 5JH6A 4NKAA 4CLIA 1YXVA 5FWKK 1XH4A 2OXDA 3BQCA 3NW5A 2W1EA 3TJCA 4ALVA 4QYHA 4O38A 5HCYA 3W32A 3KK9A 4EL9A 2PVYA 4AA0A 3BYOA 4GK2A 2J4ZA 4AZTA 2J0MB 5C03A 3P78A 5K4IA 3UDBA 4JRNA 2YIWA 3FDNA 5EQYA 3SG8A 2RKUA 4CKIA 3PJ3A 3FI4A 3UIBA 4O7WA 1H1QA 1Q8ZA 2CLQA 5FTQA 3HEGA 5ACBC 4G6LA 2UZBA 2VNYA 4WA9A 4ZSAA 4FIEA 3UIMA 3UYTA 4GVJA 2LAVA 2Y4PA 4QMXA 3SOAA 2IWIA 3MV5A 2PMNX 2QLQA 3I1AA 3PRFA 2VTOA 4FTUA 4IXPA 3KY2A 5G6VA 4R78A 5I5ZA 4PPAA 2C6DA 3A8XA 3NUAA 2QLUA 5LCKA 3Q4TA 4GV1A 1JKLA 5LVPA 2OZAB 5J8IA 4LUDA 4QMSA 4OT6A 2XYUA 3VUGA 1GAGA 5IUIA 2BDJA 1W0XC 4BC6A 1S9IA 5IQFA 3SXRA 5GIPE 2QCSA 4ID7A 4ZK5A 4DGOA 3CGOA 4JOAA 2PVJA 4IX6A 2PHKA 2B1PA 3SX9A 3DZOA 3LFFA 3W2PA 5KNJA 1GIJA 4JLCA 4U79A 2JIUA 4BCPA 2P2HA 4MWHA 3VAPA 3F2AA 4D1XA 2ZMCA 5FEQA 3HUCA 3NVMB 4FKSA 5HIBA 5IPJA 3P23A 4HPUE 1O6YA 3OOGA 4BIBA 4QYEA 1AD5A 4UB7A 5CANA 4BF2A 4C4HA 2HIWA 2WEIA 2UW5A 3A7HA 5EDRA 2PUPA 3QRUA 5CF5A 4TYJA 1UU8A 4AOIA 3FZ1A 3KC3A 4BHNA 5EQEA 1PXNA 3RNYA 4UZDA 1Y6BA 2ITYA 1K3AA 2B9FA 5J7HA 4O1OA 5HHWA 3LOKA 3BWJA 1OM1A 3UPXA 2VTTA 3E8NA 2WQBA 4FX3A 5IH5A 4FGRA 2FO0A 1OKYA 5AV3A 3ZYAA 3NLBA 4BBFA 3I7BA 5CF4A 4RX9A 2ESMA 2BDFA 2AYPA 4ASEA 3RPVA 3B2WA 2IW8A 3SAYA 5L2IA 3IW8A 3BCEA 3H9FA 2X2KA 2UZVA 4RWKA 3K2LA 4FIHA 4FSZA 3IDPA 2QR7A 3TUDA 4HYSA 4KKHA 2ITOA 2PZPA 2J5EA 5A4EA 2W4JA 3G6GA 4FTLA 4I24A 4C4GA 2E9UA 1ZMVA 3E5AA 2PU8A 5BQ0A 2I0YA 4BCQA 2EXEA 4DC2A 5CXZA 4CG8A 3D4QA 4N4SA 3NW7A 4LV8A 3HV4A 2UW9A 4N6YA 4O6EA 4BDIA 3KXNA 3E3PA 3C1XA 3CR0A 4I93A 4F9WA 2YM8A 4DYMA 3R1NA 1YXUA 2XIZA 2XKCA 4L3JA 2OBJA 3BE9A 5E90A 5I3RA 1FOTA 3VRYA 4L01A 3PJ8A 2HWPA 3Q6WA 3PXQA 3T8OA 2R5TA 1NVRA 1PXKA 3EN9A 1ZOEA 3L1SA 4Y5HA 5D1JA 2HW7A 3EQPA 3FZTA 1TQPA 3TG1A 1PXPA 4RA5A 3UZTA 4RQVA 4D2VA 2BAQA 3D15A 4QYGA 2XKEA 4ZTHA 4CT1A 1JNKA 3QQGA 3R30A 4DINA 3KXZA 4RFZA 2QODA 2OFUA 5DMZA 4NM7A 4L53A 4RJ7A 5A6OA 4AACA 1FVTA 3OWLA 3UMXA 4ANQA 4F64A 3KN6A 4CFXA 5K5NA 3C4FA 2WEVA 4DG0E 3NIEA 3EFWA 4A06A 2UUEA 1GJOA 3MWUA 2DS1A 5DR9A 3ZEPA 3NAYA 4U81A 3HRCA 2VTQA 2XIRA 3FHIA 4YBKA 4QMNA 5J1WA 2EWAA 2IZSA 3DQXA 4IZAA 1J7LA 3VS2A 3ZMMA 4FEWA 2XK9A 2WIHA 3MH1A 1B39A 4GYGA 3V8SA 3BPRA 3WOWA 2OIQA 1SNUA 4EKLA 4X3FB 5D7AA 4IADA 4AE9A 4U6RA 4TWNA 2ITPA 5EYKA 3T3UA 4ZY4A 3LKMA 1YQJA 5HU9A 5AR4A 2BFXA 3VUHA 4O0VA 2B9HA 3OCBA 4F7NA 3QQJA 4RQKA 2J0LA 3MY5A 1IA8A 5EOLA 3RHKA 4G9CA 4IC8A 4L3LA 5EM7A 2IG7A 2WGJA 3IG7A 4HJOA 3HX4A 2OZAA 2CGWA 4FG8A 4QMLA 5IU2A 3CTQA 4RVKA 1GZ8A 2VO0A 4XHKB 4FG9A 4IZ5A 2QQ7A 5IH6A 4FUYA 4FNYA 5JN2A 5K0KA 4FV9A 3AD6A 5A3XA 1PYXA 2W1IA 4BIEA 3HV5A 4F4PA 3IW4A 5AUWA 4XNEA 1Q61A 2ITVA 3QFVA 4CZTA 5AM6A 4FK6A 3WARA 4MH7A 5KE0A 1H25A 1PXJA 4FF8A 4XMOA 4FTAA 4UYAA 4V05A 4XEYA 3VS7A 3MESA 1W98A 2W4KA 2XBAA 3QL8A 3QWJA 3R04A 4LGGA 4OR5A 4XG2A 5ETAA 5HIDA 2W5AA 3K5UA 2VNWA 4FT0A 4YBJA 5FEEA 4E1ZA 4EOKA 4QP7A 3OTVA 3EFKA 3EIDA 3C4ZA 3PE2A 2A1AB 2ZB0A 1ZOGA 2O63A 3U6IA 2CNVA 4AFEA 3DA6A 1P5EA 1FVRA 3CPCA 1JKKA 2RG5A 3U4UA 3ZUTA 3IOPA 5BVKA 1OPJA 3PWYA 4ORKA 2BTSA 4KBCA 3A7GA 1OL6A 2PPQA 1VZOA 4IWDA 2HY0A 2H6DA 4H58A 4OBQA 5L8LA 5F20A 2XVDA 3DOGA 4DA5A 1YXSA 4KBAA 5KHWA 3NUXA 3IDCA 4FL3A 5AP7A 5JSMA 2C6KA 4U3ZA 3H10A 3QUDA 2CHLA 1UNHA 1H01A 3G90X 2X8EA 5TR6A 3WYXA 4PL4A 2WMWA 1OITA 2V5QA 1G8AA 3CC6A 2X4FA 5KMLA 3IECA 4B8MA 3GC7A 4D2WA 4TYGA 4BL1A 2YDJA 3O2MA 2V62A 4FICA 5AP6A 2C5OA 1OKVA 5HU3A 1T45A 3QTIA 3BI6A 4GFMA 3LFAA 4BR3A 4YP8A 3F5GA 4HCTA 2Q0NA 3BV3A 4AT4A 2X2MA 3A7JA 3VF9A 3PXFA 3ORPA 4U45A 5HNBA 4MBJA 4OAUC 2CN5A 5GIOE 2YAKA 4FSNA 3RGFA 4FVRA 4DFBA 4H3QA 3HA8A 3A62A 5I9VA 3PSDA 4JJRA 5LJJA 1ATPE 3FYKX 4X2GA 4W9XA 4IE9A 4IIRA 4KIKB 4UXLA 3V5WA 4WNOA 1L3RE 1RQQA 2IZRA 4FYNA 5FD2A 4JIAA 3Q96A 1O9UA 2WELA 2IJMA 2YCFA 1YW2A 2WMUA 2VV9A 4FOCA 4NJ3A 2PMIA 2GS7A 2WTIA 3I0OA 4YPSA 5DG5A 5M55A 4B99A 5AUXA 3IPHA 3PLAE 2F2CB 3EMGA 2HY81 4B0GA 2UVYA 4GMYA 4NFMA 3TT0A 2CGXA 4EHGA 2W1HA 2HWOA 1PKGA 4FUXA 4F1OA 4HNFA 1DM2A 1U4DA 5CSWA 2JITA 