1OUKA

The structure of p38 alpha in complex with a pyridinylimidazole inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
348
structure length
348
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Structural basis for p38alpha MAP kinase quinazolinone and pyridol-pyrimidine inhibitor specificity
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 348
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1oukA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1oukA01
4EKLA 3SXFA 4WUNA 5B2LA 3BLHA 3P23A 2FB8A 4PDOA 2UW9A 4E3CA 4GFGA 2ZJWA 2A19B 3EN4A 4FKGA 4PUZA 4TNDA 4U80A 4DGMA 4GEOA 1VR2A 4FL2A 2A2AA 4U97A 3D5UA 3W2OA 3OD6X 2WPAA 2YIXA 3QRTA 2GNJA 4I0RA 3W32A 4HZSA 4X6QC 2W0JA 4ZSEA 4JJRA 3MFTA 4QMXA 4H05A 3HECA 3JVRA 3MV5A 4ASDA 5M44A 3UJGA 2J9MA 3C9WA 2RIOA 3POOA 4OBOA 2W4JA 3I6WA 1WAKA 4RWKA 5BYZA 2CDZA 3GU6A 3GT8A 3ORZA 4FV7A 4X3FC 5ANEA 2HXQA 2WMQA 3H0ZA 4GIIA 4K33A 5FQDC 4O7WA 1YDSE 4DGOA 3G9NA 3T3VA 3UE4A 3DB6A 4I0TA 4MAOA 4HVSA 1GZOA 2PYWA 3TNIA 1JKKA 5HLNA 3QUPA 1LEZA 1M2QA 2R0UA 1H1SA 1IRKA 4J71A 2RSVA 2B9IA 4BCQA 1ZLTA 5H8BA 1YKRA 3D7TB 3QUDA 1Q5KA 3UQCA 4IM2A 4QT1A 4DFBA 5CY3A 4S32A 4C2WA 1H28A 2NRYA 5CVGA 4XG3A 4F7SA 4X2FA 4O0VA 3RHXA 4AG8A 2O2UA 3E87A 3PE1A 2IPXA 2R2PA 3R2YA 5TT7A 1IASA 2EXEA 2W1DA 5EI2A 4ZSAA 2YHVA 3G51A 5E8ZA 4MHAA 4FVRA 4MWHA 1R39A 4QMTA 1OIUA 3PJ2A 4DITA 3QRIA 3P9JA 3Q4TA 4BDCA 3F5XA 5FDXA 4BIDA 4A9RA 4J8MA 3ORXA 2CN8A 4IB3A 2A1AB 4IZ7A 3GU7A 2XM9A 4I5CA 3ZM9A 3NDMA 4YSJA 2IVSA 3F2RA 4O83A 2PPQA 5JEBA 4MF1A 4G5JA 4XP0A 1PXPA 1QPJA 1OL2A 1U46A 3F3VA 1WBWA 4RZWA 5AP7A 2OF2A 4EJNA 5HLWA 2GQSA 3U87A 2VTHA 3I0OA 3NYVA 5AUWA 3CD3A 3OCBA 3ORLA 4XUFA 1GIHA 4RFYA 5AAGA 4M97A 2H9VA 5M51A 3KB7A 5IMEA 2PHKA 4CLJA 5CVFA 5JGAA 3HMPA 4FKSA 2VX1A 3TUBA 4G9RA 4O7NA 2C3LA 3F82A 4CD0A 2OJ9A 3ZS5A 3GXLA 3QAME 2PZIA 4IX6A 4RT7A 2JBOA 3SX9A 4AGCA 4C3FA 5M4CA 3S95A 3EQBA 5DPVA 4O84A 3MY5A 2W4KA 2C3KA 1OM1A 5HI2A 4BWXA 3AD4A 3DAEA 2QO7A 1JNKA 4I22A 4QMNA 4EBWA 4YJVA 5A3XA 3KEXA 5CT7A 3MFRA 3PSBA 4R1VA 5A4CA 2BKZA 2UZBA 2P0CA 1R0PA 1A48A 4WNMA 2O63A 2OJFE 3BHVA 1SZMA 4FKRA 1OMWA 2HY81 4GT4A 4LOQA 4YTHA 5ANDA 3ZLXA 3FLSA 4QYHA 3QD3A 4GVJA 4CVAA 3U51A 1RJBA 3CSVA 3VS1A 3AMAA 3FQHA 4AX8A 3AC2A 3KA0A 4XP2A 4IJ9A 3OCGA 3I5NA 5M08A 4H3QA 4K6ZA 4NCTC 1MRUA 2Y4IC 3WF7A 2QOFA 5CU0A 3IGGA 3U6IA 3V8WA 4ANLA 3AD5A 3NX8A 4ZTNA 3NUPA 4LOPA 5LMKC 5HCYA 2ITZA 3R8ZA 3O17A 3EFKA 2O3PA 4MNEB 2FSTX 3SAYA 4RJ6A 5KNJA 4LRJA 4IJPA 4GT3A 4AP7A 4AZEA 4GK2A 4ZTQA 4Z7HA 1PRYA 4DA5A 5J95A 1CSNA 2X7GA 4S33A 4JBQA 3WF5A 2PSQA 1U54A 2YLFA 4YURA 2BROA 4JNWA 2YA9A 3N9XA 3FYKX 4WG4A 5HNGA 1P4OA 3UG2A 5M4IA 4E6AA 1Y57A 2QOQA 4TWPA 5A54A 1W8CA 3BHTA 4IXPA 4KRDA 1KOBA 2F4JA 3OG7A 4YJRA 4FT5A 4ACHA 4F7JA 4K2RA 3C7QA 3VS6A 4OLIA 4ACDA 3BBWA 4CV9A 5LVMA 2W5BA 4IX3A 3R0TA 4UEUA 2HWPA 2BRBA 3UIUA 4CNHA 4E6QA 3DDQA 5AP3A 1YQJA 1H25A 5JRSA 3M11A 1ZMUA 5FM2A 5HIEA 4F0FA 4IVBA 4IDVA 4BZOA 3IOPA 2ZOQA 2R7BA 2FYSA 2W1GA 1OVEA 2KULA 2V0DA 2W1EA 3BRBA 3O7LD 1OIYA 3PPJA 3QTXA 1YOMA 5CXZA 4F9AA 1U5RA 3FWQA 1B38A 2PZRA 1CDKA 3R7YA 4AAAA 2FSLX 3MVLA 3RTPA 3UO6A 4QMYA 2PVFA 1S9IA 3LFQA 4ALUA 1WVYA 2XK8A 4QD6A 2X6DA 3PRFA 4E7WA 4IFGA 3QC4A 5JN2A 5FLFA 5J87A 4NKSA 5EYCA 3VBVA 1JOWB 2R3GA 4HVGA 2C6MA 4O0WA 4ZS0A 5ETFA 3PUPA 1ZZLA 2JLDA 4HCTA 4AGUA 4BDKA 3BPRA 3T9IA 4DYMA 3S0OA 4CYIA 4HYIA 1FMOE 4LV5A 5HG7A 4EHEA 5J8IA 4DE4A 3IONA 2VO0A 2OBJA 3PTGA 1OKVA 3RMFA 5C03A 4PTEA 3EWHA 3BBTB 1W82A 4FTNA 4JR7A 4HPUE 4M66A 3KN6A 3EYHA 3NLBA 4NU1A 5FGKA 4OTGA 4JOAA 4FZDB 1BL6A 2H6DA 4HPTE 4OBPA 2OIDA 5K0XA 4V01A 4O7YA 4OGRA 4KBKA 4UMRA 1ZY5A 2HXLA 4R3PA 4YBKA 5AR7A 4M14A 4ZK5A 3R9DA 4CFWA 3O96A 4UMQA 2VWVA 4D4YA 4IAKA 5KMNA 4WBOA 4AXAA 3VS4A 4S2ZA 4KS7A 3HRCA 2CGXA 2PMOX 3FUPA 4X2JA 3KXMA 2GNGA 3FHIA 2XM8A 3GCQA 2DUVA 4N4SA 2UZLA 3RAWA 3S4QA 3UMWA 3ZUUA 3K2LA 2C5VA 3G9LX 4DFYA 3KRWA 3KK8A 4EUUA 1PXJA 1ZYCA 1KE8A 2GHMA 3IDPA 3QZHA 2JGZA 3LFSA 2X4ZA 2YFXA 4IC7A 3MVJA 1PMUA 3TZ7A 1O6LA 4MVFA 1WVXA 3E64A 3TT0A 5AP2A 2WO6A 4FEXA 1HOWA 3SRVB 4U8ZA 4X0MA 5TOZA 4EI4A 3LJ0A 4AF3A 4X6RA 3IGOA 2VX3A 4FKWA 4IEBA 4UYAA 4AFEA 2J6MA 3GNIB 3ORMA 1KOAA 4QMZA 3ZZEA 3PJCA 4EOJA 4RA5A 3A8WA 4APCA 2ZDUA 1G5SA 2UV2A 4TWCA 4XS2A 2HENA 2PVRA 4BCOA 4DHFA 2QONA 4X3FA 3DK7A 3QCSA 4NTTA 4C4HA 3ZRMA 3H9RA 3ITZA 5CVHA 4M15A 4ALVA 4P5QA 2J5EA 5CZHA 2UZUE 2VTSA 5DG5A 3GC9A 3FI8A 4RWLA 5BVKA 3UIBA 1J7IA 4RWJA 3C51A 3DAJA 4U41A 4Y73A 2YN8A 1OKYA 3LZBA 4GMYA 4I24A 4BDEA 2Y8OA 5EH0A 3V51A 2BTRA 4IQ6A 5KBQA 1YDRE 4G17A 4AGWA 2XNGA 2PMNX 4FV1A 4PQNA 5F95A 3K5UA 3THBA 4TL0A 3ZEPA 1T45A 3QFVA 3Q9ZA 1Q3DA 5AUTA 4TYEA 3VUHA 3IK3A 4L01A 3TTJA 2QI8A 5E9EA 3GC8A 3PJ3A 4NFNA 4QP1A 2R3IA 3O0GA 4J95A 5F20A 1ZYDA 2PUIA 3KXXA 5LCKA 2X81A 4APPA 4F4PA 3AQVA 1OPJA 2H8HA 4CFMA 4XP3A 4L3JA 1OECA 2ERZE 4RC2A 4D2VA 1KE5A 4IB1A 2YACA 2OWBA 2I0VA 2FGIA 1QPEA 3SRVA 4QP9A 4KABA 2JKMA 3R9NA 3EJ1A 3QLFA 5CLPA 2PZ5A 4PP7A 1F3MC 2XNEA 4BI1A 2WB8A 4JRNA 4AZSA 4C3RA 3FPMA 2WIHA 4W8DA 3NR9A 3VS0A 4L68A 1OL6A 4I6BA 4RQKA 3QQKA 2WTVA 