1OUKA

The structure of p38 alpha in complex with a pyridinylimidazole inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
348
structure length
348
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for p38alpha MAP kinase quinazolinone and pyridol-pyrimidine inhibitor specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 110
structure length 348
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1oukA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1oukA01
1J7IA 3EFKA 1H00A 3AT3A 2BFYA 3C4XA 5HHWA 3OWLA 4MVFA 3R04A 4YNEA 3NUAA 2F7EE 4HGTA 4JDIA 3MA3A 2H96A 2HENA 2W1CA 3L8SA 4G31A 4KS7A 5DEYA 3OC1A 4AT3A 5I9XA 5HKMA 3LLAA 4IM3A 3Q53A 3C1XA 4LV5A 4BC6A 4X2NA 3K3IA 4JI9A 3C7QA 2VNWA 4IAFA 5ANGA 2R3HA 2GCDA 2XCHA 5IA2A 4CCBA 1CKIA 2XKEA 4BCFA 5AADA 4DBXA 5K0XA 4FV8A 4DGMA 5FUTA 3A7GA 2ITVA 3DPKA 4BCGA 3ZBXA 3Q2JA 2B1PA 4DTAA 2WO6A 1DI8A 4IAZA 4LL0A 4WBBB 5AUVA 5C8MA 3QQGA 2CKPA 3R01A 4K9YA 4JBOA 5ICPA 1NXKA 3UJGA 3F5PA 3NCGA 3T9IA 3EQHA 3F3WA 3MIAA 4BYJA 3F3VA 3KA0A 3O23A 4FSRA 2QLUA 4W4XA 4PMTA 4JX7A 5J8IA 2DWBA 3SDJA 3FXWA 4IB3A 4FE2A 3DBQA 2BZKB 3QD4A 3NGAA 4YZDA 4IFCA 5E91A 4MCVA 5J5SA 2GFCA 4FTOA 2ZV8A 4FTRA 4M68A 2I7QA 3G6HA 3KRWA 4JX3A 2R7IA 3KL8A 4FTLA 3VC4A 1FVVA 1QPJA 1V0OA 2X9EA 2R5TA 3BBTB 4RFZA 3R8UA 4BR3A 2Q0BA 2XVDA 3L9PA 3ORLA 4PP9A 5CEPA 3DAEA 3Q4TA 2CMWA 1NVQA 2O5KA 3GGFA 2P0CA 4C4HA 3TNWA 2YCQA 2HCKA 3AOXA 3GXLA 5DT4A 4YPSA 3SC1A 2WTKB 3VS4A 4K6ZA 2ESMA 2BIKB 4AX8A 1KOAA 2G1TA 2ZM4A 4I21A 4L3LA 1RJBA 5H8EA 2W0JA 4IZYA 1XBBA 3VS3A 5B2LA 3NMUF 1JSTA 3CP9A 4C3PA 5FM3A 1JSVA 1GJOA 2F2UA 3AT4A 2YIYA 3IECA 2XK3A 4OLIA 3QHRA 4FEXA 1ZARA 4EQMA 2H6DA 4XJ0A 2OH0E 3Q60A 4K77A 2OXXA 1SYKA 4AGWA 2PMLX 1FPUA 2YIXA 4RIOA 3MB7A 3VS2A 4YZNA 1ZYLA 2R64A 4IACA 2WMXA 2ZM3A 1Y6AA 5AR2A 4I5MA 1PXLA 2P33A 3DXPA 4L7SA 5A4TA 4J7BA 3ZS5A 3QWKA 4ZTLA 2WOTA 5KE0A 2R3OA 4GEOA 2BAKA 3ID6C 3I7CA 3ZRKA 2X1NA 2BRNA 3C4ZA 2W5BA 3LCDA 5I9VA 5M56A 3BYVA 4JR7A 3DLZA 3CJGA 3PP0A 5M53A 4FT9A 4IJPA 1TVOA 4Z55A 2VTLA 1M7NA 4B4LA 3DA6A 3TNQB 5BVFA 4OTRA 3P0MA 3IDCA 5IUHA 2JKKA 1KE6A 1Q4LA 3DOGA 1H25A 5JT2A 2RFSA 3IK3A 3QGWA 4EBWA 4UYNA 2VAGA 3QHWA 3POZA 2VU3A 4IH8A 4FIHA 1REKA 3RCJA 4GFOA 3KN5A 4ANLA 2VWUA 3G9LX 3M42A 1KV2A 1FINA 2P2HA 4ASXA 4GFGA 3II5A 5AV1A 5KZIA 2CCHA 3G90X 2C5OA 3G9NA 4R5SA 4JDKA 4JNWA 1UKHA 2UW0A 4F0IA 2I0HA 4J52A 1G3NA 5T6KA 3ZLWA 3E8EA 4LGGA 3OXZA 3SX9A 2UZVA 4U43A 4GK2A 2XK4A 4C2WA 3U51A 3PIXA 4OBOA 4YBKA 5CASA 1W83A 2FUMA 2X8IA 4NCTA 5CU3A 3TNIA 4BB4A 5DH3A 3FI3A 4QMYA 3GFEA 3ALOA 4F7NA 4F9CA 3QRIA 1Y91A 4BDAA 4C4EA 3U6HA 3BYMA 3RHKA 5JK3A 1PYXA 3QLGA 4JG6A 3WOWA 4ITJA 4WOVA 3PWYA 4FTTA 3K54A 5DT3A 2XNBA 4U6RA 2CGUA 2KULA 3W1FA 3E88A 4WHZA 4RZVA 3MI9A 4XEYA 2EWAA 5IEVA 2IO6A 1MRVA 4DGNA 3QQJA 3TI1A 2YJRA 3GU7A 3V8TA 2BRMA 4X3JA 5KMLA 3EJ1A 3FLSA 3HVCA 3E63A 4TNDA 4XV3A 4USDA 2X2MA 5IKWA 3EHAA 5CSPA 3CPBA 3DV3A 3THBA 4WNKA 2YA9A 3EN7A 5DRDA 4ZTHA 3KXZA 5IA4A 1W98A 3AGLA 3BYOA 4IXPA 2B0QA 2G2HA 3TTJA 3P79A 3ZLYA 2PZPA 4I0TA 3MN3A 3L8VA 1YHSA 4O0WA 3RWQA 3AG9A 2OF2A 2HZ0A 4R1VA 4EZ7A 2BRHA 4QMMA 3UVPA 5GJFA 3GOKA 4WT6A 4PY1A 4MAOA 1XH8A 5CEQA 4RA4A 2OGVA 3O8TA 2XMYA 1EH4A 1H1RA 4HPUE 4N70A 4CTCA 1P4FA 4DEBA 5IA1A 2VTQA 5JFWA 5JGDA 3R1QA 4QYYA 3Q4CA 4EZ5A 5LOHA 2RIOA 3IS5A 5F94A 4V0GB 1H1SA 5CSVA 3ERKA 2G01A 3PXFA 4FT7A 4BDJA 1APME 4ZSEA 2UUEA 1PXNA 3QKLA 1TQPA 5EM6A 1GZOA 1YWNA 4FNYA 3NW6A 3BCEA 4YJVA 4BTJA 4D4YA 2WMSA 2B52A 2GNIA 4ACHA 5TR6A 3CKWA 2IZRA 4G34A 2I0YA 4X2KA 2PL0A 4RX8A 4F9YA 3PZHA 4I4EA 1YI3A 4UMTA 4A4OA 4FL2A 2CSNA 3HUBA 5CI7A 3RPSA 4JRNA 3FY0A 3M11A 4QQTA 3GQIA 1RQQA 4M3QA 4P5ZA 3FLQA 3VWAA 4UN0C 3U8WA 2XNOA 2IZSA 2XNNA 4YJOA 1L3RE 4TWCA 4CVAA 3W2SA 3BHHA 4YLKA 3QBNA 4ZZNA 2QKRA 5TOZA 4GVAA 5JQ5A 5EQYA 4H39A 4BKYA 1JVPP 4QMTA 5HE1A 1CKPA 4IZAA 5JEBA 2UVZA 5DRBA 3EQRA 1WBTA 3NUNA 3DJ6A 3UZPA 2PMIA 4O7NA 4HVHA 3FBVA 5HOAA 3HV5A 4FIEA 2HAKA 4ASDA 4KWPA 3SW4A 4O86A 4IEBA 2BDWA 4IHPA 1I09A 2Z2WA 3E92A 2WTWA 3NNUA 5HO6A 3W8QA 3ZSGA 4JVGA 4EQUA 4QMVA 4GKIA 3VVHA 2JDRA 3KGAA 3UOJA 2ZOQA 5HBHA 4MWIA 4DAWA 3R7VA 4ZP5A 3RAWA 2VUWA 2C30A 3TG1A 2AC3A 4OAVB 3BZ3A 2WB8A 3FPQA 4RJ6A 3HKOA 2ZVAA 1WBNA 3PJ1A 1A48A 4E20A 3D9VA 5GJGA 4D5HA 3SOCA 5TE0A 5D12A 3QTSA 4ACDA 3IW6A 5CF4A 1CM8A 2X6DA 4Y5QA 4EI4A 4ZMEA 3H30A 5ANEA 1XBAA 2V55A 2Y9QA 5AX3A 4AN9A 5ANOA 4ACMA 5BMSA 4NZWB 4XG3A 3DKOA 1OPKA 2YM5A 2XJ1A 4LGHA 5AP6A 1UA2A 3KULB 4CFNA 3ZDIA 3BYSA 4BIDA 3DK3A 3UPXA 4D0WA 2PVNA 1IA9A 3RNYA 3AT2A 3DLSA 4NIFB 3DGKA 5E8TA 3OROA 2OJFE 3FMHA 4FTCA 5AM7A 2OKRA 3LXLA 1YKRA 5KBQA 3C5UA 5IQBA 4H05A 4W8EA 3QL8A 4MBJA 4FTJA 3NWWA 5FGKA 3R8MA 4HW7A 5C03A 4HJOA 1LP4A 4K0YA 3PIYA 4XHKB 3IW7A 2JIVA 1S9IA 3DFCB 2HWOA 4Y72A 5CU4A 1MRYA 4FIFA 4OBQA 2YAAA 4Q9SA 5C9CA 3E7VA 3TM0A 3FSKA 3PVWA 4IAKA 4BI1A 1YHWA 3HDNA 3HMIA 3FDNA 3GU8A 1YDRE 3QC9A 4FG9A 3VRZA 3KULA 2JKQA 1OKYA 2XEYA 3R2YA 4IB0A 4NEUA 5L2IA 4QMLA 4O0RA 5HZNA 3K2LA 1G8SA 5JH6A 4EUTA 2IZTA 3ZO1A 3UG2A 2GU8A 5A6OA 1PXKA 2RFNA 1MQBA 3EN6A 4KRDA 5EOLA 5A4EA 3KXXA 4UBAA 