2YIYA

Crystal structure of compound 8 bound to tak1-tab
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
306
structure length
293
Chain Sequence
SLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 7, TGF-BETA-A
publication title The Discovery and Synthesis of Selective Dfg-Out Tak-1 Inhibitors
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase activator
total genus 93
structure length 293
sequence length 306
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yiyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yiyA01
4KINA 1YW2A 3FXZA 3DXNA 4BI2A 4Z9LA 1YOLA 2J0MB 3Q5ZA 4J95A 4IH8A 4XG9A 4GT5A 4TPTA 3QD2B 4QYGA 5CAQA 1H1QA 2WMTA 5AADA 3R8ZA 4O7RA 5HIBA 3P78A 3PY1A 1JQHA 5H8BA 2X9FA 4JX7A 2GNIA 2EB3A 3NLBA 3OT8A 4KABA 1ZMVA 4OLIA 4BHZA 3AT4A 4BCKA 4HNFA 5TF9A 1UKIA 3LOKA 2P2HA 4BN1A 5AUTA 3KFAA 4UXQA 5CT0A 4GFMA 4D5HA 3DKOA 4RG0A 5M4CA 2HELA 4UALA 5L2IA 3W10A 3LLAA 3VHKA 1KOAA 4C4EA 2ITYA 4MNEB 4Q2AA 3QTRA 3H0YA 2ZM4A 5DN3A 3T9TA 5JFWA 3FDNA 5LMKA 4FTQA 4IVBA 4UMTA 4CLJA 2VO3A 3R7EA 1G8SA 4NCTC 4XOYA 4DFZE 3Q9WA 4D2WA 3ULZA 4F63A 5C1QB 4F1MA 1Q8ZA 2UUEA 2YM3A 5KHXA 3QCSA 4FVPA 4CMOA 3LFAA 4JBOA 4F1TA 5TOZA 2R7BA 3WYYA 2YDIA 3L8VA 4O83A 4QTEA 3QBNA 1JSVA 1YWVA 3IDCA 4K2RA 4WRSA 4E6QA 5KMKA 4IWPA 5DT0A 3TDWA 4ALWA 4G6OA 4AE9A 3HMPA 3FMLA 4G1WA 3ZBFA 1OKWA 3HA8A 4FSTA 3SW4A 4ZSJA 3PVWA 5IA4A 4LOOA 5HI2A 4YHFA 3SRVB 2UW3A 4D9UA 1JKKA 3TNIA 5CF8A 4A06A 3F2AA 3O2MA 4RVKA 5F95A 2P2IA 2Z8CA 4HGSA 4QD6A 2BAKA 2YA9A 3DZQA 4JT3A 4ASDA 3HV6A 2LGCA 5L4QA 4ZJVA 4BC6A 4APCA 4NH1A 2YWVA 3G51A 3ZSHA 4BTFA 2WMVA 4JDIA 5J8IA 5BVWA 4D2SA 1PMNA 2PTKA 4RQVA 4WRGA 4IVDA 4F09A 5HTCA 3QKLA 3FLWA 4KKGA 4WUAA 2ESMA 2OXYA 3IW4A 3QC9A 2ZV7A 3VULA 4F6WA 4RZVA 3PWYA 4BBEA 2HY81 3OW4A 3GBZA 4N6YA 4QQTA 3A4OX 3MGYA 4IZYA 4QOXA 3QCXA 2Y7JA 5AX3A 5FXQA 3HVCA 1WVXA 4XBUA 2ZDTA 3LVPA 1OECA 4YHTA 4YJVA 5EW9A 4NK9A 5HESA 3QQHA 1UA2A 3TUDA 4O21A 3FZRA 3G9LX 5CSVA 5B7VA 4MH7A 1WBPA 4TXCA 4O27B 4AW0A 2WTKC 5DNRA 5IEVA 2YDKA 2ZV9A 5D9HA 1UU9A 2V7AA 2XCHA 3F66A 4TWNA 2Z7QA 3LXKA 4F99A 5J79A 3NUYA 4X2NA 2X7OA 3COKA 3QRJA 4IWDA 4NL0A 2YM4A 1VEBA 4A9YA 4IB0A 4Y73A 5AAEA 4JVGA 2CGVA 3NIZA 4RJ6A 3R7YA 2B9FA 4OT5A 4CCBA 2UVXA 3DKFA 4ASZA 4NIFB 3ENHA 3QTSA 5E90A 3JS2A 5AFVA 5IMXA 3KXMA 3F3UA 4TWOA 3Q3BA 3I81A 4Q5EA 1U54A 2VGOA 3O7LD 3VIDA 5JFXA 2UZWE 3MY0A 3MJ1A 1YDTE 3JPVA 5DGZA 3UYTA 3HUBA 3DLSA 3E7OA 4BDIA 2EU9A 2V7OA 2AC3A 3BV3A 2I7QA 4TYJA 4AZTA 4E7WA 4LMNA 5I9YA 4O0WA 4R7IA 2ZM1A 1NA7A 3KXGA 3MTFA 4FTMA 5IZFA 2GQRA 1TQPA 3G6HA 1ZYLA 2O63A 3DLZA 3UIMA 3VS3A 4YSJA 3EOCA 5CAUA 3HMNA 4E5BA 4KIQA 3GCUA 3HLLA 3E93A 4JXFA 4YNOA 5K0KA 3SXFA 4BWKA 4I5MA 4IE9A 4M67A 3UVQA 3ZH8A 3EYHA 1OITA 4FSRA 4O6LA 3O23A 1KUTA 4MXYA 2NNWB 4A4LA 5IA3A 5AV0A 4UMQA 3EWHA 4FT7A 2QO7A 4MD8E 2YACA 4R8QA 4DT8A 4IQ6A 3OP5A 3L9PA 3TV7A 4EJNA 3HDNA 5CS6A 3V5JA 3IQ7A 3EL8A 3RALA 2G2IA 2OIQA 2PVHA 4UWBA 4R78A 4LL0A 4YZNA 2WMQA 3OCBA 5A4QA 5K5NA 2XRUA 3K3JA 4RMZA 5KO1A 1OB3A 4OAVB 2V5QA 4LYNA 2WTDA 3RK5A 3TCPA 2C3IB 4PMSA 4ZAUA 3ZUTA 5FQDC 4XOZA 2ITWA 3EFLA 4XP2A 2JAMA 3AC5A 1A9UA 4JG8A 4MF1A 2RFDA 4RIXB 4QMLA 2YCFA 3UP7A 5AP4A 2ZVAA 3GQLA 3O0GA 3SV0A 2WQBA 3AD5A 3EQPA 3UOKA 2W1ZA 3DBQA 5DA3A 3ZLXA 1IAHA 1WZYA 3MVMA 5DLSA 3ZCLA 4BIEA 3GOPA 4LUDA 3U54A 3WIKA 4A9SA 4GU9A 5IG1A 3HGKA 2JFLA 3MH1A 4CLIA 3F3WA 4X6QC 2C3LA 1QCFA 2WTKB 5EOLA 3DQXA 2CN5A 2G2HA 3Q9YA 3RPVA 5A4EA 3R8UA 3C5IA 2GNHA 3PXQA 3JUHA 4XG4A 3DPKA 4AZFA 3VUKA 3L8PA 5JGBA 3A8XA 4JG6A 4K6ZA 4IACA 1STCE 4MBIA 4BCOA 3EQCA 3D94A 4L8MA 3P08A 2ZV8A 4GK4A 4QO9A 3UNZA 5ANDA 3WF9A 3OS3A 4F9YA 3PVGA 4X21A 3GC9A 3TXOA 3QD3A 4QT1A 3ZTXA 4FEUA 5DOSA 1GIJA 1PJKA 5ETCA 5JMSA 5KCVA 1GY3A 4YTCA 2NP8A 2JC6A 4OBQA 2XZSA 3UC4A 5IEYA 2A1AB 4PQNA 2OJIA 4LOPA 5IDNA 3V3VA 3F7WA 3EMGA 4LG4A 4YSMA 5EKOA 4AT5A 4ENYA 4IAYA 3ZRMA 4D4SA 2HWPA 4AT3A 5I9ZA 4UZHA 5K9IA 2G15A 4S30A 3A61A 3MIYA 2X9EA 3R8LA 5FTOA 5LMBA 3IW6A 4DH8A 2ONLC 3ZC6A 3LMHA 2F49A 3FMHA 4BI1A 3FJQE 5CAOA 1Q3WA 2X6EA 2ZYBA 3CE3A 3Q5IA 4FT5A 2BRNA 2QD9A 3AQVA 3F5PA 3FKLA 1H1RA 2P33A 4YPDA 4M14A 2WMRA 3AOXA 2W1HA 4RRVA 3G33A 3TJDA 4RQKA 1OZ1A 2CLXA 3DA6A 3BU5A 4IIRA 4ACDA 2C0TA 5CF6A 4MXXA 4CFWA 3FPQA 4L00A 3QGYA 4FZDB 4ZS4A 5HVYA 2XIYA 3UIBA 5A46A 1CMKE 4O96A 2BFYA 5A3XA 5EQPA 2HYYA 5AV3A 4EOOA 3C7QA 1VR2A 1J1CA 1SM2A 3LFNA 2Q0NA 3LHJA 1YXXA 5BVOA 2W7XA 3N4UA 5BMMA 3C1XA 4HVHA 4DH7A 4F0GA 2BALA 4X3FA 5IUGA 5DG5A 2OG8A 4CMTA 4WNPA 4K18A 1KV1A 5CF4A 2ZDUA 3FKNA 5CSWA 2CHLA 2OWBA 2YZAA 3BGQA 3M2WA 4E20A 4PDOA 4BICA 4L68A 3BWFA 3PJ3A 2XIRA 4AX8A 4YJPA 4FL3A 3AD4A 4XS2A 3AGMA 3QC4A 2PE1A 4B9DA 1UVRA 1WBNA 3FMNA 3MY1A 4KSQA 3SRVA 4BIBA 5AWMA 4PL3A 3EJ1A 1Q97A 4FUYA 2YIYA 1K9AA 3SKCA 4AA4A 2W1EA 4F9BA 5EYMA 2BRHA 1LEZA 4C38A 4C33A 4OTDA 3FL4A 3TJCA 4FSUA 2X4ZA 4U3ZA 3A2CA 3CJFA 3DU8A 4PMMA 4RC3A 4Z55A 2X7GA 4J1RA 4L3LA 2CCHA 3Q4UA 4F9WA 3COIA 1YI6A 4UWCA 2PVLA 3F61A 3EIDA 4PRJA 5HE2A 5EDPA 3F69A 3ORTA 4EHGA 1YWNA 4EOKA 5I3OA 2E9UA 2C47A 3BE2A 3GP0A 3NYVA 3DQWA 2YCQA 1PW2A 3Q6WA 2ZJWA 3KVXA 3R7UA 