2YIYA

Crystal structure of compound 8 bound to tak1-tab
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
306
structure length
293
Chain Sequence
b'SLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDHG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 7, TGF-BETA-A
publication title The Discovery and Synthesis of Selective Dfg-Out Tak-1 Inhibitors
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase activator
total genus 93
structure length 293
sequence length 306
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2011-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2yiyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2yiyA01
5H8GA 4FT0A 3DZOA 2UZTA 3GVUA 3AT2A 4BDJA 2QOCA 5DG5A 4CMTA 4UWBA 3W2SA 4EWQA 4I6HA 4V04A 4O7WA 5I3OA 3ALOA 2F57A 2B7AA 2OG8A 2VWIA 5IUHA 3MIYA 5M4FA 3A60A 4FIGA 4KBCA 1H07A 3S00A 5J1VA 3SLSA 1SZMA 3MVLA 1FGKA 3FAAA 3NUAA 3MH2A 4V01A 4C4EA 4WG3A 4GKHA 3E63A 2QOIA 4OTWA 3RCDA 5F1ZA 4NTSA 1OIUA 3BLQA 2GQRA 4WUAA 1O6KA 3OWPA 4UZDA 5HCZA 3ZO2A 3ALNA 2WTWA 5DMZA 3S0OA 3WZKA 3ORZA 3ZO1A 4LYNA 4U81A 2RFNA 3E87A 4XBRA 5K5XA 1WBTA 3C13A 4OBOA 3FE3A 3A99A 3DKFA 4P5QA 5HNGA 4AGCA 1H0WA 1NA7A 3R0TA 5IDPA 4IM0A 2OZAB 4QQCA 4DGLC 4F09A 4UV0A 4UMPA 2CMWA 3KCFA 4BDEA 5IEYA 1GIHA 1SVHA 3EQGA 4O7ZA 4YC3A 4Y72A 3R01A 4JDIA 4LM5A 3PVGA 1U4DA 2CKOA 5M07A 3FZ1A 4M84A 2BILB 4FTMA 3UNKA 3F3VA 1YI4A 1H00A 2WNTA 3DNDA 4ZY6A 4YPSA 5AR4A 2QR8A 2BKKA 4KRDA 2XM9A 4DTBA 4I3ZA 3F82A 4RRVA 5IQDA 4NKSA 4LI5A 1O6YA 3TNQB 4AN9A 1UU8A 2ZVAA 4LGHA 2UW4A 4ZJVA 3KMMA 2XP2A 3GCPA 3OTVA 4YJQA 4EQCA 3LXNA 2VO3A 4BWPA 1JSUA 2R3HA 4BWXA 4ZSJA 3AQVA 4FKTA 4DFXE 4IX6A 4HVHA 3VF9A 2YCFA 3ZM9A 