1OUKA

The structure of p38 alpha in complex with a pyridinylimidazole inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
348
structure length
348
Chain Sequence
b'ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Structural basis for p38alpha MAP kinase quinazolinone and pyridol-pyrimidine inhibitor specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 348
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1oukA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1oukA01
3RM6A 1GZKA 3PXFA 3LIJA 3FI2A 3MS9A 3R30A 1ZY5A 4ZJJA 1VYZA 3LOKA 4BB4A 5IQCA 1TQIA 5IDPA 3QUEA 4UZHA 1Y6AA 3ZSIA 4NCTC 2ZAZA 4FTOA 1AQ1A 3FBVA 4JG8A 3S1HA 4N4SA 5CLPA 3MH3A 3R7GA 3NLBA 2WPAA 3VS6A 4ZZMA 3LMHA 2B9JA 4ACCA 4BR3A 4QMWA 3R7IA 2WU7A 3PWDA 4IZ5A 3VBWA 2I0YA 1J91A 4LL0A 3DFAA 2J0MB 2Z2WA 4D2TA 2VU3A 3V5LA 3EFJA 5AIRA 3COMA 3OUKA 4BIBA 3BHVA 3E7VA 4AF3A 1PF8A 3A8XA 3K5VA 1KE6A 4QTCA 4DH1A 4FNYA 3U6HA 4D2WA 4P5QA 3Q5ZA 2JIIA 3ZO1A 1H00A 5E8UA 4C38A 3QTWA 4OTQA 4QMYA 3MIAA 3TL8A 2CDZA 3SKCA 4DCAA 2OF2A 5A4TA 3W32A 3WZJA 5D1JA 4NK9A 1JSUA 5CF5A 4UX9A 2A1AB 4O7TA 3R7UA 4FG8A 4O7VA 1OBGA 4KABA 5AJQA 3QCQA 5E8TA 5KZ0A 5CSVA 4D0WA 2PTKA 4QMNA 1DM2A 3GQIA 5A4CA 2YCSA 4IBMA 3HECA 4YJRA 2XIZA 4DFZE 3CKXA 3I0QA 4QMOA 3SOAA 4FV7A 2WIHA 2GS6A 3HEGA 5CZIA 2QVSE 5BVOA 3TNWA 5HQ0A 4QP2A 3DAKA 5E1SA 4WOVA 2JDOA 4JVGA 4XV3A 4UYNA 4EH8A 4QYEA 3DBCA 3CP9A 4BYJA 3HMPA 2CKOA 4IC8A 4G34A 2GHMA 2XBAA 3PXQA 3RCDA 3VF8A 3VS7A 3IQ7A 5LARA 1Y91A 5D11A 4RIOA 3U87A 4U8ZA 3QRKA 2QD9A 4GIIA 5LMBA 4EHZA 3C0IA 2AC3A 4U97A 3VULA 3JVSA 4FVQA 2QQ7A 5J5SA 5DR2A 1WBWA 4UY9A 3IS5A 4OBQA 3TZMA 4IAYA 3ETAA 4FTTA 3VS0A 4EC8A 3EHAA 4BDDA 4DGNA 5CAQA 2B54A 1YXSA 3GU4A 3NPCA 1URCA 1V1KA 5HD7A 5CU2A 3BYUA 2H96A 2QURA 1EH4A 3G2FA 3KXHA 2BALA 5I3OA 3NYOA 3FLYA 3E8EA 5JSMA 5J5TA 2UVYA 4X3FA 5FUTA 2OJJA 4KSQA 1FQ1B 3VWAA 1U54A 3VN9A 3AT2A 4MX9A 5CQUA 5DE2A 1J7IA 3KMMA 5DYJA 3I7BA 2P55A 5HLPA 3W2CA 4RT7A 3VRZA 4BDAA 4RVMA 4EK3A 4R5SA 4LL5A 3UPZA 1KE8A 2BTSA 3ORPA 4EL9A 4Y95A 4FKJA 3I0OA 1G8SA 2KTYA 5K3YA 2YIWA 4IFCA 2X7GA 4C02A 3H9RA 3L9PA 3RKBA 3T8OA 5HTIA 1H08A 3SDJA 4M8TA 4X7QA 4IZ7A 3TUCA 1V0PA 4HYUA 2Z02A 4W8EA 3HAMA 3PLAE 4C4FA 5CEOA 2HZNA 3CY2A 4RWLA 5JGAA 3QCSA 2C6OA 5ETIA 5E1EA 4DFYA 5IQHA 2BRHA 4ZY6A 3PXZA 3BELA 4ZP5A 2Z8CA 2E9OA 2WMQA 4WT6A 2P3GX 3R7YA 2XKCA 2VWXA 5CTPA 2VX0A 4O2PA 4KS7A 3W2OA 4ACHA 2J6MA 4IW0A 2PZRA 2W1GA 2Q83A 5FXSA 1URWA 3EN4A 1R1WA 3VNTA 1ZARA 1U5QA 4L46A 5DEYA 5DT0A 3AMAA 3NX8A 4EBWA 3OW4A 3PA4A 2A0CX 3AMBA 3Q6WA 4U79A 3FSFA 4EH5A 5JH6A 1ZYLA 2OFVA 4CRLA 2VTQA 3K3IA 3Q32A 4DLIA 1B6CB 5CU3A 2BZJA 2ZDTA 3KK9A 4W4YA 5EFQA 4L53A 4D2SA 2LGCA 3E62A 3HV7A 3IGOA 5BUJA 4D1XA 4IEBA 5DH3A 2HZIA 3CD3A 4UZDA 5IQDA 4AW1A 4QYGA 4G5PA 1ZAOA 4AX8A 2PVHA 3OW3A 1BMKA 4XLIA 3U55A 1MP8A 1V0OA 2NRYA 3F5PA 3FKOA 3L8XA 5DOSA 4UMUA 2CMWA 4QTAA 3DK3A 5B2KA 2OZOA 4WO5A 3IW4A 4BDFA 3TEIA 4MD9E 3QYWA 4BDEA 2JFLA 1H1QA 4FIEA 1K2PA 4V01A 4FTNA 4RIWA 2AC5A 4W9XA 1GZNA 3PYYA 4HGEA 4UXLA 5TOZA 4ZS4A 1F5QA 3BLRA 3DU8A 2XIRA 4XRLA 1WBTA 2CGUA 5D12A 3JY0A 1H07A 1YHSA 3GC9A 2CLQA 5K0XA 1FVVA 5CEMA 4PUZA 1K3AA 2CPKE 3BEAA 2OJIA 3H10A 3MSSA 1ZOHA 4FKLA 4NM7A 3C9WA 4BI1A 4PL4A 3BEGA 3GFEA 1TQPA 3AT4A 3F2NA 1OECA 3QWJA 2ERKA 4DGOA 3FXWA 5J7BA 3NMUF 2GHLA 5EYCA 3LQ5A 4O1PA 1Q5KA 3WF5A 4QMVA 3BU6A 2G9XA 1JOWB 2YIYA 3UE4A 1REJA 2W1FA 3EQBA 3S00A 3PA5A 3V8WA 4AN9A 5CVGA 5ANDA 2XEZA 3FMKA 2VGOA 4FMQA 3RNYA 2J50A 3MIYA 3MPAA 4MNEB 3OBJA 4ANMA 4BCNA 4C3RA 3GP0A 4J98A 4NTTA 3RPOA 2E9NA 2YEXA 3PVBA 4PP7A 2ITYA 2RSVA 1REKA 1KV1A 4IFGA 4BFMA 3HP2A 3ANRA 5KX8A 4C0TA 4IB1A 2X1NA 2F2UA 4CKJA 4AGCA 1W84A 4FX3A 1UVRA 4DTAA 4FUXA 2W1ZA 3BZ3A 3OC1A 5J79A 3OROA 4CQGA 4FUYA 3PVUA 4TWNA 2HOGA 1XQZA 3G0EA 2CNQA 1H0WA 5D7VA 3MY1A 4IAFA 4D1SA 4EKLA 4ZSAA 5GZ9A 2ITNA 4BBEA 4OGRA 4BN1A 1ZYDA 3ZLSA 2XCHA 4FSZA 1UWHA 5M09A 3P0MA 4DEGA 4HCUA 2O65A 1YXXA 4WG5A 2BZKB 3W2QA 2OICA 4S2ZA 2VO7A 2J7TA 2ITPA 3TUBA 3KRRA 4O7ZA 2EWAA 2PPQA 5JK3A 5HG9A 4PY1A 2BFXA 3FMDA 3ROYA 5IA4A 1O6YA 1UU9A 2BILB 2P4IA 3R73A 2C47A 2V22A 2VTIA 3NW7A 3QA0A 4MQ2A 3K5UA 2VTRA 3TZ9A 5M57A 4RJ3A 4FSYA 4RVKA 5E8VA 4EHVA 3R0TA 4QMTA 4EH2A 3QXOA 1O6LA 1PXLA 3M1SA 5EQEA 3P7BA 1GIHA 4LV8A 5FBNC 5LQFA 3UNZA 3OWKA 4FV0A 3D15A 5EI2A 2YISA 3KC3A 3G90X 2PVJA 5K5NA 4IB0A 3QTSA 2XIXA 5AR3A 4PDSA 4PL5A 3D7ZA 4FIGA 5JGDA 2BRBA 4QQCA 4MEDA 4BC6A 4GT5A 5BX0A 5IISA 4FSNA 3DXPA 4AGWA 3PXYA 2W7XA 1PMUA 4GS6A 4J52A 4GK2A 4BCIA 4JI9A 2F7ZE 3L1SA 3OOGA 4YC8A 4AP7A 4O38A 4FK3A 4AS0A 3SGCA 4ZZOA 4Y85A 3QUPA 3PZHA 4WSQA 3MGYA 4A4OA 1ZRZA 4EKKA 4F6WA 3Q52A 3CC6A 2G2IA 5JQ5A 3IDBA 3DS6A 2ZYBA 3DAEA 3DZQA 2OO8X 5AAFA 1SVHA 4QMPA 2JDSA 4G6OA 4F1TA 3RBWA 3DQXA 3COIA 4HNIA 5HCXA 3QRTA 2B7AA 3QHRA 1PXKA 2HXLA 2WGJA 5BVWA 4F99A 4FTJA 4YZDA 5CVHA 4E4XA 1MUOA 3R1NA 5J7HA 1Q41A 1XH4A 4EZ7A 5E4HA 4YMJA 2IVTA 4GL9A 2RF9A 4DEEA 4R7IA 5IEYA 3KGAA 2FB8A 2ITOA 2J5FA 3GUBA 3LFQA 5M07A 2YDKA 2B9FA 2XIYA 5CI6A 2CHLA 4I5CA 5D10A 5HU3A 2OH4A 2BROA 2JBPA 4F0IA 2FO0A 2XNNA 4UMQA 3FC1X 2P33A 4IX4A 