3F5UA 3P5KA 4O2PA 1F0QA 4R3RA 5AV1A 3DKCA 5DT4A 3PLAE 4RSSA 5L8LA 3G0EA 4PPAA 1M52A 4YJQA 3SDJA 1UU3A 2WFYA 1TKIA 4J53A 4KB8A 4H39A 4ZY4A 2IZSA 3F7ZA 4ZY5A 4ACMA 4RJ3A 5I3RA 2PVMA 3R1QA 2O5KA 2QKWB 4IADA 3ZFMA 4QP6A 2FSTX 3RK9A 5HTIA 1FMOE 4LRMA 4O7VA 3GCSA 4U43A 4RIWB 3GVUA 2ITQA 3E87A 4IDVA 3I0QA 2R0IA 2W1CA 4XG8A 1ZLTA 4DEDA 1IAJA 3B8QA 2J7TA 3RWQA 4FKTA 3FSFA 4CFNA 4QYEA 5KMLA 1RE8A 3Q32A 2BTRA 3SLSA 4RA4A 2VX0A 5LCJA 2CNQA 2JFMA 4NIFA 2XBAA 4GSBA 3SOCA 4BIDA 3L9MA 2C3JA 3R01A 2DQ7X 2WQOA 3A7JA 4HZRA 4FTIA 3TV4A 3PXRA 3VN9A 2BUJA 2FYSA 3GU4A 5JH6A 3ORXA 3DY7A 3H0ZA 2Y6OA 4ASEA 3P7AA 3H9FA 4FOCA 4JI9A 5BUIA 4NCTA 2RSVA 4NW5A 4FYOA 3D7ZA 5CENA 5EI2A 4FV7A 2ERZE 1ZOGA 3VBWA 2G1TA 3PXKA 4V0GB 1ND4A 4FV0A 1MRYA 1REKA 3HZTA 1TQMA 4QNAA 2DUVA 4C2VA 4KRDA 2VNYA 4DG3E 4EH8A 5I9WA 4RA5A 2PULA 2YERA 4DH3A 2O8YA 3C13A 4ZJIA 3QTXA 4AGUA 4HCUA 2XF0A 1Y6AA 3N9XA 5FD2A 4E93A 4C62A 5AA9A 3HV7A 5GZ8A 4JL9A 4OTWA 4DTBA 3QQLA 4DF3A 4QP9A 3V01A 3TZ8A 4O7SA 5CF5A 3GCVA 5C4KA 4NSTA 1OPJA 5FRIA 4DEGA 5AP6A 4F9CA 3TIZA 3FE3A 5A14A 4D55A 4JR7A 5GIOE 1Y8GA 4HVDA 2GCDA 3DTCA 1NW1A 4EH7A 3D83A 3QZFA 3DOGA 4C02A 3TACA 4RJ8A 1O6LA 4BDDA 4GT3A 4ZLYA 4CGAA 4MD7E 3FKOA 3PWDA 5AP0A 4LRJA 4I92A 1Q8UA 3O96A 4HNIA 3IECA 2XKEA 4A9UA 4RIXA 1KE7A 5IF1A 5AMNA 4AZSA 2RF9A 1GZNA 1OPKA 2OK1A 5K0XA 4ZSLA 2WIHA 3ATTA 3TTJA 4FIGA 5EOBA 1GAGA 2BIYA 3O8PA 3OY1A 5E8ZA 3N4TA 4CKIA 4JG7A 4EH4A 4AG8A 3DAKA 1XH8A 3PXFA 4D9TA 1IASA 4FKQA 3QWJA 4F1OA 1LR4A 5A54A 4I41A 3F9NA 3R83A 4NTTA 3W2RA 4R77A 1A48A 3OTUA 5FLFA 1APME 1F3MC 4WNOA 3ZFYA 3FI4A 3AD6A 3E5AA 4IEBA 3VUMA 3T3UA 5AEPA 1PMEA 2XUUA 3HUCA 3FQHA 5KKRB 3FI2A 2RFSA 3SG9A 4K1BA 2V62A 3THBA 4QMUA 1WBVA 2OH0E 4MBJA 3FC1X 4YTHA 3R00A 3WIGA 1PXNA 4GIHA 4MD9E 4PL5A 2ERKA 3U8WA 3MESA 4DT9A 5E8XA 5CSHA 2PMOX 1OIYA 2BDFA 4KNBA 4JS8A 4RWKA 5HQ0A 2QG5A 4TYEA 4EZ3A 3MH3A 4FV3A 4EOPA 5LQFA 4MX9A 2VX3A 5M4UA 4BKJA 4DHFA 2UW0A 4JOAA 4RWLA 5JFSA 2CSNA 2ITUA 2X8IA 3E8NA 2PVKA 3OFMA 3FQEA 2W9ZB 4U6RA 3RNIA 3MPTA 1NY3A 2RFNA 4HCTA 4XP0A 1OL7A 5HX6A 4KIOA 1XHAA 3OY3A 3E3PA 4K77A 5E8SA 5HD7A 1V0OA 4JBPA 1DI9A 1H08A 2QR8A 2UZOA 3PFQA 3DBEA 4EOJA 3BEAA 4XG2A 5DI1A 3I6WA 4FV1A 2PU8A 4GS6A 3CGFA 1CKIA 1Y91A 2B55A 2PHKA 5CU6A 2ZV2A 2OF4A 3AC1A 1O9UA 3VVHA 4A9TA 4HVGA 3DXQA 2HWOA 3EN5A 1H1WA 3QX4A 4XV2A 4N4SA 3RWPA 5KMMA 5CZHA 4DCAA 2J5FA 3NUUA 3O7LB 4HPTE 3DB6A 1JKTA 4C35A 3NNWA 2IVTA 5AAGA 4BY9E 5A9UA 5I4NA 1BL6A 3VS1A 5AUVA 3UZRA 2HXQA 4ITJA 3ROYA 2R0UA 1ZOHA 4JBQA 1FGIA 2AYPA 2XNGA 3BI6A 2W06A 1UNHA 3EH9A 3C51A 4ALUA 2IO6A 1V1KA 3AXWA 5AAFA 3ETAA 2QO9A 1FVTA 5DT3A 5GJGA 2FUMA 4OAUC 1UNGA 4FV8A 4P7EA 5FTGA 4O7WA 3R71A 3LFCA 4FNZA 2VWIA 2VX1A 3PJ2A 4NUSA 5HO6A 3R9NA 3UDBA 4BGQA 1JNKA 2FVDA 4ZTHA 5M4IA 4X2FA 5BVKA 4EK3A 4QYFA 2QKRA 5CU4A 2REIA 1L8TA 3O17A 4BZDA 2C1AA 1BI8A 3C0IA 2XIKA 3BHYA 4CTCA 4S34A 2PUNA 4H05A 3WARA 5HCYA 1SVHA 4QMPA 2UVYA 4W4VA 5EM5A 3KMUA 3RPOA 3U6HA 4UB7A 5HTBA 2BROA 3FWQA 1BLXA 5EM8A 3CD8A 1PXOA 2A4LA 3I60A 3KCFA 3N51A 4IMYA 4QMSA 4WNKA 4CD0A 1Y57A 3O50A 5IQFA 4YGAA 4LQMA 1NVSA 3VQUA 4XRLA 4S2ZA 2JBPA 3GQIA 4K0YA 1HOWA 4TNBA 4JDKA 2VNWA 1LP4A 2ZOQA 5J9YA 3KC3A 3PE2A 1PF8A 2ZMDA 2JDRA 4DA5A 2BTSA 3QTQA 3RCDA 1O6YA 2VWVA 4FTTA 4C59A 4FMQA 4MEDA 3TV6A 4O1PA 4E1ZA 4XCUA 4L9IA 2JDTA 3C9WA 3DKGA 3BYVA 3NZ0A 1REJA 2XJ0A 2YN8A 3MTLA 5M57A 4XMOA 1YDRE 4FZ7A 4FZFB 2GTMA 2BKKA 4IHPA 3HMMA 4UYNA 2GPHA 5D7AA 2JIUA 2WU7A 4IM3A 4MKCA 3TZ7A 4F0IA 3TKUA 4D4RA 2ACXA 3CQUA 4YTFA 2Z7RA 3Q04A 2O64A 3PSCA 2XS0A 4ERWA 3DGKA 1XBAA 1Z57A 1Q5KA 1WBOA 5CALA 4G31A 1BMKA 4X0MA 3PA4A 3MVJA 4AZWA 4BGGA 4IFCA 4X3FC 4P5QA 3UC3A 2ONLA 3Q4ZA 3NNVA 3B2TA 2UZDA 4YC3A 3ZSIA 4R7BA 4ONAA 2PZPA 5CEOA 3QGWA 4ZTLA 1UV5A 3QZGA 4GKHA 4I6FA 2HZNA 4DITA 5EFQA 3NUAA 1H00A 1KOBA 1P4OA 2R3GA 3CLYA 3RTPA 3QKMA 3ZYAA 3QXOA 1FQ1B 2EXMA 1OIUA 2I6LA 2J0JA 1W0XC 5EM7A 5HKMA 1P5EA 3GGFA 4CFMA 4PX6A 2R7IA 3GC0A 3DNEA 2UW7A 3ET7A 2R3LA 3QUDA 3TN8A 4I94A 3ZBXA 4C4IA 1H26A 3FC2A 3PIZA 4FKPA 4JX3A 5CI6A 2JIIA 4L67A 4V0GA 4EWHA 1UWHA 3QF9A 3F82A 4MWHA 1DM2A 3T3VA 4YJSA 5EKNA 1ZZ2A 2E9NA 4S33A 3A4PA 3FMJA 5JKGA 5E8TA 5EH0A 1YKRA 2VTIA 4HYIA 4D28A 1URCA 4GFOA 5HLWA 1LEWA 4GU6A 4FTAA 4ZMFA 3FLYA 4FTJA 5AUZA 4AWIA 4HYHA 1SNUA 4M0YA 4ZOGA 2H6DA 3EN9A 3KA0A 3RAWA 3V6SA 2VGPA 4FIFA 5BVDA 4BHNA 3R63A 1Q4LA 1PXIA 3QTUA 3GU5A 5DMZA 2IJMA 2CLQA 3KU2A 4CYJA 1RQQA 3UNKA 2OJFE 3ITZA 3FQSA 4XNEA 4YBJA 3UJGA 5KE0A 4EH9A 2XNEA 2J0KA 3OHTA 5AUYA 5IH6A 3UG1A 3VJOA 5CWZA 4TYIA 3HV4A 4U41A 4CYIA 5AP2A 4NEUA 3R22A 3ZM4A 1ZMWA 4ACCA 1IA8A 3ZXTA 4FX3A 3Q2JA 2R3FA 4YZBA 2C5YA 1BKXA 4XG3A 5G1XA 4AZVA 3UOJA 2HW6A 3ZUUA 3G90X 2BAQA 3NNXA 4YHJA 1BYGA 2HZIA 5CAPA 4I1ZA 4BCNA 3CSVA 3SG8A 3SA0A 2XB7A 2ETMA 2OFVA 3L8XA 3MA6A 4ACGA 3D5XA 3NAYA 3QZIA 2VTAA 1FINA 3EB0A 3E8CA 4OUCA 3MPAA 5A4LA 4I93A 4JRNA 1OUKA 3DJ6A 3IDBA 3G2FA 4KRCA 1MUOA 1S9JA 2BHHA 2GHLA 4GFGA 4X3FB 3R9HA 3F2NA 2G9XA 2BKZA 4M97A 2RFEA 3O8TA 3TG1A 2C6TA 3NRMA 5JGAA 4QTCA 2VTJA 3EYGA 4YU2A 4ZLOA 1RJBA 1ZYDA 2W1FA 3I5ZA 3R9OA 4BCJA 5J5TA 1XQZA 4TZRA 4XH6A 