1OUKA

The structure of p38 alpha in complex with a pyridinylimidazole inhibitor
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
348
structure length
348
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for p38alpha MAP kinase quinazolinone and pyridol-pyrimidine inhibitor specificity
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 110
structure length 348
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2003-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1oukA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1oukA01
5HZNA 3Q04A 1A48A 4EUUA 3FXXA 3RI1A 2C6TA 5HCXA 4APCA 4GH2A 2CLQA 3OW4A 4KD1A 4OT5A 3ZYAA 4UY9A 4KUJA 3SXRA 2ZM4A 5EK7A 2B4SB 4G6NA 3MY0A 3TCPA 3ZBFA 3FEGA 3NUSA 3ZCLA 1I09A 4AGCA 4ONAA 3K5UA 5AUUA 2EU9A 5TKDA 3ZBXA 2PYWA 3HECA 2VD5A 5CAOA 2YM5A 5CSHA 4QMUA 2HZNA 5A4TA 4J52A 5HTBA 1IRKA 3C4EA 3D7TA 4ID7A 1JKSA 1Z5MA 3F5UA 3D94A 3BU3A 4EC9A 2XJ0A 2XVDA 5GIPE 3QTWA 5J87A 4R6VA 4QTEA 3EWHA 2VTJA 4JX7A 2YAKA 3UDBA 2Y6OA 3G9LX 2XNMA 4FKQA 4TNBA 3D5WA 4BZOA 4HYUA 5IQEA 1QPCA 4YO6A 3DCVA 4A9TA 1FINA 3RP9A 3P9JA 3TV4A 4BDFA 4BVUA 3IGOA 5HORA 1GJOA 2O8YA 4HOKA 4LUDA 4FKVA 5J9YA 2X8EA 4AGWA 3TUCA 5F95A 3O51A 3F7WA 4FYOA 5H2UA 5H8EA 4K6ZA 4DTBA 3RALA 4WG5A 4L01A 3H0YA 4IVCA 1WAKA 4JG7A 4JI9A 2RL5A 4TWOA 5LOHA 1EH4A 4JVGA 3IOPA 3MIYA 3CIKA 4YO4A 4RX8A 1NA7A 2JBPA 2QOBA 4YBJA 3WBLA 2CPKE 2AYPA 4LUEA 1PXMA 3D14A 1GIJA 3MVJA 3R71A 4TYGA 4CTCA 4NYEA 3W2QA 2UW0A 4BDDA 4LV5A 4R8QA 4GS6A 5AWMA 2Q0NA 3AT2A 2PZIA 4FSNA 4FTLA 3R9OA 2Z60A 3IPHA 5J79A 2QURA 2UW8A 3IQ7A 3KY2A 1T46A 4ANQA 3UNJA 2GFSA 4QQCA 4C36A 4FEVA 1OIRA 3P78A 3WZUA 5B2MA 1GZ8A 2I0YA 2W96B 4FG8A 4IWDA 3DK7A 4A07A 1U54A 2VNYA 1LPUA 4MD8E 3LKMA 4QQ5A 4JDJA 4P5QA 5AUZA 3VHEA 4BCKA 3R7OA 4FVRA 1JOWB 5C8NA 4K11A 3OY3A 3Q5ZA 5GHVA 2BZIB 4M66A 2R64A 3GFWA 4KS8A 3Q9WA 4NKSA 2VTHA 3TN8A 5FXSA 2IW6A 4DH5A 3SGCA 2BALA 3W8LA 4GUEA 2GHMA 3KCFA 5IQHA 2O63A 2QVSE 4ZJIA 2ESMA 4FTUA 1UU7A 5FTGA 3VUTA 5C4LA 2B55A 5HOAA 4IB3A 3ORNA 2BZHB 1GIIA 3G51A 4FKSA 2GCDA 3HA6A 3VW6A 1YXVA 2VV9A 4IVAA 4GVJA 3WIGA 3R73A 4DITA 3OEFX 1KE8A 2OJFE 3OTVA 2R3FA 2PVHA 5IZFA 5J7BA 4BCJA 3DBCA 4UWYA 4PMSA 4LRJA 1YWRA 4CMTA 4YMJA 2WU6A 3HV3A 4X7QA 2W17A 5CLPA 4XBRA 4IE9A 4YNEA 3R00A 5ETCA 4EYMA 4TWPA 4EQUA 4YU2A 4IAYA 2JGZA 3S1HA 1YWNA 4FKTA 1TQMA 3BE9A 4IFGA 1UWJA 1MP8A 3E5AA 4F9BA 1P4OA 5K0XA 3M2WA 4MWIA 4BTKA 5HVYA 2YM4A 1H1QA 2Y4IB 4DF3A 5CWZA 2J0JA 3E8DA 3VUDA 3QTIA 2QQ7A 2C68A 4BCOA 2GQRA 4ZTMA 4U7ZA 3W2SA 4EZ3A 1DAWA 3BEGA 3EMGA 3FLSA 4IDVA 2QKRA 5L6PA 4R3RA 2BHHA 4QP1A 3VUHA 5JGBA 5M06A 1NW1A 2BRMA 4BN1A 3AD4A 4QQJA 5TE0A 3FXZA 2PZPA 3L1SA 3KXXA 3RPYA 2QHNA 3SKCA 1UKHA 3MVMA 3VF9A 1YOLA 2FB8A 3H4JA 4Y5HA 3L9LA 4NEUA 2HAKA 2BAQA 4U80A 2C3LA 1F3MC 2VUWA 4R3CA 4TWNA 5CYIA 1CKPA 4RLKA 3E7VA 4IZ7A 4AA0A 3BQCA 1OIUA 3NCZA 1JWHA 4QNAA 3AGMA 3D2IA 3ZO1A 2OJGA 3G33A 4QYEA 4EBWA 4X3FB 3T9IA 3II5A 3IW4A 1TVOA 3OFMA 4L43A 4RIXA 4BCIA 4CFUA 4B9DA 1M17A 4J8NA 4OTWA 3EQCA 4CKJA 3KXHA 4Q5EA 4LOPA 2WMRA 1A9UA 4H3PA 3FPQA 1Q3DA 2LAVA 4PY1A 1Q5KA 3DS6A 4QNYA 4D4VA 3R6XA 2BAJA 3DT1A 2XJ1A 3HRBA 2UV2A 4FT7A 3V5WA 5AM6A 5L2QA 5HBEA 3U9NA 4GG5A 4CLJA 3QFVA 2WMAA 3HV4A 3SC1A 4U6RA 5CF4A 2I1MA 1OUYA 2C1AA 2P33A 3BBTB 3F3ZA 1OPKA 4D1XA 4MBIA 3UP2A 1WCCA 1CMKE 4K1BA 3A4OX 4O82A 4JR7A 5BUIA 3P23A 3VIDA 3ORTA 3Q96A 1Q8YA 1BMKA 1RJBA 4E26A 4USDA 5DEWA 4F7SA 3N9XA 2A27A 4UX9A 3R7VA 2Z8CA 3OT3A 4Q9SA 4WHZA 4ALWA 1GY3A 5DWRA 2XNNA 3AC8A 4O0XA 3RM6A 4HVSA 3O71A 1B38A 4FKPA 4YNOA 1U4DA 2ITXA 3DZQA 2SRCA 1LEWA 4FNWA 4XHKB 1Q97A 3CD8A 2XK4A 3RHKA 4A9UA 1KE5A 4EK5A 2UW3A 3FMJA 2C6IA 5K4IA 4I6BA 4OAUC 4DAWA 2Z02A 4JS8A 3ZLYA 3OWJA 1XBCA 3QRUA 4FT5A 5D12A 4CMUA 2BKZA 3EH9A 5EDPA 4ZIMA 4ZLOA 2GDOA 4LQMA 3H0ZA 4GK4A 5AV2A 5CX9A 3W55A 5AFVA 4FEQA 4XYFA 4OTHA 5BVFA 3PA5A 4F9AA 4IW0A 3TTIA 5K5XA 4JL9A 4EZ5A 5CENA 2YCFA 3K3IA 2QR8A 3R9DA 3DQXA 1Q99A 1OKZA 5I9WA 1QL6A 3BHYA 5CALA 3QUEA 4TWCA 4RWKA 2ITPA 3FZPA 2DYLA 4O0RA 4B6LA 3JXWA 2OICA 3QBNA 4WOVA 3VS1A 1TKIA 5LMBA 5C8MA 5DI1A 2YM7A 2YITA 4C33A 4D0XA 5B2LA 4O7ZA 3Q4TA 4FT3A 4D9UA 4EOLA 3LLTA 2F49A 3QYZA 3ERKA 4YUQA 4PTCA 3R2YA 3OP5A 4RJ3A 2PMOX 1VZOA 4KIKB 2YM8A 3JYAA 4G1WA 4W4XA 4JT3A 2H96A 4YBKA 4D2WA 3ID6C 4G2FA 5AAGA 2OZAA 2CGXA 3FC2A 2YCSA 1SNXA 5H8BA 5CEPA 5ANEA 4PTEA 2OJ9A 3GUBA 3QWJA 5GNKA 3VHKA 4B8MA 5E4HA 3GB2A 3WILA 3OCGA 3MW1A 2NO3A 4DE4A 4FZ6A 4FNXA 4ZAUA 3KMMA 2CKEA 4CEGA 4OLIA 3DAJA 4KABA 2PE1A 3UO4A 5E7RA 1M2PA 4JQEA 2WMSA 2XMYA 3H9FA 4IC7A 4AZVA 4AUAA 3MVLA 3OXTA 4PUZA 4QMLA 4N4SA 3GCSA 2OI4X 4YJVA 1Q62A 3DFCB 4U0IA 1FVRA 3VQUA 2JITA 4I4FA 4DN5A 2CGWA 3ZHPC 5KO1A 3AQVA 2XCKA 5E8WA 2IVTA 4WD5A 5AP5A 2JDRA 3NNUA 1JPAA 1XH8A 3P5KA 3E64A 3CGOA 2YJRA 3HV5A 5KBRA 4C2VA 4WG4A 3R1YA 3LQ3A 2GNIA 3WYXA 5IUGA 3Q6UA 3AT4A 2P4IA 1H8FA 4OTQA 5DT4A 1DM2A 4PMPA 3G90X 3BYVA 4GL9A 2WQBA 4LFIA 1T45A 2PZYA 4ZTHA 5BYLA 3G2FA 4YJQA 1OKYA 3LW0A 2YZAA 4MQ1A 4UMUA 3GC8A 3AG9A 4RIWA 1P14A 2X8IA 5JMSA 3R9RA 4IBMA 3IW7A 5A46A 3ZEWA 1W84A 5BX0A 5B7VA 1JSTA 3DBQA 4UXLA 5LMAA 3KULB 