3ORTA 4WRGA 4NWMA 3LXPA 2VWZA 4B8MA 4GG7A 4XG4A 1V1KA 3AC5A 5CEOA 5KZ0A 3O71A 3BKBA 3VBXA 4UMUA 1XO2B 4DGOA 4QOXA 3RZFA 3LAUA 1XH4A 1W84A 3ZUUA 1U5QA 5J7BA 2JKOA 5IEXA 2CNVA 3W2OA 1UV5A 3UC4A 4YJTA 4CMOA 4DHFA 2IPXA 1HCLA 4A9TA 4YZMA 4EOMA 4J96A 3W2PA 4E7WA 2XIYA 5IDPA 4IAYA 4BGQA 2IVVA 1LEZA 5DWRA 3UE4A 5FQDC 4BKJA 5DE2A 3QTWA 4A9RA 2YFXA 4D1ZA 4UWBA 4BCNA 3VO3A 2G2FA 5FDPA 3BEAA 3ZSHA 2YM4A 3K5VA 2BR1A 4I0SA 4WO5A 3V6RA 1HCKA 3A60A 2GS2A 3GU4A 3P78A 3P7BA 4MD7E 4RC4A 2C5NA 5K4IA 1P4OA 1YI4A 2IW8A 3DY7A 4EK8A 4RJ8A 2HZNA 2R3GA 4RLLA 2XIXA 5FBNC 4ACCA 3EN4A 3F3ZA 5ANIA 3VN9A 3COMA 4Q5EA 4MKCA 4FKQA 3JPVA 4JS8A 4IDVA 2CPKE 5ANDA 3MY5A 2IVSA 2JLDA 4RIYA 5T68A 2F2CB 3C0IA 1Q3WA 3CGFA 5AUZA 3LKMA 3GT8A 4FKTA 5EKNA 3LQ5A 5EYCA 4PL3A 3UOKA 3W55A 3CQWA 3TZMA 3QXPA 3CTHA 4FK6A 4F08A 2WU7A 4YZ9A 4C4JA 1REJA 4G3GA 4GSBA 5KMNA 5I3OA 4CMTA 3PLSA 4AACA 4HYIA 3NVMB 1R39A 2C6MA 2QOIA 4J99A 4I5PA 3Q3BA 3AC4A 5M06A 3MFRA 4BVUA 1XWSA 4EOPA 2ONLA 3PY3A 5CNOA 4XH6A 4ZS0A 4BGGA 4F6SA 2WQEA 4TXCA 2RFEA 4Z7GA 4BFMA 2UW6A 3BBWA 5J9YA 2VTSA 4NKSA 1G8AA 1MRUA 2V7OA 5JSMA 4KIQA 4NH1A 3C13A 4BZDA 5EYKA 4RWJA 3T9TA 2CLXA 4I23A 4E4XA 3QTUA 3MPAA 4CV8A 4AT5A 4H1JA 2X81A 2VTJA 4PL5A 4HCVA 4B7TA 3ATSA 4UB7A 5EI6A 2XKDA 4UMPA 4UEUA 4UWYA 4RZWA 4W9XA 3FLWA 4Y46A 4FV2A 4U45A 4DEAA 5IF1A 2EXCX 2JGZA 1ATPE 1Q8TA 2UV2A 3CTQA 1GZKA 2O8YA 2QQ7A 4X2JA 3S3IA 3UTOA 3UNKA 3L8PA 3HP5A 1GIHA 1ZAOA 4FV6A 2AC5A 2PZIA 4M67A 4G3FA 4U80A 4C58A 4C61A 3O8UA 3PG3A 2QO2A 4DFYA 4E4MA 4JDJA 4ZJJA 1PXJA 4FUXA 2C4GA 3I4BA 1AQ1A 4FG8A 3FQSA 5DFPA 1IAJA 3Q6UA 2BRBA 4BY9E 2QODA 3CCNA 4KD1A 4OAUC 2Y4IB 3PVUA 4FZAB 5AP4A 2Y6MA 4TYGA 1H0WA 4LUDA 4WSYA 3OT8A 3T3VA 4ALUA 4EK5A 4IW0A 3PY1A 4F1OA 2NNWB 2C47A 3T8OA 3V5LA 2ITUA 4D2WA 3D7ZA 4L44A 3TWJA 1B39A 3OXTA 3VJNA 3F7WA 5DVRA 3VUGA 3FXXA 4E5BA 5KMMA 4O7YA 2BZJA 4TWPA 2WMVA 3ITZA 5HESA 5D41A 3ULZA 3ZHPC 4D2VA 3SD0A 3V3VA 5KX8A 3FHRA 4RT7A 3JUHA 4IC8A 2A19B 3ENHA 4EC9A 5B7VA 4JLCA 3KMMA 3GENA 4BI0A 2VWYA 2UZBA 3PXYA 3HMOA 2WMUA 4YBJA 3PA4A 4WNOA 2OZOA 3UIXA 3MTLA 2W1EA 5B2KA 3HECA 1PXPA 3VS5A 4J95A 1OL6A 3EYHA 4O0YA 5CU0A 4MEDA 4NIFA 3HZTA 4AZTA 3ZM9A 3IQ7A 3MIYA 3D7TB 5CYIA 1YI6A 3G15A 2JDOA 3EQFA 1GOLA 4MK0A 4BZOA 2I1MA 2RKUA 1YXSA 2XK6A 4IAAA 5HCXA 3EWHA 2FVDA 3NCZA 3QUDA 5CWZA 4AN2A 1PKDA 4H3PA 4A4XA 1YXTA 1WBSA 2GFSA 1PHKA 4QP8A 2OFVA 4UV0A 1OITA 4V01A 4UZDA 2EB2A 3GNIB 2G2IA 2PUUA 1SNUA 3DKCA 4RIXB 4XBUA 5M44A 5C8KA 3G0FA 2HZ4A 2ZJWA 2OH4A 5IG1A 3LJ1A 2VRXA 3H9OA 5E8XA 1V0PA 2C6LA 4N6ZA 3DAJA 4DH5A 4IADA 1QCFA 4IVCA 1GIIA 3PXQA 4J8NA 2CKQA 1YHVA 4K8AA 2A1AB 3GVUA 4C4FA 3BWJA 3MVHA 2PVMA 1H1PA 4CD0A 4Z3VA 3ROCA 4E5AX 2PTKA 5IQIA 3VW6A 5EKOA 4YJNA 4RFYA 4XG7A 3ORKA 3CY3A 3ZONA 3LJ2A 3Q52A 4JG8A 5IQHA 4LOOA 5CANA 5AV3A 5B0XA 1OI9A 4AG8A 4YSJA 5DG5A 3RJCA 5BYYA 2XNMA 3BGPA 1IA8A 2W99B 4GCJA 2WIHA 4O21A 3HGKA 3I0QA 3CQUA 3U4WA 2G9XA 4GFMA 1GAGA 4J97A 3UGCA 3FEGA 2RFDA 3TV4A 4FEUA 2YIQA 3ZLXA 3IONA 2J5FA 3BHYA 3HMPA 1A06A 1URWA 3PJCA 1IEPA 2XP2A 5GIOE 4GT5A 3LM5A 4U42A 3DU8A 2WEIA 4ID7A 4NTSA 1R0PA 2FB8A 1KV1A 3VBYA 1NT2A 3C4FA 3DFAA 3TXOA 5BVWA 4EK3A 3UG1A 4ZSLA 5HLPA 3PTGA 4AGUA 1BX6A 3IPHA 4RPVA 4FKVA 3AC1A 3KN6A 4X0MA 4XNEA 4BDBA 3V5JA 3Q4UA 5DGZA 3Q32A 2AUHA 3PJ3A 2VO7A 3FKLA 4S31A 3AD5A 2GTNA 4LMUA 2YM7A 3DS6A 2XBAA 3IKAA 1PMUA 3MB6A 3TNPC 2XNPA 4U79A 3FAAA 2OXYA 2HXQA 4L53A 3QCSA 2I6LA 5HE3A 4XUFA 4BCKA 2QD9A 2J0JA 5IH4A 4NU1A 2CGVA 3I6WA 3MW1A 3NS9A 2UZNA 4ZLZA 1OL2A 4FZ6A 3GFWA 4KNBA 2XNGA 4PMSA 2X8EA 2AYPA 4GIHA 3CQEA 4M0ZA 2DQ7X 5DHJA 5CEKA 3UYTA 4Y85A 2C5XA 4RC3A 3V6SA 3NUUA 2WIPA 5HTIA 5E8WA 5FLFA 3TZ7A 4JL9A 3GU6A 3WZKA 5IISA 3U54A 1E1XA 3RBWA 4PF4A 2VWWA 2WMRA 4U41A 3NIEA 3R83A 3QU0A 2H8HA 2Z7SA 1UWHA 5JZJA 4F9WA 5TT7A 3QTIA 1R3CA 2F7XE 3E7OA 4RC2A 3PLAE 4DFBA 2YERA 5GHVA 3ATTA 2GNFA 2GNLA 3C0GA 5AV2A 3R8PA 3R8ZA 1UU7A 5EYMA 3L9LA 4PP7A 5L6OA 2G15A 4YZCA 5DEWA 2P3GX 5ETFA 1XBCA 2JDSA 5H8BA 1XH7A 4P90A 4PTGA 4RVKA 3PDTA 4FYNA 5EI8A 3Q9YA 1OB3A 1O6YA 4JQ8A 4JT3A 2YABA 1GZNA 4CYIA 1NW1A 3LVPA 3CIKA 4X21A 2GHLA 2PVFA 4ARKA 1CKJA 3I1AA 2GQRA 3SKCA 4QP4A 5IMEA 4HCUA 5AAFA 4RRVA 4TTHB 3U4UA 1IAHA 3F7ZA 4GKHA 3GP0A 2X6EA 4MF1A 5CEIA 3S2PA 5ETAA 1H26A 4CGAA 3DXQA 4TYHB 3R1SA 1FQ1B 4RFMA 3UIBA 5I5ZA 1OUKA 4CZYB 3F2NA 3VUIA 3LCKA 1OL1A 3TUBA 1KOBA 3N9XA 4RLKA 1XH6A 4BCQA 3FZSA 2C6DA 3PY0A 3LJ0A 2JITA 3G6GA 5AEPA 5C1QB 2CKOA 3A61A 5JFVA 4U0IA 3O17A 3QFVA 2GPHA 2OXDA 4DEDA 3CR0A 3QZHA 1JPAA 4HGSA 4K18A 2X0GA 5EFQA 4R78A 5DBXA 3D2IA 3REPA 1NA7A 2B4SB 2JIIA 2A27A 3E5AA 4EWQA 5H3QA 1GY3A 5DT0A 4GG5A 4IB5A 4CEGA 4BF2A 4DT9A 5ETIA 5HO8A 4F64A 1WVWA 2JAMA 2BTSA 3A7FA 4F70A 4TKSA 4O22A 3KVXA 4KS8A 3FMEA 4TN6A 3R8VA 2VWIA 4WIHA 4C37A 5HG5A 3QD3A 4NL0A 3DK7A 2J5EA 4XV9A 1E9HA 4NFNA 4AW1A 2ZMCA 1FMOE 3F5UA 2RG6A 3FWQA 3KU2A 4E6DA 4DC2A 3Q5ZA 4EHEA 4IWQA 5DMZA 3BX5A 5HEZA 4AXAA 4C4GA 5L6PA 2QOQA 4R5YA 2C6TA 4RVTA 3VQUA 2WZJA 3SQQA 2GDOA 3LFAA 5CLPA 4A7CA 4NK9A 4PDSA 4FV0A 5M4FA 1M17A 4S34A 5HG7A 1OUYA 4C7TA 4BDIA 2OSCA 4CXAA 4EH7A 2V0DA 3EQCA 4D2RA 