3TV4A 3UIMA 4ALWA 3W2RA 3IDBA 3HNGA 3MN3A 3COKA 3UTOA 3Q9YA 1GZKA 2PVMA 3OTVA 3OBGA 4MD9E 2OJGA 2PU8A 3FLQA 2HZIA 5ETCA 5HVYA 4GJ3A 1APME 3EQDA 1BUHA 3Q2JA 4U3ZA 3DY7A 4FIEA 3TNPC 2G15A 5IEYA 3U54A 2BPMA 2DYLA 3OCSA 4FEQA 4FNYA 3UVRA 4TRLA 4WRGA 1JSUA 4FSWA 4IHPA 4NFMA 1SVHA 5HNBA 3PA4A 3AOXA 4J97A 3BYMA 4FR4A 2ZYBA 1R0EA 5CX9A 4BDFA 4MH7A 3NUUA 5CI7A 4DEBA 4FG7A 2BZHB 3II5A 4L52A 5ETAA 4IX4A 5HORA 4DG0E 2FSMX 2YEXA 4EK4A 3ULIA 4UMTA 3HP5A 4D1SA 3C4FA 3TNWA 3K54A 3WF9A 5JGBA 1TQPA 3VRZA 1HCKA 1OKWA 3TWJA 3V6RA 3ZOSA 2Z02A 1Q8WA 4GRBA 4NM7A 2QO2A 4XEYA 4ZJIA 4KUJA 2RFSA 3F88A 4ZY5A 3VBTA 3EQIA 4NCTA 3ORPA 5HG9A 2W99B 3A61A 3OTUA 5LMKA 5CF4A 4C61A 4G5PA 4C59A 5JGDA 3JXWA 5AIRA 4BCNA 4AN9A 2CKOA 2VWWA 2JFLA 4ZSJA 4FTKA 2W7XA 2IZUA 3QZIA 1M14A 1UVRA 2I0YA 4IWPA 4NIFA 4UALA 4CSVA 3QCXA 5AEPA 3PIYA 3Q6UA 3MSSA 5HU9A 3GU5A 4K11A 2BALA 4LYNA 2R64A 4C2VA 2OKRA 3RJCA 2C30A 1G8AA 2ITYA 4TWOA 4DT9A 3RPRA 2UW4A 1ZARA 4U45A 2Z7SA 5AUYA 4DC2A 2R3HA 3HRFA 1OPLA 2ZM1A 1YWRA 3OUKA 3QQJA 5IQGA 3DDPA 3ANQA 5E90A 3MH0A 4KB8A 1FMKA 2YCRA 2YWVA 4HYUA 4LOOA 4MXAA 5JQ5A 3Q9XA 1W98A 3O8PA 1XO2B 1IA9A 2V22A 3UOJA 2W5AA 5AIKA 4ACMA 3MYGA 4XLIA 4BZDA 4D9UA 3V8SA 4G6OA 4JT3A 4G16A 4C8BA 2AYPA 2PE0A 5AX9A 3H4JA 2FVDA 4PMPA 3WE8A 3M2WA 2CLXA 1PMVA 2YM4A 3MDYA 3GU8A 3BQRA 2J51A 1Y6AA 3GEQA 4ACCA 3AC5A 3LXLA 3ATTA 3AGLA 3EQPA 3G0EA 3NAXA 1DAYA 4KA3A 1SM2A 4E4XA 1OIRA 3HA6A 4HW7A 2B4SB 4F7NA 2IJMA 5T6KA 2IN6A 3P79A 2YZAA 4FBXA 3NRMA 4FIGA 3MB6A 5E8UA 4DFZE 4MTAA 3T9TA 1TKIA 3NUXA 1A9UA 3R83A 4QP8A 2J50A 4M12A 4A4OA 1NVRA 1YW2A 2P4IA 2YAAA 4Z55A 4NYEA 1KWPA 2XCHA 3HZTA 4NZWB 4R8QA 4M13A 4RFZA 4RSSA 4B99A 2O8YA 5AUUA 4BDHA 4G3CA 3EH9A 2WOUA 3PIZA 3PYYA 4NM0A 2Y0AA 3FDNA 5T68A 3RNIA 4E5AX 5M06A 2YCFA 2Z2WA 2CGVA 2GMXA 5LVPA 1LP4A 3R63A 1ZMWA 4DLIA 4YP8A 3P5KA 5I9WA 3DBFA 3DK3A 4FNXA 2YDJA 4EC8A 4BGHA 5A6NA 3KL8A 3PIXA 1IEPA 4JDKA 5CALA 3N51A 2QODA 4LUEA 3G2FA 2GS7A 3WARA 5IH6A 4R5SA 1Y8YA 2BDJA 3OEZA 3BWFA 4B4LA 4O0XA 1K2PA 2PMIA 3R7OA 3RK5A 4O0RA 2BAKA 2UZTA 4BRXA 4BYIA 4MYGA 3L9NA 5EG3A 3W1FA 4O27B 3QKLA 5AM7A 4KIKB 4E73A 2QOCA 3KRRA 3C4CA 4ZY6A 3RNYA 4RMZA 3QTWA 5TO8A 2XKFA 4RIOA 3R9HA 3A8XA 2W9ZB 1WMKA 2RG6A 4HYSA 4A9YA 3W33A 3FY0A 4JG7A 4WSQA 4D0WA 1GIJA 1ZAOA 4JG8A 3ZC6A 4JR3A 4EOLA 5HGIA 3A4OX 2F9GA 3PG1A 3BEGA 4AZTA 5L8KA 2AUHA 2XEYA 2YABA 4WNOA 5B0XA 2NRUA 2CCHA 2QVSE 3IW7A 4CT1A 4QYGA 5JZNA 4M7IA 4LV8A 1H24A 1Q99A 2OF4A 2XF0A 1KSWA 4YLJA 3RWPA 1M52A 4PL3A 1OGUA 5DE2A 2VNWA 5CT0A 2ITUA 3KXZA 4FYOA 5CEMA 2ZV2A 5CF8A 5GIOE 4EOIA 4C02A 4M3QA 2E2BA 2QHMA 3CKXA 4C37A 1G8SA 3PVBA 3ZM4A 4PDPA 2R3KA 3IQ7A 4PF4A 5EKNA 5AUXA 3ZMMA 1YXSA 3QWJA 5AMNA 3HLLA 1NT2A 4RBLA 2C5XA 4KD1A 5C01A 3ZFXA 4O7TA 3EZRA 4A4LA 4IB0A 2EXMA 4L6QA 3QA0A 4AZVA 5E7RA 5DR9A 3O8TA 5FP6A 3AGMA 4DFUA 4KRCA 3UODA 3R8MA 4U0IA 4PTGA 2PZPA 3PRIA 4FIJA 5DI1A 3V5LA 4C4FA 4RA4A 4TZRA 3N4VA 5IZFA 4YBJA 4E1ZA 5HIBA 3A7IA 1ZZ2A 2YZLA 4AQCA 2I0HA 3UO4A 4KIKA 3GFWA 2QOBA 4U5JA 4YJNA 1CKIA 2OK1A 4EUTA 3PZHA 4BWKA 2YIYA 1IR3A 1R1WA 2XCKA 4GL9A 3ID6C 3FI4A 4G2FA 3F7ZA 4NEUA 4IAIA 1OPKA 3V5TA 4MD8E 4CFUA 2VGPA 1NY3A 2Y6MA 3KY2A 5C27A 3QD4A 4WHZA 1M7QA 3HDMA 5FM3A 4C4JA 3EFWA 4DAWA 3D5WA 5LXMA 3COIA 3H10A 3E8NA 3TJDA 4D2TA 3BZ3A 2R3PA 4EK6A 2VWBA 4ZMFA 3TIZA 2QR7A 4FKTA 1GOLA 2B9JA 4Y85A 2PE1A 3HV5A 2JC6A 1H27A 4JG6A 2HIWA 3BIZA 2UVYA 5HBEA 2J2IB 4M68A 4TYHA 4CGAA 3C4ZA 2XNNA 2YM6A 5FBNC 3UZPA 4EONA 2WTKC 3ZFMA 4FV3A 4ASZA 4YUQA 4XX9A 3PY1A 4JQ7A 4GJ2A 3NWWA 3BYUA 4XG4A 4XOZA 4AFJA 4CCBA 5BX0A 4FT7A 3VF9A 4GK3A 4I6FA 2HZ0A 4G31A 3C0GA 5G1XA 5DEWA 5KMIA 4ZY4A 2QOLA 3QQHA 5CEKA 2C6TA 4OW8A 5F1ZA 1E1VA 4P5ZA 3VS5A 1ND4A 3RPSA 3E3PA 3ZSGA 5A14A 4QNAA 1Z57A 3DBQA 5EKOA 4OAVB 2HAKA 3PA3A 4EEVA 3R9RA 5CEPA 4H39A 4O7ZA 4FMQA 1UNGA 2BIKB 5AV4A 3C0HA 1H8FA 2ZDTA 4BDAA 4BCPA 4QP2A 5K0KA 3R7IA 4G9CA 1U5QA 4MF0A 4FKLA 2RFDA 4RVMA 3PPKA 4YTFA 4NSTA 2ZV8A 2XRWA 4KBAA 2UW6A 4XCUA 3SOCA 2VTQA 5HX8A 5E8YA 1FOTA 4ITHA 2WU7A 4Z9LA 5A6OA 5DN3A 3GBZA 2JAVA 2YIQA 3Q4UA 2VRXA 4ERKA 2VZ6A 2F7ZE 3RAHA 3FMKA 3C50A 3HP2A 3A7GA 1REJA 3ALNA 2R3JA 2YWPA 2E9NA 3E5AA 3DZQA 4FZ7A 3R8PA 3C4WA 3TKUA 5HOAA 4F7LA 4UWCA 4YZ9A 1M2PA 4N6YA 3ZXZA 5EYDA 4D2SA 2XNBA 1AQ1A 4BR3A 4AOIA 1P4FA 5J1WA 1XH7A 1BX6A 3FXXA 3IOKA 1VYWA 3KF7A 5ITAA 4AS0A 4KKEA 5G6VA 4HOKA 4XJ0A 4YZCA 3QYWA 5D7AA 5DMZA 2QG7A 4V04A 2VWIA 4QMPA 5M56A 4PMMA 2BFXA 4AW0A 4A9SA 3BI6A 2XK4A 2HK5A 3PJ8A 4GH2A 1AD5A 4OTDA 2Q0NA 5FTOA 3R6XA 5ACKA 4O21A 2P2IA 3W16A 4BCJA 2C6EA 3BX5A 4TXCA 4I92A 3R1SA 5BMMA 4WKQA 3CIKA 3OC1A 4A07A 4MXOA 3VBWA 4BCFA 4F0GA 4F9WA 1JSVA 3TV7A 1IA8A 2F2CB 4EH5A 5EDPA 2JFMA 2HW6A 3VIDA 5DR2A 5BMSA 1RW8A 5K4JA 3ODZX 5IQHA 2IZSA 2WEVA 3MA3A 4BF2A 2XUUA 1Q8ZA 4EK5A 5A4EA 2VO7A 3WE4A 4XNEA 2VNYA 5KZ0A 3VC4A 2RKUA 4I5HA 3SHEA 3GQLA 4AOTA 5H2UA 3PA5A 3FV8A 3KQ7A 2C68A 4QP3A 3NIEA 2FO0A 3FMEA 2XKDA 1B39A 3VUGA 3C5UA 3LIJA 3FPQA 3D2IA 4BI0A 4ZSGA 3LXKA 2EB2A 3EIDA 3KXGA 5DEYA 4U42A 3KRLA 4I6QA 3G6GA 2UZWE 2YDKA 3ANRA 5HLPA 5JRQA 5I9VA 4DF3A 4W8EA 4OTQA 3DBDA 3EYGA 