4RFZA 1ZYSA 4GEOA 3ZXZA 5HNBA 4LI5A 3C4FA 4RX8A 3UGCA 3VO3A 4E6CA 2CJMA 5GINE 2YLFA 4RIOA 1R0EA 4ZZOA 4L3PA 2IZTA 2VD5A 4FF8A 4BCMA 3KVWA 3R2YA 4Z7GA 4G16A 2W5BA 3MA3A 1I44A 3QTIA 1JKLA 4PTCA 4YPSA 5D7VA 3BHTA 1XWSA 2FO0A 3ANQA 1YOMA 3ODZX 3ULIA 3KN6A 2JAVA 4GT4A 4U80A 3WZUA 4BBMA 1FMKA 4H1MA 3HRCA 4EBWA 5HD4A 5CVGA 4AP7A 1W82A 3ACKA 5DYJA 2BPMA 3U4UA 3DJ5A 2C6OA 2NRYA 2Z2WA 3LJ0A 2QLQA 3BCEA 4NM5A 4BR3A 4FSMA 2QOBA 3G6GA 4CSVA 4RJ7A 4L44A 3GFWA 2ZMCA 3HYHA 3AMBA 5DEYA 3PJ1A 5HICA 4DEBA 4I5CA 4JAIA 4F9AA 5F4NA 4BCGA 3R2BA 1S9IA 4IAIA 1E9HA 4K33A 4PPBA 4ANOA 4E73A 4ARKA 3R9RA 3CPBA 4IZ5A 5KNJA 3MFUA 3A62A 2XP2A 3QLGA 4RJ4A 4Q9ZA 3OUNB 3SXSA 5H2UA 1Y8YA 3M42A 3PVBA 5GNKA 3MH2A 3LAUA 2P4IA 3PIXA 4FV9A 1H25A 2C5OA 4DBXA 2XH5A 3G5DA 2R5TA 4R1VA 3RPSA 4GUEA 4UXLA 4AE6A 1Q8YA 4ZSEA 1O6KA 1VJYA 4EYJA 4II5A 4F7JA 4FBXA 4TWCA 3K2LA 3ZLSA 2VRXA 3ENMA 4E4LA 1IG1A 5GJFA 5FDPA 4UBAA 5TO8A 5M06A 4ERKA 5KBQA 1OMWA 2I0HA 4AFJA 2C6LA 1OKVA 4GW8A 4FL2A 5LXMA 1YVJA 3MFTA 5AR2A 2RIOA 4AN2A 2GDOA 5IQBA 3ALNA 2QNJA 5HBEA 3ZS5A 3R7VA 2HZ4A 3COMA 2YM7A 5ANIA 3ZO1A 2PVYA 3OG7A 5M44A 1ATPE 4AU8A 2I1MA 3KN5A 4I23A 4WUNA 3ZUVA 4S31A 4HYUA 2I0VA 2YHVA 2BCJA 4YC8A 3S95A 2X0GA 2JGZA 3TKIA 3ZEWA 3ZU7A 4ASXA 4FEVA 3BU3A 2UW5A 4IAAA 3UVPA 4XLVA 3FXXA 5DFPA 4DCEA 4RLKA 3IO7A 4O7YA 3WI6A 2OZOA 3WF6A 4CKRA 4KIPA 3ZRLA 3R28A 4DLIA 3LCOA 2JDSA 1BX6A 4XP3A 1MRVA 2ITZA 3QU0A 1PXKA 4K9YA 4PP9A 1OPLA 3QRKA 4FT0A 3RZBA 5CXHA 2VTQA 1Z9XA 1H4LA 5DWRA 4L53A 3HEGA 4C7TA 2UZEA 5HE0A 1OVEA 2EWAA 2WXVA 2BR1A 3UG2A 3D0EA 1UU7A 3W1FA 3NSZA 4RZWA 1FVRA 4DFYA 5DVRA 4BCPA 2J2IB 3TUBA 2V0DA 5HG7A 4FSQA 2EXCX 2OKRA 5FEEA 4IJ9A 2OF2A 2VWYA 2HY0A 4U44A 2JITA 3W8LA 4QPAA 3LM0A 4X7QA 5ETFA 4YJOA 3TNHA 4J97A 4QP1A 2PMLX 3R9DA 3ATSA 5CANA 3WZKA 2ETRA 3GNIB 4G5PA 4O22A 2JDVA 4XHKB 5IH5A 2XKCA 1QMZA 3NMUF 1UWJA 4AN9A 5CQUA 2WAJA 3E62A 4Y46A 5EI8A 4R1YA 4YJRA 4GG7A 5L3AA 1R78A 4E4NA 3NEWA 3VBVA 2QODA 1WBSA 3FBVA 3OXZA 2NPQA 3RBWA 1UNLA 1PXPA 3GC7A 1ERKA 3LFBA 4K8AA 4BDBA 4BGHA 4CT1A 4EQUA 1ZRZA 2DS1A 3OWKA 3DFCB 4IW0A 3VC4A 3IW5A 2OIBA 2ITTA 2QU5A 3CXWA 4J96A 2CPKE 5D11A 4BKZA 2UZUE 3OXIA 4QTDA 4G6NA 3ROCA 2YITA 3OOGA 2UZTA 1YXVA 1GZ8A 3DT1A 3TZMA 3VBQA 2AUHA 1NVQA 5C4LA 3RJCA 2GFSA 3U9NA 5CVHA 4FKWA 3VBYA 3OWJA 3RHXA 3OCTA 5EW8A 5H8GA 2XKDA 3OOMA 5CTPA 1Q62A 4Y8DA 3R8VA 3BPRA 4ZXTA 1OI9A 1B39A 3TKHA 3CD3A 5CNNA 5M55A 2C1BA 4BTMA 1MQBA 4N70A 5E1SA 5HHWA 3FLNC 2WMXA 5HZNA 4N57A 2BZKB 3TDVA 3MFRA 4QMXA 5IA5A 3ORKA 1P2AA 4QP3A 3CTHA 4Z16A 1XH6A 2OH4A 3HECA 3LQ5A 1URWA 4BTJA 3D9VA 3PSDA 3C5UA 4J52A 4RFYA 5GZ9A 3RVGA 4DEAA 2YWPA 4IVAA 2SRCA 3TI1A 4GK2A 3ZHPC 2PUPA 4KKHA 5K3YA 2QOHA 5L2TA 2JIVA 4LRKA 5IQEA 4Y5HA 3CR0A 1HCLA 3DBFA 2IWIA 5IA2A 4LL5A 4K11A 4YURA 5IPJA 4KBKA 4QMVA 3OWLA 5K4JA 2OBJA 4WIHA 5IMEA 2XJ2A 4N6ZA 2GNJA 2QOKA 3H4JA 5M09A 4GK3A 4GKIA 3LXLA 4M84A 5ACBC 4IVCA 2CMWA 4FGRA 3QRIA 5FG8A 4BDHA 3PP1A 1J1BA 2AC5A 5IA0A 4UMPA 4IANA 3UOHA 3SGCA 4B6LA 4F65A 3S1HA 2R64A 5IISA 2ITXA 2WIPA 3RK7A 4G2FA 3Q53A 3SQQA 3I0OA 2NRUA 2GS6A 2CGWA 3VS6A 2VZ6A 3KULA 4EOSA 1KE5A 2VO6A 3R1YA 5TT7A 4RPVA 3O51A 3JXWA 4L42A 3WZEA 2ITVA 3PRFA 4GUBA 3Q4TA 3MB6A 4HCVA 3NUSA 2X4FA 4L43A 5KX8A 3RGFA 4FKVA 3QTWA 1CSNA 3EQIA 4BCHA 3D15A 4APPA 3GT8A 2ETKA 4EOQA 5E8YA 4OTGA 4FNWA 3HX4A 3VS7A 3D5WA 3LXNA 3ELJA 1OL2A 4GMYA 4BB4A 3AMYA 3NW7A 2CKEA 2J4ZA 2A19B 3D14A 5KZ0A 2CDZA 4ZTNA 5I9UA 1IA9A 2BZHB 1W83A 4KA3A 4KUJA 4JLCA 4PUZA 4R5YA 4USFA 3S0OA 4AA5A 2A0CX 3NCGA 4CTBA 4LUEA 1JSUA 1V0BA 2PL0A 1PXMA 4MXOA 3UYSA 3DK6A 3UPXA 4RJ5A 1YXUA 4BCFA 4B4LA 3P7BA 2E9OA 4I20A 5I9VA 4AA0A 4CFFA 4NZWB 4FIJA 3TUCA 3P86A 3AGLA 3OCGA 3LFEA 1SYKA 1JOWB 1I09A 3ANRA 4FODA 5AR3A 5KKRC 4RLLA 1QPJA 4O86A 2QQ7A 3CC6A 4ZJJA 3IW7A 1ZXEA 5E8WA 4XV9A 4FV6A 2BRMA 4PF4A 3CCNA 4G3EA 1OL1A 3ORLA 2W17A 4PMTA 4OTRA 3PLSA 1PMUA 4YZ9A 3RKBA 3E7VA 3EQHA 2UW6A 5FDXA 5HLPA 2JBOA 3DV3A 4R3CA 1XO2B 4S32A 1JSTA 5EHYA 1IEPA 3PY0A 2Z7SA 5IEXA 5GJDA 4DFUA 1ZY5A 1FGKA 3VAPA 5CNOA 5E8VA 5EDQA 2IG7A 4WD5A 4XX9A 4YLLA 3PVUA 3VNTA 4CNHA 4AOTA 3PRIA 3HAVA 3GU8A 2I0EA 3QQJA 4GG5A 3I7CA 4YZDA 3WYXA 4WHZA 2HW7A 4EZ5A 2XNMA 4GV1A 4TW9A 5IQCA 4U81A 2IW8A 3TNWA 2Z02A 3K3IA 4ZZMA 4FV4A 3LFQA 2QHMA 1OIQA 3DK3A 2XK8A 3CY3A 4EOLA 1SNXA 2QOQA 4QP7A 4C3FA 4MTAA 5ANKA 4IM0A 2QHNA 5HG9A 3BGPA 4ZTQA 5CEMA 2E9PA 3G0FA 2WGJA 4NM7A 4XG6A 3A7GA 4E6DA 1YI4A 2ZB0A 1CTPE 4M3QA 3LKMA 3VQHA 5ANJA 3KB7A 5F9EA 1NVRA 1M7NA 4RWIA 3P23A 3AC4A 3SAYA 4QP8A 5C8MA 3UQCA 1WVWA 4FNYA 4DGOA 2J50A 4HPUE 3NCZA 2R3HA 3COHA 4MBLA 2JEDA 3ZLWA 3TNPC 4LMUA 5D12A 2YJRA 2WPAA 3NYXA 4ZMEA 1JVPP 3BYMA 2QO2A 5HG8A 5HIDA 1ZY4A 5IQAA 3CKWA 4ZSGA 4IX6A 3FYKX 4UZDA 5HEZA 3RMFA 4RX7A 3D5UA 3PIYA 3HMOA 3BHVA 4CVAA 2KULA 3GCPA 1G3NA 1Z5MA 2XBJA 4DH5A 5C8NA 1K2PA 4IB1A 4OTFA 4XEYA 3RI1A 4GCJA 2WKMA 4EEVA 3OUKA 4FSWA 2R2PA 4AXAA 3ID6C 3WILA 4YJNA 4DFLA 4LV8A 4NJDA 5LOHA 3BLHA 4FIEA 2H9VA 5A4CA 4QQ5A 3F5GA 3QA8A 3MFSA 2OGVA 3P9JA 4FG9A 3VUGA 2WTVA 4BWXA 3S2PA 5JZJA 3WF5A 5HU3A 4IB5A 2HENA 3B2WA 2I0YA 3SHEA 2R9SA 3F3VA 3HAMA 3IG7A 