4YO4A 2W7XA 3FMJA 4F6WA 5K3YA 5CQUA 3QQFA 2ERKA 4JOAA 3VUDA 4LG4A 4Y8DA 3WZJA 3NNWA 4AW5A 3OCGA 4I1ZA 2R3PA 4QPMA 4PDPA 2VO0A 2PZ5A 2FSMX 2YIWA 5E90A 5LMAA 3OMVA 3WYXA 1H4LA 5J5TA 1PMNA 5CSWA 3KFAA 4IB1A 2XIRA 2BPMA 2HY0A 1KSWA 2OZAB 3OEZA 4QP2A 5FTQA 2VTOA 3RAIA 5EDPA 4E8AA 1J7LA 2PHKA 4C0TA 4I22A 4G9RA 1JNKA 3ET7A 2IVUA 2YLEA 3I6UA 1ZMVA 4MXYA 3PJ2A 2SRCA 5J1WA 1QMZA 3DDQA 4C38A 3MH2A 4W4YA 3FMMA 4PDOA 1OIRA 5L8LA 3BWFA 4QTBA 2GSFA 1YW2A 2WMBA 3AQVA 4HNIA 4U7ZA 2E2BA 3D5UA 3R7OA 2PUNA 4WG4A 3PPZA 4CLJA 5IZFA 5CXHA 1J1BA 3AMAA 3ANQA 4ZLOA 4DH3A 3GBZA 4NW5A 5AAEA 2V22A 4EK6A 4J71A 3UIMA 4X2GA 2WMTA 4UXLA 3R6XA 2Z02A 2OZAA 3H3CA 3NW5A 3RINA 3S00A 4DEHA 3LHJA 3A8WA 4CG8A 5I9WA 2UVYA 2ZMDA 4IM0A 3SG9A 5KO1A 4JQ7A 3ZTXA 4AN3A 1SNXA 3U6JA 5E4HA 3UQFA 3U87A 4E73A 4ZZOA 2O3PA 3CD3A 4IJ9A 3TJDA 2ZV2A 3GUBA 2VTNA 4W8DA 4E1ZA 5IMXA 3HRCA 3TZ9A 4FTMA 5E92A 3Q9ZA 3QX4A 4X3FC 5J87A 1P5EA 4ZOGA 1IG1A 3ZUTA 2R3IA 2VGOA 5E1SA 3BIZA 3GCSA 4FIIA 4RWKA 5HCZA 3GC0A 3NYVA 3OFMA 4I93A 1ZZ2A 3C4WA 4MXCA 3QQKA 4CFWA 4Z7HA 2QOBA 1PW2A 1Q5KA 4L00A 2YWPA 4IM2A 3SXFA 3PE1A 3HEGA 4BKZA 4FTUA 1R0EA 5HNIX 3UOLA 1IASA 3ORMA 3QCQA 5F4NA 4L68A 3FC2A 3IW5A 4MBLA 2C6OA 4D2PA 4XX9A 5GNKA 3I79A 1PJKA 3BGZA 4PWNA 1M14A 3OVVA 4Z9LA 3R0TA 5EI2A 3TACA 3FPMA 4CMUA 2C5VA 4DFUA 4DT8A 5IQDA 3EOCA 3Q04A 4CZTA 2NRUA 5EYDA 2JAVA 4TYIA 4ACGA 5CF6A 2BHHA 3MY0A 3C5IA 1B38A 4ZSJA 1K3AA 3FQEA 4ZLYA 4QQCA 3KRRA 2IG7A 4U44A 2JC6A 4G6OA 4Y95A 1NY3A 3PWDA 1M2PA 5L2QA 2OLCA 2RG5A 4NM5A 2IVTA 4DA5A 2JFLA 3MFSA 3OTUA 4YUQA 1M2RA 3E8CA 1O9UA 2I0EA 2PVLA 3BPRA 5AFVA 4DBNA 3EQDA 1YRPA 4ENXA 4RSSA 1DS5A 4WBOA 4JBVA 4FTIA 4O91A 4DG2E 1YOJA 5TKDA 4OTIA 4H3QA 2ETKA 3QC4A 1RW8A 4YTHA 5EM8A 3MH3A 5FBOA 4P5QA 4MTAA 4U3YA 5AMNA 5H8GA 3VBTA 3RNIA 3WARA 3NX8A 1ZMWA 5GINE 4WNPA 4AS0A 1XKKA 4A4LA 4R1YA 5DOSA 4RQKA 3R8LA 1LUFA 4NTTA 4XRLA 1R1WA 4F65A 3OCBA 4PTEA 5LJJA 4UYAA 4O6EA 2ITTA 4O2PA 2WMWA 4M69B 2BIYA 3W33A 4DTBA 4FOCA 3ZSIA 1PMEA 4I41A 3G33A 4FKSA 5B2MA 3S0OA 2W05A 3BU5A 4XLVA 3KC3A 3OT3A 4JIAA 4A9SA 3HX4A 4TZRA 5FM2A 4GT3A 3FKOA 2C3KA 5AJQA 2QU5A 5AUXA 3R7YA 4D28A 4YMJA 4DGGA 2YDKA 2YZAA 4BHNA 2JKMA 2XRWA 2ZV7A 2OICA 4GJ2A 4XOZA 5EW8A 3I7BA 2Q83A 3Q5IA 5L2WA 3QKKA 4AW0A 5IH6A 4YTFA 4ANBA 4I6QA 3M2WA 3SGCA 2GNJA 4GVJA 4PPCA 2VTRA 5H2UA 4KB8A 4QQ5A 3EFLA 2GNGA 3FLNC 3ZO4A 1U59A 3SOAA 3DDPA 4XV1A 4BDGA 5BYLA 4O96A 3UMWA 4ZS4A 1YVJA 3VHEA 5LVLA 3SRVA 2VN9A 4LV8A 5AM6A 3QF9A 4C2VA 3F3TA 3IGGA 4DEGA 1Q61A 4DG0E 1H01A 5JGAA 2XK7A 3GEQA 3NAYA 4APCA 2O63A 4I20A 1PKGA 1XR1A 3KMWA 2UZEA 2ITYA 2LGCA 5A14A 4R8QA 1R78A 4OBPA 3TL8A 2XF0A 3MVLA 4LL5A 5AIRA 4NFMA 1OPLA 5GJDA 4BTKA 3R1NA 3O51A 5BVNA 2HOGA 1NVSA 2IWIA 3VUTA 3FYJX 1CSNA 3PRIA 4J98A 3IO7A 5L8JA 3UBDA 3UMXA 3D5XA 3KRLA 4EL9A 4M12A 2NO3A 5A46A 4N6YA 2J90A 2C0TA 3QTRA 3O8PA 3VUMA 5CSXA 4EYJA 1FGKA 4IX5A 3GB2A 5M4CA 5AP7A 3ZH8A 4F6UA 4H58A 4N0SA 2UW3A 5JRSA 3V8WA 2UW8A 1FVRA 5FXQA 3LFDA 4HGEA 5EOBA 5EM5A 3K3JA 4OGRA 4OR5A 1ZOHA 3AGMA 5CI6A 2C0OA 5LVPA 1IRKA 3BQRA 4DFNA 1FMKA 2VWBA 3SG8A 2PE2A 2UZLA 4BTMA 2IZUA 4OTDA 5FRIA 5LMBA 2QR7A 2UVXA 2YM3A 2OU7A 4G3DA 2F49A 3F88A 4DCAA 2XM8A 3QD2B 3QCYA 3F61A 4HZRA 5T3QA 4WUNA 3ULIA 4BDKA 2ITWA 4PNIA 3GCVA 4OTGA 2B9FA 4YHJA 2XB7A 1O6LA 3OXIA 3QRKA 4YZBA 4TL0A 2PE1A 2X4ZA 3EL7A 2YIRA 4IC7A 3ZZEA 2XIKA 2QLQA 3JVSA 5LQFA 4IANA 3MVJA 1B6CB 3FUPA 3EQPA 3B2WA 3BLHA 3D5WA 2XK9A 2QKWB 3FI2A 5DI1A 2W1FA 3DQWA 4MHAA 3FL4A 4ZK5A 4QT1A 2X2LA 2UZOA 2VX1A 4IWPA 3COKA 3ZFXA 4QP6A 3A62A 3DTWA 4JIKA 4C4IA 5IQCA 4YSMA 1Z5MA 2HIWA 4P2KA 2GS7A 4M66A 4O0XA 2Y8OA 4K33A 3AC2A 3KRJA 1SVEA 2HW7A 4M8TA 3TT0A 4V04A 2OF4A 4RX5A 3Q6WA 4YP8A 3QGYA 1VYZA 5KKRB 3MV5A 4OT6A 3TKIA 2QOKA 4JXFA 4BCMA 4IIRA 3WILA 4ZSAA 4Z16A 3QD0A 5HBJA 3OWJA 1A9UA 1OM1A 2VX0A 5BVKA 2J51A 4USFA 3HAVA 4O84A 4D4VA 2V5QA 4RX7A 4F0FA 4B8LA 5BUEA 2PUIA 4HYHA 4IDTA 4CZUA 5HVKA 3PSDA 2ETRA 3LOKA 4N4SA 1Q8ZA 2BVAA 3ZCLA 2X8DA 2R3RA 4G1WA 4FKIA 3JY9A 5C27A 2YJSA 3UO6A 1Q3DA 4FSZA 3F82A 4DG3E 5JZNA 2I0VA 3CKXA 1BMKA 4I0RA 4FT0A 3DCVA 4G9CA 2R3QA 1LPUA 2IJMA 4ZXTA 4EHZA 5FXRA 1I44A 2X7OA 4FKGA 1WAKA 4JDHA 4GMYA 4ONAA 3DB6A 1WFCA 1Y8GA 5BQ0A 3NLBA 5KMOA 3LXNA 4E6AA 1VR2A 3PRFA 2DUVA 2W5HA 4O0TA 4R7HA 2ITQA 2HXLA 4CSVA 1GNGA 2B9IA 2X9FA 3R7GA 4PMMA 5HVYA 4GRBA 1PXOA 3NPCA 3DXNA 5J1VA 3MSSA 4FC0A 4FEQA 4QYFA 3GQLA 1MP8A 2VWXA 4PV0A 5JGBA 2GMXA 2IW9A 1QPCA 5GZ9A 3CS9A 2BHEA 2C1BA 3D83A 3N4VA 3A7IA 5DA3A 2QURA 3R7IA 5AAGA 5M09A 2WTJA 5E8ZA 1Q8YA 1QPEA 3CEKA 2F7ZE 3BQCA 4NKAA 2V62A 5AR7A 5JN2A 4XP0A 2BMCA 4DYMA 2YDJA 3FC1X 4KIPA 1TKIA 3P08A 5LMKA 4U9AA 2BTRA 4H1MA 3P9JA 4FV7A 1XJDA 4ZTRA 4IZ5A 1ZRZA 5HQ0A 2JFMA 5TO8A 3PA5A 1OL5A 3GC8A 3D94A 3DJ5A 3ZXTA 2E9PA 5J9LA 1Z9XA 3VQHA 5CAPA 2YM6A 3KK9A 2R3LA 3DKGA 3ORZA 4MXZA 3Q96A 1ZLTA 3RM7A 2B9JA 2E9VA 2YM8A 2PE0A 4JG7A 1UNHA 2PMNX 3V5WA 3TDVA 2JDTA 4BHZA 1UU3A 2UW5A 4G6LA 1F0QA 4EJ7A 3V5TA 4AF3A 4GUEA 1YQJA 3O96A 5BYZA 2OJ9A 3QUPA 4G3EA 1JSUA 3FI4A 3LPBA 4QYGA 4USEA 2PYWA 4BDFA 4KSPA 2QG5A 3PPKA 4QP3A 4RIWB 1KUTA 5D9HA 1YDSE 