1R3CA 1FBNA 4L68A 5HE1A 3NCZA 2ONLC 5E8SA 4P4CA 4RZVA 2XKEA 3CS9A 4AN3A 3S4QA 1OKVA 2JAVA 2VTHA 3KVWA 4KIKB 4QP3A 5IQIA 2OGVA 3GB2A 4IJ9A 3COHA 3RZFA 1H1SA 3ATSA 4F7SA 5LOHA 1RJBA 2ZJWA 3EQRA 4HGLA 4PQNA 5C8KA 2WTVA 4WNMA 5H9BA 2FUMA 1YXTA 2J9MA 3ZDUA 4LMUA 4YTHA 5L8KA 3S95A 4XV9A 3DA6A 3PWYA 5M06A 2IZSA 1JKSA 3HGKA 5HTCA 3E5AA 3ORXA 1H26A 1XBAA 3WIKA 3POOA 4AZTA 2UZOA 3CEKA 2C6IA 4QMXA 4YSJA 2UZNA 4GT4A 2OSCA 1BL6A 5DR9A 4RGJA 5C26A 3C13A 3DCVA 2Y6MA 2CJMA 4FK6A 2QG7A 5JGBA 4L01A 4P90A 3MESA 4BF2A 2C1AA 2WQOA 3QYZA 3V5PA 4YNOA 3HV3A 4FT9A 4MBLA 3ENMA 3P79A 2CGWA 4JL9A 1AD5A 5DWRA 3RK5A 3QAME 2VTNA 4ZTQA 4FR4A 3EB0A 4TL0A 3EQIA 2AYPA 3DTWA 3QX2A 4FIFA 4R1VA 4CZUA 2WQBA 3O23A 4YBKA 2QOHA 1G3NA 2OWBA 2X0GA 5LJJA 3IDPA 2NPQA 5CAUA 3O8PA 3R7EA 1M14A 4EK5A 4EOIA 5J9YA 5FTGA 2PUPA 4A4LA 5IA2A 2UW4A 2YIQA 3L9MA 3PXRA 3R63A 4L67A 5GJFA 3WZKA 4NM5A 3RAIA 1MRUA 4CFMA 4F09A 5CAOA 3TIZA 5HLNA 2JFMA 4QTEA 4DT8A 4E73A 4X3FC 4O7LA 1PW2A 4HPUE 4O81A 4F63A 3F7ZA 2OXXA 4KINA 4C4HA 1WBSA 2UVXA 3BQCA 4IHPA 3R8LA 2CKQA 2VUWA 4AZSA 2WNTA 2UZWE 3BWFA 4KUJA 4X21A 3WYYA 2P0CA 4M14A 4BHNA 4LFIA 5FXRA 2YM5A 4RIYB 3ULIA 4EI4A 2UW3A 3GNIB 3NS9A 4JS8A 5EM5A 3I6WA 4OTRA 4BWKA 2ERZE 2C68A 3F7WA 3QQKA 4U0IA 5BMMA 3VS2A 4FA2A 2QOLA 2WTWA 2YM8A 3OS3A 4I5PA 5A46A 2OZAA 2BTRA 3F3WA 3P4KA 3PJ2A 4GYGA 5HBHA 4F9YA 5I0BA 5JKGA 4I0SA 3CPCA 4PP9A 1Q3DA 4JQ7A 3R01A 2P2IA 3Q4ZA 5CZHA 4HVDA 5IEXA 3CJGA 3NNUA 2H6DA 4NW5A 4TYIA 3R1QA 4GG7A 3G9LX 4MWIA 4M69B 5CNNA 2G1TA 4OAUC 2JKQA 1UKHA 3TT0A 4D0XA 2O0UA 3DKCA 4OTDA 1OL7A 1PMVA 2F7EE 1WBVA 3QX4A 3OMVA 5EHYA 3CTJA 4LRJA 3QD3A 3TUDA 1NY3A 4TWCA 5CF6A 1PMNA 5KBQA 3DTCA 3NUYA 4I6QA 5FGKA 3E7OA 5M55A 1KE7A 5JT2A 2J0LA 4H3QA 4YLKA 5FM2A 4EOMA 5L2SA 2NNWB 4F1OA 4F4PA 4O7SA 1JVPP 2UW7A 3B2TA 4DN5A 3QQGA 4XRJA 3KL8A 3VO3A 3LQ3A 2HELA 4OAVB 3NVMB 5CF8A 2XYNA 4FSQA 4DINA 2XH5A 1YQJA 4WBOA 3ZRMA 4QQTA 2JEDA 4B99A 4U45A 4CFUA 2ETKA 4XLVA 2YM6A 1UA2A 4C7TA 3ORMA 4C61A 4F70A 3ZZEA 4BBFA 3UZRA 2ZB0A 2YCQA 2P2HA 1PXJA 3GCUA 1R39A 4P2KA 4ERKA 1PY5A 2PUUA 3BHUA 1MRVA 5ANKA 3UO5A 4F1MA 3PIXA 1PXNA 3ZU7A 1P5EA 3KRJA 4ZSEA 4I20A 3OCTA 3D14A 4CKRA 2Z7RA 4H36A 4HCVA 3VVHA 5IF1A 4I22A 3UQFA 2ETRA 3SAYA 4B4LA 2PU8A 3A99A 4R3PA 1H8FA 4N0SA 5F94A 3QALE 4CSVA 4ITHA 3BBTB 4J53A 4FF8A 3SLSA 3TJCA 5E90A 1YOJA 2CSNA 3KCFA 4N6YA 3DFCB 3MW1A 4FZFB 3UJGA 4C8BA 3VHKA 4A9TA 4G3FA 2DUVA 3SW4A 2R3PA 3KN5A 4FOCA 4LI5A 5EOBA 5HVKA 2RFSA 4UEUA 2YHVA 4XG6A 2HXQA 4IZYA 3V3VA 2ITXA 1FVTA 3R71A 4RWKA 4MF0A 4A9SA 2CLXA 3D2KA 3FV8A 4IZAA 4EZ5A 1ZYSA 4GK4A 5LCKA 3QD0A 4FTLA 3RMFA 3UDBA 4E4MA 4F9CA 1NW1A 4EWHA 4FODA 2X2LA 2VO0A 5JEBA 3SW7A 4L7FA 2Y8OA 2ZMDA 3UP2A 4O7NA 4X6QC 1IG1A 2WTIA 3O2MA 4I6FA 4EH6A 2FA2A 2QONA 3PG3A 3QBNA 3ZEPA 4YTCA 5G1XA 2FGIA 4UWYA 3GC0A 3FYJX 3PTGA 3WF9A 4ZTNA 3P9JA 4CQEA 2PUNA 3FI8A 4G2FA 4F7LA 3MJ1A 2Z7SA 4AT4A 5B2LA 2XZSA 2ITVA 3A62A 4NFMA 5HU9A 3ZRKA 5L2QA 3MDYA 4J1RA 4XMOA 3BPRA 1NVRA 3ZXTA 1FMKA 4K2RA 4CLIA 4Y5HA 3UOJA 2WMWA 3A60A 4PV0A 4O6EA 3C4CA 2X6DA 3KMWA 4FZ7A 3TIYA 4LG4A 1XJDA 3GU7A 5L8LA 5AUVA 3DLZA 4E6DA 5EM8A 4USEA 4I6BA 3UIBA 2IVSA 3EQDA 1ZLTA 2O3PA 4ZIMA 2YLEA 5HO6A 3MY0A 3S0OA 5BYLA 2GPHA 3KCKA 3LXKA 3AC2A 3N4TA 5AUUA 4JX3A 3KKVA 3GFWA 4V0GB 4DTKA 3ZOSA 1OL2A 2IZTA 4DGLC 5HX6A 1O9UA 4W4WA 4DF3A 5M44A 3H4JA 4W4XA 3NUPA 3E63A 2XS0A 4C34A 1U4DA 2BVAA 5IU2A 3O8TA 1OIUA 5JRSA 4U80A 1PYEA 2R3IA 1UKIA 3EYHA 5AWMA 4V04A 3WOWA 5CEKA 4NKSA 4IXPA 2YZLA 4BKYA 1OZ1A 3P5KA 2O8YA 3EN9A 5EQPA 5L3AA 4APPA 4DG3E 4IVAA 5AP1A 4F64A 5HVYA 3B2WA 4RLKA 4EH4A 3ZFXA 5FP6A 5F1ZA 2XBJA 4RC3A 4AGDA 2VWBA 4ANNA 4IVCA 3BE9A 3WZUA 4ZAUA 2GMXA 5AR5A 4TYEA 3ALOA 2RG5A 5HG8A 4O82A 2FSMX 4OLIA 4YLLA 2BR1A 1NVSA 3RJCA 4MTAA 5AV1A 4EONA 4GKHA 5JFWA 2I0VA 3QGWA 2C69A 3UG1A 1KSWA 1QPJA 2YJSA 1Z5MA 3BLHA 3F88A 4FNXA 3FXZA 5A14A 3GCPA 3ZH8A 3IOPA 4CMOA 4DEDA 4ID7A 3KFAA 2UW0A 4BCGA 3HV5A 1UU3A 3MFUA 4ZSJA 2J5EA 5AR2A 1BI8A 3Q3BA 3Q9YA 4O0XA 1P14A 3ZBXA 3QTIA 4D28A 5AP2A 3ZZWA 1XHAA 5KE0A 3K2LA 3ZFMA 4HW7A 5E8YA 4JX7A 3UC4A 4ANLA 1WCCA 5IZFA 4LOOA 4EORA 4RA4A 4J71A 5T68A 3SHEA 5HNBA 3SXFA 3NVKI 5ETAA 5LVLA 1Z9XA 4O0TA 4KB8A 5HE3A 2V5QA 3JYAA 5I9ZA 4AFEA 1SZMA 4D2VA 4HGSA 4YC6A 4FGBA 5GZAA 3FMLA 4QNYA 2B0QA 4BDCA 4AUAA 4CXAA 2OKRA 2BDFA 2ZM1A 4MF1A 3EYGA 4MNEA 4KIQA 4X0MA 5KMLA 1AGWA 3DQWA 4NSTA 4D4SA 3D2IA 3HMNA 3MH2A 4XV1A 4DFUA 5C9CA 3E87A 1Q3WA 1VZOA 3FYKX 2X6EA 3QCYA 1YI6A 4FV4A 2J0KA 1GIJA 4IWPA 4TYHA 4WG4A 4FEWA 3RM7A 4ARKA 3UZPA 4ASXA 4ZMFA 4CKIA 3QTXA 5AA8A 3MH0A 5HBEA 2UUEA 3EZRA 3SX9A 3F3VA 1WFCA 2F7XE 1OIYA 3RPYA 3LXNA 3TN8A 2WKMA 4RA5A 1VYWA 3TJDA 3TACA 4CT1A 3QD2B 5JFXA 5HD4A 4IM3A 2Z60A 4M0ZA 3HNGA 4EYJA 5IKWA 2RKUA 3UG2A 5AIKA 2QR7A 3KXMA 2Q0BA 5EW8A 5AV2A 1A06A 5DRBA 2HCKA 5HEZA 3QRIA 4ONAA 4HCTA 5I9XA 1OVEA 4G3DA 5DT4A 4K11A 4YJQA 3GOKA 4AW5A 3R7OA 4B8MA 4CMUA 3CQEA 3GENA 2WTJA 5E8ZA 3DGKA 5HG7A 5HZNA 4JIKA 3TG1A 3V8SA 1WBNA 4OTIA 2RG6A 3TZ8A 3GC7A 4GV1A 1UNGA 5KO1A 4DBNA 2VX3A 3JR1A 4IMYA 1QCFA 2W1HA 5K4JA 1J1BA 2OIDA 5T3QA 4E6CA 1JNKA 4AG8A 