2VO7A 4RX5A 5TE0A 3TTIA 1EH4A 2QONA 1OL5A 4C4HA 2O3PA 1ZZLA 4V05A 4BZNA 1SZMA 2FB8A 4AAAA 3NVKI 2R3KA 5LJJA 4MHAA 3P7CA 3TM0A 5JEBA 1Q24A 3R7IA 3EFWA 4NFMA 4FIHA 3R8MA 3DBCA 3A7HA 3H9OA 3RZFA 3FZOA 3FZSA 3ORMA 3SVVA 2HK5A 2J5EA 4O0UA 3UO5A 3Q6UA 4EKKA 4DG0E 4FSZA 3UPZA 1PRYA 4FEXA 2GQGA 3POZA 3GXLA 2B0QA 4FC0A 3SD0A 4C2WA 4EKLA 3AC8A 3KF7A 2WMWA 3WE8A 4TL0A 4FZAB 5I9XA 1B38A 4DINA 5IA1A 1Q41A 5HU9A 1ZWSA 1H0WA 5HCZA 4D2RA 2F9GA 3BQRA 3FHRA 4NT4A 4D4YA 4PMPA 4FEWA 2XNNA 2QOLA 4FG7A 3QA0A 5FXRA 2C5XA 2FSOX 2YABA 5EYCA 4WOVA 4U9AA 3BEGA 3FY0A 4GYIA 5LMAA 3HL7A 2CKPA 3EFJA 4NKAA 2WU6A 2GQSA 2IVSA 4I6HA 2F7EE 3TNQB 1E1VA 3S00A 3PA3A 4R7HA 5A6OA 3TWJA 4PNKA 2W99B 1VYWA 3ZZWA 4IWQA 3FLQA 3IK3A 2A27A 2PY3A 4JR3A 4YZMA 4O91A 3R7OA 3DK7A 2F2UA 4Z3VA 4I24A 3JVSA 4BKYA 3BHUA 4FKJA 4BZOA 3V8TA 1W7HA 2PYWA 4V01A 2CNUA 2YZLA 5IQIA 3L1SA 3U4WA 3PG3A 3NVMB 1YHWA 3D4QA 3PP0A 5AR4A 3FSKA 5CSXA 3NNUA 4MCVA 1JAMA 4XV3A 3OD6X 2WB8A 5LVLA 5CU0A 5F94A 4D1SA 3VW6A 4MXAA 4P2KA 5HNGA 1GIIA 3MW1A 5F20A 1VZOA 2OIDA 2QR7A 2R3MA 3FPMA 3K54A 4FIIA 5LCKA 4ANBA 2P3GX 2GS2A 2KTYA 2WZJA 2G01A 4QMNA 1YDSE 1GZKA 4MF0A 4ZIMA 4JJRA 5E7RA 4ENXA 3KRRA 3Q2MA 5HBHA 3KMMA 3FLZA 5CY3A 2BMCA 2WMAA 5HBJA 5CU2A 5ANGA 4XBRA 2XIZA 4AW1A 2ZM3A 4RIYA 5C8KA 1WBTA 2XEYA 3DJ7A 2FSLX 4HGLA 5CU3A 1CDKA 3MB7A 3E8EA 2R3IA 3EHAA 3JY0A 3LMIA 3V51A 4C3RA 4BDCA 5KMIA 2PVNA 3MWUA 5B2KA 5CT7A 4IXPA 1YXSA 4CRLA 3R1SA 4BYIA 3BE9A 1GNGA 4FV2A 4J71A 1U46A 3PPZA 4LOQA 4DEEA 4O7LA 1E1XA 1XKKA 5FWKK 1IR3A 4E3CA 4XG7A 5C27A 1YHSA 2XCKA 2YAKA 3Q52A 3VUDA 4O0YA 4B8LA 2JKMA 5L2QA 1M17A 1TQIA 2E2BA 3KL8A 3I7BA 3ZDUA 4BDKA 2PZIA 3F2RA 3UQFA 5ACKA 5AUUA 2VN9A 1G5SA 4C4FA 3WZJA 4CQGA 1AQ1A 3GEQA 4CZYB 5C26A 1ZMUA 4F7SA 4WG3A 2HZ0A 3RAHA 5LVOA 3U9CA 4IWOA 4AZEA 3BYOA 5HE3A 5CXZA 5BYLA 3PPKA 3O8UA 3QCQA 5KHWA 2Q83A 4OTPA 4TYHB 3NAXA 4EWQA 3D2KA 4D2TA 3IS5A 2X81A 4B99A 2QOCA 4NM3A 5AJQA 4AW5A 4BTKA 2GMXA 5GZAA 4RVMA 1YWRA 3BGZA 4M69B 4PDSA 1JBPE 4IAZA 2GU8A 4IFGA 4W4YA 2ITNA 2XK4A 4EH6A 1KWPA 2PMNX 4B7TA 3LJ1A 3ZO2A 2BZJA 4KBAA 3ERKA 2QG7A 3IOPA 3IONA 5FEQA 5DH3A 3DDQA 1F5QA 2RG5A 4UV0A 3F88A 5AM6A 4TWPA 4Z7HA 3KK9A 4DFNA 3PTGA 2VU3A 4I4EA 2BRBA 2YIWA 3NWWA 4Y5QA 1T45A 3R02A 5CYIA 5GHVA 5HGIA 5BVNA 4E5WA 5ICPA 4WSYA 4DBNA 2YM6A 4Q5HA 5LVPA 3LMGA 2WMBA 2YDJA 3A7FA 2BFXA 4QMYA 5D41A 4CFXA 4XLIA 4B0GA 3ZLYA 3MV5A 5H3QA 4MWIA 3DXPA 3V5LA 3KF4A 2Y0AA 2WEIA 4QYHA 3VUIA 4C58A 3FMDA 2PZ5A 3E3BX 3E63A 3NGAA 5FUTA 3C4CA 3R7GA 3ALOA 4R6VA 4GIIA 3ZM9A 3L8SA 4D5KA 1FVVA 4IC7A 4H1JA 4F6SA 3ORIA 5KBRA 4U7ZA 5EYDA 4X2JA 4FKSA 2OW3A 5EHLA 4EC9A 4FVQA 2VWWA 3MVLA 4A7CA 3K5UA 1AD5A 2OJJA 1M14A 4D0WA 1CM8A 2X1NA 5AIRA 2YJSA 4AW2A 4YNEA 5KUPA 2YIRA 3PZHA 4E5AX 4MK0A 3DBDA 4O2ZA 1PKGA 3BV2A 2CGXA 5AIKA 4E8AA 1M7QA 4LFIA 3AMAA 2B4SB 3E92A 3P0MA 4C8BA 2BILB 3FAAA 3BLRA 4G3GA 3NYOA 4CFVA 4AGCA 3H30A 4GH2A 4P5ZA 2E9VA 3LM5A 3H10A 1PYEA 3UVRA 2B7AA 3VJNA 4DN5A 3DTWA 4CKJA 3HV3A 5EQYA 3UO4A 3UIXA 2OXDA 4DH1A 5M56A 3U6JA 2OZAB 1KSWA 4FKUA 4XV1A 5E8UA 4CT2A 1BUHA 4FICA 3R8PA 4AOIA 5I5ZA 3RP9A 4BCQA 2JKKA 3EL7A 4TNDA 2UZNA 4G3DA 1IRKA 4N0SA 5BPYA 1DS5A 4LM5A 3DAEA 2C5VA 3KXNA 4M13A 4CV9A 4HW7A 1ZYCA 4IJPA 5AX9A 4CMUA 4EK6A 5LARA 2QCSA 3HNGA 4Q9SA 2C3KA 2W0JA 3KY2A 5E1EA 3ZOSA 4AACA 4FTUA 4BDGA 2B53A 3BWJA 1U4DA 4YP8A 5FP6A 2WD1A 4IBMA 4AOJA 5CEPA 3S3IA 2PPQA 2H8HA 3C0HA 5IU2A 3Q4CA 3KULB 4M7IA 4FYNA 4JIAA 1PYXA 5HVJA 5BUEA 5T68A 3S4QA 1XH5A 4FKOA 3LQ3A 2HXLA 4YLKA 1H0VA 3AG9A 4G34A 2C6EA 5AP5A 3UZPA 3PSBA 3W32A 2BRGA 3KQ7A 3ZRKA 4WA9A 5KMOA 4EC8A 3NX8A 3QYZA 4WG4A 3L9LA 3OEZA 3ORZA 2YEXA 3F5XA 4QPMA 4O38A 3KEXA 1H24A 1L3RE 2VO0A 2I40A 5HORA 4FG8A 3II5A 2PZRA 5JFVA 3HA6A 4M12A 2R4BA 3ACJA 4QTBA 4DC2A 3N4VA 4QQJA 4KS7A 5FP5A 2XKFA 4FTNA 3TL8A 2HOGA 2RKUA 4U97A 4ANQA 3P79A 2UVZA 2NO3A 4PWNA 2H96A 2W1DA 4I4FA 3QX2A 3LFSA 3MBLA 5EHOA 1PHKA 1GJOA 2PVJA 3QD4A 4YR8A 3L9NA 5AP1A 5AR5A 4OTQA 5LWMA 3OCSA 4FKGA 2X6DA 2GS7A 4MVFA 4EHZA 5DBXA 5I0BA 4NYEA 4EYMA 4TRLA 4G3CA 2IPXA 2XYNA 4CV8A 2B9JA 3KREA 1P14A 3IGOA 2B54A 3NDMA 4FTCA 4FTKA 4YBKA 4ZS0A 3REPA 4EOMA 4PV0A 5AR8A 4F6UA 5F1ZA 3BYSA 2XRWA 4ANNA 2OJ9A 1WVYA 4C0TA 2R3JA 4M68A 1FPUA 3D7TB 4G9CA 4QNYA 5FBOA 3UO6A 4FA2A 3OF0A 4EUTA 2Y8OA 1PKDA 2B52A 5E92A 3R73A 5M51A 2WNTA 2C6IA 3NIEA 3GI3A 3FMEA 4ITHA 4O82A 4MXCA 4GVJA 4FKLA 4ZZNA 1DI8A 3DB8A 3E64A 3IOKA 1WMKA 4H3BA 4U8ZA 1Q3DA 2PWLA 4BWPA 4AT4A 1CKPA 1HCKA 4IB3A 2UW8A 3QLFA 5FEDA 3BHHA 2VTSA 2WQMA 4M66A 3VBTA 4DGMA 4EORA 5BVFA 3Q9XA 4GRBA 1NXKA 4YZCA 3VRZA 3KRXA 2X7FA 4NFNA 3GU7A 3MIAA 2OO8X 4WBBB 2J0IA 4OT6A 4RWJA 4BDFA 3BRBA 3QRTA 3NPCA 4XYFA 5J1VA 1MRUA 4F7LA 4HGEA 4IAFA 1Q8WA 3IPHA 2WOUA 5AP3A 5A6NA 3DZOA 4W4WA 3CIKA 3UODA 3PUPA 3OXTA 3FY2A 5CX9A 3QQGA 4L46A 3R21A 4A9RA 3OT3A 4U5JA 2GSFA 5CQWA 2PE2A 4BI0A 5KMNA 3M11A 4DE4A 4UMRA 4G17A 5EDRA 4DTAA 2R3NA 1B6CB 2VUWA 4L6QA 5HNIX 3WZDA 4BF2A 2IW6A 2W5AA 2EXEA 4NM0A 5EK7A 3RINA 4DFXE 3FI8A 4L45A 3QQFA 3IDPA 4D2VA 4PDPA 2JKQA 3B8RA 3K5VA 1SVGA 4H58A 4FTRA 5CEIA 4KKEA 4ANMA 3QZHA 5J9ZA 2C6MA 4A4OA 4AGWA 