3SOAA 2XK3A 3QTZA 4Z7HA 1AD5A 4P2KA 3FJQE 3KKVA 5EOLA 2XYUA 4IX3A 3NUXA 4M0YA 2JIIA 3G6GA 4RJ5A 4C59A 3WIKA 2OGVA 5FTOA 3CKWA 3RCJA 4CFVA 5CU0A 1U5QA 3MB7A 3GT8A 4FV0A 3ZUUA 2YA9A 2H9VA 3F3TA 2JKKA 2WU7A 3I5ZA 3MA3A 3ETAA 4W4WA 2ZV8A 3RCDA 3UPXA 5DR9A 3LFAA 2RFDA 4XP3A 4QO9A 2CGUA 4EK6A 4CFNA 4RX5A 4YJPA 5LCJA 5BYZA 1JQHA 4I24A 4USFA 2IZUA 2BAKA 4ZZOA 5IMXA 3QCSA 2W5AA 2C6OA 2P55A 3R7UA 4ZMEA 1M2QA 2J0KA 1UV5A 1BLXA 5LCKA 3BELA 4HVHA 3E7OA 3W8QA 2OXXA 4G6OA 3W2OA 1BUHA 2PMLX 2O5KA 3HP5A 5HO7A 4IAZA 3SG8A 3PG3A 5DFPA 3BBWA 5HD4A 4WRSA 1QMZA 4EHEA 1J7LA 2G01A 1GZOA 2W06A 3P7AA 4NK9A 4DCEA 5KX8A 5FUTA 5CY3A 3DKFA 3RPVA 3LAUA 3KREA 5FM3A 1KE6A 3FMHA 1RW8A 3PPKA 3QUPA 1SVHA 4HZRA 4GW8A 4C02A 4XV9A 3E62A 5CT0A 2HZ0A 4N6YA 4YJNA 2GMXA 1JKTA 3I79A 4EH7A 1OPJA 2WFYA 3Q53A 4C3PA 1XH9A 3C4XA 4BL1A 2R3RA 4DGNA 2ITQA 3R01A 5FRIA 3LLAA 4X3FC 3NYNA 5FXRA 3MH3A 3PUPA 3LPBA 5HVKA 1Z9XA 3G0FA 4QYYA 4FEUA 2WOUA 3I1AA 4ANOA 3ZSHA 2WHBA 3U4UA 2F57A 3DNDA 3FI3A 3NNWA 4KBKA 1WMKA 2RF9A 5M4CA 4BDKA 2FYSA 4YJTA 5DOSA 4KBCA 2REIA 3MI9A 3P1AA 4LL5A 3RBWA 3Q32A 5KMMA 2PVRA 2C30A 5FLFA 4RBLA 1YRPA 4D2RA 1Q8UA 2JDSA 2OBJA 4XNEA 4HNIA 4HNFA 3L8XA 4BIBA 3VBXA 4FSUA 2OWBA 5DN3A 4IQ6A 4TYEA 3VBWA 3TUDA 1P5EA 3HMOA 3LQ5A 4ACGA 2UZOA 3VUMA 2OFUA 3FKNA 5BNJA 4L45A 2OXDA 4JRNA 1Q41A 3PXFA 1BL6A 1A06A 2C0OA 5CZIA 4G3DA 2W1FA 3PXKA 3C4ZA 5KHWA 5GIOE 4IVDA 2YIYA 4QP8A 3DKCA 3KXGA 5I9VA 3UODA 4AE6A 2GQGA 2IW9A 2BFXA 3QCXA 3TTJA 4F6WA 4FNZA 5C26A 3DAEA 3FLWA 2WTWA 4I3ZA 1ZRZA 4FZDB 4UWCA 5AP2A 5J5SA 1G8AA 3BLQA 4BI0A 5IA0A 3R22A 2NRUA 4M97A 3NYVA 4I6QA 4NCTC 2B9IA 4M15A 2HXQA 3ZTXA 3QZFA 3VNTA 2A4LA 5HCZA 4J99A 5T68A 2R3OA 4F0FA 3DNEA 2UW5A 3O17A 4WKQA 4ITHA 3BWJA 3KXZA 4FL1A 4L67A 4ENYA 3MTLA 2JIVA 2YIWA 2YWVA 4OUCA 5EKOA 5BMSA 1WBWA 1XR1A 2XIYA 2QG5A 4NFNA 3TZ9A 4ANBA 3QTQA 3R7GA 4V0GB 2I40A 4E4XA 2GHLA 5HO6A 4RFZA 2CDZA 4XLIA 5I4NA 1R78A 3R9NA 5ACKA 3H30A 4QMZA 3TZMA 4JIAA 3ZM4A 4Y46A 1SNUA 3I7BA 1VEBA 3GENA 2J6MA 2C1BA 3BKBA 2GHGA 2BTRA 1ZOHA 1UNGA 5EDRA 4XS2A 5A14A 1ZYLA 2PE2A 5EI6A 3LFQA 3UPZA 1FGIA 3BV3A 3QWKA 2J0LA 3PTGA 1URWA 5AA9A 2KTYA 3HKOA 4F7LA 5BQ0A 1I44A 2Z7RA 3MDYA 2X8DA 2XA4A 4GIIA 4IJPA 4GFGA 5LWNA 5ICPA 2A2AA 4RIXB 3PWDA 5IA4A 4O22A 1WFCA 3HDMA 3DK6A 5J8IA 1G8SA 1IA9A 2PVLA 2QU6A 5DG5A 2ITWA 1G3NA 4RGJA 3PIXA 4S32A 5DGZA 4M13A 3HGKA 1URCA 2JLDA 5IQCA 2WQNA 2IPXA 1KOBA 4X0MA 4TW9A 4IIRA 3LCDA 4D5KA 1FVVA 1SMHA 4CKIA 5DR6A 3BV2A 2VWVA 3DLZA 4M0ZA 4MQ2A 4AAAA 4R7HA 4DTAA 2AUHA 4IX6A 5BVKA 2YCRA 4R3PA 5HLNA 2XIKA 4XG2A 4GG7A 2ETKA 4R1VA 3BGZA 1OIYA 3PXYA 2W1DA 4QP7A 5IQIA 4RIOA 1GNGA 3EHAA 1H24A 2VRXA 4UMTA 4X21A 4EOJA 5HX8A 3SQQA 5A4CA 5HCYA 1Y57A 5EHYA 2VTTA 2WMTA 3QLFA 4MYGA 2NRYA 5KMJA 4OT6A 4FVQA 3OVVA 1ZY4A 4FSMA 2VTMA 4CMOA 2PL0A 3CJGA 4L7FA 1ZZ2A 3ZUTA 5JK3A 4PTGA 3G15A 3HV7A 3DLSA 2YDKA 3HMMA 1HOWA 5FWKK 3WF7A 3U4WA 4E20A 5CF6A 5I5ZA 4FTQA 4RIYA 2R4BA 3K3JA 3RZBA 3R8VA 4AQCA 4JBOA 4D2SA 3LOKA 3UYSA 4DHFA 4DFUA 3FUPA 5L2SA 1W7HA 4IMYA 3CS9A 5F4NA 5BUJA 3C0GA 4E5WA 4RWJA 3TDVA 3VBVA 2FSLX 5E1SA 4QPMA 3QL8A 3LCTA 1KOAA 1NVRA 4D55A 3FY0A 4HCTA 4YC8A 5HHWA 5D7VA 1YI6A 4Z55A 4BI2A 3VS6A 2XIZA 3FL4A 3EYGA 2C6DA 3FZ1A 2UW7A 4C35A 4E6DA 2WTCA 2PMIA 4DBXA 4E5BA 3B8QA 3AD6A 3ODZX 3CP9A 4IC8A 5A6OA 5FM2A 3FSFA 4XCUA 2CGVA 5HX6A 1H4LA 2VTOA 3TZ7A 5BVDA 3NLBA 4RJ4A 4BGHA 2ZB1A 4QP3A 4CFMA 5ACBC 3JS2A 2RSVA 4BDGA 3S00A 1IASA 3SAYA 4FSTA 4FTJA 2KULA 3F5PA 3JUHA 4N57A 3HAMA 4BY9E 2Y6MA 2YM6A 3DJ7A 1LUFA 3OCSA 4AW0A 1FGKA 3QQJA 2JD5A 3PE1A 1U54B 1IAJA 4ZSLA 4H3BA 2J4ZA 2BIKB 2VAGA 4GK3A 4IWPA 4JBPA 3FXWA 3NR9A 4J53A 4EK8A 5A4EA 4U8ZA 4ACDA 1IAHA 3SDJA 2XNPA 5B2KA 3EKKA 4BGGA 2R3NA 1ZXEA 3B2TA 4ZZMA 5IH5A 2GNLA 4O91A 3COIA 4AZTA 4GFMA 1PYEA 4M67A 4QP4A 4AZSA 5C8KA 4DFXE 4I6FA 4U9AA 2J5EA 3SVVA 1VYWA 4PX6A 3CJFA 4UMRA 4XUFA 1K3AA 3LMGA 4RT7A 4BBFA 4EHGA 3F2RA 4Q9ZA 3TV6A 3HMPA 1G5SA 2CJMA 5IU2A 3LFEA 4ERWA 3DB6A 4DA5A 3QD4A 4QMWA 2ZV7A 5E8XA 2NNWB 4FKIA 3QZIA 5D9HA 3SXSA 3ZC5A 3ELJA 3U51A 3A7GA 4ZLYA 5K9IA 4LGGA 4WIHA 3ORMA 4L7SA 1Y91A 4JRVA 5TT7A 3MY5A 4MTAA 3L9PA 2FO0A 2LGCA 3CE3A 3PG1A 5GINE 2X7GA 4YTHA 4GRBA 3G0EA 4EJ7A 4KINA 3PA4A 2W1GA 1UWHA 4FZ7A 4F9YA 3DB8A 3F6XA 4FKOA 4LRMA 4X6QC 3ZXTA 3VVHA 4XRJA 2YJSA 3MFRA 4N6ZA 2RFSA 5F20A 5BVEA 2NP8A 3JY0A 3F9NA 1MRUA 2XS0A 4PPBA 4TYHA 5EH0A 4IHPA 3FI8A 1F0QA 3TIYA 3PVUA 4D1SA 4W4YA 4LOOA 3CPBA 3Q9YA 4UB7A 1YHVA 4ZSEA 2HW7A 4FC0A 3QXPA 2BRGA 2PVJA 4IM3A 2OIDA 4XG4A 5CNNA 5CXHA 5AUTA 2I7QA 4PDPA 2P2IA 5HG8A 1QPEA 3TNPC 3E8EA 3QHRA 4FTOA 3RAKA 3W2RA 3S0OA 4APPA 4RJ7A 1OL2A 4FIJA 3NUPA 4I5HA 3D7TB 4J7BA 5CSVA 1WZYA 2W9FB 3BU6A 4K77A 4HPUE 5CSXA 2YEXA 4GFOA 2OK1A 3FC1X 2JKQA 3FY2A 4C8BA 4OTIA 2YIXA 3BYOA 3RNIA 3QHWA 3AC4A 5LXMA 5I3OA 1H00A 5E8VA 2F7EE 5KCVA 2X1NA 3F82A 4FVPA 3CY3A 2UZTA 4PP7A 2JDTA 4QPAA 4TYJA 2QKWB 2R0UA 3NDMA 4RC4A 4FG7A 4RZVA 3NWWA 3F2AA 3DKOA 4HCUA 4O0VA 4EI4A 4O81A 4OGRA 4EOQA 2BTSA 4E8AA 5CEKA 4P90A 4V0GA 1H26A 3MFSA 2B54A 4GU9A 5KMKA 2PZRA 4G3GA 4B8LA 1JSVA 4MNFA 3ZM9A 2X9FA 4YC6A 3NAXA 1RQQA 