2YIYA

Crystal structure of compound 8 bound to tak1-tab
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
306
structure length
293
Chain Sequence
SLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase activator
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 7, TGF-BETA-A
publication title The Discovery and Synthesis of Selective Dfg-Out Tak-1 Inhibitors
rcsb
source organism Homo sapiens
total genus 93
structure length 293
sequence length 306
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yiyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yiyA01
2ITTA 3V5LA 3R73A 1ZRZA 3IG7A 4H1MA 4L8MA 5FP6A 3UPZA 4O6EA 3R7OA 3LFSA 3W2SA 1SYKA 3ZO4A 4JRVA 1ERKA 5C4KA 4JJRA 2ITOA 4XG9A 5D41A 3NNUA 2ZV9A 4CCBA 4LI5A 3G33A 4BTKA 4E6AA 3ORPA 3ORTA 4DH5A 4CRSA 4J97A 4WO5A 4RX5A 4IB5A 2PY3A 4QMWA 1ZY5A 1H1QA 2BVAA 2RG5A 3C0GA 3GCSA 4DTKA 3IOKA 3U8WA 2BDJA 5D10A 5DVRA 1KE7A 5BVOA 2OG8A 2ETMA 3PJ3A 1HOWA 4R3PA 2W99B 3CD3A 4UZHA 5TKDA 3SOAA 2NP8A 4JRNA 3TZ7A 3NNWA 4BDKA 4DEAA 4Q2AA 1YHSA 3D9VA 4I0TA 3E92A 5EHYA 4UMPA 3H9OA 3CGOA 4L00A 3GU4A 1CTPE 3CJGA 2VO0A 3DBEA 4UYNA 3PIYA 5CSXA 4F9WA 5LVPA 2GMXA 1RW8A 3LM0A 1PW2A 3PUPA 4I6FA 4YJVA 3FBVA 4UMRA 3OVVA 2ONLA 5IQAA 2GTNA 2NO3A 2JITA 5ETCA 1FMKA 2P33A 3VO3A 2WOUA 2V22A 4I94A 1RDQE 4EJNA 5L8KA 1URCA 4CMOA 4MBLA 3KU2A 5HBHA 5FDPA 5F4NA 3V8SA 2OU7A 5IA0A 5IISA 3AQVA 2PVJA 2R3HA 4PNKA 3ACKA 2ITUA 3AC4A 3VBQA 4MWIA 4CYIA 4J96A 1B39A 2WMXA 4HZRA 4ZTNA 3UZTA 5A4LA 4DLJA 3DNEA 1W83A 2C5XA 3GB2A 4MBIA 5KZIA 3VNTA 3AMBA 5E8TA 5ACKA 3FI8A 2YM8A 4ANLA 2JGZA 4J1RA 4IM2A 3MVHA 4JBQA 1KE8A 3QTSA 3R04A 4CQEA 2PSQA 5CQUA 5CASA 4LOPA 2RSVA 4EEVA 5JRQA 3QKKA 2WTKC 4D9TA 2YIYA 4FGRA 4ZTSA 5A46A 3OC1A 5FGKA 2HY81 3HDNA 2VAGA 4GK3A 2LAVA 4MEDA 2JKKA 5AR4A 3ULZA 4M13A 2PMOX 3IKAA 4IC8A 3Q52A 4V0GA 1ZMVA 4Y8DA 1MRYA 2QR7A 2XNNA 3D7TB 4CZYB 4ITJA 4EZ3A 2WMAA 3EKKA 3EB0A 4J52A 1NVRA 1GOLA 1K2PA 3KULB 3V51A 4C2VA 4U8ZA 3UO4A 4HW7A 1YKRA 3OROA 4YC6A 5I3OA 3CPBA 3B8RA 5HO8A 3RK9A 3KKVA 4JXFA 3EKNA 1OKYA 1UKHA 3KN5A 3VHEA 3E8DA 2RIOA 2X4ZA 5LMKA 3TNIA 3QQJA 3FMHA 2GNIA 2CMWA 2PVRA 3KMWA 4XP3A 3V5PA 1F5QA 3T9TA 4EH2A 2W1IA 4DEBA 3GUBA 4DGNA 2RFNA 3PXQA 4HNFA 5BUJA 2WTDA 4M7IA 1YVJA 2ZV7A 3N51A 4I6BA 3VS2A 3DQWA 4E93A 2A4LA 1R78A 4YNOA 4L3JA 4ALUA 3H0ZA 2IZUA 3LOKA 1ZOHA 1Y57A 5DEWA 3GVUA 2YM7A 2J0LA 3EZVA 4EORA 3OCSA 2W4KA 1WBPA 3AOXA 4EHEA 2PK9A 3PSCA 1PRYA 4XOZA 4EOMA 3R01A 4AGWA 2CKPA 3LFEA 4CG9A 2WQMA 4J99A 4BN1A 5LOHA 3MH0A 1BMKA 3UP2A 5LVNA 4M0ZA 1FMOE 3R71A 3KCKA 4W4XA 3RCDA 3U6IA 5ETFA 4NTSA 4TY1A 3NUYA 3U55A 2XA4A 4I20A 1SNXA 3K5UA 2RF9A 4I22A 3BV3A 3HAMA 2B1PA 3WZUA 3GU5A 1KUTA 3MPMA 3WZEA 2VTAA 4DEIA 4D0WA 4UWBA 3CS9A 4FVQA 2C4GA 3MPTA 4Y72A 5L2QA 4O0TA 3NUNA 5B7VA 3VQUA 4EI4A 4YR8A 3ORIA 1PYEA 4GIIA 4RIXA 4ZLYA 3DXNA 3RHXA 5AM6A 1IRKA 4FVPA 4BDFA 4FNWA 1UVRA 4X2JA 4OTPA 2BRBA 2JBPA 4NKSA 1QPDA 2JEDA 4RC4A 5ANGA 5HZNA 1H24A 4A4XA 2WELA 3ZDUA 5GNKA 4EBVA 1SM2A 3VRYA 3FZPA 5IEYA 4FI1A 4II5A 3ANRA 5EOLA 3NYXA 4IAKA 5I9UA 1BYGA 1UNHA 5KMKA 2C68A 3P86A 4AACA 4IJPA 5M07A 2VTIA 4KA3A 3L9NA 2HW6A 4O38A 4ZK5A 3TZMA 5KE0A 4PY1A 3AC3A 4ZXTA 3R1SA 2QO2A 3TT0A 1H26A 4QP4A 1EH4A 2OJJA 2A27A 4UZDA 4YJTA 3ZO3A 3KK9A 3ZUTA 3QZFA 4BDDA 4OAUC 4ERKA 2WTKB 4O7VA 1U54A 4KWPA 3B8QA 4FF8A 4QTAA 3SHEA 2W5HA 4C37A 4EH9A 2XNMA 4P4CA 2X4FA 4PF4A 5GINE 4I1ZA 3IDCA 2GNFA 1GIHA 2C5OA 4ZLZA 4I5HA 3T9IA 3F5UA 4DAWA 3FY2A 3ZUUA 5IA1A 5FP5A 4F08A 4EK6A 4LV5A 2UVYA 4RFZA 3RPYA 3VQHA 3M1SA 4UXQA 3FPQA 3R8VA 3SRVB 4I3ZA 2QO9A 4FIHA 3DBDA 5J9YA 3FHIA 5BUEA 4GT5A 5GJFA 4FSUA 3EFJA 4AAAA 1UA2A 2WMUA 4D2RA 4YURA 2WTJA 4RFMA 3W32A 4AW0A 4HVHA 4QMQA 5IA4A 3POZA 1NT2A 2BFYA 1SNUA 3AD5A 2R3MA 3E8NA 2PUUA 3D5VA 3MJ1A 3OXZA 2XIKA 4E4LA 5CT7A 3LCSA 3THBA 4W9WA 3AC2A 2VTQA 4C4GA 3BLQA 3PRFA 1I44A 3ZDIA 5I9ZA 3DBFA 4R7IA 2WGJA 4HYIA 3T8OA 1P4FA 3F69A 2W96B 3EFWA 4HPTE 4AP7A 2CN5A 4CNHA 3KVWA 2EXMA 2HAKA 2NRUA 3FZTA 4XNEA 1PXNA 5FXQA 5J5SA 3QC9A 3HAVA 3BGZA 4OT5A 4S33A 1H4LA 3IOPA 3LQ8A 1DAWA 2OZAA 1CDKA 2XH5A 3LFFA 4LM5A 4LOQA 5BVFA 5IF1A 4WT6A 3DK6A 1HCKA 2W0JA 1J1BA 3PTGA 2UV2A 5KBRA 5AJQA 1CMKE 4USEA 4YC8A 4GU9A 1OL7A 1OBGA 3R6XA 5CT0A 1OITA 2XK9A 4BB4A 3BRBA 5CNNA 2CDZA 5CSHA 1BX6A 3QLGA 1H25A 2YABA 5IQDA 4DITA 5C9CA 1OPKA 5A4CA 3BU3A 2W1ZA 5IDPA 1OM1A 5EDRA 3A7HA 4YJSA 5B0XA 2ITNA 3P08A 4H05A 3NUPA 2BKKA 4OTFA 4L45A 5DR6A 3LPBA 4O6LA 3KGAA 3S95A 2XVDA 4M8TA 3QLFA 3QRJA 3BBWA 2F4JA 3R1YA 5J79A 3F2AA 4APCA 3AXWA 5D11A 1QMZA 4O96A 4UX9A 2UZUE 4TWPA 3TKHA 5CVFA 1UKIA 3TKUA 2UW5A 4FBXA 4BDGA 4IB3A 4U7ZA 4FC0A 4IMYA 4BGQA 4D4SA 4FVRA 3OWPA 5LARA 2BRHA 2W1CA 4BCFA 3CLYA 4FTUA 4M15A 2WTVA 3ALOA 3FE3A 1YQJA 3TNPC 2XBJA 1CKPA 4F63A 2QOIA 2QOHA 3MVJA 4QP8A 5CSWA 4C59A 3QCSA 4D55A 3ZSGA 4ENXA 4FKPA 2WOTA 4MQ1A 3I1AA 1P5EA 1Z9XA 1XWSA 4BHZA 4DGMA 4U80A 4WD5A 5LMBA 3POOA 4JBVA 5EYKA 3VBTA 3V5QA 4YTFA 3VC4A 2E9PA 1VZOA 4MTAA 3F3UA 4JX3A 4RGJA 2Q0NA 3HP2A 3GQLA 3EQHA 1O6LA 4IAIA 1WZYA 4A9SA 1OGUA 2YAKA 2PMIA 1LP4A 4C61A 3ID6C 1VEBA 1Y8GA 2E9VA 4FTIA 4FUYA 4YZ9A 