2X4ZA 4RQVA 4RG0A 2X81A 3HRBA 3VBXA 1PHKA 2GSFA 1F3MC 3BYOA 4M15A 1LPUA 3CBLA 3ZO4A 4PRJA 4UBAA 2A4LA 4C35A 4E5BA 2R3LA 1J1CA 5DR6A 2WAJA 3AC8A 4KKHA 2YLFA 4TWOA 4U9AA 4O0YA 5HBJA 4DBXA 2XM9A 3FQSA 2HZ4A 2NP8A 1L8TA 1SVGA 1J3HA 3CKWA 4J99A 5HG5A 3GI3A 4AN2A 2CKEA 4D4VA 3GU6A 1HOWA 2VTLA 4QMQA 2VO3A 2W1DA 4MD8E 4CCUA 2FVDA 4U81A 3UO6A 5EQYA 2CKPA 2OJ9A 4GUBA 2J0IA 4IX6A 3Q9WA 4WD5A 3R9DA 1WBOA 1W83A 5AR8A 3TNIA 4NYEA 1WVXA 1OKZA 3O71A 1H27A 4G9CA 4ZEGA 4D2PA 3BHHA 3AQVA 4FBXA 4BKZA 3ZM4A 2UW6A 5BPYA 4K18A 2BRGA 4QMSA 4IAKA 1TQMA 3LMGA 1YDSE 2Y4IC 2W1EA 1OPJA 3FMHA 3M2WA 2GFCA 4IVBA 3A8WA 3OWLA 5K0KA 2OXYA 4TPTA 4W9WA 3LAUA 3SRVB 3MV5A 3KEXA 5JMSA 4PPCA 3VQUA 1DAWA 5IQAA 1W82A 3EQGA 4YZMA 4DEHA 4ASEA 2R0IA 4FTIA 3FLZA 2W4OA 3JXWA 3C4WA 3MI9A 4JBVA 2OIQA 4M7IA 5HIDA 3VQHA 3F2RA 3QZIA 4TNBA 4DE4A 2R3QA 3I5ZA 4DGGA 2B52A 1KOBA 4MBIA 4K1BA 1CM8A 4MCVA 4U40A 2CCIA 4YJSA 4ZTHA 4CZYB 4DH8A 3DJ5A 4H3PA 3LLAA 3DNEA 3W33A 2C6DA 2V55A 3W16A 1FINA 3FDNA 4MD7E 4O91A 3Q53A 3V6RA 2PVRA 3KRXA 3R8MA 2OJFE 3OBGA 2QO2A 3D7TB 4R1YA 4AFJA 3OCGA 2GTMA 4KIKA 2BDWA 5JN2A 4ZY5A 3VW8A 4PDOA 5EKNA 2GCDA 3V5TA 1Q99A 3N4UA 3VS4A 3RNIA 4LRMA 2W5AA 4JLCA 4KD1A 4G3EA 1VR2A 4MNFA 2VWUA 1PXPA 5LMKA 1DS5A 3FWQA 4MBJA 4R6VA 4MXYA 4DH3A 5KMJA 3AC3A 5JQ8A 3FKLA 4YHJA 5CS6A 1LR4A 2R3GA 4KBCA 4YNEA 2W06A 1Y8GA 1GJOA 3MJ2A 3MBLA 3FQHA 1IA8A 2R4BA 3A7JA 4PTCA 1F0QA 2V0DA 3VUMA 5T6KA 1ZWSA 4GJ3A 4K9YA 1XBBA 3D5UA 3VBYA 4DA5A 2PMNX 3RPRA 3TV7A 1OIQA 5A4LA 3U6IA 4DLJA 2HAKA 1ZZLA 5HHWA 3ZLXA 5C4KA 3OZ6A 3CIKA 3MVHA 2J4ZA 1JKKA 4D5HA 3EN5A 3UTOA 4QPSA 2I0EA 4RQKA 4GFMA 2A19B 3FZSA 4K77A 4QOXA 3F5XA 3CQWA 3LFFA 3RAWA 4NT4A 3FSKA 4AE9A 5I9UA 4XHKB 2FSTX 1YWRA 4EOOA 3IOKA 4YURA 2PVMA 3EN6A 2PVFA 2FYSA 5M4FA 1DI9A 3PDTA 1XWSA 4FKVA 4K6ZA 3WILA 3LCKA 3WBLA 5BMSA 4E4LA 5CSWA 2VTTA 5AAGA 3B8RA 4Q9SA 1B38A 1BI7A 4NIFB 2PVKA 3ZC6A 5EHOA 4J8MA 4R78A 4CRSA 5HOAA 3FY0A 1ZXEA 4I24A 1TVOA 3OUNB 4RVTA 4E6AA 3FY2A 4Y8DA 2QNJA 4JG6A 4Y83A 1DAYA 2YAKA 3PVGA 5EM6A 5FG8A 2X2KA 1WVWA 2BAQA 4JJRA 4UV0A 3T3VA 2CN5A 4IANA 4KKGA 5CSXA 4BGGA 4CTBA 3OEZA 3NUXA 4QP7A 4YU2A 1FOTA 2YIXA 4NL0A 1JSVA 3FL5A 2XUUA 3OD6X 4M69A 2PY3A 4APCA 4QT1A 1T46A 4N6ZA 5BVEA 4J96A 1V0BA 1YW2A 2PSQA 2XRUA 3CJFA 2Y9QA 3FLSA 3FQEA 2B55A 3Q5IA 4WNKA 4O7RA 3R9RA 2BDJA 3PY1A 3ZLWA 2UVZA 4A9RA 5B7VA 3LKMA 2GNFA 1Q4LA 3HMMA 3KULA 4F9BA 3HRFA 4ANQA 3PPZA 5HORA 5KCVA 1CMKE 5HVJA 4I4FA 2R3OA 2WOUA 4CFFA 2GNGA 3K3JA 4IM0A 2YITA 2OU7A 5EM7A 4BY9E 4I1ZA 4BCOA 3FHRA 5CASA 4R7BA 2I7QA 3FKNA 2XK3A 1H4LA 4YJTA 2GNHA 3H3CA 2VO6A 3GXLA 3U4WA 4HNFA 3PG1A 4RSSA 4X2KA 5AAEA 4CV9A 3TDVA 4CGAA 3SG8A 3LFCA 4C36A 3DK6A 4FKRA 4Y46A 4F9WA 2J90A 4RX5A 3TNQB 3R1YA 3FJQE 3CGFA 4TZRA 1W0XC 5AP0A 4C3PA 3QHWA 5D7AA 4RBLA 3P7CA 3OCBA 1M17A 2HWOA 3NIZA 4OBOA 5HO8A 3F2AA 5I5ZA 5JRQA 4CZTA 2QR8A 4TRLA 3VUHA 4BVUA 3ZDIA 4BCJA 4EH7A 1R0EA 2XK7A 1QPDA 2PZIA 3D5VA 3QZGA 2VN9A 3F3ZA 4E93A 2XKFA 4GVJA 2E9UA 4NFNA 4G3GA 2C5YA 4OTWA 2B1PA 2UZBA 4DG0E 4NM0A 5AM6A 4C3FA 3GC8A 4TTHB 4AOTA 1HCKA 2EXEA 3BGQA 3I60A 4L7SA 2WB8A 5BUEA 2VRXA 5KMNA 4JIAA 2E2BA 2GDOA 5H2UA 5I9WA 4BCQA 3RAHA 2XK6A 4BTFA 4RIXA 4FE2A 2QKRA 3ERKA 2QO9A 4YHFA 4IWQA 1JQHA 3HZTA 3DAJA 3E8DA 3HAVA 3R00A 3II5A 3HP5A 5HE2A 3UQCA 4XCUA 4FV1A 4GW8A 4ERWA 3FEGA 2GS7A 3R8VA 4YJVA 4CFXA 4FEXA 4C62A 5L2WA 5AX3A 4ALWA 3NWWA 2YJRA 4KRCA 3LLTA 1YWNA 5CAPA 2W17A 3BU3A 4QP4A 4PDYA 5LWNA 3ANQA 1E1XA 1QMZA 4C59A 3CY3A 2EVAA 1JSTA 3QCXA 4FEVA 3HUCA 3OTVA 1OL6A 4UWBA 1CTPE 3LPBA 3ZM9A 3IGGA 5J1VA 4IAAA 4HVSA 3ODYX 5L6WL 3FI4A 2I1MA 4OTFA 3PJ1A 2HW6A 4KRDA 3NYVA 2JIVA 2XA4A 4RLLA 5AUZA 3QD4A 2R3NA 4FTCA 3OFMA 4JQ8A 3LVPA 4USDA 3UYTA 3CSVA 1M52A 3CGOA 4CLJA 2YM3A 1YWVA 5HLWA 1KV2A 4YHTA 3EL8A 4X3FB 3O0GA 1OMWA 5TO8A 3ORNA 3VC4A 2UZUE 1U54B 5GJDA 2XP2A 4NCTA 3GCVA 3AT3A 4XH6A 3I1AA 3IKAA 3LFBA 4FV3A 5DHJA 4I5MA 4MXAA 3FXXA 4TNDA 2ZVAA 5AUYA 4W4VA 4X2FA 1ZMWA 4PWNA 3VF9A 3DLSA 4PPBA 4V0GA 3TNPC 4FSWA 2IW8A 2A2AA 2ACXA 2WHBA 4TXCA 4XJ0A 4F0FA 2DWBA 3NZ0A 4F7NA 2IG7A 4G3CA 2YDJA 5M51A 4AZVA 1Q8TA 3LXPA 2WO6A 3IECA 3AC1A 4FKWA 4YZBA 4ZMEA 3WE4A 5DNRA 2J0JA 3O96A 5EYMA 3FC2A 5L2IA 3NNWA 4YJNA 1IAHA 3RWQA 2VX1A 2BMCA 3EZVA 4L43A 3W1FA 5AV4A 3K54A 3F3TA 5TE0A 4U3YA 4AW2A 2XJ0A 1M2QA 4GEOA 4JNWA 4UXQA 3VIDA 3UMXA 2UZVA 4QMUA 3DNDA 2XJ1A 5H8EA 5FLFA 1I44A 2ZM3A 3VBTA 4X2GA 3T3UA 2R3KA 5AM7A 1JAMA 4OW8A 2GU8A 4NJ3A 1U59A 2V7OA 3I4BA 3MPMA 5CT0A 5EYKA 1WAKA 3NR9A 2WTKB 1NT2A 4E1ZA 4S32A 3ZFYA 3TV6A 3U6JA 3OY1A 2XNBA 3CXWA 2X7FA 3P7AA 3IG7A 2ITUA 3ORIA 5AV0A 3EFKA 3GQLA 4MXCA 3QQUA 5HNIX 1H25A 3AD4A 3E3PA 3Q4TA 4U6RA 4XOYA 3R9HA 3KREA 4JBOA 4ZTMA 4PL3A 4IDTA 4MQ1A 3U51A 4FOBA 4EEVA 3UIXA 4PTEA 3UNKA 3PSCA 5K5XA 5K9IA 3U9CA 1Q62A 2OF4A 1KUTA 4NU1A 4O22A 3R04A 2EXCX 4UMPA 1I09A 4I3ZA 2ZV8A 4RFMA 4ASDA 2V7AA 5C03A 4BL1A 4RJ4A 3V01A 3NYNA 3C7QA 3UOHA 3SV0A 5TF9A 3ZEWA 4FSRA 3P78A 2OK1A 2GNIA 5AUTA 3FZTA 4S31A 4DEBA 1YKRA 3PA3A 3C0GA 4X2NA 3QTUA 3SG9A 2C5VA 3DBQA 4I92A 4QTBA 4GVAA 2VTJA 3TCPA 1VJYA 3RPSA 1YI3A 2VGPA 4A9UA 3LE6A 