2C47A 1YOJA 4ZTSA 2UZDA 2VTAA 2W1DA 3A7GA 5CWZA 3TG1A 3WE8A 4EZ5A 5CALA 1ATPE 2JKMA 3PP1A 3HMMA 4FSMA 1NW1A 3EZVA 4AU8A 4AZSA 4C4JA 2X7OA 3GNIB 3Q04A 3R7EA 3FKOA 2WTKB 3OBGA 2XM8A 3PJ1A 4ZLZA 2I0HA 5CAQA 3R9RA 3CQEA 3RGFA 4FSRA 3GEQA 3ORXA 3WIGA 5EFQA 4UWYA 2CN5A 3FPMA 4NW5A 2DS1A 4C8BA 4R7BA 2BFYA 3ZBFA 4I93A 4FV4A 2R3GA 3FZPA 3RHKA 3C0HA 3LOKA 4YJTA 3HVCA 5EHYA 4J99A 2DQ7X 4NSTA 5HTIA 2WTIA 4TWCA 4YGAA 4FKPA 3WI6A 5A4CA 2ZV9A 3WF9A 2J9MA 4IAAA 3W16A 4FBXA 2ITWA 5IA0A 2VUWA 3PXYA 2I40A 2OFUA 4MQ1A 1V0BA 4BTKA 3ERKA 2YM3A 4NJ3A 4UMRA 5H8EA 1PXJA 3O7LD 2C6KA 2ONLA 3IS5A 3RM6A 4EEVA 3P5KA 5CSXA 5I9ZA 2GNGA 2JIIA 1A48A 2Z7QA 3TWJA 2HK5A 1VYZA 2YCQA 5M4CA 3ZZWA 4ERWA 4TYIA 5EDPA 2P33A 2WQBA 2C0IA 3EN9A 3R71A 5LWMA 3OROA 3V8TA 3GCVA 3DY7A 5DPVA 3U9NA 4A4OA 4DHFA 3C4EA 2GS6A 1ZYCA 5AWMA 5GJGA 2UV2A 2WQNA 3CQUA 2FA2A 4QYEA 3QKKA 1FMKA 4HGSA 2B53A 5DH3A 3ZDIA 4EOMA 2JFLA 5JGAA 3QCSA 4O91A 4PP9A 3QGYA 5CSHA 4L3PA 4KBKA 4AT4A 2B1PA 4JVGA 2XNBA 1P4FA 3OWKA 3I6WA 3I0OA 3EZRA 4QNAA 4G34A 3ORTA 3CSVA 4NIFA 2FO0A 3UYTA 4IB5A 3RTPA 3VUHA 4QPMA 4YJVA 4U0IA 2BRBA 5KZIA 3QAME 4S31A 5K9IA 3PIYA 3ANQA 1ZYJA 4QP6A 4UZHA 3PE2A 3O2MA 4IXPA 5E9EA 2C6EA 5E91A 2Z8CA 4FSZA 5BVWA 4JX3A 1XH9A 2ITQA 4FT9A 3QQGA 2B55A 1Y6AA 3LCOA 4EOQA 2BR1A 5IH4A 1OBGA 4XX9A 4WKQA 2AYPA 4R1YA 4FNXA 2GDOA 4O7NA 2A19B 3R7VA 4D58A 5FG8A 5AM7A 5E7RA 2PVRA 2PZYA 4PNKA 2BIYA 1OL1A 4HVIA 5IMEA 2VO0A 3UBDA 2E9OA 4KKHA 5CZIA 3AD4A 1SNXA 3KKVA 3OP5A 3Q9WA 4JT3A 5FD2A 2BTSA 3QCXA 5HO7A 3IK3A 2YITA 5HVKA 4O7TA 3CEKA 4D28A 4BCKA 5KHWA 4QYYA 5DA3A 3RCJA 2R9SA 2VWUA 4E73A 1FGIA 5BQ0A 2RKUA 1S9IA 1YOLA 1WAKA 4TT7A 3OC1A 3VUKA 2GS2A 2BFXA 2WD1A 3DS6A 4XP3A 