1OUKA

The structure of p38 alpha in complex with a pyridinylimidazole inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
348
structure length
348
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Structural basis for p38alpha MAP kinase quinazolinone and pyridol-pyrimidine inhibitor specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 348
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1oukA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1oukA01
4FC0A 2EVAA 1XH4A 2HW6A 3CKXA 3UO4A 2JLDA 4UALA 2VTSA 1QPCA 4L53A 4QMMA 5T68A 5C4LA 4L3PA 4YZBA 1P4OA 3W8LA 4I0SA 2CSNA 4DBNA 5EDPA 2JIIA 2RG5A 4JL9A 2EUFB 4APPA 5IU2A 4A4OA 4HGSA 4QMUA 2ONLC 3OWPA 4RLLA 4OR5A 3E88A 4O7RA 4MBIA 3UOJA 3VUKA 3BYVA 3MVMA 3QD3A 4PMPA 4O7TA 2ZB1A 2X4ZA 4IZAA 4QMSA 1B39A 1RQQA 2JBPA 4TWPA 4FUXA 4OTPA 2EWAA 3BBTB 4JNWA 3TIZA 1URWA 2JFLA 4Z55A 2XJ2A 4OTRA 3Q9YA 4NTSA 4AQCA 3UOHA 3GCPA 4D2SA 3UQCA 4QMTA 2QOCA 5AM7A 2UW6A 2CHLA 4D58A 3C1XA 4PDYA 4ZTMA 4Z7HA 2NPQA 3ZONA 2XJ0A 5JSMA 2CNQA 3F69A 3JVRA 4K8AA 5CSWA 2OZAA 2J50A 2B52A 3RKBA 1GJOA 3FC2A 3LFDA 4YSJA 3F66A 5H2UA 2J9MA 2J0JA 4O0YA 4OUCA 1B38A 3LW0A 5CZHA 2JKQA 4MYGA 3QF9A 4EOPA 2RSVA 5CXZA 2CKEA 1Q24A 4AG8A 5HVJA 1UNHA 2W5HA 4G17A 5HHWA 4O81A 3NYVA 4ZOGA 3BEAA 1V0PA 4DG2E 2IPXA 1CDKA 4IACA 5C26A 3DZOA 4FV4A 4KB8A 3U54A 3RNIA 4I94A 4DTBA 4G5PA 1SVGA 2B55A 5TKDA 3AT3A 3S1HA 5J87A 2OFVA 3PA3A 1Y91A 3ORMA 3FZRA 4V0GB 4FV8A 5I9VA 2VX1A 5HCYA 1YRPA 3NW5A 3U4UA 5JGDA 1PMVA 3BU6A 2BKZA 4IQ6A 2XCHA 4FT3A 2HAKA 3GNIB 5J79A 3S0OA 3EKNA 3FQSA 4JOAA 1F0QA 2C4GA 2IVTA 2YAKA 3C7QA 4HCVA 4QO9A 3RHXA 4WUAA 3PY0A 4UWCA 3D5WA 4X2KA 4F9BA 4I22A 2JITA 5CSVA 3SXFA 4MD8E 4JG7A 4F0GA 4EOQA 4D2PA 4NK9A 3DK7A 2W96B 3MB6A 2C5XA 3MDYA 4ZTNA 3VBVA 5J7HA 1RDQE 3SRVA 1E1XA 2UZOA 4MHAA 2OO8X 4JR7A 5DRDA 3VWAA 3KN5A 4EWQA 4F7SA 4TYGA 5A6OA 4ZIMA 3FLNC 2YJRA 4FKSA 2ZYBA 1O6LA 4XV2A 4H36A 4CLIA 3H0YA 4AT5A 4MX9A 3CQWA 4G16A 4ITIA 2H9VA 4BDDA 1XBAA 4TYEA 3TKUA 1W98A 3OD6X 1P2AA 3GC9A 4FODA 4ZMFA 4LMUA 5DT3A 3FZPA 2GPHA 3ZU7A 4BTJA 4I4FA 1KE8A 3ORNA 3RTPA 3W8QA 2GS7A 3ZSHA 2R7BA 4QP8A 5LWMA 4P90A 4B9DA 2VTOA 3LQ8A 2X81A 3RPSA 4RG0A 4DEEA 5DT4A 5L8LA 4JQEA 4UMQA 4YZMA 2QOIA 3KXNA 1AD5A 3L9PA 5JRSA 3CKWA 3KXZA 3BYUA 1XKKA 1ZXEA 3NNUA 4FX3A 4GFMA 4IJ9A 5E1EA 3E93A 3TTJA 3HA6A 4HNIA 4QTDA 3QQHA 3DKGA 3IW7A 2BRGA 2PMIA 3BPRA 4MWHA 4PTGA 4R8QA 3UVQA 1XH8A 5GZAA 4B99A 2V55A 2GQSA 4LFIA 2W1EA 3TZ7A 1JSTA 3QFVA 4Q2AA 5KBRA 4OTHA 3UZRA 3IG7A 4CEGA 1GOLA 3IW6A 5IMXA 3PPJA 2BRMA 2IZTA 4BYJA 2PY3A 2C5VA 3QYZA 3WI6A 3AC4A 2ZV2A 3HV7A 4IHPA 3FPMA 5HESA 3R8ZA 4S31A 4DBXA 1GZOA 5CEMA 4FKWA 2R9SA 4LI5A 2BHEA 3V8SA 2Z2WA 3EB0A 2OBJA 4ITHA 3VS3A 2BILB 3BX5A 1O6KA 3CD8A 3PPKA 3QTWA 4RWJA 5EQYA 2HZNA 5B2LA 2C68A 3LQ5A 3LXKA 4DEBA 3BV3A 5HE3A 1OIQA 3VO3A 4UV0A 3QGWA 2BAQA 4BWKA 4E6AA 1K9AA 3ORIA 5C8MA 5HEZA 3BGQA 3UBDA 2P0CA 3BE2A 3DS6A 4LOOA 4U79A 3ZS5A 4A9YA 3LZBA 4DFNA 4E4NA 3UPZA 4Q9ZA 1DAWA 3NUAA 5EQPA 4EUUA 2G01A 1JSVA 4KSPA 5HE1A 3UIXA 4R7HA 1OITA 1ZYSA 2QQ7A 4BI0A 5KMLA 2XK9A 5EW8A 1ZRZA 2BUJA 5AR8A 3DLZA 4BCJA 1H01A 1L3RE 3RZFA 3RNYA 3L9MA 5CEOA 4JBPA 2RFDA 2JDOA 2P33A 3C0GA 5EHLA 4WBBB 5CU2A 3E5AA 3QC4A 1W84A 3VBWA 4D4VA 3CPCA 2LGCA 3DA6A 4MH7A 2UW4A 2OJ9A 4TWCA 1YI4A 4DFXE 4N6ZA 5J1WA 5FEQA 3LM0A 4E6CA 4FV7A 2E9UA 4YBKA 3TCPA 3ALNA 4YUQA 3O8PA 1J7UA 5M06A 2C0TA 2WMWA 3DLSA 3JPVA 3NS9A 4O6EA 2DWBA 4S33A 3G15A 3MTLA 3KU2A 3LXNA 1JKLA 4QNAA 4YZCA 4CCUA 1YWRA 2B9FA 1P5EA 5I5ZA 2LAVA 4RWLA 2XK6A 4C59A 3KY2A 4C0TA 3PY1A 4C4JA 2VWYA 2WIHA 2UZWE 3QRIA 2PZIA 3ORPA 3U6HA 3EFKA 3I7BA 1WBTA 2DQ7X 3NNXA 3VF9A 4U8ZA 3GU5A 2ZDTA 4E26A 3TJCA 3DTWA 1GY3A 3R0TA 4JBOA 2R3FA 4F1TA 4R7BA 4CZYB 5ACBC 4JS8A 1BL6A 3WZJA 4LRKA 3W2CA 4AOTA 5GJDA 3QUPA 4KIOA 3RINA 4FTIA 2WU6A 4BTMA 1EH4A 3TNIA 3ZO1A 3HUCA 4J1RA 3PXRA 4MNEA 1Y6BA 3UODA 3D15A 4KABA 4MF1A 3EQGA 4NIFB 1CTPE 3FKOA 4GVJA 4R77A 3EIDA 3Q5ZA 4TN6A 4BHNA 2UZUE 2W99B 3AMAA 5M44A 2C5YA 4P5ZA 4W9XA 4J8MA 5BUEA 4A9RA 3K3IA 2E9NA 4QP9A 3C4WA 4DTKA 4RIWA 4UYAA 2W17A 3KFAA 3M2WA 5GIPE 1JNKA 4U40A 1VZOA 4CV9A 5A6NA 4F7JA 5IQIA 4QP1A 2VTRA 3JY9A 5C27A 2FB8A 3KRXA 2F9GA 4JDKA 5JH6A 2GHMA 1IR3A 4U43A 4PDSA 2WTIA 3DU8A 3REPA 2OIBA 4AFEA 3F6XA 3ODYX 4IDTA 4IB0A 3C9WA 4K0YA 1W7HA 3O7LB 4R3CA 3BWFA 1MUOA 4M84A 4HVGA 1MRVA 2BKKA 3LOKA 1ZYJA 1W8CA 2VD5A 3PP1A 2VU3A 2Z7RA 3LCDA 4FTOA 4GV1A 4L3LA 4NH1A 3RM7A 3VW6A 2XP2A 3FWQA 1BUHA 2CMWA 3D5XA 4LM5A 3R83A 3V5WA 3T3UA 4X3FB 4EHVA 1HCKA 4R1YA 5M09A 5L6OA 4J52A 5JKGA 2JEDA 2C6OA 2O3PA 2X6EA 3JS2A 4PNKA 4BDEA 3NR9A 3EJ1A 3GC7A 3UQGA 3KB7A 4X2JA 4MD7E 4DG3E 4O0WA 3A61A 3FLQA 3GOKA 5A46A 1QL6A 4O7NA 1Q8UA 3R6XA 3MH2A 4HOKA 5AUXA 4RIXA 3HRBA 3JVSA 5KX8A 3GT8A 4X2NA 2CGUA 2HZ4A 2ZV8A 4FG7A 3K3JA 4FSUA 4A4XA 4B0GA 3HKOA 4JT3A 4RFYA 3FXZA 5F95A 5EHOA 2C3LA 5E8TA 3OTUA 3N4VA 3VF8A 2WOUA 3BU3A 4CVAA 2UV2A 4AT4A 3TDWA 4PL4A 4XCUA 3PG1A 3E7VA 2W4KA 5CEIA 4EH4A 1Q97A 1OIRA 5LQFA 3EQIA 5A4TA 4FEQA 2ITWA 4AZFA 2BZHB 3A7FA 4C38A 2WD1A 4FYNA 5CU3A 4CFXA 5IISA 3P5KA 2HK5A 2BZIB 