3R9DA 2R3LA 1IASA 4B0GA 4DG3E 4OBQA 5BMSA 4L44A 4U81A 4DE4A 2HZNA 2F9GA 1PXKA 2IZTA 4FT5A 3D7TA 3KXXA 4BDBA 1UU9A 4UALA 5L4QA 3DLZA 2R0UA 3FQHA 4F4PA 4QMTA 2JDSA 3C51A 1H1RA 5HKMA 3MYGA 3SC1A 2HWOA 1ZOGA 3KULA 4GG5A 4M14A 5A54A 4MXZA 4BDEA 4RZVA 4FSRA 5FLFA 3C5IA 2EXEA 3UO5A 1XBBA 2CCHA 3ZEWA 1ZYCA 2VTMA 1JSTA 5EM8A 3I81A 3MH3A 2V7OA 4GFOA 2BZKB 2YAAA 3FSKA 4N70A 3MS9A 3DKCA 3PIZA 4RWKA 3CE3A 4ZJJA 3BYMA 4PDOA 1NY3A 2WQOA 5J9ZA 1Y6AA 2R3PA 2XEYA 4AGUA 4Y46A 3FL5A 4RJ7A 4IM0A 4HCVA 4FV8A 3TTJA 3QF9A 3KCFA 2BDWA 3FMMA 4BCQA 4QYGA 4BCHA 2Z2WA 1FINA 1BL6A 3G5DA 3LXKA 3M42A 3UG2A 3QQUA 5DPVA 3UO6A 3E63A 4LRJA 2W4OA 4W8DA 1XJDA 3SG8A 3QD2B 3HEGA 4RX7A 4XP0A 3JY9A 5CWZA 1ATPE 2C3KA 3IQ7A 3R63A 4D58A 2XP2A 2J0MB 3LCKA 1BL7A 4I0RA 4KAOA 2YCRA 3CY3A 4D4VA 2YCQA 5HVJA 5ANJA 2DQ7X 5EW8A 5IH6A 4DFNA 4I21A 3UVPA 2ZV2A 5LCJA 2CCIA 4TNBA 3TV7A 4BCGA 4AT3A 5IA5A 4AUAA 2BAQA 5EK7A 5JGBA 4RIYB 4FZDB 4GL9A 3EQDA 3QALE 1YXVA 4PP7A 3NS9A 5IUGA 3GFEA 3GEQA 4ZS0A 4HVIA 2QNJA 4Y73A 3FKOA 4L9IA 3ZRKA 1Y6BA 4DFYA 2VZ6A 3H30A 4R7HA 5FTGA 4TWOA 4AGDA 1MQ4A 3R83A 1SMHA 4DN5A 4HGLA 4EKLA 3MFTA 4EH6A 4IFGA 2G2IA 2CSNA 4XHKB 3K3JA 5BVWA 3ZC5A 3WZJA 1OIQA 4BHNA 4BDHA 2X81A 4L46A 4QTBA 3FV8A 3KRXA 4RWJA 5E8XA 4MF0A 3Q04A 4MK0A 4DFXE 5KHWA 1H27A 3HV7A 4JNWA 4D2PA 1XBCA 3KXZA 4GVAA 4XP2A 3Q3BA 3QTUA 1H08A 4DT9A 4MX9A 3W2PA 4L53A 1ND4A 4BR3A 4G16A 2HZIA 5FUTA 1AGWA 4FZ7A 2OZOA 5HNBA 3UODA 5KO1A 2IW9A 4AE6A 4MXCA 3OCTA 3Q2JA 4E6CA 3VJOA 4F7SA 4WG5A 3VF9A 5B2MA 1ZYDA 3P23A 1YW2A 5FXSA 1YXUA 2X8IA 3WF6A 4QQCA 2C6KA 4DEEA 4EYJA 4EZ7A 5AADA 1XQZA 4ANMA 1KOAA 4AOTA 4JDJA 4DFLA 5HQ0A 4B99A 4U42A 4WOVA 4XV2A 4EZ5A 4NZWB 4RLLA 2Z60A 3RPOA 4F6SA 5KMNA 3JS2A 5D7VA 4FNYA 3CKXA 3V5JA 2W05A 3ENHA 2FYSA 3SXSA 4NUSA 1Q8ZA 4EL9A 4AU8A 3MB7A 5IDNA 3PPKA 2H6DA 2X8EA 5CY3A 1PHKA 2WMQA 2PL0A 5CU3A 2UW9A 3QTQA 4K33A 3CR0A 2FUMA 3MFSA 3KRLA 3SRVA 3R1NA 5LXMA 1CM8A 4BBFA 2W9ZB 3QA0A 4G3DA 2GHMA 3RKBA 4E4MA 4KUJA 3FLWA 1JPAA 4BBEA 3KXMA 3CXWA 4QPSA 2OXYA 1OIUA 1TQIA 3A60A 1GNGA 5CX9A 2CNQA 2ZJWA 4MXAA 3LXNA 1Q8UA 3LCTA 4Y95A 2FSMX 4FK3A 2PZRA 4BDJA 2J2IB 2UW3A 4YO4A 3TDWA 4QQ5A 2BDFA 3VN9A 3MJ2A 3TM0A 3RAKA 3RK7A 1FOTA 3DS6A 2ITVA 1WFCA 3BQCA 3D14A 3OF0A 1LR4A 3BEAA 3OWKA 4QMVA 2BZJA 3I0QA 4LFIA 5GZ9A 3ZBXA 3AMYA 2WAJA 4OW8A 1TQPA 5HNIX 3EFKA 3CQWA 2CGUA 1JNKA 4PPCA 3QRKA 5CI7A 3V5WA 2CKOA 4PMMA 5AIKA 4G6LA 5DI1A 4C35A 5HX6A 5M4FA 3PVUA 3KB7A 3PZHA 4FKSA 2R3KA 5A4TA 3V3VA 5JMSA 2H34A 3SD0A 1XR1A 2Y4IC 3NPCA 4MBJA 3DKFA 4F7JA 2YM5A 3R7EA 3GCPA 5AA9A 4CD0A 4E8AA 3TKIA 5JEBA 4EOLA 2QLQA 5FG8A 5HD4A 2UZEA 4NTTA 2BTSA 4U43A 4YSJA 2UW7A 4NM5A 3L8VA 3BU5A 4LYNA 3IPHA 3KMMA 1K9AA 4FG8A 4JQ8A 3RALA 3NNXA 3LFCA 3VBVA 3A7IA 2WMRA 2GSFA 5HGIA 3FYJX 2HY0A 4E5BA 3UQFA 3UBDA 2IZSA 2P3GX 2CPKE 2JBOA 3MA6A 3QCYA 4D2TA 4I92A 3CTHA 5DNRA 5EDPA 5KNJA 1SZMA 2JAVA 4G1WA 3SV0A 2OJIA 3ORXA 4D2VA 4EH5A 3PVBA 2HZ4A 2C6DA 2O2UA 5IKWA 3ZRMA 3VS0A 3TI1A 3EQCA 4Q9SA 3ROYA 5M4CA 2YIXA 3FLSA 3P5KA 4OTIA 3ALNA 1B6CB 3E88A 1JSUA 2LGCA 3EH9A 3DAKA 3L8XA 4BI2A 3U87A 3EQPA 4C4FA 3O17A 4QYHA 2R3FA 3MVLA 4OT6A 1KOBA 5HE0A 5AUUA 4C34A 4FKOA 4KBCA 2AC3A 2V55A 2C0IA 2OIBA 4W4YA 2EVAA 2WTWA 4YZBA 2IO6A 4AQCA 5I0BA 5JH6A 3DXQA 4JT3A 4WIHA 4TZRA 5L2IA 1Q97A 2G9XA 5ANIA 5AR8A 3O71A 4EOIA 2WTCA 2VUWA 3SLSA 4O27B 4ZLOA 3QX4A 4K11A 1KSWA 4L52A 5CEQA 3LXLA 2X7FA 4RRVA 3RGFA 2VV9A 1UNGA 3VWAA 3TUBA 2HWPA 4UWYA 2RGPA 4F9AA 2BIKB 3TIZA 3ZLXA 4R7BA 1MUOA 3DB6A 2C6MA 2YCSA 3BYOA 1OB3A 2O64A 3FC2A 4RBLA 3WILA 4ZTRA 5DN3A 3W16A 2GU8A 4O0YA 3RCJA 4B4LA 2I40A 2W17A 2VTSA 4JX7A 3TZ8A 4FV4A 4RC2A 4FSWA 4IAZA 2BAJA 1H1PA 4IHPA 3CD8A 4C3FA 3BE2A 4GV1A 4E5AX 1MQBA 4UN0C 2GNGA 1J91A 4PUZA 4DF3A 4C33A 5AUVA 3HV5A 3KXHA 2PVMA 1WVXA 3PVGA 4B6LA 4YBKA 5FBNC 4AGCA 4YZNA 3TCPA 2GFSA 5LJJA 2QURA 3FMEA 5CAPA 4L7FA 1FPUA 3EMGA 2VTTA 2G01A 3CTQA 2PE1A 2REIA 2B9JA 4ANQA 4EONA 2XEZA 3KN6A 3ZTXA 4EOOA 4AA5A 4DG2E 3JVRA 3FLQA 1H00A 3H3CA 4MF1A 3NYNA 4U97A 1CKJA 1KWPA 3KEXA 2A1AB 4EQUA 1UWJA 2B53A 4QP6A 1ZZLA 3RK5A 5AV4A 3SAYA 4FEWA 4NH1A 4PTCA 1FBNA 4TT7A 3UTOA 3V6RA 3E87A 1OKZA 4U79A 2QONA 4V05A 3ZXTA 4R1YA 3OCGA 2XRUA 2Y4IB 4M0YA 4RMZA 2VWXA 4ZSEA 5AUTA 4GW8A 4NM0A 2Q0BA 1H8FA 1KV2A 3L9LA 3AGMA 4RVLA 2WD1A 4DGOA 2J0KA 4MD9E 2XM9A 2J7TA 4M84A 4BKJA 3UNJA 2BPMA 2YEXA 4RJ4A 2YA9A 3F9NA 4C8BA 5JQ8A 1YDRE 1GIIA 2WKMA 3DT1A 4IEBA 4IZ7A 5EG3A 4ZY6A 1Q41A 4M97A 4S31A 5IG1A 3WE8A 1ZARA 2X9FA 3KL8A 4JR3A 4GK2A 2VTNA 3RJCA 4W4VA 1Q3DA 2WU7A 1RE8A 2YZAA 3QQGA 4QPMA 4FUXA 5BVKA 2E9NA 4XOYA 3KVXA 5L3AA 4P7EA 4QOXA 4DTBA 3VF8A 3NIZA 5IPJA 3C5UA 4RX9A 5GIPE 3UOHA 2IVVA 5CQWA 4BY9E 3PXRA 1UNLA 3GC0A 5AUXA 4N6YA 3COMA 3I5ZA 2R4BA 4F65A 2NNWB 3AT2A 2J5EA 4MAOA 4GKIA 4IAFA 3BLHA 5DT0A 4FIIA 3E93A 4RIYA 4QMNA 3GI3A 2IVSA 1WBVA 4IC7A 4O2ZA 1GY3A 1MP8A 3K5VA 3JVSA 5J1WA 1YOLA 3S0OA 3PDTA 4IW0A 5HCYA 5DG5A 5CEKA 3GU8A 4L6QA 4FNZA 4E4XA 2HYYA 4CXAA 4YLKA 3OY3A 3TTIA 5FD2A 2NRYA 3F3VA 4FZ6A 4DCAA 3PZEA 1TQMA 2C5YA 4FKWA 4IAYA 4QYYA 4NJDA 2UZLA 2NPQA 5DMZA 1XH9A 3FSFA 4K1BA 4XX9A 3TJCA 4B8MA 4FV9A 