2CHLA 2R0IA 2WQNA 3QZGA 4KRCA 5CENA 4AUAA 5JMSA 4CRSA 3N4TA 3OCSA 4PX6A 4AQCA 4R7BA 4HVSA 4ITIA 2X4FA 4MD9E 3RMFA 3L8XA 4GH2A 4WG5A 3W10A 5JQ8A 1KE5A 2OFUA 3HV7A 5ANJA 3F6XA 1J7UA 4ANNA 4XYFA 3H4JA 3ZU7A 1JAMA 4GK3A 4AFEA 4F9AA 3DT1A 2BKZA 3R21A 1G5SA 3UQGA 5A3XA 4ANOA 2BDFA 4B0GA 1W82A 4EC8A 3QCXA 3A7JA 4QPAA 2QOOA 2WAJA 4BIBA 5IH5A 3HDMA 1J3HA 3LLTA 5I9UA 3UDBA 2HW6A 3U9CA 1UWJA 4RJ4A 2P4IA 5EW9A 3LMHA 2WELA 4M14A 2E9NA 4M84A 3PJ8A 1ZZLA 2J6MA 4O7ZA 5CSHA 5DN3A 1DM2A 5I9ZA 4EKKA 4FUYA 5E7RA 3QX2A 3HP2A 3TNHA 4S33A 4HYUA 3MH1A 4RQVA 4Y5HA 5BUJA 5I3RA 4C8BA 3SVVA 3OCTA 3MFUA 2YISA 3ACKA 3F66A 1JKKA 1W8CA 4U5JA 5A6NA 3EN5A 4KUJA 3LFCA 2R2PA 4BWPA 2PPQA 2C1AA 1OL7A 4MF0A 4KKGA 4BWKA 4CT1A 1HOWA 3UPZA 4HPTE 3ZO2A 3MWUA 2ZYBA 2C68A 5I0BA 4TYEA 3C4EA 4HYSA 2WTVA 3R30A 2Z7LA 3NUYA 2XIZA 3ZLSA 5AA8A 4I5HA 3ZC6A 1SMHA 5L6WL 3M1SA 3PIZA 5CVGA 5D7VA 4E4LA 2VO3A 3ZBFA 4CKRA 3ZXZA 4AP7A 2VZ6A 5BUIA 5KMKA 5LXMA 2VTPA 5CAOA 1SM2A 2X2KA 3HL7A 3HV3A 4YLJA 3RK9A 4AE6A 1F5QA 5GZAA 5CU6A 2W9ZB 4ZTNA 4O6LA 3FJQE 4EH2A 1YXUA 3PYYA 1WBPA 3HMMA 3ODZX 4GW8A 5CVHA 3ROYA 5AV4A 4F7JA 4YNOA 4NUSA 2VTIA 3S95A 3LCOA 4FL1A 5DIAA 1W0XC 3BHTA 4UZHA 4I6FA 4HZSA 4TNBA 1BUHA 5AR8A 3FMDA 4WD5A 4QTAA 2VTTA 4XV2A 3ZEWA 4D2TA 4QP7A 2UZTA 1PRYA 2HELA 2C3LA 2PVRA 4H3BA 3P7CA 5F1ZA 4B9DA 4QMPA 4QQJA 2WQOA 2J0KA 3UP7A 4BCJA 3E3BX 5G1XA 4BBMA 4EOKA 4EOLA 4O83A 4U8ZA 5CTPA 3SLSA 4PUZA 3JR1A 2O65A 5HE0A 2XYUA 2RF9A 3FMNA 3PXZA 2VTAA 2XEZA 4O82A 4DF3A 4YJQA 4MQ1A 4MX9A 4L7FA 3CD8A 4WRSA 3QA0A 3Q9WA 4RVMA 4EOIA 3U6IA 3R71A 5DR6A 3NW7A 3VBQA 1V0BA 4L3PA 1Q97A 2PSQA 4J8MA 4OTHA 2ITPA 3MESA 1J91A 4MNEA 3D5VA 4C62A 4BN1A 3G51A 2BDJA 4D9TA 2W17A 4AWIA 4DEIA 4QTEA 1ERKA 3KKVA 4FZ7A 4RIYB 3E87A 4GU9A 3FYKX 3OG7A 1WVYA 4FTAA 4L42A 4ZSGA 3NYNA 2YHVA 2DYLA 4IWDA 4RG0A 5FP5A 3VRYA 1J1CA 3V5PA 2WKMA 4WUAA 3OW4A 2A2AA 5M07A 4O27B 5D1JA 2ZDUA 5CVFA 2GHMA 5FDXA 5IPJA 4DFZE 2W4JA 2FSOX 4KINA 2BAJA 5HICA 4FVRA 4TRLA 2FGIA 3E8DA 2F57A 3RAHA 4CYJA 2ITNA 4TYHA 3TUDA 5EM7A 3R9HA 4EHVA 4FT3A 2CJMA 5F20A 4O7TA 3LIJA 4FKRA 3WIKA 3BRBA 4YURA 3S1HA 1OMWA 4PNKA 1P2AA 1ZYDA 2VNYA 3PG1A 1E1VA 4D4SA 2EB3A 4DLIA 5GZ8A 3VF9A 1MQ4A 2C3JA 4ZY4A 3NEWA 2W1IA 1OBGA 4ERWA 2VV9A 5IA0A 1FGIA 4QMWA 4RX9A 5CZHA 3ZDUA 4NCTC 5BVEA 3VUHA 5C4KA 5JFSA 2CLQA 2YDIA 2VTMA 3OF0A 2WPAA 3MDYA 4NM0A 3H0ZA 4NM3A 4IFGA 5J7HA 4Y83A 3WZUA 3CLYA 1UNGA 2JDVA 3W32A 4M69A 3HA6A 5JKGA 4L67A 3E64A 4FNXA 1Q99A 3QA8A 3UIUA 3GC7A 3LCSA 3ZRLA 1O6KA 1S9JA 3DKFA 3R2BA 4BBEA 1LR4A 4RIWA 3AC8A 4ZAUA 3LW0A 3SXRA 1YDTE 1UVRA 3OUKA 2I40A 3R7UA 1VYWA 3UNZA 4JR3A 3V8SA 4A9YA 3MJ2A 5IUIA 5AUUA 2KTYA 5K9IA 3V51A 4XG9A 4XBRA 3I5ZA 5CEMA 4D58A 1OVEA 1JKSA 3PPJA 3GI3A 3TTIA 4L8MA 3PP1A 2VD5A 1RE8A 3WZEA 2ITZA 2WTKC 2QC6A 3Q9XA 3FSFA 4BL1A 3HA8A 1WBOA 3BLRA 4KIKB 1OKVA 4IQ6A 2OWBA 3B2TA 1TQIA 3AD4A 4EH8A 5KNJA 2QI8A 4X3FB 2WXVA 2CGXA 4LYNA 3L1SA 1GIJA 2PULA 4OW8A 3BI6A 1H08A 3OW3A 4V05A 3QQLA 4X2FA 4O81A 4LGDA 3JVRA 3EFJA 3RP9A 3VS0A 4G2FA 4EH4A 4DE4A 2JBOA 2BAQA 3HRFA 4I5CA 4QD6A 4KBCA 3VAPA 5K5XA 4MXXA 4P4CA 5D11A 2OBJA 3ZYAA 3ANRA 3BV2A 2CNUA 5KMJA 4FSNA 3HYHA 3P5KA 4C35A 5CF8A 5M57A 1FOTA 3IG7A 3RVGA 4M13A 2A0CX 3NIZA 1M7QA 5ANKA 5EQPA 4D9UA 1OPJA 3IGOA 2XK8A 3ORXA 3EFWA 3GOPA 4OT5A 2E9UA 1H0VA 3MH0A 1DAYA 4KBKA 2WTDA 4G6NA 3ZC5A 5IEYA 5LCJA 3R9RA 2GS6A 2RGPA 4XG6A 1DI9A 3KXGA 4C33A 5ITAA 2YN8A 5HVJA 5KHWA 4ZTSA 2C6IA 3FQHA 3NUPA 3PVGA 1U5RA 3A4PA 1OZ1A 3BELA 2WNTA 5BVDA 4C36A 4FIGA 2OG8A 3QXOA 4QYEA 4DH8A 3ENMA 3V5QA 4L9IA 3WF7A 5IA3A 3ELJA 3R00A 5CALA 1CMKE 4O38A 4R3CA 5AUTA 4LRJA 2FSLX 4A9UA 1BYGA 3OBGA 3LFSA 1YXXA 4R6VA 3BGQA 5HGIA 4YTCA 3TUCA 3H9FA 5K4JA 3RPOA 3U9NA 3HNGA 4ZMFA 3CE3A 3BV3A 3MFTA 4YJUA 4D2SA 5FD2A 4YJPA 2JD5A 4CNHA 2ETMA 3IOKA 3UO4A 2Y0AA 2ITXA 3F5GA 4RIXA 5AUYA 4IVAA 4CT2A 2C3IB 4V0GA 3FMLA 2BILB 4FV5A 4PPAA 3OY3A 4O7LA 3FZRA 3A99A 3HLLA 4O7WA 5FTGA 3DNEA 3C4CA 3L9MA 1XHAA 4ENYA 4FNWA 2W96B 2H34A 3VHKA 4FT5A 2RSVA 4FEVA 3RM6A 4CKJA 4AZWA 4MWHA 5L2SA 3CY2A 4QMUA 1H1QA 3I81A 4PTCA 4QTDA 3WZDA 3QYWA 4C02A 3CGOA 1VZOA 5CU2A 4ASZA 3OWKA 5BNJA 4L6QA 1ZYSA 5CAQA 5HD7A 4S30A 4EOSA 4FV3A 4HCTA 4UWCA 5AR5A 4DLJA 3GU5A 3RCDA 1Y57A 3QZFA 2FYSA 4G5JA 1JLUE 4QMSA 1CTPE 4TWOA 1Y8YA 1BL7A 4K11A 5CT0A 4L01A 4NM7A 3LMIA 4CKIA 4DCEA 3AC3A 3R73A 2BKKA 1PYEA 3PSCA 4QP9A 2ACXA 1Q41A 4O7SA 4GYIA 4B99A 2CCIA 3GCQA 4E6QA 4R7IA 2W1HA 2XYNA 5AX9A 3QTXA 1OIYA 5M4UA 4AGDA 2W1GA 3QZIA 5A9UA 5ACBC 1U54A 5IA5A 1XH9A 3R02A 4OTFA 3TCPA 4AA5A 5C26A 3FZ1A 2C5YA 4RGJA 3SV0A 3O0GA 4BDHA 5HU3A 3TN8A 4HVDA 4EH5A 3RGFA 4JJRA 4FSQA 3WI6A 2B7AA 3ZMMA 3H9RA 3WF8A 1QL6A 4QMOA 3VS6A 5G6VA 2J50A 4EH6A 4LQMA 4CFXA 4PMPA 3DBDA 3LM0A 3D0EA 3CPCA 3EMGA 5DR2A 2R9SA 3QKMA 2J2IB 4KKEA 4LM5A 4XCUA 5CQWA 5AV0A 4FEWA 2ONLC 3WE4A 4I6BA 2Y6OA 3QALE 3MVMA 2WTCA 5AP1A 3ODYX 3COHA 3VS1A 4ANSA 4GU6A 4D1SA 2B54A 2OIDA 5EG3A 4CQGA 4O7VA 3LE6A 5EQEA 5E8VA 1JKLA 2PVHA 5CX9A 4F9BA 4XP2A 5HLNA 2VX3A 3GCPA 1YWVA 3RHXA 1LEWA 3NR9A 4KIKA 4LOQA 2OJJA 4O2ZA 5DPVA 3SW7A 3GCUA 3F3UA 3VULA 1KE8A 