2UW0A 2GNJA 2C5VA 3OUKA 3UE4A 4DH8A 4HYUA 3QD3A 4E5BA 4KSQA 3MTLA 5DN3A 3LFQA 3WIKA 1CM8A 5KMIA 1YOMA 5A4EA 3UO6A 4OTRA 4BI0A 3MB7A 4HVDA 3K54A 3CTQA 4RWLA 5E8XA 3TM0A 4YURA 2ZMCA 3NUXA 3I7BA 5AR2A 2EUFB 3SD0A 3RP9A 5ANOA 4XUFA 3NX8A 4E4LA 1HCLA 3BWJA 4EJNA 3TNWA 2GSFA 3FZSA 4XG4A 3MH1A 4BCMA 4JDKA 5HTCA 4Z3VA 4C3PA 1URWA 4PDSA 3D5UA 3COMA 5BNJA 4OTPA 1SVGA 4GK4A 1XJDA 5LCJA 3BYVA 4G31A 3I79A 2CDZA 5GZAA 5EM5A 4DFUA 1YDTE 2YJRA 4DEBA 4QMOA 3QTSA 5AP2A 3IDCA 1H1PA 1LR4A 4C36A 2IVVA 2QOFA 4KNBA 2OJFE 2WFYA 3FLWA 3W1FA 4A7CA 4AACA 2HENA 1CKPA 3E93A 3KRLA 2PVHA 3RPOA 3VUMA 1ZARA 4ITJA 4RX8A 3NCGA 1W7HA 3ANRA 3NUUA 5D7VA 3U8WA 4BZNA 4IW0A 4JRNA 3OW4A 4EOOA 2R0IA 3PZHA 2YAKA 4D1XA 4QD6A 5ETCA 2QG5A 4WNPA 4WOVA 5LVOA 3SG9A 2PHKA 2X2LA 3TV6A 3UC4A 3MFSA 5KMKA 2YACA 4RBLA 4E5WA 2IVTA 3QX2A 4C57A 5BMSA 2J2IB 4GVJA 2BROA 3FI3A 2GTNA 1TQIA 3P0MA 3TACA 2HWPA 3WBLA 3UC3A 2RG5A 5HE3A 4D9UA 5GIPE 3D2KA 4X7QA 5JRSA 4AX8A 3TNPC 5EQPA 5GHVA 4AN3A 3A7IA 4YR8A 5ANGA 3C7QA 5I9YA 3PSBA 3ZXZA 2X7FA 3DAEA 4YJSA 2J90A 3PJ8A 1BKXA 2XA4A 2B9HA 3M1SA 3CR0A 3DQXA 2CLXA 2HZ0A 4F9AA 3M2WA 5CEMA 2PVYA 2WTDA 3A7FA 4GT4A 2YCRA 4XS2A 3RHXA 1ZXEA 4QP7A 3R8LA 4DCEA 3DK6A 2XNGA 5L2IA 1H25A 2Z60A 3OBJA 2VX3A 4XV1A 5HHWA 3KRRA 1L8TA 4EH5A 1DAWA 3GCSA 4FI1A 3MDYA 3MVHA 4FIHA 4KS7A 1J91A 4J71A 2WTJA 4IZ7A 1T46A 4QO9A 1VZOA 3LCTA 5DT4A 5TF9A 4C7TA 2RSVA 4ALWA 3KY2A 5EH0A 1U5RA 3R8PA 4E6QA 5IPJA 5AP7A 4L42A 2PE1A 4BBMA 5L6OA 4AZWA 3MV5A 5IQAA 2WOTA 2WMBA 2Q0NA 5DRBA 3CD3A 3K3IA 4CQGA 1H4LA 4OGRA 1KV2A 4IE9A 3CS9A 1WMKA 4EK8A 1Y57A 4NFNA 4ALUA 1FINA 3QKLA 4FKJA 4IH8A 4Y83A 3TTJA 4FTIA 4GU6A 4YJRA 1Q3WA 4QYHA 3W10A 3MVMA 3MY0A 4YSJA 1Z5MA 