3EHAA 2OICA 2XS0A 3U87A 1U54B 3A61A 3NW6A 5AR2A 1WBPA 1OKZA 4J53A 1PRYA 4EQCA 1XWSA 3P86A 5DBXA 3OC1A 3JR1A 1G5SA 3E63A 3GENA 3BIZA 3FZOA 4ITIA 3DBDA 5BYZA 5HVJA 3M2WA 3TZ8A 3C4WA 3KFAA 4H3BA 2C6LA 2OSCA 4EWHA 3ZM9A 1CKJA 3DB6A 4TRLA 5HOAA 1R39A 4AZWA 5DHJA 1YHVA 3GU6A 3QQHA 3EZRA 3BLHA 3V8WA 4ANBA 4CTBA 2OH4A 3EQGA 1ZMWA 4AE6A 3ZSIA 2PVRA 3LJ1A 4NSTA 4TZRA 3PLSA 3QD2B 3QUEA 3Q4ZA 4X2KA 3VS3A 1OUYA 3TKHA 4IAYA 2C3LA 5IA1A 3P08A 2OU7A 2HW6A 3HMNA 4QMYA 3EN7A 3TZ9A 1IA9A 4GU6A 3ZM4A 4PL5A 4FZDB 1Q8WA 3P4KA 4HGEA 2VTRA 5C26A 5GZ9A 2GTMA 4DF3A 4CNHA 3RMFA 4I94A 3QXOA 1Z57A 3MH3A 4V0GA 3R9OA 1Q97A 1MRUA 4DFNA 4QMWA 2EUFB 2FSOX 4UMPA 3L8VA 1W84A 3IQ7A 4YNOA 3GT8A 3Q04A 3R7GA 1O6LA 2YLFA 4R7HA 3TTIA 2VO3A 2C5VA 3I81A 4NH1A 5IMXA 4IAKA 4E73A 2KTYA 4FNWA 4M15A 4BFMA 5K5XA 4F65A 4E6CA 3R8MA 2XEZA 1YDTE 4II5A 2W17A 1PKDA 5BVEA 3I5NA 4QRCA 4F1MA 3K3JA 4ZZOA 5HLPA 5JT2A 3QHRA 1BMKA 2HYYA 4PUZA 2GNLA 2XK4A 3RM6A 2W1CA 5BMSA 5E8WA 1LP4A 1M7NA 4RMZA 3ZC5A 4BDCA 3PRIA 4RIYB 5BUJA 5L2WA 3DXPA 2HOGA 4DEIA 1XJDA 1H1SA 3BHYA 3VO3A 5JFXA 4DEEA 5HE1A 2AC3A 4Q2AA 3OWKA 3QD3A 5E8VA 3SGCA 3FL5A 3R02A 2VTAA 5ANJA 3DK3A 4ASZA 2FYSA 4FVPA 4QPAA 3UMWA 2ZYBA 4RRVA 1MUOA 2OXYA 3ALNA 4FTJA 4X21A 5AWMA 2BIKB 1JBPE 3E87A 3BGPA 4IAIA 5LMAA 3V8TA 5F9EA 4DH5A 4LL0A 2ZV8A 4G9RA 3ITZA 4NW6A 4P7EA 5DLSA 3HDNA 3OEZA 2UW8A 3EL7A 2R7BA 5B0XA 5BYYA 2W06A 3KA0A 5C01A 2BUJA 3WE8A 5CAPA 2JKMA 3EN6A 4UMUA 1EH4A 4L6QA 3R22A 4NT4A 1OZ1A 4WIHA 2R3KA 3ZUUA 2VTIA 2WTDA 2RSVA 5ETCA 3PXZA 3EQFA 3PA5A 3A60A 4O7TA 2YITA 3OEFX 1OPKA 5IZFA 3W18A 2YIQA 3VQUA 4Y46A 2CNUA 1Q3DA 3CCNA 5CAOA 5EKOA 4EYMA 2X6DA 4ZSEA 3ZXZA 3FSFA 4EH3A 3BU3A 4FGBA 5KKRC 4XG4A 4UEUA 3VW6A 5EW3A 2WIPA 3Q3BA 3I6WA 4J7BA 3OZ6A 4BCKA 5LVOA 2HXLA 3ZEWA 3AD4A 2CKQA 2WMVA 2XNEA 1E1VA 4I6QA 1J7IA 3DBQA 2WTCA 5DE2A 5FUTA 3FEGA 3DS6A 2VO7A 3FLWA 3QQFA 4YO4A 3PA3A 4EYJA 4N0SA 2Z2WA 4YZNA 5TO8A 5CAVA 4YC8A 3F5UA 3K54A 3R8ZA 3AQVA 3W55A 4C34A 5AP4A 4EHZA 3HRFA 3PVGA 2QI8A 4Z55A 4MTAA 4DLIA 2O0UA 3JXWA 3BE2A 2F2UA 4MD7E 4E7WA 5HTBA 4AGWA 3Q2JA 4YSJA 3W8QA 1H24A 4WRGA 4Y8DA 1Y8YA 3EQRA 4D0WA 3DY7A 4QMUA 5GJGA 4BDBA 2ZM3A 4UY9A 3WYYA 1YWVA 3IW5A 5IA5A 3ZRLA 3FMLA 4IX3A 4EKKA 3RVGA 3ORXA 4BCNA 5BVWA 2WMQA 3EN4A 4FNXA 4FV1A 1LEWA 1GZOA 3GVUA 4K2RA 1H26A 2PVMA 3BELA 4TYHB 5EM5A 5FG8A 5C27A 4J95A 3ZSGA 3EKNA 2UZOA 2PE1A 3DK6A 3RINA 4PMSA 4ZEGA 4HZRA 4DBXA 4XBUA 3FC2A 3FXZA 2UZWE 2AC5A 4ZY6A 3HMPA 5IDNA 2JKQA 3F3UA 2XNPA 3R28A 2PMLX 4RJ8A 2HZ0A 3GFEA 2Y9QA 3KN5A 2ZJWA 2EU9A 2VZ6A 1CTPE 5HCXA 4A9RA 2X8IA 4EZ5A 4GKHA 2XK7A 1CKPA 4JXFA 1ZZLA 4RVTA 5DT3A 1DAYA 1VYWA 4AX8A 3NPCA 5LWMA 1I44A 2IVSA 1XH5A 5EDPA 3TCPA 4F0FA 4ZY5A 3KB7A 5FM3A 3AC8A 5DVRA 4XG8A 4RC4A 2O64A 1U46A 2FSTX 5E8UA 2OJGA 2CJMA 2EVAA 2W99B 4JG6A 1DI8A 5KMIA 2C5YA 2BRGA 4L9IA 2J90A 1OIUA 2YCQA 4FTIA 1YHSA 3OUKA 3QCYA 4LGDA 4CMTA 3LLAA 3FSKA 1H0WA 1X8BA 5AX9A 3VBTA 1JSUA 4XX9A 4D2RA 4RFYA 5F4NA 2AUHA 4IM3A 2XJ2A 5LMBA 4FL1A 4OTGA 5LARA 4AU8A 2WMBA 1OIRA 4LI5A 3LCTA 2A4LA 2JEDA 3ROCA 4O0UA 3I7CA 3DZQA 1JVPP 2QO9A 3PY0A 4O0TA 3V5PA 4IQ6A 4Z7GA 1Q3WA 3Q6UA 4RIYA 1PXOA 3QRJA 4FTMA 2GNIA 4JQ7A 3EFLA 4MQ1A 4MX9A 3OCSA 2OKRA 5K4JA 3BYSA 3NWWA 3VF8A 3UZPA 5HD7A 4R5YA 4EK3A 2H96A 1UU7A 3NYNA 4JS8A 4V04A 3ORNA 3O50A 4JBPA 4MAOA 2GTNA 3MB7A 1RE8A 2JDOA 4XG7A 2XNNA 2XP2A 2OF4A 4OTFA 4DEGA 4HZSA 3ZU7A 3SA0A 4EQUA 4E6AA 3RM7A 3GP0A 4W4VA 4F0IA 2W1GA 2WMSA 5M09A 4FK3A 4GEOA 3QYZA 2WTVA 1BLXA 2XIXA 4S2ZA 3P7AA 1XBCA 2BKZA 5IKWA 5BX0A 2B0QA 5HVKA 3DKFA 4O0YA 3M1SA 4IDVA 3E7OA 2BIYA 4O2ZA 4OTPA 4DFYA 2WFYA 4FKJA 4FSQA 5JFWA 2YDKA 2VN9A 3DBCA 3FYJX 3KEXA 2XB7A 1PYEA 3COKA 4R3RA 4NEUA 4AZSA 4EH2A 2WPAA 4ZSLA 4Z16A 4UN0C 3C5IA 4ZTQA 2WTJA 4GT4A 5L4QA 1OB3A 3KU2A 4RJ6A 4S34A 5FBNC 4YZMA 4JDIA 5CSVA 2BHEA 3TKUA 2JLDA 1IG1A 5JKGA 1WCCA 3IGOA 4FSYA 1KV1A 3TEIA 1F5QA 2YDIA 5IG1A 2E2BA 4O7SA 2GNHA 3FJQE 3DFCB 3FUPA 5TF9A 3G51A 4B9DA 4C4JA 4L43A 4F6WA 3VUDA 