4TRLA 5E9EA 3S2PA 5HIDA 4UXLA 1OI9A 3OW4A 3EHAA 4A06A 2YZLA 1WBSA 3IGGA 4YHJA 1ZYSA 4TL0A 1NW1A 1XHAA 4XJ0A 1PMNA 4U0IA 3UOLA 1YI6A 5CNOA 3RM6A 4BCOA 5CEPA 5ETIA 2XK4A 3F88A 3F82A 3R0TA 4ZTLA 4KB8A 4IJ9A 3MDYA 3QCQA 4ZSGA 3NYOA 3Q32A 4A9YA 4G5PA 3IW8A 2QOLA 4IX4A 4A7CA 5KCVA 3HMPA 4RVTA 3KRJA 4M3QA 5AP3A 4GMYA 4QP1A 2CGVA 5E90A 5HE1A 5IMEA 4I4EA 3Q2MA 3AC8A 5KMOA 1E9HA 4GVJA 4U3YA 3UVQA 3R7UA 4O7WA 5AAGA 2JFMA 1U5QA 2QHMA 5JQ5A 3QUEA 4CGAA 1J7LA 4H3BA 3R28A 3DBQA 2OH0E 4X0MA 5BUIA 4RSSA 3CY2A 5M4UA 2P0CA 2WHBA 4ZOGA 1RQQA 4ZTQA 4L7SA 5IQHA 4FE2A 4FOBA 4LMNA 2VO3A 3DDQA 5IEVA 4AZWA 3E8CA 5HESA 5EI6A 4CRLA 3SVVA 5E92A 3U4WA 3ZSHA 2ZB0A 3W55A 2BKZA 1TKIA 2WQEA 3GBZA 3HDMA 3HX4A 4M12A 4BIEA 4F0FA 4JAJA 1YDSE 4L3PA 4JBOA 4EBWA 3EQRA 4DFBA 3JR1A 2WNTA 3MB6A 4ZSJA 4PL5A 4FTLA 4E7WA 1WBWA 2GNLA 4I5MA 4KKHA 3IW7A 3OTVA 1YXTA 4O22A 4AF3A 4MVFA 4ITIA 2PZPA 4CLJA 4QMLA 3DAJA 3H4JA 3OXIA 1NVSA 5J8IA 3LLTA 4FKJA 4FTKA 4QMYA 3OOGA 4EWHA 1X8BA 4AOIA 3ACJA 2JIUA 5T68A 1UWHA 2YHVA 3P0MA 3E62A 4MYGA 4CMTA 3EN9A 4ASXA 4NEUA 3P1AA 4RIOA 5CXHA 2EWAA 4FIGA 2PVKA 4IVBA 2VNYA 4EUTA 3LCDA 4BZDA 4C7TA 4DINA 4QYFA 3BX5A 2WQNA 4Q9ZA 1AD5A 1H1SA 5HU9A 2W9FB 4BFMA 1IA9A 3PA3A 5L8LA 2VX1A 2ITQA 2C3IB 3F5XA 5H9BA 5KUPA 3MY0A 4EWQA 1OL1A 2BAKA 4FV2A 3WF8A 3ZSIA 3NEWA 5D9HA 5CEMA 1UU7A 2G1TA 3VRZA 2XNOA 4PWNA 5IUHA 4IM3A 5EM5A 3WARA 1YOJA 3O7LD 1UV5A 3IW5A 3PFQA 5JZJA 3OMVA 4TW9A 1LEWA 2VWUA 5KX8A 5LWNA 1OKWA 3TJDA 4YO6A 3ORZA 3PJ2A 1GZNA 3FUPA 4O7YA 3QQFA 3HV4A 4QMOA 2EB3A 3UMXA 3R9HA 4HVSA 3KK8A 3ETAA 3I4BA 4EHVA 4QO9A 3DFAA 2R5TA 4YZDA 5B2KA 4L42A 3ZLSA 4C4JA 4J71A 1SVGA 2XBAA 2YM3A 4DH7A 1BI8A 1R39A 1T46A 2OSCA 3VIDA 3NWWA 3D4QA 5L8JA 2R3QA 1Z57A 5KMJA 4HVDA 4YJRA 4YHTA 1IAHA 4EYMA 4DCEA 4CYJA 1NXKA 4GIHA 3QGWA 3FMLA 3VBXA 2UZDA 1WVWA 3BYSA 4ORKA 4IB0A 3FPMA 2QQ7A 3QWKA 3BGPA 3EIDA 4IZYA 1REKA 2XKEA 3A8WA 3MBLA 4EK3A 5AEPA 3ET7A 4XG8A 4NFNA 4B7TA 4FTQA 4NK9A 3ZEPA 1AQ1A 2B55A 4AWIA 3Q5ZA 5IH4A 4PQNA 3QAME 3DKGA 5HTBA 4HYUA 1WVYA 5FEQA 4U44A 3UOJA 4D0XA 3LJ1A 3JXWA 3IW4A 3MWUA 3OT3A 4IANA 2W1GA 3Q4CA 4FX3A 4HGSA 4MNFA 4S30A 2W7XA 4G3EA 4TWCA 4CVAA 2OFVA 4RQKA 4XG4A 3DV3A 4O0VA 2G15A 2Y7JA 4KRDA 3QQLA 4YSMA 4YU2A 1G3NA 3BHVA 2OIDA 4UMTA 5F94A 3R9NA 4GRBA 1XKKA 4FEXA 3NW6A 5CEIA 3F2NA 3VUMA 2BRGA 4FT9A 3KXNA 4NM7A 5CAVA 4J8MA 2I1MA 4QQTA 2E9UA 3GFWA 4EJ7A 2XNPA 3QHWA 3ZZEA 3A2CA 4AZSA 3I7BA 4ANOA 4IIRA 2G2FA 4PDPA 2GNJA 4NU1A 5HLNA 2YFXA 5BVDA 5AR5A 5CXZA 5A3XA 4RC3A 2WO6A 4BYIA 4OBOA 2AYPA 4E3CA 3ZYAA 3TUDA 2H8HA 2XKFA 5T3QA 3ZH8A 2UVXA 4P2KA 3LLAA 3UIBA 3PY3A 3U4UA 1Q24A 3D83A 3PY0A 1H0VA 3FLZA 2OXXA 4YJQA 1M52A 3RZBA 4PX6A 4ERWA 5JFXA 4QP2A 5DOSA 4IB1A 3SDJA 4EOPA 2CGXA 2WFYA 4H3PA 2HCKA 5FTOA 5H3QA 4QMSA 1JAMA 5C8KA 5J7BA 3KY2A 4UBAA 1YRPA 2YIQA 5E1SA 2VTJA 4CEGA 5AR7A 4IAAA 2VO6A 1Q8WA 2JIVA 2W1DA 5CU2A 4ZJVA 3PIXA 4RPVA 4DEDA 1BLXA 3R7YA 5JFVA 1F0QA 4FSTA 4XLVA 5DRDA 2DS1A 5CF6A 4Y5HA 3VS3A 3FZSA 5EFQA 3HMNA 3RMFA 3QBNA 3HGKA 4QP3A 3D5XA 5IUIA 1IG1A 1KE6A 3FI4A 4EUUA 5A4QA 4YNEA 3NRMA 5AV2A 2X0GA 4TYHA 5CZHA 3UC3A 1PXOA 3ERKA 2X7GA 4WSYA 2VWBA 4YTHA 4F6WA 5K5XA 2VWIA 2IZRA 3LQ5A 3RWQA 3UQCA 4PMPA 4FIEA 5IQCA 3F61A 3TZ9A 4LG4A 2W5AA 2QG5A 3C4CA 3NNVA 5TOZA 3GU6A 1SVHA 2GHGA 3HP5A 4G6NA 2X1NA 3E64A 3WI6A 3F66A 4DHFA 3VBYA 3SW7A 5GZ8A 1W82A 4DFZE 3FY0A 3GC9A 4NW6A 5BVNA 3KRWA 3HMMA 3FHRA 3A8XA 4IWDA 3UIUA 4B9DA 4BC6A 2CNUA 3IK3A 5E8WA 4KINA 4QMPA 4HOKA 1H07A 3BHUA 3W18A 3PA4A 5HICA 3NW5A 1WBOA 3D0EA 3LQ3A 3NDMA 3NLBA 4KIQA 4C02A 3BV2A 2WIPA 3CKWA 3A4OX 1P2AA 4ZJIA 2BILB 5AAEA 3S00A 3P7BA 3QWJA 1PKGA 1G8SA 3PJ1A 3O96A 4QT1A 4O86A 4DC2A 3PJ8A 5DLSA 4J98A 3IONA 4RWLA 3WIKA 3ZO2A 3SGCA 3DZOA 2J50A 2WPAA 4PMTA 5AUWA 1GIJA 2ITZA 2ACXA 1E1VA 4RFYA 1XBAA 4F09A 3MTLA 4V01A 5AP7A 1ZMUA 3B2TA 2WMBA 2BRMA 2R64A 4O7SA 4NJ3A 3CBLA 1JLUE 5L6WL 3GT8A 2PU8A 3RAWA 2OICA 2QVSE 4FODA 4APPA 3I6WA 4KKGA 2EB2A 3RPRA 3OP5A 4CFVA 4FMQA 5K0XA 4FSQA 4KBAA 3UVRA 2XMYA 1QPEA 5JRSA 2B52A 4NCTA 1A48A 3WZDA 5DE2A 3T3UA 4FKTA 4PPAA 2BROA 3W8QA 5EKNA 2BMCA 2UZOA 2VTOA 4A07A 1M2PA 5IQGA 5CU4A 5C27A 4OTDA 2J5FA 2RFSA 1J1CA 3B2WA 5C03A 3Q5IA 3PG3A 2Y6MA 1V0PA 3W8LA 4DH8A 5AX9A 3C1XA 2R3OA 2WMSA 5FQDC 4D1XA 2Z7SA 2OKRA 5AP4A 4M66A 4AE9A 5J87A 3QKLA 4F70A 4H39A 4YHFA 4PL4A 5EW3A 4F99A 2ITYA 4IFCA 3WIGA 5EQYA 3H9RA 2GCDA 3MFRA 5LMAA 3EL7A 3HV3A 4ZZMA 3ZBFA 4BKYA 3PP0A 1PJKA 4E6QA 2IJMA 4M69B 3D15A 2YITA 2XIRA 2ITXA 2OBJA 2VTLA 3W1FA 4Z7GA 3VUKA 4AW2A 3NAXA 3LCOA 4G17A 5F95A 3C50A 3UNZA 1RJBA 1L8TA 4R1VA 3O2MA 3FI2A 4KSPA 4OGRA 4HGTA 4GCJA 3OHTA 4FYNA 4XMOA 3CQUA 2BRNA 1MRVA 5AX3A 5LVMA 4BZOA 1M17A 4FK6A 4I23A 4OAVB 1BI7A 3FLNC 1Q3WA 2Y9QA 3MH2A 3GENA 3H0YA 3WF9A 3RNIA 5JGAA 4FG7A 5ITAA 2AC5A 2FA2A 2OWBA 3NGAA 3R7IA 5BQ0A 5D12A 5G6VA 4BDIA 2GPHA 2B9IA 3MH1A 4AX8A 4FSZA 3TV6A 1OPJA 2V0DA 4G31A 4TYJA 3AGLA 3UGCA 4ANSA 5BVEA 1YXSA 5AP0A 2VWVA 3M11A 4Y85A 3L9PA 3G2FA 3DTCA 2C5NA 2JIIA 3V04A 4KBKA 4GEOA 1XO2B 1OL6A 1S9JA 4FKGA 5HBEA 4EC8A 2P55A 2KULA 2RFDA 3DK3A 5DIAA 2I0YA 5CENA 4AZVA 4U5JA 3HL7A 4E4NA 