1H0WA 3GCPA 4M8TA 1J91A 2C5YA 3OTUA 3CLYA 4NFMA 4DG0E 3PA3A 1AQ1A 2IVSA 2VU3A 3V5JA 2OZOA 5D11A 2UW6A 3FLYA 4BCQA 4MXZA 5HLWA 4GT3A 2UUEA 4YPSA 4FSZA 5CNOA 2P3GX 2ERKA 4ARKA 4HGTA 4E6QA 4TXCA 3UZRA 1OECA 2WPAA 4V01A 4AT4A 3QLGA 4XX9A 2OJIA 1VJYA 5JGAA 5AAEA 2PVNA 3ZLXA 4GKIA 5IMEA 3QD0A 3OF0A 3CEKA 3MH1A 3NS9A 3Q4CA 4AZEA 5K5NA 5HU9A 4XLVA 4NUSA 4I0SA 4YHJA 2EB2A 5AJQA 2J5FA 3CKXA 2JIUA 2O65A 1SYKA 4TPTA 3DQWA 4L3LA 1OI9A 3WF8A 3SA0A 3CPCA 3A62A 2RIOA 2W5HA 2ETMA 4IAAA 5AP3A 4FV3A 2QG7A 2VNWA 3ZUVA 2QC6A 4F7JA 2AC3A 5FP6A 3NYXA 2WQOA 2QO9A 2WIPA 3C13A 3OW3A 5CAQA 1DI8A 2WTKB 5DR2A 3PIZA 1R0EA 4PPCA 2A0CX 3T8OA 4C4EA 5A3XA 3U6HA 5HG9A 3ZFMA 5EDQA 3HLLA 3BYMA 2PWLA 3ENMA 3QKMA 3HDNA 5IISA 3ZXZA 2X4FA 3LHJA 4C34A 1HCLA 3ANRA 4CNHA 5DBXA 3FQHA 4DFYA 1XH5A 3HV6A 2UW9A 2YHVA 4MBJA 3Q4ZA 3ORKA 4KSPA 4O1OA 4HYHA 2C6KA 5HU3A 4RRVA 1H07A 2OZAB 2PU8A 4TTHB 1ZYDA 4BTMA 3ROCA 4F1OA 5HNIX 4MF0A 1DI9A 4PNKA 4D9TA 4Z16A 3NEWA 4F08A 2WO6A 4KKHA 4RA4A 2WEVA 3POOA 4QMQA 4LGHA 2EXMA 3GOKA 4RJ8A 4RX7A 3OWLA 2ITYA 2PE0A 2QOLA 3RZFA 4DEGA 2GQSA 2XK7A 2WELA 4S31A 4ALUA 3DXNA 4IAKA 2ZYBA 2VWZA 3UZTA 2CLXA 3NUYA 4FNYA 3FZTA 3R8LA 3TNWA 2W05A 4DH3A 2XM8A 2X7OA 3I4BA 4RFYA 4L3PA 4X6RA 3V5QA 5KMLA 2XUUA 2WD1A 4ZXTA 3VS0A 1ERKA 3VBQA 4BRXA 3VF8A 3DJ6A 4UXQA 5EM8A 5HG7A 4BF2A 3M1SA 5IEYA 1JLUE 1TQIA 5AV1A 4FIEA 2YWPA 2V62A 5I9XA 2CMWA 3AC2A 1B39A 1GAGA 4KIPA 4FEXA 4BDAA 4UYAA 2C69A 4M14A 2BDJA 3KVXA 2XNOA 5L2TA 4IDTA 3O8UA 4ZY5A 1WBOA 2PUIA 2XKFA 3M11A 5M57A 2UZBA 5JT2A 3QF9A 4BFMA 3I81A 2ITOA 2NPQA 3ZZEA 4H58A 4RA5A 1XO2B 2J2IB 4JBQA 4KRCA 5TF9A 4YZ9A 3SW7A 4AGDA 5JFWA 1YI3A 4KIKA 2XCHA 3ORXA 2WTDA 4BIEA 3PRIA 4NJ3A 4QMXA 1FPUA 4ZZNA 4HVDA 2VTPA 3NUUA 4QP6A 5ANGA 1E9HA 2WZJA 1RDQE 4JAIA 3ALOA 3PZHA 5FD2A 1XWSA 4LG4A 2XIXA 4FTRA 2IVVA 4YTIA 5T3QA 3QZGA 4R78A 3MYGA 4AW2A 3LXLA 4MH7A 4G9CA 1OVEA 4L68A 5D41A 2UZEA 3WI6A 5F9EA 4IJ9A 5J1WA 5I0BA 3HUBA 4LMUA 2W1IA 3PPJA 1YXTA 3NPCA 2PVKA 5DNRA 2Y4PA 4G3CA 4K8AA 2VTSA 2X0GA 2YDIA 1OITA 3FHRA 3A7JA 3ZH8A 4ANNA 4CLIA 5L8KA 3DAKA 4OBQA 2RFEA 2HY81 3OUKA 3EFKA 3MWUA 4FX3A 4MD9E 4DYMA 4E93A 4IXPA 4MK0A 3VN9A 4JIKA 2B9FA 3KRXA 3PRFA 1H1RA 3EJ1A 4EWHA 1PMNA 3DK3A 5AX3A 3F66A 3G9NA 3QZHA 3UOHA 4TL0A 4TZRA 4FK6A 4FSRA 3ACJA 4O6EA 5ANDA 3O23A 4BDBA 4BHZA 4D0WA 4EUTA 4F0GA 4EQMA 3ULZA 4BZNA 4BWKA 4DGGA 1W82A 2A1AB 2R9SA 4XV1A 2CCIA 4D2TA 1FMOE 3FKOA 3Q60A 4Y72A 3FMDA 4J8MA 4XEYA 1W98A 1APME 4LM5A 4UEUA 3D5XA 4F70A 4G16A 5AADA 4HGEA 2XK9A 3DOGA 1FVTA 3VC4A 4K0YA 3UIUA 5KNJA 2WMWA 3ZSGA 3TV7A 4JR3A 3ZLSA 3EKNA 2GNHA 3W2PA 2VZ6A 4O7SA 2PZ5A 3PJ1A 5AM7A 5C1QB 2G1TA 2BZJA 4ASDA 3NVKI 2XRWA 3UC3A 2VO0A 3R21A 3C4WA 4D4YA 3EQIA 4GYIA 4Q2AA 4C3RA 4Z3VA 4RVTA 3UJGA 2ZDTA 1XH6A 4GV1A 4BKJA 3UIMA 1KSWA 5KMNA 3BHTA 4WG3A 4EOSA 4F1TA 3R2BA 4EH3A 2VWXA 3R7EA 3MJ1A 4DEDA 4RZWA 1FQ1B 2VTNA 3MBLA 1WVWA 3CQUA 2CNQA 3LJ0A 1PXKA 2BILB 3DGKA 2B7AA 3TKUA 1M7QA 3R8ZA 4M12A 1MQBA 1BL7A 2XH5A 2UZLA 4RQVA 3EN6A 2CKQA 5EYCA 3EQRA 4JOAA 1PJKA 3ZDIA 2WQEA 3PSDA 2I0EA 4XP2A 4YGAA 4Y83A 4WT6A 3U87A 5K4JA 4XOYA 5C03A 4DLIA 1Q8ZA 4FV5A 3PP0A 3DU8A 4PL4A 5CEIA 4LI5A 3EFLA 4DEIA 4CVAA 2IW8A 4O7NA 3GC0A 4NKAA 4UYNA 2IJMA 4YJOA 5EHLA 5TO8A 2YLFA 5C27A 5HTIA 5HNBA 1L8TA 4X2FA 3RK7A 5IQAA 4F64A 1GZNA 2QU5A 2ONLA 3IK3A 4WNKA 4BC6A 5KMOA 5AIRA 4RMZA 4FIHA 5HLPA 4O7LA 3R83A 1WVXA 3S95A 3D7ZA 3A60A 4G3EA 2QD9A 3ZRMA 3W32A 3RKBA 2O3PA 2OF2A 3EN4A 4P5ZA 4WUAA 5ETAA 4FI1A 4TYHB 3OC1A 3FQEA 2GNJA 5HESA 4MBLA 3GFEA 4EWQA 3PSBA 4QP2A 3O8TA 5FQDC 5CQUA 4P4CA 4LGDA 3JPVA 3DZOA 1REJA 3OMVA 5DA3A 3SLSA 1JNKA 3FMKA 4QMVA 3R9HA 3THBA 4BYJA 1HCKA 4PL3A 3FQSA 4QMTA 4Y8DA 2IVUA 3KULA 3RVGA 5CEOA 2RG5A 2JDOA 3MV5A 4CFWA 5IF1A 2H6DA 2E9NA 1X8BA 5CVHA 1MRVA 3GQIA 3SOCA 3UVPA 3WZKA 3ZOSA 5KMIA 4ZS0A 3SRVB 4IX5A 5HBHA 2Y8OA 4CRSA 3A2CA 3DY7A 3UQFA 2QO7A 4MXCA 3PIYA 3QAME 4I1ZA 4RVMA 4U42A 4XV3A 4C57A 2CCHA 3RGFA 5A6NA 4O0TA 1J3HA 1OPLA 4CQEA 4R5YA 2GS2A 3VS2A 2JKMA 2OF4A 2YAAA 4A9YA 4O7YA 3UP7A 4G34A 3CXWA 4BCHA 2R3IA 3UVQA 2B9HA 4EHZA 4NL0A 4CYJA 2PHKA 4YR8A 1ZYJA 3QTSA 5G1XA 3BHVA 4FYNA 5EQYA 3ET7A 4EH2A 4EH5A 1ZLTA 4HJOA 2IZSA 4ZSJA 1W0XC 2CSNA 3DPKA 2OIBA 2IZTA 5HEZA 3W18A 4F7NA 3TNIA 3BI6A 3E63A 4EBVA 4L00A 3NCGA 4M7IA 1YHWA 4W9XA 4ANSA 2ZAZA 3E88A 5GJFA 4R7IA 5AR7A 3WF6A 4RG0A 1TQPA 3BGPA 2XEZA 5L6WL 4HGSA 3Q6WA 1WBNA 2FUMA 4FIIA 4GYGA 1QCFA 4IM0A 4L6QA 1Q61A 4MNEB 4C4IA 1IR3A 4S2ZA 2PVMA 5EFQA 3BHUA 1JAMA 4BYIA 5GZ9A 3ZEPA 4FTIA 2XB7A 4FKRA 1UU9A 3QX2A 4HCVA 5AR3A 2E9UA 5DT3A 5LJJA 2BRBA 4OTDA 5AR2A 3EYHA 4ZTNA 4IB1A 4D4SA 2YM3A 3QCQA 4TKSA 3PJ2A 5E8SA 2C0TA 4MXXA 4EKKA 4YLJA 1V0OA 3QRJA 4X2NA 3CTJA 5E1EA 5EHOA 4YZMA 4UBAA 3MFTA 4IB5A 4E1ZA 3KQ7A 4B0GA 5LQFA 5HO8A 5IDNA 5LVOA 5J9LA 4EK3A 5AIKA 5CZHA 3ZONA 4G9RA 2VWYA 4RWLA 4NJDA 4RIWB 2Y9QA 5JRSA 3QTRA 3UOLA 2QO2A 3GC9A 2X6DA 4I92A 4KIOA 4TRLA 4QMSA 3Q52A 2BUJA 2VWWA 4RVKA 3EOCA 3GNIB 1YW2A 3FWQA 4ZTQA 5DIAA 4D1ZA 4RFMA 3RPOA 2C47A 3ZLWA 4A7CA 5AV4A 3V8SA 2QHMA 2YFXA 5EYDA 3HVCA 1H1PA 4I20A 3OOMA 2BMCA 3FL5A 1ZYCA 4I5PA 4U40A 5IUIA 