4M0ZA 4M7IA 3VRZA 3FLSA 1ZYDA 4A4LA 4Q5EA 4F9AA 4AWIA 1URWA 4U40A 3O0GA 3LCSA 5L3AA 4KABA 4NIFB 4ERWA 3T3VA 3B8QA 1GNGA 3GCPA 3R8PA 3QCXA 4QMPA 3TIZA 3G2FA 4LG4A 4C3RA 2VWXA 4G3GA 5B2KA 3HRBA 1JLUE 3RCJA 3ZRKA 3R1SA 2ERKA 3ZC6A 2QG5A 4G5JA 2KULA 4WG3A 4XLIA 4LL5A 4XV3A 4TYHA 4ZTSA 4I6FA 2JDTA 4C4FA 3BBWA 3OCTA 5CAQA 4RIWB 3FMDA 4D4RA 4DEDA 3DLZA 3FI2A 3MVMA 3ORIA 4KIPA 4P2KA 4FKPA 5A4TA 4PTEA 2X4ZA 4RVLA 2BZKB 4CZUA 3KRLA 1Y57A 1PF8A 4S31A 3UOHA 3OT8A 4FKRA 4U42A 3GC0A 4DLJA 4QQCA 3MTLA 3ULZA 5CF6A 4KA3A 4EORA 2RF9A 3TUCA 1M7QA 4MEDA 3WZUA 4ENYA 2J5FA 4TN6A 4J52A 4QMZA 4OBPA 4RIXA 5JEBA 3F7WA 3OTUA 4NYEA 1ZY5A 1NW1A 4CV9A 1YVJA 3LXPA 3MBLA 4FTCA 2G01A 3UODA 4CFNA 4RC2A 3ZO3A 1TKIA 4UALA 3NYVA 4BZOA 2BILB 3NDMA 3FZSA 3II5A 3SRVA 3NR9A 4U9AA 4H1MA 4CCUA 3QRIA 2PVHA 1IASA 1LR4A 2WB8A 5ANIA 2RL5A 3JVRA 3GC9A 5CSHA 4QTEA 3PJ1A 4GJ2A 4IJ9A 2VGPA 4F7JA 5DGZA 5KKRB 2Y4IB 3UNKA 4XP3A 4I6BA 3BYVA 3FQSA 5FM2A 1PJKA 3QKMA 4H05A 1W83A 2JFMA 1H07A 3A7FA 3G6HA 4MCVA 4ZS0A 3PWDA 3BEGA 4CMUA 2QOBA 2OGVA 4EOQA 4CRLA 4ZZNA 4PY1A 4E3CA 3FY2A 3MW1A 5AA9A 3VBVA 1RW8A 2R3MA 3HECA 4FA2A 2JFLA 1SVHA 2VWZA 2C5XA 3HV6A 2Y8OA 3NX8A 4X2JA 3REPA 3VS5A 3GEQA 2W9ZB 1XH9A 2PMOX 3KRWA 3VNTA 2XNBA 3UQCA 4WKQA 2OG8A 4UZHA 3UG2A 2PULA 4BWPA 4C8BA 2VRXA 3Q5ZA 2I0HA 4O86A 2NNWB 1SZMA 3MVLA 3UO4A 3QQUA 2HZIA 4RFMA 5E8YA 2F7EE 1A9UA 3D94A 4BDGA 4IZYA 5A46A 5I9YA 3DB8A 4L46A 2QHNA 2P4IA 3FQEA 4NWMA 3ORMA 5KMKA 4HVGA 3QALE 5GNKA 4CMOA 1SNXA 4EZ7A 4FT9A 2WQNA 4ZSGA 1L8TA 2WXVA 3EB0A 5M07A 3LXKA 4M84A 4PPCA 4EK4A 3ULIA 3CKWA 1YWNA 4BN1A 4JIKA 1BL7A 4FV6A 4K11A 3VIDA 3WZEA 4A4XA 5CF8A 5AAFA 3LJ0A 2VO6A 5F1ZA 5CASA 4FODA 1UU9A 3OWPA 4O27B 2QG7A 4ZTMA 5IQIA 3Q4UA 4YZ9A 4E93A 4YUQA 4ACMA 4DTBA 4YMJA 3PYYA 2P3GX 2WQEA 4YPDA 4AW0A 4FL2A 4GIHA 3SHEA 3VW8A 4BCHA 4DGGA 4QP8A 2C6TA 4EH7A 4Z7HA 5T6KA 3CJFA 3LQ3A 1UV5A 5FXSA 5CNOA 2B53A 3Q9ZA 1QPEA 4I21A 4EH4A 4XP0A 3VHEA 4OBOA 4YR8A 2UZEA 4KUJA 2R64A 4NIFA 1WBSA 4P90A 5HEZA 5AR5A 1FGIA 2JC6A 1OVEA 2BAKA 3F2NA 3EQCA 3ACKA 5ANDA 5JZJA 4FC0A 1P2AA 3T9IA 5CSXA 5HE0A 3DBFA 4IFGA 3SXSA 4C33A 4KIOA 1H08A 4EBVA 5M57A 3UIUA 2QOIA 2CGUA 4XYFA 2QOOA 3WF6A 4AP7A 4RIWA 4FV5A 2BDWA 4R7IA 4E5AX 4CYJA 3TDWA 1E9HA 3B8RA 4R3PA 3DAJA 4WUNA 3KRXA 2P55A 3MPAA 2RIOA 3U6HA 1Q8TA 3PXRA 3R2BA 3L9LA 4JX7A 4ASXA 5L2TA 3VS1A 2NPQA 3D7TB 4RZWA 4PRJA 5AP5A 4R77A 4C2VA 3UVRA 4BZNA 5A54A 5H8BA 3MJ1A 2QC6A 3F69A 2F9GA 1TQIA 2W5HA 3BRBA 4IAZA 3RK5A 5LMKC 3FI8A 3NEWA 2ZOQA 3LXLA 4EK6A 3C7QA 1F3MC 3LLTA 1RDQE 1R0EA 3GOKA 3PG3A 4LMUA 4XRLA 4AA4A 4F1TA 4ZMEA 3IS5A 4DEBA 1TQMA 1YDRE 2C3IB 1UWJA 2BROA 4EONA 4BTJA 3CQUA 3O23A 2QOLA 4YJPA 3CSVA 4XV2A 1V1KA 3R73A 4BCOA 4AZVA 5BMMA 3R83A 4FV8A 4IVDA 4Y85A 5EG3A 5FRIA 5F95A 3S3IA 4XCUA 2GHLA 4K9YA 4FTNA 3PPZA 4AUAA 1J7UA 4DFLA 3SLSA 3RWQA 4CTCA 4KRDA 4R8QA 5ITAA 3RWPA 3COMA 1LPUA 2YM5A 2X7FA 4V0GB 3VWAA 3R1YA 4QQ5A 4BCMA 3MN3A 4R7BA 5IUGA 5DFPA 1BL6A 1XR1A 1APME 3R9DA 4A9UA 5CVGA 3BU6A 4I22A 3OFMA 1WBVA 3ODZX 2GS2A 4LGHA 1Q62A 4FTRA 2C6MA 1OL7A 2WTKB 4AN9A 1Y8GA 2BVAA 5DR2A 1FPUA 4WRSA 4PMPA 4GS6A 3ZO2A 4GU9A 5JRSA 2R3QA 4G3DA 2XA4A 4HCUA 3P7CA 4FVQA 3OW3A 3LVPA 2R3OA 4WBBB 4O6LA 5DIAA 5A9UA 2QOQA 2XF0A 3DU8A 3U4WA 5M53A 2J0KA 4EC8A 4XOYA 5J9ZA 2XIKA 4FEUA 3OHTA 3EKKA 4L8MA 4M97A 3R7VA 3TI1A 5IH4A 4A9YA 1VYZA 4AT3A 4KS8A 4RC3A 4F0GA 2IZUA 4QNAA 5JGDA 2YAAA 3GCVA 4GG7A 4ACGA 4PP7A 5AP1A 3D5WA 3LQ5A 4NJDA 3RJCA 5M06A 1R3CA 1IRKA 4M66A 1P4FA 2ZV9A 4G6OA 4O7ZA 4GVAA 2FGIA 1MRVA 3R2YA 4EUUA 3LIJA 4MNFA 3S00A 3EN5A 3OOMA 4QP3A 3VHKA 4BYJA 2I1MA 4ASDA 4BWKA 3R71A 2BALA 2B9IA 3ZS5A 2W96B 1QCFA 1YWRA 1B38A 5T68A 4C37A 2W1ZA 2WU7A 4M68A 5HE2A 4B8LA 3WF5A 4F63A 1BI7A 2B55A 1GOLA 3QQKA 1PHKA 4XS2A 3MY1A 5CVFA 5EK7A 4PWNA 2HENA 3QTUA 4EH5A 3U9CA 3P5KA 3GCSA 2XNMA 3SXFA 3I0QA 3UO6A 5EOBA 3TWJA 4H1JA 2PY3A 2VD5A 2W0JA 1Q5KA 3D2KA 4FTKA 4IACA 5CU2A 2RGPA 2E9VA 5AMNA 3KVWA 1WMKA 4IAAA 5EDQA 5HBHA 4TL0A 