3HKOA 3LW0A 4FR4A 2YWVA 2G2HA 4F1OA 4QP9A 3PPZA 3OT8A 1YWNA 5HORA 2ERKA 2C3LA 4D5HA 4O7ZA 4O82A 3ULIA 4GYGA 4TWNA 5KZ0A 3C7QA 4QYEA 1IEPA 3EN7A 4HYSA 3ZHPC 1PMUA 4O0UA 1M7QA 4G9CA 3CTJA 2YDIA 1YOMA 1V1KA 2CKEA 2YLFA 3QRIA 4LL0A 3HLLA 2BALA 3QRTA 4GT4A 2VTPA 2VN9A 4I6HA 4F6UA 3AD4A 4CFWA 3WYYA 2WEIA 5CTPA 4F9BA 2XJ0A 2CKQA 2VGPA 3C4FA 4FKRA 4BCPA 4JL9A 4MKCA 4J7BA 5AMNA 3HRFA 3OBJA 4XS2A 5K5NA 3PLAE 2VX0A 2EUFB 4G6OA 2F7XE 2XM8A 4HPUE 3QYZA 3KREA 2XUUA 2I0EA 3LMGA 3W2CA 4BCNA 1Z5MA 4EKKA 5CF8A 2IVUA 4MXOA 4LUEA 3R8MA 5KHXA 3NMUF 2VWZA 1FGKA 4EH7A 3HZTA 1PMEA 2J51A 1U46A 4TN6A 2XS0A 2VRXA 3DJ5A 4AN2A 4EK5A 5TR6A 5E7RA 4BYJA 3U6JA 2UZBA 3EQGA 4MXXA 4S32A 3Q4UA 4W9XA 5AP5A 3N4TA 4BBMA 3VS7A 1Q62A 4YPSA 5CYIA 3I79A 4OTGA 2HIWA 4G3CA 3MIYA 3R21A 5EHLA 3O50A 4AG8A 3HMIA 3A7GA 3KF4A 4FA2A 5BYYA 4IZ5A 1JQHA 2W5BA 3F3TA 3OS3A 3I0OA 4XH6A 4GU6A 4KS8A 5E8YA 5EM6A 3PY1A 4IVDA 5TF9A 4Z55A 4PNIA 3U54A 4XV1A 3G90X 4F0GA 3CCNA 3HUBA 3SKCA 2OF4A 3IGOA 3NAYA 3BWJA 3QUPA 4RIWA 4ENYA 5H8BA 1ZYJA 4RA4A 5EQEA 3LM5A 2JKQA 3O8TA 3L1SA 4P90A 1PYXA 3QD3A 3EN5A 4C3PA 2PVFA 2UW0A 1W7HA 1H1WA 4GJ3A 4YTCA 2GS6A 5FBOA 5GIOE 2IVTA 4K6ZA 4ASZA 3P7CA 3FC1X 2XJ2A 1OUKA 4ACCA 2XYUA 5I3RA 2VWWA 3HA6A 5ETAA 3UPXA 2W1FA 5D1JA 4CG8A 3QTXA 5DH3A 3ZUVA 1DAYA 5GHVA 3H10A 4N57A 1KE5A 2JD5A 5KMMA 4O0SA 4EQMA 4F0IA 1M2RA 2ZDUA 3E8EA 4DH3A 3EFLA 4R77A 3D2KA 4QPAA 2GDOA 3D7ZA 3ZRLA 3GNIB 4YLJA 3O8PA 4FTJA 1YDTE 3DA6A 2ZVAA 2OXDA 4R3CA 4D1SA 5HEZA 4WBBB 4Z9LA 3I6UA 2AUHA 3PLSA 4YZCA 4ARKA 1ZOEA 5ANDA 2J9MA 2X7OA 3HRBA 3F3WA 4I5CA 3PVWA 4JR7A 5CAOA 3EZRA 4FKVA 3E3BX 4IWPA 4N6ZA 4MCVA 4UYAA 3JPVA 2CLQA 2O5KA 2P4IA 4JBPA 3BZ3A 2F7EE 2JLDA 3F7WA 4JQEA 5GJGA 3UE4A 4CQGA 3D2IA 2YDKA 3QTWA 5AUZA 4CFMA 2QOBA 3TDVA 3A7FA 2PE2A 4BWXA 4FL3A 3UP7A 4FV3A 1QL6A 2VO7A 3EWHA 3IO7A 3REPA 4UMUA 4GG7A 4FKUA 4IX5A 4XBUA 1W8CA 2VTRA 4U45A 2V5QA 5K3YA 2SRCA 4A9UA 3OOMA 4WNPA 4BVUA 2I0VA 4XG3A 2B9FA 2XIZA 3ZM4A 5L2WA 3NUAA 5KKRC 3FLYA 3UG1A 3QKMA 5JZNA 3DK7A 3RNYA 2OGVA 2XRWA 2Q83A 5E1EA 3SXRA 5F20A 4H3QA 3AD6A 3WYXA 3S4QA 3UIMA 3BU6A 2HXLA 4FNXA 5AV3A 4ACGA 4DBNA 5KBQA 2JKOA 4OTHA 5I9WA 3FMKA 4FICA 2HW7A 2R7BA 3K2LA 4FTCA 4KKEA 4JQ7A 3UOKA 2B7AA 4IX3A 3R02A 4PDSA 2Z7QA 4FSYA 2RKUA 4L01A 5H8GA 3ZXZA 4AZFA 1XH6A 3HA8A 2HXQA 3R2BA 3PWDA 4DFUA 3R8UA 3BWFA 3ZLWA 3OCBA 3VJNA 3L8PA 4BDCA 1VYWA 4CV8A 4XLIA 4FSMA 3ELJA 4O0RA 4PRJA 3NX8A 5HG5A 3PSBA 2ERZE 2PTKA 2X9EA 3VS1A 3WF7A 4KABA 4MXYA 2ZDTA 2CGWA 2VU3A 2ZM3A 5CZIA 1ZLTA 1VJYA 1YWVA 2PZIA 2GS7A 4I93A 4BGHA 2VX3A 4KIPA 5A6OA 2IN6A 5AAFA 4YJOA 3M2WA 4CKJA 5EQPA 3LHJA 5ANEA 4WNOA 3QZHA 2IG7A 5EI2A 2O8YA 3DDPA 3FWQA 4J53A 3MGYA 3OTUA 4NCTC 2C0TA 1O6KA 3CPCA 1BUHA 4R6VA 2F7ZE 3C0IA 3NZ0A 3JYAA 3OWLA 4YC3A 4Z3VA 5IMXA 4FEVA 2ZYBA 4H36A 3LFQA 4BGGA 3VHKA 1WBTA 4BL1A 5FEDA 2C1BA 4ZZOA 3AMAA 5T6KA 4X2KA 4K8AA 3TL8A 3C9WA 1R0EA 5IZFA 2QI8A 3R00A 3UDBA 3LZBA 3U6HA 4X21A 2EXCX 3BHYA 3VVHA 5FXRA 5TE0A 1LUFA 3FMDA 4X3FC 4ZS4A 4GUBA 1W84A 4D28A 4FTOA 5JGDA 5I9YA 4LL5A 3RPVA 2OH4A 4WG4A 3ZC6A 3RWPA 2C47A 3Q9XA 5BPYA 3VS6A 5GJDA 4USDA 3R8LA 1HCLA 4M69A 3GCQA 2YERA 4YJUA 3DLSA 5CAQA 1WBNA 2PVYA 4IE9A 1JVPP 3BCEA 4PP9A 3SW4A 2QO7A 1V0BA 3TN8A 1PXLA 2C6EA 4I4FA 2I6LA 3RBWA 3TACA 3MTFA 3OWJA 3SA0A 2J0IA 4BTFA 4R3RA 3RINA 4AW5A 4GFGA 5HO7A 3MA3A 4O2PA 3FZOA 3ZM9A 4BIBA 4OTRA 4X2NA 2WTIA 5J95A 3MESA 4RJ3A 4F64A 1K3AA 4TYHB 1WCCA 2IW8A 4J8NA 4ONAA 1MRUA 4NW5A 5ICPA 4EK8A 2YDJA 3O7LB 5AV1A 4ZTMA 3EQIA 1M14A 4TYGA 1PXIA 3E3PA 2R3GA 3DB8A 3U51A 3ZS5A 4Z7HA 5I5ZA 5DGZA 1A9UA 4DEHA 3EYHA 4NL0A 4JG6A 4Y5QA 4EOKA 5C01A 3UC4A 2I0HA 3QHRA 3UMWA 1OBDA 3I7CA 2XCHA 4FTRA 2W1HA 4RVMA 4XEYA 3ZU7A 5IA2A 2UW8A 3EJ1A 5M56A 4FV6A 2BR1A 3R22A 3V8WA 3TNWA 5LVOA 2XK6A 3Q9YA 4GT3A 4WA9A 4E5WA 4F9YA 5KKRB 2O3PA 2XNGA 3SX9A 5DYJA 3SOCA 4FKQA 3FL4A 3CIKA 4PL3A 5HLPA 3TNHA 2YN8A 4DGLC 5HVKA 3GGFA 4N0SA 3QA8A 5JFWA 2QR8A 1PXPA 2O65A 3KRRA 3LIJA 1XH4A 3BQRA 4EK4A 2JFLA 1U59A 3D5UA 4U6RA 4QQJA 5A14A 2Z7LA 4QNYA 3HECA 1JOWB 2RG6A 4UEUA 4CSVA 3VAPA 4IWOA 2JDRA 4JG7A 4CV9A 2XCKA 1W98A 4OLIA 5DWRA 2O63A 5J5TA 4FTAA 3W2QA 3MY1A 4O83A 4EH4A 4ZY5A 4FIJA 2QKWB 4G2FA 5EH0A 3LFAA 3SQQA 4AW1A 4CT2A 3GC7A 2CHLA 5L2SA 1Q8YA 5K0KA 5BMMA 3WBLA 5LCKA 2OO8X 4V04A 2FSOX 3A61A 4RG0A 5EM7A 4FT3A 3G9NA 4I24A 4ZIMA 4EQCA 1O6YA 4YMJA 5C26A 2BTRA 5FRIA 1JKKA 4WUAA 1OPLA 4XG2A 4JDKA 4WKQA 4GK4A 3F6XA 2WMWA 3VUHA 3VW6A 5M4IA 3BLRA 1OZ1A 4KIKB 3WF5A 2WMVA 4ZY4A 3A62A 4G3FA 4IVAA 4NKAA 4WRSA 5ANKA 3DQXA 3Q4TA 1NVQA 3FEGA 3KFAA 4H1JA 3H9FA 1REJA 2C6TA 3UZRA 4O91A 3ZZWA 4UV0A 5M55A 4X3FB 1J7IA 3HMOA 4USFA 2X2LA 3OFMA 2J90A 3PXKA 4EH3A 2QC6A 3COIA 3RP9A 5IQIA 5M53A 3KQ7A 3NCGA 3Q4ZA 1FVTA 3IS5A 3HRCA 3DPKA 3CEKA 2P2HA 3R30A 4A9TA 4D1ZA 1Q4LA 1R1WA 4X2FA 5IH5A 4ZEGA 5JK3A 2F49A 2QODA 4AA4A 1M2QA 1CSNA 4HYHA 4MNEB 2YWPA 5EOBA 4BTJA 1J3HA 3BI6A 5DHJA 3QRUA 4BI1A 4I6QA 2Y8OA 4RJ6A 4BKZA 5F9EA 4KNBA 1DI9A 1PY5A 1Q61A 5CU0A 3ZFXA 4MD8E 2XNBA 3P7AA 5FTQA 4BTMA 4CKRA 4O7NA 4IDTA 5KMLA 3ORMA 2ESMA 4CFUA 4S2ZA 4YLLA 3ATTA 1WMKA 5HO6A 4AA0A 2WQBA 5CS6A 