4EH3A 2O2UA 2XK8A 4RIWB 1WBPA 4PPAA 4O0VA 3AC5A 2UZTA 2HY0A 4CFVA 4ALVA 2PVLA 3RPVA 3I79A 5M4IA 3ZUUA 4FKTA 4GJ2A 4I0RA 4YO4A 3ALNA 4CYJA 3JUHA 3MN3A 4G9RA 4GSBA 4EOQA 5JFSA 3FZ1A 2JD5A 2E9PA 3WZDA 3Q2MA 5AR4A 3ZUVA 4LYNA 2QG5A 3MWUA 4G31A 3MTLA 4AT3A 4RX8A 4I5HA 4UN0C 5HO7A 1STCE 1OKWA 4DITA 4JAIA 5IUGA 3TKUA 5DPVA 4Z16A 4UYAA 4RC2A 4XOZA 4B6LA 5AV3A 2WIPA 1OUKA 2PZYA 2WQNA 2DS1A 3D0EA 3MB7A 2WTKC 3HYHA 4O0WA 2GQRA 4CV8A 2XM8A 5BNJA 3EQCA 1UNHA 3C4XA 1RE8A 1O6KA 5CU6A 5DRDA 1G8AA 4C33A 4DYMA 2DQ7X 3GCSA 4JQEA 1GAGA 3EQPA 2YWPA 1IASA 1KE9A 2PULA 4O83A 4GU6A 4DFBA 2YCFA 2VWIA 3HV6A 3LFAA 4CMTA 5FEEA 3L8SA 5CSHA 5HTBA 2ITQA 4DFXE 1FPUA 2XNPA 3EH9A 3TZ7A 4IH8A 3D9VA 3OTUA 4L3PA 3LFEA 3OWJA 4ZLOA 2XEYA 4OBPA 4E26A 3ZYAA 4OTPA 4ASZA 4D4RA 5CU0A 4HYIA 5FRIA 5KMMA 2WMVA 3GT8A 4S33A 3FLNC 4BIEA 2B9HA 4FZAB 4AA4A 4I6HA 3EKNA 4OR5A 2ZM4A 5DVRA 3E64A 3E92A 1GOLA 3KB7A 4WNPA 4EQUA 3QQLA 3AMYA 2EXMA 3QC9A 5I9YA 5KUPA 3KN6A 4N70A 3RCJA 1BL7A 4R7HA 5EI6A 3UIUA 3DDPA 1JLUE 4H58A 2BAKA 3W2SA 4FIHA 5AP3A 4ZLYA 4AZFA 4BIDA 1BX6A 5E9EA 4HZSA 4FKPA 5EI8A 5TKDA 4AWIA 3HMOA 1XO2B 3NSZA 1ZMUA 2O64A 3KRWA 3TNHA 5BUIA 1H1RA 3R9NA 5A4EA 3BHYA 5A54A 4KNBA 2WTCA 1CSNA 5HI2A 4DAWA 4EHEA 4QQJA 3V8TA 1HCLA 4JOAA 4WBBB 4YLJA 5EOLA 4HOKA 5HE0A 4U41A 4DH7A 5LVPA 2R3HA 3PLSA 3PZEA 3VS5A 5FXQA 5AMNA 2VWVA 5AP7A 2PVNA 2GNJA 2VTSA 4RWIA 4BCHA 4K8AA 4FIIA 1WZYA 2VD5A 2UW5A 4FT5A 4Y73A 5ANGA 3LJ0A 5LXMA 5CENA 1UU7A 2C1BA 2X8EA 3G6GA 3HMIA 3R22A 4LOPA 4NEUA 4XBRA 3R83A 4KA3A 4C4EA 4U3ZA 5L4QA 4YPDA 4FZ6A 3Q9XA 2WZJA 3I7CA 4RFZA 3N4VA 3P86A 5FDXA 4ZK5A 5E92A 3U54A 4DFNA 3KK8A 3MH1A 5D9HA 3WF6A 2X9FA 3EFWA 2JLDA 2IZRA 3IO7A 4R3RA 3V5JA 4NZWB 2V62A 4TW9A 3W8QA 1OGUA 5KZIA 2YM4A 4L3JA 2BZHB 3LJ1A 5EDQA 4AACA 5AFVA 5C4LA 1YHVA 4WUAA 2GQGA 2RL5A 3A7HA 3IW7A 4FL2A 4WIHA 4JAJA 4MKCA 3C1XA 5C8NA 5BQ0A 4FTUA 5KKRC 1OL5A 4PTGA 5AUXA 4BBMA 2IJMA 2QHMA 3BCEA 2E9VA 4CVAA 4WRSA 3F3UA 4XEYA 4XX9A 5BVDA 2CNUA 5ETFA 2BRMA 4ACMA 4CEGA 5DMZA 1JPAA 1DI8A 4AW0A 3OG7A 4O1OA 4O7WA 2VAGA 5FQDC 5GZ8A 2W96B 1Z57A 2H34A 4CG9A 4AA5A 4RJ8A 1IRKA 3ACKA 4M67A 4TN6A 4S30A 4DT9A 3LFDA 4M68A 4CYIA 5ICPA 2ITWA 3RI1A 4IACA 3SXSA 4E8AA 5I3RA 1BUHA 2XYUA 3Q96A 2XNOA 4EUUA 1NXKA 3W18A 2YM7A 1E1VA 5EDPA 4IDVA 3VS1A 3KA0A 1H1WA 1U46A 3FI3A 2BZIB 1YI4A 3FL4A 4HZRA 2PMOX 2QOCA 4XBUA 2WMSA 4Z9LA 4TYJA 2XCKA 3O17A 2GNLA 3U9NA 3PIZA 4ZTLA 5LVOA 4E5AX 3O51A 3G5DA 3I5NA 4GIHA 2JAMA 2F2CB 2YA9A 3DBDA 4I21A 4FV8A 4PF4A 4D5KA 5H3QA 5KMKA 2WELA 1YVJA 5H8BA 4GFGA 3ZCLA 4B8LA 2WU6A 4AGUA 1GY3A 3MA3A 3R28A 2OIBA 4FKOA 2XNEA 2DYLA 4A4XA 3TM0A 4YUQA 4E6QA 1OITA 2I6LA 5A4QA 5IA1A 2BHEA 4EJ7A 3D94A 3SXRA 4H05A 3DB8A 2FSLX 3BV3A 4F0GA 4PMMA 2W4JA 4ZSLA 1ATPE 4L52A 1GZOA 2HY81 3EOCA 4QYHA 3QKLA 3COKA 4RX9A 5GNKA 3UPXA 3W10A 2YDIA 2ITTA 3QWKA 4HYSA 4ITJA 5L6PA 4DEIA 3MVLA 1APME 2UZDA 4LGDA 4O0RA 3VBQA 5K4IA 4FZDB 3OEFX 5M53A 4C4JA 2XNGA 3PY0A 4L00A 5AP5A 3DKGA 4JDJA 4BDGA 2C0IA 3S2PA 1PXIA 3BRBA 4YTFA 4YZCA 4ANSA 3VUTA 3OOMA 4O2ZA 2R64A 3G33A 4BICA 1LEWA 3OT8A 5JZNA 4JR7A 4XP3A 5CEQA 3CLYA 4IAZA 2OBJA 4PMTA 3UGCA 3UC3A 1BYGA 4CNHA 1FMOE 2R9SA 4KIOA 3KXNA 4FL1A 3NUAA 4J8NA 2JBOA 3FMMA 1OM1A 3FPMA 4GFOA 4X2JA 5FP5A 5CQWA 4FI1A 5CX9A 4EOJA 5EW3A 3NEWA 3IK3A 2VV9A 3ORKA 2R2PA 5J95A 3TDWA 3ENHA 4QMMA 2R7BA 2R3JA 5EDRA 4RJ7A 3FE3A 4C58A 3KY2A 4IM2A 5AP6A 3TV4A 2BCJA 2OW3A 4Z3VA 2QC6A 5AUWA 1Y57A 2OZAB 3WF7A 4Z55A 2C6EA 2W5BA 2C0TA 3FUPA 4L44A 2RFNA 5IEVA 5IH4A 2Y4IB 4UALA 4UWCA 3ZO2A 2HENA 2IZUA 1OUYA 3PVWA 4AZEA 3KMUA 4D4YA 4KBKA 2C3LA 2G01A 3FZOA 4XG2A 4HYHA 3OT3A 4QMLA 3W8LA 5CYIA 3R9OA 4YBJA 4FTAA 4M97A 4KKEA 2REIA 5EW9A 5LMAA 4O0SA 4FSTA 4ENXA 3UP7A 2B53A 3L9LA 3E8NA 3R2YA 3W55A 5IMEA 2Y6OA 4E3CA 3IW8A 1YXUA 3C0HA 3LCSA 4NUSA 4BWPA 3O7LB 2UZLA 2QHNA 1OIRA 3ITZA 2ONLA 4XYFA 3P1AA 4YR8A 4L8MA 4U7ZA 4BHZA 2XVDA 3A2CA 4AA0A 2C4GA 2C0OA 5DI1A 3VUKA 3THBA 1ZZ2A 3DDQA 2G2HA 1YRPA 4WHZA 4X3JA 4EYMA 5BVNA 4L6QA 3V51A 4QP9A 5C27A 3WE8A 2ESMA 4YJOA 4YZ9A 4IX3A 3A4OX 3DKOA 1GIIA 3QKKA 3IPHA 4IAIA 3TKIA 1BKXA 4M12A 3ZLYA 4R8QA 1JBPE 4EK6A 3HV4A 3JS2A 5M4CA 3BE2A 3OF0A 4EHGA 4M0YA 2BUJA 2C6MA 5FTQA 3IONA 4Q2AA 1PXMA 4II5A 4ZZNA 4IWDA 4A9YA 3BHTA 3UIMA 4BWXA 5HNGA 4DC2A 4CFNA 3AOXA 4RX7A 3RP9A 1YOLA 3C50A 3NNVA 4FGRA 4FKUA 4BDIA 3AC4A 5AX9A 2RFEA 3ACJA 3HA8A 3BU5A 2VWYA 2XMYA 3QL8A 3CE3A 4QQ5A 2JKOA 5L6OA 3GBZA 3F82A 5E91A 2IW9A 3DJ6A 4OUCA 5DEWA 1IAJA 5ANJA 2O5KA 3VJNA 3L8PA 5HKMA 2JDVA 2XJ2A 4NH1A 1FVRA 5KHWA 2A27A 3LCOA 4EZ3A 1MQ4A 3PSBA 2C6KA 5DFPA 3KF7A 4BTKA 1IA9A 4I0TA 4H1MA 4RRVA 1UV5A 4GUEA 3BI6A 2IN6A 1Q61A 2QCSA 3NDMA 1W8CA 4ITIA 4JR3A 4E7WA 3PUPA 3LFSA 4FEQA 3POZA 2GFSA 2VTOA 3P23A 2ZOQA 3FZPA 3QKMA 1CKJA 1XKKA 1ZOEA 2VZ6A 2LAVA 4LGGA 4BYIA 4OTGA 2HWPA 3PIYA 4F08A 3PFQA 4MVFA 2ZV7A 4I41A 5A6OA 1SMHA 3HLLA 3KXXA 3MYGA 5C01A 3LFNA 4HVHA 3LHJA 1P4FA 3AD5A 3BIZA 4M84A 3ZMMA 5L8JA 3A7FA 3U8WA 3NAXA 3AGMA 4XG9A 2PYWA 3I6UA 3QC4A 3UODA 4EQCA 3EN7A 4F6SA 4H1JA 5G6VA 5D41A 3UVQA 4B0GA 3DXQA 4AOJA 4ORKA 2QLQA 1H0VA 5AR7A 5FTOA 4CD0A 4MAOA 