3Q4UA 4J97A 4HW7A 5J5TA 2W1HA 4ENXA 2IWIA 4FTCA 3FYKX 3GU7A 5GJGA 4CD0A 4BCFA 2YDJA 4NSTA 3EFWA 3C9WA 4C2WA 2V5QA 3U55A 2P2HA 3N51A 5IQGA 2X9EA 2GFCA 4I23A 2V22A 2GNGA 2ZV9A 4CRLA 4K18A 3TKHA 3BQRA 2WTIA 2HELA 2HXLA 4ITIA 4NM3A 1KWPA 4LMNA 2WQMA 4ZY6A 3RTPA 3V8WA 3RPRA 5DYJA 4QMNA 4AS0A 3KGAA 4XV2A 2PK9A 2X7FA 4I41A 5LWMA 2CKPA 2CNVA 2BDFA 2CKOA 1O6YA 4CZTA 3LM5A 3V5PA 4GJ3A 1MUOA 2PULA 4XG6A 4DCAA 3DV3A 4NU1A 4NCTA 4AA4A 1WBSA 2C5XA 1XKKA 3LE6A 2V0DA 1XBAA 2C5NA 2QONA 4BBMA 3KRRA 4CSVA 3QD3A 5AEPA 2A19B 2DUVA 1R39A 4JX3A 3BLRA 5ANKA 4FG9A 1Y8YA 3KXNA 2WMVA 2J9MA 3NW7A 5EW3A 5BPYA 4RQKA 5JFXA 3QRTA 5J95A 1Q3WA 1PMEA 2BRNA 4JBVA 4F1MA 4D4RA 5FG8A 3IO7A 3QQFA 4GJ2A 1V1KA 2ITNA 2X6EA 4EONA 5M07A 5EM7A 3F5XA 3O96A 4ZEGA 3D2KA 3KU2A 3TNQB 3BCEA 3C0IA 4BCMA 3ATSA 2PY3A 4KB8A 4M84A 1CSNA 5CEQA 4BCPA 3GVUA 4Y73A 5AUYA 2B0QA 2OJJA 3IG7A 3D0EA 1ZARA 1IG1A 4ANLA 3V04A 2HWPA 3AD5A 4PDSA 1MQ4A 1CDKA 4Y5QA 4DH7A 3FYJX 4QMOA 2CN5A 3F69A 1OBGA 4BKYA 3KF4A 3MFUA 4FIGA 2ZV2A 4AF3A 2ZMCA 4U81A 5HNGA 4FSWA 3C0HA 4C7TA 1ZAOA 3R8PA 5FEQA 5HICA 3OWKA 3DXPA 2V7AA 3MJ2A 4OW8A 4PWNA 3PXRA 2OXYA 3FAAA 2AC5A 3E3BX 3CD3A 5IA5A 3UZPA 1J1CA 4WUNA 3OD6X 4JG8A 2JEDA 3RPSA 1U46A 4UV0A 1JKKA 3FLZA 2BVAA 2OW3A 2YIQA 2WMUA 3O0GA 4PPAA 4EOPA 5AP6A 1H1WA 2X2MA 3PZEA 4M69A 2FVDA 3F3WA 1Q8TA 4DINA 1M7NA 5FTQA 4E6AA 5FP5A 2VX3A 3NSZA 5FXQA 3LM0A 2H8HA 2QR7A 4ACMA 3BYSA 4N0SA 5M51A 4IAIA 1YOJA 3IGGA 3UG2A 3IW5A 3QXOA 5KE0A 4ZTLA 2I0VA 2PUNA 3H9OA 4C4FA 1YXSA 5KKRB 3JR1A 3PJ8A 3QRIA 2J90A 4GT4A 4L9IA 1IEPA 4WRGA 4AOJA 4D5HA 4C4HA 3DFAA 2F2UA 5AR5A 3OXZA 4FV7A 2X2KA 2OU7A 1SZMA 4W9WA 4ZTRA 4GCJA 3C5UA 2BDWA 3ORLA 3KEXA 1OL5A 2ZVAA 2C3KA 4JDHA 3IDCA 4GIHA 4QRCA 3TKIA 4MNEA 1OUKA 3UMWA 2R3KA 2VWBA 2ETRA 4FKLA 3R8UA 4AOIA 4F6UA 5DMZA 3NMUF 1NVQA 1NVSA 5JZNA 4BR3A 4O96A 4BWXA 4DGOA 3EZVA 4FKJA 3PVGA 1Z57A 5I9UA 2W4OA 4J1RA 4PQNA 4DFLA 1F5QA 4I21A 4EOMA 4XG3A 4O0YA 4UZDA 3SV0A 1J1BA 4CCUA 4NW5A 3T3UA 2EB3A 3VS7A 2H34A 2PUUA 5IA2A 3R02A 2ERZE 4CV9A 5ETIA 3A8XA 5EI2A 5H9BA 4DFZE 2J50A 3Q5IA 4ZP5A 5K3YA 2ZOQA 4QTAA 4ITJA 3R30A 4R7BA 4FTMA 2QOKA 4OTFA 4A4OA 1XBBA 4F63A 1Y8GA 4L44A 3EQFA 4GMYA 4G5JA 2ACXA 2R3LA 5D1JA 4GSBA 5EYMA 4CV8A 4YHTA 5HIDA 2JKOA 3R7IA 4ASEA 5M53A 5CU2A 4ZTSA 3FMLA 1OL1A 3HX4A 2EXEA 5CT7A 4JAJA 3VJNA 4ZY4A 4DT9A 4EKLA 3O50A 2X81A 3GCVA 3SRVA 1PXLA 4F65A 4RIYB 1OL7A 2UVYA 4AW1A 4J98A 1SM2A 4A4LA 3OT8A 4JDIA 5AP1A 3WE4A 5EQEA 3QC4A 5J9ZA 3I6WA 5AAFA 5C4KA 1S9JA 2Z7QA 3LVPA 3GOPA 4RJ6A 2JC6A 4FV6A 5LVLA 5E8YA 3COHA 2GS6A 2QI8A 5IPJA 4CG9A 1OKWA 4YTFA 4IWQA 2CHLA 4ORKA 1WBTA 4KWPA 2C0IA 2E9PA 4U43A 4L3JA 3PY3A 5KZ0A 2QOCA 1UNLA 3HYHA 3H9RA 3EN7A 3BRBA 3TWJA 2FGIA 4DH1A 3B8RA 4O86A 2W4JA 5IG1A 4ZSAA 4PDOA 2WMQA 3UOKA 3BEAA 3KN5A 3HL7A 3QQHA 4FV4A 3ZO4A 3OBGA 4TT7A 4YLKA 4BIDA 2WAJA 1RE8A 2PTKA 1DAYA 2EXCX 3ITZA 2G2IA 2C6EA 2WNTA 3A99A 4J95A 2ZM1A 4FZAB 5TR6A 3DA6A 4FTAA 4KKEA 4C62A 3CBLA 2R7BA 4GK2A 2XK6A 2RKUA 4FF8A 3LFBA 4BB4A 3U6JA 2W1CA 1YXXA 4QMMA 4RC2A 4YJSA 3RWPA 4O38A 2VTLA 4ACHA 3FE3A 3FZRA 5ANOA 4F0IA 3F7ZA 4FGRA 3DBDA 3C7QA 2I0HA 5M56A 3MPAA 4L52A 4FR4A 5KZIA 2X2LA 4R5SA 4U44A 3GC7A 3W16A 3VS3A 4AACA 2GTMA 1FBNA 3DBEA 3CSVA 4I0TA 1H01A 2YISA 5IH6A 2C5OA 3HEGA 3RINA 2IN6A 4EOOA 2XNBA 3FI2A 3KB7A 3ALNA 5L4QA 5L2IA 3AMBA 4KIQA 4QD6A 2PSQA 3UVRA 4YURA 2RGPA 3EQGA 4YPDA 3PLSA 3TI1A 4EOIA 3K2LA 4NIFB 4S34A 3LJ2A 2R3HA 5HD7A 4AT5A 3FI4A 3GP0A 4S33A 5FBNC 3KXMA 3SD0A 4BTFA 5CF5A 3OCBA 2Y7JA 3GBZA 2XBJA 2FSOX 1JSUA 4YHFA 5HKMA 5BYYA 2C3IB 4CFXA 4H1MA 5CAUA 5KKRC 1V0PA 2QNJA 4USEA 1QPJA 4U41A 1XH4A 3MH2A 3ZS5A 5AA8A 4NTTA 4F6SA 2B1PA 5HIBA 3QKKA 3D83A 4O7WA 4FL2A 3VO3A 1LP4A 3QTXA 1YDTE 5H8GA 3VULA 2BHEA 4ZJVA 1UA2A 3EQDA 1PXPA 2WEIA 3EL8A 4EORA 4R1YA 4QT1A 3NW5A 1NXKA 2E2BA 2PMNX 4KKGA 4EH4A 5JQ5A 4IANA 5AR4A 1W83A 3HRFA 5HE3A 4UMPA 4MKCA 4RC3A 2EVAA 3VRYA 4BBEA 5CVFA 3BX5A 3NNXA 3TXOA 3UC4A 3UIBA 3FMMA 3Q3BA 4HGLA 5DHJA 3QX4A 3QGWA 3CTQA 1OGUA 4ERKA 3E87A 4CT2A 3V8TA 3QD2B 5L6OA 3PWYA 4YSMA 3OOGA 3IECA 3MN3A 4IM2A 3WE8A 4RWIA 1YDRE 3FKLA 3JY9A 4C4GA 1ZWSA 4K9YA 4W4VA 4U5JA 2OO8X 5F1ZA 2FA2A 4RX9A 3L9NA 2BCJA 4FTNA 3VUKA 3SX9A 4CCBA 4BDIA 5EM6A 4XG9A 3G6HA 2BIYA 5FDPA 3P79A 3LCOA 4DEHA 4FEWA 3KC3A 3O8PA 4FGBA 3HUCA 5IQBA 2EUFB 2W0JA 3GCQA 3ZRKA 4O6LA 3LFNA 2ZJWA 3LXKA 4LRKA 3COMA 1DS5A 4NZWB 3AMYA 3PE2A 3D5UA 3GXLA 2GNFA 3ZFYA 3ZMMA 4DC2A 1VYZA 3OG7A 4HVGA 1PW2A 1UKIA 4K2RA 5DEYA 3DBFA 4NIFA 4M69B 3UMXA 4FSYA 1YQJA 4MEDA 4XP0A 3R04A 4M3QA 3TJDA 3WARA 3P08A 3SHEA 2PPQA 1OM1A 2R2PA 5CI6A 4F09A 4A9RA 2WKMA 3WOWA 3FZSA 4FOCA 3NUNA 4GU6A 3TJCA 3C5IA 4O7VA 2GU8A 4AN3A 4U45A 4AWIA 4IEBA 2FSTX 2ITTA 2J0MB 1ZMWA 5EG3A 3UNKA 4O7RA 5LMKA 3C50A 2WB8A 5I9YA 3AXWA 4AX8A 4D2VA 3E8NA 1OMWA 5HIEA 2ITVA 4UWBA 4UALA 3KL8A 4U3ZA 4NM5A 3QA0A 3NW6A 4E5AX 2ITZA 1PXNA 2J51A 3I60A 4MHAA 3FLQA 3D5VA 4YSJA 1ND4A 1FMKA 5AUXA 3VUIA 2G15A 4I6HA 4PF4A 1BI7A 2JFMA 5AUVA 3P0MA 4AFEA 2ZDUA 3QA8A 2HCKA 2R7IA 4EZ7A 2CNUA 2WIHA 1PKDA 2QOOA 2XKEA 3P4KA 3NIEA 3PY1A 5HE0A 2G9XA 1H27A 2HZ4A 3QC9A 5ANJA 