4NFMA 3NVKI 4ZLYA 2OI4X 3ELJA 3LCOA 4RWIA 3RGFA 4O7WA 2VO6A 5JGBA 4C58A 2QR8A 4TYJA 5H9BA 4PMTA 4KINA 4JJRA 5AUYA 2OJGA 4FIIA 4FL2A 4TWOA 4C7TA 5C4KA 5IZFA 5CALA 4IZ5A 1V1KA 2GNHA 5B7VA 5CY3A 3QX2A 3DAJA 2C6IA 5DHJA 4RVMA 4S30A 2QKRA 3EMGA 5AAGA 2UW7A 1ZOEA 4KRCA 5DEWA 4J71A 2BTSA 5KKRC 5M4FA 5AA8A 1OL1A 4IH8A 2Z8CA 3R22A 4WRGA 4BIEA 2C6LA 5K3YA 4O82A 3CSVA 5BVKA 4JLCA 5D7AA 3G51A 5D9HA 2R3KA 5G6VA 2VZ6A 5CT7A 3UG1A 3VQHA 4ERKA 4K77A 4O0XA 4W9WA 4ASXA 4TWNA 4I5CA 4JIAA 5FTOA 2ITXA 3EL8A 1FGKA 5EI6A 3FE3A 3P1AA 4W4VA 4D1SA 4YJNA 3SVVA 2O63A 2XNNA 4GMYA 4PNIA 3NSZA 4OTGA 2HELA 5DR6A 3ZDUA 4DH7A 5L3AA 1YOMA 2NO3A 4PPAA 5I9WA 3TJDA 2E9VA 3R1QA 2XK3A 3HMMA 1MRYA 3PJCA 3THBA 3ET7A 2O8YA 4C37A 4CYJA 5HE0A 4KA3A 4RX8A 4FT0A 2YZLA 2C0OA 5FBNC 1M17A 3EQPA 4NCTC 3FMHA 5GJFA 4YR8A 4EHEA 3C13A 4EC9A 4EI4A 1YDRE 3OW3A 5J9LA 3U9NA 4E20A 4BI2A 4GRBA 4C62A 4CT1A 1ZY5A 4RIYB 1PF8A 4KWPA 4RJ3A 5CX9A 3TI1A 4M14A 4CYIA 3D2IA 5AEPA 2PHKA 1OIUA 2UW0A 2YDJA 3A62A 3F3TA 3QCYA 4GYGA 5CSXA 3V8WA 4C2VA 3OROA 3O8TA 2V7OA 3UVRA 3COKA 1V0OA 2YIYA 1YXSA 3MJ1A 4BCMA 3NGAA 1OL6A 4M7IA 3KMWA 5IH6A 4LOQA 3MA3A 4QPAA 3BQCA 1BMKA 2PMNX 3BZ3A 5DOSA 5A9UA 2JIUA 2Q0NA 3MYGA 2WMRA 1ZMWA 3P7CA 1VJYA 3W2PA 3IDBA 4RX9A 1UVRA 2GS2A 4WNKA 4RRVA 3FHIA 4O0TA 3DXNA 3DB8A 1VYWA 5DRBA 1OB3A 2CCHA 2WQMA 3AG9A 3CJFA 4KIPA 4RA4A 4F9WA 1J91A 2CJMA 3QD4A 5FXQA 4CQEA 4H1JA 5AX9A 3KXMA 3AGLA 3NCZA 4DFLA 4IX3A 3QQFA 3FSFA 4M12A 2YWPA 4BDCA 3T3VA 5C8NA 3VUIA 4TL0A 4BI1A 4IAFA 2JKKA 5G1XA 2Z7SA 4RT7A 3RM6A 4EK4A 3UP2A 2YLFA 2O65A 3LMGA 5AUVA 5KKRB 3GOPA 2FA2A 2GU8A 1QPJA 3AD6A 1G8AA 3R28A 4XNEA 3FKLA 3ORZA 3QHRA 4GK2A 2B9HA 3OTVA 4L7SA 4UWYA 3TNQB 4PDPA 4GU9A 2QKWB 2YDKA 3MV5A 4I20A 4QMWA 4ZSEA 3ZSGA 1GIHA 3EQDA 4IBMA 3ZO3A 5BVEA 5HO8A 4AFJA 5FUTA 2E2BA 4DEAA 5EDQA 4BCOA 3W55A 4RMZA 4FGRA 3DDQA 5LVOA 4QP2A 1I44A 3B8QA 3KULA 4O84A 5ANKA 2V5QA 2O64A 4QMXA 2ITOA 4BC6A 2VTQA 2H6DA 3M11A 3PWYA 2WMQA 1YHVA 4YZ9A 3W16A 3PVBA 3UGCA 2G2HA 2CN8A 2I6LA 3HAVA 4IVCA 4QMQA 4DTAA 2WMSA 1ZMVA 3C0HA 2OXXA 1KV2A 4E7WA 4IAYA 4Y5QA 3ZFMA 2CKOA 5IUGA 3BHVA 3NYOA 4CFMA 2ITNA 3G33A 1JBPE 4K9YA 3SOAA 2RFEA 3UMXA 4FOBA 4ZTSA 4FR4A 4ANSA 1JKTA 2YCQA 3DPKA 1BLXA 4ANNA 2F7XE 5E8YA 4BY9E 4GKHA 4MXOA 5L6WL 2A0CX 2QLUA 3ETAA 3F7ZA 5AR5A 3WZEA 3HA8A 4UX9A 1UKIA 5IQDA 3FHRA 3H9RA 1R39A 5M4UA 5M08A 2ZOQA 1TQPA 4YTCA 1E9HA 4FSNA 4EH9A 3EZVA 3IGOA 4AX8A 4R3PA 2I0YA 1TQMA 3CE3A 3VBQA 1I09A 4HJOA 3KVXA 1PHKA 2NRYA 2FSMX 2NNWB 2YEXA 3COIA 3H30A 4YNOA 3UVPA 3VS2A 3EQCA 3SHEA 4FVQA 4GT4A 2UZVA 3QCQA 4EQMA 5KZ0A 4G6NA 3VS1A 4GT5A 4BGHA 4PTEA 3NRMA 3DFAA 3S95A 5B2MA 2UZTA 4BCQA 2PUUA 5E8VA 4YHFA 4FTCA 2PVYA 4FIGA 3DJ6A 5CYIA 4FUYA 2Z7LA 5AV0A 2VX3A 3N51A 3Q5IA 5LVLA 5AV4A 5BUJA 2W1DA 2R3PA 3Q2JA 2WXVA 5M4IA 3OCBA 5IMEA 3HV5A 4FKOA 4FL1A 5E4HA 3FQHA 3NUSA 3EWHA 1PKGA 1WVXA 1IA8A 1NVRA 2ZM4A 3G0FA 3NZ0A 3ORKA 3QCSA 5DR9A 1VEBA 2W1IA 2ZAZA 3MY0A 5DG5A 5LXMA 2CNVA 5IPJA 3PA5A 5EKOA 4NJDA 4QYFA 4A06A 2PPQA 3R9OA 5CAPA 1XBCA 4XHKB 3L8VA 4LUDA 3R7IA 5K4JA 3HZTA 2PMLX 4XUFA 3DT1A 5HVKA 5CXHA 2BDFA 3AC5A 3NEWA 2UZNA 5L2SA 2HZIA 1ZZLA 3LQ3A 2PULA 1UU7A 3ZLSA 4IAIA 3ENMA 4RQVA 4DFUA 3I79A 4CKRA 2OZAB 3P08A 1QPEA 3VUMA 2YIRA 2XNMA 2B54A 4GK4A 4WG5A 5K5XA 3SW7A 2ITZA 5BMMA 3U9CA 1UNLA 4Y83A 4E4LA 5E91A 3HL7A 2OF2A 4YJOA 4AZEA 3WF7A 3B2TA 5E8UA 2XBJA 4ACDA 4ACHA 4DGNA 2OJJA 2YIQA 2P3GX 4D2RA 2UW9A 4EC8A 2WTCA 1SYKA 4ZSAA 2HW7A 4U0IA 2XB7A 2FVDA 3QQGA 4CRLA 4QRCA 3VIDA 4YJTA 5LARA 3KMUA 1OBGA 3R1SA 2JDTA 3GBZA 5GINE 3KC3A 5D7VA 1SVEA 2XJ1A 4G9RA 3ERKA 2VX0A 2Y6OA 4I4EA 4F9CA 3KRWA 2WELA 2WMTA 4HGEA 4YO6A 3EQFA 4ORKA 4K2RA 3WF6A 2C6MA 4ZSJA 2WPAA 4RJ6A 2QCSA 3O2MA 4AE6A 1H1WA 2VGOA 4DLJA 4O38A 5FEEA 1NVQA 1PXMA 5FP6A 5ICPA 3DXQA 4DF3A 3MJ2A 3NNWA 2REIA 5DPVA 4AGWA 2PZPA 2XM8A 3FAAA 3OFMA 3SRVB 3NW7A 3U6JA 4GCJA 2YWVA 2GSFA 5BNJA 2G1TA 4NJ3A 1M7NA 4QYEA 3AD5A 4FV5A 4BL1A 4D28A 1XR1A 5CVHA 3SG9A 4X7QA 4DFZE 2ITPA 4HPUE 2VAGA 1H28A 2GFCA 5I9XA 4ZZOA 3I1AA 3QXOA 4BZNA 4HVIA 4ZEGA 3DY7A 3C51A 3ZEWA 2CLQA 5AM6A 3LFNA 2P2HA 1W82A 1H1RA 3CC6A 3I81A 2WTVA 4OTFA 2YM6A 4PX6A 4OTDA 4XBRA 3P9JA 4FL3A 2WIPA 3LFAA 3UTOA 4F1OA 1WBSA 4WA9A 4KD1A 3KL8A 3H9OA 3FI2A 3VBYA 4D1ZA 2P55A 3FQEA 3PXQA 4WG3A 5HKMA 2OIQA 3NWWA 4QOXA 5HO7A 5HTCA 2J0LA 4HYIA 2WFYA 4YPSA 2JKOA 3FV8A 5ETCA 4IX5A 4IXPA 3OS3A 1FVTA 1FMOE 3PIZA 2ZM3A 4K1BA 3VN9A 2XUUA 4UMUA 4IZYA 4MVFA 4XV1A 5F4NA 3BWJA 2JGZA 4NFNA 4OTIA 5CU6A 4EH5A 4IC8A 4ONAA 2XIRA 4BCKA 3CPBA 2R3RA 3UC3A 2WGJA 3GCQA 3KCKA 4AACA 3R9RA 3LJ2A 3WYYA 2XK7A 1OPJA 2UZEA 5FXSA 4ACGA 5KO1A 4EH7A 2BALA 5A54A 3BI6A 3MW1A 3GXLA 4ZTHA 1ZOGA 5FM2A 3Q9XA 1RW8A 3BE9A 3RPOA 5C01A 5CSHA 4G9CA 3AC2A 4O0UA 4RX7A 4O7VA 2AUHA 3SA0A 3W10A 4RWKA 3EQRA 4Z3VA 1YW2A 3PIXA 1YDTE 2OK1A 2V22A 3GU8A 5JMSA 2CPKE 3FZOA 1DS5A 5TOZA 5HLNA 3HRFA 5A4EA 3PVWA 5EM6A 3IKAA 3KCFA 2WEVA 4DE4A 1A06A 5L2WA 3GB2A 2XVDA 4JRVA 3SDJA 5GZ9A 3LKMA 4BN1A 1WZYA 3PDTA 4XP0A 4KUJA 2XNBA 1QMZA 4U6RA 5HLWA 3LCKA 2GTMA 1JPAA 3NW6A 5HICA 4U41A 5IKWA 3O96A 4IJPA 4QPSA 1FOTA 