3WARA 5DGZA 4FEUA 4PNKA 3ORTA 2R0UA 4EOKA 2YCRA 2BFYA 3BLQA 1YXVA 3IDCA 4FNZA 4MYGA 1K9AA 3VS3A 4EH9A 2KULA 4UMRA 3T9IA 4XV2A 4YZNA 1QL6A 2QI8A 3UNJA 4D58A 1P2AA 2R5TA 4O84A 4JT3A 4XG4A 5FBOA 4DFLA 4RJ6A 3LJ2A 1YHWA 3MPTA 4PMPA 1SM2A 3VJOA 2WOTA 4MXXA 4CT2A 3QQHA 4Y72A 2PHKA 3Q6UA 4XUFA 3GGFA 4FTKA 4LUDA 3TTJA 3TXOA 2QLUA 5LCJA 3PE2A 5LWMA 3AGLA 5DT3A 4E4NA 2OI4X 2R3RA 1Y8YA 3V5QA 4IX5A 4QO9A 4NWMA 1ZYCA 4OT5A 5EKOA 5ACBC 2C30A 4ZSGA 5BYZA 5A9UA 3JVRA 5TR6A 4FG9A 2ZV2A 4BGHA 4FC0A 3R7VA 2W99B 4MHAA 2XRWA 4KWPA 5CEIA 3ULZA 2WXVA 2O63A 2IPXA 2GS2A 2G2FA 5CNOA 5EK7A 4DG2E 4AQCA 2W9ZB 4RIYA 3B8QA 5HICA 3QTRA 4KSPA 3L9NA 3R8PA 4RWJA 3BWJA 3CQUA 2JGZA 4R3CA 5AP4A 1ZYJA 2C6LA 4KS8A 4J7BA 4YGAA 3EQFA 2W1CA 5ANIA 1UU8A 2YACA 3KQ7A 4H39A 3GEQA 1VEBA 5M08A 4PX6A 4A06A 1YDRE 3PP1A 2Y0AA 4QMZA 3KRLA 3TTIA 3PY3A 3CTQA 4EK8A 2Y4PA 3E93A 3QLFA 2I0HA 3DY7A 3Q4UA 5CF4A 3MVJA 3JY9A 3NGAA 4TWPA 2X8DA 4YJPA 5AEPA 1S9JA 2W0JA 4JDHA 5DBXA 4EWQA 2OG8A 5CXHA 5IA5A 4JG7A 2YWVA 4G17A 3BX5A 2QOIA 4L9IA 2BKKA 2AUHA 4FV6A 1ZOGA 2QOBA 4ZJIA 4UMTA 3MY5A 2QOFA 4DCEA 3DPKA 2JITA 4FTRA 2PMIA 2YABA 3DOGA 3PRIA 3RALA 3D5XA 5C1QB 3VBVA 5J1WA 2W5HA 4TKSA 2F4JA 5I4NA 3GU5A 3BYMA 4CFWA 5GINE 3V6SA 1TKIA 4FT0A 5AADA 3LW0A 3TWJA 4YC3A 3DK7A 2UW8A 5CWZA 4LOQA 1LP4A 4ZTSA 1ZMVA 3UQGA 5CAVA 2YN8A 4TYHB 3DB6A 4ZLZA 4D9UA 2BRNA 1OBDA 2GTNA 5GHVA 3FLQA 4Z7HA 3F61A 3G6HA 2XB7A 4D1ZA 4R77A 3ZBFA 4EK4A 4U44A 5HESA 3WI6A 1L3RE 1SNUA 1PRYA 3LM0A 3QRUA 3F9NA 3QRJA 4U5JA 2JDTA 4YO6A 4ACGA 5J9ZA 4BI2A 2VTAA 3QXPA 4L42A 3F5UA 3EQHA 3ID6C 1H01A 3LZBA 5IUIA 3ZO3A 2BAJA 3REPA 4F7JA 3EL7A 3W2RA 3NRMA 4H3BA 1XH9A 1OPLA 3QTZA 4XP2A 2FSOX 2UW9A 4Y5QA 3RINA 1ND4A 5EHLA 3HUBA 4G16A 4WNOA 5EYDA 1U5RA 4M13A 1M7QA 4R5YA 2W4KA 4I93A 3PPKA 5CU4A 3GCQA 3OP5A 3PXKA 2ZB1A 2ITZA 1Q8WA 4IB3A 3RK9A 2QOQA 3QLGA 4LRKA 1BLXA 2WEIA 2VTPA 3BGPA 3KF4A 3R1SA 3ZHPC 3ZUTA 1S9IA 2NO3A 5F20A 4HPTE 3ZRLA 4QTDA 2EB3A 5HIBA 1RW8A 3NW5A 5GIPE 3L8VA 4FL3A 2C3IB 4O96A 4Z7GA 5HCYA 2IWIA 4D55A 3QZHA 4C4IA 5DIAA 2R3FA 2C5OA 5J87A 5CEPA 4M3QA 4ZY4A 2H8HA 4BKJA 3F5GA 4LUEA 2WMAA 4BTJA 3FMJA 4K0YA 4QYFA 3KU2A 3AXWA 3OWPA 4EQMA 2BHHA 4S34A 4CCBA 4IADA 3NUSA 2HYYA 2Y7JA 5IQFA 3LM5A 3QU0A 3DZOA 5HIEA 1G5SA 3Q04A 2PL0A 4RMZA 4QRCA 4V05A 5FEDA 3R8UA 1J7LA 4JRNA 3WZEA 2X8IA 3LCTA 5F9EA 3NUNA 3OXTA 4Q5EA 2HK5A 5DLSA 4RVLA 3C4EA 2XK4A 1PKDA 3OHTA 1Q8YA 4K33A 4I23A 4D2RA 5KMOA 4AZWA 4WG3A 4BGQA 3UOLA 3MFRA 5IQBA 4DGMA 5J8IA 3H0YA 5A3XA 4HGTA 3G15A 4FYNA 2X2MA 1ZY4A 5ETCA 4LMNA 3I81A 3V5WA 3CD8A 3C4ZA 2VNYA 1B39A 3P08A 3R6XA 1PYXA 5CY3A 4KIPA 2EB2A 2IW6A 5I9VA 3BKBA 1MRYA 2GHGA 3H9OA 3Q9ZA 4QYYA 5A6NA 3H0ZA 4EOPA 5IUHA 2UZEA 4EBVA 4FICA 1OL1A 5H8GA 2OXDA 4DEAA 2VWZA 1T45A 2CCHA 3G0FA 4BDBA 3DBEA 5BYYA 3A61A 3D5WA 4LGHA 2B4SB 4FTMA 4X6RA 5FD2A 4FVPA 5HCZA 2WD1A 3SQQA 2BIYA 3ZC5A 4MH7A 4JBQA 5EH0A 4PNIA 4ZOGA 1PKGA 3VUIA 3SC1A 4L45A 3R02A 4WKQA 3VUGA 2RIOA 3Q2JA 3LCDA 4WA9A 2WEVA 1JKLA 4UB7A 5EG3A 2SRCA 5IQGA 1FGIA 5C8MA 4C37A 4HJOA 2UV2A 4WUNA 2GQSA 3S3IA 3ZSGA 5F4NA 2YAAA 4O27B 2WQMA 1PJKA 2X39A 3OCSA 3EJ1A 3ORZA 2XIKA 4ZTRA 4B9DA 4USFA 4ACDA 3DXNA 4FT7A 4FYOA 2F49A 4DHFA 2X7OA 3Q60A 3FZRA 3HDMA 2PUIA 3C5UA 5GIOE 2Z7LA 4G6LA 3BGZA 4G5JA 5E7RA 5IG1A 4O7YA 3FAAA 4BCFA 3ZSHA 3VUDA 5TT7A 1MQBA 2H9VA 2VTMA 4C2VA 5IMXA 3F66A 3CPBA 1XH7A 3MFTA 4TYGA 5GJGA 4RZWA 3GVUA 3KXZA 4AXAA 4BCPA 4ENYA 5CT7A 4FVRA 1NVQA 4E20A 5HGIA 1CDKA 1XR1A 5JFVA 5IQEA 1LUFA 5ITAA 4FSUA 4J97A 2C5XA 2WMUA 3VHEA 1Y6BA 3MB6A 1E9HA 1W98A 3EKKA 4J95A 3RHXA 2J51A 4PDPA 4U42A 4F65A 4ZJVA 2QODA 2XNMA 2W1IA 4QP6A 3LXLA 4NKAA 3ROCA 1GNGA 4G6NA 3IW5A 4E5WA 3FLWA 4IWOA 3PJ8A 2IVUA 3IW6A 2RFDA 5IH6A 4IQ6A 3NAYA 4FSMA 4BZNA 3GOPA 3M11A 3QF9A 4YTIA 3AD6A 2B9IA 2WMBA 4FKIA 4AAAA 2IO6A 3G51A 3SVVA 4AT5A 3CTHA 4BCMA 5CANA 5KMIA 2WMXA 1IR3A 3SD0A 5ANEA 3RVGA 2QOKA 4MXOA 4TT7A 5M4UA 2BIKB 3BV2A 4HVGA 4QD6A 5E8WA 3BQRA 4BTMA 4YSMA 1XH5A 4EJNA 1R0PA 2CGXA 3V04A 4CTCA 2CNVA 2EU9A 2VWWA 3R8ZA 1IEPA 3HL7A 3PRFA 5LVMA 3EFLA 2YFXA 2ZMCA 4O0UA 2YZAA 3A7GA 4QP8A 5LMKC 3PP0A 4GKIA 4F6UA 2PE2A 2C3KA 4DTBA 4C4GA 2EUFB 2X9EA 3MVMA 4FTQA 3PJ3A 4M66A 4NTSA 4BDHA 1RQQA 3H30A 4N57A 2F9GA 4FG7A 4F9AA 2ETMA 4LV5A 4XNEA 5BVFA 1NA7A 4QP1A 5KKRB 3OXZA 3F6XA 3UBDA 3VAPA 5ANOA 4JDKA 4BDJA 2WMRA 2OJGA 4JDIA 1UNLA 3KULB 3HDNA 2BPMA 3RZBA 3MA6A 3N51A 3VW6A 4FKQA 1SVEA 3RTPA 2W9FB 3QA8A 3RK7A 3E3BX 3FPQA 3R2BA 4GT3A 3UVRA 2YIRA 1A48A 4A07A 4NJDA 3MFSA 4NM3A 4PMSA 4A7CA 4L3LA 4YJUA 4C2WA 4IVDA 4HVIA 1SNXA 5IA3A 4EUTA 1Q8UA 4B7TA 4BCKA 4GU9A 4WSYA 1OPKA 1QPCA 3A4PA 2F57A 2PVYA 4KAOA 4GH2A 3HA6A 1QPEA 2WTDA 4JXFA 5FWKK 3O8UA 3TKHA 4ALUA 1W7HA 2OLCA 2R7IA 3EIDA 3H9FA 3U4UA 4OT6A 3NCGA 3NUUA 3HKOA 3DKFA 1H24A 4NW6A 3SOCA 3C4FA 2JDRA 3WYXA 4D9TA 1H1PA 5LVNA 3D4QA 4FKSA 4TY1A 2BKZA 5CVFA 5DG5A 2PK9A 4RJ5A 3W2PA 1H28A 5JZJA 4BDKA 2W05A 3FHIA 3F69A 4P5ZA 3HVCA 4RFYA 3ELJA 3QZFA 4ZS0A 1CKIA 4RIXB 2JKKA 1PXOA 3BYSA 4YP8A 5L2TA 3T9TA 1M2PA 2QOOA 3ZONA 1X8BA 1XH6A 5CI7A 3SRVA 3D83A 3Q4CA 1JWHA 5F95A 4I94A 3ATTA 1RDQE 