2CKQA 2X39A 2UZLA 4RVTA 4GL9A 3MJ2A 2R3RA 3MPMA 4IZAA 4BL1A 3I1AA 3WOWA 3PYYA 2PVRA 4FR4A 3W2CA 2PZYA 5AR7A 5HE1A 3FYJX 5D10A 5DIAA 3EQFA 4ACHA 4O7TA 3JR1A 1R0PA 3OMVA 4JQ8A 2GTNA 3ZONA 5HVKA 4DLJA 1PXJA 5LVMA 4TYHA 3VF8A 4LGDA 5HIEA 2C6DA 3DFAA 5L6OA 3QFVA 3BIZA 4U0IA 3W2QA 4BDAA 3PJ8A 2FA2A 4I0SA 3V8WA 3NR9A 3T9IA 5J95A 4M69A 3GB2A 4PTGA 1UKHA 4WO5A 2EUFB 3SC1A 4YTIA 4XJ0A 4JQEA 4L01A 4FT9A 3EKKA 3ZO4A 3D2IA 2X2LA 4M8TA 2F4JA 4FOBA 1OBGA 2YM8A 2J9MA 4JDJA 4RGJA 5DPVA 5TR6A 4YO4A 1M2QA 3BKBA 5A4TA 2BIKB 2B9HA 3U51A 2FSMX 4JBVA 3UMXA 5CASA 1YXTA 3VUTA 2GHGA 4DG2E 2ITPA 4CCUA 4EQCA 3QALE 1R3CA 4AGDA 4UX9A 2DWBA 4WKQA 4FKIA 3PXZA 4QPSA 4UN0C 3NYNA 1FBNA 4TY1A 1DAYA 4BDEA 3O71A 3KK8A 5BX0A 5J7BA 5M4FA 5JT2A 3CTQA 4OGRA 4JNWA 4TTHB 4AQCA 3FV8A 3ZSGA 4GJ3A 5BQ0A 3VS0A 3RNYA 2PUIA 4HVSA 4KIKB 1AGWA 3EQDA 3FZ1A 2O65A 5HCXA 1W98A 4OTHA 4X2GA 5IQHA 2JKOA 2V55A 4W4XA 4O7NA 1DAWA 1R39A 2Y6MA 3F3ZA 5IH4A 4ZSAA 2F2CB 3QKKA 4J8NA 5L2SA 2C0OA 4MAOA 4QMTA 2GNLA 1SMHA 5CZIA 4IZ7A 5JN2A 2CCIA 3DNDA 4DEIA 1XH9A 3PG1A 4I6QA 4W8DA 1XH4A 2C0IA 5IDPA 3VWAA 3BZ3A 4D1XA 4C4GA 3QXPA 1P4FA 4UYAA 5DRBA 3UP2A 2BDJA 1KE6A 3P4KA 1YRPA 2W5HA 5ETIA 3VHEA 2XNPA 3SOAA 4W9WA 1H01A 3CBLA 3ZDIA 4E26A 2QVSE 3EKNA 2OZAA 3C50A 1QPCA 1QPDA 4D58A 3HKOA 5M53A 4JDHA 5IQGA 3FHIA 4L7SA 3QYWA 2V22A 2VWUA 3CS9A 4I22A 3RAIA 4WNMA 4PDYA 2YM5A 2W96B 2XK3A 4J98A 2GHMA 3FZTA 3NW6A 4I3ZA 3W18A 4AF3A 4EBVA 1K3AA 3KRLA 4A4XA 4EUUA 4WSQA 5HLNA 4MNEA 2PSQA 2XJ1A 4QYYA 4PY1A 3UBDA 3FEGA 1V0PA 4HOKA 3FUPA 5L6PA 2WQNA 4KAOA 4ZK5A 5M07A 3PDTA 2VV9A 3MS9A 5J9LA 3UMWA 3Q9ZA 5IUIA 3R1NA 4L7FA 3ZFXA 1Q61A 4MXZA 5DR6A 1PXLA 4Y72A 4X2KA 4F0FA 4C57A 3UQGA 1PY5A 3V8SA 5AP7A 4D4VA 1BI7A 4RX9A 1NT2A 3AT2A 4R5SA 4WT6A 2VTMA 3KRWA 2QURA 2CN8A 3HP2A 3EN7A 4RIYB 4EL9A 4QP4A 4UWYA 3Q96A 2R3PA 1GZOA 2YCRA 1JKSA 3EN6A 3GENA 1ZYJA 2C69A 2W4JA 3F3TA 4QMMA 2VTHA 3LW0A 4RC2A 4KD1A 3P1AA 3TT0A 4R3PA 2QU6A 3WF8A 4UY9A 4FK6A 3QUEA 3RPYA 3QQUA 3GC8A 5T6KA 2PK9A 2IVUA 2W4OA 4XRJA 4NW6A 1RDQE 3LPBA 4FZ6A 5J5SA 1Q99A 5FTQA 3UTOA 4D0XA 2P0CA 4DGGA 2JLDA 4M0ZA 4TN6A 4C36A 4ALVA 4EOIA 3FMKA 3HDMA 5AUWA 2O0UA 5BMSA 3A7IA 3GOKA 3V5QA 3DDPA 2UW4A 4LGGA 4WBOA 4IX3A 4W8EA 4FTLA 2XK6A 4G3FA 3MH0A 4BBFA 4NU1A 4QMOA 2GNGA 4AN3A 2WTCA 3UIUA 2Y4IC 4IX5A 3D7TA 4M15A 3UNJA 3U6IA 1JLUE 2FGIA 5EM6A 3CTJA 3VS4A 2WTWA 5CEQA 4B8MA 4FK3A 3QRUA 3ZMMA 3AT3A 2XNBA 4EONA 2EVAA 4FI1A 5LMKC 3SW7A 5C9CA 3C4XA 3PE1A 4H36A 4DFBA 3KCKA 4OBPA 3TZ9A 4ID7A 3BLQA 3LIJA 2PE0A 1OGUA 5JRSA 1W8CA 3NS9A 5HO8A 5H9BA 3WBLA 4DYMA 4ZTMA 2ZAZA 3OEFX 5AV4A 4L52A 3CQEA 4USDA 4QRCA 4TYGA 4Y85A 4CFUA 2C4GA 3VF9A 3MVHA 2CNVA 3ODYX 4O7ZA 4U42A 1SVEA 3LLTA 5B2LA 5B2MA 3CJGA 3H9RA 4CXAA 2YIQA 5ANOA 4JIKA 4CQEA 4RBLA 1YHVA 4EZ7A 3QAME 3IW8A 4EH2A 4TKSA 1Y6BA 1TVOA 3A60A 3BU6A 5CLPA 3RCJA 3JY9A 3V5PA 1QL6A 4FV5A 4ZTSA 5JQ5A 3EQRA 3TEIA 4V04A 3CY2A 4ZEGA 4IM2A 4O0RA 4FL1A 4IDTA 5DRDA 1PMVA 3KMWA 4QMZA 5FXSA 3W8QA 4KWPA 3C0GA 4MQ2A 3MSSA 2OFUA 3KXHA 4E6AA 1X8BA 4F70A 2C5NA 1MQ4A 3AC3A 4FSYA 2B1PA 5AA8A 2BVAA 3LCTA 4UEUA 4YLJA 3WF7A 4F08A 3PZEA 3VS5A 2OLCA 1GOLA 4C34A 2VWZA 5BYYA 4EK5A 3EQGA 3LCKA 3V5WA 5JSMA 3SXRA 3LCDA 3T8OA 3MYGA 2Z7LA 3OW3A 3BBTB 2IVVA 2BDWA 2WOTA 4I5HA 4ITIA 5BVEA 4W9XA 3V04A 3NUPA 3QTZA 5C01A 4ZTRA 1FOTA 1GIHA 5FM2A 3NUXA 3QHWA 3GU6A 1U59A 4C37A 4FUXA 3G9NA 3E88A 4CEGA 2W4KA 5DE2A 3DAJA 4O0TA 1J7UA 4ORKA 3QHRA 1J3HA 1OM1A 3RAKA 1VYZA 3W2OA 2WQEA 3LZBA 3ZZEA 1R1WA 4BRXA 5ITAA 3ORPA 4O1OA 4XUFA 2HAKA 5BNJA 5JRQA 4G9RA 3OVVA 2XIXA 2XM9A 3JVRA 1JWHA 3BYUA 3C4ZA 3M1SA 4DEHA 2WMUA 1G8AA 1T46A 3NW5A 1W84A 4CZTA 5IUHA 1XH7A 4USEA 3HRBA 2QLUA 4EK4A 3ZEPA 2WEVA 3QD0A 4FT3A 5KMJA 1RW8A 1H8FA 4GYGA 2WHBA 2VWBA 2Y4IB 4NKSA 3I79A 3D5VA 5HO7A 2C30A 4Y95A 4ZY6A 4F7NA 2YIXA 5IKWA 3R0TA 5HOAA 5H8EA 3BX5A 4I0TA 2VTTA 5J1WA 5L2WA 3LFDA 4O84A 4P4CA 4TT7A 3PJCA 3EZRA 3LE6A 4J99A 5D1JA 2OJGA 5JGDA 1H28A 2OU7A 4KS8A 1CKJA 4IC8A 3FXWA 3IGGA 4NWMA 4KIKA 2RGPA 4I0RA 4EH5A 2PMIA 1M2PA 5L6WL 3DCVA 4QMWA 4DGLC 4OBOA 2XMYA 2PVFA 5CSPA 1H1PA 4CG8A 2F7XE 5FBNC 2F7ZE 2Q0BA 3OZ6A 3E8DA 3I4BA 3CGOA 3GUBA 2W05A 5E91A 4D1ZA 2VWXA 1OIRA 3KXZA 3LJ2A 2OSCA 1OBDA 4ZLZA 3OWPA 3EN4A 4P90A 2J90A 4FVRA 2HCKA 5DR2A 5FM3A 3ZO3A 3RHKA 5HG5A 1KE9A 2BZIB 2P55A 4A07A 4HVIA 2B9IA 2JD5A 5T3QA 5ANEA 2YAAA 4EHEA 4WG5A 5LVNA 4H3QA 2OXXA 5JZNA 3BQCA 1U5RA 3LQ8A 4GJ2A 4YMJA 5E4HA 2WTIA 2A2AA 2IZRA 3R04A 3KXXA 4C61A 3VBXA 3MI9A 4MNFA 3RPRA 5GIPE 4PTEA 3NUNA 3HP5A 5EI6A 2C6KA 3TIYA 5CI7A 2CGUA 2OICA 2BAJA 2UW9A 5EG3A 4EH3A 4U3YA 4C3PA 3QQKA 1ZAOA 1XBCA 4HYSA 3W55A 4JAJA 4L3JA 4BYJA 4U79A 5EYKA 3GCQA 3OBJA 4KBCA 4O0XA 1OUYA 3CQWA 4BDJA 2O2UA 4RFMA 4YJUA 2XNOA 2GFCA 3ORNA 1XR1A 4O0SA 2W1GA 4QP2A 5IQDA 4YJTA 4FSNA 1WFCA 1OKYA 2ITOA 2Y9QA 3VW8A 3W16A 4E4XA 3KKVA 2XVDA 3OBGA 4E4MA 5JQ8A 5M08A 5DR9A 1KE8A 4FTOA 1BL7A 1JPAA 1WCCA 4ANSA 4YUQA 4JQ7A 4EQMA 2W1IA 5DEWA 5BYZA 4PNIA 4OR5A 2QOOA 4LGHA 2YFXA 4QTAA 4U45A 4U40A 2CKOA 4G5JA 4I6BA 2QOIA 2ZB1A 2QC6A 5HX8A 2XK7A 3R6XA 2XK9A 2X8DA 2XM8A 4MQ1A 4F4PA 4O0VA 4KSPA 4RVLA 