3MVMA 4EH4A 4GKIA 5M07A 5EFQA 4RIYA 4DGNA 2I1MA 4QTDA 3E8EA 3QBNA 4P7EA 3BU5A 3L9PA 4Y83A 3UQGA 2VTJA 4L67A 5EYKA 2VX0A 4OBQA 1CMKE 4GU6A 5BPYA 1SMHA 5DT0A 2F7XE 4YJSA 5C4KA 3VHKA 3QHRA 3HKOA 5CSWA 4JS8A 4AT4A 5CSXA 3TCPA 1ZY4A 1X8BA 5AP5A 1U54B 4N6ZA 4FEUA 2XBAA 1H00A 5JH6A 3ZO1A 5IA1A 5KMLA 4UZHA 5HE1A 3WBLA 4CKJA 2HYYA 3ZTXA 5IG1A 4O1PA 3R2BA 2GNLA 3WF6A 3CJFA 2XBJA 3W8QA 5AV3A 2PUNA 3LMHA 4OT5A 3EQRA 2I40A 2QG5A 3E7VA 4FZ6A 5C8MA 5DNRA 4ZXTA 3T3UA 3FXZA 5IQFA 4UV0A 1E1XA 2HY0A 4DGLC 1UKIA 3TXOA 4USFA 4FOBA 5EOBA 4FTAA 3F66A 3VWAA 4XV1A 5DYJA 5L6OA 3I79A 3SG9A 5HD7A 3OFMA 2IVUA 4NUSA 3FSFA 2DS1A 4OR5A 3ZDIA 5I9XA 5L2TA 1XR1A 2BZJA 3MFUA 5FEDA 3FMJA 3R7VA 3QRUA 1KE6A 3R9OA 5HO7A 3C4XA 4U9AA 5TKDA 2QKRA 2WQNA 4IE9A 1URWA 1BI7A 4DBXA 3TZMA 4CZYB 3MI9A 4TWNA 4ZIMA 3VS3A 5LOHA 1MQ4A 4L8MA 4NTSA 4FI1A 2W9FB 2XKEA 3R1QA 4L45A 3ZO3A 4OAUC 2V5QA 4YO6A 3DOGA 4EL9A 5HKMA 1BL7A 3GCPA 3QF9A 4IM3A 3GC7A 4FL3A 1IAJA 3F61A 3NW6A 3V6SA 5KBRA 2PULA 3DAKA 4XBUA 4DH5A 2GDOA 3UQFA 2ZMDA 5EM7A 4UN0C 2OZOA 4V05A 2BIYA 2BZKB 3FL4A 3UP7A 2YJSA 3MH2A 4I6HA 4H58A 3VULA 3UNZA 4B8LA 4LGGA 3VHEA 2OLCA 2CKEA 3CR0A 3WF8A 2RFNA 3DBCA 3ZONA 4U81A 3PWDA 4YC6A 3HAVA 1JSTA 5FEEA 3UC4A 3OXTA 1MUOA 1WBVA 2PZYA 3DQXA 3RKBA 2JEDA 3IKAA 3QTRA 3R21A 4DN5A 2B0QA 4B9DA 1CTPE 4WRSA 4RQVA 3CTQA 3HGKA 3AXWA 5BYYA 3ZU7A 4AZWA 4Z3VA 3ATSA 3DTWA 4LM5A 2XK6A 5E8TA 2UZEA 4QTEA 4RLKA 2V55A 3FMNA 4P90A 4Y5QA 5LARA 2W1CA 2VGOA 4A9UA 3U6HA 2QO9A 4YHFA 1UKHA 2X4FA 4ENYA 4QOXA 1Q97A 4QMSA 2OGVA 5M09A 4YJPA 2X7OA 3FLZA 1OI9A 3LM5A 3NUAA 3ULZA 4BZNA 3QTUA 2W1ZA 5C8KA 4AW5A 3Q9WA 3HV3A 4QP4A 2JDSA 5HICA 4EKKA 3ZO4A 2BHHA 3VAPA 1KUTA 4FTLA 1Y91A 5CNOA 3QXOA 3F2NA 3I60A 2WTCA 5F94A 4ZSLA 4F63A 2ZMCA 5A4TA 2BRHA 4MEDA 4MBJA 3MS9A 4HZRA 3KCKA 3G5DA 3E8DA 2QLQA 1XBBA 2WTJA 1W84A 2ZB1A 4MWIA 1OL7A 1Q8YA 2VWXA 3MIAA 4FSZA 2RF9A 1GZNA 1DAWA 1H26A 2WFYA 1YOJA 1I44A 1UU7A 2C5OA 2WKMA 3CCNA 3HV7A 3LFCA 5EDQA 3QD0A 3BKBA 3O51A 1ZYSA 5L3AA 1YVJA 3Q5IA 3MGYA 1W83A 3FKLA 2VO6A 4MCVA 3BWJA 4XYFA 4Y46A 4NJ3A 4KINA 3CLYA 2Z60A 4X3FB 4JVGA 4DT8A 2X39A 3A7JA 1H1PA 4F9YA 2GTNA 2HZNA 4W9XA 3ZH8A 3HMMA 3DXQA 5IUGA 5E1SA 4FG8A 4CXAA 1FVRA 4CRLA 2YCSA 5LMAA 4IZ5A 3FZTA 3P0MA 3MJ2A 5CU3A 2BDWA 1W7HA 4BCGA 5DA3A 2XNMA 4BDDA 3MPTA 3ZHPC 3ELJA 1BKXA 2A27A 3L8VA 3LFBA 3QUEA 4IZAA 2VU3A 4U40A 1TQIA 3RCDA 4BTFA 4EH8A 5KMMA 5EK7A 4EQCA 1EH4A 2XIXA 1Q41A 3N4UA 5AAFA 4DEDA 3DU8A 3AT3A 4AA5A 4EQMA 1Q62A 1J1BA 2BKKA 4QQCA 5EI6A 2JKQA 5CAPA 5GIPE 3GI3A 2J0MB 3HMOA 3LMGA 4FVPA 1NXKA 1SVGA 5DFPA 1FGIA 4D1ZA 3TDVA 4L44A 3RPVA 4M69B 2YIRA 4G3EA 3MIYA 4KS8A 3FY2A 2V7OA 3KVWA 4F99A 3MVHA 4PPBA 4I4FA 4DFNA 1MQBA 4GVAA 4BBFA 4WT6A 2IG7A 4FGBA 4CTBA 1F5QA 4GG7A 5K3YA 1WBTA 4YNEA 3OWJA 4FEWA 5M4FA 3EN7A 2BZIB 2J4ZA 5EYMA 2IVTA 4E20A 5FTGA 2V62A 3NNXA 2OW3A 3PXZA 3SXRA 4B7TA 3EFLA 3MTFA 5IU2A 1XWSA 3TUCA 4O82A 2ITWA 4I21A 2CLQA 5HTBA 5KE0A 5HU3A 3F7WA 5JZJA 3QKMA 3UNJA 5LMBA 2WQMA 3SVVA 1BLXA 3VUDA 4GK4A 4QRCA 4A4XA 2E9VA 2YM8A 4OTPA 5HBJA 1S9JA 2BAJA 3CGOA 3JYAA 4FEVA 2WIPA 3HV4A 4I93A 3IDCA 4RJ3A 3UOKA 3PXYA 4FV6A 4H36A 3PPZA 3TZ9A 5J5TA 3AC4A 4JDJA 4LL5A 5HO8A 1TQMA 3V5JA 4PV0A 1W0XC 3CS9A 4CV8A 1M7NA 2UVZA 5HVJA 4RIXA 2BVAA 5IA2A 1SVEA 3UVQA 4FIIA 3BE9A 1ATPE 3LQ8A 2C6DA 4WD5A 4ZMEA 4PNIA 2XNOA 4E93A 1IAHA 3F3UA 4M69A 2XK9A 4QQ5A 2QHNA 4RIWB 3FSKA 3TNHA 4IB5A 1JKTA 4DEGA 4YLLA 2IZRA 1NVSA 4M0YA 2GFCA 5I9ZA 4F09A 1FBNA 1ZRZA 3RCJA 3R01A 3R28A 4JI9A 2REIA 3R73A 3VW8A 3W10A 2H34A 3LAUA 4YPSA 2P33A 2Y4IB 4DGGA 4EYJA 4GUEA 4ZLZA 4YJUA 5I3OA 5L6WL 3BGQA 5JFVA 2I0EA 4JAIA 4Y72A 2OIQA 4JBOA 5ACBC 2GHLA 3CY2A 2X2LA 3P86A 5LJJA 3OHTA 2XIKA 3ERKA 2XA4A 2BRNA 4FKOA 2WEIA 2EXCX 3RBWA 3Q4CA 4NM3A 4I5PA 4FV0A 2YLEA 3I6UA 3PP1A 3PWYA 4NIFB 2GQGA 2SRCA 2GNHA 2XVDA 3RI1A 1FPUA 2X8EA 2J0IA 3PXFA 4CEGA 2R3QA 2VTRA 4DEHA 2RGPA 4LGDA 4DG3E 3R8UA 4ANMA 4GKHA 4AN3A 3ODYX 2WQBA 4FUXA 4FK3A 5ANIA 4RVLA 4DTBA 3W2QA 1PYXA 1YI3A 4O0YA 4TY1A 4XLVA 4ZJJA 3UG1A 2WTWA 3MBLA 3EHAA 3JY9A 4U79A 2EUFB 5GZAA 4L3LA 4J7BA 5KKRC 4EH7A 5CF6A 3H0YA 2QOHA 3FE3A 2YM5A 2ONLC 4YSMA 4RIWA 2B54A 2UZOA 4ZOGA 1PXNA 4QPMA 3MPMA 4EHGA 4A7CA 1OZ1A 5KUPA 3WIGA 3DT1A 5FEQA 3B2WA 4X3JA 3MH3A 2IW8A 3JS2A 3RALA 4C4IA 2CNQA 2PY3A 3KXNA 1PKGA 3RP9A 3W8LA 1XJDA 5AAEA 4BN1A 2ITTA 3TUDA 2OJIA 4D2WA 4BCHA 1J3HA 2OU7A 3VW6A 3PG3A 2XYNA 3TNQB 3HUCA 5IQCA 3OUNB 2PVYA 5DH3A 3RZBA 3ZBFA 5CF5A 5FXQA 4XRJA 1VEBA 4GG5A 4WIHA 4B6LA 4CFNA 3SG8A 2JDOA 2PVHA 3LFEA 2C4GA 5JSMA 5IQDA 5IA5A 3MA6A 1MRYA 1F0QA 4X2GA 3W2SA 3ZLYA 3U6JA 3BU6A 3BYSA 4FTMA 4QQJA 3RK9A 5DIAA 3W2PA 4FKQA 5DLSA 4IZYA 1REKA 4YZBA 2QNJA 3C13A 4ZJVA 4C36A 2P2HA 3F5UA 3LM0A 1UWHA 3ZCLA 3UBDA 4MXYA 2OFUA 5H8GA 1L8TA 4C4EA 1OB3A 3L8PA 2C69A 4IANA 3FEGA 2WD1A 1H1QA 2BAQA 3PZEA 5E4HA 3E63A 4AU8A 2XZSA 5AP4A 4CMUA 3NUSA 4O86A 4JBPA 4PMTA 5HX6A 3DFAA 3DNDA 5IUIA 5J5SA 1ZOHA 4JQ8A 3O7LB 3NZ0A 4FTCA 4JBVA 4EZ5A 5HD4A 2G01A 3EOCA 4K1BA 1Q3WA 3KFAA 4AACA 1PJKA 4JQEA 4QPAA 4BCKA 5BYLA 5CSHA 4A9TA 3OWPA 4CFFA 2IZTA 3S1HA 3NNUA 3EL8A 4O1OA 