2UVZA 3MS9A 5CU0A 1OKWA 3QTZA 1G8SA 5DT4A 4DITA 4I0TA 2ZM1A 2EXCX 2X39A 3LQ8A 3OBJA 4YJTA 5D41A 3NUUA 5EI2A 4FYOA 4MK0A 5EW9A 3U9NA 4NZWB 1YOLA 4W8EA 2O3PA 4B4LA 2IVUA 4TY1A 3EYHA 5CLPA 4YO6A 2FUMA 2OH0E 5H2UA 3T9TA 3A4PA 3WILA 1KE6A 5HG8A 3AT3A 1UWHA 1MQ4A 3EQDA 5CXHA 4D55A 4MYGA 4GCJA 1WFCA 1FBNA 2OFVA 5AR8A 5HZNA 5AAGA 5KZIA 4FV4A 1TVOA 4OLIA 5HNGA 2PZ5A 4IBMA 3ACJA 5CI6A 4V01A 1MRYA 2JGZA 5IEVA 2C0IA 2PE2A 3A8WA 3UIXA 3MPMA 4UV0A 3MFSA 2XKFA 3D7TA 2QNJA 3DGKA 2C6IA 4O83A 3RZFA 5M56A 1GZNA 1YXTA 4D4VA 5JQ8A 4NL0A 1ND4A 5CU6A 3FHRA 4MF1A 3QTWA 4M0YA 4QO9A 4UXQA 3UBDA 3KULA 4IHPA 4DT8A 2G2FA 1LEZA 2QOHA 3DPKA 3GU5A 3ODYX 5EW8A 2PUNA 2YEXA 1UA2A 4YHTA 2YABA 4E4XA 2Z7QA 3FZPA 3U55A 4NKSA 2R3PA 3DTWA 3LPBA 5K0XA 3ZSHA 5CQUA 3D9VA 5TKDA 5HO6A 2Y7JA 5FP6A 3VUMA 2RG6A 3PVWA 1PMEA 5DT0A 2HZ4A 4RA4A 5EHLA 4LRMA 3GCQA 3W33A 4C0TA 4IX5A 4E20A 4L68A 4GUBA 3WIKA 3AG9A 3Q53A 5GJFA 1OBDA 4G5PA 4QTDA 4EK5A 3TDVA 4GUEA 1Q99A 2HK5A 2XCKA 3M11A 3C13A 2BZHB 3ID6C 4GK4A 4QMOA 4O22A 1MP8A 4NK9A 1OL5A 1ZWSA 4QMQA 2RFDA 4RWJA 3NIZA 1GY3A 2P2IA 3LMIA 2VAGA 4FV0A 2ETRA 2YCSA 4JX3A 4TTHB 5FGKA 4ACHA 4ZMFA 2X1NA 1VJYA 4IVCA 5AJQA 3VN9A 3HMMA 5JMSA 3R7IA 1OUKA 5H9BA 4ACCA 3KMUA 4PTCA 3W2OA 2VWVA 4FKLA 4QMTA 1H8FA 1H00A 1Z5MA 3DQWA 3QCSA 4FSTA 4QD6A 3VBQA 4CQGA 3LFEA 4L00A 1FQ1B 4ZZMA 4IW0A 5ETFA 4ZJJA 2GDOA 3EQHA 3FLYA 3AC5A 4O81A 4PPBA 5FTOA 3NSZA 2ITQA 2UW4A 5A4CA 2PZRA 3H30A 2XEYA 3VUKA 3NYXA 5IF1A 1IAJA 2G2IA 3FMKA 3OY3A 2QOKA 5BVFA 1WBNA 3QQLA 2B52A 5HO7A 3DLSA 4LRJA 4NTSA 3ORTA 4H39A 5FBOA 2ZAZA 1YI4A 2ONLA 3OT3A 3JUHA 3OS3A 5L8JA 3SOCA 3QZFA 3ZDIA 4HGTA 3L9MA 3OMVA 5HLWA 1OI9A 2PE0A 3DNDA 2EB3A 4PF4A 1FMOE 4EJ7A 2Y0AA 4GFGA 2DQ7X 2XK3A 2WTWA 4AGDA 2VTMA 4G31A 4ITHA 2I6LA 5CT0A 3S2PA 4IANA 4YJOA 1XH6A 3LCKA 3PJCA 3DJ6A 4PTGA 4YJQA 4AW5A 4C3PA 4D28A 4DHFA 4QQTA 4GSBA 4L44A 4XG3A 1OBGA 4C61A 2BAJA 4XG6A 3KCKA 3H9RA 2OI4X 1CKIA 3JPVA 3NAXA 3F3ZA 5HG5A 3KK8A 3EZVA 3I4BA 4PL3A 2C47A 4PDOA 2BTRA 3KVXA 1Q24A 4QQJA 4PNKA 4BGQA 4UYNA 1U59A 3CY3A 3SD0A 2GNGA 3W2SA 3FC1X 3WZKA 3FLZA 2VWWA 3QKKA 3MDYA 2X81A 4IWQA 1OL2A 2XCHA 3QX4A 2QU6A 4EWQA 4QNYA 2FA2A 4U0IA 3F3TA 4YTFA 4CFFA 4BGGA 4O84A 3MFTA 5IQHA 3MH0A 2WHBA 4LM5A 3O8UA 3W16A 4NM5A 3I5ZA 4D2TA 3Q9WA 2WOTA 4YTHA 2YFXA 3W1FA 5L2SA 2XK6A 5ANGA 3VULA 4ENXA 2BHHA 3G9LX 4BIDA 3ANRA 1GZKA 1URCA 2XNGA 5HD4A 3WZDA 5KX8A 3DNEA 3OD6X 1V0OA 2F49A 3ZZWA 4W4WA 4G16A 4BTMA 5CALA 1Z9XA 2H34A 3DKGA 4EH6A 2VTNA 4WSYA 5DYJA 1PXMA 2GMXA 3A4OX 3KGAA 3ROYA 2J51A 3QX2A 2I0VA 5AR7A 5EKNA 4AOTA 3D14A 5AA8A 3QA0A 1M2RA 3UC3A 3HKOA 3HZTA 5GHVA 4BBEA 3OUNB 3R7UA 3OCGA 1WAKA 4KNBA 5AIKA 2G9XA 3QLGA 4BDKA 4P4CA 2C69A 3ZUVA 4CKRA 5KMNA 1H1RA 4WNKA 3RNIA 2W5BA 4EQMA 4RLLA 4NU1A 4XJ0A 4K6ZA 3SDJA 4BDHA 3Q2MA 4UMRA 5KCVA 4EC9A 2BRMA 5IA0A 4NCTA 2YCRA 3UOKA 3ZLWA 1REJA 2ITWA 3EOCA 3MA3A 4CXAA 3FMJA 3SV0A 3R63A 4JBQA 4ZJVA 2QKRA 4CGAA 4BI1A 4M12A 4C38A 4X2NA 1M52A 3LCOA 1FVVA 4K18A 5F94A 5ETIA 4W9WA 3QZHA 1KE8A 2NRUA 4FKUA 4CFVA 3OG7A 4DE4A 2VWYA 4LV5A 3NYOA 5AFVA 4CCBA 3AMAA 3COHA 4MD9E 3RAKA 3TNPC 3UC4A 4BVUA 4EOPA 3NVKI 5IQDA 4EOJA 4RIXB 1W7HA 1JPAA 3TACA 1XO2B 3VS0A 4HGLA 3DCVA 5IISA 3D7ZA 4AA5A 4I6HA 2OO8X 2B9JA 4L7SA 3VQHA 2J0JA 3I79A 3F9NA 3SRVB 3TJDA 2WMRA 3KXMA 4WT6A 3OXTA 4TWOA 3L8PA 2CKPA 2OIDA 2H8HA 3ERKA 3GGFA 1Q4LA 3ALOA 4G3CA 3PY1A 3RPSA 2UZLA 5CENA 1OL1A 3FAAA 4FKGA 4BICA 2GU8A 1Y6AA 2WNTA 3E93A 4KKGA 3KQ7A 3TZMA 2IPXA 4JDJA 4KINA 4S30A 4G3EA 4ALWA 3FY0A 2QO2A 4MWIA 1QPJA 4TKSA 5CX9A 2ITNA 3QGYA 4JAIA 4AZEA 4HVIA 3DAKA 2R3FA 3VS6A 3N4TA 4EHVA 5KBQA 3O8PA 3L9NA 3GFWA 1ZYJA 4ITJA 4FZAB 2BRHA 4G1WA 5FP5A 2WZJA 2ZDTA 3TN8A 2J7TA 3C5UA 4D5HA 2PYWA 1UVRA 2HCKA 5J9LA 3EQIA 1BYGA 2QURA 1NVSA 4FIJA 4KD1A 3E62A 3S4QA 2RFEA 5HTCA 4CQEA 3TKIA 1ZOHA 2C5NA 5EQPA 1H4LA 2G2HA 2WOUA 1PY5A 3TNQB 4AGUA 3ATTA 3RALA 3F3VA 2QOFA 3QA8A 3AGMA 3FPMA 3AXWA 1UKIA 2XYNA 3F66A 4FIFA 4IVBA 4PX6A 3F88A 4DCAA 