3FZRA 3MFUA 4E73A 5FM2A 4ACHA 2C3JA 1FVVA 3VUDA 3VS4A 5HE2A 3TUCA 4CKIA 3RI1A 1JKSA 2C5VA 3DXPA 4ITHA 3ANQA 2B9HA 2WEVA 2PUNA 2OI4X 4RLKA 4LGHA 4Y83A 1YI3A 3PPJA 4G34A 3JY0A 5AWMA 3VS5A 2PWLA 4C0TA 1OMWA 5HNGA 5C8MA 2F2UA 2WU6A 2UVZA 2R3JA 3ORNA 4XG7A 4RVKA 3LFBA 3QUDA 5AR2A 4LMUA 2GHLA 4O1PA 3LVPA 4WNMA 2QKRA 4C4IA 3MVMA 3R1QA 3P78A 2O0UA 3EN4A 5HG7A 4BF2A 2PZYA 4FTTA 4I0SA 4RWIA 1UU8A 3GCVA 4EC9A 5CSVA 3SG9A 4K2RA 2XIXA 4Q5EA 5G1XA 5TO8A 3DU8A 1H0WA 5HE3A 3BIZA 5ANOA 3TEIA 4KRCA 2XKDA 1YHVA 4CMUA 4ACMA 3GQIA 4BRXA 2YJSA 1T45A 4ACDA 4DTAA 3HUCA 5J1VA 5AV0A 4GYIA 1UU3A 3G0FA 4FTMA 5JFSA 3ROCA 4CFXA 2VNWA 3C13A 1PKDA 5K4JA 4TYEA 2FO0A 3Q96A 4CT1A 5C4LA 4DEGA 5CF5A 4LV8A 3DKOA 2I7QA 5DFPA 3DY7A 5A6NA 4D5KA 2FSLX 2ZAZA 4L67A 1KV1A 4D2SA 4OR5A 4FTNA 3O0GA 5C1QB 5AUYA 3N4UA 2B4SB 3U9CA 3LJ2A 3QD0A 4XRJA 4NYEA 2F2CB 3ZONA 2ZMDA 2FB8A 3RAIA 5KMIA 4L68A 3FMNA 5K9IA 3UJGA 3QQHA 4U40A 4NT4A 3BHTA 3D94A 2UZVA 2JDVA 2OJ9A 2GS2A 2ZB1A 4QTCA 3QXPA 1OIYA 1QPCA 4RIWB 3GC8A 4Z16A 4FEUA 4IXPA 1H01A 3EQFA 4RJ5A 5HIBA 3V5TA 4CZUA 3E7VA 3KXGA 1OKVA 1Y91A 2R9SA 1E1XA 4FKIA 4HCUA 3KF7A 4PTGA 5EYCA 4C2WA 4DH1A 3L9MA 4IZAA 3PE2A 3ODZX 3LFDA 3ZFMA 5IQBA 2ZOQA 2EU9A 4HZSA 4C36A 4X6RA 3EN6A 5LQFA 4ANNA 2JDTA 3G9LX 4WHZA 5FEEA 2PZ5A 2W1EA 4AXAA 2BHEA 4UMQA 5HOAA 2PULA 4O21A 1G8AA 3V01A 2QU5A 2OW3A 3DAEA 2YJRA 4JDHA 3GU7A 4XCUA 4EOQA 4I41A 4C3RA 5CVGA 4LRKA 3ZFYA 4LUDA 4YUQA 3GXLA 2H96A 5EI8A 4FEQA 2XB7A 4NM3A 4E1ZA 4O81A 4OUCA 2UZTA 1OECA 3A7JA 4DT8A 5TT7A 2R3NA 5HU3A 2FGIA 5E4HA 3R7VA 1OIRA 2WIHA 4BWPA 2UUEA 2YCFA 3JUHA 3ORLA 2GFCA 5HBJA 5AA8A 4CFFA 3BYVA 1LPUA 5IQFA 5EKOA 2JC6A 4QMUA 3QYWA 5FWKK 3E7OA 2B54A 4OTQA 3F7ZA 3FJQE 1ZMWA 1O9UA 2GQGA 2ZV8A 3MN3A 3NYVA 3HVCA 5FM3A 2OK1A 1WAKA 3ITZA 1JSVA 4FT7A 4MD7E 1JWHA 2R2PA 4QMMA 4E26A 5I4NA 3L8SA 4O7LA 4ID7A 4JIKA 1ZZ2A 3TWJA 4PPBA 3WOWA 3AG9A 5L6OA 4K9YA 2UZNA 3R9OA 5HCXA 3PYYA 1ZXEA 4C58A 4WSQA 1GAGA 1PXJA 4GH2A 4FOCA 3BYUA 3PSDA 5M57A 1OL5A 1GZOA 3FMJA 5AP6A 3A99A 5GZAA 5CVHA 5HCZA 4RT7A 4UB7A 3MSSA 3MPAA 3W10A 3PA5A 3RPSA 3WE4A 4ASEA 2GQSA 1DI8A 3DTWA 3NUSA 4HCTA 2GNHA 2J6MA 4FSNA 4G9RA 4W4WA 4O0XA 2C6OA 4I5PA 4R8QA 2BZHB 3NUUA 3NUXA 5CEOA 3LE6A 4U3ZA 4BCKA 4QD6A 2ONLC 4RX8A 4ALVA 4P5QA 3LMIA 4GS6A 3FQSA 3BEGA 1S9IA 3KA0A 1GJOA 3O23A 2HZ0A 3DFCB 3SXFA 3OD6X 4D2WA 3F2RA 4CCUA 4KIOA 2PVNA 1OL2A 2X6EA 5I9XA 4NFMA 4QTDA 2P2IA 2ITWA 3DCVA 5CSPA 1ZAOA 2X8DA 3QTZA 4CZTA 4E6DA 3COHA 4HNIA 3IECA 4NWMA 1URWA 4O1OA 2HOGA 4Q5HA 4QMXA 5CU6A 2IPXA 3RVGA 3P9JA 3ZO1A 4IDVA 4KIKA 1YI4A 2FVDA 4AN9A 4ANBA 3HV6A 4WRGA 2OJFE 5IQEA 2HENA 4MH7A 1R0PA 2R0IA 5AM7A 5EDQA 2V62A 1YHWA 3AT4A 3QTRA 4U9AA 4D4YA 3W33A 2XK8A 3FDNA 2XJ1A 5CF4A 5F1ZA 3EYGA 3TXOA 2UW6A 4QRCA 2XYNA 4X3FA 1ZYLA 2XK7A 2PUIA 4BI0A 2FH9A 4MHAA 1JKLA 2X39A 4YJNA 4K0YA 4AFEA 4ALWA 3UNKA 2PMNX 4AZTA 3FKNA 3MY5A 2X2MA 3BPRA 3CC6A 3TNQB 5L2TA 2DUVA 4FV7A 1VR2A 1XH7A 5E91A 4ZP5A 4FV1A 4YJPA 5CANA 3BELA 3FAAA 4AOJA 2XNEA 4MNEA 2J4ZA 4BCJA 1KE9A 3NVMB 3NSZA 2QU6A 4IH8A 5E8UA 5LMKC 3RAHA 4IBMA 5HG8A 2Y6OA 4EHZA 4HVGA 1P4OA 3ORKA 3OW3A 3TV4A 4BIDA 3AT3A 3EOCA 4NIFB 2PE0A 3F3ZA 1I09A 1ZWSA 1H28A 2QG7A 1CKIA 3V8TA 4PV0A 2ZMCA 3OEFX 4PMSA 5M08A 2VD5A 3VULA 4IADA 3P4KA 3QD4A 3RTPA 4M67A 5CALA 2PHKA 4A9RA 4U41A 1STCE 3FKLA 4JIAA 4GKHA 5H2UA 1PMVA 3OUNB 4RJ8A 5CLPA 4WNKA 4P5ZA 5L6PA 4XV9A 3OZ6A 5HVYA 2JAMA 2C6IA 3W2RA 2CNVA 4TNDA 4FV5A 2PMLX 3PXZA 5J9LA 4K77A 1W0XC 5M06A 3PXYA 5E8ZA 3HNGA 4W8EA 2X2KA 2DWBA 4K18A 5M51A 2B0QA 4BDAA 4HGEA 2E9OA 3F5PA 3QU0A 4N4SA 4XRLA 2JDOA 1SVEA 5HHWA 2C30A 1FGIA 3I5NA 4XG6A 4FZAB 4PDYA 2V7AA 4TPTA 4EH8A 3RHKA 3FZ1A 4B8LA 5C8NA 3IDBA 4C62A 2PYWA 2Z8CA 4O0WA 4C38A 4IVCA 1Q5KA 3ENMA 4ZZNA 4LGDA 2PVHA 2WXVA 4KD1A 1TVOA 3VW8A 5A9UA 4MQ2A 5DBXA 2F57A 4DBXA 5K4IA 3COKA 5DR9A 4AFJA 3ATSA 4FGBA 1JKTA 4CTCA 2Z7RA 3DBCA 3QTIA 4O7RA 2KTYA 3AC5A 4ASDA 4C4HA 3N4VA 4LQMA 4ZSAA 5AIRA 5DT3A 3G6GA 2XK3A 4FZFB 4ZMFA 1R3CA 3UZPA 4JDIA 2YACA 4NSTA 4DGGA 3RZFA 4TXCA 4QTEA 2R7IA 2J0JA 4GUEA 4M68A 4X2GA 1DS5A 4FIFA 4ZTHA 4JS8A 5B2LA 2HK5A 2YM4A 4CFNA 3PWYA 3VBWA 3DJ6A 3FXZA 2IWIA 3Q60A 2YIWA 2RL5A 1VYZA 1Q8TA 4F9CA 3BGQA 2WB8A 5J7HA 4DLIA 2UW4A 5EHOA 4LOOA 3PJCA 4KS7A 3QQKA 3CGFA 2BHHA 4EOSA 4FL2A 4ZAUA 4R5SA 2X6DA 3OXTA 5HD7A 2ZM4A 4E20A 3PRIA 4PTEA 3CJFA 5IU2A 2ETRA 4V0GB 1DM2A 3HYHA 4R78A 2WZJA 3MIAA 5I9VA 4DA5A 1FVRA 4AT5A 2VTHA 3T3VA 3PE1A 3C4XA 3QZGA 4G3GA 1GZ8A 3W2OA 5LWMA 5D7AA 5HIEA 3TG1A 4JI9A 4H58A 1JBPE 4AZEA 5HTIA 5AR3A 3II5A 5CAUA 5HX8A 5M44A 1BKXA 2BZIB 4LGGA 3IW6A 3NR9A 4WUNA 5E8SA 4BCIA 4BWKA 5JT2A 4O84A 4G5JA 3R7GA 1APME 2H9VA 2IW6A 3QXOA 4FKLA 3FXWA 4JLCA 5E8VA 2ITPA 5EW9A 1YXXA 4LRMA 1A06A 1IA8A 3O8UA 5HI2A 3NW7A 3DOGA 3GOKA 2QD9A 4IACA 2A2AA 4TYIA 4A4LA 3MW1A 4AS0A 3QFVA 3LJ0A 2C69A 5AP1A 3RM7A 3QGYA 2YISA 3QZIA 2CJMA 3I60A 1XH8A 1YWRA 2QOCA 3V6SA 1QPJA 3DJ7A 3OEZA 2OLCA 3LMHA 1L3RE 2VWYA 2FSTX 3FQEA 2PPQA 3CQEA 3K3IA 1GZKA 2C0OA 4GJ2A 3NVKI 3Q9ZA 1M7NA 5DRBA 3ODYX 4CLIA 3GP0A 3KC3A 4OBPA 2QHNA 2ZM1A 3VUTA 4RZWA 2QOFA 3QL8A 4FG9A 2DYLA 4YBJA 1OVEA 