2J0MB 2W1DA 4UY9A 4MH7A 3S4QA 4L46A 2WQMA 4RVLA 4AOTA 1YOMA 3BHUA 3OOGA 4K2RA 5A4LA 4HVGA 4FYOA 5C01A 3ZFMA 5EHOA 5E8SA 3VBWA 1OGUA 4L52A 3KXMA 5FTOA 5HIDA 3QLFA 5HX6A 1WCCA 3B8RA 3EZRA 1K2PA 4NJDA 5CT7A 2OO8X 4BYIA 3LFNA 2XJ2A 2QNJA 2YCSA 2WGJA 4FV4A 3KREA 3A8XA 3IDBA 2QG7A 3TDWA 1ZYJA 2HK5A 4CCUA 2O2UA 1WVXA 2W9FB 4S2ZA 4TPTA 3BU6A 5E8YA 4CG9A 2EUFB 5HO7A 2UZWE 3JY0A 3PUPA 2WU6A 4FMQA 4UXQA 3ZFYA 4YJRA 3PSBA 2XNEA 5AP2A 4TY1A 4MXOA 3CTJA 4QMXA 4AZSA 5E8UA 3MGYA 3NYXA 4FI1A 3D2KA 3O7LD 3W16A 1KE7A 4FZFB 4YC6A 2EXMA 4LFIA 5HNBA 2UW7A 4AU8A 4YC3A 2IN6A 3QRUA 3MS9A 3ALNA 4KIOA 1Y6BA 2GHGA 1T46A 3TV6A 4AOJA 3LQ8A 4BIEA 5KKRC 3O50A 5DR9A 2XKFA 3QTQA 4EBVA 3UZTA 5AIKA 3D14A 4FTKA 3NYOA 4YC8A 5F9EA 5I4NA 1JKTA 1KE9A 4BCPA 4AA0A 1Q8WA 3R9OA 4CQEA 4D1XA 1URCA 4GV1A 5AWMA 5HLWA 4O0SA 3DBCA 5HE2A 3I60A 2B55A 5HG8A 4AW2A 3KCKA 1STCE 3HAMA 1IR3A 1ZXEA 4AFJA 4EHGA 5J79A 4II5A 3EQGA 3KB7A 4AZFA 2ERZE 4D0XA 2YCFA 1F3MC 5K0KA 3D15A 3SAYA 4UMQA 2QU6A 2PZRA 2J9MA 1XQZA 4EH3A 4D55A 5IQGA 4RJ7A 3VBVA 2H9VA 3VUKA 3ZOSA 4BWXA 3LFFA 3BE9A 4ALVA 5KBRA 4HVIA 3DTCA 3R1YA 3PFQA 3FMKA 4QMQA 2GTMA 4YJSA 4Q9ZA 2B53A 4DITA 1Q24A 2GQSA 3KRXA 3WYYA 2OIQA 1ZYCA 4F7LA 4PL4A 3RK5A 2OW3A 4O7RA 4QNYA 3F5XA 3FLYA 5H9BA 2X7GA 4BGHA 1UU9A 4JRVA 1XH5A 2XA4A 3KXNA 4FG7A 2O0UA 4S32A 5LCKA 4UX9A 4DEEA 5LVMA 4EOJA 4I4FA 4KKHA 3N4UA 5GIPE 2CDZA 4KABA 3OP5A 1U54B 3KMUA 2PVKA 4FR4A 1U46A 4W9WA 4YPDA 3SXSA 4CTBA 2UW4A 5L3AA 5ACKA 5FEEA 4FSMA 5BMMA 3HUCA 3FI8A 4AZEA 3C51A 4PQNA 2F4JA 2Z7QA 5FEDA 5KMIA 3TJCA 2BZHB 4FX3A 4NJ3A 3UOHA 4E26A 2YLFA 5AP3A 3NZ0A 5AUWA 1Q62A 2ZAZA 4MQ2A 3NUXA 3PZEA 4FIJA 3HV4A 2Z8CA 4Q2AA 3UO5A 2NRYA 4CFVA 2Y4IC 5A54A 3RI1A 3EQIA 2PY3A 5BX0A 3G0EA 3FE3A 3P23A 5J9ZA 4XP3A 4NYEA 5IQAA 3MYGA 3ZZWA 2WFYA 2P55A 4U40A 3R9DA 3ORIA 3HV6A 2J0LA 4EZ3A 3LZBA 3NRMA 4IWOA 5DLSA 4PDYA 5HG9A 2W06A 3R7EA 3NAXA 2XJ0A 3GC9A 1L8TA 2R3NA 2PVJA 4YGAA 5L8KA 1OBDA 4O1PA 4FVQA 3HMNA 2WMQA 4APPA 4FL3A 3EZVA 1H27A 3VIDA 4KSQA 5HD4A 4ASEA 1KWPA 2HZIA 4HGLA 2QR8A 4X6QC 2ITOA 3BE2A 4FK3A 4FTQA 4ZJVA 2NP8A 4BBFA 1SZMA 2WEVA 4FKOA 4K1BA 3OD6X 1W7HA 4G16A 4LMNA 4A06A 4M0YA 1GZ8A 5AA9A 3L9NA 5HCYA 5A4QA 3OY1A 2WHBA 3QTZA 3WIGA 2J7TA 4DTKA 3KVWA 4RJ5A 2W1ZA 3U55A 4BDEA 4FV1A 4ZEGA 3ZRMA 3B8QA 3G5DA 1ZMUA 4FOBA 4R3PA 4ZTQA 4ZIMA 5KUPA 1VEBA 3LCTA 3KF4A 4JAIA 2XS0A 3JS2A 3W2RA 2V7AA 3WF9A 4EH9A 3O2MA 4U97A 4JBPA 4BCIA 4M7IA 3WBLA 1UNLA 4L43A 3V04A 4F99A 4NSTA 4E4NA 4F09A 5FWKK 2PK9A 3CBLA 3WE8A 3RPVA 3ZM4A 4ZY5A 2OJGA 3QYZA 1DAWA 3LMGA 5HIEA 5BVOA 2QOLA 1AGWA 2BROA 5HTBA 3LFBA 4IX4A 3QUEA 1WBWA 4RWLA 4EOQA 4FKUA 4NW6A 5JFXA 5LMKC 3DNDA 4E5WA 4EKLA 3R28A 2WOUA 2WQBA 2HWPA 3FHIA 3HRBA 2BRGA 4W4VA 3TZ8A 1RDQE 1H1WA 3D4QA 4RMZA 3R9NA 2VWVA 2W5AA 4BDDA 4G3CA 4GJ3A 4E3CA 5CF5A 3SRVB 4AA4A 3VNTA 4GL9A 4LI5A 5HI2A 3UNJA 4EK4A 4LUEA 4KA3A 5CAUA 2XM9A 4I6HA 1P14A 4RA5A 5C8NA 3RAKA 1H24A 2JBPA 4XG8A 3FKNA 4D5KA 4GYGA 3CSVA 2Q0NA 4Q5HA 4YR8A 5JRQA 5AR3A 4C59A 5LWNA 3FY2A 2R4BA 2R7BA 3ZEPA 4CFUA 4JAJA 2ZB0A 3P86A 4FV9A 4KAOA 4QMNA 2CNQA 4IX6A 3Q2MA 4JQEA 1BKXA 3P1AA 3EIDA 2GQGA 2FSTX 2YEXA 2HY81 5AP5A 4YHTA 4ZZMA 2R0UA 4MD8E 3ORNA 4BTFA 1OECA 4RBLA 4PRJA 3AXWA 4WA9A 3TKUA 4ALWA 2UZUE 3UYSA 4FZDB 4MYGA 2Y7JA 3SA0A 4P7EA 3KCFA 1BI8A 5HTCA 2ZM1A 3P4KA 2C69A 4O0UA 3TIYA 4FODA 4UALA 4I92A 4IZ7A 4CV9A 2XH5A 3C9WA 3DQXA 4H36A 5EH0A 2NPQA 2C6KA 3RPYA 3RK7A 2QO7A 4IBMA 3BLQA 2Z60A 3TV7A 2PWLA 4ERKA 4FTNA 4XS2A 4MNEB 4YO6A 3E93A 3QQHA 1U4DA 2OI4X 3NVKI 2JEDA 1QPDA 4FKJA 4LRMA 4EONA 3ACJA 2XZSA 2LAVA 2XKCA 4X7QA 4JBQA 4MNFA 5EK7A 5M51A 3EQBA 4C3RA 1YXVA 3I0OA 2REIA 4YHFA 4U3ZA 4TW9A 4DINA 1BLXA 2QOHA 3EN9A 3OBJA 3R63A 2ZV9A 3EKKA 3RKBA 3UZRA 4OTWA 2YCRA 1PF8A 2Y4PA 4F7SA 3BU3A 5EDRA 5HIBA 3BYUA 3UODA 4AAAA 3PVBA 2X7FA 2VO6A 5AR4A 2UW9A 5D10A 2R3KA 4EUUA 3RTPA 1WBVA 4YU2A 4LRKA 4E6CA 2YZLA 4OTQA 3NDMA 4I24A 5CAVA 3KQ7A 4FGRA 2GNHA 3KXHA 5CZIA 4HOKA 4O1OA 2YAKA 3ORPA 3QAME 1JBPE 3TIZA 3DJ7A 1K9AA 3UQCA 3F2RA 3VS7A 3FL5A 1JWHA 2CKEA 2HYYA 2XCKA 4E93A 4C3FA 3RWPA 1ZOGA 5LWMA 3AMYA 2R3FA 3V01A 1BL6A 3W8LA 2YWVA 4QNAA 3LFEA 2F9GA 4FNZA 1WZYA 1BI7A 2UZDA 5LARA 4ZTMA 3OTVA 5DYJA 3I5NA 3WF5A 4AZVA 4BCHA 3QQUA 5I9YA 1JOWB 5FXSA 3A4OX 3FV8A 2P2IA 3NNXA 4J53A 3OUNB 4RJ3A 2VTHA 3SHEA 3MBLA 3E62A 4FKWA 4F4PA 2XBJA 3FZPA 4I94A 4WNMA 2QCSA 3IOPA 3W2CA 4FICA 2R3MA 4BRXA 4FBXA 2FO0A 3MTFA 1Z57A 4MBIA 2J0IA 4TYJA 4RWIA 3NSZA 5D7AA 4IVBA 2BUJA 3FLZA 2X39A 4NT4A 4QP1A 3PA3A 4EEVA 2VGPA 4FKLA 4DFXE 3ZUVA 4PPBA 3UVRA 4GK4A 2PMOX 4F63A 4ORKA 4EWHA 2B9HA 3IW4A 3MPMA 3H0YA 4F1MA 4FF8A 4AE9A 1WMKA 4DH7A 5BPYA 4U81A 1TQMA 3QWJA 3DB8A 2A4LA 4D4RA 3T3UA 1FBNA 2OIBA 2W4OA 4YLLA 1MUOA 1NVRA 4DH1A 4W4WA 3G2FA 5F95A 4DN5A 5E9EA 4HNFA 2EXEA 4ANQA 3VF8A 3DBEA 3DZOA 1OKZA 3JXWA 1ZOEA 4FKPA 4X3FA 5KHXA 5M4IA 2CN8A 4BZNA 1PXIA 4GUBA 4OUCA 1M2QA 3EKNA 4XRJA 3QRTA 2QVSE 2WMAA 1PMVA 4QYHA 5CS6A 1YWRA 2BCJA 2FA2A 3LQ3A 1AD5A 4WSQA 4IX3A 2QOFA 3RALA 4EQCA 4CRLA 4EJNA 4QTCA 4R3RA 4G17A 3OHTA 3LFQA 3MPTA 5M55A 5HX8A 2O64A 3P7AA 5EHLA 2YITA 3KEXA 