1OPKA 4TYHA 4CFUA 3KREA 5IQFA 2V5QA 5KMNA 1RE8A 4I0SA 4RX9A 5HG8A 3R8MA 3ZRKA 4EHVA 3NLBA 5JEBA 5GZ8A 1SYKA 1IAHA 4DH3A 2IZRA 1G3NA 3SQQA 4ZP5A 4O38A 2XVDA 4EH4A 3C4XA 4BDBA 4CMOA 2JAVA 4FL2A 2VTPA 2CLQA 1PHKA 2NP8A 3EB0A 2C5OA 2ZB0A 3O50A 3QXPA 4DC2A 4CZYB 1U54A 4P7EA 2BZHB 3QYZA 5DGZA 3W2OA 3UZRA 3EQBA 3FYKX 2UUEA 3BHVA 3FQHA 5EW8A 1IRKA 3I5ZA 3R2BA 3HL7A 3WZJA 4OBQA 3LJ0A 3PXFA 4KINA 3D7ZA 2WAJA 3IW7A 3R1QA 4U9AA 3RK9A 4ASEA 4D2VA 4X2FA 4D2SA 5A9UA 4A9SA 1OI9A 4USEA 3R2YA 2CGWA 4MNFA 2PULA 4AW5A 3POZA 3R02A 3VC4A 4LQMA 2EB2A 2BRMA 3OCTA 5ITAA 2IVSA 1Q5KA 4PL5A 5FP6A 4I94A 2QOBA 5A54A 4FKOA 3VBVA 4C35A 5D7AA 5C4KA 4IBMA 4UN0C 4PTEA 4IVDA 3ZS5A 4F9WA 3DBEA 4M68A 4XYFA 3GB2A 3ACJA 4M13A 2PUPA 5IA3A 3F3UA 2PZIA 2R2PA 4RIOA 1Y8YA 4X2JA 3OCGA 5LMKC 3UOKA 3NUPA 4O0XA 2VX0A 5ANIA 2WELA 4ZEGA 4A4XA 5C1QB 1PXKA 2BAJA 3Q2JA 4GK3A 1UNGA 3DB8A 4H05A 4DT8A 3F88A 4RVMA 4BDGA 1OMWA 2R3NA 4GYIA 4R78A 3MA3A 5EQEA 1O9UA 3H30A 4ANBA 2IN6A 4QMPA 3V6RA 5E8SA 3FKLA 1URCA 4TWNA 3I5NA 3H9RA 1FQ1B 3K5VA 4WSQA 4WNOA 4EK3A 3OW3A 3R28A 4IADA 3WF6A 3Q4CA 3BHYA 2YERA 4LV5A 2XNOA 4V05A 4QRCA 4XV3A 2ITNA 4IC7A 4U42A 3HA8A 4USFA 2XIYA 3CKWA 3TCPA 2BRGA 4HGEA 2CNVA 1Q8YA 3MYGA 1AD5A 3I1AA 1W84A 5DLSA 3EQPA 4KABA 4QOXA 4XLVA 4ENYA 3DPKA 4TYEA 1GOLA 1U59A 1X8BA 2BKZA 2W9FB 2BDFA 3H3CA 3PIZA 3Q9ZA 3PY1A 4C38A 2HW6A 3ORMA 3ORKA 3QX4A 1KOAA 3WZEA 5A46A 3ULIA 3CLYA 3PVBA 2OI4X 3E92A 2I0YA 4XOZA 3K5UA 1MP8A 1B38A 4I23A 5AP1A 3LIJA 2W0JA 3GFWA 5CXHA 4D4SA 2VTIA 4B4LA 3U4UA 5L3AA 3QA0A 3R7YA 3ATSA 4CV9A 3F6XA 4KWPA 3NYOA 2E9UA 2YLFA 3TI1A 3UOHA 3R04A 2WEIA 2VO6A 3MJ1A 4K11A 1FVVA 3R1NA 2J5EA 2R3IA 2UW5A 4I5HA 4TYHB 5HBHA 4ORKA 4CFWA 