2GQRA 4BICA 1J7UA 4MWHA 3BKBA 4D9UA 2PUPA 3P79A 5HLWA 2XIYA 3UYTA 4JVGA 4RQVA 3CP9A 4A4OA 4F7LA 2BFXA 2GTMA 2BIYA 4BCMA 2BUJA 2C1AA 2RFEA 4GSBA 4JAIA 2W06A 4C4EA 5JSMA 2OIQA 1Y8YA 4ZSLA 5BYZA 3VUGA 3OBGA 2A0CX 3R9RA 3C4EA 3TIYA 4F1TA 4WBOA 3GOPA 4L3LA 4X6QC 5HG9A 4X3JA 3CSVA 2QOQA 4RIXB 5AP2A 3Q6WA 3A4PA 2E2BA 3NIEA 4EOJA 3S1HA 4UY9A 2R3RA 4JOAA 4AN3A 3LXPA 4F1MA 3ZOSA 3MV5A 5ACBC 3BE9A 4R5YA 3F5GA 3FXXA 3C4ZA 1F3MC 2UZWE 4TTHB 2R3IA 1LEZA 3Q6UA 3G0EA 1Q99A 4YZMA 2PVLA 2OJGA 5H8EA 3UYSA 2Y4PA 3LAUA 4OTWA 4YPDA 4YTIA 4CTBA 2Y0AA 3D5WA 4WG3A 3AC1A 4YGAA 4RA5A 2OFUA 4QP7A 3G51A 4XBRA 4DYMA 5DR2A 1FQ1B 1IR3A 2C6LA 3G6HA 2Z02A 4L43A 5FDXA 4FL1A 1QCFA 1G5SA 2QOOA 1XH5A 3PXFA 2XF0A 4XV3A 5CI6A 5BYLA 2XZSA 1IAJA 1ZY4A 3EQBA 3WZKA 3K54A 3MI9A 4QNAA 1U54B 2VGOA 3FYKX 5DA3A 2WMTA 5DEYA 3R8ZA 3ZMMA 2XKCA 3Q9WA 4IQ6A 5IEXA 4YP8A 5LVLA 3C0HA 4QMZA 3OUKA 4C57A 2HELA 4O7TA 4ZMEA 1PXMA 1V0OA 5BX0A 2OF2A 3O51A 1PF8A 4BZNA 3LKMA 2W4JA 3VUIA 3Q53A 5EYMA 2CLXA 5AFVA 4X7QA 2A19B 1P14A 3BHHA 1OUYA 5DT4A 3GCUA 4FT0A 4IX6A 3ZLYA 3LFNA 3UIXA 3QX2A 3DNDA 3NCZA 3C4WA 3QC4A 4UWCA 4D4RA 2JKMA 3FI3A 3U9NA 5JKGA 5M09A 2QLUA 5EYDA 2YLEA 3BBTB 4EHGA 3QCXA 3R8PA 3IDPA 3DGKA 4IWQA 4HJOA 4XYFA 5JN2A 2QCSA 3R2YA 4F7NA 3PP1A 2YIRA 4GFMA 1NA7A 5HTCA 3OY1A 3EL8A 3DZQA 2QOKA 4AT4A 4TKSA 1U4DA 2ETKA 3ZCLA 3S3IA 3UQGA 3OG7A 4S34A 4J95A 2YM6A 2BCJA 3KMUA 3PG1A 4KSQA 5BNJA 4FV0A 3E5AA 4FYOA 4XUFA 5A4EA 2CN8A 1B38A 3N9XA 1U5RA 4JG8A 5IA3A 4NIFA 2OZAB 4DG0E 3G15A
chains in the Genus database with same CATH superfamily
2ITTA 3V5LA 3R73A 1ZRZA 3IG7A 4H1MA 4L8MA 5FP6A 3UPZA 4O6EA 3R7OA 3LFSA 3W2SA 1SYKA 3ZO4A 4JRVA 1ERKA 4F78A 5C4KA 4JJRA 2ITOA 4XG9A 5D41A 3NNUA 2ZV9A 4CCBA 4LI5A 3G33A 4BTKA 4E6AA 3ORPA 3ORTA 4DH5A 4CRSA 4J97A 4WO5A 4RX5A 4IB5A 2PY3A 4QMWA 1ZY5A 1H1QA 2BVAA 2RG5A 3C0GA 3GCSA 4DTKA 3IOKA 3U8WA 2BDJA 5D10A 5DVRA 1KE7A 5BVOA 2OG8A 2ETMA 3PJ3A 1HOWA 4R3PA 2W99B 3CD3A 4UZHA 5TKDA 3SOAA 2NP8A 4JRNA 3TZ7A 3NNWA 4BDKA 4DEAA 4Q2AA 1YHSA 3D9VA 4I0TA 3E92A 5EHYA 4UMPA 3H9OA 3CGOA 4L00A 3GU4A 1CTPE 3CJGA 2VO0A 3DBEA 4UYNA 3PIYA 5CSXA 4F9WA 5LVPA 2GMXA 1RW8A 3LM0A 1PW2A 3PUPA 4I6FA 4YJVA 3FBVA 4UMRA 3OVVA 2ONLA 5IQAA 2GTNA 2NO3A 2JITA 5ETCA 1FMKA 2P33A 3VO3A 2WOUA 2V22A 4I94A 1RDQE 4EJNA 5L8KA 1URCA 4CMOA 4MBLA 3KU2A 5HBHA 5FDPA 5F4NA 3V8SA 2OU7A 5IA0A 5IISA 3AQVA 2PVJA 2R3HA 4PNKA 3ACKA 2ITUA 3AC4A 3VBQA 4MWIA 4CYIA 4J96A 1B39A 2WMXA 4HZRA 4ZTNA 3UZTA 5A4LA 4DLJA 3DNEA 1W83A 2C5XA 3GB2A 4MBIA 5KZIA 3VNTA 3AMBA 5E8TA 5ACKA 3FI8A 2YM8A 4ANLA 2JGZA 4J1RA 4IM2A 3MVHA 4JBQA 1KE8A 3QTSA 3R04A 4CQEA 2PSQA 5CQUA 5CASA 4LOPA 2RSVA 4EEVA 5JRQA 3QKKA 2WTKC 4D9TA 2YIYA 4FGRA 4ZTSA 5A46A 3OC1A 5FGKA 2HY81 3HDNA 2VAGA 4GK3A 2LAVA 4MEDA 2JKKA 5AR4A 2X0QA 3ULZA 4M13A 2PMOX 3IKAA 4IC8A 3Q52A 4V0GA 1ZMVA 4Y8DA 1MRYA 2QR7A 2XNNA 3D7TB 4CZYB 4ITJA 4EZ3A 2WMAA 3EKKA 3EB0A 4J52A 1NVRA 1GOLA 1K2PA 3KULB 3V51A 4C2VA 4U8ZA 3UO4A 4HW7A 1YKRA 3OROA 4YC6A 5I3OA 3CPBA 3B8RA 5HO8A 3RK9A 3KKVA 4JXFA 3EKNA 1OKYA 1UKHA 3KN5A 3VHEA 3E8DA 2RIOA 2X4ZA 5LMKA 3TNIA 3QQJA 3FMHA 2GNIA 2CMWA 2PVRA 3KMWA 4XP3A 3V5PA 1F5QA 3T9TA 4EH2A 2W1IA 4DEBA 3GUBA 4DGNA 2RFNA 3PXQA 4HNFA 5BUJA 2WTDA 4M7IA 1YVJA 2ZV7A 3N51A 4I6BA 3VS2A 3DQWA 4E93A 2A4LA 1R78A 4YNOA 4L3JA 4ALUA 3H0ZA 2IZUA 4O4EA 3LOKA 1ZOHA 1Y57A 5DEWA 3GVUA 2YM7A 2J0LA 3EZVA 4EORA 3OCSA 2W4KA 1WBPA 3AOXA 4EHEA 2PK9A 3PSCA 1PRYA 4XOZA 4EOMA 3R01A 4AGWA 2CKPA 3LFEA 4CG9A 2WQMA 4J99A 4BN1A 5LOHA 3MH0A 1BMKA 3UP2A 5LVNA 4M0ZA 1FMOE 3R71A 3KCKA 4W4XA 3RCDA 3U6IA 5ETFA 4NTSA 4TY1A 3NUYA 3U55A 2XA4A 4I20A 1SNXA 3K5UA 2RF9A 4I22A 3BV3A 3HAMA 2B1PA 3WZUA 3GU5A 1KUTA 3MPMA 3WZEA 2VTAA 4DEIA 4D0WA 4UWBA 3CS9A 4FVQA 2C4GA 3MPTA 4Y72A 5L2QA 4O0TA 3NUNA 5B7VA 3VQUA 4EI4A 4YR8A 3ORIA 1PYEA 4GIIA 4RIXA 4ZLYA 3DXNA 3RHXA 5AM6A 1IRKA 4FVPA 4BDFA 4FNWA 1UVRA 4X2JA 4OTPA 2BRBA 2JBPA 4NKSA 1QPDA 2JEDA 4RC4A 5ANGA 5HZNA 1H24A 4A4XA 2WELA 3ZDUA 5GNKA 4EBVA 1SM2A 3VRYA 3FZPA 5IEYA 4FI1A 4II5A 3ANRA 5EOLA 3NYXA 4IAKA 5I9UA 1BYGA 1UNHA 5KMKA 2C68A 3P86A 4AACA 4IJPA 5M07A 2VTIA 4KA3A 3L9NA 2HW6A 4O38A 4ZK5A 3TZMA 5KE0A 4PY1A 3AC3A 4ZXTA 3R1SA 2QO2A 3TT0A 1H26A 4QP4A 1EH4A 2OJJA 2A27A 4UZDA 4YJTA 3ZO3A 3KK9A 3ZUTA 3QZFA 4BDDA 4OAUC 4ERKA 2WTKB 4O7VA 1U54A 4KWPA 3B8QA 4FF8A 4QTAA 3SHEA 2W5HA 4C37A 4EH9A 2XNMA 4P4CA 2X4FA 4PF4A 5GINE 4I1ZA 3IDCA 2GNFA 1GIHA 2C5OA 4ZLZA 4I5HA 3T9IA 3F5UA 4DAWA 3FY2A 3ZUUA 5IA1A 5FP5A 4F08A 4EK6A 2XAOA 4LV5A 2UVYA 4RFZA 3RPYA 3VQHA 3M1SA 4UXQA 3FPQA 3R8VA 3SRVB 4I3ZA 2QO9A 4FIHA 3DBDA 5J9YA 3FHIA 5BUEA 4GT5A 5GJFA 4FSUA 3EFJA 4AAAA 1UA2A 2WMUA 4D2RA 4YURA 2WTJA 4RFMA 3W32A 4AW0A 4HVHA 4QMQA 5IA4A 3POZA 1NT2A 2BFYA 1SNUA 3AD5A 2R3MA 3E8NA 2PUUA 3D5VA 3MJ1A 3OXZA 2XIKA 4E4LA 5CT7A 3LCSA 3THBA 4W9WA 3AC2A 2VTQA 4AXCA 4C4GA 3BLQA 3PRFA 1I44A 3ZDIA 5I9ZA 3DBFA 4R7IA 2WGJA 4HYIA 3T8OA 1P4FA 3F69A 2W96B 3EFWA 4HPTE 4AP7A 2CN5A 4CNHA 3KVWA 2EXMA 2HAKA 2NRUA 3FZTA 4XNEA 1PXNA 5FXQA 5J5SA 3QC9A 3HAVA 3BGZA 4OT5A 4S33A 1H4LA 3IOPA 3LQ8A 1DAWA 2OZAA 1CDKA 2XH5A 3LFFA 4LM5A 4LOQA 