1FVVA 3AOXA 3BKBA 3MTFA 5LMKA 3LLAA 2ZMCA 2PVKA 5IUIA 2ITQA 4FK6A 2XNPA 2ETMA 4IAZA 2PZRA 3VUGA 1DI8A 3NUYA 3DKCA 1ZYCA 1STCE 2B9JA 4JAIA 4UWBA 4BBFA 5AADA 4YSMA 2YAAA 2X8IA 3MA6A 5GNKA 3A7IA 5D1JA 4BWXA 4BIBA 5EDRA 5E1SA 3VW8A 4C3FA 2PWLA 3UMWA 5FD2A 3R7UA 3QA8A 5BVWA 5JZJA 2YA9A 3EN9A 4BYIA 4PY1A 5LCJA 2ITVA 4GKIA 1BKXA 2IWIA 1M2RA 5LMBA 2O5KA 4XG8A 4F6UA 4EQCA 3UZPA 2PU8A 3E8NA 3QTZA 4YTFA 3OVVA 4OBQA 3P23A 4EKLA 5CEPA 3Q4CA 2PE1A 1J1CA 3DBDA 3R04A 5E7RA 3W2OA 4BHZA 5EK7A 2IW9A 4NTTA 1U54B 4HCUA 4YHTA 4D4YA 3LMIA 3LFCA 4TZRA 1Q8YA 3HV3A 4MXXA 3DKOA 3WILA 5EYDA 4H05A 2I0VA 4BTKA 4LL5A 4BCPA 3JY0A 5L4QA 4FSRA 5D12A 3UYTA 2NRUA 5E8WA 3LPBA 3IS5A 1ZYLA 4MNEB 2VTHA 5JEBA 4YJVA 4EQUA 1F3MC 2C3KA 4Q5HA 4QP4A 4CCBA 5K5NA 3DNEA 5HG7A 4EEVA 3L9LA 1FGIA 1DI9A 1UWJA 4AS0A 2X7OA 4TTHB 4X6RA 4RJ7A 3DB6A 5L2IA 2R3MA 3P4KA 4UN0C 3TV7A 1S9JA 3Q32A 2I40A 1GZKA 3OUNB 4FTNA 3CXWA 4BCIA 4FZFB 3HVCA 4PL5A 4RIWB 5TE0A 1ZY4A 4HYSA 3VS5A 2QO7A 3KVWA 4KIKA 5AUWA 2C6DA 2FSTX 3FLSA 3H4JA 3QLGA 4G6OA 5FP5A 2V7AA 5TR6A 4FV1A 3UIMA 3LMHA 2F57A 5M07A 2WO6A 4G3CA 1KE6A 5ANJA 2BHHA 5EOBA 4ANBA 4XMOA 4N70A 2YABA 4N0SA 2OH0E 5A14A 3COMA 2RIOA 4YP8A 2VO7A 3TUCA 3R1NA 2XA4A 2H34A 4K18A 3E63A 5D41A 3IOKA 4PQNA 3PFQA 1Z5MA 3OY1A 2WMVA 3A7HA 4CSVA 3ANRA 3UIBA 4XP3A 3CJGA 3TKHA 3HECA 4O96A 4WRSA 3TWJA 1KSWA 3D7TA 3R30A 4PMSA 3RAHA 3VRZA 4KBCA 2J6MA 4YZDA 4YJQA 4UMRA 2PVNA 1Q3WA 4MXYA 1QPDA 2C1AA 4C3PA 2NP8A 4JDHA 4CT2A 1KE7A 2IZRA 4ANOA 3KGAA 2PUPA 1XBBA 4RVKA 3LCTA 4XRLA 3FJQE 4W4YA 3BYSA 3Q53A 3M1SA 2X9FA 4DEHA 4XG9A 2XKCA 1OL7A 4PUZA 3TT0A 1U5QA 4UEUA 4W8EA 4RIXB 5M57A 3RWQA 2QU6A 4HW7A 5CZIA 4R78A 4QT1A 3F3UA 3TZ8A 2WQNA 3OXZA 4IEBA 2OW3A 4CMUA 2RFNA 2VWVA 5FQDC 5IH5A 2G2FA 4X3FC 5LWNA 4TNDA 2VTTA 3AQVA 4HVHA 1XQZA 2ERZE 3C4EA 4W8DA 4AN9A 2R3HA 3V8TA 2CNUA 3D0EA 3HAMA 2H96A 5JQ8A 5I4NA 1PXNA 2HXQA 4D9UA 3BRBA 1REKA 1H25A 5DYJA 4UXQA 1UU8A 3HDNA 5EM5A 4IFCA 4E4XA 3TACA 4F09A 3DZQA 4DG0E 4G31A 2YITA 4QMYA 4BIDA 1BX6A 3MGYA 2QOFA 1O9UA 5JN2A 2C69A 3MFRA 3I6UA 4JG6A 5HIDA 4BDGA 1YQJA 2R64A 4G3FA 4PWNA 4RC4A 2I0EA 3HNGA 2Y4IB 2YIXA 3BYOA 2W5BA 2IZSA 4MXZA 4UY9A 4ENXA 4FKQA 4EOSA 3EFWA 5I9YA 5IG1A 4PDOA 3PJ8A 4FA2A 2CLXA 2SRCA 3HGKA 3O7LD 4YJRA 3FMLA 4GFGA 5DR2A 5BVDA 4F4PA 4ANLA 3NIZA 3OBGA 2YJSA 3G9LX 3LE6A 2R3IA 3P7BA 3VS4A 3BLQA 4NL0A 4KBKA 3G90X 3L8SA 3CQUA 2VTLA 5IQGA 1UU9A 1RJBA 4FKLA 5ANDA 3LFFA 5LCKA 4EZ5A 4NW5A 4CD0A 4E5AX 3COHA 2X9EA 4IX6A 1WBVA 2YN8A 4EK3A 4ZSLA 4RVTA 3AC1A 4GIHA 1WBPA 1VR2A 3HYHA 3VVHA 4EZ7A 4NWMA 5IUHA 3MSSA 3Q3BA 4EL9A 2I1MA 3WE8A 4EZ3A 2YM7A 4GSBA 2BRBA 4XP2A 4EK8A 3FI3A 4K11A 5AIKA 2PVLA 1Q5KA 3Q60A 4FZAB 5ETFA 2R3LA 5IH4A 3BV2A 3ZDIA 3ZRMA 4R6VA 4BGGA 2JD5A 3IPHA 4CFWA 4RSSA 4ZLZA 3HMNA 2ZDUA 4J8NA 4XV3A 4G3EA 4GL9A 4ZS0A 2ONLA 3MY1A 2IJMA 5ANOA 3G5DA 1Q8TA 2A2AA 3KRLA 5HD7A 4CZTA 1URCA 3E92A 4DITA 1FBNA 2WB8A 2W1GA 3DFCB 4I6BA 2P2IA 3TZ9A 4L46A 3EN5A 2VTMA 3UZTA 3RCDA 4TW9A 5GZ8A 3FMMA 4S34A 5JGAA 3PA4A 1H24A 2A19B 4L7FA 1XJDA 2B9IA 2W05A 4DA5A 3RWPA 4YJUA 3OCGA 5IQFA 3PZHA 1PMNA 2RFSA 3EFJA 3R9NA 4ARKA 5E90A 2C3JA 4G3GA 4IWQA 2J2IB 4RJ8A 3V5TA 4U45A 3HV4A 1FINA 2WTDA 4FZDB 4G5JA 3OG7A 4XBUA 3II5A 3F5XA 4NZWB 2VWZA 4G6LA 2EXMA 4BZOA 2PYWA 2CGWA 1H0WA 3U6IA 3UYSA 2VTNA 3CEKA 4YO4A 5EW9A 4PP9A 3CLYA 1R1WA 3KRRA 1M2QA 3OMVA 3OWKA 3DK6A 4QTAA 5HIBA 2VO0A 3F3WA 4JG8A 3F82A 3KK9A 4JAJA 1T46A 3QTXA 4DN5A 5JFXA 4OLIA 2PMOX 3F2NA 3R02A 4TYHA 5BVFA 5HBJA 3ATTA 3UOLA 4GS6A 4YLLA 3RJCA 4O7SA 2YLEA 4CTCA 4F0FA 4BWPA 2C6TA 3QU0A 4I41A 2W0JA 1TKIA 3S00A 2VUWA 5CENA 4F0IA 4JQ8A 4U9AA 3OXIA 2YACA 4FIJA 4H58A 3ZZWA 4YC8A 3RK9A 2B1PA 1OIYA 4TT7A 3MI9A 3TNHA 1HCLA 3LJ0A 2C5OA 4I23A 3SGCA 4CFNA 3Q9WA 5CVGA 2OICA 1JKKA 4IVAA 4FSQA 4NKSA 2UZDA 2EB2A 2R3OA 3I6WA 4IC7A 4N6YA 1APME 4ZTLA 4GUEA 2BIKB 4HVDA 5DWRA 4C57A 4AA0A 2RKUA 5HG8A 2YCRA 1KV1A 5DMZA 3KXXA 4Y72A 4F6SA 4I1ZA 2RF9A 4FTRA 4QTCA 3TKIA 1WVWA 1P4FA 1SZMA 5H8BA 3OCSA 4M13A 3TTIA 4CZUA 5CF4A 3DXPA 4AA4A 3RALA 3GFWA 5FLFA 3I5ZA 3LHJA 4OTQA 1E1VA 4W4XA 4QQCA 4BVUA 5HQ0A 3OWLA 4ID7A 4WT6A 3A60A 4H39A 3N9XA 4FNXA 1LR4A 4IE9A 1B6CB 4JDJA 4DYMA 2PVFA 3FC1X 5JFVA 5M56A 2PVHA 1KE9A 3QUDA 2GNLA 5KNJA 4E6QA 2PVRA 3KQ7A 3VS6A 4BCFA 2J0KA 4CFFA 4OAUC 2DS1A 2WZJA 3HP5A 4JXFA 4O6LA 3U87A 3PUPA 2QO2A 3DBFA 1FMKA 3ZZEA 5BYYA 3G2FA 2X8EA 3O23A 5HZNA 4F9AA 2VWXA 5AX3A 4IWDA 3QQJA 2BDJA 3H0ZA 4HZSA 2VNYA 4IM3A 4X6QC 3ROYA 1CSNA 3S4QA 3VC4A 1WAKA 3PSCA 4KKHA 1OECA 2EU9A 2QD9A 5AR3A 1U59A 5AUTA 4ZTRA 4KRDA 4XLIA 3PPZA 2YDIA 3E87A 2HWOA 3SV0A 3LJ1A 1CMKE 4KIQA 4EUTA 4QP6A 1Z9XA 3OT8A 4L9IA 5CAQA 2PUNA 5H3QA 3WF9A 4NM5A 3VUDA 2WTKB 4QYHA 3F5PA 3WIGA 4DCAA 3PRFA 1PY5A 4J53A 2GDOA 2HZ0A 5J9ZA 5IQAA 3IOPA 3Q6UA 3R8MA 3F7WA 1BL7A 2FH9A 4PMMA 5B2KA 5IEXA 1Q99A 2FO0A 4Y5HA 4I0RA 4ZMEA 4YMJA 4R1VA 3MVLA 4BTFA 3O8UA 5AV2A 1H0VA 2XIZA 1CKJA 4RJ5A 2OZOA 3L9NA 2I7QA 1H1QA 2QHNA 3SD0A 3QYWA 5HBEA 1ZYDA 5L2QA 4RC3A 4FV2A 2AYPA 2BVAA 1ATPE 4FTJA 3Q9ZA 4FT5A 4RPVA 3R8LA 3FI8A 4XV9A 4MBLA 5E8SA 4MEDA 4TYIA 5DFPA 4FVRA 3GP0A 