4HVSA 3KK9A 3QTXA 2XKCA 2HZNA 5AX3A 3PZEA 2IZSA 4ZMEA 2VWXA 5EYCA 4C34A 4WA9A 4WRGA 5AMNA 4YSMA 5D1JA 4ASZA 5M53A 4RJ5A 4BYJA 4O1OA 3KB7A 2X4FA 4M14A 3RK5A 1KE7A 4PMTA 5B2KA 4BCGA 2J0LA 5IH6A 1ZOGA 3KK8A 4OLIA 4EBWA 4P2KA 1W83A 2GNLA 2O64A 3V01A 5IA1A 2WTKC 4RWKA 4A07A 5FTOA 1YXXA 4E6CA 2QOHA 3VIDA 3U6JA 4J1RA 1YXSA 3GQIA 4J7BA 5KNJA 2XRWA 4YTHA 2EU9A 3WZUA 2C3KA 2YM6A 5AADA 4XMOA 5EM7A 1ZYDA 3G9NA 3KMWA 4ALVA 3VS5A 4ANSA 4IEBA 2E9NA 3QUPA 3HMPA 3VBTA 4K0YA 3L8XA 2O8YA 1W82A 5CVHA 4LRJA 3S95A 4ZXTA 4GW8A 2QI8A 4JIKA 2HYYA 4TXCA 5EKOA 4ZSEA 4F6SA 4BTJA 3I81A 4CFVA 5HD4A 4FYOA 4EH8A 3OVVA 3NSZA 3UJGA 3VS1A 3W8LA 1HCKA 4GSBA 4GIIA 2NRUA 3QRIA 4FKSA 3IW8A 4FT7A 2WMUA 3OD6X 4DAWA 4W4XA 4BI2A 4TW9A 3S2PA 1UVRA 4M97A 4RJ3A 2R7BA 1UA2A 3R8UA 4JLCA 3T8OA 4ZOGA 4LL5A 5BVEA 1XBCA 3LAUA 5C27A 3EN5A 3V5PA 4U97A 1OVEA 2YFXA 2XRUA 3KXXA 3PWDA 4W9XA 1R1WA 4O86A 4AA0A 4O81A 1JVPP 3KC3A 4M7IA 4FKRA 4IB1A 3FLSA 3FMDA 3QD4A 4OTFA 3TJCA 1QPDA 2RFDA 2VTNA 5CEKA 2ZM4A 4UBAA 5LARA 4LUDA 4BFMA 3ZHPC 4C2WA 4D2TA 2PUNA 3DKCA 2BZJA 4LOOA 2P4IA 3TUBA 5C26A 4AP7A 2C69A 2I0VA 5D12A 4B6LA 2R0UA 4FNYA 4EHEA 1WBPA 1FVTA 4FTAA 3E8DA 4DGOA 3UIBA 4BYIA 4LFIA 1RDQE 3EFJA 4DLJA 4MEDA 2QU5A 3COKA 4FTCA 5GINE 3GCQA 4FUYA 4I20A 1FPUA 3W2QA 1JKLA 2ZB1A 5FBNC 3ZRMA 4RWIA 4MNEA 5HVYA 3W32A 3Q9XA 4G6LA 2XNEA 3FJQE 2YM7A 3Q52A 3PG1A 4KIOA 3SDJA 2BALA 5FXRA 3MW1A 3LLAA 5CF5A 3P1AA 5B2MA 2WMTA 3G6HA 3DCVA 3FMHA 2R7IA 4EORA 3SHEA 1BYGA 3C4CA 3QD2B 4BDIA 3SXRA 1JLUE 4JBPA 3V5TA 4GV1A 5M55A 2PTKA 3MGYA 4A9TA 4CCBA 3TUCA 4M0ZA 2C3IB 4HYIA 3FMKA 4O2ZA 1BLXA 4U6RA 4FV5A 2ITPA 3F66A 5HORA 4U8ZA 2YAAA 2WMRA 3H0ZA 5CI6A 1PXPA 5JGDA 4ANLA 3ENMA 3LCDA 3NW7A 