5BVFA 5IF1A 4WT6A 3DK6A 1HCKA 2W0JA 1J1BA 3PTGA 2UV2A 5KBRA 5AJQA 1CMKE 4USEA 4YC8A 4GU9A 1OL7A 1OBGA 3R6XA 5CT0A 1OITA 2XK9A 4BB4A 3BRBA 5CNNA 2CDZA 5CSHA 1BX6A 3QLGA 1H25A 2YABA 5IQDA 4DITA 5C9CA 1OPKA 5A4CA 3BU3A 2W1ZA 5IDPA 1OM1A 5EDRA 3A7HA 4YJSA 5B0XA 2ITNA 3P08A 4H05A 3NUPA 2BKKA 4OTFA 4L45A 5DR6A 3LPBA 4O6LA 3KGAA 3S95A 2XVDA 4M8TA 3QLFA 3QRJA 3BBWA 2F4JA 3R1YA 5J79A 3F2AA 4APCA 3AXWA 5D11A 1QMZA 4O96A 4UX9A 2UZUE 4TWPA 3TKHA 5CVFA 1UKIA 3TKUA 2UW5A 4FBXA 4BDGA 5BV3A 4IB3A 4U7ZA 4FC0A 4IMYA 4BGQA 4D4SA 4FVRA 3OWPA 5LARA 2BRHA 2W1CA 4BCFA 3CLYA 4FTUA 4M15A 2WTVA 3ALOA 3FE3A 1YQJA 3TNPC 2XBJA 1CKPA 4F63A 2QOIA 2QOHA 3MVJA 4QP8A 5CSWA 4C59A 3QCSA 4D55A 3ZSGA 4ENXA 4FKPA 2WOTA 4MQ1A 3I1AA 1P5EA 1Z9XA 1XWSA 4BHZA 4DGMA 4U80A 4WD5A 5LMBA 3POOA 4JBVA 5EYKA 3VBTA 3V5QA 4YTFA 2NYAA 3VC4A 3W0PA 2E9PA 1VZOA 4MTAA 3F3UA 4JX3A 4RGJA 2Q0NA 3HP2A 3GQLA 3EQHA 1O6LA 4IAIA 1WZYA 4A9SA 1OGUA 2YAKA 2PMIA 1LP4A 4C61A 3ID6C 1VEBA 1Y8GA 2E9VA 4FTIA 4FUYA 4YZ9A 3R9DA 2R3LA 1IASA 4B0GA 4DG3E 4OBQA 5BMSA 4L44A 4U81A 4DE4A 2HZNA 2F9GA 1PXKA 2IZTA 4FT5A 3D7TA 3KXXA 4BDBA 1UU9A 4UALA 3AKLA 5L4QA 3DLZA 2R0UA 3FQHA 4F4PA 4QMTA 2JDSA 3C51A 1H1RA 5HKMA 3MYGA 3SC1A 2HWOA 1ZOGA 3KULA 4GG5A 4M14A 5A54A 4MXZA 4BDEA 4RZVA 4FSRA 5FLFA 3C5IA 2EXEA 3UO5A 1XBBA 2CCHA 3ZEWA 1ZYCA 2VTMA 1JSTA 4O4BB 3I81A 5EM8A 3MH3A 2V7OA 4GFOA 2BZKB 2YAAA 3FSKA 4N70A 3MS9A 3DKCA 3PIZA 4RWKA 3CE3A 4ZJJA 3BYMA 4PDOA 1NY3A 2WQOA 5J9ZA 1Y6AA 2R3PA 2XEYA 4AGUA 4Y46A 3FL5A 4RJ7A 4IM0A 4HCVA 4FV8A 3TTJA 3QF9A 3KCFA 2BDWA 3FMMA 4BCQA 4QYGA 4BCHA 2Z2WA 1FINA 1BL6A 3G5DA 3LXKA 3M42A 3UG2A 3QQUA 5DPVA 3UO6A 3E63A 4LRJA 2W4OA 4W8DA 1XJDA 3SG8A 3QD2B 3HEGA 4RX7A 4XP0A 3JY9A 5CWZA 1ATPE 2C3KA 3IQ7A 3R63A 4D58A 2XP2A 2J0MB 3LCKA 1BL7A 4I0RA 4KAOA 2YCRA 3CY3A 4D4VA 2YCQA 5HVJA 5ANJA 2DQ7X 5EW8A 5IH6A 4DFNA 4I21A 3UVPA 2ZV2A 5LCJA 2CCIA 4TNBA 3TV7A 4BCGA 4AT3A 5IA5A 4AUAA 2BAQA 5EK7A 5JGBA 4RIYB 4FZDB 4GL9A 3EQDA 3QALE 1YXVA 4PP7A 3NS9A 5IUGA 3GFEA 3GEQA 4ZS0A 4HVIA 2QNJA 4Y73A 3FKOA 4L9IA 3ZRKA 1Y6BA 4DFYA 2VZ6A 3H30A 4R7HA 5FTGA 4TWOA 4AGDA 1MQ4A 3R83A 1SMHA 4DN5A 4HGLA 4EKLA 3MFTA 4EH6A 4IFGA 2G2IA 2CSNA 4XHKB 3K3JA 5BVWA 3ZC5A 3WZJA 1OIQA 4BHNA 4BDHA 2X81A 4L46A 4QTBA 3FV8A 3KRXA 4RWJA 5E8XA 4MF0A 3Q04A 4MK0A 4DFXE 5KHWA 1H27A 3HV7A 4JNWA 4D2PA 1XBCA 3KXZA 4GVAA 4XP2A 3Q3BA 3QTUA 1H08A 4DT9A 4MX9A 3W2PA 4L53A 1ND4A 4BR3A 4G16A 2HZIA 5FUTA 1AGWA 4FZ7A 2OZOA 5HNBA 3UODA 5KO1A 2IW9A 4AE6A 4MXCA 3OCTA 3Q2JA 4E6CA 3VJOA 4F7SA 4WG5A 3VF9A 5B2MA 1ZYDA 3P23A 1YW2A 5FXSA 1YXUA 2X8IA 3WF6A 4QQCA 2C6KA 4DEEA 4EYJA 4EZ7A 5AADA 1XQZA 4ANMA 1KOAA 4AOTA 4JDJA 4DFLA 5HQ0A 4B99A 4U42A 4WOVA 4XV2A 4EZ5A 4NZWB 4RLLA 2Z60A 3RPOA 4F6SA 5KMNA 3JS2A 5D7VA 4FNYA 3CKXA 3V5JA 2W05A 3ENHA 2FYSA 3SXSA 4NUSA 1Q8ZA 4EL9A 4AU8A 3MB7A 5IDNA 3PPKA 2H6DA 2X8EA 5CY3A 1PHKA 2WMQA 2PL0A 5CU3A 2UW9A 3QTQA 4K33A 3CR0A 2FUMA 3MFSA 3KRLA 3SRVA 3R1NA 5LXMA 1CM8A 4BBFA 2W9ZB 3QA0A 4G3DA 2GHMA 3RKBA 4E4MA 4KUJA 3FLWA 1JPAA 4BBEA 3KXMA 3CXWA 4QPSA 2OXYA 1OIUA 1TQIA 3A60A 1GNGA 5CX9A 2CNQA 2ZJWA 4MXAA 3LXNA 1Q8UA 3LCTA 4Y95A 2FSMX 4FK3A 4FRFA 2PZRA 4BDJA 2J2IB 2UW3A 4YO4A 3TDWA 4QQ5A 2BDFA 3VN9A 3MJ2A 3TM0A 3RAKA 3RK7A 1FOTA 3DS6A 2ITVA 1WFCA 3BQCA 3D14A 3OF0A 1LR4A 3BEAA 3OWKA 4QMVA 2BZJA 3I0QA 4LFIA 5GZ9A 3ZBXA 3AMYA 2WAJA 4OW8A 1TQPA 5HNIX 3EFKA 3CQWA 2CGUA 1JNKA 4PPCA 3QRKA 5CI7A 3V5WA 2CKOA 4PMMA 5AIKA 4G6LA 5DI1A 4C35A 5HX6A 5M4FA 3PVUA 3KB7A 3PZHA 4FKSA 2R3KA 5A4TA 3V3VA 5JMSA 2H34A 3SD0A 1XR1A 2Y4IC 3NPCA 4MBJA 3DKFA 4F7JA 2YM5A 3R7EA 3GCPA 5AA9A 4CD0A 4E8AA 3TKIA 5JEBA 4EOLA 2QLQA 5FG8A 5HD4A 2UZEA 4NTTA 2BTSA 4U43A 4YSJA 2UW7A 4NM5A 3L8VA 3BU5A 4LYNA 3IPHA 3KMMA 1K9AA 4FG8A 4JQ8A 3RALA 3NNXA 3LFCA 3VBVA 3A7IA 2WMRA 2GSFA 5HGIA 3FYJX 2HY0A 4E5BA 3UQFA 3UBDA 2IZSA 2P3GX 2CPKE 2JBOA 3MA6A 3QCYA 4D2TA 4I92A 3CTHA 5DNRA 5EDPA 5KNJA 1SZMA 4DDIA 2JAVA 4G1WA 3SV0A 2OJIA 3ORXA 4D2VA 4EH5A 3PVBA 2HZ4A 2C6DA 2O2UA 5IKWA 3ZRMA 3VS0A 3TI1A 3EQCA 4Q9SA 3ROYA 5M4CA 2YIXA 3FLSA 3P5KA 4OTIA 3ALNA 1B6CB 3E88A 1JSUA 2LGCA 3EH9A 3DAKA 3L8XA 4BI2A 3U87A 3EQPA 4C4FA 3O17A 4QYHA 2R3FA 3MVLA 4OT6A 1KOBA 5HE0A 5AUUA 4C34A 4FKOA 4KBCA 2AC3A 2V55A 2C0IA 2OIBA 4W4YA 2EVAA 2WTWA 4YZBA 2IO6A 4AQCA 5I0BA 5JH6A 3DXQA 4JT3A 4BJJB 4WIHA 4TZRA 5L2IA 1Q97A 2G9XA 5ANIA 5AR8A 3O71A 4EOIA 1TZDA 2WTCA 2VUWA 3SLSA 4O27B 4ZLOA 3QX4A 4K11A 1KSWA 4L52A 5CEQA 3LXLA 2X7FA 4RRVA 3RGFA 2VV9A 1UNGA 3VWAA 3TUBA 2HWPA 4UWYA 2RGPA 4F9AA 2BIKB 3TIZA 3ZLXA 4R7BA 1MUOA 3DB6A 2C6MA 2YCSA 3BYOA 1OB3A 2O64A 3FC2A 4RBLA 3WILA 4ZTRA 5DN3A 3W16A 2GU8A 4O0YA 3RCJA 4B4LA 2I40A 2W17A 2VTSA 4JX7A 3TZ8A 4FV4A 4RC2A 4FSWA 4IAZA 2BAJA 1H1PA 4IHPA 3BL7A 3CD8A 4C3FA 3BE2A 4GV1A 4E5AX 1MQBA 4UN0C 2GNGA 1J91A 4PUZA 4DF3A 4C33A 5AUVA 3HV5A 3KXHA 2PVMA 1WVXA 3PVGA 3TMOA 4B6LA 4YBKA 5FBNC 4AGCA 4YZNA 3TCPA 2GFSA 5LJJA 2QURA 3FMEA 5CAPA 4L7FA 1FPUA 3EMGA 2VTTA 2G01A 3CTQA 2PE1A 2REIA 2B9JA 4ANQA 4EONA 2XEZA 3KN6A 3ZTXA 4EOOA 4AA5A 4DG2E 3JVRA 3FLQA 1H00A 3H3CA 4MF1A 3NYNA 4U97A 1CKJA 1ST4A 1KWPA 3KEXA 