4NH1A 4C4JA 3DKGA 1U59A 3I0QA 4DGLC 1ZMUA 3OWPA 3F3UA 3T9TA 4EHVA 4KRDA 3O2MA 3TIZA 1IA8A 3V3VA 4EL9A 4DTKA 4FV2A 4OTGA 3VBTA 2JAMA 3ODYX 4ASXA 4IX4A 4E3CA 3VW8A 3PPZA 1Y6BA 4GKHA 3QKLA 3MESA 1R3CA 3KN6A 4FBXA 4WSYA 5DH3A 4AGUA 5AP7A 3DJ5A 5JQ8A 1JKLA 3IDPA 5C9CA 2VWUA 4I22A 4UN0C 2VGOA 4XH6A 1OL6A 4PDYA 1ZY5A 3MVHA 4MCVA 2ZMDA 4IFCA 3S2PA 4DEAA 3UYTA 3CCNA 3I5NA 1BX6A 3GQLA 3LXPA 5C01A 4MXOA 4E7WA 3OZ6A 3OBJA 3TT0A 4RLLA 4YTCA 5JKGA 1PYXA 4IZAA 4H05A 2HY0A 3GGFA 3CQEA 2YLEA 5T6KA 4YLLA 3H3CA 2VO7A 3RAWA 2B53A 1ZMVA 4ZMFA 3NIZA 3Q9XA 3O7LD 2GS7A 4E6CA 3TACA 1XQZA 3IKAA 4BZDA 1BYGA 3L9MA 3VRZA 3EQPA 1B6CB 2UW4A 3PJ3A 3NNVA 4NWMA 5J1VA 2XP2A 4ZOGA 4DLJA 3NUAA 2C3JA 3HMIA 2O0UA 3RAHA 4G17A 3V51A 3LXNA 5EKNA 4FZFB 4AA5A 2XKCA 3UQGA 4WNMA 3H10A 3R7YA 4DG3E 3TEIA 3NVMB 4HPTE 2VN9A 3UO6A 1LR4A 2WTKC 1S9IA 3C51A 4TN6A 3IW8A 3EQBA 3QGYA 1UVRA 5FGKA 3WF5A 5BVOA 3R1NA 5CAVA 3BGQA 3OY1A 2YZLA 2Q83A 4FUXA 5LMKC 4O0UA 5BUEA 4DG2E 4AFJA 3PDTA 4U79A 3PVWA 4FE2A 3GU6A 1K9AA 3BLHA 4H36A 5GZ8A 3ORPA 1WBVA 4HYSA 2WGJA 4CKRA 4CQGA 1YKRA 2J7TA 4II5A 2IG7A 3DTWA 5FDXA 3TNHA 4BCGA 2OG8A 3PXQA 3W33A 4NTSA 3PP1A 4FODA 2R3GA 4UMQA 4CT1A 3KFAA 3HP2A 1ATPE 5L8LA 1VR2A 4LV8A 2E9VA 5HGIA 3RHXA 2XM9A 2HENA 4B4LA 2JFLA 3NGAA 3D9VA 4WO5A 4A9SA 1YI4A 4Z7GA 5KHXA 5M44A 5IKWA 3KF7A 3MTFA 1K2PA 2WXVA 1PY5A 4GVAA 3V5LA 4P7EA 4YJRA 3W1FA 2RG6A 3S3IA 4A4XA 3JVRA 4BGQA 2G2HA 3AC1A 3ZU7A 3ZRLA 2XF0A 3PSCA 1MRYA 4ZK5A 1YWVA 2R3QA 3CGFA 3TUBA 2UZDA 4FKUA 3BHHA 5CF8A 2OFVA 2HOGA 4MXAA 1REKA 5AV3A 3AGLA 3P7BA 2J0IA 4MXYA 4OTRA 5DT0A 3UIXA 4CYIA 5AX9A 3IONA 3REPA 3U6IA 3N4UA 4QMPA 4M68A 4GUBA 4CFFA 3HNGA 3F88A 3OEZA 4FL3A 2F4JA 4QP9A 5HVJA 3RK5A 3QQUA 2F7XE 4E4MA 3NZ0A 3FPMA 5J7HA 3UBDA 3QQLA 3BWFA 2F9GA 4BTJA 4HVIA 1WVYA 5IDPA 3I7CA 4JG6A 4O21A 2XKDA 4FICA 4G6LA 5FEEA 3A61A 2XK8A 5BVNA 3LFCA 2OLCA 2BR1A 3C4CA 2W7XA 5A4LA 5JFSA 3QUDA 1GIHA 1OBDA 4FV9A 4AG8A 5DLSA 3W10A 3WF9A 4CZUA 3UO5A 5GJDA 4AN2A 1R0PA 3ANQA 3FZOA 3IDBA 3LFDA 5KUPA 4X2KA 2VTRA 4J71A 5JEBA 5AP0A 4KA3A 5DVRA 1M2RA 3HAVA 2PUPA 3ZDUA 3QRKA 2Y0AA 3FMNA 4BI1A 3V01A 4I0RA 5AP4A 3EN9A 4RVLA 4FV8A 3R8MA 3CY2A 3W2CA 2XNEA 5L8JA 4C37A 5DE2A 1UNHA 5IA3A 3AMAA 5LVMA 2HYYA 5D7AA 2R3MA 5CVGA 3SG9A 4X3FA 4XBUA 2BKKA 2ZM3A 4OBPA 4YC3A 3KA0A 3KRWA 3MIAA 4LYNA 1YVJA 5JRQA 5KBQA 4V04A 3TL8A 2BZKB 1H0VA 4IWOA 4BICA 5E91A 3KRJA 4A06A 5CANA 3EL7A 5HQ0A 4EH9A 3RAIA 4NT4A 2VO3A 4U3YA 2XJ2A 4YZBA 3R1QA 4AE9A 2I6LA 5E90A 2GSFA 2C4GA 1KE9A 3FBVA 4QYFA 4EK4A 5D10A 1XH7A 2W5BA 4BKZA 3OHTA 4FK3A 3CC6A 2XRUA 4EC8A 4X2JA 1UU8A 2UVZA 3A7FA 3LQ8A 4X2GA 3JVSA 5CQWA 3RMFA 4FV1A 3PLAE 5E9EA 3FMEA 3UE4A 4HZSA 4QYHA 2YABA 2HK5A 4D58A 4I4EA 3OXIA 4IB0A 4BWPA 3NYOA 3MSSA 5BMMA 3EIDA 3ZO3A 2EWAA 3QALE 5M4IA 5IQDA 3UTOA 5EM5A 3ULIA 3MA6A 1CKIA 2Z7SA 4AU8A 4O7TA 1YXUA 4Y95A 2C5VA 1GOLA 5CTPA 3PVBA 5E8TA 5LARA 4ZJJA 5M4UA 3PFQA 4V05A 3C1XA 3L8SA 3UQCA 4Q5HA 2BFYA 4D2PA 5ITAA 5I3RA 2IZRA 4G31A 1PF8A 1Q4LA 3BPRA 3SW4A 1L3RE 2O2UA 2W99B 3A7IA 5CI7A 1H28A 1JVPP 3NAYA 3HA8A 4NM0A 2VTIA 3LZBA 1J7UA 2OSCA 4QPSA 2W4KA 4CGAA 2XYNA 2QOHA 4PL5A 1V0BA 3FHIA 3KCKA 3QQKA 3T3VA 1H1SA 4XRLA 1SVEA 3B2WA 3HZTA 3V6RA 2WMBA 4IH8A 4B99A 5LVPA 4XMOA 5IA1A 5DPVA 3HMNA 4H39A 2Z2WA 4FIFA 4EOKA 4O1PA 2BRHA 3A7HA 3LMIA 2XEYA 4TYIA 3IW6A 4C61A 3CR0A 1PKGA 4YJUA 4JDKA 3N4VA 2E9OA 2ONLC 3F3VA 3LJ1A 4L46A 3ZZWA 3UNZA 5HBJA 5IEVA 3UG1A 4MX9A 3E8CA 2X39A 4KNBA 3VS5A 1XHAA 1FOTA 3KRLA 4QOXA 3EFJA 4RPVA 1CTPE 4H3QA 4FA2A 4O83A 3LIJA 1OKVA 2VO6A 2VGPA 4WSQA 2B52A 4FSQA 3AT3A 3BU5A 4QTDA 3R0TA 3O7LB 2HZIA 1PRYA 5B0XA 4XG8A 4AT3A 4BDJA 5FEDA 4YZNA 4DT8A 4U97A 2DQ7X 1OZ1A 4IACA 5ETFA 1O6KA 3MPTA 4E4NA 4IADA 5HI2A 5CU6A 3I6UA 4EQCA 4DEEA 4MWHA 4DH8A 4AN9A 4C58A 3K54A 3OROA 3VS4A 4OTPA 2HIWA 2Q0BA 4PP9A 5EI8A 3I0OA 4YZDA 3VAPA 4C3FA 3COKA 1BI8A 3LFSA 3L8VA 1Q8WA 4JXFA 4Z9LA 4EH6A 5M4FA 2X4ZA 5CSPA 4ZSGA 5F94A 5L2WA 3BZ3A 4PMMA 3F61A 3M42A 1QPDA 2VTQA 4FT0A 4MF1A 1KE7A 4QTBA 3TM0A 3A4PA 1ZOGA 4NM7A 2VX1A 4F4PA 3AC5A 1PHKA 4Y85A 3LFFA 3L8PA 4FT9A 4DFNA 2QLQA 3ATTA 2GTNA 3EN5A 3DXQA 3VJOA 3MPMA 4WNPA 3WZEA 4EYJA 4AOTA 3IOKA 2V55A 3KVWA 3MS9A 5A9UA 5HG5A 1UU3A 5EYKA 5L3AA 1GZKA 2QLUA 3C4FA 4E4LA 4KS7A 3EQHA 4W8EA 3QCYA 2JBOA 1OIQA 4IZ5A 4OBOA 2WTVA 2UVXA 2QOQA 3ACKA 3GU5A 3ORZA 4FTKA 3ZC6A 2UZNA 5JSMA 1KUTA 4AXAA 4DBNA 3ZO2A 4ZLZA 1O9UA 2F7ZE 2PVFA 3K5VA 4E73A 5HTCA 3POZA 3R28A 4J96A 2OH0E 5IQFA 3V5TA 4QMYA 1BKXA 4PRJA 4O0SA 4CTBA 3WZDA 2FSMX 4F9CA 3RNYA 2Z7LA 3MY1A 3BIZA 4XJ0A 3A8WA 3U8WA 5CEMA 5I9ZA 1YOMA 4ASZA 4TY1A 2JDVA 3SXFA 3P7CA 1P2AA 5K0KA 1CKJA 5M55A 4C38A 3D4QA 2QODA 1WBPA 3QTUA 3BE2A 2C6MA 4QTCA 5G6VA 3TZ8A 1Q24A 5HE2A 4D28A 2VX0A 2R0IA 1NY3A 4O2PA 3DDPA 4IAFA 3UOJA 1JBPE 4BDHA 4B7TA 3VQHA 4OAVB 2OKRA 3ZFXA 1U5RA 5ANIA 3LCKA 3P86A 5JH6A 3LMHA 4I5CA 3FSKA 3EB0A 4PNIA 3N4TA 5EW9A 5TOZA 1E1XA 5A4QA 5M08A 3DTCA 5CASA 2VWIA 2WTJA 2UZUE 4MAOA 2YIRA 4ZS4A 3EZRA 3GCUA 3VBYA 1AGWA 5DRDA 4HYIA 4IZYA 4GEOA 3NRMA 2W1ZA 3ZSIA 4YZCA 1ZOEA 5IH4A 1H25A 5M09A 4L53A 4X3JA 3Q9ZA 3KMUA 4IVBA 4K33A 