4UXQA 4WG3A 5CSPA 3NUNA 5KO1A 3SXSA 2HWOA 3DCVA 5CQWA 2BDFA 2PMLX 3P78A 3VQUA 3L9MA 4M0ZA 5J7HA 4FZFB 1KE9A 4PTCA 4RGJA 5BNJA 1FQ1B 4XV3A 4HGEA 4DTAA 2Z7LA 4XV2A 4BYJA 4F6SA 4C62A 5FXRA 3CTHA 2XJ0A 3JVSA 3NCZA 4IMYA 5ANOA 4PWNA 3WZUA 5HO6A 3ZC5A 3H9FA 1YRPA 3C5IA 4J99A 4OTWA 5CYIA 4XRLA 3FKOA 3PSCA 4RLLA 5M55A 2O65A 3LCDA 2VV9A 2ETMA 4K77A 3QQFA 5HCZA 3DK6A 4RVKA 2NPQA 1O9UA 1ZWSA 2GFSA 4FV5A 3DFCB 2W17A 4BDGA 2XP2A 3UYTA 4BTKA 4FA2A 4R78A 2JDVA 4XG7A 4YJQA 2VTMA 5CAUA 5D7VA 1J91A 3LE6A 2UW7A 3QRJA 4JDIA 4IC8A 2XK7A 3F5GA 3TACA 4PL5A 2W05A 3LVPA 1GAGA 4D4SA 4DEAA 2QCSA 2CJMA 4AE9A 5BVDA 4D2RA 4MXZA 5IISA 1JQHA 1OIQA 2FA2A 5AR3A 3EQFA 3NNWA 3P08A 3A7HA 3DXNA 3S3IA 2GHGA 4C57A 5GJGA 2WMXA 2PUPA 3R04A 4NJDA 3AG9A 3ZUVA 3CPBA 3LFFA 3ZYAA 5LWMA 4QMMA 4BBEA 5A4LA 2Q0BA 4BL1A 3ZSIA 3Q04A 2X2KA 2XJ1A 1LUFA 4JRVA 2VD5A 2X0GA 3ACJA 3LPBA 1H08A 3DB8A 2Y7JA 4DH1A 3AD6A 3NGAA 1XBAA 3BV3A 2BUJA 4O0SA 4TTHB 4XH6A 5BUEA 4ZP5A 5EQYA 3I0QA 4IWQA 3H3CA 4KIPA 3PXQA 2XH5A 2Z7QA 1DM2A 2Z7RA 5AR5A 1Q24A 2F2UA 4O7VA 1OBGA 4HNFA 3F9NA 4FSNA 3A62A 2UZNA 2PVNA 3FBVA 1GY3A 4R7HA 4FT3A 5CQUA 5HE2A 3ZFYA 4JL9A 4R7BA 2JKOA 3DKFA 4J98A 4TYHB 5I0BA 2OJJA 4NT4A 4BB4A 1QPDA 2J0LA 3BYOA 3E3BX 4P4CA 5AM6A 5HNIX 2QC6A 4DINA 4WBBB 5I3RA 3JR1A 5GINE 1Y8GA 3FKNA 2G2IA 3LQ5A 4FNWA 4KIQA 4E5WA 1UU9A 3CXWA 3KU2A 3NYOA 4KIOA 5H8EA 3LOKA 4J96A 4XOYA 4EWHA 5EHOA 2BILB 2YM3A 5CENA 1T46A 3O2MA 1GZ8A 3PLSA 3PSDA 3K3IA 2JBPA 2W4OA 3OOGA 3OY1A 4J8NA 2G2FA 3GQIA 4E6CA 4QNYA 4ITIA 2QU6A 4MXCA 4AE6A 4EH2A 1J7UA 5FTQA 3L8XA 1H0VA 4FV4A 3KN5A 5HE0A 5AWMA 5IEXA 3DKCA 2ZM3A 4EK8A 3BEAA 2J0KA 4YU2A 4RWIA 3MY0A 5FBOA 3F2AA 4GW8A 2ITPA 2VTTA 3IO7A 3JUHA 1YDTE 5DHJA 5HG5A 1URCA 3RHKA 5BUIA 5FRIA 4DLJA 3QALE 5FDPA 3QLGA 4I3ZA 4ERWA 4FG9A 5E8XA 4JIKA 2ZV7A 4F6UA 3ZRLA 5EW9A 4TYGA 3SW7A 4BDIA 4F9BA 2E9OA 5AP1A 1RQQA 4EC9A 5KMOA 3IPHA 3QYZA 4PDYA 2WMVA 2ITXA 4H1MA 3D5XA 4JLCA 4MBIA 4PMSA 3O8UA 4FKJA 5IDNA 2XK3A 4QTAA 4H3PA 2XEZA 4D9TA 4DH7A 1QCFA 4MQ2A 3CC6A 2GSFA 3OP5A 1K3AA 4MX9A 3WOWA 4YTIA 4Z7GA 2XYUA 4LI5A 5C26A 2WOTA 5CAOA 5E92A 5CEOA 4AN2A 3OMVA 1PKDA 4FSYA 5CU2A 3SD0A 4AT5A 5C1QB 3PLAE 4QYEA 1JPAA 3Q2MA 4BDBA 4ARKA 3FAAA 3GB2A 3P7AA 4BIEA 2R9SA 1ZYLA 1FVTA 2R3FA 3QA8A 3BV2A 3ETAA 3EFJA 4YZNA 3ZUTA 2OICA 2ONLA 3ENHA 4LUDA 4C38A 1PXMA 2ZAZA 3R22A 2QQ7A 2WQOA 2DWBA 3A4PA 5IKWA 4AW1A 2OH0E 3OROA 3ZZWA 4DFLA 1MP8A 4QTCA 4D0XA 2J7TA 2B7AA 3OW4A 1RDQE 2VTIA 4G34A 5AV2A 5HE3A 3WZDA 4JIAA 2CCIA 4U7ZA 4X2NA 2BTSA 2HZ4A 4FYNA 1YXXA 4M84A 3DV3A 3L9LA 5JFWA 3DBEA 5C9CA 4IWDA 3QX2A 4PL4A 1H0WA 5F9EA 3I5ZA 4LRMA 4HNIA 4F65A 4KBCA 3E62A 2QR8A 2VTOA 4HGTA 3C4EA 4ZTRA 5J9YA 3SA0A 2ITQA 4UMPA 2GPHA 5TF9A 4F1OA 2GU8A 4M8TA 4AW2A 5L2IA 3HAMA 3MPAA 3GVUA 3UOHA 4NW5A 4FICA 3RAIA 3UMXA 3ALOA 4EHVA 4ORKA 3IG7A 4IFCA 4MKCA 4FTRA 2R3OA 3VJNA 3HA8A 5CSVA 3VUIA 5B2MA 3R8VA 4I1ZA 3BHYA 2HELA 4Q9SA 3QKKA 4LG4A 2XS0A 4CYJA 5AX3A 5L8JA 2RFEA 2F49A 2Y9QA 3PJ1A 2Q83A 5AV0A 4RIYB 4PNKA 4IM0A 1JWHA 1DI9A 2WQEA 5E91A 3QQLA 5IQEA 1XH9A 2VUWA 5B2KA 3I4BA 2RL5A 4AZFA 1H01A 4IAZA 3DLZA 1V0BA 4XG9A 4QMVA 1XHAA 3E88A 3DGKA 3DJ5A 4FKPA 5D10A 2X6EA 5GZ9A 2G1TA 4IIRA 4UX9A 5CU4A 4HJOA 1XBCA 2PUUA 5CEIA 3TN8A 2H96A 2HW7A 3WIKA 4D58A 2F57A 2QD9A 4NK9A 2PTKA 3GOKA 3HMIA 4EHZA 2UW8A 3CQEA 3G33A 3LCOA 1Y6BA 1WBNA 3Q32A 3IS5A 4IWOA 3AC1A 4FF8A 5I9YA 2XIYA 5DWRA 4ID7A 3VO3A 5FXSA 1A06A 4BCIA 1BMKA 3MJ1A 5L8LA 2Y4PA 2B9FA 3CQUA 3DZOA 4EOOA 5KHWA 2W06A 3DQWA 3VNTA 2BFYA 2WMSA 1R78A 3QGWA 4IACA 2JIVA 4O38A 5TR6A 5JFXA 3AT4A 2WU6A 3OXIA 3PVUA 3QGYA 4G3DA 2C6IA 3EQHA 4D28A 2JIIA 3DKGA 4HCUA 4F64A 2JD5A 2RG5A 4OTFA 2ZV9A 4IADA 4DEEA 2VTLA 2X1NA 4F0IA 3DPKA 5EM8A 1QL6A 4YPDA 3WILA 2UW3A 3GUBA 3C1XA 4YTCA 2OH4A 4LRKA 3D15A 2IO6A 4BKZA 2XIRA 4HCVA 4C35A 2ZM4A 3ZLSA 5CANA 2ITNA 1XH4A 3A99A 1ZOEA 4D2PA 1YHSA 1ZMVA 4E6DA 2C47A 4O0UA 4FX3A 5JFSA 2WXVA 4FT9A 2XRUA 1OL5A 4KKGA 4YC8A 4MD7E 2NP8A 3NEWA 3G0FA 4QMOA 4R3CA 4YZMA 5AJQA 5J7BA 2E9PA 4ZLOA 5J9LA 3IECA 4ANQA 5BVNA 4QP6A 2UVXA 3REPA 4DH3A 4R7IA 4QMWA 1YWNA 4YLKA 3SKCA 4YZDA 3LMIA 3NMUF 4L00A 2QU5A 4FKUA 2XIZA 3OT8A 5J9ZA 4FGRA 5AR2A 4CKIA 3KMWA 5IQBA 5T3QA 3D5VA 3QC9A 4I5MA 3S00A 4FTOA 3FQSA 3AT2A 2JDRA 4IVCA 3UVPA 5AA8A 5CU6A 4EOMA 5BVWA 3TJCA 2VTAA 4L9IA 2JKKA 1PXKA 4DCEA 3D7TA 4RJ8A 4I0SA 4U6RA 5DT3A 4EK3A 3CTJA 3QHWA 3KGAA 2WTKB 2YDIA 4C4GA 3SDJA 3R7UA 3E92A 3VUMA 1XH5A 2I6LA 3PP0A 4G1WA 3UPZA 4ASEA 1YI4A 5HESA 1BYGA 2WHBA 3Q6WA 4YHJA 3H9OA 4CFXA 3F3ZA 2XMYA 5I9UA 4C58A 3HVCA 3U9NA 5AR8A 4AGDA 3PXKA 4FTJA 4IW0A 2YITA 4DBNA 3LLAA 4O91A 2YERA 3U9CA 3NYNA 4JX3A 1WVWA 3LCSA 3ZBXA 4QMQA 3KREA 4WG5A 4XG8A 4GIHA 3BHHA 4W4XA 4CZTA 3I7CA 3PY0A 2BR1A 4GT5A 3W2CA 4EH6A 3GOPA 3QTQA 1I09A 4IDTA 4S31A 4K8AA 3FHRA 3HUBA 4I20A 3SLSA 3QCQA 4EZ3A 5M53A 5A9UA 1H07A 2WTIA 5EI8A 4UWBA 1MRVA 4Q9ZA 5J1VA 5L6PA 4IBMA 1V1KA 1OBDA 4XV9A 4HVIA 5EHYA 3VUKA 3Q52A 1NW1A 4CKRA 5JKGA 2A0CX 1DS5A 4CCUA 2XJ2A 5BQ0A 5HQ0A 4CRSA 5ANKA 1JAMA 3EMGA 2C1AA 3LHJA 3NPCA 3B8RA 3MH1A 3VBYA 4TW9A 1XKKA 5FG8A 2P3GX 3EKKA 4ANNA 