4HJOA 3LFFA 4BFMA 5CEKA 4CG9A 2J51A 3V5TA 4FKRA 4NTSA 4DAWA 3GFEA 4EK8A 3KRJA 4PP7A 1XJDA 1U54B 1J7IA 1WAKA 2VAGA 2Z60A 3EFKA 3I6UA 4YC6A 4PPCA 3QWKA 4C4JA 4Y83A 4IAKA 1OKZA 4YO6A 4FEQA 2H34A 1KV2A 5G6VA 3OTVA 3POOA 3SX9A 2HIWA 3PY3A 4X3JA 4CZUA 4OTIA 2UV2A 5J7HA 1A06A 3CP9A 4J7BA 3FI3A 3IKAA 3VRYA 3QL8A 2R3QA 4DGNA 3FLSA 3H3CA 4AS0A 2J0LA 3OROA 5L8JA 2WMSA 5AM7A 3AC2A 3CEKA 2VTRA 3RM6A 3RM7A 5CAVA 3U87A 4JRVA 5BUJA 1LPUA 3HMIA 2YISA 2WELA 4ZP5A 5AUXA 2QOFA 3C4WA 3W2SA 4F64A 2OI4X 3QCYA 4I21A 4ANLA 2G2FA 4EHVA 3KGAA 3C4EA 4AFEA 1J7LA 4BCIA 4EI4A 1LUFA 3HRFA 4LV5A 4BVUA 2VTOA 2VTNA 5KZIA 5ETAA 1H27A 2W9FB 1XBBA 4NJ3A 4UMUA 5JK3A 5E9EA 4FNXA 1YI3A 4RIWA 1OL6A 2FH9A 4H3PA 2GNFA 2XA4A 1J91A 2IN6A 4HZSA 2QI8A 3MY5A 2X2MA 3FL5A 2X2KA 3A99A 5AV2A 3UZTA 3DS6A 5EQEA 3I5NA 1ZARA 2Y4PA 1MP8A 1YQJA 3EZVA 4I5PA 3VUHA 4CRSA 3CKXA 1M2RA 2WO6A 5K5XA 2UZBA 2XYUA 3MDYA 4G6LA 4J8MA 2BHEA 3CPCA 2RL5A 3A8WA 1H1SA 3HV5A 3BBWA 3QUPA 1QPEA 1U5QA 4X6RA 5EW3A 5J87A 5K4IA 3FMMA 2F57A 2WTJA 4QQCA 4FE2A 2IZUA 4O81A 2DYLA 3U55A 4EJ7A 5TKDA 3VS2A 3G15A 2VTLA 3PXYA 3LCSA 3V6RA 1UU8A 2J6MA 4OW8A 3W33A 5FGKA 5B0XA 1WBWA 2EB2A 4AUAA 3EQBA 3LXPA 4PL4A 2XEZA 5DHJA 4D2PA 3OC1A 2IW9A 2LAVA 5LWNA 2YCSA 4IX4A 2C68A 1ZOEA 2JDOA 3UOLA 4RC4A 3JYAA 4DTKA 5L8KA 3Q60A 3PA5A 3R30A 4QMQA 4HGTA 3F6XA 4GVAA 1YOJA 3W2PA 2VTPA 3ZC5A 5CVFA 5C03A 4RT7A 3UE4A 3FZPA 2YLEA 3MN3A 1Q8TA 3PPJA 3WE4A 3BELA 2X8EA 2R3OA 2PUUA 2RG6A 2UZVA 4FGBA 4MYGA 4O6EA 1H07A
chains in the Genus database with same CATH superfamily
4KINA 1YW2A 3FXZA 3DXNA 4BI2A 4Z9LA 1YOLA 2J0MB 3Q5ZA 4J95A 4IH8A 4XG9A 4GT5A 4TPTA 3QD2B 4QYGA 5CAQA 1H1QA 2WMTA 5AADA 3R8ZA 4O7RA 5HIBA 3P78A 3PY1A 1JQHA 5H8BA 2X9FA 4JX7A 2GNIA 2EB3A 3BL9A 3NLBA 3OT8A 4KABA 1ZMVA 4OLIA 4BHZA 3AT4A 4BCKA 4HNFA 5TF9A 1UKIA 3LOKA 2P2HA 4BN1A 5AUTA 3O5AA 3KFAA 4UXQA 5CT0A 4GFMA 4D5HA 3DKOA 4RG0A 5M4CA 2HELA 4UALA 5L2IA 3W10A 3LLAA 3VHKA 1KOAA 4C4EA 2ITYA 4MNEB 4Q2AA 3QTRA 3H0YA 2ZM4A 5DN3A 3T9TA 5JFWA 3FDNA 5LMKA 4FTQA 4IVBA 4UMTA 4CLJA 2VO3A 3R7EA 1G8SA 4NCTC 4XOYA 4DFZE 3Q9WA 4D2WA 3ULZA 4F63A 5C1QB 4F1MA 1Q8ZA 2UUEA 2YM3A 5KHXA 3QCSA 4FVPA 4CMOA 3LFAA 3W0PA 4JBOA 4F1TA 5TOZA 2R7BA 3WYYA 2YDIA 3L8VA 4O83A 4QTEA 3QBNA 1JSVA 1YWVA 3IDCA 4K2RA 4WRSA 4E6QA 5KMKA 4IWPA 5DT0A 3TDWA 4ALWA 4G6OA 4AE9A 3HMPA 3FMLA 4G1WA 3ZBFA 1OKWA 3HA8A 4FSTA 3SW4A 4ZSJA 3PVWA 5IA4A 4LOOA 5HI2A 4YHFA 3SRVB 2UW3A 4D9UA 1JKKA 3TNIA 5CF8A 4A06A 3F2AA 3O2MA 4RVKA 5F95A 2P2IA 2Z8CA 4HGSA 4QD6A 2BAKA 2YA9A 3DZQA 4JT3A 4ASDA 3HV6A 2LGCA 5L4QA 4ZJVA 3W0SA 4BC6A 4APCA 4NH1A 2YWVA 4BJJA 3G51A 3ZSHA 4BTFA 2WMVA 4JDIA 5J8IA 5BVWA 4D2SA 1PMNA 2PTKA 4RQVA 4WRGA 4IVDA 4F09A 5HTCA 3QKLA 3FLWA 4KKGA 4WUAA 2ESMA 2OXYA 3IW4A 3QC9A 2ZV7A 3VULA 4F6WA 4RZVA 3PWYA 4BBEA 2HY81 3OW4A 3GBZA 4N6YA 4QQTA 3A4OX 3MGYA 4IZYA 4QOXA 3QCXA 2Y7JA 5AX3A 5FXQA 3HVCA 1WVXA 4XBUA 2ZDTA 3LVPA 1OECA 4YHTA 4YJVA 5EW9A 4NK9A 5HESA 3QQHA 1UA2A 3TUDA 4O21A 3FZRA 3G9LX 5CSVA 5B7VA 4MH7A 1WBPA 4TXCA 4O27B 4AW0A 2WTKC 5DNRA 5IEVA 2YDKA 2ZV9A 5D9HA 1UU9A 2V7AA 2XCHA 3F66A 4TWNA 2Z7QA 3LXKA 4F99A 5J79A 3NUYA 4X2NA 2X7OA 3COKA 3QRJA 4IWDA 3NFGB 4NL0A 2YM4A 1VEBA 4A9YA 4IB0A 4Y73A 5AAEA 4JVGA 2CGVA 3NIZA 4RJ6A 3R7YA 2B9FA 4OT5A 4CCBA 4LDTA 2UVXA 3DKFA 4ASZA 4NIFB 3ENHA 3QTSA 5E90A 3JS2A 5AFVA 5IMXA 3KXMA 3F3UA 4TWOA 3Q3BA 3I81A 4Q5EA 1U54A 2VGOA 3O7LD 3VIDA 5JFXA 2UZWE 3MY0A 3MJ1A 1YDTE 3JPVA 5DGZA 3UYTA 3HUBA 3DLSA 3E7OA 4BDIA 2EU9A 2V7OA 2AC3A 3BV3A 2I7QA 4TYJA 4AZTA 4E7WA 4LMNA 5I9YA 4O0WA 4R7IA 2ZM1A 1NA7A 3KXGA 3MTFA 4FTMA 5IZFA 2GQRA 1TQPA 3G6HA 1ZYLA 2O63A 3DLZA 3UIMA 3VS3A 4YSJA 3EOCA 5CAUA 3HMNA 4E5BA 4KIQA 3GCUA 3HLLA 3E93A 4JXFA 4YNOA 5K0KA 3SXFA 4BWKA 4I5MA 4IE9A 4M67A 3UVQA 3ZH8A 3EYHA 1OITA 4FSRA 4O6LA 4AXEA 3O23A 1KUTA 4MXYA 2NNWB 4A4LA 5IA3A 5AV0A 4UMQA 3EWHA 4FT7A 2QO7A 4MD8E 2YACA 4R8QA 4DT8A 4IQ6A 3OP5A 3L9PA 3TV7A 4EJNA 3HDNA 5CS6A 3V5JA 3IQ7A 3EL8A 3RALA 2G2IA 2OIQA 2PVHA 4UWBA 4R78A 1W2DA 4LL0A 2WMQA 3OCBA 4YZNA 5A4QA 2XRUA 3K3JA 4RMZA 5K5NA 5KO1A 1OB3A 4OAVB 2V5QA 4LYNA 2WTDA 3W0MA 3RK5A 3TCPA 2C3IB 4PMSA 4ZAUA 3ZUTA 5FQDC 4XOZA 2ITWA 3EFLA 4XP2A 5BV3A 2JAMA 3AC5A 1A9UA 4JG8A 4MF1A 2RFDA 4RIXB 4QMLA 2YCFA 3UP7A 5AP4A 2ZVAA 3GQLA 3O0GA 3SV0A 2WQBA 3AD5A 3EQPA 3UOKA 2W1ZA 3DBQA 5DA3A 3ZLXA 1IAHA 1WZYA 3MVMA 5DLSA 3ZCLA 4BIEA 3GOPA 4LUDA 3U54A 3WIKA 4A9SA 4GU9A 5IG1A 3HGKA 2JFLA 3MH1A 4CLIA 3F3WA 4X6QC 2C3LA 1QCFA 2WTKB 5EOLA 3DQXA 2CN5A 2G2HA 3Q9YA 3RPVA 5A4EA 2IF8A 3R8UA 3C5IA 2GNHA 3PXQA 3JUHA 4XG4A 3DPKA 4AZFA 3VUKA 3L8PA 5JGBA 3A8XA 4JG6A 4K6ZA 4IACA 1STCE 4MBIA 4BCOA 3EQCA 3D94A 4L8MA 3P08A 2ZV8A 4GK4A 4QO9A 3UNZA 5ANDA 3WF9A 3OS3A 4F9YA 3PVGA 4X21A 3GC9A 3TXOA 3QD3A 4QT1A 3ZTXA 4FEUA 3W0NA 5DOSA 1GIJA 1PJKA 5ETCA 5JMSA 5KCVA 1GY3A 4YTCA 2NP8A 2JC6A 4OBQA 2XZSA 3UC4A 5IEYA 2A1AB 4PQNA 2OJIA 4LOPA 5IDNA 3V3VA 3F7WA 3EMGA 4LG4A 4YSMA 5EKOA 4AT5A 4ENYA 4IAYA 3ZRMA 2ZFYA 4D4SA 2HWPA 4AT3A 5I9ZA 4UZHA 5K9IA 2G15A 4S30A 3A61A 3MIYA 2X9EA 3R8LA 5FTOA 5LMBA 3IW6A 4DH8A 4FJVA 2ONLC 3ZC6A 3LMHA 2F49A 