1T45A 4I3ZA 4QRCA 3VW8A 4UMRA 3UC3A 4Y73A 4A07A 3FZTA 3ETAA 3F69A 3KY2A 1UKIA 4XMOA 3RPRA 2PUPA 1ZY5A 4TT7A 2QOCA 3ZO3A 3AMBA 4FSUA 2ZB1A 4IVDA 3FZOA 4DFLA 3N51A 4L3JA 2JIUA 2W4KA 5FEQA 3CJFA 3MJ1A 5EDQA 3KF7A 1FVTA 4IAIA 5TF9A 5IQEA 3QRJA 4C34A 3DZQA 4TWNA 4J1RA 5KCVA 2Z7RA 4IMYA 4GIIA 4QPSA 3VJOA 2BALA 3POOA 4XLIA 4CLIA 2YACA 3IDPA 4IE9A 2QO9A 5IU2A 5FP6A 4ANMA 3NUSA 2PZYA 4GT4A 4M15A 5CXZA 4FSYA 4M97A 4AT4A 5EHYA 4GS6A 3UVQA 2C6EA 1OIQA 3AD6A 4N57A 3KK8A 2QHNA 2ZDTA 4YTIA 4R77A 1Q8UA 5C4LA 4FVPA 3MA6A 3D7TA 5K5NA 3C50A 1ZY4A 3W2QA 3DK6A 3EL8A 2OJIA 5DNRA 4B6LA 3OZ6A 4G5PA 3DAKA 5ETCA 3OOMA 1JQHA 3Q4ZA 2DS1A 3EB0A 5A4CA 4EYMA 2FH9A 2WD1A 5M08A 5J95A 3PXRA 3E8NA 5HNGA 3TKHA 5CNNA 3UP2A 3K5UA 5HORA 4F1TA 2EVAA 4FSWA 4KBAA 4FSTA 3RZBA 5IDNA 4LOPA 1VJYA 3OEFX 1UU8A 3LXKA 3EYGA 2XRUA 4OTPA 1ND4A 3PE2A 5AP0A 1PY5A 1PXMA 3BHVA 1OKWA 4FA2A 3JYAA 2EU9A 3A2CA 4QMZA 5CY3A 1OIUA 4BCOA 2CGWA 3IW8A 1H07A 2PVYA 3DBFA 2QHMA 5LVNA 2RL5A 5FG8A 2PU8A 4F0GA 3FXZA 4X6RA 4AOIA 1X8BA 5IQFA 4MXAA 4FGBA 5EW3A 5HBEA 3TEIA 1H28A 2IW6A 3F2AA 5L2TA 3R22A 3OS3A 3OWPA 3W18A 3NNVA 1SVGA 1YOLA 1H8FA 2BZIB 2R3JA 3BEGA 5E1EA 4ZY6A 4BI2A 4C57A 5L4QA 3EH9A 4CFMA 4XG2A 4O0VA 4XOYA 1ZWSA 4CFFA 3A7HA 4ITHA 1SVHA 4BICA 3CXWA 5IUGA 1CDKA 2QONA 4EOOA 4DGLC 2E9OA 3COIA 4QO9A 4EORA 4WG3A 2WTIA 3E3PA 5HU9A 3PXKA 3H10A 2C0IA 3O7LB 4L45A 3WF6A 4BDCA 3CC6A 2OK1A 4ZJIA 3F9NA 4WKQA 2CN5A 5LVOA 2XUUA 4AGCA 1M52A 2J4ZA 3C0HA 3MY1A 2BFXA
chains in the Genus database with same CATH superfamily
1J7IA 3EFKA 1H00A 3AT3A 2BFYA 3C4XA 5HHWA 3OWLA 4MVFA 3R04A 4YNEA 3NFGB 2F7EE 4HGTA 4JDIA 3NUAA 3MA3A 2H96A 2HENA 2W1CA 3L8SA 4G31A 4KS7A 5DEYA 3OC1A 4AT3A 5I9XA 5HKMA 3LLAA 4IM3A 3Q53A 3C1XA 4LV5A 4AXDA 4BC6A 4X2NA 3K3IA 4JI9A 3C7QA 2VNWA 4IAFA 5ANGA 2R3HA 2GCDA 2XCHA 5IA2A 4CCBA 1CKIA 2XKEA 4BCFA 5AADA 4DBXA 5K0XA 4FV8A 4DGMA 5FUTA 3A7GA 2ITVA 3DPKA 4BCGA 3ZBXA 3Q2JA 2B1PA 4DTAA 2WO6A 1DI8A 4IAZA 4LL0A 4WBBB 5AUVA 5C8MA 3QQGA 2CKPA 3R01A 4K9YA 4JBOA 5ICPA 1NXKA 3UJGA 3F5PA 3NCGA 3T9IA 3EQHA 3F3WA 3MIAA 4BYJA 3F3VA 3KA0A 3O23A 4FSRA 2QLUA 4W4XA 4PMTA 4JX7A 5J8IA 2DWBA 3SDJA 3FXWA 4IB3A 4FE2A 3DBQA 2BZKB 3QD4A 3NGAA 4YZDA 4IFCA 5E91A 4MCVA 5J5SA 2GFCA 4FTOA 2ZV8A 4FTRA 4M68A 2I7QA 3G6HA 3KRWA 4JX3A 2R7IA 3KL8A 4FTLA 3VC4A 1FVVA 1QPJA 1V0OA 2X9EA 2R5TA 3BBTB 4RFZA 3R8UA 4BR3A 2Q0BA 2XVDA 3L9PA 3ORLA 4PP9A 5CEPA 3DAEA 3Q4TA 2CMWA 1NVQA 2O5KA 3GGFA 2P0CA 4C4HA 3TNWA 2YCQA 2HCKA 3AOXA 3GXLA 5DT4A 4YPSA 3SC1A 2WTKB 3VS4A 4K6ZA 1XMLA 3PUFC 2ESMA 2BIKB 4AX8A 1KOAA 2G1TA 2ZM4A 4I21A 4L3LA 1RJBA 5H8EA 2W0JA 4IZYA 1XBBA 3VS3A 5B2LA 3NMUF 1JSTA 3CP9A 4C3PA 5FM3A 4O4BB 1JSVA 1GJOA 2F2UA 3AT4A 2YIYA 3IECA 2XK3A 4OLIA 3QHRA 4FEXA 1ZARA 4EQMA 2H6DA 4XJ0A 2OH0E 3Q60A 4K77A 2OXXA 1SYKA 4AGWA 2PMLX 1FPUA 2YIXA 4RIOA 3MB7A 3UDTA 3VS2A 4YZNA 1ZYLA 2R64A 4IACA 3W0SA 2WMXA 2ZM3A 1Y6AA 5AR2A 4I5MA 1PXLA 2P33A 3DXPA 4L7SA 5A4TA 4J7BA 3ZS5A 3QWKA 4ZTLA 2WOTA 5KE0A 2R3OA 4GEOA 2BAKA 3ID6C 3I7CA 3ZRKA 2X1NA 2BRNA 3C4ZA 2W5BA 3LCDA 5I9VA 5M56A 3BYVA 4JR7A 3DLZA 4LV7A 3CJGA 3PP0A 5M53A 4FT9A 4IJPA 1TVOA 4Z55A 2VTLA 1M7NA 4B4LA 3DA6A 3TNQB 5BVFA 4OTRA 3P0MA 3IDCA 5IUHA 2JKKA 1KE6A 1Q4LA 3DOGA 1H25A 5JT2A 2RFSA 3IK3A 3QGWA 4EBWA 4UYNA 2VAGA 3QHWA 3POZA 2VU3A 4IH8A 4FIHA 1REKA 3RCJA 4GFOA 3KN5A 4ANLA 2VWUA 3G9LX 3M42A 1KV2A 1FINA 4BJJA 2P2HA 4ASXA 4GFGA 3II5A 5AV1A 5KZIA 2CCHA 3G90X 2C5OA 3G9NA 4R5SA 4JDKA 4JNWA 1UKHA 2UW0A 4F0IA 2I0HA 4J52A 1G3NA 5T6KA 3ZLWA 3E8EA 4LGGA 3VONA 3OXZA 3SX9A 2UZVA 4U43A 4GK2A 2XK4A 4C2WA 3U51A 3PIXA 4OBOA 4YBKA 5CASA 1W83A 2FUMA 2X8IA 4NCTA 5CU3A 3TNIA 4BB4A 5DH3A 3FI3A 4QMYA 3GFEA 3ALOA 4F7NA 4F9CA 3QRIA 3BL7A 1Y91A 4BDAA 4C4EA 3U6HA 3BYMA 3AKJA 3RHKA 5JK3A 1PYXA 3QLGA 4JG6A 3WOWA 4ITJA 4WOVA 3PWYA 4FTTA 3K54A 5DT3A 2XNBA 4U6RA 2CGUA 2KULA 3W1FA 3E88A 4WHZA 4RZVA 3MI9A 4XEYA 2EWAA 5IEVA 2IO6A 1MRVA 4DGNA 3QQJA 3TI1A 2YJRA 3GU7A 3V8TA 2BRMA 4X3JA 5KMLA 3EJ1A 3FLSA 3HVCA 3E63A 4TNDA 4XV3A 4USDA 2X2MA 5IKWA 3EHAA 5CSPA 3CPBA 3DV3A 3THBA 4WNKA 2YA9A 3EN7A 5DRDA 4ZTHA 3KXZA 5IA4A 1W98A 3AGLA 3BYOA 4IXPA 2B0QA 2G2HA 3TTJA 3P79A 3ZLYA 2PZPA 4I0TA 3MN3A 3L8VA 1YHSA 4O0WA 3RWQA 3AG9A 2OF2A 2HZ0A 4R1VA 4EZ7A 2BRHA 4QMMA 3TMOA 3UVPA 5GJFA 3GOKA 4WT6A 4PY1A 4MAOA 1XH8A 5CEQA 4RA4A 2NYAA 2OGVA 3O8TA 2XMYA 1EH4A 1H1RA 4HPUE 4N70A 4CTCA 1G8KA 1P4FA 4DEBA 5IA1A 2VTQA 5JFWA 5JGDA 3R1QA 4QYYA 3Q4CA 4EZ5A 5LOHA 2RIOA 3IS5A 5F94A 4V0GB 1H1SA 5CSVA 3ERKA 2G01A 3PXFA 4FT7A 4BDJA 1APME 4ZSEA 2UUEA 1PXNA 3QKLA 1TQPA 5EM6A 1GZOA 1YWNA 4AXCA 4FNYA 3NW6A 3BCEA 4YJVA 4BTJA 4D4YA 2WMSA 2B52A 2GNIA 4ACHA 5TR6A 3CKWA 2IZRA 4G34A 2I0YA 4X2KA 2PL0A 4RX8A 4F9YA 3PZHA 4I4EA 1YI3A 4UMTA 4A4OA 4FL2A 2CSNA 3HUBA 5CI7A 3RPSA 4JRNA 3FY0A 3M11A 4QQTA 4MUQA 3GQIA 1RQQA 4M3QA 4P5ZA 3FLQA 3VWAA 4UN0C 3U8WA 2XNOA 2IZSA 2XNNA 4YJOA 1L3RE 4TWCA 4CVAA 3W2SA 3BHHA 4YLKA 3QBNA 4ZZNA 2QKRA 5TOZA 4GVAA 5JQ5A 5EQYA 4H39A 4BKYA 1JVPP 4QMTA 5HE1A 1CKPA 4IZAA 5JEBA 2UVZA 5DRBA 3EQRA 1WBTA 3NUNA 3DJ6A 3UZPA 2PMIA 4O7NA 4HVHA 3AKKA 3FBVA 