2PVLA 2O64A 1U59A 2UZVA 4PY1A 4NM5A 3KMMA 2VO3A 4O6EA 3QZFA 4JX7A 4DEIA 3G90X 4B8MA 4KAOA 4ANBA 4J53A 3U8WA 2YM7A 2C3IB 2OO8X 2I7QA 2KTYA 3F6XA 3OCTA 3VJOA 3LQ3A 2PVKA 1OITA 3BLQA 2C0TA 4GUBA 4K9YA 3Q3BA 3LW0A 2CSNA 2OZAB 3RINA 3CD8A 4AOJA 1Q61A 3IW4A 4O2ZA 2BHEA 2UW5A 5M57A 3MESA 3EKNA 5JK3A 1WZYA 2QOIA 3GU4A 4FOCA 2C0IA 4R3RA 2C5NA 2PL0A 3NUYA 5HIDA 4U3YA 3QRKA 5D9HA 4N57A 3RK7A 3COHA 3OEFX 2JDTA 1G3NA 1VZOA 1XH8A 2Z8CA 3NSZA 4L7FA 3SC1A 4RPVA 4MNEA 4B0GA 3MTLA 2C5YA 3GFEA 1STCE 4BCMA 3FLWA 2OXYA 4EWQA 5FD2A 2J0JA 2GNIA 4L7SA 4I4EA 4EORA 4HGLA 1IG1A 3F3WA 4YJOA 3ZXTA 5IA0A 4TNBA 3RVGA 3RZFA 5IA4A 3QZGA 4RX8A 3R8LA 4DFXE 4GFOA 4RIXB 2YJRA 1L3RE 1O6KA 3Q53A 5BVFA 3UDBA 4CLIA 1PMNA 5D12A 3V01A 4BIBA 4FL1A 2YAKA 3TKIA 4JXFA 4MK0A 3KF4A 5HG8A 3R7GA 5IPJA 3U4UA 4EOSA 3H30A 4LL0A 5IH4A 2BRGA 4RRVA 3TI1A 3FZ1A 3VRYA 1UWJA 4F9CA 1YWVA 3LCKA 3UP2A 1LPUA 4L3PA 5AR4A 5LWNA 4W4WA 1PMEA 3NCGA 3IW8A 4FUYA 2C1BA 4AWIA 2OZAA 2W5HA 2XKCA 3ORKA 4FIHA 3LXPA 2WZJA 5DGZA 5GJDA 5A46A 3COMA 1H1RA 2PVJA 3K5VA 3QD2B 3P7CA 1AGWA 3DS6A 4ACGA 4BI2A 2GTMA 4FSUA 5ETIA 2R7IA 4PDSA 5AP6A 3NVMB 4FKVA 4ZEGA 1OUKA 4XBRA 5KMKA 4RC4A 2X8IA 4WNPA 2PWLA 1WBSA 1WFCA 3OW3A 4FTUA 4FVQA 2XNPA 5CASA 4GYIA 4R5YA 1PW2A 5D41A 4L46A 4RX5A 2QOOA 1H4LA 5FWKK 4ZZMA 3BCEA 3SV0A 3U55A 4ZAUA 2W1FA 4M67A 4PP9A 4R1YA 4X7QA 3EN6A 1P14A 3ZRKA 2FSOX 1JVPP 2R3NA 3L8SA 3EQGA 4BHNA 5BVOA 4X2KA 4IH8A 3NNVA 3D83A 3V5PA 4RVTA 4CG8A 3DLSA 3HV6A 2B52A 4GU9A 3GC0A 4PPAA 3WZKA 1XH6A 5KHXA 4XG2A 3AC3A 2VTPA 4OUCA 3VS2A 2UZDA 4BTJA 1OL1A 3VN9A 5IEVA 5E1EA 5EDRA 3OWLA 4FTTA 2WMUA 4NH1A 3QTSA 4ZTMA 3Q60A 5K5XA 2WMBA 4X21A 3CKWA 3CP9A 3BHUA 4TYIA 4OTIA 4TPTA 4TT7A 4KKHA 3FQEA 3ZO2A 3A7FA 5IF1A 2AC3A 4RFMA 3HDNA 3QTZA 5AA9A 3M1SA 5IUHA 3UIXA 4QMLA 1K9AA 1GNGA 2CGWA 3WYYA 5K9IA 3BE2A 2VWZA 3K3JA 1YXVA 2X9EA 4D5HA 3MB7A 4O81A 3TTIA 4HGSA 4FV9A 4ASXA 3KVXA 3UZRA 4G6NA 4UZDA 5HVKA 4NKAA 5L2WA 5CTPA 5CWZA 1YXTA 2O0UA 4LFIA 5D1JA 5EQEA 4KNBA 5CNNA 1CKPA 1M17A 2E9UA 3FLYA 4FSMA 2CNVA 3GCSA 3NW7A 3MY1A 3WZJA 4I23A 2CNUA 3DA6A 3OBJA 3Q96A 5A4QA 1H1WA 1PYEA 4J52A 3WYXA 5K5NA 3KK9A 4YJTA 1ZOGA 4NWMA 3TEIA 4O96A 5DOSA 4OTRA 3NYXA 2WNTA 5GHVA 3OF0A 1PXLA 1U4DA 5GZ8A 3QWKA 4WOVA 3CBLA 1PXIA 3I7BA 3LLTA 4OTHA 4UB7A 2OXXA 2EB3A 5EQPA 1Z5MA 4GFMA 4UY9A 5L4QA 2R3RA 4FSQA 4AA0A 1Q8TA 2GQRA 3OS3A 4F70A 3BGZA 4Z16A 4ZLYA 2CMWA 3UC3A 3VBXA 2CGUA 1GJOA 2ITOA 4BGGA 5GNKA 3OY3A 3BYVA 3V5WA 4NL0A 2W1HA 3FI2A 3BGPA 1QMZA 3RM6A 5EW3A 3FLNC 2JAMA 3O23A 4ITJA 3KMUA 3QQGA 2QOKA 2X7FA 5BUJA 2FUMA 3KC3A 4MNFA 4D5KA 4O7RA 1V0PA 5LVNA 5EW8A 3QXPA 2ERKA 3PVGA 1UU8A 4NW6A 2BRMA 2YIWA 1M2RA 3UNKA 4LMNA 4CQEA 5LVLA 3RGFA 3NS9A 4XG6A 2ITVA 3POZA 5EM5A 4QMUA 1Q8UA 4PPCA 5LQFA 3EL7A 1UNHA 5HZNA 1LR4A 4GV1A 5ANJA 3FMMA 3B8QA 3HYHA 5JMSA 2GS6A 2R0IA 1O6YA 1PHKA 3EN5A 3I1AA 2QKWB 3NAYA 3SGCA 5KCVA 5IQIA 4L53A 5ICPA 3DXPA 1GIIA 3PVWA 2LGCA 3FC2A 4LMUA 4EQUA 4F1MA 4ANSA 4USEA 4II5A 4F1TA 5H3QA 3DJ6A 1CM8A 2C6OA 2EU9A 2NO3A 3CY3A 1YOLA 1DI8A 4W4VA 3E93A 3D7ZA 4W9WA 2B1PA 2VN9A 1UNLA 3MWUA 3ORIA 1ERKA 2V7AA 2IWIA 1TVOA 4D4VA 3O71A 3VVHA 3FZRA 3CEKA 4CZUA 5CAQA 3NVKI 3TIYA 3R1NA 3LJ1A 5DT4A 3QU0A 3QX4A 5C4LA 4YR8A 2J90A 3QQUA 3G6HA 4TKSA 4BTMA 2VTNA 1BI8A 4L42A 1P2AA 4CT2A 4J1RA 3JY0A 4BICA 1ZXEA 4HYHA 3IW6A 3NW5A 4V0GB 3KKVA 4RX7A 2GCDA 1OKZA 3CE3A 4PX6A 3QL8A 3MW1A 3VS7A 4BWPA 4QQTA 1WBPA 3D0EA 3W18A 4RG0A 2BMCA 4GCJA 5J79A 2WELA 4WNKA 5JT2A 3M42A 3VQHA 3CJGA 2ESMA 4TN6A 2FH9A 2PE2A 3KULB 3BQCA 3UOLA 1SNUA 4CFVA 4EZ7A 2R4BA 3TG1A 3UZTA 5EM6A 3D14A 4GS6A 4BKJA 4N0SA 4R6VA 4A06A 1FVVA 3KCFA 2G9XA 4Q5EA 2X9FA 4W4YA 3RPOA 2WAJA 1WCCA 1B6CB 2NNWB 4QYFA 4FSRA 2W96B 3TKHA 3PE2A 4O0TA 4ANOA 3WI6A 3HL7A 5AFVA 1VYZA 3FI3A 4N70A 3Q5ZA 4QYYA 4EH3A 3GCUA 4CMTA 5E8WA 3PFQA 5M4UA 4KSQA 3FMHA 2ZVAA 4ZZOA 3A60A 3OOMA 3ACKA 4LQMA 1LEWA 3S2PA 3AMBA 4BKYA 2CKPA 2WMTA 4C0TA 3I81A 3ZSHA 1UA2A 4MQ1A 2IW6A 3V04A 4EYMA 4HVHA 5IQAA 4MBLA 5KZIA 1Q4LA 3KXHA 4E5BA 3JPVA 2ZB0A 3LCTA 4GSBA 5LVOA 4BHZA 3HEGA 3LFAA 3UPXA 1NVQA 4G6LA 4V0GA 2GS2A 4ZZNA 4EOPA 4HVDA 3EQCA 4FKIA 1NA7A 2C6LA 4UYNA 1HCLA 3P7BA 4FK6A 5AUZA 4KSPA 3D94A 3ET7A 3GP0A 3R02A 4FSTA 2JIUA 4Q2AA 3PY3A 4UWYA 4CG9A 1RE8A 3RPYA 4UXLA 4BC6A 4UBAA 3OXZA 3ROCA 1JKLA 3KULA 4BDJA 5AADA 4IVAA 2VAGA 4PRJA 4F08A 3D9VA 5L2QA 3ORNA 4D55A 4EH9A 2G2HA 2C0OA 4CQGA 4P2KA 5EOLA 3R71A 3FL5A 4C3PA 1Z9XA 1FINA 4E4MA 4Y5HA 2PK9A 3AC8A 3TM0A 2HOGA 4E4NA 5FUTA 4C7TA 2B55A 3E8CA 4UMUA 3LFNA 2VWYA 3FMDA 2C3JA 4L43A 5DVRA 3MFSA 3HX4A 1V0OA 3CGFA 2QURA 4E4LA 3FZSA 4FT0A 3F5PA 4ZTSA 4TYJA 4DTKA 3DTCA 3OT3A 4YC3A 2CPKE 5EHLA 4IAAA 1R3CA 5HBHA 4I41A 3TL8A 4O7LA 5CI6A 5LCJA 4G3GA 3VBQA 5KX8A 5HEZA 2A4LA 3TV6A 2UW0A 3Q4ZA 4RX9A 4YGAA 2GNFA 5KKRB 5DBXA 3DNEA 4K18A 3FMLA 4BGQA 4EOQA 4BFMA 4WO5A 4BVUA 3R7EA 4JDHA 4O2PA 4GYGA 5F4NA 5CXHA 4R77A 3PDTA 3ROYA 2P55A 4FZAB 4ONAA 1UU3A 4YNOA 4C34A 2XB7A 4RC3A 4RJ5A 3DJ7A 1YI6A 5IDPA 3GGFA 3E7OA 3BU3A 4YHTA 1SYKA 3D2KA 2J5FA 3OVVA 2R3MA 4Y95A 3EN9A 1YHVA 2CHLA 3HRBA 3L1SA 4RJ4A 4JAJA 4D4RA 4WA9A 4ZS4A 