4P5QA 3TEIA 3K54A 5H8EA 1V0BA 2BRHA 1CKIA 3CD3A 2W1FA 4IAKA 5AWMA 5LVPA 3FL4A 3PLSA 5JK3A 1TQIA 2W9ZB 3QTIA 4XG2A 4H1MA 4LUEA 4IANA 3ROCA 2J90A 2WAJA 3JUHA 1XH5A 3RAWA 3BLRA 4UXLA 3ZLWA 3KKVA 4I92A 4LQMA 4B6LA 2FUMA 4DHFA 3ODZX 2FGIA 3BQRA 5EHYA 3ZBXA 1X8BA 3IDCA 3LIJA 5KZIA 4U3ZA 3VRYA 2VV9A 3POOA 4IWOA 4E73A 2QOHA 3CCNA 1PW2A 2UW8A 1Y8YA 4XX9A 5AAEA 5KBQA 4C4HA 4ZAUA 3BHTA 4LV5A 3QZHA 4FKGA 3PZEA 3FMJA 2UVYA 2PVMA 1KOBA 3FI4A 5HE2A 3G6GA 4PP7A 4BDFA 4FKJA 4GVAA 4RFMA 4C2WA 3EN4A 2OJFE 3H9FA 5FTGA 4FGBA 3QRKA 4W4WA 2WMBA 3A4PA 5ANGA 4EWHA 5DA3A 2QONA 3GU6A 3QRTA 3KRJA 1JLUE 2IVSA 4YTIA 4ZJJA 3NVMB 5CAVA 4YGAA 4RZWA 5CSPA 3UPXA 4AF3A 5I0BA 4M15A 4JDIA 4AW1A 4FEUA 3V5QA 3B2WA 4I5HA 3ZCLA 4UMTA 3VNTA 3QA0A 3FYKX 3TXOA 4E1ZA 3UJGA 3DOGA 1FPUA 4DFBA 3WBLA 1YI3A 5AIRA 1ZLTA 4IM2A 4O1PA 2FSLX 2HXLA 5F1ZA 3D94A 2J7TA 3DNDA 3QZGA 4U81A 5FGKA 4D1XA 5FTQA 3FMKA 3L8XA 5M51A 4CFUA 5DH3A 3R73A 5HVYA 2XCKA 2ZV7A 5F94A 4AGUA 1OBDA 5I3RA 2BAJA 3A7GA 5BMSA 5FG8A 4ZLOA 4M68A 2IN6A 2JKMA 3BEGA 4FG9A 4NT4A 4U97A 4YNEA 5HIEA 1XH6A 1YXTA 3CQEA 2Y4PA 3V04A 3QQKA 3GQIA 4YC3A 1CM8A 4QYGA 4D0WA 2HYYA 3FSKA 4S32A 4O7ZA 5DGZA 4DEDA 4J99A 5FBOA 3FXXA 3MVJA 5IQEA 4WO5A 4RFZA 3FL5A 3MFUA 1Q41A 3HUBA 3UDBA 3DKFA 5JQ5A 3TM0A 4DH8A 1OL2A 3IK3A 3ZO4A 4ZY5A 4UZDA 3I5NA 2ZM1A 2XRWA 4XS2A 4FKIA 3TUBA 3F3VA 4M3QA 4FNZA 3PXZA 1JWHA 2B4SB 3OT3A 5HCZA 1XH9A 3R7OA 3BYMA 2XEZA 1ZMUA 2YM4A 2XH5A 4IW0A 4NM3A 4XRJA 5EH0A 5EOLA 3OW4A 5AR4A 5AUZA 1Q61A 3UO6A 2VNWA 2XEYA 4XLVA 3HEGA 4RIOA 5IQCA 3W33A 3MBLA 4M67A 4L67A 4LYNA 3UNKA 4XG3A 4NEUA 5EYKA 2V62A 4I0TA 5C9CA 2XBAA 4F08A 4FTQA 3GI3A 1ZOHA 2GCDA 3T9TA 3BCEA 3AXWA 4J97A 4FNYA 3JR1A 3C5IA 2ZV9A 1GIJA 2UW5A 1J1BA 4PRJA 3DGKA 4S2ZA 4X3JA 3QALE 5IDNA 3U55A 2G9XA 1H08A 2C6KA 3PVUA 3VAPA 4D2VA 4KKEA 4QMOA 4DLIA 5CANA 3WZDA 5HORA 1OI9A 3ORLA 5DEYA 5TT7A 4R5SA 1LPUA 3ACKA 3I4BA 2B53A 4OTWA 2WTWA 3IW5A 5J95A 4CLJA 5AUUA 3IECA 5LMAA 3ZBFA 2R2PA 4F7NA 3WF8A 3WZUA 3LFEA 4YLJA 3ID6C 1J7IA 4D4RA 4KS7A 3F3ZA 4ZS4A 4EOIA 4L44A 4FV9A 1TVOA 4FSYA 4GYIA 2R0UA 3E3BX 4GIIA 5JZNA 3WOWA 3RK5A 1UKHA 1YHSA 4LMNA 4YZNA 1NW1A 3DK3A 3W1FA 3ZRLA 3VHEA 3FEGA 4ZY4A 4HYUA 3ZEPA 2P4IA 2WKMA 4K33A 5DVRA 2QO9A 5LJJA 4O27B 2VO3A 3SQQA 4LV8A 4AE9A 3MPAA 3PIYA 3KEXA 4DAWA 3I0QA 3IW8A 2WQOA 4EJ7A 2QC6A 1GZNA 4WSYA 4ZSGA 1OMWA 5T6KA 2GNFA 2QOLA 3SC1A 3PY3A 4ZZNA 3KREA 4D5KA 5DNRA 4ASDA 5EQEA 3A4OX 3KN6A 1PMEA 1WMKA 3ZUTA 3PXYA 4FKUA 4O7YA 3RAKA 3AGMA 3OOMA 4KKGA 3V6SA 3CTHA 4O0SA 5CNOA 3BELA 3A7JA 2DUVA 4CGAA 4I5MA 5A4QA 3MH3A 3O51A 4AZWA 5LOHA 4I93A 3ZM4A 4WNOA 2QLQA 2XYNA 4D2TA 2PL0A 2UUEA 2Q83A 3EYHA 3PYYA 5HG9A 4E4MA 4DGLC 3QQLA 3ZO2A 2VRXA 2FYSA 4OT5A 4NCTA 3LCSA 3R9HA 3HP2A 4F1MA 4F65A 5C8KA 4QMLA 4TY1A 4Z9LA 1REJA 4QPMA 3NUNA 3Q4ZA 2C5NA 4BDJA 4WHZA 3VJNA 1YVJA 4I6FA 1R3CA 4IB5A 1H26A 4TPTA 5FM3A 5A4LA 3CIKA 5KMIA 3GGFA 5I3OA 3GENA 3LFQA 5FDPA 5JFSA 4EK6A 1YXUA 4F7LA 1SVHA 2HWPA 2PSQA 4TKSA 2XIYA 2GNGA 3ZHPC 2O0UA 1KUTA 2QVSE 2R7IA 5A3XA 3DQWA 4GU6A 3QCXA 4BDHA 1AGWA 3CTQA 3E8CA 3OWJA 1IEPA 2VTAA 3FYJX 4DEIA 3BIZA 2C6EA 3D7TB 4UMPA 2XK4A 1A9UA 2GTNA 3UNZA 4ACMA 4BFMA 4XG7A 1OKWA 3I60A 3NYXA 3DTCA 3MFTA 3RPRA 4C35A 5AP6A 1H00A 4PL3A 3FKNA 3IQ7A 3UQFA 5E8ZA 5GIOE 2UW3A 3DBCA 5KUPA 1OKZA 3RAIA 1R0EA 4AAAA 4FMQA 4BCGA 4F70A 1OUKA 2R3GA 4QMNA 2UVZA 1UNGA 4IMYA 1ZARA 3ZFYA 3WF5A 3TDVA 3JXWA 4DFYA 1AQ1A 4EK5A 2J0MB 5LVMA 2EXEA 4G34A 3QXPA 4IAAA 4TRLA 3RHKA 4EH2A 5BVNA 2OU7A 1J3HA 4EJNA 2X7FA 3P78A 2BPMA 2JBOA 3SX9A 1YKRA 3BLHA 4GFOA 2X39A 1YOLA 3R7GA 2WNTA 4IDVA 4ITJA 4XH6A 4MNFA 3VS7A 3ZUVA 4F99A 3H3CA 4O83A 3IW4A 5JRQA 5KE0A 3MN3A 3ZTXA 2B7AA 3QWJA 2VWWA 2XKFA 3N4TA 3DDPA 4PPBA 5HX6A 5CF8A 3DAEA 4Y95A 2BMCA 3LXPA 3SLSA 4USFA 3ANQA 5KMMA 3FLZA 3R00A 4FNWA 4P7EA 1R78A 5AP7A 2EB3A 3ZYAA 4RQKA 2WU7A 2GNIA 2X6DA 2OSCA 3OXTA 4UYNA 5L8KA 4ZP5A 2I0HA 2YCSA 5I9UA 2W4JA 3CY2A 1YI6A 3AC8A 4R5YA 4C02A 4D9TA 5AV3A 5TO8A 2WMUA 5CAOA 3RI1A 3VUHA 3BBWA 5M53A 4IFGA 1U4DA 3CY3A 4EOMA 2HOGA 1PKDA 3NAXA 3W2SA 3QTRA 1W0XC 2R3QA 4U44A 3NYNA 4IIRA 3TV6A 4CKIA 5HBHA 2ZB0A 5AP1A 4CQGA 3NCGA 1PYEA 4JR3A 2OWBA 3EN6A 3F2AA 5BUIA 3FLWA 4M97A 3OC1A 2VWUA 5AMNA 5AP2A 3MY5A 4AUAA 4OW8A 3HRCA 1ERKA 3DBQA 4F63A 1NA7A 4L01A 5ETAA 4AOIA 2Y4IC 4Z7GA 5EYMA 5DBXA 5H8GA 4LGGA 4ZJVA 4EORA 2HIWA 2X4FA 4CRSA 4ZK5A 4BZDA 3GFEA 2BR1A 4FSMA 5L6PA 3E8DA 1OL5A 1XWSA 4KBAA 2G15A 3ZXTA 5BQ0A 1OKVA 2VN9A 2BIYA 2F4JA 3QRUA 3PE2A 5CS6A 5ANEA 2WTJA 3R7EA 5BPYA 3DJ7A 4FSZA 5ETIA 3TZMA 1ZZ2A 4MXAA 3P86A 2PVJA 4N4SA 2ZMDA 4GEOA 2QG5A 4R7IA 2KTYA 5E92A 3ZH8A 4D5HA 2OXDA 4G2FA 5FXRA 4Y73A 4HGTA 1IRKA 1IAJA 1SMHA 2JDVA 4EYMA 4EOLA 2F7ZE 1XH7A 3PXKA 3QKMA 3TN8A 3NLBA 3IO7A 2OG8A 3QAME 5CT0A 5K0KA 4AGDA 4C4GA 3RCJA 4QQJA 4Z16A 2BCJA 3OEZA 4M69A 5DN3A 3HMIA 4AN2A 3R2BA 3UOKA 3DAKA 4PF4A 1VYZA 4C4FA 3W32A 4CMOA 2BFXA 4ASZA 4O21A 4U5JA 3R8VA 5K4IA 2CKQA 4IZ7A 5D11A 2RG6A 4UZHA 4X21A 4ERWA 4LOPA 1M7QA 4FTMA 3ENHA 2QR7A 2IW8A 4HVSA 2CGXA 3ALOA 1M2PA 5E8XA 5FEDA 4YLKA 5BYZA 2YFXA 1R0PA 5AJQA 3M42A 4U3YA 4ANMA 2R0IA 