2A2AA 4KRCA 4OTDA 1V0OA 3GP0A 4AE9A 3PUPA 4L3JA 4IAYA 3HRBA 3IPHA 4FSTA 2AC5A 3PP0A 3OOMA 3IW6A 4R77A 3OEFX 5HGIA 3BBWA 3KF4A 1U5QA 4A9RA 5ANJA 4IX5A 2OF4A 3LFSA 4F63A 3TDWA 3D9VA 1H8FA 3A8XA 2PPQA 1AQ1A 3M42A 2JAMA 5EYMA 4FEQA 3KULB 3PPJA 3TT0A 4CSVA 5AUXA 4CVAA 3PVWA 4FKQA 3LXKA 3AC5A 2LAVA 2JDOA 2OO8X 2QQ7A 2XF0A 2W1FA 3LM5A 3BV3A 3VS3A 4L3LA 2GHMA 3FWQA 3U55A 3LFCA 4HPUE 3QZIA 4EH2A 2IW9A 4ZTQA 3JR1A 3UOJA 4HCVA 1VR2A 4GVAA 4E6DA 2G01A 3I6UA 5A4TA 3G51A 5JKGA 1W0XC 3ZONA 3FEGA 4XEYA 2OXXA 4YZMA 2J5FA 2PZRA 2R3KA 3POOA 3R7GA 3RPSA 5CU0A 2F2UA 4E4XA 5CQUA 4EHZA 5FDPA 4D5KA 3A2CA 5HLWA 3KXHA 4O0YA 4LMUA 2G2FA 2Z2WA 3IOKA 4X2NA 3R7IA 2JDVA 3R8ZA 4EYJA 3MB6A 4EBVA 4MBLA 3N4VA 4CYIA 1SNUA 1NXKA 5J9YA 4YLJA 2ONLC 3KFAA 4NTTA 4AG8A 3SV0A 1OIYA 4G9CA 4DFZE 1YDRE 3BRBA 4FTKA 3VHKA 4O1PA 4UXLA 4MXXA 2UZEA 3AG9A 4QMYA 3FY2A 1J7IA 3BI6A 4G3GA 5T68A 1ZYLA 5J9LA 1Q4LA 2QHNA 4XV2A 2Y4IC 1RQQA 3UQGA 4DE4A 4CMUA 5CXZA 1GIJA 5LOHA 3A7JA 2JGZA 2FUMA 5AEPA 5K0XA 3C50A 4S34A 3R83A 5FXQA 3LQ8A 4BCHA 4D2PA 4EONA 3LQ3A 4AS0A 5E90A 4NJDA 3GC9A 4HZRA 3AT4A 1H1QA 3ZH8A 3PVUA 3NNWA 5LMAA 4C3RA 3F2AA 4YTCA 2R3RA 3HRCA 4TWPA 5HKMA 2WMVA 3VO3A 2VZ6A 3DK7A 3FV8A 4AOJA 4C37A 4U40A 1H1WA 1OL7A 2VNWA 2OXYA 4FGBA 4E6AA 5BVDA 3LPBA 5HLPA 1GY3A 3EQRA 3TEIA 2YIYA 4OTHA 4ZSAA 2QO7A 2W5AA 2B54A 3HP5A 1G8SA 4YHTA 4MNEB 5EDRA 3TIZA 3DXPA 4U43A 4RZVA 1H27A 5HQ0A 5EG3A 1HOWA 2PL0A 2OICA 3LJ2A 4WNKA 3A61A 2XYUA 3G33A 3QCYA 4AZFA 4EKKA 4RSSA 3PDTA 2V22A 3F3WA 4G16A 2OIDA 4H1MA 2EB3A 3PRIA 2BPMA 3DT1A 4R5SA 4R5YA 4UX9A 1PJKA 2VTJA 2C1BA 3QWKA 4IAIA 4RQKA 4QMUA 2QOLA 3ZUVA 4PL3A 2GHLA 5G6VA 2JD5A 3KF7A 4I22A 3H9OA 5G1XA 5GJFA 4QP1A 1YWRA 