5LMKA 5HKMA 5M4UA 4DGNA 1YOMA 1PW2A 2XKDA 5IDPA 4FI1A 3ZXTA 4ANOA 4AW1A 5C4LA 3MFRA 3N51A 4GT5A 4XUFA 3BX5A 3I60A 3NNUA 3POOA 5HTIA 2YM7A 2R3IA 3G0FA 4IH8A 3UOJA 1NVQA 1H27A 1OPLA 3QRKA 4D58A 3RPOA 2BZJA 3BU5A 5CYIA 1PMUA 1SYKA 3KF4A 3QGWA 2PTKA 2YN8A 4USFA 3IO7A 2ZMDA 4QMVA 3HLLA 4LUEA 4YSMA 2JIVA 1QPCA 5CVHA 5CEMA 1XHAA 4Q9SA 5J9YA 3FKNA 4TPTA 4D4SA 1KE5A 2WKMA 4ZXTA 2BZIB 1PMNA 2VU3A 4MXYA 2ITUA 2YIXA 4USEA 3FMNA 2GS6A 5J79A 4C57A 3QTQA 3F5PA 3G5DA 5E4HA 2HELA 2IO6A 4E5WA 4RX7A 2YM6A 2A2AA 5GZAA 3W10A 3F61A 5DR6A 4AS0A 2WMXA 4FKTA 3CP9A 2Y6MA 4FZFB 2XRUA 1BKXA 3O7LB 3QHWA 4IDTA 5EHOA 4DG2E 1PMVA 2XK8A 4EH8A 3SW7A 4JR7A 2ZDUA 2QD9A 3ANQA 3PZEA 4D4YA 3ZZEA 3NCGA 5AUVA 3COIA 5CSPA 3GB2A 5JGAA 4FSWA 3FV8A 4XV1A 1WVYA 4FKWA 2JAVA 4RT7A 4DFZE 5AM7A 3S0OA 4J8MA 4TWCA 1YOJA 1WVXA 3FKOA 2ERZE 3BKBA 1A48A 4WG4A 1WBTA 4TNDA 2CKOA 3IONA 2GSFA 3ZLSA 4DTKA 4FE2A 5BYLA 3QWKA 2ONLC 4EOOA 5J5SA 3QKLA 3QRTA 2GHGA 2UW6A 1OIQA 2ZB1A 3DFAA 3A7IA 1J3HA 3PSCA 1DS5A 2OXXA 5B2LA 3LFQA 4S33A 1NT2A 5E8ZA 4L42A 4AT5A 2PL0A 4YU2A 1KUTA 4ZTNA 3F7ZA 3DKOA 4S32A 3GU7A 2PVNA 1KE7A 2YISA 2YZLA 3IW6A 4C62A 2PZIA 1HCKA 2UW7A 4BHZA 1T46A 3C0HA 3E8DA 5CU4A 4C4IA 1V0BA 2EB2A 5KMJA 4CFWA 1Q41A 5EI6A 3CKXA 2GNJA 3K3IA 4C35A 2UW0A 3ZBXA 2BRNA 4EH9A 3TV6A 3Q9YA 4WHZA 4YURA 5HG7A 3V5TA 1KSWA 2GQRA 2ACXA 2VX3A 3OBGA 3WBLA 5KUPA 5HX8A 3UQFA 2QU5A 4AZFA 1ZZ2A 3EH9A 4J97A 4JR3A 5I9UA 5LWNA 4O0WA 1VR2A 2BRBA 2X7OA 2J0IA 4GG5A 4GK3A 2ITXA 3PA4A 4YC3A 1LUFA 3HUBA 1JKTA 1STCE 2CCIA 3BBTB 2J9MA 4PDPA 5LVMA 3R9RA 1M2PA 2J50A 4MXOA 3RZBA 4BZDA 4E6QA 4HNIA 5AP2A 4ANMA 2XRWA 4G6NA 5DEYA 2PVLA 2C0TA 3ORLA 4GT3A 4JVGA 5HICA 3CBLA 2YA9A 5AP3A 4IZ7A 4LFIA 4DGLC 3PXKA 4QP2A 3G0EA 5HVYA 3RK9A 4BTKA 2JD5A 4Y73A 3ZLXA 3FXWA 4XBRA 2CPKE 4CEGA 5JRQA 4IB3A 3O8TA 4HYUA 2R0UA 5E8XA 1ZMUA 4R5SA 3HGKA 3SVVA 3NMUF 3D83A 5IMEA 2X9EA 3FMHA 3NNXA 5CEIA 2W7XA 5EFQA 5IUHA 1SM2A 4FEQA 5A4QA 4QMMA 4I0SA 3LAUA 3P79A 2OJ9A 3QZGA 2YZAA 3HDMA 3ELJA 4I92A 2XZSA 2CNQA 1OMWA 4G34A 4YZBA
chains in the Genus database with same CATH superfamily
3U8WA 4Y95A 2C1AA 4N70A 3LJ2A 2FSLX 4NCTC 3UG1A 5HX6A 5IA2A 3MSSA 1ZYLA 2WMTA 1JQHA 2J6MA 4GIIA 4CZYB 4RPVA 2JDRA 4U5JA 3FKLA 4DH7A 3E3BX 5DNRA 3AKLA 2F57A 2V55A 1HCLA 3A99A 4LOOA 3DT1A 2JDSA 4XH6A 4QP9A 4DH8A 3L8XA 5FXRA 2ZV7A 3JVSA 3LM0A 2X0OA 3P9JA 5KO1A 2OLCA 2V22A 4IB0A 2YACA 3DKCA 2BFYA 4KRCA 3HA6A 3FPQA 4XRJA 5DWRA 4FV2A 4Y72A 4JBVA 3UOLA 1ZYCA 4I1ZA 5CT7A 4G2FA 2IW6A 1SMHA 3ZLYA 4ZOGA 5DN3A 4ANSA 5M08A 5D7VA 3NUPA 4K1BA 4W4YA 4O7YA 2PZYA 2V7AA 4E5BA 4FIIA 2XH5A 2X7GA 4IX4A 4JQ8A 5C8KA 4AXEA 2DYLA 4XP2A 2R0IA 4AW2A 4D1SA 4UWBA 1R1WA 3BGZA 2C0OA 3FI3A 3W2QA 2YHVA 3O7LD 5B2MA 4N6ZA 3PSBA 3FLNC 4NFNA 4Q5HA 4X3JA 4XOZA 5IQCA 3LM5A 3O51A 4F7SA 1SVEA 4LOQA 3PP0A 4RGJA 5H8GA 4DAWA 3JS2A 2E9OA 4IWOA 4YHJA 3VUTA 2H9VA 4EJNA 4U3YA 4HW7A 4QPSA 3Q4CA 4FKVA 4RX8A 4MXAA 4R6VA 4K8AA 3LCDA 4UMTA 2WQMA 3MVJA 4JT3A 2VTSA 1OGUA 4FTTA 4MKCA 3ZFMA 4OTHA 4IFCA 3PPKA 4R1VA 3MTFA 5DEWA 4G3FA 4BDAA 5E8TA 4A4OA 5FQDC 1XMMA 4BCFA 2OWBA 1UNLA 3NZ0A 4RZVA 5EHYA 3B2TA 4TYEA 1WVWA 4FEVA 5C1QB 4RBLA 3PIYA 1R78A 2UZNA 2W05A 3MH2A 4PV0A 3DXQA 1ERKA 3R6XA 5IQBA 3LHJA 5IA4A 5HBEA 2OF2A 3KULB 3NNVA 2Z8CA 3QCQA 5D9HA 4O0RA 3PP1A 5E8SA 3BLQA 1YKRA 3Q60A 4E6DA 4I5MA 5GZ8A 5JGBA 1XH8A 4ZSJA 4YTCA 4O21A 3FQHA 4IB1A 3ML1A 3ZO1A 1FGKA 3VUIA 5IQAA 4IM0A 4C7TA 4OTRA 1ZRZA 3KXXA 3TNWA 1E1XA 3NGAA 5JK3A 5J87A 3UYSA 3MY0A 4OTWA 2C3JA 4F7LA 4CV8A 4F9BA 3WIGA 1ZXEA 5BUEA 2A27A 4KB8A 3BEAA 4Z9LA 2XM9A 3PPJA 3CJGA 4WNPA 2WMAA 4O7NA 1H28A 4RWLA 4OAVB 2FVDA 3AC3A 4I41A 4DCEA 4M3QA 2R3JA 3AC2A 4ZLOA 5C8NA 1GIHA 3AOXA 3N9XA 4LRKA 1M14A 3TL8A 4FTOA 3QD0A 3UDZA 2W4OA 3SC1A 3EWHA 3NUSA 1ZLTA 3CLYA 3DXNA 1B6CB 3IK3A 4JDKA 4A9TA 3IDBA 1ST4A 2VTJA 3D0EA 4WG5A 4YC6A 5A6NA 4U8ZA 3UP7A 3AGLA 3MJ2A 2CGVA 4U7ZA 1BUHA 5DA3A 4W4XA 1OECA 5L2QA 2VTHA 5HBJA 5I9ZA 3UZRA 3CQEA 4BKYA 3PY3A 4EEVA 4YJRA 