3LXNA 2X2MA 4E8AA 1JKSA 2WGJA 3LFDA 5L2SA 2WMRA 4FV2A 4IAYA 4K0YA 4LGHA 3QCYA 3V3VA 4FTQA 4Q5HA 4USDA 4IX5A 4YMJA 2OIBA 3DKOA 4BY9E 2QLUA 5B7VA 3P4KA 4O6LA 4FE2A 1E9HA 4KWPA 4QO9A 3B2TA 4U43A 5H9BA 2B53A 2DQ7X 2ETRA 3P1AA 5D11A 1WBOA 2R3LA 4DG2E 5IMXA 1CKJA 1UV5A 2O5KA 3VF8A 5HTIA 4BBMA 4WUAA 3V5QA 4ZTHA 1J7LA 2HCKA 3LJ2A 3ORTA 3OWKA 4U44A 4EJ7A 5HHWA 1FGKA 5FP5A 3UGCA 3W55A 4F6WA 2LAVA 5BVEA 3SOAA 3V8TA 3R1YA 1YHWA 4AA4A 1J1CA 1XQZA 4XMOA 3U4WA 3ZLWA 4IVDA 4AUAA 3FXWA 5HTCA 4FODA 4QP7A 5K4IA 3RM7A 3CPCA 3SQQA 4FV8A 4CMOA 4XHKB 2OXDA 5AV1A 4FC0A 4OT6A 5TE0A 4C33A 4FIFA 3NIZA 3TZ8A 2CKQA 5AUVA 3HMNA 3QTIA 3RWQA 5E8SA 3BELA 4S30A 3ZDUA 4DCAA 5IH5A 2Y6OA 3N4TA 5KMJA 4YO4A 1ZYJA 1JBPE 2WTDA 3ZEWA 4G3FA 5C8NA 2EWAA 2IW9A 5DRDA 4AT3A 1QPCA 3T8OA 3GENA 1PY5A 5ANGA 5CEQA 5IA3A 2WMWA 3ENMA 2YCQA 3KRXA 3EB0A 2UUEA 2C6KA 3EZVA 3F3TA 3C0IA 4IAFA 3LKMA 4O22A 4MXXA 1PXOA 3O50A 5HCXA 4H3BA 3PXRA 3FYJX 3RAKA 4FTIA 3G15A 2JITA 3FZPA 4H1JA 4Y8DA 4EBVA 5AP0A 4EOKA 4I94A 1JLUE 4FNZA 2CN5A 4CTCA 2ETKA 3IW5A 1OUYA 5DRBA 4O7SA 2ACXA 2F7EE 5CAVA 4QPSA 2R5TA 2B9HA 3BLRA 4DH8A 1P5EA 3TDWA 5I5ZA 2WMAA 3CQWA 3FJQE 2OI4X 3FZOA 2X8DA 3R00A 3F69A 3SW4A 1KV1A 2W1IA 2OG8A 1PF8A 3R30A 3UYSA 4S34A 5CZIA 2OSCA 5JQ8A 5CS6A 5GJFA 1VJYA 3KRJA 5DR6A 5E8VA 4ZTLA 4QTBA 4ENXA 5I4NA 2IVVA 4D1XA 1SNXA 2VWUA 3A2CA 3AMYA 4RZVA 2YISA 2OFVA 2EVAA 3UO5A 2BCJA 3FC1X 1YXUA 3GCVA 3D4QA 1KV2A 4RJ7A 3OZ6A 4WSYA 1KE7A 3VUTA 3WZEA 4E26A 2AC5A
chains in the Genus database with same CATH superfamily
4EKLA 3SXFA 4WUNA 5B2LA 3BLHA 3P23A 2FB8A 4PDOA 2UW9A 4E3CA 4GFGA 2ZJWA 2A19B 3EN4A 4FKGA 4PUZA 4TNDA 4U80A 4DGMA 4GEOA 3W0QA 1VR2A 4FL2A 2A2AA 4U97A 3D5UA 3W2OA 3OD6X 2WPAA 2YIXA 3QRTA 2GNJA 4I0RA 3W32A 4HZSA 4X6QC 2W0JA 4ZSEA 4JJRA 3MFTA 4QMXA 4H05A 3HECA 3JVRA 3MV5A 4ASDA 5M44A 3UJGA 2J9MA 3C9WA 2RIOA 3POOA 4OBOA 2W4JA 3I6WA 1WAKA 4RWKA 5BYZA 2CDZA 3GU6A 3GT8A 3ORZA 4FV7A 4X3FC 5ANEA 2HXQA 2WMQA 3H0ZA 4GIIA 4K33A 5FQDC 4O7WA 1YDSE 4DGOA 3G9NA 3T3VA 3UE4A 3DB6A 4I0TA 4MAOA 4HVSA 1GZOA 2PYWA 4AXCA 3TNIA 1JKKA 5HLNA 3QUPA 1LEZA 1M2QA 2R0UA 1H1SA 4FRFA 1IRKA 4J71A 1TFFA 2RSVA 2B9IA 4BCQA 1ZLTA 5H8BA 1YKRA 3D7TB 3QUDA 1Q5KA 3UQCA 4IM2A 4QT1A 4DFBA 5CY3A 4S32A 4C2WA 1H28A 3BLAA 2NRYA 5CVGA 4XG3A 4F7SA 4X2FA 4O0VA 3RHXA 4AG8A 2O2UA 3E87A 3PE1A 2IPXA 2XANA 2R2PA 3R2YA 5TT7A 1IASA 2EXEA 2W1DA 5EI2A 4ZSAA 2YHVA 3G51A 5E8ZA 4MHAA 4FVRA 4MWHA 1R39A 4QMTA 1OIUA 3PJ2A 4DITA 3QRIA 3P9JA 3Q4TA 4BDCA 3F5XA 5FDXA 4BIDA 4A9RA 4J8MA 3ORXA 2CN8A 4IB3A 2A1AB 4IZ7A 3GU7A 2XM9A 4I5CA 3ZM9A 3NDMA 4YSJA 2IVSA 3W0SA 4O4EA 3F2RA 4O83A 2PPQA 5JEBA 4MF1A 4G5JA 4XP0A 1PXPA 1QPJA 1OL2A 1U46A 3F3VA 1WBWA 4RZWA 5AP7A 2OF2A 4EJNA 5HLWA 2GQSA 3U87A 2VTHA 3I0OA 3NYVA 5AUWA 3CD3A 3OCBA 3ORLA 4XUFA 1GIHA 3AKJA 4RFYA 5AAGA 4M97A 2H9VA 5M51A 3KB7A 5IMEA 2PHKA 4CLJA 5CVFA 5JGAA 3HMPA 4FKSA 2VX1A 3TUBA 4G9RA 4O7NA 2C3LA 3F82A 4CD0A 2OJ9A 3ZS5A 3GXLA 3QAME 2PZIA 4IX6A 4RT7A 2JBOA 3SX9A 4AGCA 4C3FA 5M4CA 3S95A 3EQBA 5DPVA 4O84A 3MY5A 2W4KA 2C3KA 1OM1A 5HI2A 4BWXA 3AD4A 3DAEA 2QO7A 1JNKA 4I22A 4QMNA 4EBWA 4YJVA 5A3XA 3KEXA 5CT7A 3MFRA 3PSBA 4R1VA 5A4CA 2BKZA 2UZBA 2P0CA 1R0PA 1A48A 4WNMA 2O63A 2OJFE 3BHVA 1SZMA 4FKRA 1OMWA 2HY81 4GT4A 4LOQA 4YTHA 5ANDA 3ZLXA 3FLSA 4QYHA 3QD3A 4GVJA 4CVAA 3U51A 1RJBA 3CSVA 3VS1A 3AMAA 3FQHA 4AX8A 3AC2A 3KA0A 4XP2A 4IJ9A 3OCGA 3I5NA 5M08A 4H3QA 4K6ZA 4NCTC 1MRUA 2Y4IC 3WF7A 2QOFA 5CU0A 3IGGA 3U6IA 3V8WA 4ANLA 3AD5A 3NX8A 4ZTNA 3NUPA 4LOPA 5LMKC 5HCYA 2ITZA 3R8ZA 3O17A 3EFKA 2O3PA 4MNEB 2FSTX 3SAYA 4RJ6A 5KNJA 4LRJA 4IJPA 4GT3A 4AP7A 4AZEA 4GK2A 4ZTQA 4Z7HA 1PRYA 4DA5A 5J95A 1CSNA 2X7GA 4S33A 4JBQA 3WF5A 2PSQA 1U54A 2YLFA 4YURA 2BROA 4JNWA 2YA9A 3N9XA 3FYKX 4WG4A 5HNGA 1P4OA 3UG2A 5M4IA 4E6AA 1Y57A 2QOQA 4TWPA 5A54A 1W8CA 3BHTA 4IXPA 4KRDA 1KOBA 2F4JA 3OG7A 4YJRA 4FT5A 4ACHA 4F7JA 4K2RA 3C7QA 3VS6A 4OLIA 4ACDA 3BBWA 4CV9A 5LVMA 2W5BA 4IX3A 3R0TA 4UEUA 2HWPA 2BRBA 3UIUA 4CNHA 4E6QA 3DDQA 5AP3A 1YQJA 1H25A 5JRSA 3M11A 1ZMUA 5FM2A 5HIEA 4F0FA 4IVBA 4IDVA 4BZOA 3IOPA 2ZOQA 2R7BA 2FYSA 2W1GA 1OVEA 2KULA 2V0DA 2W1EA 3BRBA 3O7LD 1OIYA 3PPJA 3QTXA 1YOMA 5CXZA 4F9AA 1U5RA 3FWQA 1B38A 2PZRA 1CDKA 3R7YA 4AAAA 2FSLX 3MVLA 3RTPA 3UO6A 4QMYA 2PVFA 2A98A 1S9IA 3LFQA 4ALUA 1WVYA 2XK8A 4QD6A 2X6DA 3PRFA 4E7WA 4IFGA 3QC4A 5JN2A 5FLFA 5J87A 4NKSA 5EYCA 3VBVA 1JOWB 2R3GA 4HVGA 2C6MA 4O0WA 4ZS0A 5ETFA 3PUPA 1ZZLA 2JLDA 4HCTA 4AGUA 4BDKA 3BPRA 3T9IA 4DYMA 3S0OA 4CYIA 4HYIA 1FMOE 4LV5A 5HG7A 4EHEA 5J8IA 4DE4A 3IONA 2VO0A 2OBJA 3PTGA 1OKVA 3RMFA 5C03A 4PTEA 3EWHA 3BBTB 1W82A 4FTNA 4JR7A 4HPUE 4M66A 3KN6A 3EYHA 3NLBA 4NU1A 5FGKA 4OTGA 4JOAA 4FZDB 1BL6A 2H6DA 4HPTE 4OBPA 2X0OA 2OIDA 5K0XA 4V01A 4O7YA 4OGRA 4KBKA 4UMRA 1ZY5A 2HXLA 4R3PA 4YBKA 5AR7A 4M14A 4ZK5A 3R9DA 4CFWA 3O96A 4UMQA 2VWVA 4D4YA 4MUQA 4IAKA 5KMNA 4WBOA 4AXAA 3VS4A 4S2ZA 1ST4A 4KS7A 3HRCA 2CGXA 2PMOX 3FUPA 4X2JA 3KXMA 2GNGA 3FHIA 2XM8A 3GCQA 2DUVA 4N4SA 2UZLA 3RAWA 3S4QA 3UMWA 3ZUUA 3K2LA 2C5VA 3G9LX 4DFYA 3KRWA 3KK8A 4EUUA 1PXJA 1ZYCA 1KE8A 2X0QA 