2OH0E 1KWPA 2HZ0A 1P4OA 2XK9A 1OB3A 3DV3A 2HIWA 3ZXZA 5AA9A 3BYVA 2NRUA 2X4FA 2PMLX 4IE9A 3BBWA 4GYIA 4MWHA 1R78A 4AU8A 4BZOA 5E8XA 5FM3A 4FV9A 3KXGA 4FV5A 2ZDUA 4O21A 5CSPA 3RWPA 3UZTA 3E8CA 1M2RA 2HW7A 4Q5HA 2FH9A 4W8DA 2PE0A 2JIUA 4FIJA 3WIGA 5M56A 4IC7A 1Q97A 3D7TA 3ORLA 3PSDA 2VNWA 4LM5A 4EOSA 4O86A 3QTQA 3QQFA 1CKPA 4GG5A 1LEZA 4BZDA 2PZ5A 2QU5A 3DT1A 4O6LA 3ZTXA 4XG7A 5FDPA 3QFVA 3EMGA 3ZS5A 3NNXA 3QGYA 5FEQA 3FMNA 3C5IA 4XG8A 3UOKA 4QNAA 5CXZA 2ZV9A 3E88A 3A7IA 3M42A 1WMKA 5CALA 3LMIA 2CN8A 3MTFA 1KE5A 2CGVA 2QKWB 2Z7QA 4ANOA 4GRBA 4ANBA 1JKTA 2RGPA 3G9NA 3UVPA 2OFUA 2WFYA 5IA0A 3NIEA 1A9UA 3RHKA 3WF8A 2C3JA 3GU8A 1XBCA 2PZPA 4P7EA 2QU6A 3O7LD 3QQJA 1M7NA 1OKYA 3CCNA 4FKGA 3PE1A 4GCJA 4BRXA 1KOAA 3DJ7A 5IH5A 3R21A 3SA0A 2PWLA 3TI1A 3EWHA 3CR0A 4FT3A 1XH8A 4IB5A 4IIRA 2QO7A 3NW6A 3O50A 4BI0A 1OI9A 2JKMA 4EC9A 3HRCA 5DN3A 4WRGA 3FMEA 3OVVA 3RAKA 4U43A 2WMTA 5J9LA 4CG8A 1GZ8A 5BVKA 2J2IB 3PPJA 3HX4A 4XS2A 4G1WA 4MXZA 2JC6A 4GMYA 4IJPA 4RC4A 4XP0A 3OXIA 5IPJA 1PMEA 4FNWA 4LQMA 1Q8ZA 4QPAA 2YERA 4FV2A 3UMWA 5B2MA 2I40A 1FGKA 1SYKA 4KBAA 3C51A 1ERKA 4RPVA 4XG3A 3ODZX 4DH5A 1UWJA 3UYSA 3N9XA 2IVVA 5ACKA 5KHXA 5B0XA 2XF0A 4QPMA 2C5NA 1Q24A 4NIFA 5DA3A 3LQ8A 4EOLA 2R3MA 3JPVA 4C57A 4GK3A 4JBPA 5KNJA 2XKDA 3PJCA 1J7UA 3ET7A 4AOIA 5HX8A 3AG9A 3DBFA 4MK0A 3NYXA 4Q9ZA 5IDNA 3QUDA 2C6TA 2WQEA 4I4EA 1YOMA 4AE6A 5KBRA 3VRYA 4JRVA 4YPSA 2G15A 3RGFA 3UO4A 2PE1A 2Q0NA 3KVXA 3OY3A 4ZXTA 1WVYA 4OTHA 1YDTE
chains in the Genus database with same CATH superfamily
3RM6A 1GZKA 3PXFA 3LIJA 3FI2A 3MS9A 3R30A 1ZY5A 4ZJJA 1VYZA 3LOKA 4BB4A 5IQCA 1TQIA 5IDPA 3QUEA 4UZHA 1Y6AA 3ZSIA 4NCTC 2ZAZA 4FTOA 1AQ1A 3FBVA 4JG8A 3S1HA 4N4SA 5CLPA 3MH3A 3R7GA 3NLBA 2WPAA 3VS6A 4ZZMA 3LMHA 2B9JA 4ACCA 4BR3A 4QMWA 3R7IA 2WU7A 3PWDA 4IZ5A 3VBWA 2I0YA 1J91A 4LL0A 3DFAA 2J0MB 2Z2WA 4D2TA 2VU3A 3V5LA 3EFJA 5AIRA 3COMA 3OUKA 4BIBA 3BHVA 3E7VA 4AF3A 1PF8A 3A8XA 3K5VA 1KE6A 4QTCA 4DH1A 4FNYA 3U6HA 4D2WA 4P5QA 3Q5ZA 2JIIA 3ZO1A 1H00A 5E8UA 4C38A 3QTWA 4OTQA 4QMYA 3MIAA 3TL8A 2CDZA 2XAOA 3SKCA 3TYKA 4DCAA 2OF2A 5A4TA 3W32A 3WZJA 5D1JA 4NK9A 1JSUA 5CF5A 4UX9A 2A1AB 4O7TA 3R7UA 4FG8A 4AQKA 4O7VA 1OBGA 4KABA 5AJQA 3QCQA 5E8TA 5KZ0A 5CSVA 4D0WA 2PTKA 4QMNA 1DM2A 3GQIA 5A4CA 2YCSA 4IBMA 3HECA 4YJRA 2XIZA 4DFZE 3CKXA 3I0QA 4QMOA 3SOAA 4FV7A 4DHJA 2WIHA 2GS6A 3HEGA 5CZIA 2QVSE 5BVOA 3TNWA 5HQ0A 4QP2A 3DAKA 5E1SA 4WOVA 2JDOA 4JVGA 4XV3A 4UYNA 4EH8A 4QYEA 3DBCA 3CP9A 4BYJA 3HMPA 2CKOA 4IC8A 4G34A 2GHMA 2XBAA 3PXQA 3RCDA 3VF8A 3VS7A 3IQ7A 5LARA 1Y91A 5D11A 4RIOA 3U87A 4U8ZA 3QRKA 2QD9A 4GIIA 5LMBA 4EHZA 3C0IA 2AC3A 4U97A 3VULA 3JVSA 4FVQA 2QQ7A 5J5SA 5DR2A 1WBWA 4UY9A 3IS5A 4OBQA 3TZMA 4IAYA 3ETAA 4FTTA 3VS0A 4EC8A 3EHAA 4BDDA 4DGNA 5CAQA 2B54A 1YXSA 3GU4A 3NPCA 1URCA 1V1KA 5HD7A 5CU2A 3BYUA 2H96A 2QURA 1EH4A 3G2FA 3KXHA 2BALA 5I3OA 3NYOA 3FLYA 3E8EA 5JSMA 5J5TA 2UVYA 4X3FA 5FUTA 2OJJA 4KSQA 1FQ1B 3VWAA 1U54A 3VN9A 3AT2A 4MX9A 5CQUA 5DE2A 1J7IA 3KMMA 5DYJA 3I7BA 2P55A 5HLPA 3W2CA 4RT7A 3VRZA 4BDAA 4RVMA 4EK3A 4R5SA 4LL5A 3UPZA 1KE8A 2BTSA 3ORPA 2XANA 4EL9A 4Y95A 4FKJA 3I0OA 1G8SA 2KTYA 5K3YA 2YIWA 4IFCA 2X7GA 4C02A 3H9RA 3L9PA 3RKBA 3T8OA 5HTIA 4O4FA 1H08A 3SDJA 4M8TA 4X7QA 4IZ7A 3TUCA 1V0PA 4HYUA 2Z02A 4W8EA 3HAMA 3PLAE 4C4FA 5CEOA 2HZNA 3CY2A 4FRFA 4RWLA 3QCSA 2C6OA 5JGAA 5ETIA 3NFGB 5E1EA 4DFYA 5IQHA 2BRHA 4ZY6A 3PXZA 3BELA 2XARA 4ZP5A 2Z8CA 2E9OA 2WMQA 4WT6A 2P3GX 3R7YA 2XKCA 2VWXA 5CTPA 2VX0A 4O2PA 4KS7A 3W2OA 4ACHA 2J6MA 4IW0A 2PZRA 2W1GA 2Q83A 5FXSA 1URWA 3EN4A 1R1WA 3VNTA 4BJJB 1ZARA 1U5QA 4L46A 5DEYA 5DT0A 3AMAA 3NX8A 4EBWA 3OW4A 3PA4A 2A0CX 3AMBA 3Q6WA 4U79A 3FSFA 4EH5A 5JH6A 1ZYLA 2OFVA 4CRLA 2VTQA 3K3IA 3Q32A 4DLIA 1B6CB 5CU3A 2BZJA 2ZDTA 3KK9A 4W4YA 5EFQA 4L53A 4D2SA 2LGCA 3E62A 3HV7A 3IGOA 5BUJA 4D1XA 4IEBA 5DH3A 2HZIA 3CD3A 4UZDA 5IQDA 4AW1A 4QYGA 4G5PA 1ZAOA 4AX8A 2PVHA 3OW3A 1BMKA 4XLIA 3U55A 1MP8A 1V0OA 2NRYA 3F5PA 3FKOA 3L8XA 5DOSA 4UMUA 2CMWA 4QTAA 3DK3A 5B2KA 2OZOA 4WO5A 3IW4A 4BDFA 3TEIA 4MD9E 3QYWA 4BDEA 2JFLA 1H1QA 4FIEA 1K2PA 4V01A 4FTNA 4RIWA 2AC5A 4W9XA 1GZNA 3PYYA 4HGEA 4UXLA 5TOZA 4ZS4A 1F5QA 3BLRA 3DU8A 2XIRA 4XRLA 1WBTA 2CGUA 5D12A 3JY0A 1H07A 1YHSA 3GC9A 2CLQA 5K0XA 1FVVA 5CEMA 2IF8A 1K3AA 2CPKE 3BEAA 2OJIA 3H10A 3MSSA 1ZOHA 4FKLA 4NM7A 3C9WA 4BI1A 4PL4A 3BEGA 3GFEA 1TQPA 3AT4A 3F2NA 1OECA 3QWJA 2ERKA 4DGOA 3FXWA 5J7BA 3NMUF 2GHLA 5EYCA 3LQ5A 4O1PA 1Q5KA 3WF5A 4QMVA 3BU6A 2G9XA 2X0QA 1JOWB 2YIYA 3UE4A 1REJA 2W1FA 3EQBA 3S00A 3PA5A 3V8WA 4AN9A 5CVGA 5ANDA 2XEZA 3FMKA 2VGOA 4FMQA 3RNYA 2J50A 3MIYA 3MPAA 4MNEB 3OBJA 4ANMA 4BCNA 4C3RA 3GP0A 4J98A 4NTTA 3RPOA 2E9NA 2YEXA 3PVBA 4PP7A 2ITYA 2RSVA 1REKA 1KV1A 4IFGA 4BFMA 3HP2A 3ANRA 5KX8A 4C0TA 4IB1A 2X1NA 2F2UA 4CKJA 4AGCA 1W84A 4FX3A 1UVRA 4DTAA 4FUXA 2W1ZA 3BZ3A 3OC1A 5J79A 3OROA 4CQGA 4FUYA 3PVUA 4TWNA 2HOGA 1XQZA 3G0EA 2CNQA 1H0WA 4AXEA 5D7VA 3MY1A 4IAFA 4D1SA 4EKLA 4ZSAA 5GZ9A 2ITNA 4BBEA 4OGRA 4BN1A 1ZYDA 3ZLSA 2XCHA 4FSZA 1UWHA 5M09A 3P0MA 4DEGA 4HCUA 2O65A 1YXXA 4WG5A 2BZKB 3W2QA 2OICA 4S2ZA 