1QMZA 4BDJA 1XBAA 2IVVA 5HE3A 2ITZA 4D1ZA 3D2IA 3W2RA 2JAMA 2CLXA 2F7ZE 2BPMA 3SKCA 4YJVA 4C3FA 4D2PA 3NCZA 3RP9A 3D5XA 2Z60A 3C4CA 4IC7A 4P5ZA 5DOSA 2J2IB 3TIYA 5EYCA 3VBWA 3QTRA 1I09A 3H4JA 2UZTA 4DDGA 5GINE 5CWZA 2B4SB 2E9NA 2ETMA 4JI9A 3NFFB 5DPVA 4RJ4A 3O96A 1TFFA 3SQQA 2LGCA 4U43A 3V5LA 4XLVA 3LZBA 4HCVA 2EXMA 5L6PA 3DJ7A 3BGQA 3PFQA 3QF9A 3HMIA 2VWBA 3U6JA 3BHUA 3PXYA 1MQBA 5EI8A 4ZLYA 2W1DA 3TTJA 1CM8A 1UNGA 3AD5A 4YLLA 4X7QA 3BYMA 3QZIA 4MHAA 3DTCA 3MIYA 3NS9A 2PUIA 2PVKA 3WI6A 4KKEA 4XV9A 5LCJA 2Z02A 3BHHA 2RFNA 3C0GA 1W2FA 2B54A 4NM0A 5AV1A 1J1BA 1ZYSA 4FOBA 2IZTA 4M13A 4YJSA 2PUUA 4JG8A 3R8UA 4O96A 3MYGA 5CY3A 3CD3A 4IEBA 4KWPA 4I3ZA 4L52A 4MNEB 5AUZA 4CFMA 1FMKA 2XIYA 3DK7A 5AIRA 5BPYA 2R3NA 4J99A 3V6SA 3NNWA 5IQGA 4BCGA 4NM3A 3V51A 2HAKA 4BYIA 3PDTA 4X0MA 2XBJA 4OTIA 4YJNA 3HP2A 4HOKA 4EOIA 4RX5A 3ZOSA 2OK1A 3BZ3A 4NW5A 2FSMX 4ZS4A 4TXCA 3MPTA 4BRXA 3IOKA 4YZCA 2CDZA 5HO8A 2YLEA 5FDPA 5I4NA 3S95A 2QOCA 5L6OA 3AC4A 5CI7A 4RVMA 3KCFA 1KV2A 2CMWA 3ENHA 4IWPA 3ZH8A 3JY0A 5AP0A 4FEXA 1HOWA 3HMOA 1BX6A 4I5PA 5BUIA 4TYIA 2NRYA 4EOLA 4GJ3A 4N57A 1IR3A 3CS9A 3TV7A 5CU3A 3UDTA 2X6EA 1NXKA 1JOWB 2O5KA 5E7RA 2C3KA 4F6UA 4WUAA 4BI0A 4EZ3A 1W82A 4C02A 4RWIA 2JKOA 5HCZA 4E26A 3TNHA 4F9CA 4J71A 4MXCA 3KMWA 2R3GA 3F2RA 3LFNA 3JY9A 4BKJA 4JBOA 1KOBA 4BJJB 2FH9A 4IJPA 4DEAA 3R21A 4KSQA 3N4VA 3OY1A 1ZY4A 5M4FA 2XAMA 3C9WA 2HXQA 2OJJA 2C68A 3PIZA 3VS4A 1JSTA 3AMYA 2JKKA 2O2UA 3FL4A 3QC9A 4O2PA 5AX3A 5HGIA 3W8LA 2CCHA 2YIRA 3L9PA 5CEPA 4MUQA 3FXXA 1K2PA 2R4BA 4I4EA 4FIGA 2GPHA 3C4XA 4USDA 3LMGA 4FT7A 3F3WA 3RAWA 5G1XA 3ZRMA 3BYUA 1QPDA 5DH3A 3GU8A 4DH1A 4UWYA 3ORKA 4CVAA 5E1EA 3G15A 5JFVA 5AUUA 5JFSA 4QT1A 4FZ6A 3C51A 3QBNA 4KBKA 2QR8A 3OW4A 3PUPA 5D11A 3HNGA 5K3YA 4PP9A 5D12A 2GFCA 4C4EA 5KZ0A 4X6RA 5CZHA 3BWFA 4AXAA 3GCUA 3F5XA 2OZOA 4D2SA 3UNZA 3HL7A 4QP4A 4TNBA 4F09A 3H0YA 2PWLA 2WU6A 2JDVA 3GI3A 4LMNA 3OWJA 2I7QA 4BY9E 4JRVA 4EOSA 2G1TA 1GIIA 1Q8YA 4PMTA 3BHVA 4H36A 2JBPA 3OXIA 1BI8A 4WO5A 3NUYA 3MB6A 1O6KA 2YERA 2X0GA 4X3FA 4QP1A 2UV2A 2X0QA 2SRCA 3KF7A 3DJ5A 1M2QA 3QU0A 5HG9A 3CTJA 3ETAA 1JAMA 4BB4A 4WOVA 4D9UA 5E1SA 2C6OA 4CLJA 3A2CA 4APCA 3GQLA 5JQ5A 2VTPA 3SW4A 3IGGA 1TZDA 2WAJA 1H0VA 3PJ2A 3E88A 2Q83A 3ZFYA 4FSRA 4A9SA 1K9AA 3W2CA 4C59A 3HAVA 3MGYA 2P0CA 4TT7A 2OJIA 4CFUA 3LW0A 1DI9A 5EM6A 3IKAA 3ORZA 4J98A 4X6QC 3V6RA 3ZCLA 4ZJIA 5HORA 1VEBA 2V0DA 2F7XE 2XALA 3QC4A 3ZBFA 4O1PA 4MBIA 2BKKA 4YJUA 4ANNA 4L45A 5LVNA 5M4IA 5EM8A 4ACDA 2ZVAA 2VX1A 4H3PA 1AGWA 4ERKA 5FDXA 2VTLA 4D5KA 5KHXA 4B6LA 3GBZA 3WE4A 4DT9A 4YHFA 5EH0A 3PE1A 3CTHA 3PIXA 4GFOA 5CZIA 3CD8A 5JZNA 3RHXA 5B7VA 2XM8A 4BBMA 2WO6A 3R7YA 3K5VA 5D10A 4WD5A 3TV4A 3F82A 4ZP5A 3TNIA 4UMQA 4AAAA 4CYIA 5M51A 1KE9A 2GFSA 2QONA 3N4UA 4CG9A 5BVOA 1CSNA 5CS6A 5K9IA 5KMMA 4MF0A 3CE3A 4DH3A 2Q0BA 3HAMA 2VUWA 5FXQA 4C58A 3C50A 4MNEA 3V5QA 1H1PA 5AUYA 4I5HA 1P4OA 1S9JA 3GOPA 4MXXA 4YLKA 4EI4A 4AGCA 2YIYA 4MXZA 3R7OA 3CY2A 3EFJA 3RAHA 5I9XA 1R0PA 3UPZA 4ZLZA 4ONAA 3ATSA 2HZNA 5HI2A 1M17A 3GXLA 4BGHA 4C36A 2R3HA 2XJ0A 3Q9XA 1NA7A 2XJ1A 3WF7A 4O7LA 4DEHA 2BMCA 3QAME 1YHWA 3QYWA 3UP2A 4ZAUA 5H3QA 4UBAA 3O71A 5ANKA 5KMOA 1YI3A 2VGOA 3O5AA 4EOMA 4AN2A 3E7VA 2XUUA 3POZA 1W8CA 1P14A 4ARKA 3UGCA 2QHMA 4RIOA 2B7AA 4U97A 2VWUA 4BWXA 3DBEA 3V01A 4JG7A 3KRRA 2XMYA 3C0IA 5IQEA 4J96A 4ANLA 3LXNA 4I5CA 4BTFA 4KSPA 4BJJA 4CT2A 3VVHA 2DWBA 3FE3A 4RLKA 3G33A 3QUPA 2Z7LA 1XH7A 4E4NA 5EYDA 3AT2A 5LQFA 3CXWA 3PTGA 2Y4IC 3UVQA 4QP6A 5CNNA 4KIKA 3HP5A 4O7RA 1JSVA 4EUTA 5CEKA 3R00A 2X8DA 5M4CA 2YWVA 5BVDA 3D5VA 1XQZA 3LFBA 2JIIA 4GRBA 4AFJA 3I6UA 1A06A 4E4LA 4HVDA 4MD8E 4KAOA 1G3NA 4OT5A 4YLJA 5LOHA 2O8YA 1OGYA 4YNEA 2ITTA 5L8KA 2CSNA 3D5UA 4F70A 3KRJA 2DUVA 2VX0A 3L8SA 2I0EA 3GU4A 1KWPA 3GC8A 5AADA 5LXMA 3KKVA 4QOXA 4IAFA 4QTAA 3ZDUA 3AC1A 4W8DA 4Z3VA 2PSQA 2QVSE 4JL9A 4O7VA 2PVFA 1WZYA 3GQIA 2P33A 4X2FA 5H8EA 1W2DA 2C4GA 4QTCA 2YJRA 1U54A 4GW8A 4AQCA 3OVVA 2Z7RA 