2QOFA 3AOXA 4C0TA 1M52A 3MB6A 4EEVA 1J7IA 4QQTA 3RJCA 2YCQA 3U9CA 2BPMA 3MH0A 3QQGA 5CSWA 1M14A 3E3PA 3D15A 4I94A 1PXJA 5E92A 1OB3A 3GU4A 1H08A 4DGMA 4WNOA 4WBBB 4BDCA 2G2FA 4O2ZA 3R63A 3GI3A 2GPHA 3QU0A 3TDWA 2OH4A 3VUGA 2YERA 5IEXA 4LOQA 1PXIA 3DDQA 3KMWA 2QOIA 3GU8A 1YDSE 2Y4IC 4O27B 3UGCA 4EH8A 2F2CB 2WOTA 3ORIA 2XZSA 4GT5A 5AV0A 4N70A 1NT2A 1XJDA 2BROA 4JQ7A 3OCTA 4CXAA 4FOBA 5CU3A 1KV1A 1PMUA 2VTAA 4OR5A 1Y6AA 5IUHA 4O0WA 4AZWA 2IO6A 4F9WA 5HE1A 1O6LA 5CS6A 4TNDA 4KAOA 3RK9A 4ANMA 3CQWA 3WZJA 4FTTA 4JJRA 4ALVA 3CTHA 3ENHA 5GZAA 4QYGA 3PYYA 2XIRA 3ROYA 4MVFA 1KV2A 1W8CA 2ZB0A 5JFVA 1YHSA 2JAVA 2UZVA 1R1WA 1PXOA 5E8ZA 3FV8A 2PVYA 2C6LA 4AP7A 2R5TA 4XOZA 4S30A 4AZFA 3HRCA 3Q2JA 3MGYA 4PV0A 1CM8A 5E8UA 2R3PA 3KK9A 3WYYA 4I93A 4FUYA 4O84A 5EQPA 4JLCA 4LL0A 5LVNA 3PJCA 1PMVA 4JQ8A 5AR8A 3PY0A 5FBOA 2QCSA 3U54A 4DFBA 3OUNB 5H3QA 1ZZLA 2HW6A 3F2NA 3NX8A 4RSSA 2B9JA 4L8MA 4EJNA 4MD7E 4AW5A 2YN8A 4F99A 3OS3A 5CU4A 5DRBA 2RFNA 3BYUA 3LCSA 2XBAA 1P4FA 3F5GA 2DWBA 3IS5A 4I5MA 3E93A 2V7OA 3RWQA 5JGDA 4KBAA 5BVWA 2ITUA 2YACA 2R3JA 5AMNA 3V6SA 2OIQA 3FLNC 4WA9A 3G5DA 1STCE 4WBOA 2P0CA 1LEZA 5CXZA 1SVGA 1E1VA 2DS1A 4UZHA 3TG1A 4FMQA 4DEBA 1ZYSA 4JNWA 2O64A 3AC3A 4H1JA 4FKGA 4KSQA 3R1SA 3GEQA 4BDEA 4CZYB 4L42A 2CN8A 5CAPA 5EOBA 5EW8A 4ACCA 4BCNA 4R77A 2WMXA 5JN2A 3Q2MA 4CG8A 3KK8A 2UZWE 4FKWA 4NW6A 2FH9A 3PXZA 2W1EA 2HWOA 4YP8A 4G5PA 4G3FA 4W8DA 2W9ZB 5A54A 5JZJA 4PMTA 4BHNA 3QYWA 2XNGA 3RM7A 3FDNA 5AUWA 3VWAA 3E92A 4XG7A 3S4QA
chains in the Genus database with same CATH superfamily
5HZNA 3Q04A 1A48A 4EUUA 3FXXA 3RI1A 2C6TA 3PFYA 5HCXA 4APCA 4GH2A 2CLQA 3OW4A 4KD1A 4OT5A 3ZYAA 4AXCA 4UY9A 4KUJA 3SXRA 2ZM4A 5EK7A 2B4SB 4G6NA 3MY0A 3TCPA 3ZBFA 3FEGA 3NUSA 3ZCLA 1I09A 4AGCA 4ONAA 3K5UA 5AUUA 2EU9A 5TKDA 3ZBXA 2PYWA 3HECA 2VD5A 5CAOA 2YM5A 5CSHA 4QMUA 2HZNA 5A4TA 4J52A 5HTBA 1IRKA 3C4EA 3D7TA 4ID7A 1JKSA 1Z5MA 3F5UA 3D94A 3BU3A 4EC9A 2XJ0A 2XVDA 5GIPE 3QTWA 5J87A 4R6VA 4QTEA 3EWHA 2VTJA 4JX7A 2YAKA 3UDBA 2Y6OA 3G9LX 2XNMA 4FKQA 4TNBA 3D5WA 4BZOA 4HYUA 5IQEA 1QPCA 4YO6A 3DCVA 4A9TA 1FINA 3RP9A 3P9JA 3TV4A 4BDFA 4BVUA 3IGOA 5HORA 3BL9A 1GJOA 2O8YA 4HOKA 4LUDA 4FKVA 5J9YA 4JMQA 2X8EA 4AGWA 3TUCA 5F95A 3O51A 3F7WA 4FYOA 5H2UA 5H8EA 4K6ZA 4DTBA 3RALA 4WG5A 4L01A 4DHZA 3H0YA 4IVCA 1WAKA 4JG7A 4JI9A 2RL5A 4TWOA 5LOHA 1EH4A 4JVGA 3IOPA 3MIYA 3CIKA 4YO4A 4RX8A 1NA7A 2JBPA 2QOBA 4YBJA 3WBLA 2CPKE 2AYPA 4LUEA 1PXMA 3D14A 1GIJA 3MVJA 3R71A 4TYGA 4CTCA 4NYEA 3W2QA 2UW0A 4BDDA 4LV5A 4R8QA 4GS6A 5AWMA 2Q0NA 3AT2A 2PZIA 4FSNA 4FTLA 3R9OA 2Z60A 3IPHA 5J79A 2QURA 2UW8A 3IQ7A 3KY2A 1T46A 4ANQA 3UNJA 2GFSA 4QQCA 4C36A 4FEVA 1OIRA 3P78A 3WZUA 5B2MA 1GZ8A 2I0YA 2A98A 2W96B 4FG8A 4IWDA 3DK7A 4A07A 1U54A 2VNYA 3ML1A 1LPUA 4MD8E 3LKMA 4QQ5A 4JDJA 4P5QA 5AUZA 3VHEA 4BCKA 3R7OA 4FVRA 1JOWB 5C8NA 4K11A 3OY3A 3Q5ZA 5GHVA 2BZIB 4M66A 2R64A 3GFWA 4KS8A 3Q9WA 4NKSA 2VTHA 3TN8A 5FXSA 2IW6A 4DH5A 3SGCA 2BALA 3W8LA 4GUEA 2GHMA 3KCFA 5IQHA 2O63A 2QVSE 4ZJIA 2ESMA 4FTUA 1UU7A 5FTGA 3VUTA 5C4LA 2B55A 5HOAA 4IB3A 3ORNA 2BZHB 1GIIA 3G51A 4FKSA 2GCDA 3HA6A 3VW6A 1YXVA 2VV9A 4IVAA 4GVJA 3WIGA 3R73A 4DITA 3OEFX 1KE8A 2OJFE 3OTVA 2R3FA 2PVHA 5IZFA 5J7BA 4BCJA 4AAYA 3DBCA 4UWYA 4PMSA 4LRJA 1YWRA 4CMTA 4YMJA 2WU6A 3HV3A 4X7QA 2W17A 5CLPA 4XBRA 4IE9A 4YNEA 3R00A 5ETCA 4EYMA 4TWPA 4EQUA 4YU2A 4IAYA 2JGZA 3S1HA 1YWNA 4FKTA 1TQMA 3BE9A 4IFGA 1UWJA 1MP8A 3E5AA 4F9BA 1P4OA 5K0XA 3M2WA 4MWIA 4BTKA 5HVYA 2YM4A 1H1QA 2Y4IB 4DF3A 5CWZA 2J0JA 3E8DA 3VUDA 3QTIA 2QQ7A 2NYAA 2C68A 4BCOA 2GQRA 4ZTMA 4U7ZA 3W2SA 4EZ3A 1DAWA 3BEGA 3EMGA 3FLSA 4IDVA 2QKRA 5L6PA 4R3RA 2BHHA 4QP1A 3VUHA 5JGBA 5M06A 1NW1A 2BRMA 4BN1A 3AD4A 4QQJA 5TE0A 3FXZA 2PZPA 3L1SA 3KXXA 3RPYA 2QHNA 3SKCA 1UKHA 3MVMA 3VF9A 1YOLA 2FB8A 3H4JA 4Y5HA 3L9LA 4NEUA 2HAKA 2BAQA 4U80A 2C3LA 1F3MC 2VUWA 4R3CA 4TWNA 5CYIA 1CKPA 4RLKA 3E7VA 4IZ7A 4AA0A 3BQCA 1OIUA 3NCZA 1JWHA 4QNAA 3AGMA 3D2IA 3ZO1A 2OJGA 3G33A 4QYEA 4EBWA 4X3FB 3T9IA 3II5A 3IW4A 1TVOA 3OFMA 4L43A 4RIXA 4BCIA 4CFUA 4B9DA 1M17A 4J8NA 4OTWA 3EQCA 4CKJA 3KXHA 4Q5EA 4LOPA 2WMRA 1A9UA 4H3PA 3FPQA 1Q3DA 2LAVA 4PY1A 1Q5KA 3DS6A 4QNYA 4D4VA 3R6XA 2BAJA 3DT1A 2XJ1A 3HRBA 2UV2A 4FT7A 3V5WA 5AM6A 5L2QA 5HBEA 3U9NA 4GG5A 4CLJA 3QFVA 2WMAA 3HV4A 3SC1A 4U6RA 5CF4A 2I1MA 1OUYA 1TFFA 2C1AA 2P33A 3BBTB 3F3ZA 1OPKA 4D1XA 4MBIA 3UP2A 1WCCA 1CMKE 4K1BA 3A4OX 4O82A 4JR7A 5BUIA 3P23A 3VIDA 3ORTA 3Q96A 4QDEA 1Q8YA 1BMKA 1RJBA 4E26A 4USDA 5DEWA 4F7SA 3N9XA 2A27A 4UX9A 3R7VA 2Z8CA 3OT3A 4Q9SA 4WHZA 4ALWA 1GY3A 5DWRA 2XNNA 3AC8A 4O0XA 3RM6A 4HVSA 3O71A 1B38A 4FKPA 4YNOA 1U4DA 2ITXA 3DZQA 2SRCA 1LEWA 4FNWA 4XHKB 1Q97A 3CD8A 2XK4A 3RHKA 4A9UA 1KE5A 4EK5A 2UW3A 3FMJA 2C6IA 5K4IA 4I6BA 4OAUC 4DAWA 2Z02A 4JS8A 3ZLYA 4BJJA 3OWJA 1XBCA 3QRUA 4FT5A 5D12A 4CMUA 2BKZA 3EH9A 4FRFA 5EDPA 4ZIMA 4ZLOA 2GDOA 4LQMA 3H0ZA 4GK4A 5AV2A 5CX9A 3W55A 5AFVA 4FEQA 4XYFA 4OTHA 5BVFA 3PA5A 4F9AA 4IW0A 4I6LA 3TTIA 5K5XA 4JL9A 4EZ5A 5CENA 2YCFA 3K3IA 2QR8A 3R9DA 3DQXA 1Q99A 1OKZA 5I9WA 1QL6A 3BHYA 5CALA 3QUEA 4TWCA 4RWKA 2ITPA 3FZPA 2DYLA 