5HOAA 3HV5A 4FIEA 2HAKA 4ASDA 4KWPA 3SW4A 4O86A 4IEBA 2BDWA 4IHPA 1I09A 2Z2WA 3E92A 2WTWA 3NNUA 5HO6A 3W8QA 3ZSGA 4JVGA 4EQUA 4QMVA 4GKIA 4F78A 3VVHA 2JDRA 3KGAA 3UOJA 2ZOQA 5HBHA 4MWIA 4DAWA 3R7VA 4ZP5A 3RAWA 2VUWA 2C30A 3TG1A 2AC3A 4OAVB 3BZ3A 2WB8A 3FPQA 4RJ6A 3HKOA 2ZVAA 1WBNA 3PJ1A 1A48A 4E20A 3D9VA 5GJGA 4D5HA 3SOCA 5TE0A 4BJJB 5D12A 3QTSA 4ACDA 3AKLA 3IW6A 5CF4A 1CM8A 2X6DA 4Y5QA 4EI4A 2XALA 3H30A 5ANEA 4ZMEA 1XBAA 2V55A 2Y9QA 5AX3A 4AN9A 5ANOA 4ACMA 5BMSA 4NZWB 4XG3A 3DKOA 1OPKA 2YM5A 2XJ1A 4LGHA 5AP6A 1UA2A 3KULB 4CFNA 3ZDIA 3BYSA 4BIDA 3DK3A 3UPXA 4D0WA 2PVNA 1IA9A 3RNYA 3AT2A 3DLSA 4NIFB 3DGKA 5E8TA 3OROA 2OJFE 3FMHA 4FTCA 5AM7A 2OKRA 3LXLA 1YKRA 5KBQA 3C5UA 5IQBA 4H05A 4W8EA 3QL8A 4MBJA 4FTJA 3NWWA 5FGKA 3R8MA 4HW7A 5C03A 4HJOA 1LP4A 4K0YA 3PIYA 4XHKB 3IW7A 2JIVA 1S9IA 3DFCB 2HWOA 4Y72A 5CU4A 1MRYA 4FIFA 4OBQA 2YAAA 4Q9SA 5C9CA 3E7VA 3TM0A 3FSKA 3PVWA 4IAKA 4BI1A 1YHWA 3HDNA 3HMIA 3FDNA 3GU8A 1YDRE 3QC9A 4FG9A 3VRZA 3KULA 2JKQA 1OKYA 2XEYA 3R2YA 4IB0A 4NEUA 5L2IA 4QMLA 4O0RA 5HZNA 3K2LA 1G8SA 5JH6A 4EUTA 2IZTA 3ZO1A 3UG2A 2GU8A 5A6OA 1PXKA 2RFNA 1MQBA 3EN6A 4KRDA 5EOLA 5A4EA 3KXXA 4UBAA 3ORTA 4WRGA 4NWMA 3W0OA 3LXPA 2VWZA 4B8MA 4GG7A 4XG4A 1V1KA 3AC5A 5CEOA 5KZ0A 3O71A 3BKBA 3VBXA 4UMUA 1XO2B 4DGOA 4QOXA 3RZFA 3LAUA 1XH4A 1W84A 3ZUUA 1U5QA 5J7BA 2JKOA 5IEXA 2CNVA 3W2OA 1UV5A 3UC4A 4YJTA 4CMOA 4DHFA 2IPXA 1HCLA 4A9TA 4YZMA 4EOMA 4J96A 3W2PA 4E7WA 2XIYA 5IDPA 4IAYA 4BGQA 2IVVA 1LEZA 5DWRA 3UE4A 5FQDC 4BKJA 5DE2A 3QTWA 4A9RA 2YFXA 4D1ZA 4UWBA 4BCNA 3W0PA 3VO3A 2G2FA 5FDPA 3BEAA 3ZSHA 2YM4A 3K5VA 2BR1A 4I0SA 4WO5A 3V6RA 1HCKA 3A60A 2GS2A 3GU4A 3P78A 3P7BA 4MD7E 4RC4A 2C5NA 5K4IA 4O4CA 1P4OA 1YI4A 2IW8A 3DY7A 4EK8A 4RJ8A 2HZNA 2R3GA 4RLLA 2XIXA 5FBNC 4ACCA 3EN4A 3F3ZA 5ANIA 3VN9A 3COMA 4Q5EA 4MKCA 4FKQA 3JPVA 4JS8A 4IDVA 2CPKE 5ANDA 3MY5A 2IVSA 2JLDA 4RIYA 5T68A 2F2CB 3C0IA 1Q3WA 3CGFA 5AUZA 3LKMA 3GT8A 4FKTA 5EKNA 3LQ5A 5EYCA 4PL3A 3UOKA 3W55A 3CQWA 3TZMA 3QXPA 3CTHA 4FK6A 4F08A 2WU7A 4YZ9A 4C4JA 1REJA 4G3GA 4GSBA 5KMNA 5I3OA 4CMTA 3PLSA 4AACA 4HYIA 3NVMB 1R39A 2C6MA 3W0NA 2QOIA 4J99A 4I5PA 3Q3BA 3AC4A 5M06A 3MFRA 4BVUA 1XWSA 4EOPA 2ONLA 3PY3A 5CNOA 4XH6A 4ZS0A 4BGGA 2XARA 4F6SA 2WQEA 4TXCA 2RFEA 4Z7GA 1VLRA 4BFMA 2UW6A 3BBWA 5J9YA 2VTSA 4NKSA 1G8AA 1MRUA 2V7OA 5JSMA 4KIQA 4NH1A 3C13A 4BZDA 5EYKA 4RWJA 3T9TA 2CLXA 4I23A 4E4XA 3QTUA 3MPAA 4CV8A 4AT5A 4H1JA 2X81A 3PFYA 2VTJA 4PL5A 4HCVA 4B7TA 3ATSA 4UB7A 5EI6A 2XKDA 4UMPA 4UEUA 4UWYA 4RZWA 4W9XA 3FLWA 4Y46A 4FV2A 4U45A 4DEAA 5IF1A 2EXCX 2JGZA 1ATPE 1Q8TA 2UV2A 3CTQA 1GZKA 2O8YA 2QQ7A 4X2JA 3S3IA 3UTOA 3UNKA 3L8PA 3HP5A 1GIHA 1ZAOA 4FV6A 2AC5A 2PZIA 4M67A 4G3FA 4U80A 4C58A 4C61A 3O8UA 3PG3A 2QO2A 4DFYA 4E4MA 4JDJA 4ZJJA 1PXJA 4FUXA 2C4GA 3I4BA 1AQ1A 4FG8A 3FQSA 5DFPA 1IAJA 3Q6UA 2BRBA 4BY9E 2QODA 3CCNA 4KD1A 4OAUC 2Y4IB 3PVUA 4FZAB 5AP4A 2Y6MA 4TYGA 1H0WA 4LUDA 4WSYA 3OT8A 3T3VA 4ALUA 4EK5A 4IW0A 3PY1A 4F1OA 2NNWB 2C47A 3T8OA 3V5LA 2ITUA 4D2WA 3D7ZA 4L44A 3TWJA 1B39A 3OXTA 3VJNA 3F7WA 5DVRA 3VUGA 3FXXA 4E5BA 5KMMA 4O7YA 2BZJA 4TWPA 2WMVA 3ITZA 5HESA 5D41A 3ULZA 3ZHPC 4D2VA 3SD0A 3V3VA 5KX8A 3FHRA 4RT7A 3JUHA 4IC8A 2A19B 3ENHA 4EC9A 5B7VA 4JLCA 3KMMA 3GENA 4BI0A 2VWYA 2UZBA 3PXYA 3HMOA 2WMUA 2ZFYA 4YBJA 3PA4A 4WNOA 2OZOA 3UIXA 3MTLA 2W1EA 5B2KA 3HECA 1PXPA 3VS5A 4J95A 1OL6A 3EYHA 4O0YA 5CU0A 4MEDA 4NIFA 3HZTA 4AZTA 3ZM9A 3IQ7A 3MIYA 3D7TB 5CYIA 1YI6A 3G15A 2JDOA 3EQFA 1GOLA 4MK0A 4BZOA 2I1MA 2RKUA 1YXSA 2XK6A 4IAAA 5HCXA 3EWHA 2FVDA 3NCZA 3QUDA 5CWZA 4AN2A 1PKDA 4H3PA 4A4XA 1YXTA 1WBSA 2GFSA 1PHKA 4QP8A 2OFVA 4UV0A 1OITA 4V01A 4UZDA 2EB2A 3GNIB 3P5JC 2G2IA 2PUUA 1SNUA 3DKCA 4RIXB 4XBUA 5M44A 5C8KA 3G0FA 2HZ4A 2ZJWA 2OH4A 5IG1A 3LJ1A 2VRXA 3H9OA 5E8XA 1V0PA 2C6LA 4N6ZA 3DAJA 4DH5A 4IADA 1QCFA 4IVCA 1GIIA 3PXQA 4J8NA 2CKQA 1YHVA 4K8AA 2A1AB 3GVUA 4C4FA 3BWJA 3MVHA 2PVMA 1H1PA 4CD0A 4QDVA 4Z3VA 3ROCA 4E5AX 2PTKA 5IQIA 3VW6A 5EKOA 4YJNA 4RFYA 4XG7A 3ORKA 3CY3A 3ZONA 3LJ2A 3Q52A 4JG8A 5IQHA 4LOOA 5CANA 5AV3A 5B0XA 1OI9A 4AG8A 4YSJA 5DG5A 3RJCA 5BYYA 2XNMA 3BGPA 1IA8A 2W99B 4GCJA 2WIHA 4O21A 3HGKA 3I0QA 3CQUA 3U4WA 2G9XA 4GFMA 1GAGA 4J97A 3UGCA 3FEGA 2RFDA 3TV4A 4FEUA 2YIQA 3ZLXA 3IONA 2J5FA 3BHYA 3HMPA 1A06A 1URWA 3PJCA 1IEPA 2XP2A 5GIOE 4GT5A 3LM5A 4U42A 3DU8A 2WEIA 4ID7A 4NTSA 1R0PA 2FB8A 1KV1A 3VBYA 1NT2A 3C4FA 3DFAA 3TXOA 5BVWA 4EK3A 3UG1A 4ZSLA 5HLPA 3PTGA 4AGUA 1BX6A 3IPHA 4RPVA 4FKVA 3AC1A 3KN6A 4X0MA 4XNEA 4BDBA 3V5JA 3Q4UA 5DGZA 3Q32A 2AUHA 3PJ3A 2VO7A 4AQKA 3FKLA 4S31A 3AD5A 2GTNA 4LMUA 2YM7A 3DS6A 2XBAA 3IKAA 1PMUA 3MB6A 3TNPC 2XNPA 4U79A 3FAAA 2OXYA 2HXQA 4L53A 3QCSA 2I6LA 5HE3A 4XUFA 4BCKA 2QD9A 2J0JA 5IH4A 4NU1A 2CGVA 3I6WA 3MW1A 3NS9A 2UZNA 4ZLZA 1OL2A 4FZ6A 3GFWA 4KNBA 2XNGA 4PMSA 2X8EA 2AYPA 4GIHA 3CQEA 4M0ZA 2DQ7X 5DHJA 5CEKA 3UYTA 4Y85A 2C5XA 4RC3A 3V6SA 3NUUA 2WIPA 5HTIA 5E8WA 5FLFA 3TZ7A 4JL9A 3GU6A 1XMMA 3WZKA 5IISA 3U54A 4DHIB 1E1XA 3RBWA 4PF4A 2VWWA 2WMRA 4U41A 3NIEA 3R83A 3QU0A 2H8HA 2Z7SA 1UWHA 5JZJA 4F9WA 5TT7A 3QTIA 1R3CA 2F7XE 3E7OA 4RC2A 