4F0IA 3QLFA 4OAVB 3MESA 3VUDA 2XEYA 3UTOA 3EYGA 4CKRA 3FI2A 5IUGA 2BAQA 4QP3A 3GOKA 4M8TA 2ZAZA 3IONA 4A9YA 3P86A 4UMUA 5HU3A 4PPCA 2QHMA 2WHBA 2ETMA 4YHJA 5I4NA 5GJDA 4GH2A 5IG1A 3TV7A 2WPAA 3UNZA 3NVKI 4AE6A 5AV3A 2BMCA 5K0KA 4LV8A 1QPJA 4O21A 1PRYA 1YI3A 5CY3A 3C0IA 1BMKA 1Q8TA 2Z7SA 4FTTA 1GZNA 4ACHA 3NIEA 3U51A 3QTWA 2IZUA 3FQEA 3B8QA 4PV0A 1YHWA 5IA2A 5AV0A 4FVQA 4QMXA 1WVYA 3MJ2A 3O0GA 3AC8A 3FLZA 3F61A 4L53A 4C59A 4YZNA 3GQLA 5J79A 4XG2A 5KHXA 4QMLA 3ZFMA 1XQZA 4Q9SA 3UNJA 4X6QC 2YDIA 2JIVA 5IEXA 1BUHA 3BU5A 3BX5A 4F08A 5JZJA 3R00A 1XKKA 2YDJA 1R39A 2FSLX 1IEPA 3FYJX 1DI9A 3C4FA 4N6YA 4JQEA 3FSKA 4JX7A 2XK6A 1LPUA 3CTJA 3RNYA 3VVHA 5KMJA 2C30A 3I7CA 4AW2A 1PY5A 5C4LA 2XIZA 3JS2A 4WUNA 3QD0A 5D41A 4BCJA 3SVVA 4AW0A 4DF3A 5FTGA 2FB8A 5LQFA 5IA5A 1YQJA 2X8DA 2XNNA 2RL5A 4W4VA 3CIKA 3MPMA 5L6PA 3CQWA 4GUEA 4RQVA 4CT2A 5ICPA 3LXPA 3UVRA 3K2LA 4NW6A 5M4IA 3P4KA 4S30A 4ZTHA 5H3QA 5CVFA 3V8WA 3FUPA 4D1SA 5JT2A 1JBPE 2NO3A 2BRNA 3DLSA 4FTOA 2QU6A 4G1WA 1ZWSA 4NEUA 4ZLYA 2RFSA 3VN9A 3KRJA 3LHJA 3P9JA 2C6TA 3FI4A 5DBXA 1YDSE 5CTPA 4FSWA 1Y8GA 1PKGA 4E5AX 5A6OA 1ND4A 4GK2A 1KV1A 1KE5A 4FT5A 2B9FA 2WO6A 3UMXA 4AW1A 4FNWA 3F2RA 2YIWA 4FV2A 3BU3A 4HJOA 4RC3A 5AJQA 4QNYA 2BDWA 3SA0A 3NW6A 3NDMA 3OG7A 4Y5HA 5EOBA 2YIQA 2YEXA 1Q3DA 2X0GA 3QL8A 1M2RA 5EK7A 1OIRA 4MVFA 5GIOE 3DV3A 4PWNA 2P55A 4M66A 4OTIA 3DK3A 4DGMA 3TDVA 4FKLA 4O0SA 4W4WA 4PQNA 5FXSA 3RALA 4DBNA 5M57A 5L2SA 3LW0A 3KGAA 4O7YA 5HE0A 5BVNA 3II5A 5F20A 2W4OA 5KO1A 1A06A 5AIKA 1UV5A 4PL4A 3VJNA 1VJYA 2XK3A 2G2HA 3AD5A 2YZLA 5TE0A 3NAXA 5CVGA 4Q9ZA 1PW2A 5CASA 4MH7A 4YNOA 2O3PA 3W8QA 2IZTA 2HW7A 3D2IA 4K9YA 1E9HA 4FK3A 2W99B 5AV2A 2Y8OA 4D4RA 