4O0RA 4B6LA 3JXWA 2OICA 3QBNA 4WOVA 3VS1A 1TKIA 5LMBA 5C8MA 5DI1A 2YM7A 2YITA 4C33A 4D0XA 5B2LA 4O7ZA 3Q4TA 4FT3A 4D9UA 4EOLA 3LLTA 2F49A 3QYZA 3ERKA 4YUQA 4PTCA 3R2YA 3OP5A 4RJ3A 2PMOX 1VZOA 4KIKB 2YM8A 3JYAA 4G1WA 4W4XA 4JT3A 2H96A 4YBKA 4D2WA 3ID6C 4G2FA 5AAGA 2OZAA 2CGXA 3FC2A 2YCSA 1SNXA 5H8BA 5CEPA 5ANEA 4PTEA 2OJ9A 3GUBA 3QWJA 5GNKA 3VHKA 4B8MA 5E4HA 3GB2A 3WILA 3OCGA 3MW1A 2NO3A 4DE4A 4FZ6A 4FNXA 4ZAUA 3KMMA 2CKEA 4CEGA 4OLIA 3DAJA 4KABA 2PE1A 3UO4A 5E7RA 1M2PA 4JQEA 2WMSA 2XMYA 3H9FA 4IC7A 4AZVA 4AUAA 3MVLA 3OXTA 4PUZA 4QMLA 4N4SA 3GCSA 2OI4X 4YJVA 1Q62A 3DFCB 4U0IA 1FVRA 3VQUA 2JITA 4I4FA 4DN5A 2CGWA 3ZHPC 5KO1A 3AQVA 2XCKA 5E8WA 2IVTA 4WD5A 5AP5A 2JDRA 3NNUA 1JPAA 1XH8A 3P5KA 3E64A 3CGOA 2YJRA 3HV5A 5KBRA 4C2VA 4WG4A 3R1YA 3LQ3A 2GNIA 3WYXA 5IUGA 3Q6UA 3AT4A 2P4IA 1H8FA 4OTQA 5DT4A 1DM2A 4PMPA 3G90X 3BYVA 4GL9A 2WQBA 4LFIA 1T45A 2PZYA 4ZTHA 5BYLA 3G2FA 4YJQA 1OKYA 3LW0A 2YZAA 4MQ1A 4UMUA 3GC8A 3AG9A 4RIWA 1P14A 2X8IA 5JMSA 3R9RA 4IBMA 3IW7A 5A46A 3ZEWA 1W84A 5BX0A 5B7VA 1JSTA 3DBQA 4UXLA 5LMAA 3KULB 3SOAA 2XK3A 3QTZA 4Z7HA 1AD5A 4P2KA 1XMMA 3FJQE 3KKVA 5EOLA 2XYUA 4IX3A 3NUXA 4M0YA 2JIIA 3G6GA 4RJ5A 4C59A 3WIKA 2OGVA 5FTOA 3CKWA 3RCJA 4CFVA 5CU0A 1U5QA 3MB7A 3NFFB 3GT8A 4FV0A 3ZUUA 2YA9A 2H9VA 3F3TA 2JKKA 2WU7A 3I5ZA 3MA3A 3ETAA 4W4WA 2ZV8A 3RCDA 3UPXA 5DR9A 3LFAA 2RFDA 4XP3A 4QO9A 2CGUA 4EK6A 4CFNA 4RX5A 4YJPA 5LCJA 5BYZA 1JQHA 4I24A 4USFA 2IZUA 2BAKA 4ZZOA 5IMXA 3QCSA 2W5AA 2C6OA 2P55A 3R7UA 4ZMEA 1M2QA 2J0KA 1UV5A 1BLXA 5LCKA 3BELA 4HVHA 3E7OA 3W8QA 2OXXA 4G6OA 3W2OA 1BUHA 2PMLX 2O5KA 3HP5A 5HO7A 4IAZA 3SG8A 3PG3A 5DFPA 3BBWA 5HD4A 4WRSA 1QMZA 4EHEA 1J7LA 2G01A 1GZOA 2W06A 3P7AA 4NK9A 4DCEA 5KX8A 5FUTA 5CY3A 3DKFA 3RPVA 3LAUA 3KREA 5FM3A 1KE6A 3FMHA 1RW8A 3PPKA 3QUPA 1SVHA 4HZRA 4GW8A 4C02A 4XV9A 3E62A 5CT0A 2HZ0A 4N6YA 4YJNA 2GMXA 1JKTA 3I79A 4EH7A 1OPJA 2WFYA 3Q53A 4C3PA 3P5JC 1XH9A 3C4XA 4BL1A 2R3RA 4DGNA 2ITQA 3R01A 5FRIA 3LLAA 4X3FC 3NYNA 5FXRA 3MH3A 3PUPA 3LPBA 5HVKA 1Z9XA 3G0FA 4QYYA 4FEUA 4AXFA 2WOUA 3I1AA 4ANOA 3ZSHA 2WHBA 3U4UA 2F57A 3DNDA 3FI3A 3NNWA 4KBKA 1WMKA 4O4FA 3KIOC 2RF9A 5M4CA 4BDKA 2FYSA 4YJTA 5DOSA 4KBCA 2REIA 3MI9A 3P1AA 4LL5A 3RBWA 3Q32A 5KMMA 2PVRA 2C30A 5FLFA 4RBLA 1YRPA 4D2RA 1Q8UA 2JDSA 2OBJA 4XNEA 4HNIA 4HNFA 3L8XA 4BIBA 3VBXA 4FSUA 2OWBA 5DN3A 4IQ6A 4TYEA 3VBWA 3TUDA 1P5EA 3HMOA 3LQ5A 4ACGA 2UZOA 3VUMA 2OFUA 3FKNA 5BNJA 4L45A 2OXDA 4JRNA 1Q41A 3PXFA 1BL6A 1A06A 2C0OA 5CZIA 4G3DA 2W1FA 3PXKA 3C4ZA 5KHWA 5GIOE 4IVDA 2YIYA 4QP8A 3DKCA 3KXGA 5I9VA 3UODA 4AE6A 2GQGA 2IW9A 2BFXA 3QCXA 3TTJA 4F6WA 3O5AA 4FNZA 5C26A 3DAEA 3FLWA 2WTWA 4I3ZA 1ZRZA 4FZDB 4UWCA 5AP2A 5J5SA 1G8AA 3BLQA 4BI0A 5IA0A 3R22A 2NRUA 4M97A 3NYVA 4I6QA 4NCTC 2B9IA 4M15A 2HXQA 3ZTXA 3QZFA 3VNTA 2A4LA 5HCZA 4J99A 5T68A 2R3OA 4F0FA 3DNEA 2UW5A 3O17A 4WKQA 4ITHA 3BWJA 3KXZA 4FL1A 4L67A 4ENYA 3MTLA 2JIVA 2YIWA 2YWVA 4OUCA 5EKOA 5BMSA 1WBWA 1XR1A 2XIYA 2QG5A 4NFNA 3TZ9A 4ANBA 3QTQA 3R7GA 4V0GB 2I40A 4E4XA 2GHLA 5HO6A 4RFZA 2CDZA 4XLIA 5I4NA 1R78A 3R9NA 5ACKA 3H30A 4QMZA 3TZMA 4JIAA 3ZM4A 4Y46A 1SNUA 3I7BA 1VEBA 3GENA 2J6MA 2C1BA 3BKBA 2GHGA 2BTRA 1ZOHA 1UNGA 5EDRA 4XS2A 5A14A 1ZYLA 2PE2A 5EI6A 3LFQA 3UPZA 1FGIA 3BV3A 3QWKA 2J0LA 3PTGA 1URWA 5AA9A 2KTYA 3HKOA 4F7LA 5BQ0A 1I44A 2Z7RA 3MDYA 2X8DA 2XA4A 4GIIA 4IJPA 4GFGA 5LWNA 5ICPA 2A2AA 4RIXB 3PWDA 5IA4A 4O22A 1WFCA 3HDMA 3DK6A 5J8IA 1G8SA 3W0QA 1IA9A 2PVLA 2QU6A 5DG5A 2ITWA 1G3NA 4RGJA 3PIXA 4S32A 5DGZA 4M13A 3HGKA 1URCA 2JLDA 5IQCA 2WQNA 2IPXA 1KOBA 2IEWA 4X0MA 4TW9A 4IIRA 3LCDA 4D5KA 1FVVA 1SMHA 4CKIA 5DR6A 3BV2A 2VWVA 3DLZA 4M0ZA 4MQ2A 4AAAA 4R7HA 4DTAA 2AUHA 4IX6A 5BVKA 2YCRA 4R3PA 5HLNA 2XIKA 4XG2A 4GG7A 2ETKA 4R1VA 3BGZA 1OIYA 3PXYA 2W1DA 4QP7A 5IQIA 4RIOA 1GNGA 3EHAA 1H24A 2VRXA 4UMTA 4X21A 4EOJA 5HX8A 3SQQA 5A4CA 5HCYA 1Y57A 5EHYA 2VTTA 2WMTA 3QLFA 4MYGA 2NRYA 5KMJA 2XARA 4OT6A 4FVQA 3OVVA 1ZY4A 4FSMA 2VTMA 4CMOA 2PL0A 3CJGA 4L7FA 1ZZ2A 3ZUTA 5JK3A 4PTGA 3G15A 3HV7A 3DLSA 2YDKA 3HMMA 1HOWA 5FWKK 3WF7A 3U4WA 4E20A 5CF6A 5I5ZA 4FTQA 4RIYA 2XALA 2R4BA 3K3JA 3RZBA 3R8VA 4AQCA 4JBOA 4D2SA 3LOKA 3UYSA 4DHFA 4DFUA 3FUPA 5L2SA 1W7HA 4IMYA 3CS9A 5F4NA 5BUJA 3C0GA 4E5WA 4RWJA 3TDVA 3VBVA 2FSLX 5E1SA 4QPMA 3QL8A 3LCTA 1KOAA 1NVRA 4D55A 3FY0A 4HCTA 4YC8A 5HHWA 5D7VA 1YI6A 4Z55A 4BI2A 3VS6A 2XIZA 3FL4A 3EYGA 2C6DA 3FZ1A 2UW7A 4C35A 4E6DA 2WTCA 2PMIA 4DBXA 4E5BA 3B8QA 3AD6A 3ODZX 3CP9A 4IC8A 5A6OA 5FM2A 3FSFA 4XCUA 2CGVA 5HX6A 2XANA 1H4LA 2VTOA 3TZ7A 5BVDA 3NLBA 4RJ4A 4BGHA 2ZB1A 4QP3A 4CFMA 5ACBC 3JS2A 2RSVA 4BDGA 3S00A 1IASA 3SAYA 4FSTA 4FTJA 2KULA 1W2CA 3F5PA 3JUHA 4N57A 3HAMA 4BY9E 2Y6MA 2YM6A 3DJ7A 1LUFA 3OCSA 4AW0A 1FGKA 3QQJA 2JD5A 3PE1A 1U54B 1IAJA 4ZSLA 4H3BA 2J4ZA 2BIKB 2VAGA 4GK3A 4IWPA 4JBPA 3FXWA 3NR9A 4J53A 4EK8A 5A4EA 4U8ZA 4ACDA 1IAHA 3SDJA 2XNPA 5B2KA 3EKKA 4BGGA 2R3NA 1ZXEA 3B2TA 4ZZMA 4DDGA 5IH5A 2GNLA 4O91A 3COIA 4AZTA 4GFMA 1PYEA 4M67A 4QP4A 4AZSA 5C8KA 4DFXE 4I6FA 4U9AA 2J5EA 3SVVA 1VYWA 2X0OA 4PX6A 3CJFA 4UMRA 4XUFA 1K3AA 3LMGA 4RT7A 4BBFA 4EHGA 3F2RA 4Q9ZA 