3VJOA 1BI7A 4IADA 2W1ZA 3C5UA 4B8MA 5J5SA 4EHGA 4J96A 1Q8ZA 3D4QA 2OLCA 4DT9A 3FDNA 2AC3A 2QHMA 4YURA 4EBVA 3MH1A 1IASA 3QZFA 4LRJA 3LVPA 3QKKA 1BI8A 1DM2A 2PTKA 4FG8A 4XJ0A 2W1HA 3MFSA 4ANQA 4C8BA 4ZXTA 4QMPA 4TYHB 4WSQA 3MPMA 2J51A 1FVRA 2WHBA 4EOOA 2VTJA 3A99A 4BDKA 1JQHA 1OUYA 3NNVA 4NSTA 3NPCA 3GCSA 5ACKA 1J7LA 3TUDA 3N4UA 3O71A 5E9EA 3HMOA 3JYAA 3V5PA 4D2WA 3U8WA 4AW5A 4BDIA 2CGVA 3Q4UA 4ALVA 4AZSA 4FEVA 3EHAA 3F61A 3CGFA 3AT2A 3E7OA 3TG1A 4A7CA 4C61A 2CKPA 3GU4A 3Q04A 4BF2A 2A1AB 3RVGA 3HX4A 4IVBA 2QOBA 5ITAA 4MD9E 2IG7A 4U42A 5HTBA 4EH6A 1YXVA 3PSBA 4QMZA 1JAMA 3ULZA 2ACXA 3PWDA 1YOJA 4GW8A 4C33A 1Y6AA 2Q0BA 2Y7JA 4V0GA 3V5LA 5CVFA 2C30A 2XNEA 2XMYA 4RC2A 1WFCA 2XRUA 4PPCA 3KXHA 2YM5A 3PTGA 3GC8A 5CF5A 3AT4A 3FZTA 4ZY6A 1H1SA 3FMEA 4FIHA 3VULA 3W2QA 4D0XA 2Z02A 3NUPA 4Y46A 2QU5A 4FIEA 2WQEA 2W4OA 4M0ZA 3ZSIA 3WZKA 4AXAA 3C4XA 4BCHA 3KF4A 3Q52A 5CWZA 3IDPA 5A4CA 4CG8A 5AFVA 3QUEA 3H10A 4CV8A 4FE2A 3EQBA 4O7LA 3F2RA 5HX8A 4MK0A 5DT0A 1WBNA 3BGPA 2XKEA 4JBVA 4QTBA 3R9DA 4NM0A 3HV6A 4FTLA 4JQ7A 3SW4A 5EI8A 4L45A 4F64A 1NY3A 3FXWA 3TIYA 1U54A 1U5RA 4E5BA 3E64A 2A4LA 1Q8WA 2VTIA 2X2KA 3LM5A 3MPTA 2ETRA 2GFSA 1T45A 2PE0A 4KSQA 5K0XA 1YHWA 2HY81 1PMUA 2W5AA 5HGIA 2GNJA 1SNUA 5I9ZA 4Y8DA 3SKCA 3MH0A 1OVEA 4O2ZA 4JX7A 4X2FA 1IAHA 4FKRA 5AP3A 5DI1A 3U51A 4MF0A 1P14A 2R3NA 3TNPC 1S9IA 4MCVA 4AWIA 2ERKA 4IM0A 2AC5A 4CTBA 4FEWA 5DLSA 3EFLA 4GJ2A 4QTEA 4L52A 4P2KA 2OIDA 2F2UA 3BHUA 1WCCA 4XOZA 3Q2MA 4WOVA 4FICA 4V01A 5FWKK 4AU8A 5L8JA 1ZWSA 2CDZA 2J4ZA 3PSDA 4E93A 4L68A 4O86A 4ACCA 3V3VA 3ORXA 3K5UA 3PLAE 3NIEA 4WNMA 4X2GA 2W06A 4A9SA 5IA4A 2XYUA 3PXFA 3R7YA 5CNNA 3AMYA 3BHYA 5JFWA 3ZRKA 4K6ZA 4MAOA 2J5EA 5HNGA 2QI8A 1Y57A 4KNBA 2GHGA 4WD5A 2W9FB 3ULIA 2W1CA 1XO2B 3QRJA 4AP7A 5J7BA 1OPLA 2WTKC 4M0YA 5IEYA 5JT2A 2ETKA 5IA0A 1JVPP 1LP4A 3WARA 2GQRA 3G9NA 3R2YA 4YBJA 4BBEA 3NX8A 1PXKA 4NM7A 3EQHA 4V04A 4I3ZA 2UZLA 4RGJA 4LGDA 3MB7A 1GNGA 5KMJA 3DBEA 4A9UA 3D7ZA 4QYYA 3NMUF 3C4ZA 1GIIA 2E9OA 2X1NA 3ZOSA 4IX4A 5CI6A 4WG4A 2C1BA 4U7ZA 3LAUA 1NXKA 4J7BA 4XEYA 4R3RA 2ESMA 3P7AA 2Y6MA 3ATSA 1ZAOA 3PVGA 2PUIA 3ZXZA 2X0GA 5HTIA 2JDSA 1HOWA 3TNWA 5HO6A 2OXYA 2UVXA 2X8DA 3FUPA 2J5FA 3QD0A 2DYLA 2ZVAA 4USDA 3KULB 3Q4TA 3D9VA 3PJ2A 4G1WA 4FVPA 5KMNA 2Z60A 2WMXA 3R8PA 1H07A 5KHWA 4FIFA 1OGUA 3QL8A 2QOQA 5J1VA 1JSUA 4RA5A 4FKVA 4JX3A 2A27A 2BTRA 3ZC6A 5AV1A 5KMKA 4NYEA 3QZIA 4FOCA 3QLFA 4IB1A 3BU5A 5HU3A 4FBXA 1KWPA 1OPKA 2UZBA 4FYOA 5HNBA 3GQLA 4FF8A 4QMVA 5CU0A 5DIAA 3IONA 2X7GA 4H3BA 3LFBA 2WMAA 2BDWA 1G5SA 5KHXA 5IQBA 1JOWB 2XS0A 3PP0A 5M4CA 2X2MA 4GG5A 4FV3A 4E8AA 4KAOA 4OBOA 4ALWA 1PRYA 4JIKA 2ZJWA 1WVYA 4JVGA 1JKSA 2JIVA 3NUUA 4J95A 4USEA 1F5QA 5IF1A 1YXXA 5EI2A 4EOJA 4AT3A 4NUSA 4RJ4A 3FZSA 3SAYA 3R71A 4AOJA 5F9EA 4E3CA 1H27A 1FQ1B 2YHVA 3EZRA 4ALUA 2IZUA 3OOGA 1IG1A 4NKAA 4EHZA 4MQ1A 3C4CA 1H1PA 3FBVA 5T3QA 3VQUA 2IO6A 4FSTA 4OGRA 4HGLA 3SXSA 4BGQA 2BZJA 2YM8A 2F7EE 2JAMA 3B8RA 4NIFA 3QWKA 3HLLA 4YJSA 3RP9A 3V51A 3Q96A 3UIUA 3BHHA 1Q62A 4G3DA 4M66A 3C0IA 1O6YA 1BYGA 4AZTA 3OF0A 5DE2A 2HENA 5HOAA 1G8SA 3SOCA 2VWIA 5AAFA 5CASA 4YJPA 1DAYA 3MIAA 4QNYA 3D5UA 3D83A 1H4LA 2IVVA 4CXAA 4GH2A 2QURA 4IVDA 5HG5A 4RLKA 2JDRA 3POZA 3WE4A 2RGPA 4RBLA 4XYFA 2OF4A 3V6RA 4B8LA 1UWHA 4AW2A 4ZTQA 4DEGA 2CCIA 4FK3A 1GZ8A 5EM7A 4BKJA 1SNXA 3PJ1A 3AMBA 4FTTA 3K5VA 3QTUA 3ACJA 4FTKA 5CQWA 4ENYA 3OZ6A 3RMFA 3RPVA 4I6QA 3MS9A 2Y0AA 4ZJIA 2OFUA 4HZRA 2GQGA 4DINA 2R5TA 5CU4A 4U80A 3I0OA 4L6QA 1QCFA 2C47A 2YZAA 2VWBA 3PRIA 4EH3A 4X3FA 3FPQA 4D55A 2OKRA 1K3AA 3A2CA 3KA0A 5BX0A 5CEQA 2XF0A 4M8TA 2J0IA 2XIXA 3GEQA 3UO5A 4LG4A 3MESA 3FMNA 4O22A 3E8EA 3R21A 4NW6A 3FLYA 1MQ4A 4O1OA 1PXJA 1UV5A 2C0IA 2E9PA 4IWPA 3UNJA 4BKYA 4AZVA 2VTPA 1Q3DA 3MWUA 4MKCA 5IQHA 3ZFXA 3W18A 2QOKA 4TNBA 3A8XA 3D2KA 4C4IA 3FMDA 2BRNA 4H3QA 4DH1A 5IDPA 5BYLA 3QD2B 3GVUA 2GMXA 3UP7A 2G2IA 5AR2A 4CFVA 5C1QB 4B7TA 3PG3A 3HMPA 4GJ3A 4BBMA 4EOKA 5HLPA 4FV6A 4HNFA 4I6HA 5FDXA 3L1SA 4PTCA 4GG7A 5LMKC 2FSOX 3C4FA 2BROA 4UBAA 4MXCA 4ASEA 4DT8A 3QBNA 1XHAA 2PZYA 3S2PA 2XM9A 2V0DA 3RK7A 3OP5A 3D14A 2WEIA 2JC6A 4I24A 4RZVA 3F9NA 3KK8A 3R8UA 3RPYA 4MWIA 3CP9A 1M52A 5CQUA 2H8HA 2KULA 2PK9A 4O0VA 4UB7A 4FEXA 4NU1A 3RBWA 2ITTA 3CBLA 3CR0A 4O91A 3LFSA 4RVLA 2WOTA 4FV0A 3QC9A 5AA9A 4D4SA 4FKPA 3V5JA 3L8PA 3QTSA 1PXOA 1UA2A 3G6HA 3GUBA 4WBOA 1MP8A 1Z57A 4GT3A 5C03A 3UE4A 4C36A 3DJ5A 3EH9A 4XG6A 1U46A 3OEFX 2BAKA 4TXCA 2YISA 4CKJA 5HI2A 4BR3A 2R3JA 2XZSA 1A48A 2BFYA 2GHLA 5ANIA 3EL7A 4FKTA 5AR7A 3CGOA 3AC3A 3EN7A 4Q9SA 3G0EA 4F6WA 2X2LA 5CF6A 4RX5A 3UG2A 4CMTA 4JBQA 2O2UA 1ND4A 3K2LA 2JAVA 2RL5A 4MBJA 4FT7A 1KOAA 2R4BA 3PJ3A 3OBJA 4OBPA 4DGOA 4YTHA 3ORTA 3ZUUA 1Q4LA 3A8WA 5FRIA 1OM1A 4X0MA 3VBTA 2PZ5A 2B0QA 4GK3A 3KMMA 3LXLA 4BDAA 5B0XA 5AP5A 2F49A 2QOOA 4AGCA 1L8TA 3O17A 2PE2A 4APCA 5EYCA 4YU2A 4YPDA 5CI7A 4JRNA 3O0GA 2Z7QA 4L00A 5CLPA 3R63A 2QG7A 4LGHA 4O2PA 4II5A 4XOYA 4Y85A 3VS0A 5IA1A 4N57A 1W83A 3FZ1A 4BCNA 4BICA 5IA2A 5CTPA 3O50A 1OZ1A 4IB3A 5KCVA 3GCUA 4HYHA 3AD4A 3OCTA 4RIYA 4V05A 4XG4A 4DH3A 5EW3A 