2VO7A 2J7TA 2ITPA 3TUBA 3KRRA 4O7ZA 2EWAA 2PPQA 5JK3A 5HG9A 4PY1A 2BFXA 3FMDA 3ROYA 5IA4A 1O6YA 1UU9A 2BILB 2P4IA 3R73A 2C47A 2V22A 2VTIA 3NW7A 3QA0A 4MQ2A 3K5UA 2VTRA 3TZ9A 5M57A 4RJ3A 4FSYA 4RVKA 5E8VA 4EHVA 3R0TA 4QMTA 4EH2A 3QXOA 1O6LA 1PXLA 3M1SA 5EQEA 3P7BA 1GIHA 4LV8A 5FBNC 5LQFA 3UNZA 3OWKA 4FV0A 3D15A 5EI2A 2YISA 3KC3A 3G90X 2PVJA 5K5NA 4IB0A 3QTSA 2XIXA 5AR3A 4PDSA 4PL5A 3D7ZA 4FIGA 5JGDA 2BRBA 4QQCA 4MEDA 4BC6A 4GT5A 5BX0A 5IISA 4FSNA 3DXPA 4AGWA 3PXYA 2W7XA 1PMUA 4GS6A 4J52A 4GK2A 4BCIA 4JI9A 2F7ZE 3L1SA 3OOGA 4YC8A 4AP7A 4O38A 4FK3A 4AS0A 3SGCA 4ZZOA 4Y85A 3QUPA 3PZHA 4WSQA 3MGYA 4A4OA 1ZRZA 4EKKA 4F6WA 3Q52A 3CC6A 2G2IA 5JQ5A 3IDBA 3DS6A 2ZYBA 3DAEA 3DZQA 2OO8X 5AAFA 1SVHA 4QMPA 2JDSA 4G6OA 4F1TA 3RBWA 3DQXA 3COIA 4HNIA 5HCXA 3QRTA 3PFYA 2B7AA 3QHRA 1PXKA 2HXLA 2WGJA 5BVWA 4O4EA 4F99A 4FTJA 4YZDA 5CVHA 4E4XA 1MUOA 3R1NA 5J7HA 1Q41A 1XH4A 4EZ7A 5E4HA 4YMJA 2IVTA 4GL9A 2RF9A 4DEEA 4R7IA 5IEYA 3KGAA 2FB8A 2ITOA 2J5FA 3GUBA 3LFQA 5M07A 2YDKA 2B9FA 2XIYA 5CI6A 2CHLA 4I5CA 5D10A 5HU3A 2OH4A 2BROA 2JBPA 4F0IA 2FO0A 2XNNA 4UMQA 3FC1X 2P33A 4IX4A 1R3CA 1FBNA 4L68A 5HE1A 3NCZA 2ONLC 3W0SA 5E8SA 4P4CA 4RZVA 2XKEA 3CS9A 4AN3A 3S4QA 1OKVA 2JAVA 2VTHA 3KVWA 4KIKB 4QP3A 5IQIA 2OGVA 3GB2A 4IJ9A 3COHA 3RZFA 1H1SA 3ATSA 4F7SA 5LOHA 1RJBA 2ZJWA 3EQRA 4HGLA 4PQNA 5C8KA 2WTVA 4WNMA 5H9BA 2FUMA 1YXTA 2J9MA 3ZDUA 4LMUA 4YTHA 5L8KA 3S95A 4XV9A 3DA6A 3PWYA 5M06A 2IZSA 1JKSA 3HGKA 5HTCA 3E5AA 3ORXA 1H26A 1XBAA 3WIKA 3POOA 4AZTA 2UZOA 3CEKA 2C6IA 4QMXA 3BL9A 4YSJA 2UZNA 4GT4A 2OSCA 1BL6A 5DR9A 4RGJA 5C26A 3C13A 3DCVA 2Y6MA 2CJMA 4FK6A 2QG7A 5JGBA 4L01A 4P90A 3MESA 4BF2A 2C1AA 2WQOA 3QYZA 3V5PA 4YNOA 4QDEA 3HV3A 4FT9A 4MBLA 3ENMA 3P79A 4QDVA 2CGWA 4JL9A 1AD5A 5DWRA 3RK5A 3QAME 2VTNA 4ZTQA 4FR4A 3EB0A 4TL0A 3EQIA 2AYPA 3DTWA 3QX2A 4FIFA 4R1VA 4CZUA 2WQBA 3O23A 4YBKA 2QOHA 1G3NA 2OWBA 2X0GA 5LJJA 3IDPA 2NPQA 5CAUA 1W2CA 3O8PA 3R7EA 1M14A 4EK5A 4EOIA 5J9YA 5FTGA 2PUPA 4A4LA 5IA2A 2UW4A 2YIQA 3L9MA 3PXRA 3R63A 4L67A 5GJFA 3WZKA 4NM5A 3RAIA 1MRUA 4CFMA 4F09A 5CAOA 3TIZA 5HLNA 2JFMA 4QTEA 4DT8A 4E73A 4X3FC 4O7LA 1PW2A 4HPUE 4O81A 4F63A 3F7ZA 2OXXA 4KINA 4C4HA 3AKJA 1WBSA 2UVXA 3BQCA 4IHPA 3R8LA 2CKQA 2VUWA 4AZSA 2WNTA 2UZWE 3BWFA 4KUJA 4X21A 3WYYA 2P0CA 4M14A 4BHNA 4LFIA 5FXRA 2YM5A 4RIYB 1G8KA 3ULIA 4EI4A 2UW3A 3GNIB 3NS9A 4JS8A 5EM5A 3I6WA 4OTRA 4BWKA 2ERZE 2C68A 3F7WA 3QQKA 4U0IA 5BMMA 3VS2A 4FA2A 2QOLA 2WTWA 2YM8A 3OS3A 4I5PA 5A46A 2OZAA 2BTRA 3F3WA 3P4KA 3PJ2A 4GYGA 5HBHA 4F9YA 5I0BA 5JKGA 4I0SA 3CPCA 4PP9A 1Q3DA 4JQ7A 3R01A 2P2IA 3Q4ZA 5CZHA 4HVDA 5IEXA 3CJGA 3NNUA 2H6DA 4NW5A 4TYIA 3R1QA 4GG7A 3G9LX 4MWIA 4M69B 5CNNA 2G1TA 4OAUC 2JKQA 1UKHA 3TT0A 4D0XA 2O0UA 3DKCA 4OTDA 1OL7A 1PMVA 2F7EE 1WBVA 3QX4A 3OMVA 5EHYA 3CTJA 4LRJA 3QD3A 3TUDA 1NY3A 4TWCA 5CF6A 1PMNA 5KBQA 3DTCA 3NUYA 4I6QA 5FGKA 3E7OA 5M55A 1KE7A 5JT2A 2J0LA 4H3QA 4YLKA 5FM2A 4EOMA 5L2SA 2NNWB 4F1OA 4F4PA 4O7SA 1JVPP 2UW7A 3B2TA 4DN5A 3QQGA 4XRJA 3KL8A 3VO3A 3LQ3A 2HELA 4OAVB 3NVMB 5CF8A 2XYNA 4FSQA 4DINA 2XH5A 1YQJA 3AKLA 4WBOA 3ZRMA 4QQTA 2JEDA 4B99A 4U45A 4CFUA 2ETKA 4XLVA 2YM6A 1UA2A 4C7TA 3ORMA 4C61A 4F70A 3ZZEA 4BBFA 3UZRA 2ZB0A 2YCQA 2P2HA 1PXJA 3GCUA 1R39A 4P2KA 4ERKA 1PY5A 2PUUA 3BHUA 1MRVA 5ANKA 3UO5A 4F1MA 3PIXA 1PXNA 3ZU7A 1P5EA 3KRJA 4ZSEA 4I20A 3OCTA 3D14A 4CKRA 2Z7RA 4H36A 4HCVA 3VVHA 5IF1A 4I22A 3UQFA 2ETRA 3SAYA 4B4LA 2PU8A 3A99A 4R3PA 1H8FA 4N0SA 5F94A 3QALE 4CSVA 4ITHA 3BBTB 4J53A 4FF8A 3SLSA 3TJCA 5E90A 1YOJA 2CSNA 3KCFA 4N6YA 3DFCB 3MW1A 4FZFB 3UJGA 4C8BA 3VHKA 3W0QA 4A9TA 4G3FA 2DUVA 3SW4A 2R3PA 3KN5A 4FOCA 4LI5A 5EOBA 5HVKA 2RFSA 4UEUA 2YHVA 4XG6A 2HXQA 4IZYA 3V3VA 2ITXA 1FVTA 3R71A 4RWKA 4MF0A 4A9SA 2CLXA 3D2KA 3FV8A 1OGYA 4IZAA 4EZ5A 1ZYSA 4GK4A 5LCKA 3QD0A 4FTLA 3RMFA 3UDBA 4E4MA 4F9CA 1NW1A 4EWHA 4FODA 2X2LA 2VO0A 5JEBA 3SW7A 4L7FA 1TFFA 2Y8OA 2ZMDA 3UP2A 4O7NA 4X6QC 1IG1A 2WTIA 3O2MA 4I6FA 1ST4A 4EH6A 2FA2A 2QONA 3PG3A 3QBNA 3ZEPA 4YTCA 5G1XA 2FGIA 4UWYA 3GC0A 3FYJX 3PTGA 3WF9A 4ZTNA 3P9JA 4CQEA 2PUNA 3FI8A 4G2FA 4F7LA 3MJ1A 2Z7SA 4AT4A 5B2LA 2XZSA 2ITVA 3A62A 4NFMA 5HU9A 3ZRKA 5L2QA 3MDYA 4J1RA 4XMOA 3BPRA 1NVRA 3ZXTA 1FMKA 4K2RA 4CLIA 4Y5HA 3UOJA 2WMWA 3A60A 4PV0A 4O6EA 3C4CA 2X6DA 3KMWA 4FZ7A 3TIYA 4LG4A 1XJDA 3GU7A 5L8LA 5AUVA 3DLZA 4E6DA 5EM8A 4USEA 3O5AA 2AQXA 2X0OA 4I6BA 3UIBA 2IVSA 3EQDA 1ZLTA 2O3PA 4ZIMA 2YLEA 5HO6A 3MY0A 3S0OA 5BYLA 2GPHA 3KCKA 3LXKA 3AC2A 3N4TA 4AXCA 5AUUA 4JX3A 3KKVA 3GFWA 4V0GB 4DTKA 3ZOSA 1OL2A 2IZTA 4DGLC 5HX6A 1O9UA 4W4WA 4DF3A 5M44A 3H4JA 4W4XA 3NUPA 3E63A 2XS0A 4C34A 1U4DA 2BVAA 5IU2A 3O8TA 1OIUA 5JRSA 4U80A 1PYEA 2R3IA 1UKIA 3EYHA 5AWMA 4V04A 3WOWA 5CEKA 4NKSA 4IXPA 2YZLA 4BKYA 1OZ1A 3P5KA 2O8YA 3EN9A 5EQPA 5L3AA 4APPA 4DG3E 4IVAA 5AP1A 4F64A 5HVYA 3B2WA 4RLKA 4EH4A 3ZFXA 5FP6A 5F1ZA 2XBJA 4RC3A 4AGDA 2VWBA 4ANNA 4IVCA 3BE9A 3WZUA 4ZAUA 2GMXA 5AR5A 4TYEA 3ALOA 2RG5A 5HG8A 4O82A 2FSMX 4OLIA 4YLLA 2BR1A 1NVSA 3RJCA 4MTAA 5AV1A 4EONA 4GKHA 5JFWA 2I0VA 3QGWA 2C69A 3UG1A 1KSWA 1QPJA 2YJSA 1Z5MA 3BLHA 3F88A 4FNXA 