3FMHA 4BI1A 3FJQE 5CAOA 1Q3WA 2X6EA 2ZYBA 3CE3A 3Q5IA 4FT5A 4QDEA 2BRNA 2QD9A 3AQVA 3F5PA 3FKLA 1H1RA 2P33A 4YPDA 4M14A 2WMRA 3AOXA 2W1HA 4RRVA 3G33A 3TJDA 4RQKA 1OZ1A 2CLXA 3DA6A 3BU5A 4IIRA 4ACDA 2C0TA 5CF6A 4MXXA 4CFWA 3FPQA 4L00A 3QGYA 4FZDB 4ZS4A 5HVYA 2XIYA 3UIBA 5A46A 1CMKE 1ST4A 4O96A 2BFYA 5A3XA 5EQPA 2HYYA 5AV3A 4EOOA 3C7QA 1VR2A 1J1CA 1SM2A 3LFNA 2Q0NA 3LHJA 1YXXA 5BVOA 2W7XA 3N4UA 5BMMA 3C1XA 4HVHA 4DH7A 4F0GA 2BALA 4X3FA 5IUGA 5DG5A 2OG8A 4CMTA 4WNPA 4K18A 1KV1A 5CF4A 2ZDUA 3FKNA 5CSWA 2CHLA 2OWBA 2YZAA 3BGQA 3M2WA 4E20A 4PDOA 4BICA 4L68A 3BWFA 3PJ3A 2XIRA 4AX8A 4YJPA 4FL3A 3AD4A 4XS2A 3AGMA 3QC4A 2PE1A 4B9DA 1UVRA 1WBNA 3FMNA 3MY1A 4KSQA 3SRVA 4BIBA 5AWMA 4PL3A 3EJ1A 1Q97A 4FUYA 2YIYA 1K9AA 3SKCA 4AA4A 2W1EA 4F9BA 5EYMA 2BRHA 1LEZA 4C38A 4C33A 4OTDA 3FL4A 3TJCA 4FSUA 2X4ZA 4U3ZA 3A2CA 3CJFA 3DU8A 4PMMA 4RC3A 4Z55A 2X7GA 4J1RA 4L3LA 2CCHA 3Q4UA 4F9WA 3COIA 1YI6A 3UDZA 4UWCA 2PVLA 3F61A 3EIDA 4PRJA 5HE2A 5EDPA 3F69A 3ORTA 4EHGA 1YWNA 4EOKA 5I3OA 2E9UA 2C47A 3BE2A 3GP0A 3NYVA 3DQWA 2YCQA 1PW2A 3Q6WA 2ZJWA 3KVXA 3R7UA 3F5UA 3P5KA 4O2PA 1F0QA 4R3RA 5AV1A 3DKCA 5DT4A 3PLAE 1W2CA 4RSSA 5L8LA 3G0EA 4PPAA 1M52A 4YJQA 3SDJA 1UU3A 2WFYA 1TKIA 4J53A 4KB8A 4H39A 4ZY4A 2IZSA 3F7ZA 4ZY5A 3PUFC 4ACMA 4RJ3A 5I3RA 2PVMA 3R1QA 2O5KA 2QKWB 4IADA 3ZFMA 4QP6A 2FSTX 3RK9A 5HTIA 1FMOE 4LRMA 4O7VA 3GCSA 4U43A 4RIWB 3GVUA 2ITQA 3E87A 3BLAA 4IDVA 3I0QA 2R0IA 2W1CA 4XG8A 1ZLTA 4DEDA 1IAJA 3B8QA 2J7TA 3RWQA 4FKTA 3FSFA 4CFNA 4QYEA 4QEBA 5KMLA 1RE8A 1XMLA 3Q32A 2BTRA 3SLSA 4RA4A 2VX0A 5LCJA 2CNQA 2JFMA 4NIFA 2XBAA 4GSBA 3SOCA 4BIDA 3L9MA 2C3JA 3R01A 2DQ7X 2WQOA 3A7JA 4HZRA 4FTIA 3TV4A 3PXRA 3VN9A 2BUJA 2FYSA 3GU4A 5JH6A 3ORXA 3DY7A 3H0ZA 2Y6OA 4ASEA 3P7AA 3H9FA 4FOCA 4JI9A 5BUIA 4NCTA 2RSVA 4NW5A 4FYOA 3D7ZA 4O4EA 5CENA 5EI2A 4FV7A 2ERZE 1ZOGA 3VBWA 2G1TA 3PXKA 4V0GB 1ND4A 4FV0A 1MRYA 1REKA 3HZTA 1TQMA 4QNAA 2DUVA 4C2VA 4KRDA 2VNYA 4DG3E 4EH8A 5I9WA 4RA5A 2PULA 4LV7A 2YERA 4DH3A 4MUQA 2O8YA 3C13A 4ZJIA 3QTXA 4AGUA 4HCUA 2XF0A 1Y6AA 3N9XA 5FD2A 4E93A 4C62A 5AA9A 3HV7A 5GZ8A 4JL9A 4OTWA 4DTBA 3QQLA 4DF3A 4QP9A 3V01A 3TZ8A 4O7SA 5CF5A 3GCVA 5C4KA 4NSTA 1OPJA 5FRIA 4DEGA 5AP6A 4F9CA 3TIZA 3FE3A 5A14A 4D55A 4JR7A 5GIOE 1Y8GA 4HVDA 2GCDA 3DTCA 1NW1A 4EH7A 3D83A 3QZFA 3DOGA 4C02A 3TACA 4RJ8A 1O6LA 2X0PA 4BDDA 4GT3A 4ZLYA 4CGAA 4MD7E 3FKOA 3PWDA 5AP0A 4LRJA 4I92A 1Q8UA 3O96A 4HNIA 3IECA 2XKEA 4A9UA 4RIXA 1KE7A 5IF1A 5AMNA 4AZSA 2RF9A 1GZNA 1OPKA 2OK1A 5K0XA 4ZSLA 2WIHA 3ATTA 3TTJA 4FIGA 5EOBA 1GAGA 2BIYA 3O8PA 3OY1A 5E8ZA 3N4TA 4CKIA 4JG7A 4EH4A 4AG8A 3DAKA 1XH8A 3PXFA 4D9TA 1IASA 4FKQA 3QWJA 4F1OA 1LR4A 5A54A 4I41A 3F9NA 3R83A 4NTTA 3W2RA 4R77A 1A48A 3OTUA 5FLFA 1APME 1F3MC 4WNOA 3ZFYA 3FI4A 3AD6A 3E5AA 4IEBA 3VUMA 3T3UA 5AEPA 1PMEA 2XUUA 3HUCA 3FQHA 5KKRB 3FI2A 2RFSA 3SG9A 4K1BA 2V62A 3THBA 4QMUA 1WBVA 2OH0E 4MBJA 3FC1X 4YTHA 3R00A 3WIGA 1PXNA 4GIHA 4MD9E 4PL5A 2ERKA 3U8WA 3MESA 4DT9A 5E8XA 5CSHA 2PMOX 1OIYA 2BDFA 4KNBA 4JS8A 4RWKA 5HQ0A 2QG5A 4TYEA 4EZ3A 3MH3A 4FV3A 4EOPA 5LQFA 4MX9A 2VX3A 5M4UA 4BKJA 4DHFA 2UW0A 4JOAA 4RWLA 5JFSA 2CSNA 2ITUA 2X8IA 3E8NA 2PVKA 3OFMA 3FQEA 2W9ZB 4U6RA 3RNIA 1XMMA 3MPTA 1NY3A 2RFNA 4HCTA 4XP0A 1OL7A 5HX6A 4KIOA 1XHAA 3OY3A 3E3PA 4K77A 5E8SA 5HD7A 1V0OA 4JBPA 1DI9A 1H08A 2QR8A 2UZOA 3PFQA 3DBEA 4EOJA 3BEAA 4XG2A 5DI1A 3I6WA 4FV1A 2PU8A 4GS6A 3CGFA 1CKIA 1Y91A 2B55A 2PHKA 5CU6A 2ZV2A 2OF4A 3AC1A 1O9UA 3VVHA 4A9TA 4HVGA 3DXQA 2HWOA 3EN5A 1H1WA 3QX4A 4XV2A 4N4SA 3RWPA 5KMMA 5CZHA 4DCAA 2J5FA 3NUUA 3O7LB 4HPTE 3DB6A 1JKTA 4C35A 3NNWA 2IVTA 5AAGA 4BY9E 5A9UA 5I4NA 2XAOA 1BL6A 3VS1A 5AUVA 3UZRA 2HXQA 4ITJA 3ROYA 2R0UA 1ZOHA 4JBQA 1FGIA 2AYPA 2XNGA 3BI6A 2W06A 1UNHA 3EH9A 3C51A 4ALUA 2IO6A 1V1KA 3AXWA 5AAFA 3ETAA 2QO9A 1FVTA 5DT3A 5GJGA 2FUMA 4OAUC 1UNGA 4FV8A 4P7EA 5FTGA 4O7WA 3R71A 3LFCA 4FNZA 2VWIA 2VX1A 3PJ2A 4NUSA 5HO6A 3R9NA 3UDBA 4BGQA 1JNKA 2FVDA 4ZTHA 5M4IA 2XAMA 4X2FA 5BVKA 4EK3A 4QYFA 2QKRA 5CU4A 2REIA 1L8TA 3O17A 4BZDA 2C1AA 1BI8A 3C0IA 2XIKA 3BHYA 4CTCA 4S34A 2PUNA 4H05A 3WARA 5HCYA 4AXFA 1SVHA 4QMPA 2UVYA 4W4VA 5EM5A 3KMUA 3RPOA 3U6HA 4UB7A 5HTBA 2BROA 3FWQA 1BLXA 5EM8A 3CD8A 1PXOA 2A4LA 3I60A 3KCFA 3N51A 4IMYA 4QMSA 4WNKA 4CD0A 1Y57A 3O50A 5IQFA 4YGAA 4LQMA 1NVSA 3VQUA 4XRLA 4S2ZA 2JBPA 3GQIA 4K0YA 1HOWA 4TNBA 4JDKA 2VNWA 1LP4A 2ZOQA 5J9YA 3KC3A 3PE2A 1PF8A 2ZMDA 2JDRA 4DA5A 2BTSA 3QTQA 3RCDA 1O6YA 2VWVA 4FTTA 4C59A 4FMQA 4MEDA 3TV6A 4O1PA 4E1ZA 4XCUA 4L9IA 2JDTA 3C9WA 3DKGA 3BYVA 3NZ0A 1REJA 2XJ0A 2YN8A 3MTLA 5M57A 4XMOA 1YDRE 4FZ7A 4FZFB 2GTMA 2BKKA 4IHPA 3HMMA 4UYNA 2GPHA 5D7AA 2JIUA 2WU7A 4IM3A 4MKCA 3TZ7A 4F0IA 3TKUA 4D4RA 2ACXA 3CQUA 4YTFA 2Z7RA 3Q04A 2O64A 3PSCA 2XS0A 4ERWA 3DGKA 1XBAA 1Z57A 1Q5KA 1WBOA 5CALA 4G31A 1BMKA 4X0MA 3PA4A 3MVJA 4AZWA 4BGGA 4IFCA 4X3FC 4P5QA 3UC3A 2ONLA 3Q4ZA 3NNVA 3B2TA 2UZDA 4QDVA 4YC3A 3ZSIA 4R7BA 4ONAA 2PZPA 5CEOA 3QGWA 4ZTLA 1UV5A 3QZGA 4GKHA 4I6FA 2HZNA 4DITA 5EFQA 3NUAA 1H00A 1KOBA 1P4OA 2R3GA 3CLYA 3RTPA 3QKMA 3ZYAA 3QXOA 1FQ1B 2EXMA 1OIUA 2I6LA 2J0JA 1W0XC 5EM7A 5HKMA 