2GHMA 3IDPA 3QZHA 2JGZA 3LFSA 2X4ZA 2YFXA 4IC7A 3MVJA 1PMUA 3TZ7A 1O6LA 4MVFA 1WVXA 3E64A 3TT0A 5AP2A 2WO6A 4AXDA 4FEXA 1HOWA 3SRVB 4U8ZA 4X0MA 5TOZA 4EI4A 3LJ0A 4AF3A 4X6RA 3IGOA 2VX3A 4FKWA 4IEBA 4UYAA 4AFEA 2J6MA 3GNIB 3ORMA 1KOAA 4QMZA 3ZZEA 3PJCA 4EOJA 4RA5A 3A8WA 4APCA 2ZDUA 1G5SA 2UV2A 4TWCA 4XS2A 2HENA 2PVRA 4BCOA 4DHFA 2QONA 4X3FA 3DK7A 3QCSA 4NTTA 4C4HA 3ZRMA 3H9RA 3ITZA 5CVHA 4M15A 4ALVA 4P5QA 2J5EA 5CZHA 2UZUE 2VTSA 5DG5A 3GC9A 3FI8A 4RWLA 5BVKA 3UIBA 1J7IA 4RWJA 3C51A 3DAJA 4U41A 4Y73A 2YN8A 1OKYA 3LZBA 4GMYA 4I24A 4BDEA 2Y8OA 5EH0A 3V51A 2BTRA 4IQ6A 5KBQA 1YDRE 4G17A 4AGWA 2XNGA 2PMNX 4FV1A 4PQNA 5F95A 3K5UA 3THBA 4TL0A 3ZEPA 1T45A 3QFVA 3Q9ZA 1Q3DA 5AUTA 4TYEA 3VUHA 3IK3A 4L01A 3TTJA 2QI8A 5E9EA 3GC8A 3PJ3A 4NFNA 4QP1A 2R3IA 3O0GA 4J95A 5F20A 1ZYDA 2PUIA 3KXXA 5LCKA 2X81A 4APPA 4F4PA 3AQVA 1OPJA 2H8HA 4CFMA 4XP3A 4L3JA 1OECA 2ERZE 4RC2A 4D2VA 1KE5A 4IB1A 2YACA 2OWBA 2I0VA 2FGIA 1QPEA 3SRVA 4QP9A 4KABA 2JKMA 3R9NA 3EJ1A 3QLFA 5CLPA 2PZ5A 4PP7A 1F3MC 2XNEA 4BI1A 2WB8A 4JRNA 4AZSA 4C3RA 3FPMA 2NYAA 2WIHA 4W8DA 3NR9A 3VS0A 4L68A 1OL6A 4I6BA 4RQKA 3QQKA 2WTVA 3TV4A 3UIMA 4ALWA 3W2RA 4F78A 3IDBA 3HNGA 3MN3A 3COKA 3UTOA 3Q9YA 1GZKA 2PVMA 3OTVA 3OBGA 4MD9E 2OJGA 2PU8A 3FLQA 2HZIA 5ETCA 5HVYA 4GJ3A 1APME 3EQDA 1BUHA 3Q2JA 4U3ZA 3DY7A 4FIEA 3TNPC 2G15A 5IEYA 3U54A 2BPMA 2DYLA 3OCSA 4FEQA 4FNYA 3UVRA 4TRLA 4WRGA 1JSUA 4FSWA 4IHPA 4NFMA 1SVHA 5HNBA 3PA4A 1OGYA 3AOXA 4J97A 3BYMA 4FR4A 2ZYBA 1R0EA 5CX9A 4BDFA 4MH7A 3NUUA 5CI7A 4DEBA 4FG7A 2BZHB 3II5A 4L52A 5ETAA 4IX4A 5HORA 4DG0E 2FSMX 2YEXA 4EK4A 3ULIA 4UMTA 3HP5A 4D1SA 3C4FA 3TNWA 3K54A 3WF9A 5JGBA 1TQPA 3VRZA 1HCKA 1OKWA 3TWJA 3V6RA 3ZOSA 2Z02A 1Q8WA 4GRBA 4NM7A 2QO2A 4XEYA 4ZJIA 4KUJA 2RFSA 3F88A 4ZY5A 3VBTA 3EQIA 4NCTA 3ORPA 5HG9A 2W99B 3A61A 3OTUA 5LMKA 5CF4A 4C61A 2IEWA 4G5PA 4C59A 5JGDA 3JXWA 5AIRA 4BCNA 4AN9A 2CKOA 2VWWA 2JFLA 4ZSJA 4FTKA 2W7XA 2IZUA 3QZIA 1M14A 1UVRA 2I0YA 4IWPA 4NIFA 4UALA 4CSVA 3QCXA 5AEPA 3PIYA 3Q6UA 3MSSA 5HU9A 3GU5A 4K11A 2BALA 4LYNA 2R64A 4C2VA 2OKRA 3RJCA 2C30A 1G8AA 2ITYA 4TWOA 4DT9A 3RPRA 2UW4A 1ZARA 4U45A 2Z7SA 5AUYA 4DC2A 2R3HA 3HRFA 1OPLA 2ZM1A 1YWRA 3OUKA 3QQJA 5IQGA 3DDPA 3ANQA 5E90A 3MH0A 4KB8A 1FMKA 2YCRA 2YWVA 4HYUA 4LOOA 4MXAA 5JQ5A 3Q9XA 1W98A 3O8PA 1XO2B 1IA9A 2V22A 3UOJA 2W5AA 5AIKA 4ACMA 3MYGA 4XLIA 4BZDA 4D9UA 3V8SA 4G6OA 4JT3A 4G16A 4C8BA 2AYPA 2PE0A 5AX9A 3H4JA 2FVDA 4PMPA 3WE8A 3M2WA 2CLXA 1PMVA 2YM4A 3MDYA 3GU8A 3BQRA 2J51A 1Y6AA 3GEQA 4ACCA 3AC5A 3LXLA 3ATTA 3AGLA 3EQPA 3G0EA 3NAXA 1DAYA 4KA3A 1SM2A 4E4XA 1OIRA 3HA6A 4HW7A 2B4SB 4F7NA 2IJMA 5T6KA 2IN6A 3P79A 2YZAA 4FBXA 3NRMA 4FIGA 3MB6A 5E8UA 4DFZE 4MTAA 3T9TA 1TKIA 3NUXA 1A9UA 3R83A 4QP8A 2J50A 4M12A 4A4OA 1NVRA 1YW2A 2P4IA 2YAAA 4Z55A 4NYEA 1KWPA 2XCHA 3HZTA 4NZWB 4R8QA 4M13A 4RFZA 4RSSA 4B99A 2O8YA 5AUUA 4BDHA 4G3CA 3EH9A 2WOUA 3PIZA 3PYYA 4NM0A 2Y0AA 3FDNA 5T68A 3RNIA 4E5AX 4QDVA 5M06A 2YCFA 2Z2WA 2CGVA 2GMXA 5LVPA 1LP4A 3R63A 1ZMWA 4DLIA 4YP8A 3P5KA 5I9WA 3DBFA 3DK3A 4FNXA 2YDJA 4EC8A 4BGHA 5A6NA 3KL8A 3PIXA 1IEPA 4JDKA 5CALA 3N51A 2QODA 4LUEA 3G2FA 2GS7A 3WARA 5IH6A 4R5SA 1Y8YA 2BDJA 3OEZA 3BWFA 4B4LA 4O0XA 1K2PA 2PMIA 3R7OA 3RK5A 4O0RA 2BAKA 2UZTA 4BRXA 4BYIA 4MYGA 3L9NA 5EG3A 3W1FA 4O27B 3QKLA 5AM7A 4KIKB 4E73A 2QOCA 3KRRA 3C4CA 4ZY6A 3RNYA 4RMZA 3QTWA 5TO8A 2XKFA 4RIOA 3R9HA 3A8XA 2W9ZB 1WMKA 2RG6A 4HYSA 4A9YA 3W33A 3FY0A 4JG7A 4WSQA 4D0WA 1GIJA 1ZAOA 4JG8A 3ZC6A 4JR3A 4EOLA 5HGIA 3A4OX 2F9GA 3PG1A 3BEGA 4AZTA 5L8KA 2AUHA 2XEYA 2YABA 4WNOA 5B0XA 2NRUA 2CCHA 2QVSE 3IW7A 4CT1A 4QYGA 5JZNA 4M7IA 4LV8A 1H24A 1Q99A 2OF4A 2XF0A 1KSWA 4YLJA 3RWPA 1M52A 4PL3A 1OGUA 5DE2A 2VNWA 5CT0A 2ITUA 3KXZA 4FYOA 5CEMA 2ZV2A 5CF8A 5GIOE 4EOIA 4C02A 4M3QA 1TZDA 2E2BA 2QHMA 3CKXA 4C37A 1G8SA 3PVBA 3ZM4A 4PDPA 2R3KA 3IQ7A 4PF4A 5EKNA 5AUXA 3ZMMA 1YXSA 3QWJA 5AMNA 3HLLA 1NT2A 4RBLA 2C5XA 4KD1A 5C01A 3ZFXA 4O7TA 3EZRA 4A4LA 4IB0A 2EXMA 4L6QA 3QA0A 4AZVA 5E7RA 5DR9A 3O8TA 5FP6A 3AGMA 4DFUA 4KRCA 3UODA 3R8MA 4U0IA 4PTGA 2PZPA 3PRIA 4FIJA 5DI1A 3V5LA 4C4FA 4RA4A 4TZRA 3N4VA 5IZFA 4YBJA 4E1ZA 5HIBA 3A7IA 1ZZ2A 2YZLA 4AQCA 2I0HA 3UO4A 4KIKA 3GFWA 2QOBA 4U5JA 4YJNA 1CKIA 2OK1A 4EUTA 3PZHA 4BWKA 2YIYA 1IR3A 1R1WA 2XCKA 4GL9A 3ID6C 3FI4A 4G2FA 3F7ZA 4NEUA 4IAIA 1OPKA 3V5TA 4MD8E 4CFUA 2VGPA 1NY3A 2Y6MA 3KY2A 5C27A 4JMQA 3QD4A 4WHZA 1M7QA 3HDMA 5FM3A 4C4JA 3EFWA 4DAWA 3D5WA 5LXMA 3COIA 3H10A 3E8NA 3TJDA 4D2TA 3BZ3A 2R3PA 4EK6A 1W2FA 2VWBA 4ZMFA 3TIZA 2QR7A 4FKTA 1GOLA 2B9JA 4Y85A 2PE1A 3HV5A 2JC6A 1H27A 4JG6A 2HIWA 3BIZA 2UVYA 5HBEA 2J2IB 4M68A 4TYHA 3AKLA 4CGAA 3C4ZA 2XNNA 2YM6A 5FBNC 4I6LA 3UZPA 4EONA 2WTKC 3ZFMA 4FV3A 4ASZA 4YUQA 4XX9A 3PY1A 4JQ7A 4GJ2A 3NWWA 3BYUA 4XG4A 4XOZA 4AFJA 4CCBA 5BX0A 4FT7A 3VF9A 4GK3A 4I6FA 2HZ0A 4G31A 3C0GA 5G1XA 5DEWA 5KMIA 4ZY4A 2QOLA 3QQHA 5CEKA 2C6TA 4OW8A 5F1ZA 1E1VA 4P5ZA 3VS5A 1ND4A 3RPSA 3E3PA 3ZSGA 5A14A 4QNAA 1Z57A 3DBQA 5EKOA 4OAVB 2HAKA 3PA3A 4EEVA 3R9RA 5CEPA 4H39A 4O7ZA 4FMQA 1UNGA 2BIKB 5AV4A 2XARA 4FJVA 3C0HA 1H8FA 2ZDTA 4BDAA 4BCPA 4QP2A 5K0KA 