3TV6A 3HMPA 1G5SA 2CJMA 5IU2A 3LFEA 4ERWA 3DB6A 4DA5A 3QD4A 4QMWA 2ZV7A 5E8XA 2NNWB 4FKIA 3QZIA 5D9HA 3SXSA 3ZC5A 3ELJA 3U51A 3A7GA 4ZLYA 5K9IA 4LGGA 4WIHA 3ORMA 4L7SA 1Y91A 4JRVA 5TT7A 3MY5A 4MTAA 3L9PA 2FO0A 2LGCA 3CE3A 3PG1A 3UDTA 2X7GA 4YTHA 5GINE 4GRBA 3G0EA 4EJNA 4EJ7A 4KINA 4BJJB 3PA4A 2W1GA 1UWHA 4FZ7A 4F9YA 3DB8A 3F6XA 4FKOA 4LRMA 4X6QC 3ZXTA 3VVHA 4XRJA 2YJSA 3MFRA 4N6ZA 2RFSA 5F20A 5BVEA 2NP8A 3JY0A 3F9NA 1MRUA 2XS0A 4PPBA 4TYHA 5EH0A 4AXEA 4IHPA 3FI8A 1F0QA 3TIYA 3PVUA 4D1SA 4W4YA 4LOOA 3CPBA 3Q9YA 4UB7A 1YHVA 4ZSEA 2HW7A 4FC0A 3QXPA 2BRGA 2PVJA 4IM3A 2OIDA 4XG4A 5CNNA 5CXHA 5AUTA 2I7QA 4PDPA 2P2IA 5HG8A 1QPEA 3TNPC 3E8EA 3QHRA 4FTOA 3RAKA 3W2RA 3S0OA 4F78A 4APPA 4RJ7A 1OL2A 4FIJA 3NUPA 4I5HA 3D7TB 4J7BA 4QEBA 5CSVA 1WZYA 2W9FB 3BU6A 4K77A 4HPUE 5CSXA 2YEXA 4GFOA 2OK1A 3FC1X 2JKQA 3FY2A 4C8BA 4OTIA 2YIXA 3BYOA 3RNIA 3QHWA 3AC4A 5LXMA 5I3OA 1H00A 5E8VA 2F7EE 1XMLA 5KCVA 2X1NA 3F82A 4FVPA 3CY3A 2UZTA 4PP7A 2JDTA 4QPAA 4TYJA 2QKWB 2R0UA 3NDMA 4RC4A 4FG7A 4RZVA 3NWWA 3F2AA 3DKOA 4HCUA 4O0VA 4EI4A 4DDIA 4O81A 4OGRA 4EOQA 2BTSA 4E8AA 5CEKA 4P90A 4V0GA 1H26A 3MFSA 2B54A 4GU9A 5KMKA 2PZRA 4G3GA 4B8LA 1JSVA 4MNFA 3ZM9A 2X9FA 4YC6A 3NAXA 1RQQA 1H0WA 3GCPA 4M8TA 1J91A 2C5YA 3OTUA 3CLYA 4NFMA 4DG0E 3PA3A 1AQ1A 2IVSA 2VU3A 3V5JA 2OZOA 5D11A 2UW6A 3FLYA 4BCQA 4MXZA 5HLWA 4GT3A 2UUEA 4YPSA 4FSZA 3VONA 5CNOA 2P3GX 2ERKA 4ARKA 4HGTA 4E6QA 4TXCA 4FJVA 3UZRA 1OECA 2WPAA 4V01A 4AT4A 3QLGA 4XX9A 2OJIA 1VJYA 5JGAA 5AAEA 2PVNA 3ZLXA 4GKIA 5IMEA 3QD0A 3OF0A 3CEKA 3MH1A 3NS9A 3Q4CA 4AZEA 5K5NA 5HU9A 4XLVA 4NUSA 4I0SA 4YHJA 2EB2A 5AJQA 2J5FA 3CKXA 2JIUA 2O65A 1SYKA 4TPTA 3DQWA 4L3LA 1OI9A 3WF8A 3SA0A 3CPCA 3A62A 2RIOA 2W5HA 2ETMA 4IAAA 5AP3A 4FV3A 2QG7A 2VNWA 3ZUVA 2QC6A 4F7JA 2AC3A 5FP6A 3NYXA 2WQOA 2QO9A 2WIPA 3C13A 3OW3A 5CAQA 1DI8A 2WTKB 5DR2A 3PIZA 1R0EA 4PPCA 2A0CX 3T8OA 4C4EA 5A3XA 3U6HA 5HG9A 3ZFMA 5EDQA 3HLLA 3BYMA 2PWLA 3ENMA 3QKMA 3HDNA 5IISA 3ZXZA 2X4FA 3LHJA 4C34A 1HCLA 3ANRA 4CNHA 5DBXA 3FQHA 4DFYA 1XH5A 3HV6A 2UW9A 2YHVA 4MBJA 3Q4ZA 3ORKA 4KSPA 4O1OA 4HYHA 2C6KA 5HU3A 4RRVA 1H07A 2OZAB 2PU8A 4TTHB 1ZYDA 4BTMA 3ROCA 4F1OA 5HNIX 4MF0A 1DI9A 4PNKA 4D9TA 4Z16A 3NEWA 4F08A 2WO6A 4KKHA 4RA4A 1G8KA 2WEVA 3POOA 4QMQA 4LGHA 2EXMA 3GOKA 4RJ8A 4RX7A 3OWLA 2ITYA 2PE0A 4AXDA 2QOLA 3RZFA 4DEGA 2GQSA 2XK7A 2WELA 4S31A 4ALUA 2XAOA 3DXNA 4IAKA 2ZYBA 2VWZA 3UZTA 2CLXA 3NUYA 4FNYA 3FZTA 3R8LA 3TNWA 2W05A 4DH3A 2XM8A 2X7OA 3I4BA 4RFYA 4L3PA 4X6RA 3V5QA 5KMLA 2XUUA 2WD1A 4ZXTA 3VS0A 1ERKA 3VBQA 4BRXA 3VF8A 3DJ6A 4UXQA 5EM8A 5HG7A 4BF2A 3M1SA 5IEYA 1JLUE 1TQIA 5AV1A 4FIEA 2YWPA 2V62A 5I9XA 2CMWA 3AC2A 1B39A 1GAGA 4KIPA 4FEXA 4BDAA 4UYAA 2C69A 4M14A 2BDJA 3KVXA 2XNOA 5L2TA 4IDTA 3O8UA 4ZY5A 1WBOA 2PUIA 2XKFA 3M11A 5M57A 2UZBA 5JT2A 3QF9A 4BFMA 3I81A 2ITOA 2NPQA 3ZZEA 4H58A 4RA5A 1XO2B 2J2IB 4JBQA 4KRCA 5TF9A 4YZ9A 3SW7A 4AGDA 5JFWA 1YI3A 4KIKA 2XCHA 3ORXA 2WTDA 4BIEA 3PRIA 4NJ3A 4QMXA 1FPUA 4ZZNA 4HVDA 2VTPA 3NUUA 4QP6A 5ANGA 1E9HA 2WZJA 1RDQE 4JAIA 3ALOA 3PZHA 5FD2A 1XWSA 4LG4A 2XIXA 4FTRA 2IVVA 4YTIA 5T3QA 3QZGA 4R78A 3MYGA 4AW2A 3LXLA 4MH7A 4G9CA 1OVEA 4L68A 5D41A 2UZEA 3WI6A 5F9EA 4IJ9A 5J1WA 5I0BA 3HUBA 4LMUA 2W1IA 3PPJA 1YXTA 3NPCA 2PVKA 5DNRA 2Y4PA 4G3CA 4K8AA 2VTSA 2X0GA 2YDIA 1OITA 3FHRA 3A7JA 3ZH8A 4ANNA 4CLIA 5L8KA 3DAKA 4OBQA 2RFEA 2HY81 3OUKA 3EFKA 3MWUA 4FX3A 4MD9E 4DYMA 4E93A 4IXPA 4MK0A 3VN9A 4JIKA 2B9FA 3KRXA 3PRFA 1H1RA 3EJ1A 4EWHA 1PMNA 3DK3A 5AX3A 3F66A 3G9NA 3QZHA 3UOHA 4TL0A 4TZRA 4FK6A 4FSRA 3ACJA 4O6EA 5ANDA 3O23A 4BDBA 4BHZA 4D0WA 4EUTA 4F0GA 4EQMA 3ULZA 4BZNA 4BWKA 4DGGA 1W82A 2A1AB 2R9SA 4XV1A 2CCIA 4QDVA 4D2TA 1FMOE 3FKOA 3Q60A 4Y72A 3FMDA 4J8MA 4XEYA 1W98A 1APME 4LM5A 4UEUA 3D5XA 4F70A 4G16A 5AADA 4HGEA 2XK9A 3DOGA 1FVTA 3VC4A 4K0YA 3UIUA 5KNJA 2WMWA 3ZSGA 3TV7A 4JR3A 3ZLSA 3EKNA 2GNHA 3W2PA 2VZ6A 4O7SA 2PZ5A 3PJ1A 5AM7A 5C1QB 2G1TA 2BZJA 4ASDA 3NVKI 2XRWA 3UC3A 2VO0A 3R21A 3C4WA 4D4YA 3EQIA 4GYIA 4Q2AA 4C3RA 4Z3VA 4RVTA 3UJGA 2ZDTA 1XH6A 4GV1A 4BKJA 3UIMA 1KSWA 5KMNA 3BHTA 4WG3A 4EOSA 4F1TA 3R2BA 4EH3A 2VWXA 3R7EA 3MJ1A 4DEDA 4RZWA 1FQ1B 2VTNA 3MBLA 1WVWA 3CQUA 2CNQA 3LJ0A 1PXKA 2BILB 3DGKA 2B7AA 3TKUA 1M7QA 3R8ZA 4M12A 1MQBA 1BL7A 2XH5A 2UZLA 4RQVA 3EN6A 2CKQA 5EYCA 3EQRA 4JOAA 1PJKA 3ZDIA 2WQEA 3PSDA 2I0EA 4XP2A 4YGAA 4Y83A 4WT6A 3U87A 5K4JA 4DHIB 4XOYA 5C03A 4DLIA 1Q8ZA 4FV5A 3PP0A 3DU8A 4PL4A 5CEIA 4LI5A 3EFLA 4DEIA 4CVAA 2IW8A 4O7NA 3GC0A 4NKAA 3W0MA 4UYNA 2IJMA 4YJOA 5EHLA 5TO8A 2YLFA 5C27A 5HTIA 5HNBA 1L8TA 4X2FA 3RK7A 5IQAA 4F64A 1GZNA 2QU5A 2ONLA 3IK3A 4WNKA 4BC6A 5KMOA 3BL7A 5AIRA 4RMZA 4FIHA 5HLPA 4O7LA 3R83A 1WVXA 3S95A 3D7ZA 3A60A 4G3EA 2QD9A 3ZRMA 3W32A 3RKBA 2O3PA 2OF2A 3EN4A 4P5ZA 4WUAA 5ETAA 4FI1A 4TYHB 3OC1A 3FQEA 2GNJA 5HESA 4MBLA 3GFEA 4EWQA 3PSBA 4QP2A 3O8TA 5FQDC 5CQUA 4P4CA 4LGDA 3JPVA 3DZOA 1REJA 3OMVA 5DA3A 3SLSA 1JNKA 3FMKA 4QMVA 3R9HA 3THBA 4BYJA 1ST4A 1HCKA 4PL3A 3FQSA 4QMTA 4Y8DA 2IVUA 3KULA 3RVGA 5CEOA 2RG5A 2JDOA 3MV5A 4CFWA 5IF1A 2H6DA 2E9NA 1X8BA 5CVHA 1MRVA 3GQIA 3SOCA 3UVPA 3WZKA 3ZOSA