3KF7A 3OHTA 3V01A 2IW6A 1K2PA 3GU7A 3I7CA 3NDMA 3DV3A 4FZ6A 4WIHA 3VUTA 4MQ2A 3SG8A 1PJKA 3R1YA 5IA3A 2XKDA 3ZLYA 5KMOA 5GHVA 2W7XA 4L43A 2YCFA 4HCTA 3OUKA 1PXIA 4DCEA 1OKYA 4QP7A 5HNIX 2Y8OA 3F5GA 3RZBA 3QKLA 4BRXA 3ITZA 4HPTE 3CTJA 4EONA 5EM8A 3EYGA 4EKKA 3GC0A 2QODA 3FY0A 4AA5A 4OAVB 2GS6A 3ZLXA 5F20A 2OGVA 2Y9QA 3QQUA 4C4EA 2VGPA 4E5WA 1CKPA 1YWNA 2HCKA 3SXRA 3UC4A 4KS8A 2IVUA 4BB4A 3MIYA 4JI9A 3R7VA 3QTQA 2YM3A 3TV4A 5CAUA 1IA9A 5L2TA 3E3PA 3F5UA 1MQBA 3NUXA 3R01A 1G3NA 1WBWA 4FT9A 3Q6WA 3LLTA 4WNPA 1PXPA 3IGGA 2OH4A 3NAYA 4C34A 5TF9A 2HY0A 4EBWA 5J5TA 2BZKB 2WQBA 4CNHA 3S3IA 3C50A 4B4LA 5LVNA 4LRMA 4DH5A 2JFMA 4FTUA 4L42A 1YWVA 4MTAA 4ZZMA 4F9YA 3ZM9A 2XNGA 1UU3A 1PXLA 4J98A 1KE5A 4FI1A 2CN5A 2YIWA 4BKZA 1WBOA 1PYXA 4Q5EA 4QP3A 5J8IA 3D5VA 3VBXA 3DCVA 3W2RA 2ITYA 4YHJA 4DGMA 3F88A 5GJGA 4AN3A 4FZ7A 4EH8A 5HD4A 1MRUA 3EKKA 4L3JA 2YERA 5EFQA 2EXCX 3CS9A 4PV0A 4AW0A 1H8FA 3PE1A 3P0MA 5HU9A 2OJIA 1GAGA 4C3RA 4I21A 4QD6A 1LEWA 4DGGA 2F2CB 5AP4A 4H3PA 2C3IB 3KXGA 4QQ5A 4DC2A 4E6DA 3P79A 4EYJA 3OY3A 3FY2A 4YC6A 3QGYA 4WUNA 3WYXA 4A07A 2XIKA 3GCVA 5CEKA 1RE8A 3E62A 4WKQA 3QHWA 3QX4A 1NVSA 5EKNA 5K9IA 3DQXA 4GUBA 1LUFA 3BGZA 4I5PA 4LL0A 4OT6A 3VHKA 3MVHA 1M14A 4L8MA 4A9TA 2ITUA 5IA5A 4KIKB 4P4CA 4A4LA 5HCXA 3T8OA 5EG3A 5D10A 3EOCA 5M55A 4FTAA 4BDBA 4O0RA 3U4WA 2QNJA 1NT2A 3ZMMA 3T9IA 1SM2A 3HDMA 4QQTA 5AP0A 3WIKA 1LEZA 4FSWA 4CG9A 1Y8GA 2XK8A 5BVOA 5J9YA 1YDSE 2XNOA 3ZC5A 4M69B 5IEVA 3TL8A
chains in the Genus database with same CATH superfamily
4FC0A 2EVAA 1XH4A 2HW6A 3CKXA 3UO4A 2JLDA 4UALA 2VTSA 1QPCA 4L53A 4QMMA 5T68A 5C4LA 4L3PA 4YZBA 1P4OA 3W8LA 4I0SA 2CSNA 4DBNA 5EDPA 2JIIA 2RG5A 4JL9A 2EUFB 4APPA 5IU2A 4A4OA 4HGSA 4QMUA 2ONLC 3OWPA 4RLLA 4OR5A 3E88A 4O7RA 4MBIA 3UOJA 3UDTA 3VUKA 3BYVA 3MVMA 3QD3A 4PMPA 4O7TA 2ZB1A 2X4ZA 4IZAA 4QMSA 1B39A 1RQQA 2JBPA 4TWPA 4FUXA 4OTPA 2EWAA 3BBTB 4JNWA 3TIZA 4LV7A 1URWA 2JFLA 4Z55A 2XJ2A 4OTRA 3Q9YA 4NTSA 4AQCA 3UOHA 3GCPA 4D2SA 3UQCA 4QMTA 2QOCA 5AM7A 2UW6A 2CHLA 4D58A 3C1XA 4PDYA 4ZTMA 4Z7HA 2NPQA 3ZONA 2XJ0A 5JSMA 2CNQA 3F69A 3JVRA 4K8AA 5CSWA 2OZAA 2J50A 2B52A 3RKBA 1GJOA 3FC2A 3LFDA 4YSJA 3F66A 5H2UA 2J9MA 2J0JA 4O0YA 4OUCA 1B38A 3LW0A 5CZHA 2JKQA 4MYGA 3QF9A 4EOPA 2RSVA 5CXZA 2CKEA 1Q24A 4AG8A 5HVJA 1UNHA 2W5HA 4G17A 5HHWA 4O81A 3NYVA 4ZOGA 3BEAA 1V0PA 4DG2E 2IPXA 1CDKA 4IACA 5C26A 3DZOA 4FV4A 4KB8A 3U54A 3RNIA 4I94A 4DTBA 4G5PA 1SVGA 2B55A 5TKDA 3AT3A 3S1HA 5J87A 2OFVA 3PA3A 1Y91A 3ORMA 3FZRA 4V0GB 4FV8A 5I9VA 2VX1A 5HCYA 1YRPA 3NW5A 3U4UA 5JGDA 1PMVA 3BU6A 2BKZA 4IQ6A 2XCHA 4FT3A 2HAKA 3GNIB 5J79A 3S0OA 3EKNA 3FQSA 4JOAA 1F0QA 2C4GA 2IVTA 2YAKA 3C7QA 4HCVA 4QO9A 3KIOC 3RHXA 4WUAA 3PY0A 4UWCA 3D5WA 4X2KA 4F9BA 4I22A 2JITA 5CSVA 3SXFA 4MD8E 4JG7A 4F0GA 4EOQA 4D2PA 4NK9A 4I6LA 3DK7A 2W96B 3MB6A 2C5XA 3MDYA 4ZTNA 3VBVA 5J7HA 1RDQE 3SRVA 1E1XA 2UZOA 4MHAA 2OO8X 4JR7A 5DRDA 3VWAA 3KN5A 4EWQA 4F7SA 4TYGA 5A6OA 4ZIMA 3FLNC 2YJRA 4FKSA 2ZYBA 1O6LA 4XV2A 4H36A 4CLIA 3H0YA 4AT5A 4MX9A 3CQWA 4G16A 4ITIA 2H9VA 4BDDA 1XBAA 4TYEA 3TKUA 1W98A 3OD6X 1P2AA 3GC9A 4FODA 4ZMFA 4LMUA 5DT3A 3FZPA 2GPHA 3ZU7A 4BTJA 4I4FA 1KE8A 3ORNA 3RTPA 3W8QA 2GS7A 3ZSHA 2R7BA 4QP8A 4QDEA 5LWMA 4P90A 4B9DA 2VTOA 3LQ8A 2X81A 3RPSA 4RG0A 4DEEA 5DT4A 5L8LA 4JQEA 4UMQA 4YZMA 2QOIA 3KXNA 1AD5A 3L9PA 5JRSA 3CKWA 3KXZA 3BYUA 1XKKA 1ZXEA 3NNUA 4FX3A 4GFMA 4IJ9A 5E1EA 3E93A 3TTJA 3HA6A 4HNIA 4QTDA 1W2CA 3QQHA 3DKGA 3IW7A 2BRGA 2PMIA 3BPRA 4MWHA 4PTGA 4R8QA 3UVQA 1XH8A 5GZAA 4B99A 2V55A 2GQSA 4LFIA 2W1EA 3TZ7A 1JSTA 3QFVA 4Q2AA 5KBRA 4OTHA 3UZRA 3IG7A 4CEGA 1GOLA 3IW6A 5IMXA 3PPJA 2BRMA 2IZTA 4BYJA 2PY3A 2C5VA 3QYZA 3WI6A 3AC4A 2ZV2A 4FJVA 3HV7A 4IHPA 3FPMA 5HESA 3R8ZA 4S31A 4DBXA 1GZOA 5CEMA 4FKWA 2R9SA 4LI5A 2BHEA 3V8SA 2Z2WA 3EB0A 2OBJA 4ITHA 3VS3A 2BILB 3BX5A 1O6KA 3CD8A 3PPKA 3QTWA 4RWJA 5EQYA 2HZNA 2XAOA 5B2LA 2C68A 3LQ5A 3LXKA 4DEBA 3BV3A 5HE3A 1OIQA 3VO3A 4UV0A 3QGWA 2BAQA 4BWKA 4E6AA 1K9AA 3ORIA 5C8MA 5HEZA 3BGQA 3UBDA 4AXCA 2P0CA 3BE2A 3DS6A 4LOOA 4U79A 3ZS5A 4A9YA 3LZBA 4DFNA 4E4NA 3UPZA 4Q9ZA 1DAWA 3NUAA 5EQPA 4EUUA 2G01A 1JSVA 4KSPA 5HE1A 3UIXA 4R7HA 1OITA 1ZYSA 2QQ7A 4BI0A 5KMLA 2XK9A 5EW8A 1ZRZA 2BUJA 5AR8A 3DLZA 4BCJA 1H01A 1L3RE 3RZFA 3RNYA 3L9MA 5CEOA 4JBPA 2RFDA 2JDOA 2P33A 3C0GA 5EHLA 4WBBB 5CU2A 3E5AA 3QC4A 1W84A 3VBWA 4D4VA 3CPCA 2LGCA 3DA6A 4MH7A 2UW4A 2OJ9A 4TWCA 1YI4A 4DFXE 4N6ZA 5J1WA 5FEQA 3LM0A 4E6CA 4FV7A 2E9UA 4YBKA 3TCPA 3ALNA 4YUQA 3O8PA 1J7UA 2XALA 2C0TA 2WMWA 3DLSA 3JPVA 3NS9A 4O6EA 2DWBA 4S33A 3G15A 3MTLA 3KU2A 3LXNA 1JKLA 4QNAA 4O4CA 4YZCA 4CCUA 1YWRA 2B9FA 1P5EA 5I5ZA 2LAVA 4RWLA 2XK6A 4C59A 3KY2A 4C0TA 3PY1A 4C4JA 2VWYA 2WIHA 2UZWE 3QRIA 2PZIA 3ORPA 3U6HA 3EFKA 3I7BA 1WBTA 2DQ7X 3NNXA 3VF9A 4U8ZA 3GU5A 2ZDTA 4E26A 3TJCA 3DTWA 1GY3A 3R0TA 4JBOA 3W0OA 2R3FA 4F1TA 4R7BA 4QDVA 4CZYB 5ACBC 4JS8A 1BL6A 3WZJA 4LRKA 3W2CA 4AOTA 3W0PA 5GJDA 3QUPA 4KIOA 3RINA 4FTIA 2WU6A 4BTMA 1EH4A 3TNIA 3ZO1A 3HUCA 4J1RA 3PXRA 4MNEA 1Y6BA 3UODA 3D15A 4KABA 4MF1A 3EQGA 4NIFB 1CTPE 3FKOA 4GVJA 4R77A 3EIDA 3Q5ZA 