3R7IA 4G9CA 1U5QA 4MF0A 4FKLA 2RFDA 4RVMA 3PPKA 4YTFA 4NSTA 2ZV8A 2XRWA 4KBAA 2UW6A 4XCUA 3SOCA 2VTQA 5HX8A 5E8YA 1FOTA 4ITHA 2WU7A 4Z9LA 5A6OA 5DN3A 3GBZA 2JAVA 4BJJA 2YIQA 3Q4UA 2VRXA 4ERKA 2VZ6A 2F7ZE 3RAHA 3FMKA 3C50A 3HP2A 3A7GA 1REJA 3ALNA 2R3JA 3VONA 2YWPA 2E9NA 3E5AA 3DZQA 4FZ7A 3R8PA 3C4WA 3TKUA 5HOAA 4F7LA 4UWCA 4YZ9A 1M2PA 4N6YA 3ZXZA 5EYDA 4D2SA 2XNBA 1AQ1A 4BR3A 4AOIA 1P4FA 5J1WA 1XH7A 1BX6A 3FXXA 3IOKA 1VYWA 3KF7A 3PFYA 5ITAA 4AS0A 4KKEA 5G6VA 4HOKA 4XJ0A 4YZCA 3QYWA 5D7AA 5DMZA 2QG7A 4V04A 2VWIA 4QMPA 5M56A 4PMMA 2BFXA 4AW0A 4A9SA 3BI6A 2XK4A 2HK5A 3PJ8A 4GH2A 1AD5A 4OTDA 2Q0NA 5FTOA 3R6XA 5ACKA 4O21A 2P2IA 3W16A 4BCJA 2C6EA 3BX5A 4TXCA 4I92A 3R1SA 5BMMA 4WKQA 3CIKA 3OC1A 4A07A 4MXOA 3VBWA 4BCFA 4F0GA 4F9WA 1JSVA 3TV7A 1IA8A 2F2CB 4EH5A 5EDPA 2JFMA 2HW6A 3VIDA 5DR2A 5BMSA 1RW8A 5K4JA 3ODZX 5IQHA 2IZSA 2WEVA 2X0PA 3MA3A 4BF2A 2XUUA 1Q8ZA 4EK5A 5A4EA 2VO7A 3WE4A 4XNEA 2VNYA 5KZ0A 3VC4A 2RKUA 4I5HA 3SHEA 3GQLA 4AOTA 5H2UA 3PA5A 3FV8A 3KQ7A 2C68A 4QP3A 3NIEA 2FO0A 3FMEA 2XKDA 1B39A 3VUGA 3C5UA 3LIJA 3FPQA 3D2IA 4BI0A 4ZSGA 3LXKA 2EB2A 3EIDA 3KXGA 5DEYA 4U42A 3KRLA 4I6QA 3G6GA 2UZWE 2YDKA 3ANRA 5HLPA 5JRQA 5I9VA 4DF3A 4W8EA 4OTQA 3DBDA 3EYGA 3MVMA 4EH4A 4GKIA 5M07A 5EFQA 4RIYA 4DGNA 2I1MA 4QTDA 3E8EA 3QBNA 4P7EA 3BU5A 3L9PA 4Y83A 3UQGA 2VTJA 4L67A 5EYKA 2VX0A 4OBQA 1CMKE 2XALA 4GU6A 5BPYA 1SMHA 5DT0A 2F7XE 4YJSA 5C4KA 3VHKA 3QHRA 3HKOA 5CSWA 4JS8A 4AT4A 5CSXA 3TCPA 1ZY4A 1X8BA 5AP5A 1U54B 4N6ZA 4FEUA 2XBAA 1H00A 5JH6A 3ZO1A 5IA1A 5KMLA 4UZHA 5HE1A 3WBLA 4CKJA 2HYYA 3ZTXA 5IG1A 4O1PA 3R2BA 4QDEA 2GNLA 3WF6A 3CJFA 2XBJA 3W8QA 5AV3A 2PUNA 3LMHA 2AEGA 4OT5A 3EQRA 2I40A 2QG5A 3E7VA 4FZ6A 5C8MA 5DNRA 4ZXTA 3T3UA 3FXZA 5IQFA 4UV0A 1E1XA 2HY0A 4DGLC 1UKIA 3TXOA 4USFA 4FOBA 3W0MA 5EOBA 4FTAA 3F66A 3VWAA 4XV1A 5DYJA 5L6OA 3I79A 3SG9A 5HD7A 3OFMA 2IVUA 4NUSA 3FSFA 2DS1A 4OR5A 3ZDIA 5I9XA 5L2TA 1XR1A 2BZJA 3MFUA 5FEDA 3FMJA 3R7VA 3QRUA 1KE6A 3R9OA 5HO7A 3C4XA 4U9AA 5TKDA 2QKRA 2WQNA 4IE9A 1URWA 1BI7A 4DBXA 3TZMA 4CZYB 3MI9A 4TWNA 4ZIMA 3VS3A 5LOHA 1MQ4A 4L8MA 4NTSA 4FI1A 2W9FB 2XKEA 3R1QA 4L45A 3ZO3A 4OAUC 2V5QA 4YO6A 3DOGA 4EL9A 5HKMA 1BL7A 3GCPA 3QF9A 4IM3A 3GC7A 4FL3A 1IAJA 3F61A 3NW6A 3V6SA 5KBRA 2PULA 3DAKA 4XBUA 4DH5A 2GDOA 3UQFA 2ZMDA 5EM7A 4UN0C 2OZOA 4V05A 2BIYA 2BZKB 3FL4A 3UP7A 2YJSA 3MH2A 4I6HA 4H58A 3VULA 3UNZA 4B8LA 4LGGA 3VHEA 3KIOC 2OLCA 2CKEA 3CR0A 3WF8A 2RFNA 3DBCA 3ZONA 4U81A 3PWDA 4YC6A 3HAVA 1JSTA 5FEEA 3UC4A 3OXTA 1MUOA 1WBVA 2PZYA 3DQXA 3RKBA 2JEDA 3IKAA 3QTRA 3R21A 4DN5A 2B0QA 4B9DA 1CTPE 4WRSA 4RQVA 3CTQA 3HGKA 3AXWA 5BYYA 3ZU7A 4AZWA 4Z3VA 3ATSA 3DTWA 4LM5A 2XK6A 5E8TA 2UZEA 4QTEA 4RLKA 2V55A 3FMNA 4P90A 4Y5QA 5LARA 2W1CA 2VGOA 4A9UA 3U6HA 2QO9A 4YHFA 1UKHA 2X4FA 4ENYA 4QOXA 1Q97A 4QMSA 2OGVA 5M09A 4YJPA 2X7OA 3FLZA 1OI9A 3LM5A 3NUAA 3ULZA 4BZNA 3QTUA 2W1ZA 5C8KA 4AW5A 2XAMA 3Q9WA 3HV3A 4QP4A 2JDSA 5HICA 4EKKA 3ZO4A 2BHHA 3VAPA 1KUTA 4FTLA 1Y91A 5CNOA 3QXOA 3F2NA 3I60A 2WTCA 5F94A 4ZSLA 4F63A 2ZMCA 5A4TA 2BRHA 4MEDA 4MBJA 3MS9A 4HZRA 3KCKA 3G5DA 3E8DA 2QLQA 1XBBA 2WTJA 1W84A 2ZB1A 4MWIA 1OL7A 1Q8YA 2VWXA 3MIAA 4FSZA 2RF9A 1GZNA 1DAWA 1H26A 2WFYA 1YOJA 1I44A 1UU7A 2C5OA 2WKMA 3CCNA 3HV7A 3LFCA 5EDQA 3QD0A 3BKBA 3O51A 1ZYSA 5L3AA 1YVJA 3Q5IA 3MGYA 1W83A 3FKLA 2VO6A 4MCVA 3BWJA 4O4CA 4XYFA 4Y46A 4NJ3A 4KINA 3CLYA 2Z60A 4X3FB 4JVGA 4DT8A 2X39A 3A7JA 1H1PA 4F9YA 2GTNA 2HZNA 4W9XA 3ZH8A 3HMMA 3DXQA 5IUGA 5E1SA 4FG8A 4CXAA 1FVRA 4CRLA 2YCSA 5LMAA 4IZ5A 3FZTA 3P0MA 3MJ2A 5CU3A 2BDWA 1W7HA 4BCGA 5DA3A 2XNMA 4BDDA 3MPTA 3ZHPC 3ELJA 1BKXA 2A27A 3L8VA 3LFBA 3QUEA 4IZAA 2VU3A 4U40A 1TQIA 3RCDA 4BTFA 4EH8A 5KMMA 5EK7A 4EQCA 1EH4A 2XIXA 1Q41A 3N4UA 5AAFA 4DEDA 3DU8A 3AT3A 4AA5A 4EQMA 1Q62A 1J1BA 2BKKA 4QQCA 5EI6A 2JKQA 5CAPA 5GIPE 3GI3A 2J0MB 3HMOA 3LMGA 4FVPA 1NXKA 1SVGA 5DFPA 1FGIA 4D1ZA 3TDVA 4L44A 3RPVA 4M69B 2YIRA 4G3EA 3MIYA 4KS8A 3FY2A 2V7OA 3KVWA 4F99A 3MVHA 4PPBA 4I4FA 4DFNA 1MQBA 4GVAA 4BBFA 4WT6A 2IG7A 4FGBA 4CTBA 1F5QA 4GG7A 5K3YA 1WBTA 4YNEA 3OWJA 4FEWA 5M4FA 3EN7A 2BZIB 2J4ZA 5EYMA 2IVTA 4E20A 5FTGA 2V62A 3NNXA 2OW3A 3PXZA 3SXRA 4B7TA 3EFLA 3MTFA 5IU2A 1XWSA 3TUCA 4O82A 2ITWA 4I21A 2CLQA 5HTBA 5KE0A 5HU3A 3F7WA 5JZJA 3QKMA 3UNJA 5LMBA 2WQMA 3SVVA 1BLXA 3VUDA 4GK4A 4QRCA 4A4XA 2E9VA 2YM8A 4OTPA 5HBJA 1S9JA 2BAJA 3CGOA 3JYAA 4FEVA 2WIPA 3HV4A 4I93A 3IDCA 4RJ3A 3UOKA 3PXYA 4FV6A 4H36A 3PPZA 3TZ9A 5J5TA 3AC4A 4JDJA 4LL5A 5HO8A 1TQMA 3V5JA 4PV0A 1W0XC 3CS9A 4CV8A 1M7NA 2UVZA 5HVJA 4RIXA 2BVAA 5IA2A 1SVEA 3UVQA 4FIIA 3BE9A 1ATPE 3LQ8A 2C6DA 4WD5A 4ZMEA 4PNIA 2XNOA 4E93A 1IAHA 3F3UA 4M69A 2XK9A 4QQ5A 2QHNA 4RIWB 3FSKA 3TNHA 4IB5A 1JKTA 4DEGA 4YLLA 2IZRA 1NVSA 4M0YA 2GFCA 5I9ZA 4F09A 1FBNA 1ZRZA 3RCJA 3R01A 3R28A 4JI9A 2REIA 3R73A 3VW8A 3W10A 2H34A 3LAUA 4YPSA 3BL7A 2P33A 2Y4IB 4DGGA 4EYJA 4GUEA 4ZLZA 4YJUA 5I3OA 5L6WL 3BGQA 5JFVA 2I0EA 4JAIA 4Y72A 2OIQA 4JBOA 5ACBC 2GHLA 3W0PA 3CY2A 2X2LA 3P86A 5LJJA 3OHTA 2XIKA 3ERKA 2XA4A 2BRNA 4FKOA 2WEIA 2EXCX 3RBWA 3Q4CA 4NM3A 4I5PA 4FV0A 2YLEA 3I6UA 3PP1A 3PWYA