3PLAE 4DFBA 2YERA 5GHVA 3ATTA 2GNFA 2GNLA 3C0GA 5AV2A 3R8PA 3R8ZA 1UU7A 5EYMA 3L9LA 4PP7A 5L6OA 4DHJA 2G15A 4YZCA 5DEWA 2P3GX 5ETFA 1XBCA 2JDSA 5H8BA 1XH7A 4P90A 4PTGA 4RVKA 3PDTA 4FYNA 5EI8A 3Q9YA 1OB3A 1O6YA 4JQ8A 4JT3A 2YABA 1GZNA 4CYIA 1NW1A 3LVPA 3CIKA 4X21A 2GHLA 2PVFA 4ARKA 1CKJA 3I1AA 2GQRA 3SKCA 4QP4A 5IMEA 4HCUA 5AAFA 4RRVA 4TTHB 3U4UA 1IAHA 3F7ZA 4GKHA 3GP0A 2X6EA 4MF1A 5CEIA 3S2PA 5ETAA 1H26A 4CGAA 3DXQA 4TYHB 3R1SA 1FQ1B 4RFMA 3UIBA 5I5ZA 1OUKA 4CZYB 3F2NA 3VUIA 3LCKA 1OL1A 3TUBA 1KOBA 3N9XA 4RLKA 1XH6A 4BCQA 3FZSA 2C6DA 3PY0A 3LJ0A 2JITA 3G6GA 5AEPA 5C1QB 2CKOA 3A61A 5JFVA 4U0IA 3O17A 3QFVA 2GPHA 2OXDA 4DEDA 3CR0A 3QZHA 1JPAA 4HGSA 4K18A 2X0GA 4FRFA 5EFQA 4R78A 5DBXA 3D2IA 3REPA 1NA7A 2B4SB 2JIIA 2A27A 3E5AA 4EWQA 5H3QA 1GY3A 5DT0A 4GG5A 4IB5A 4CEGA 4BF2A 4DT9A 5ETIA 5HO8A 4F64A 1WVWA 2JAMA 2BTSA 3A7FA 4F70A 4TKSA 4O22A 3KVXA 4KS8A 4AXFA 3FMEA 4TN6A 3R8VA 2VWIA 4WIHA 4C37A 5HG5A 3QD3A 4NL0A 3DK7A 2J5EA 4XV9A 1E9HA 4NFNA 4AW1A 2ZMCA 1FMOE 3F5UA 2RG6A 3FWQA 3KU2A 4E6DA 4DC2A 3Q5ZA 4EHEA 4IWQA 5DMZA 3BX5A 4O4EA 5HEZA 4AXAA 4C4GA 5L6PA 2QOQA 4R5YA 2C6TA 4RVTA 3VQUA 2WZJA 3SQQA 2GDOA 3LFAA 5CLPA 4A7CA 4NK9A 4PDSA 4FV0A 5M4FA 1M17A 4S34A 5HG7A 1OUYA 4C7TA 4BDIA 2OSCA 4CXAA 4EH7A 2V0DA 3EQCA 4D2RA 4YO4A 2W7XA 3FMJA 4F6WA 5K3YA 5CQUA 3QQFA 2ERKA 4JOAA 3VUDA 4LG4A 4Y8DA 3WZJA 3NNWA 4AW5A 3OCGA 4I1ZA 2R3PA 4QPMA 4PDPA 2VO0A 2PZ5A 2FSMX 2YIWA 5E90A 5LMAA 3OMVA 3WYXA 1H4LA 5J5TA 1PMNA 1OGYA 5CSWA 3KFAA 4IB1A 2XIRA 2BPMA 2HY0A 1KSWA 2OZAB 3OEZA 4QP2A 5FTQA 2VTOA 3RAIA 5EDPA 4E8AA 1J7LA 2PHKA 4C0TA 4I22A 4G9RA 1JNKA 3ET7A 2IVUA 2YLEA 3I6UA 1ZMVA 4MXYA 3PJ2A 2SRCA 5J1WA 1QMZA 3DDQA 4C38A 3MH2A 4W4YA 3FMMA 4PDOA 1OIRA 4FJVA 5L8LA 3BWFA 4QTBA 2GSFA 1YW2A 2WMBA 3AQVA 4HNIA 4U7ZA 2E2BA 3D5UA 3R7OA 2PUNA 4WG4A 3PPZA 4CLJA 5IZFA 5CXHA 1J1BA 3AMAA 3ANQA 4ZLOA 4DH3A 3GBZA 4NW5A 5AAEA 2V22A 4EK6A 4J71A 3UIMA 4X2GA 2WMTA 4UXLA 3R6XA 2Z02A 2OZAA 3H3CA 3NW5A 3RINA 3S00A 4DEHA 3LHJA 3A8WA 4CG8A 5I9WA 2UVYA 2ZMDA 4IM0A 3SG9A 5KO1A 4JQ7A 3ZTXA 4AN3A 1SNXA 3U6JA 5E4HA 3UQFA 3U87A 4E73A 4ZZOA 2O3PA 3CD3A 4IJ9A 3TJDA 2ZV2A 3GUBA 2VTNA 4W8DA 4E1ZA 5IMXA 3HRCA 3TZ9A 4FTMA 5E92A 3Q9ZA 3QX4A 4X3FC 2XANA 5J87A 1P5EA 4ZOGA 1IG1A 3ZUTA 2R3IA 2VGOA 5E1SA 3BIZA 3GCSA 4FIIA 4RWKA 5HCZA 3GC0A 3NYVA 3OFMA 4I93A 1ZZ2A 3C4WA 4MXCA 3QQKA 4CFWA 3ML1A 4Z7HA 2QOBA 1PW2A 1Q5KA 4L00A 2YWPA 4IM2A 3SXFA 3PE1A 3HEGA 4BKZA 4FTUA 1R0EA 5HNIX 3UOLA 1IASA 3ORMA 3QCQA 5F4NA 4L68A 3FC2A 3IW5A 4MBLA 2C6OA 4D2PA 4XX9A 5GNKA 3I79A 1PJKA 3BGZA 4PWNA 1M14A 3OVVA 4Z9LA 3R0TA 5EI2A 3TACA 3FPMA 4CMUA 2C5VA 4DFUA 4DT8A 5IQDA 3EOCA 3Q04A 4CZTA 2NRUA 5EYDA 2JAVA 4TYIA 4ACGA 5CF6A 2BHHA 3MY0A 3C5IA 1B38A 4ZSJA 1K3AA 3FQEA 4ZLYA 4QQCA 3KRRA 2IG7A 4U44A 2JC6A 4G6OA 4Y95A 1NY3A 3PWDA 1M2PA 5L2QA 2OLCA 2RG5A 4NM5A 2IVTA 4DA5A 2JFLA 3MFSA 3OTUA 4YUQA 1M2RA 3E8CA 2AEGA 4JMQA 1O9UA 3UDZA 2I0EA 2PVLA 3BPRA 5AFVA 4DBNA 3EQDA 1YRPA 4ENXA 4RSSA 1DS5A 4WBOA 4JBVA 4FTIA 4O91A 4DG2E 1YOJA 5TKDA 4OTIA 4H3QA 2ETKA 3QC4A 1RW8A 4YTHA 5EM8A 3MH3A 5FBOA 3KIOC 4P5QA 4MTAA 4U3YA 5AMNA 5H8GA 3VBTA 3RNIA 3WARA 3NX8A 1ZMWA 5GINE 4WNPA 4AS0A 1XKKA 4A4LA 4R1YA 5DOSA 4RQKA 3R8LA 1LUFA 4NTTA 4XRLA 1R1WA 4F65A 3OCBA 4PTEA 5LJJA 4UYAA 4O6EA 2ITTA 4O2PA 2WMWA 4M69B 2BIYA 3W33A 4DTBA 4FOCA 3ZSIA 1PMEA 4I41A 3G33A 4FKSA 5B2MA 3S0OA 2W05A 3BU5A 4XLVA 3KC3A 3OT3A 4JIAA 4A9SA 3HX4A 4TZRA 5FM2A 4GT3A 3FKOA 2C3KA 5AJQA 2QU5A 5AUXA 3R7YA 4D28A 4YMJA 4DGGA 2YDKA 2YZAA 4BHNA 2JKMA 2XRWA 2ZV7A 2OICA 4GJ2A 4XOZA 5EW8A 3I7BA 2Q83A 3Q5IA 5L2WA 3QKKA 4AW0A 5IH6A 4YTFA 4ANBA 4I6QA 3M2WA 3SGCA 2GNJA 4GVJA 4PPCA 2VTRA 5H2UA 4KB8A 4QQ5A 3EFLA 2GNGA 3FLNC 3ZO4A 1U59A 3SOAA 3DDPA 4XV1A 4BDGA 5BYLA 4O96A 3UMWA 4ZS4A 1YVJA 3VHEA 5LVLA 3SRVA 2VN9A 4LV8A 5AM6A 3QF9A 4C2VA 3F3TA 3IGGA 4DEGA 1Q61A 4DG0E 1H01A 5JGAA 2XK7A 3GEQA 3NAYA 4APCA 2O63A 4I20A 1PKGA 1XR1A 3KMWA 2UZEA 2ITYA 5BV3A 2LGCA 5A14A 4R8QA 1R78A 4OBPA 3TL8A 2XF0A 3MVLA 4LL5A 5AIRA 4NFMA 1OPLA 5GJDA 4BTKA 3R1NA 3O51A 5BVNA 2HOGA 1NVSA 2IWIA 3VUTA 3FYJX 1CSNA 3PRIA 4J98A 3IO7A 5L8JA 3UBDA 3UMXA 3D5XA 3KRLA 4EL9A 4M12A 2NO3A 5A46A 4N6YA 2J90A 2C0TA 3QTRA 3O8PA 3VUMA 5CSXA 4EYJA 1FGKA 4IX5A 3GB2A 5M4CA 5AP7A 3ZH8A 4F6UA 4H58A 4N0SA 2UW3A 5JRSA 3V8WA 2UW8A 1FVRA 5FXQA 3LFDA 4HGEA 5EOBA 5EM5A 3K3JA 4OGRA 4OR5A 1ZOHA 3AGMA 5CI6A 2C0OA 5LVPA 1IRKA 3BQRA 4DFNA 1FMKA 2VWBA 3SG8A 2PE2A 2UZLA 4BTMA 1ST0A 2IZUA 4OTDA 5FRIA 5LMBA 2QR7A 2UVXA 2YM3A 2OU7A 4G3DA 2F49A 3F88A 4DCAA 2XM8A 3QD2B 3QCYA 3F61A 4HZRA 5T3QA 4WUNA 4QEBA 3ULIA 4BDKA 2ITWA 4PNIA 3GCVA 4OTGA 2B9FA 4YHJA 2XB7A 1O6LA 3OXIA 3QRKA 4YZBA 4TL0A 2PE1A 2X4ZA 3EL7A 2YIRA 4IC7A 3ZZEA 2XIKA 2QLQA 3JVSA 5LQFA 4IANA 3MVJA 1B6CB 3FUPA 3EQPA 3B2WA 3BLHA 3D5WA 2XK9A 2QKWB 3FI2A 5DI1A 2W1FA 3DQWA 4MHAA 3FL4A 4ZK5A 4QT1A 2X2LA 2UZOA 2VX1A 4IWPA 3COKA 3ZFXA 4QP6A 1ST4A 3A62A 3DTWA 4JIKA 4C4IA 5IQCA 4YSMA 1Z5MA 2HIWA 4P2KA 2GS7A 4M66A 4O0XA 2Y8OA 4K33A 3AC2A 3KRJA 1SVEA 2HW7A 4M8TA 3TT0A 4V04A 2OF4A 4RX5A 3Q6WA 4YP8A 3QGYA 1VYZA 5KKRB