2A1AB 4EQUA 1UWJA 2B53A 4QP6A 1ZZLA 3RK5A 5AV4A 3SAYA 4FEWA 4NH1A 4PTCA 1FBNA 4TT7A 3UTOA 3V6RA 3E87A 1OKZA 4U79A 2QONA 4V05A 3ZXTA 4R1YA 3OCGA 2XRUA 2Y4IB 4M0YA 4RMZA 2VWXA 4ZSEA 5AUTA 4GW8A 4NM0A 2Q0BA 1H8FA 1KV2A 3L9LA 3AGMA 4RVLA 2WD1A 4DGOA 2J0KA 4MD9E 2XM9A 2J7TA 4M84A 4BKJA 3UNJA 2BPMA 2YEXA 4RJ4A 2YA9A 3F9NA 4C8BA 5JQ8A 1YDRE 1GIIA 2WKMA 3DT1A 4IEBA 4IZ7A 5EG3A 4ZY6A 1Q41A 4M97A 4S31A 5IG1A 3WE8A 1ZARA 2X9FA 3KL8A 4JR3A 4GK2A 2VTNA 3RJCA 4W4VA 1Q3DA 2WU7A 1RE8A 2YZAA 3QQGA 4QPMA 4FUXA 5BVKA 2E9NA 4XOYA 3KVXA 5L3AA 4P7EA 4QOXA 4DTBA 3VF8A 3NIZA 5IPJA 3C5UA 4RX9A 5GIPE 3UOHA 2IVVA 5CQWA 4BY9E 3PXRA 1UNLA 3GC0A 5AUXA 4N6YA 3COMA 3I5ZA 2R4BA 4F65A 2NNWB 3AT2A 2J5EA 4MAOA 4GKIA 4IAFA 3BLHA 5DT0A 4FIIA 3E93A 4RIYA 4QMNA 3GI3A 2IVSA 1WBVA 4IC7A 4O2ZA 1GY3A 1MP8A 3K5VA 3JVSA 5J1WA 1YOLA 3S0OA 3PDTA 4IW0A 5HCYA 5DG5A 5CEKA 3GU8A 4L6QA 4FNZA 4E4XA 2HYYA 4CXAA 4YLKA 3OY3A 3TTIA 5FD2A 2NRYA 3F3VA 4FZ6A 4DCAA 3PZEA 1TQMA 2C5YA 4FKWA 4IAYA 4QYYA 4NJDA 2UZLA 2NPQA 5DMZA 1XH9A 3FSFA 4K1BA 4XX9A 3TJCA 4B8MA 4FV9A 4TRLA 5E9EA 3S2PA 5HIDA 4UXLA 1OI9A 3OW4A 3EHAA 4A06A 2YZLA 1WBSA 3IGGA 4YHJA 1ZYSA 4TL0A 1NW1A 1XHAA 4XJ0A 1PMNA 4U0IA 3UOLA 3W0NA 1YI6A 5CNOA 3RM6A 4BCOA 5CEPA 5ETIA 2XK4A 3F88A 3F82A 3R0TA 4ZTLA 4KB8A 4IJ9A 3MDYA 3QCQA 4ZSGA 3NYOA 3Q32A 4A9YA 4G5PA 3IW8A 2QOLA 4IX4A 4A7CA 5KCVA 3HMPA 4RVTA 3KRJA 4M3QA 5AP3A 4GMYA 4QP1A 2CGVA 5E90A 5HE1A 5IMEA 4I4EA 3Q2MA 4FJVA 3AC8A 5KMOA 1E9HA 4GVJA 4U3YA 3UVQA 3R7UA 4O7WA 5AAGA 2JFMA 1U5QA 2QHMA 5JQ5A 3QUEA 4CGAA 1J7LA 4H3BA 3R28A 3DBQA 2OH0E 4X0MA 5BUIA 4RSSA 3CY2A 5M4UA 2P0CA 2WHBA 4ZOGA 1RQQA 4ZTQA 4L7SA 5IQHA 4FE2A 4FOBA 4LMNA 2VO3A 3DDQA 5IEVA 4AZWA 4QDEA 3E8CA 5HESA 5EI6A 4CRLA 3SVVA 5E92A 3U4WA 3ZSHA 2ZB0A 3W55A 2BKZA 1TKIA 2WQEA 3GBZA 3HDMA 3HX4A 4M12A 4BIEA 4F0FA 4JAJA 1YDSE 4L3PA 4JBOA 4EBWA 3EQRA 4DFBA 3JR1A 2WNTA 3MB6A 4ZSJA 4PL5A 4FTLA 4E7WA 1WBWA 2GNLA 4I5MA 4KKHA 3IW7A 3OTVA 1YXTA 4O22A 4AF3A 4MVFA 4ITIA 2PZPA 4CLJA 4QMLA 3DAJA 3H4JA 3OXIA 1NVSA 5J8IA 3LLTA 4FKJA 4FTKA 4QMYA 3OOGA 4EWHA 1X8BA 4AOIA 3W0RA 3ACJA 2JIUA 5T68A 1UWHA 2YHVA 3P0MA 3E62A 4MYGA 4CMTA 3EN9A 4ASXA 4NEUA 3P1AA 4RIOA 5CXHA 2EWAA 4FIGA 2PVKA 4IVBA 2VNYA 4EUTA 3LCDA 4BZDA 4C7TA 4DINA 4QYFA 3BX5A 2WQNA 4Q9ZA 1AD5A 1H1SA 5HU9A 2W9FB 4BFMA 1IA9A 3PA3A 5L8LA 3UDZA 2VX1A 2ITQA 2C3IB 3F5XA 5H9BA 5KUPA 3MY0A 4EWQA 1OL1A 2BAKA 4FV2A 3WF8A 3ZSIA 3NEWA 5D9HA 5CEMA 1UU7A 2G1TA 3VRZA 2XNOA 4PWNA 5IUHA 4IM3A 5EM5A 3WARA 1YOJA 3O7LD 1UV5A 3IW5A 3PFQA 5JZJA 3OMVA 4TW9A 1LEWA 2VWUA 5KX8A 5LWNA 1OKWA 3TJDA 4YO6A 3ORZA 3PJ2A 1GZNA 3FUPA 4O7YA 3QQFA 3HV4A 4QMOA 2EB3A 3UMXA 3R9HA 4HVSA 3KK8A 3ETAA 3I4BA 3VONA 4EHVA 4QO9A 3DFAA 2R5TA 4YZDA 5B2KA 4L42A 3ZLSA 4C4JA 4J71A 1SVGA 2XBAA 2YM3A 4DH7A 2A98A 1BI8A 1R39A 1T46A 2OSCA 3VIDA 3NWWA 4LDTA 3D4QA 5L8JA 2R3QA 1Z57A 5KMJA 4HVDA 4YJRA 4YHTA 1IAHA 4EYMA 4DCEA 4CYJA 1NXKA 4GIHA 3QGWA 3FMLA 3VBXA 2UZDA 1WVWA 3BYSA 4ORKA 3W0SA 4IB0A 3FPMA 2QQ7A 3QWKA 3BGPA 3EIDA 4IZYA 1REKA 2XKEA 3A8WA 3MBLA 4EK3A 5AEPA 3ET7A 4XG8A 4NFNA 4B7TA 4FTQA 4NK9A 3ZEPA 1AQ1A 2B55A 4AWIA 3Q5ZA 5IH4A 4BJJA 4PQNA 3QAME 3DKGA 5HTBA 4HYUA 1WVYA 5FEQA 4U44A 3UOJA 4D0XA 3LJ1A 3JXWA 3IW4A 3MWUA 3OT3A 4IANA 2W1GA 3Q4CA 4FX3A 4HGSA 4MNFA 4S30A 2W7XA 4G3EA 4TWCA 4AXEA 4CVAA 2OFVA 4RQKA 4XG4A 3DV3A 4O0VA 2G15A 2Y7JA 4KRDA 3QQLA 4YSMA 4YU2A 1G3NA 3BHVA 2OIDA 4UMTA 5F94A 3R9NA 4GRBA 1XKKA 4FEXA 3NW6A 5CEIA 3F2NA 3VUMA 2BRGA 3BLAA 4FT9A 3KXNA 4NM7A 5CAVA 4J8MA 2I1MA 4QQTA 2E9UA 3GFWA 4EJ7A 2XNPA 3QHWA 3ZZEA 3A2CA 4AZSA 3I7BA 4ANOA 4IIRA 2G2FA 4PDPA 2GNJA 4AXFA 4NU1A 5HLNA 2YFXA 5BVDA 5AR5A 5CXZA 5A3XA 4RC3A 2WO6A 4BYIA 4OBOA 2AYPA 4E3CA 3ZYAA 3TUDA 2H8HA 2XKFA 5T3QA 3ZH8A 2UVXA 4P2KA 3LLAA 3UIBA 3PY3A 3U4UA 1Q24A 3D83A 3PY0A 1H0VA 3FLZA 2OXXA 4YJQA 1M52A 3RZBA 4PX6A 4ERWA 5JFXA 4QP2A 3AKJA 5DOSA 4IB1A 3SDJA 4EOPA 2CGXA 2WFYA 4H3PA 2HCKA 5FTOA 5H3QA 4QMSA 1JAMA 5C8KA 5J7BA 3KY2A 3W0OA 4UBAA 1YRPA 2YIQA 5E1SA 2VTJA 4CEGA 5AR7A 4IAAA 2VO6A 1Q8WA 2JIVA 4DHZA 2W1DA 5CU2A 4ZJVA 3PIXA 4RPVA 4DEDA 1BLXA 3R7YA 5JFVA 1F0QA 4FSTA 4XLVA 5DRDA 2DS1A 5CF6A 4Y5HA 3VS3A 3FZSA 5EFQA 3HMNA 3RMFA 3QBNA 3HGKA 4QP3A 3D5XA 5IUIA 1IG1A 1KE6A 3FI4A 4EUUA 5A4QA 4YNEA 3NRMA 5AV2A 2X0GA 4TYHA 5CZHA 3UC3A 1PXOA 3ERKA 2X7GA 4WSYA 2VWBA 4YTHA 4F6WA 5K5XA 2VWIA 2IZRA 3LQ5A 3RWQA 3UQCA 4PMPA 4FIEA 5IQCA 3F61A 3TZ9A 4LG4A 2W5AA 2QG5A 3C4CA 3NNVA 5TOZA 3GU6A 1SVHA 2GHGA 3HP5A 4G6NA 2X1NA 3E64A 3WI6A 3F66A 4DHFA 3VBYA 3SW7A 5GZ8A 1W82A 4DFZE 3O5AA 3FY0A 3GC9A 4NW6A 5BVNA 3KRWA 3HMMA 3FHRA 3A8XA 4IWDA 3UIUA 4B9DA 4BC6A 2CNUA 3IK3A 5E8WA 4KINA 4QMPA 4HOKA 1H07A 3BHUA 3W18A 3PA4A 5HICA 3NW5A 1WBOA 3D0EA 3LQ3A 3NDMA 3NLBA 4KIQA 4C02A 3BV2A 2WIPA 3CKWA 3A4OX 1P2AA 4ZJIA 2BILB 4O4CA 5AAEA 3S00A 3P7BA 3QWJA 1PKGA 1G8SA 3PJ1A 3O96A 4QT1A 4O86A 4DC2A 3PJ8A 5DLSA 4J98A 3IONA 4RWLA 3WIKA 3ZO2A 3SGCA 3DZOA 2J50A 2WPAA 4PMTA 5AUWA 1GIJA 2ITZA 2ACXA 1E1VA 4RFYA 1XBAA 4F09A 3MTLA 4V01A 5AP7A 1ZMUA 3B2TA 2WMBA 2BRMA 2R64A 4MUQA 4NJ3A 4O7SA 3CBLA 1JLUE 2X0OA 3GT8A 5L6WL 3RAWA 2PU8A