4TN6A 4BHNA 3NFGB 2UZUE 2W99B 3AMAA 5M44A 2C5YA 4P5ZA 5BV3A 4W9XA 4J8MA 5BUEA 4A9RA 3K3IA 2E9NA 4QP9A 3C4WA 4DTKA 4RIWA 4UYAA 2W17A 3KFAA 3M2WA 5GIPE 1JNKA 4U40A 1VZOA 4CV9A 5A6NA 4F7JA 5IQIA 4QP1A 2VTRA 3JY9A 5C27A 2FB8A 3KRXA 2F9GA 4JDKA 5JH6A 2GHMA 1IR3A 4U43A 4PDSA 2WTIA 3TYKA 3DU8A 3REPA 2OIBA 4AFEA 3F6XA 3ODYX 4IDTA 4IB0A 3C9WA 4K0YA 1W7HA 3O7LB 4R3CA 3BWFA 1MUOA 4M84A 4HVGA 1MRVA 2BKKA 3LOKA 1ZYJA 1W8CA 2VD5A 3PP1A 2VU3A 2Z7RA 3LCDA 4FTOA 4GV1A 4L3LA 4NH1A 3RM7A 3VW6A 2XP2A 3FWQA 1BUHA 2CMWA 3D5XA 4LM5A 3R83A 3V5WA 3T3UA 4X3FB 4EHVA 1HCKA 4R1YA 5M09A 5L6OA 4J52A 5JKGA 2JEDA 2C6OA 2O3PA 2X6EA 3JS2A 4PNKA 4BDEA 3NR9A 4AAYA 3EJ1A 3GC7A 3UQGA 3KB7A 4X2JA 4MD7E 4DG3E 4O0WA 3A61A 3FLQA 3GOKA 5A46A 1QL6A 4O7NA 1Q8UA 3R6XA 3MH2A 4HOKA 5AUXA 4RIXA 3HRBA 3JVSA 5KX8A 3GT8A 4X2NA 2CGUA 2HZ4A 2ZV8A 4FG7A 3K3JA 4FSUA 4A4XA 4B0GA 3HKOA 4JT3A 4RFYA 3FXZA 5F95A 5EHOA 2C3LA 5E8TA 3OTUA 3N4VA 3VF8A 2WOUA 3BU3A 4CVAA 2UV2A 4AT4A 3TDWA 4PL4A 4XCUA 3PG1A 3E7VA 2W4KA 5CEIA 4EH4A 1Q97A 1OIRA 5LQFA 3EQIA 5A4TA 4FEQA 2ITWA 4AZFA 2BZHB 3A7FA 4C38A 2WD1A 4FYNA 5CU3A 4CFXA 5IISA 1TFFA 3P5KA 2HK5A 2BZIB 4DHIB 4NFMA 3NVKI 4ZLYA 2OI4X 3ELJA 3LCOA 4RWIA 3RGFA 4O7WA 2VO6A 5JGBA 4AQKA 4C58A 2QR8A 4TYJA 5H9BA 4PMTA 4KINA 4JJRA 5AUYA 2OJGA 4FIIA 4FL2A 4TWOA 4C7TA 5C4KA 5IZFA 5CALA 4IZ5A 1V1KA 2GNHA 5B7VA 5CY3A 3QX2A 3DAJA 2C6IA 5DHJA 4RVMA 4S30A 2QKRA 3EMGA 5AAGA 2UW7A 1ZOEA 4KRCA 5DEWA 4J71A 2BTSA 5KKRC 5M4FA 5AA8A 1OL1A 4IH8A 2Z8CA 3R22A 4WRGA 4BIEA 2C6LA 5K3YA 4O82A 3CSVA 5BVKA 4JLCA 5D7AA 3G51A 5D9HA 2R3KA 5G6VA 2VZ6A 5CT7A 3UG1A 3VQHA 4ERKA 4K77A 4O0XA 4W9WA 4ASXA 4TWNA 4I5CA 4JIAA 5FTOA 2ITXA 3EL8A 1FGKA 5EI6A 3FE3A 3P1AA 4W4VA 4D1SA 4YJNA 3SVVA 2O63A 2XNNA 4GMYA 4PNIA 3NSZA 4OTGA 2HELA 5DR6A 3ZDUA 4DH7A 5L3AA 3AKJA 1YOMA 2NO3A 4PPAA 5I9WA 3TJDA 2E9VA 3R1QA 2XK3A 3HMMA 1MRYA 3PJCA 3THBA 3ET7A 2O8YA 4C37A 4CYJA 5HE0A 4KA3A 4RX8A 4FT0A 2YZLA 2C0OA 5FBNC 1M17A 3EQPA 4NCTC 2X0OA 3FMHA 5GJFA 4YR8A 4EHEA 3C13A 4EC9A 4EI4A 1YDRE 3OW3A 5J9LA 3U9NA 4E20A 4BI2A 4GRBA 4C62A 4CT1A 1ZY5A 4RIYB 1PF8A 4KWPA 4RJ3A 5CX9A 3TI1A 4M14A 4CYIA 3D2IA 5AEPA 2PHKA 1OIUA 2UW0A 2YDJA 3A62A 3F3TA 3QCYA 4GYGA 5CSXA 3V8WA 4C2VA 3OROA 3O8TA 2V7OA 3UVRA 3COKA 1V0OA 2YIYA 1YXSA 3MJ1A 4BCMA 1ST0A 3NGAA 1OL6A 4M7IA 3KMWA 5IH6A 4LOQA 3MA3A 4QPAA 3BQCA 1BMKA 2PMNX 3BZ3A 5DOSA 5A9UA 2JIUA 2Q0NA 3MYGA 2WMRA 1ZMWA 3P7CA 1VJYA 3W2PA 3IDBA 4RX9A 1UVRA 2GS2A 4WNKA 4RRVA 3FHIA 4O0TA 3DXNA 3DB8A 1VYWA 5DRBA 1OB3A 2CCHA 2WQMA 3AG9A 3CJFA 4KIPA 4RA4A 4F9WA 1J91A 2CJMA 3QD4A 5FXQA 4CQEA 4H1JA 5AX9A 3KXMA 3AGLA 3NCZA 4DFLA 4IX3A 3QQFA 3FSFA 4M12A 2YWPA 4BDCA 3T3VA 5C8NA 3VUIA 4TL0A 4BI1A 4IAFA 2JKKA 5G1XA 2Z7SA 4RT7A 3RM6A 4EK4A 3UP2A 2YLFA 2O65A 3LMGA 5AUVA 5KKRB 3GOPA 2FA2A 2GU8A 1QPJA 3AD6A 1G8AA 3R28A 4XNEA 3FKLA 3ORZA 3QHRA 4GK2A 2B9HA 3OTVA 4L7SA 4UWYA 3TNQB 4PDPA 4GU9A 2QKWB 2YDKA 3MV5A 4I20A 4QMWA 4ZSEA 3ZSGA 1GIHA 3TMOA 3EQDA 4IBMA 3ZO3A 5BVEA 5HO8A 4AFJA 5FUTA 2E2BA 4DEAA 5EDQA 4BCOA 3W55A 4RMZA 4FGRA 3DDQA 5LVOA 4QP2A 1I44A 3B8QA 3KULA 4O84A 5ANKA 2V5QA 2O64A 4QMXA 2ITOA 4BC6A 2VTQA 2H6DA 3M11A 3PWYA 2WMQA 1YHVA 4YZ9A 3W16A 3PVBA 3UGCA 2G2HA 2CN8A 2I6LA 3HAVA 4IVCA 4QMQA 4DTAA 2WMSA 1ZMVA 3C0HA 2OXXA 1KV2A 4E7WA 4IAYA 4Y5QA 3ZFMA 2CKOA 5IUGA 3BHVA 3NYOA 4CFMA 2ITNA 3G33A 1JBPE 4K9YA 3SOAA 2RFEA 3UMXA 4FOBA 4ZTSA 4FR4A 4ANSA 1JKTA 2YCQA 3DPKA 1BLXA 4ANNA 2F7XE 5E8YA 4BY9E 4GKHA 4MXOA 5L6WL 2A0CX 2QLUA 3ETAA 3F7ZA 5AR5A 3WZEA 3HA8A 4UX9A 1UKIA 5IQDA 3FHRA 3H9RA 1R39A 5M4UA 5M08A 2ZOQA 1TQPA 4YTCA 1E9HA 4FSNA 4EH9A 3EZVA 3IGOA 4AX8A 4R3PA 2I0YA 1TQMA 3CE3A 3VBQA 1I09A 4HJOA 3KVXA 1PHKA 2NRYA 2FSMX 2NNWB 2YEXA 3COIA 3H30A 4YNOA 3UVPA 3VS2A 3EQCA 3SHEA 4FVQA 4GT4A 2UZVA 3QCQA 4EQMA 5KZ0A 4G6NA 3VS1A 4GT5A 4BGHA 4PTEA 3NRMA 3DFAA 3S95A 5B2MA 2UZTA 4BCQA 2PUUA 5E8VA 4YHFA 4FTCA 2PVYA 4FIGA 3DJ6A 5CYIA 4FUYA 2Z7LA 5AV0A 2VX3A 3N51A 3Q5IA 5LVLA 5AV4A 5BUJA 2W1DA 2R3PA 3Q2JA 2WXVA 5M4IA 3OCBA 5IMEA 3HV5A 4FKOA 4FL1A 5E4HA 3FQHA 3NUSA 3EWHA 1PKGA 1WVXA 1IA8A 1NVRA 2ZM4A 3G0FA 3NZ0A 3ORKA 3QCSA 5DR9A 1VEBA 2W1IA 2ZAZA 3MY0A 5DG5A 5LXMA 2CNVA 5IPJA 3PA5A 3NFFB 5EKOA 4NJDA 4QYFA 4A06A 2PPQA 3R9OA 5CAPA 1XBCA 4XHKB 3L8VA 4LUDA 3R7IA 5K4JA 3HZTA 2PMLX 4XUFA 3DT1A 5HVKA 5CXHA 2BDFA 3AC5A 5M06A 3NEWA 2UZNA 5L2SA 2HZIA 1ZZLA 3LQ3A 2PULA 1UU7A 3ZLSA 4IAIA 3ENMA 4RQVA 4DFUA 3I79A 4CKRA 2OZAB 3P08A 1QPEA 3VUMA 2YIRA 2XNMA 2B54A 4GK4A 4WG5A 5K5XA 3SW7A 2ITZA 5BMMA 3U9CA 1UNLA 4Y83A 4E4LA 5E91A 3HL7A 2OF2A 4YJOA 4AZEA 3WF7A 3B2TA 5E8UA 2XBJA 4ACDA 4ACHA 4DGNA 2OJJA 2YIQA 2P3GX 4D2RA 2UW9A 4EC8A 1OGYA 2WTCA 1SYKA 4ZSAA 2HW7A 4U0IA 2XB7A 2FVDA 3QQGA 4CRLA 4QRCA 3VIDA 4YJTA 5LARA 3KMUA 1OBGA 3R1SA 2JDTA 3GBZA 5GINE 3KC3A 5D7VA 1SVEA 2XJ1A 4G9RA 3ERKA 2VX0A 2Y6OA 4I4EA 4F9CA 3KRWA 2WELA 2WMTA 4HGEA 4YO6A 3EQFA 4ORKA 4K2RA 3WF6A 2C6MA 4ZSJA 2WPAA 4RJ6A 2QCSA 3O2MA 4AE6A 1H1WA 2VGOA 4DLJA 4O38A 5FEEA 1NVQA 1PXMA 5FP6A 5ICPA 3DXQA 4DF3A 3MJ2A 3NNWA 2REIA 5DPVA 4AGWA 2PZPA 2XM8A 3FAAA 3OFMA 3SRVB 3NW7A 3U6JA 