3FXZA 5A14A 3GCPA 3ZH8A 3IOPA 4CMOA 4DEDA 4ID7A 3KFAA 2UW0A 4BCGA 3HV5A 1UU3A 3MFUA 4ZSJA 2J5EA 5AR2A 1BI8A 3Q3BA 3Q9YA 4O0XA 1P14A 3ZBXA 3QTIA 4D28A 5AP2A 3ZZWA 1XHAA 5KE0A 3K2LA 3ZFMA 4HW7A 5E8YA 4JX7A 3UC4A 4ANLA 1WCCA 5IZFA 4LOOA 4EORA 4RA4A 4J71A 5T68A 3SHEA 5HNBA 3SXFA 3NVKI 5ETAA 5LVLA 1Z9XA 4O0TA 4KB8A 5HE3A 2V5QA 3JYAA 5I9ZA 4AFEA 1SZMA 4D2VA 4HGSA 4YC6A 4FGBA 5GZAA 3FMLA 4QNYA 2B0QA 4BDCA 4AUAA 4CXAA 2OKRA 2BDFA 2ZM1A 4MF1A 3EYGA 4MNEA 4KIQA 4X0MA 5KMLA 1AGWA 3DQWA 4NSTA 4D4SA 3D2IA 1W2FA 3HMNA 3MH2A 4XV1A 4DFUA 5C9CA 3E87A 1Q3WA 1VZOA 3FYKX 2X6EA 3QCYA 1YI6A 4FV4A 2J0KA 1GIJA 4IWPA 4TYHA 4WG4A 4FEWA 3RM7A 4ARKA 3UZPA 4ASXA 3ML1A 4ZMFA 4CKIA 3QTXA 5AA8A 3MH0A 5HBEA 2UUEA 3EZRA 3SX9A 3F3VA 1WFCA 2F7XE 1OIYA 3RPYA 3LXNA 3TN8A 2WKMA 4I6LA 4RA5A 1VYWA 3TJDA 3TACA 4CT1A 3QD2B 5JFXA 5HD4A 4IM3A 2Z60A 4M0ZA 3HNGA 4EYJA 5IKWA 2RKUA 3UG2A 5AIKA 2QR7A 3KXMA 2Q0BA 5EW8A 5AV2A 1A06A 5DRBA 2HCKA 5HEZA 3QRIA 4ONAA 4HCTA 5I9XA 1OVEA 4G3DA 5DT4A 4K11A 4YJQA 3GOKA 4AW5A 3R7OA 4B8MA 4CMUA 3CQEA 3GENA 2WTJA 5E8ZA 3DGKA 5HG7A 5HZNA 4JIKA 3TG1A 3V8SA 1WBNA 4OTIA 2RG6A 3TZ8A 3GC7A 4GV1A 1UNGA 5KO1A 4DBNA 2VX3A 3JR1A 4IMYA 1QCFA 2W1HA 5K4JA 1J1BA 2OIDA 5T3QA 4E6CA 1JNKA 4AG8A 2X4ZA 4RQVA 4RG0A 2X81A 3HRBA 3VBXA 1PHKA 2GSFA 1F3MC 3BYOA 4M15A 1LPUA 3CBLA 3ZO4A 4PRJA 4UBAA 2A4LA 4C35A 4E5BA 2R3LA 1J1CA 5DR6A 2WAJA 3AC8A 4KKHA 2YLFA 4TWOA 4U9AA 4O0YA 5HBJA 3TMOA 4DBXA 2XM9A 3FQSA 2HZ4A 2NP8A 1L8TA 1SVGA 1J3HA 3CKWA 4J99A 5HG5A 3GI3A 4AN2A 2CKEA 4D4VA 3GU6A 1HOWA 2VTLA 4QMQA 2VO3A 2W1DA 4MD8E 4CCUA 2FVDA 4U81A 3UO6A 5EQYA 2CKPA 2OJ9A 4GUBA 2J0IA 4IX6A 3Q9WA 4WD5A 3R9DA 1WBOA 1W83A 5AR8A 3TNIA 4NYEA 1WVXA 1OKZA 3O71A 1H27A 4G9CA 4ZEGA 4D2PA 3BHHA 3AQVA 4FBXA 4BKZA 3ZM4A 2UW6A 5BPYA 4K18A 2BRGA 4QMSA 3W0MA 4IAKA 1TQMA 3LMGA 1YDSE 2Y4IC 2W1EA 1OPJA 3FMHA 3M2WA 2GFCA 4IVBA 3A8WA 3OWLA 5K0KA 2OXYA 4TPTA 4W9WA 3LAUA 3SRVB 3MV5A 3KEXA 5JMSA 4PPCA 3VQUA 1DAWA 5IQAA 1W82A 3EQGA 4YZMA 4DEHA 4ASEA 2R0IA 4FTIA 3FLZA 2W4OA 3JXWA 3C4WA 3MI9A 4JBVA 2OIQA 4M7IA 5HIDA 3VQHA 3F2RA 3QZIA 4TNBA 4AXDA 4DE4A 2R3QA 3I5ZA 4DGGA 2B52A 1KOBA 4MBIA 4K1BA 1CM8A 4MCVA 4U40A 2CCIA 4YJSA 4ZTHA 4CZYB 4DH8A 3DJ5A 4H3PA 3LLAA 3DNEA 3W33A 2C6DA 2V55A 3W16A 1FINA 3FDNA 4MD7E 4O91A 3Q53A 3V6RA 2PVRA 3KRXA 3R8MA 2OJFE 3OBGA 2QO2A 3D7TB 4R1YA 4AFJA 3OCGA 2GTMA 4KIKA 2BDWA 5JN2A 4ZY5A 3VW8A 4PDOA 5EKNA 2GCDA 3V5TA 4AXFA 1Q99A 3N4UA 3VS4A 3RNIA 4LRMA 2W5AA 4JLCA 4KD1A 4G3EA 1VR2A 4MNFA 2VWUA 1PXPA 5LMKA 1DS5A 3FWQA 4MBJA 2A98A 4R6VA 4MXYA 4DH3A 5KMJA 3AC3A 5JQ8A 3FKLA 4YHJA 5CS6A 1LR4A 2R3GA 4KBCA 4YNEA 2W06A 1Y8GA 1GJOA 3MJ2A 3MBLA 3FQHA 1IA8A 2R4BA 3A7JA 4PTCA 1F0QA 2V0DA 3VUMA 5T6KA 1ZWSA 4GJ3A 4K9YA 1XBBA 3D5UA 3VBYA 4DA5A 2PMNX 3RPRA 3TV7A 1OIQA 5A4LA 3U6IA 4DLJA 2HAKA 1ZZLA 5HHWA 3ZLXA 5C4KA 3OZ6A 3CIKA 3MVHA 2J4ZA 1JKKA 4D5HA 3EN5A 3UTOA 4QPSA 3PUFC 2I0EA 4RQKA 4GFMA 2A19B 3FZSA 4K77A 4QOXA 3F5XA 1VLRA 3CQWA 3LFFA 3RAWA 4NT4A 3FSKA 4AE9A 5I9UA 4XHKB 2FSTX 1YWRA 4EOOA 3IOKA 4YURA 2PVMA 3EN6A 2PVFA 2FYSA 5M4FA 1DI9A 3PDTA 1XWSA 4FKVA 4K6ZA 3WILA 3LCKA 3WBLA 5BMSA 4E4LA 5CSWA 2VTTA 5AAGA 3B8RA 4Q9SA 1B38A 1BI7A 4NIFB 2PVKA 3ZC6A 5EHOA 4J8MA 4R78A 4CRSA 5HOAA 3FY0A 1ZXEA 4I24A 1TVOA 3OUNB 4RVTA 4E6AA 3FY2A 4Y8DA 2QNJA 4JG6A 4Y83A 1DAYA 2YAKA 3PVGA 5EM6A 5FG8A 2X2KA 1WVWA 2BAQA 4JJRA 4UV0A 3T3VA 2CN5A 4IANA 4KKGA 5CSXA 4BGGA 4CTBA 3OEZA 3NUXA 4QP7A 4YU2A 1FOTA 2YIXA 4NL0A 1JSVA 3FL5A 2XUUA 3OD6X 4M69A 2PY3A 4APCA 4QT1A 1T46A 4N6ZA 5BVEA 4J96A 1V0BA 1YW2A 2PSQA 2XRUA 3CJFA 2Y9QA 3FLSA 3FQEA 2B55A 3Q5IA 4WNKA 4O7RA 3R9RA 2BDJA 3PY1A 3ZLWA 2UVZA 4A9RA 5B7VA 3LKMA 2GNFA 1Q4LA 3HMMA 3KULA 4F9BA 3HRFA 4ANQA 3PPZA 5HORA 5KCVA 1CMKE 5HVJA 4I4FA 2R3OA 2WOUA 4CFFA 2GNGA 3K3JA 4IM0A 2YITA 2OU7A 5EM7A 4BY9E 4I1ZA 4BCOA 3FHRA 5CASA 4R7BA 2I7QA 3FKNA 2XK3A 1H4LA 4YJTA 2GNHA 3H3CA 2VO6A 3GXLA 3U4WA 4HNFA 3PG1A 4RSSA 4X2KA 5AAEA 4CV9A 3TDVA 4CGAA 3SG8A 3LFCA 4C36A 2XALA 3DK6A 4FKRA 4Y46A 4F9WA 2J90A 4RX5A 4O4DA 3TNQB 3R1YA 3FJQE 3CGFA 4TZRA 1W0XC 5AP0A 4C3PA 3QHWA 5D7AA 4RBLA 3P7CA 3OCBA 1M17A 2HWOA 3NIZA 4OBOA 5HO8A 3F2AA 5I5ZA 5JRQA 4CZTA 2QR8A 4TRLA 3VUHA 3VONA 4BVUA 3ZDIA 4BCJA 4EH7A 1R0EA 2XK7A 1QPDA 2PZIA 3D5VA 3QZGA 2VN9A 3F3ZA 4E93A 2XKFA 4GVJA 2E9UA 4NFNA 4G3GA 2C5YA 4OTWA 2B1PA 2UZBA 4DG0E 4NM0A 5AM6A 4C3FA 3GC8A 4TTHB 4AOTA 1HCKA 2EXEA 3BGQA 3I60A 4L7SA 2WB8A 5BUEA 2VRXA 5KMNA 4JIAA 2E2BA 2GDOA 5H2UA 5I9WA 4BCQA 3RAHA 2XK6A 4BTFA 4RIXA 4FE2A 2QKRA 3ERKA 2QO9A 4YHFA 4IWQA 1JQHA 3HZTA 3DAJA 3E8DA 3HAVA 3R00A 3II5A 3HP5A 5HE2A 3UQCA 4XCUA 4FV1A 4GW8A 4ERWA 3FEGA 2GS7A 3R8VA 4YJVA 4CFXA 4FEXA 4C62A 5L2WA 5AX3A 4ALWA 3NWWA 2YJRA 4KRCA 3LLTA 1YWNA 5CAPA 2W17A 3BU3A 4QP4A 4PDYA 5LWNA 3ANQA 1E1XA 1ST0A 1QMZA 4C59A 3CY3A 2EVAA 1JSTA 3QCXA 4FEVA 3HUCA 3OTVA 1OL6A 4UWBA 1CTPE 3LPBA 3ZM9A 3IGGA 5J1VA 4IAAA 4HVSA 3ODYX 5L6WL 3FI4A 2I1MA 4OTFA 3PJ1A 2HW6A 4KRDA 3NYVA 2JIVA 2XA4A 4RLLA 5AUZA 3QD4A 2R3NA 4FTCA 3OFMA 2X0PA 4JQ8A 3LVPA 4USDA 3UYTA 3CSVA 1M52A 3CGOA 4CLJA 2YM3A 1YWVA 3UDTA 5HLWA 1KV2A