1P5EA 3GGFA 4CFMA 4PX6A 2R7IA 3GC0A 3DNEA 2UW7A 3ET7A 2R3LA 3QUDA 3TN8A 4I94A 3ZBXA 4C4IA 1H26A 3FC2A 3PIZA 4FKPA 4JX3A 5CI6A 2JIIA 4L67A 4V0GA 4EWHA 1UWHA 3QF9A 3F82A 4MWHA 1DM2A 3T3VA 4YJSA 5EKNA 1ZZ2A 2E9NA 4S33A 3A4PA 3FMJA 5JKGA 5E8TA 5EH0A 1YKRA 2VTIA 4HYIA 4D28A 1URCA 4GFOA 5HLWA 1LEWA 4GU6A 4FTAA 4ZMFA 3FLYA 4FTJA 5AUZA 4AWIA 4HYHA 1SNUA 4M0YA 4ZOGA 2H6DA 3EN9A 3KA0A 3RAWA 3V6SA 2VGPA 4FIFA 5BVDA 4BHNA 3R63A 1Q4LA 1PXIA 3QTUA 3GU5A 5DMZA 2IJMA 2CLQA 3KU2A 4CYJA 1RQQA 3UNKA 2OJFE 3ITZA 3FQSA 4XNEA 4YBJA 3UJGA 5KE0A 4EH9A 2XNEA 2J0KA 3OHTA 5AUYA 5IH6A 3UG1A 3VJOA 5CWZA 4TYIA 3HV4A 4U41A 4CYIA 5AP2A 4NEUA 3R22A 3ZM4A 1ZMWA 4ACCA 1IA8A 3ZXTA 4FX3A 3Q2JA 2R3FA 4YZBA 2C5YA 1BKXA 4XG3A 5G1XA 4AZVA 3UOJA 2HW6A 3ZUUA 3G90X 2BAQA 3NNXA 4YHJA 1BYGA 2HZIA 4O4DA 5CAPA 4I1ZA 4BCNA 3CSVA 3SG8A 3SA0A 2XB7A 2ETMA 2OFVA 3L8XA 3MA6A 4ACGA 3D5XA 3NAYA 3QZIA 2VTAA 1FINA 3EB0A 3E8CA 4OUCA 4O4BB 3MPAA 5A4LA 4I93A 4JRNA 1OUKA 3DJ6A 3IDBA 3G2FA 4KRCA 1MUOA 1S9JA 2BHHA 2GHLA 4GFGA 4X3FB 3R9HA 3F2NA 2G9XA 2BKZA 4M97A 2RFEA 3O8TA 3TG1A 2C6TA 3NRMA 5JGAA 4QTCA 2VTJA 3EYGA 4YU2A 4ZLOA 1RJBA 1ZYDA 2W1FA 3I5ZA 3R9OA 4BCJA 5J5TA 1XQZA 4TZRA 4XH6A 4RFZA 1ZYSA 4GEOA 3ZXZA 5HNBA 4LI5A 3C4FA 4RX8A 3UGCA 3VO3A 4E6CA 2CJMA 5GINE 2YLFA 4RIOA 1R0EA 4ZZOA 4L3PA 2IZTA 2VD5A 4FF8A 4BCMA 3KVWA 3R2YA 4Z7GA 4G16A 2W5BA 3MA3A 1I44A 3QTIA 1JKLA 4PTCA 4YPSA 5D7VA 3BHTA 1XWSA 2FO0A 3ANQA 1YOMA 3ODZX 3ULIA 3KN6A 2JAVA 4GT4A 4U80A 3WZUA 4BBMA 1FMKA 4H1MA 3HRCA 4EBWA 5HD4A 5CVGA 4AP7A 1W82A 3ACKA 5DYJA 2BPMA 3U4UA 3DJ5A 2C6OA 2NRYA 2Z2WA 3LJ0A 2QLQA 3BCEA 4NM5A 4BR3A 4FSMA 2IEWA 2QOBA 3G6GA 4RJ7A 4L44A 4CSVA 3GFWA 2ZMCA 3HYHA 3AMBA 5DEYA 3PJ1A 5HICA 4DEBA 4I5CA 4JAIA 4F9AA 5F4NA 4BCGA 3R2BA 1S9IA 4IAIA 1E9HA 4K33A 4PPBA 4ANOA 4E73A 4ARKA 2AQXA 3R9RA 3CPBA 4IZ5A 5KNJA 3MFUA 3A62A 2XP2A 3QLGA 4RJ4A 4Q9ZA 3OUNB 3SXSA 5H2UA 1Y8YA 3M42A 3PVBA 5GNKA 3MH2A 3LAUA 2P4IA 3PIXA 4FV9A 1H25A 2C5OA 4DBXA 2XH5A 3G5DA 2R5TA 4R1VA 3RPSA 4GUEA 4UXLA 4AE6A 1Q8YA 4ZSEA 1O6KA 1VJYA 4EYJA 4II5A 4F7JA 4FBXA 4TWCA 3K2LA 3ZLSA 2VRXA 1G8JA 3ENMA 4E4LA 1IG1A 5GJFA 5FDPA 4UBAA 5TO8A 3UDTA 5M06A 4ERKA 5KBQA 1OMWA 2I0HA 4AFJA 2C6LA 1OKVA 4GW8A 4FL2A 5LXMA 1YVJA 3MFTA 5AR2A 2RIOA 4AN2A 2GDOA 5IQBA 3ALNA 2QNJA 5HBEA 3ZS5A 3R7VA 2HZ4A 3COMA 2YM7A 5ANIA 3ZO1A 2PVYA 3OG7A 5M44A 1ATPE 4AU8A 2I1MA 3KN5A 4I23A 2XARA 4WUNA 3ZUVA 4S31A 4HYUA 2I0VA 2YHVA 2BCJA 4YC8A 3S95A 2X0GA 2JGZA 3TKIA 3ZEWA 3ZU7A 4ASXA 4FEVA 3BU3A 2UW5A 4IAAA 3UVPA 4XLVA 3FXXA 5DFPA 4DCEA 4RLKA 3IO7A 4O7YA 3WI6A 2OZOA 3WF6A 4CKRA 4KIPA 3ZRLA 3R28A 4DLIA 3LCOA 2JDSA 1BX6A 4XP3A 1MRVA 2ITZA 3QU0A 1PXKA 4K9YA 4PP9A 1OPLA 3QRKA 4FT0A 3RZBA 5CXHA 2VTQA 1Z9XA 1H4LA 5DWRA 4L53A 3HEGA 4C7TA 2UZEA 5HE0A 1OVEA 2EWAA 2WXVA 2BR1A 3UG2A 3D0EA 1UU7A 3W1FA 3NSZA 4RZWA 1FVRA 4DFYA 5DVRA 4BCPA 2J2IB 3TUBA 2V0DA 5HG7A 4FSQA 2EXCX 2OKRA 5FEEA 4IJ9A 2OF2A 2VWYA 2HY0A 4U44A 2JITA 3W8LA 4QPAA 3LM0A 4X7QA 5ETFA 4YJOA 3TNHA 4J97A 4QP1A 2PMLX 3R9DA 3ATSA 5CANA 3WZKA 2ETRA 3GNIB 4G5PA 4O22A 2JDVA 4XHKB 5IH5A 2XKCA 1QMZA 3NMUF 1UWJA 4AN9A 5CQUA 2WAJA 3E62A 4Y46A 5EI8A 4R1YA 4YJRA 4GG7A 5L3AA 1R78A 4E4NA 3NEWA 3VBVA 2QODA 1WBSA 3FBVA 3OXZA 2NPQA 3RBWA 1UNLA 1PXPA 3GC7A 1ERKA 3LFBA 1W2FA 4K8AA 4BDBA 4BGHA 4CT1A 4EQUA 1ZRZA 2DS1A 3OWKA 3DFCB 4IW0A 3VC4A 3IW5A 2OIBA 2ITTA 2QU5A 3CXWA 4J96A 4AXDA 2CPKE 5D11A 4BKZA 2UZUE 3OXIA 4QTDA 4G6NA 3ROCA 2YITA 3OOGA 2UZTA 1YXVA 1GZ8A 3DT1A 3TZMA 3VBQA 2AUHA 1NVQA 5C4LA 3RJCA 2GFSA 3U9NA 5CVHA 4FKWA 3VBYA 3OWJA 3RHXA 3OCTA 5EW8A 5H8GA 2XKDA 3OOMA 5CTPA 1Q62A 4Y8DA 3R8VA 3BPRA 4ZXTA 1OI9A 1B39A 3TKHA 3CD3A 5CNNA 5M55A 2C1BA 4BTMA 1MQBA 4N70A 5E1SA 5HHWA 3FLNC 2WMXA 5HZNA 4N57A 2BZKB 3TDVA 3MFRA 4QMXA 5IA5A 3ORKA 1P2AA 4QP3A 3CTHA 4Z16A 1XH6A 2OH4A 3HECA 3LQ5A 1URWA 4BTJA 3D9VA 3PSDA 3C5UA 4J52A 4RFYA 5GZ9A 3RVGA 4DEAA 2YWPA 4IVAA 2SRCA 3TI1A 4GK2A 3ZHPC 2PUPA 4KKHA 5K3YA 2QOHA 5L2TA 2JIVA 4LRKA 1OGYA 3VONA 5IQEA 4Y5HA 3CR0A 1HCLA 3DBFA 2IWIA 5IA2A 4LL5A 4K11A 4YURA 5IPJA 4KBKA 4QMVA 3OWLA 5K4JA 2OBJA 4WIHA 5IMEA 2XJ2A 4N6ZA 2GNJA 2QOKA 3H4JA 5M09A 4GK3A 4GKIA 3LXLA 4M84A 5ACBC 4IVCA 2CMWA 4FGRA 3QRIA 5FG8A 1G8KA 4BDHA 3PP1A 1J1BA 2AC5A 5IA0A 4UMPA 4IANA 3UOHA 3SGCA 4B6LA 4F65A 3S1HA 2R64A 5IISA 2ITXA 2WIPA 3RK7A 4G2FA 3Q53A 3SQQA 3I0OA 2NRUA 2GS6A 2CGWA 3VS6A 2VZ6A 3KULA 4EOSA 1KE5A 2VO6A 3R1YA 5TT7A 4RPVA 3O51A 3JXWA 4L42A 3WZEA 2ITVA 3PRFA 4GUBA 3Q4TA 3MB6A 4HCVA 3NUSA 2X4FA 4L43A 5KX8A 3RGFA 4FKVA 3QTWA 1TFFA 1CSNA 3EQIA 4BCHA 3D15A 4APPA 3GT8A 2ETKA 4EOQA 5E8YA 4OTGA 4FNWA 3HX4A 3VS7A 3D5WA 3LXNA 3ELJA 1OL2A 4GMYA 4BB4A 3AMYA 3NW7A 2CKEA 2J4ZA 2A19B 3D14A 5KZ0A 2CDZA 4ZTNA 5I9UA 1IA9A 2BZHB 1W83A 4KA3A 4KUJA 4JLCA 4PUZA 4R5YA 4USFA 3S0OA 4AA5A 2A0CX 3NCGA 4CTBA 4LUEA 1JSUA 1V0BA 2PL0A 1PXMA 4MXOA 3UYSA 3DK6A 3UPXA 4RJ5A 1YXUA 4BCFA 4B4LA 3P7BA 2E9OA 4I20A 5I9VA 4AA0A 4CFFA 4NZWB 4FIJA 3TUCA 3P86A 3AGLA 3OCGA 3LFEA 1SYKA 1JOWB 1I09A 3ANRA 4FODA 5AR3A 5KKRC 4RLLA 1QPJA 4O86A 2QQ7A 3CC6A 4ZJJA 3IW7A 1ZXEA 5E8WA 4XV9A 4FV6A 2BRMA 4PF4A