4GCJA 2YWVA 2GSFA 5BNJA 2G1TA 4NJ3A 1M7NA 4QYEA 3AD5A 4FV5A 4BL1A 4D28A 1XR1A 5CVHA 3SG9A 4X7QA 4DFZE 2ITPA 4HPUE 2VAGA 1H28A 2GFCA 5I9XA 4ZZOA 3BL9A 3I1AA 3QXOA 4BZNA 4HVIA 4ZEGA 3DY7A 3C51A 3ZEWA 2CLQA 5AM6A 3LFNA 2P2HA 1W82A 1H1RA 3CC6A 3I81A 2WTVA 4OTFA 2YM6A 4PX6A 4OTDA 4XBRA 3P9JA 4FL3A 2WIPA 3LFAA 3UTOA 4F1OA 1WBSA 4F78A 4WA9A 4KD1A 3KL8A 3H9OA 3FI2A 3VBYA 4D1ZA 2P55A 3FQEA 3PXQA 4WG3A 5HKMA 2OIQA 3NWWA 4QOXA 5HO7A 5HTCA 2J0LA 4HYIA 2WFYA 4YPSA 2JKOA 3FV8A 5ETCA 4IX5A 4IXPA 3OS3A 1FVTA 1FMOE 3PIZA 2ZM3A 4K1BA 3VN9A 2XUUA 4UMUA 4IZYA 4MVFA 4XV1A 5F4NA 3BWJA 2JGZA 4NFNA 4OTIA 5CU6A 4EH5A 4IC8A 4ONAA 2XIRA 4BCKA 3CPBA 2R3RA 3UC3A 2WGJA 3GCQA 3KCKA 4AACA 3R9RA 3LJ2A 3WYYA 2XK7A 1OPJA 2UZEA 5FXSA 4ACGA 5KO1A 4EH7A 2BALA 5A54A 3BI6A 3MW1A 3GXLA 4ZTHA 1ZOGA 5FM2A 3Q9XA 1RW8A 3BE9A 3RPOA 5C01A 5CSHA 4G9CA 3AC2A 4O0UA 4RX7A 4O7VA 2AUHA 3SA0A 4DDIA 3W10A 4RWKA 3EQRA 4Z3VA 1YW2A 3PIXA 1YDTE 2OK1A 2V22A 3GU8A 5JMSA 2CPKE 3FZOA 1DS5A 5TOZA 5HLNA 3HRFA 5A4EA 3PVWA 5EM6A 2NYAA 2XARA 3IKAA 3KCFA 2WEVA 4DE4A 1A06A 5L2WA 3GB2A 4MUQA 3P5JC 2XVDA 4JRVA 3SDJA 5GZ9A 3LKMA 4BN1A 1WZYA 3PDTA 4XP0A 4KUJA 2XNBA 1QMZA 4U6RA 5HLWA 3LCKA 2GTMA 1JPAA 3NW6A 5HICA 4U41A 5IKWA 3O96A 4IJPA 4QPSA 1FOTA 1FVVA 3AOXA 3BKBA 3MTFA 5LMKA 3LLAA 2ZMCA 2PVKA 5IUIA 2ITQA 4FK6A 2XNPA 2ETMA 4IAZA 2PZRA 3VUGA 1DI8A 3NUYA 3DKCA 1ZYCA 1STCE 2B9JA 4JAIA 4UWBA 4BBFA 5AADA 4YSMA 2YAAA 2X8IA 3MA6A 5GNKA 3A7IA 5D1JA 4BWXA 4BIBA 5EDRA 5E1SA 3VW8A 4C3FA 2PWLA 3UMWA 5FD2A 3R7UA 3QA8A 5BVWA 5JZJA 2YA9A 3EN9A 4BYIA 4PY1A 5LCJA 2ITVA 4GKIA 1BKXA 2IWIA 1M2RA 3ML1A 5LMBA 2O5KA 4XG8A 4F6UA 4EQCA 3UZPA 2PU8A 3E8NA 3QTZA 4YTFA 3OVVA 4OBQA 3P23A 4EKLA 5CEPA 3Q4CA 2PE1A 1J1CA 3DBDA 3R04A 5E7RA 3W2OA 4BHZA 5EK7A 2IW9A 4NTTA 1U54B 4HCUA 4YHTA 4D4YA 3LMIA 3LFCA 4TZRA 3UDZA 1Q8YA 3HV3A 4MXXA 3DKOA 3WILA 5EYDA 4H05A 2I0VA 4BTKA 4LL5A 4BCPA 3JY0A 5L4QA 4FSRA 5D12A 3UYTA 2NRUA 5E8WA 3LPBA 3IS5A 1ZYLA 4MNEB 2VTHA 5JEBA 4YJVA 4EQUA 1F3MC 2C3KA 4Q5HA 4QP4A 4CCBA 5K5NA 3DNEA 5HG7A 4EEVA 3L9LA 1FGIA 1DI9A 1UWJA 4AS0A 2X7OA 4TTHB 4X6RA 4RJ7A 3DB6A 5L2IA 2R3MA 3P4KA 4UN0C 3TV7A 1S9JA 3Q32A 2I40A 1GZKA 3OUNB 4FTNA 3CXWA 4BCIA 4AXEA 4FZFB 3HVCA 4PL5A 4RIWB 5TE0A 1ZY4A 4HYSA 3VS5A 2QO7A 3KVWA 4KIKA 5AUWA 2C6DA 2FSTX 3FLSA 3H4JA 3QLGA 4G6OA 5FP5A 2V7AA 5TR6A 4FV1A 3UIMA 3LMHA 2F57A 5M07A 2WO6A 4G3CA 1KE6A 5ANJA 2BHHA 5EOBA 4ANBA 4XMOA 2XANA 4N70A 2YABA 4N0SA 2OH0E 5A14A 3COMA 2RIOA 4YP8A 2VO7A 3TUCA 3R1NA 2XA4A 2H34A 4K18A 3E63A 5D41A 3IOKA 4PQNA 3PFQA 1Z5MA 3OY1A 2WMVA 3A7HA 4CSVA 3ANRA 3UIBA 4XP3A 3CJGA 3TKHA 3HECA 4O96A 4WRSA 3TWJA 1KSWA 3D7TA 3R30A 4PMSA 3RAHA 3VRZA 4KBCA 2J6MA 4YZDA 4YJQA 4UMRA 2PVNA 1Q3WA 4MXYA 1QPDA 3O5AA 2C1AA 4C3PA 2NP8A 4JDHA 4CT2A 1KE7A 2IZRA 4ANOA 3KGAA 2PUPA 1XBBA 4RVKA 3LCTA 4XRLA 3FJQE 4W4YA 3BYSA 3Q53A 3M1SA 2X9FA 4DEHA 4XG9A 2XKCA 1OL7A 4PUZA 3TT0A 1U5QA 4UEUA 4W8EA 4RIXB 5M57A 3RWQA 2QU6A 4HW7A 5CZIA 4R78A 4QT1A 3F3UA 3TZ8A 2WQNA 3OXZA 4IEBA 2OW3A 4CMUA 2RFNA 2VWVA 5FQDC 5IH5A 2G2FA 4X3FC 5LWNA 4TNDA 2VTTA 3AQVA 4HVHA 1XQZA 2ERZE 3C4EA 4W8DA 4AN9A 2R3HA 3V8TA 2CNUA 3D0EA 3HAMA 2H96A 5JQ8A 5I4NA 1PXNA 2HXQA 4D9UA 3BRBA 1REKA 1H25A 5DYJA 4UXQA 1UU8A 3HDNA 5EM5A 4IFCA 4E4XA 3TACA 4F09A 2IF8A 3DZQA 4DG0E 4G31A 2YITA 4QMYA 4BIDA 1BX6A 3MGYA 2QOFA 1O9UA 5JN2A 2C69A 3MFRA 3I6UA 4JG6A 5HIDA 4BDGA 4DDGA 1YQJA 2R64A 4G3FA 4PWNA 4RC4A 2I0EA 3HNGA 2Y4IB 2YIXA 3BYOA 2W5BA 2IZSA 4MXZA 4UY9A 4ENXA 4FKQA 4EOSA 3EFWA 5I9YA 5IG1A 4PDOA 3PJ8A 4FA2A 2CLXA 2SRCA 3HGKA 3O7LD 4YJRA 3FMLA 4GFGA 5DR2A 5BVDA 4F4PA 4ANLA 3NIZA 3OBGA 2YJSA 3G9LX 3LE6A 2R3IA 3P7BA 3VS4A 3BLQA 4NL0A 4KBKA 3G90X 3L8SA 3CQUA 2VTLA 5IQGA 1UU9A 1RJBA 4FKLA 5ANDA 3LFFA 5LCKA 4EZ5A 4NW5A 4CD0A 4E5AX 3COHA 2AQXA 2X9EA 4IX6A 1WBVA 2YN8A 4EK3A 4ZSLA 4RVTA 3AC1A 4GIHA 1WBPA 1VR2A 3HYHA 3VVHA 4EZ7A 4NWMA 5IUHA 3MSSA 3Q3BA 4EL9A 2I1MA 3WE8A 4EZ3A 2YM7A 4GSBA 2BRBA 4XP2A 4EK8A 3FI3A 4K11A 5AIKA 2PVLA 1Q5KA 3Q60A 4FZAB 5ETFA 2R3LA 5IH4A 3BV2A 3ZDIA 3ZRMA 4R6VA 4BGGA 2ZFYA 2JD5A 2X0QA 3IPHA 4CFWA 4RSSA 4ZLZA 3HMNA 2ZDUA 4J8NA 4XV3A 4G3EA 4GL9A 4ZS0A 2ONLA 3MY1A 2IJMA 5ANOA 3G5DA 1Q8TA 2A2AA 3KRLA 5HD7A 4CZTA 1URCA 3E92A 4DITA 1FBNA 2WB8A 2W1GA 3DFCB 4I6BA 2P2IA 3TZ9A 4L46A 3EN5A 2VTMA 3UZTA 3RCDA 4TW9A 5GZ8A 3FMMA 4S34A 5JGAA 3PA4A 1H24A 2A19B 4L7FA 1XJDA 2B9IA 2W05A 4DA5A 3RWPA 4YJUA 3OCGA 5IQFA 3PZHA 1PMNA 2RFSA 3EFJA 3R9NA 4ARKA 5E90A 2C3JA 4G3GA 4IWQA 2J2IB 4RJ8A 3V5TA 4U45A 3HV4A 1FINA 2WTDA 4FZDB 4G5JA 3OG7A 4XBUA 3II5A 3F5XA 4NZWB 2VWZA 4G6LA 2EXMA 4BZOA 2PYWA 2CGWA 1H0WA 3U6IA 3UYSA 2VTNA 3CEKA 4YO4A 5EW9A 4PP9A 3CLYA 1R1WA 3KRRA 1M2QA 3OMVA 3OWKA 3DK6A 4QTAA 5HIBA 2VO0A 3F3WA 4JG8A 3F82A 3KK9A 4JAJA 1T46A 3QTXA 4DN5A 5JFXA 4OLIA 2PMOX 3F2NA 3R02A 4TYHA 5BVFA 5HBJA 3ATTA 3UOLA 4GS6A 4YLLA 3RJCA 4O7SA 2YLEA 4CTCA 4F0FA 4BWPA 2C6TA 3QU0A 4I41A 2W0JA 1TKIA 3S00A 2VUWA 5CENA 4F0IA 4JQ8A 4U9AA 3OXIA 2YACA 4FIJA 4H58A 3ZZWA 4YC8A 3RK9A 3BL7A 2B1PA 1OIYA 4TT7A 3MI9A 3TNHA 1HCLA 3LJ0A 2C5OA 4I23A 3SGCA 4CFNA 3Q9WA 5CVGA