4CRSA 4R3CA 3P1AA 4JAJA 3U54A 4BCJA 4FG7A 3VBYA 4FSUA 3RPYA 2OJFE 3VBXA 5A14A 3DAEA 1H1WA 4AQKA 2C30A 2A98A 2YM4A 2X9FA 5HLNA 1XBBA 2R2PA 3QLFA 3QTSA 1QL6A 4EHEA 3SG9A 5AAEA 4OW8A 3RBWA 3CIKA 3AMBA 1PXIA 4OTQA 3LMHA 3KMMA 4I23A 5GJDA 3U51A 5C4KA 4CD0A 4F6SA 3KL8A 3ZFXA 3E8CA 3E8EA 3MIAA 4KS7A 3KXHA 3RK7A 3KIOC 2C6EA 5CEOA 3QD4A 2Z7SA 1XKKA 4G17A 4APPA 3KREA 1JWHA 4PDSA 5AV2A 4QTBA 3DV3A 4ZTLA 3FMMA 2O65A 2RFSA 3NUNA 4M69B 4GL9A 4FKOA 3RI1A 3E64A 3V5JA 3VJNA 2ZM4A 4GKIA 3EYGA 4WNMA 3LFDA 4QPMA 1CMKE 1YXXA 4HPTE 3WF9A 4FR4A 3WF8A 2UW3A 4PQNA 2YWPA 5DI1A 4CKJA 3DDPA 5DRDA 2NP8A 3FZRA 4FTQA 3M42A 4M67A 4ALUA 3V04A 5T3QA 2JBOA 2UVXA 4FJVA 3IW7A 3PZHA 2IW9A 3TM0A 3FMEA 3JYAA 4O91A 4ZTRA 5IA3A 3PG1A 5E92A 4PMMA 2OW3A 4GYIA 3NRMA 5LVLA 4HVSA 5AUTA 3G9NA 4LYNA 4K77A 4D9TA 4TWPA 4O4CA 1ZAOA 5FEDA 4BDFA 5C9CA 2GNFA 5KBRA 3TUBA 3EL8A 3OF0A 4DN5A 5I0BA 2QO7A 3C4EA 2R3LA 3P7BA 4JDHA 4OTDA 5TOZA 3RTPA 5FTGA 5E91A 4YGAA 4Y83A 2BR1A 5AV4A 5J7BA 5L6WL 1REKA 3KXGA 4DHJA 4A7CA 1UU3A 4HGSA 3TXOA 4B7TA 3Q52A 3LFCA 1SVGA 3UNJA 2R7IA 4OGRA 4JQEA 2GQSA 4R1YA 2GCDA 3R0TA 2F4JA 3HVCA 3LFSA 4IMYA 1UKHA 3R8LA 3RCDA 5A4LA 4A07A 3LE6A 2Y6OA 4E4MA 4FMQA 1DAWA 4FSMA 4NUSA 2CN8A 3VC4A 5IEYA 3PFYA 5CTPA 5M44A 4BDEA 2R3RA 5ACKA 2CKEA 2ZV2A 4NTTA 4QYYA 3GUBA 3Q5IA 3BHTA 5CQWA 1RJBA 5TT7A 3R9HA 4TW9A 4IVAA 5DRBA 3O17A 3R1QA 5J95A 4FV3A 5I3OA 3UTOA 3OP5A 5AV0A 2WD1A 5E9EA 3S1HA 3PVUA 3R7EA 2I40A 5CEQA 4F99A 5CAUA 3CEKA 3FBVA 4MVFA 3OXZA 4YTIA 5AEPA 3ENMA 4MBLA 4WBOA 2UZUE 4HYHA 1YI6A 4U41A 2NO3A 4FNZA 4Q9ZA 3Q32A 4O82A 1OIYA 5C8MA 4EK8A 5HIEA 5J5TA 3QXPA 2ETKA 4L7FA 2YM3A 2FB8A 4X3FC 1J91A 3RAIA 4HYIA 3H0ZA 4GH2A 3HV3A 3F6XA 3GNIB 3UVPA 2C1BA 3ZO4A 4FV7A 4FZ7A 4I20A 3W0SA 3DDQA 2XNOA 4L3PA 4M8TA 4MQ2A 4O4EA 4HVHA 4RJ5A 3E92A 4IM2A 3H3CA 1YDSE 2R9SA 1AQ1A 3HYHA 3BLRA 3UE4A 1JKSA 2W1FA 3W0RA 4YZDA 2BCJA 3P0MA 4FT3A 4BCIA 1KOAA 4C2WA 4FBXA 3R01A 4U80A 2V7OA 5IEXA 4P5QA 4AOJA 4U44A 4CSVA 3EJ1A 3PVBA 4L67A 2X2LA 2YJSA 4E8AA 4LQMA 4DFXE 4FT5A 3W0QA 4DTAA 4F9YA 4PNIA 3MFUA 3CGFA 3MA6A 2G15A 4ZIMA 2IVTA 3BQRA 4K33A 4BKZA 3ET7A 2WTKC 3V3VA 3THBA 3RKBA 3ZONA 1PXLA 4OUCA 2QKWB 5HQ0A 3R8VA 4I4FA 2GQGA 3BV2A 3HV7A 2E9PA 4RSSA 3H9OA 5ANOA 4RJ3A 4M14A 3UQGA 4K0YA 4KIQA 4F08A 2WQOA 1V0PA 2A0CX 5I9WA 4RG0A 4PDYA 1Y91A 3ZHPC 1IEPA 2AQXA 5ANEA 2UZDA 1WBOA 3FWQA 4O0SA 4UX9A 2REIA 4WSQA 3AKKA 2W9FB 4D0XA 3TZ7A 2A19B 3EQBA 5FLFA 1Q8UA 1U5QA 5BVNA 3UO5A 4QYFA 1WBWA 4LOPA 2OIBA 4JNWA 5J1VA 4O0XA 5ICPA 2GHMA 3RPRA 3FLQA 1FINA 4FKIA 3WZJA 4J8NA 4EBWA 4XG9A 4BDDA 5TE0A 3VJOA 1YRPA 4DFUA 1ZARA 4I0RA 3QTXA 3OROA 1F0QA 4M69A 4IB5A 5HESA 1CDKA 4DG3E 1IAHA 3R9NA 4UWCA 3CQWA 3AT4A 4DBNA 4AN3A 1U5RA 1J1CA 4AG8A 1NY3A 1W2CA 4FKQA 5BNJA 5AR3A 2IN6A 3ZTXA 4AF3A 4DGMA 1G8JA 3CPBA 4BI2A 4Y5QA 3MVHA 2PK9A 3UJGA 3MI9A 2VWIA 4J1RA 5EYMA 5HNIX 5JH6A 4NKAA 4CLIA 1YXVA 5FWKK 1XH4A 2OXDA 3BQCA 3NW5A 2W1EA 3TJCA 4ALVA 4QYHA 4O38A 5HCYA 3W32A 3KK9A 4EL9A 2PVYA 4AA0A 3BYOA 4GK2A 2J4ZA 4AZTA 2J0MB 5C03A 3P78A 5K4IA 3UDBA 4JRNA 2YIWA 3FDNA 5EQYA 3SG8A 2RKUA 4CKIA 3PJ3A 3FI4A 3UIBA 4O7WA 1H1QA 1Q8ZA 2CLQA 5FTQA 3HEGA 5ACBC 4G6LA 2UZBA 2VNYA 4WA9A 4ZSAA 4FIEA 3UIMA 3UYTA 4GVJA 2LAVA 2Y4PA 4QMXA 3SOAA 2IWIA 3MV5A 2PMNX 2QLQA 3I1AA 3PRFA 2VTOA 4FTUA 4IXPA 3KY2A 5G6VA 4R78A 5I5ZA 4PPAA 2C6DA 3A8XA 3NUAA 2QLUA 5LCKA 3Q4TA 4GV1A 1JKLA 5LVPA 2OZAB 5J8IA 4LUDA 4QMSA 4OT6A 2XYUA 3VUGA 1GAGA 5IUIA 2BDJA 1W0XC 4BC6A 1S9IA 5IQFA 3SXRA 5GIPE 2QCSA 4ID7A 4ZK5A 4DGOA 3CGOA 4JOAA 2PVJA 4IX6A 2PHKA 2B1PA 3SX9A 3DZOA 3LFFA 3W2PA 5KNJA 1GIJA 4JLCA 4U79A 2JIUA 4BCPA 2P2HA 4MWHA 3VAPA 3F2AA 4D1XA 2ZMCA 5FEQA 3HUCA 3NVMB 4FKSA 5HIBA 5IPJA 3P23A 4HPUE 1O6YA 3OOGA 4BIBA 4QYEA 1AD5A 4UB7A 5CANA 4BF2A 4C4HA 2HIWA 2WEIA 2UW5A 3A7HA 5EDRA 2PUPA 3QRUA 5CF5A 4TYJA 1UU8A 4AOIA 3FZ1A 3KC3A 4BHNA 5EQEA 1PXNA 3RNYA 4UZDA 1Y6BA 2ITYA 1K3AA 2B9FA 5J7HA 4O1OA 5HHWA 3LOKA 3BWJA 1OM1A 3UPXA 2VTTA 3E8NA 2WQBA 4FX3A 5IH5A 4FGRA 2FO0A 1OKYA 5AV3A 3ZYAA 3NLBA 4BBFA 3I7BA 5CF4A 4RX9A 2ESMA 2BDFA 2AYPA 4ASEA 3RPVA 3B2WA 2IW8A 3SAYA 5L2IA 3IW8A 3BCEA 3H9FA 2X2KA 2UZVA 4RWKA 3K2LA 4FIHA 4FSZA 3IDPA 2QR7A 3TUDA 4HYSA 4KKHA 2ITOA 2PZPA 2J5EA 5A4EA 2W4JA 3G6GA 4FTLA 4I24A 4C4GA 2E9UA 1ZMVA 3E5AA 2PU8A 5BQ0A 4AAYA 2I0YA 4BCQA 2EXEA 4DC2A 5CXZA 4CG8A 3D4QA 4N4SA 3NW7A 4LV8A 3HV4A 2UW9A 4N6YA 4O6EA 4BDIA 3KXNA 3E3PA 3C1XA 3CR0A 4I93A 4F9WA 2YM8A 4DYMA 3R1NA 1YXUA 2XIZA 2XKCA 4L3JA 2OBJA 3BE9A 5E90A 5I3RA 1FOTA 3VRYA 4L01A 3PJ8A 2HWPA 3Q6WA 3PXQA 3T8OA 2R5TA 1NVRA 1PXKA 3EN9A 1ZOEA 3L1SA 4Y5HA 5D1JA 2HW7A 3EQPA 3FZTA 1TQPA 3TG1A 1PXPA 4RA5A 3UZTA 4RQVA 4D2VA 2BAQA 3D15A 4QYGA 2XKEA 4ZTHA 4CT1A 1JNKA 3QQGA 3R30A 4DINA 3KXZA 4RFZA 2QODA 2OFUA 5DMZA 4NM7A 4L53A 4RJ7A 5A6OA 4AACA 1FVTA 3OWLA 3UMXA 4ANQA 4F64A 3KN6A 4CFXA 5K5NA 1VLRA 3C4FA 2WEVA 4DG0E 3NIEA 3EFWA 4A06A 2UUEA 1GJOA 3MWUA 2DS1A 5DR9A 3ZEPA 3NAYA 4U81A 3HRCA 2VTQA 2XIRA 3FHIA 4YBKA 4QMNA 5J1WA 2EWAA 2IZSA 3DQXA 4IZAA 1J7LA 3VS2A 3ZMMA 4FEWA 2XK9A 2WIHA 5BV3A 3MH1A 1B39A 4GYGA 3V8SA 3BPRA 3WOWA 2OIQA 1SNUA 4EKLA 4X3FB 5D7AA 4IADA 4AE9A 4U6RA 4TWNA 2ITPA 5EYKA 3P5JC 3T3UA 4ZY4A 3LKMA 1YQJA 5HU9A 5AR4A 2BFXA 3VUHA 4O0VA 2B9HA 3OCBA 4F7NA 3QQJA 4RQKA 2J0LA 3MY5A 1IA8A 5EOLA 3RHKA 4G9CA 4IC8A 4L3LA 5EM7A 2IG7A 2WGJA 3W0OA 3IG7A 4HJOA 3HX4A 1XMLA 2OZAA 2CGWA 4FG8A 4QMLA 5IU2A 3CTQA 4RVKA 1GZ8A 2VO0A 4XHKB 4FG9A 4IZ5A 2QQ7A 5IH6A 4FUYA 4FNYA 5JN2A 5K0KA 4FV9A 3AD6A 5A3XA 1PYXA 2W1IA 4BIEA 3HV5A 4F4PA 3IW4A 5AUWA 4XNEA 1Q61A 2ITVA 3QFVA 4CZTA 5AM6A 4FK6A 3WARA 4MH7A 5KE0A 1H25A 1PXJA 4FF8A 4XMOA 4FTAA 4UYAA 4V05A 4XEYA 3VS7A 3MESA 1W98A 2W4KA 2XBAA 3QL8A 3QWJA 3R04A 4LGGA 4OR5A 4XG2A 5ETAA 5HIDA 2W5AA 3K5UA 2VNWA 4FT0A 4YBJA 5FEEA 4E1ZA 4EOKA 4QP7A 3OTVA 3EFKA 3EIDA 3C4ZA 3PE2A 2A1AB 2ZB0A 1ZOGA 2O63A 3U6IA 2CNVA 4AFEA 3DA6A 1P5EA 1FVRA 3CPCA 1JKKA 2RG5A 3U4UA 3ZUTA 3IOPA 5BVKA 1OPJA 3PWYA 4ORKA 2BTSA 4KBCA 3A7GA 1OL6A 2PPQA 1VZOA 4IWDA 2HY0A 2H6DA 4H58A 4OBQA 5L8LA 5F20A 2XVDA 3DOGA 3W0MA 1YXSA 4KBAA 5KHWA 4DA5A 3NUXA 3IDCA 4FL3A 5AP7A 5JSMA 2C6KA 4U3ZA 3H10A 3QUDA 2CHLA 1UNHA 1H01A 3G90X 2X8EA 5TR6A 3WYXA 4PL4A 2WMWA 1OITA 2V5QA 1G8AA 3CC6A 2X4FA 5KMLA 3IECA 4B8MA 3GC7A 4D2WA 4TYGA 4BL1A 2YDJA 3O2MA 2V62A 4FICA 5AP6A 2C5OA 1OKVA 5HU3A 1T45A 3QTIA 3BI6A 4GFMA 3LFAA 4BR3A 4YP8A 3F5GA 4HCTA 2Q0NA 3BV3A 4AT4A 2X2MA 3A7JA 3VF9A 3PXFA 3ORPA 4U45A 5HNBA 4MBJA 4OAUC 2CN5A 5GIOE 2YAKA 4FSNA 3RGFA 4FVRA 4DFBA 4H3QA 3HA8A 3A62A 5I9VA 3PSDA 4JJRA 5LJJA 1ATPE 3FYKX 4X2GA 4W9XA 4IE9A 4IIRA 4KIKB 4UXLA 3V5WA 4WNOA 1L3RE 1RQQA 2IZRA 4FYNA 5FD2A 4JIAA 3Q96A 1O9UA 2WELA 2IJMA 2YCFA 1YW2A 2WMUA 2VV9A 4FOCA 4NJ3A 2PMIA 2GS7A 2WTIA 3I0OA 4YPSA 5DG5A 5M55A 4B99A 3AKJA 5AUXA 3IPHA 3PLAE 2F2CB 3EMGA 2HY81 4B0GA 2UVYA 4GMYA 4NFMA 3TT0A 2CGXA 4EHGA 2W1HA 2HWOA 1PKGA 4FUXA 4F1OA 4HNFA 1DM2A 1U4DA 5CSWA 2JITA 3EHAA 2OICA 2XS0A 3U87A 1U54B 3A61A 3NW6A 5AR2A 1WBPA 1OKZA 4J53A 1PRYA 4EQCA 1XWSA 3P86A 5DBXA 3OC1A 3JR1A 1G5SA 3E63A 3GENA 3BIZA 3FZOA 4ITIA 3DBDA 5BYZA 5HVJA 3M2WA 3TZ8A 3C4WA 3KFAA 4H3BA 2C6LA 2OSCA 4EWHA 3ZM9A 3TYKA 1CKJA 3DB6A 4TRLA 5HOAA 1R39A 4AZWA 5DHJA 1YHVA 3GU6A 3QQHA 3EZRA 3BLHA 3V8WA 4ANBA 4CTBA 2OH4A 3EQGA 1ZMWA 4AE6A 3ZSIA 2PVRA 3LJ1A 4NSTA 4TZRA 3PLSA 3QD2B 3QUEA 3Q4ZA 4X2KA 3VS3A 1OUYA 3TKHA 4IAYA 2C3LA 5IA1A 3P08A 2OU7A 2HW6A 3HMNA 4QMYA 3EN7A 3TZ9A 1IA9A 4GU6A 3ZM4A 4PL5A 4FZDB 1Q8WA 3P4KA 4HGEA 2VTRA 5C26A 5GZ9A 2GTMA 4DF3A 4CNHA 3RMFA 4I94A 3QXOA 1Z57A 3MH3A 4V0GA 3R9OA 1Q97A 1MRUA 4DFNA 4QMWA 2EUFB 2FSOX 4UMPA 3L8VA 1W84A 3IQ7A 4YNOA 3GT8A 3Q04A 3R7GA 1O6LA 2YLFA 4R7HA 3TTIA 2VO3A 2C5VA 3I81A 4NH1A 5IMXA 4IAKA 4E73A 2KTYA 4FNWA 4M15A 4BFMA 5K5XA 4F65A 4E6CA 3R8MA 2XEZA 1YDTE 4II5A 2W17A 1PKDA 5BVEA 3I5NA 4QRCA 4F1MA 3K3JA 4ZZOA 5HLPA 5JT2A 3QHRA 1BMKA 2HYYA 4PUZA 2GNLA 2XK4A 3RM6A 2W1CA 5BMSA 5E8WA 1LP4A 1M7NA 4RMZA 3ZC5A 4BDCA 3PRIA 4RIYB 5BUJA 5L2WA 3DXPA