5J7HA 4RC4A 4YPDA 3F3ZA 3BGQA 4AGDA 4O96A 3DKGA 3AGMA 1CKIA 4MD8E 4M67A 4OTGA 5KMOA 3LFDA 1ZY5A 4K77A 4FIJA 4KAOA 4QMVA 4BF2A 2NNWB 1OPLA 4JG6A 3BGZA 4QP8A 3AMBA 3TV4A 2CKPA 1M17A 5JQ8A 3MVJA 2VTQA 4PTCA 5IKWA 5E4HA 2J0IA 3LQ5A 3KA0A 4DLIA 1YXTA 2PMLX 4MWIA 4G9RA 4CG9A 3CP9A 3O8TA 4BZOA 3QFVA 4FVPA 5HU9A 3F5PA 5EYKA 3VUIA 2WEVA 4TTHB 3HV7A 5M51A 3FY0A 2QKWB 4HYSA 4MXYA 3VS4A 1QPCA 3OY3A 3PY0A 3BBTB 3UG2A 3QC9A 3SXSA 5DFPA 3ZFXA 4FE2A 4IB3A 1YXUA 4L44A 5HIBA 3RAHA 5M4UA 4YO6A 3BYSA 5L8JA 3GU8A 3AXWA 4HCTA 5J5SA 3JVRA 4CZUA 3VQUA 3TKIA 4KSPA 2C68A 3FBVA 5ANEA 4IZAA 4FG7A 4FZDB 2R3PA 4B8MA 1QMZA 4ZTNA 1SM2A 4G3EA 4NUSA 3A62A 2J7TA 1IA8A 4F6UA 4QQ5A 3RNIA 2UVXA 5L2WA 1P14A 4ZY5A 2Q0BA 2W1GA 5BPYA 1NVQA 4BDHA 3BPRA 3CKXA 3GU6A 3JVSA 1PYEA 4Q5HA 5E1SA 5CF8A 3CPCA 4IFCA 4DFYA 1KOBA 2Y4IB 4KIPA 1OPJA 2X39A 2EXCX 5FRIA 4BBEA 5KX8A 5EYDA 3KXZA 5A4QA 2VAGA 2XBJA 3VRYA 5DR9A 3KXNA 2Y4PA 2R3FA 2OWBA 3EKKA 1XH4A 2XZSA 3NCZA 4NZWB 3RKBA 3GGFA 3OMVA 3QC4A 3EL8A 4YJNA 3MH0A 1XH7A 5I9UA 4B99A 3ROCA 1RW8A 3BYOA 3UOLA 4J98A 1KE9A 3A7HA 4EC9A 3Q32A 1OIQA 4EK6A 5HE1A 3VUGA 4ZSGA 3MN3A 4F0GA 5J9ZA 5AUYA 4QTAA 4JI9A 4NIFB 5BVOA 2P0CA 4XJ0A 4OW8A 3FDNA 4U80A 1OKZA 3THBA 2PUUA 1NT2A 3SGCA 2GPHA 3OFMA 1Y91A 3VWAA 3IDBA 4IDTA 1UNLA 3FLYA 2B4SB 4TPTA 4O22A 1F0QA 2X8EA 4LGGA 1PYXA 4XNEA 3CBLA 3ZUTA 2A0CX 4YNEA 3E7VA 5HCXA 5D11A 1G8AA 4BICA 1YXVA 2ZV2A 5KKRC 3DU8A 2QOOA 3LFNA 4IAZA 2XYNA 4ASDA 2C6OA 2XKFA 3B2WA 4BCPA 3CPBA 2HY0A 4L7SA 5E8UA 3EKNA 4GT3A 5EHOA 3K3JA 3PRFA 4BVUA 2H9VA 3QRJA 3EWHA 3SXFA 2PY3A 5DE2A 3KL8A 5JRQA 1UWHA 4GJ3A 4FSUA 3BKBA 2PVJA 2F7ZE 3Q5IA 2GQGA 4TN6A 2CCHA 5AUWA 2W4KA 4BHNA 1JKKA 3GOPA 3FHRA 3DB6A 4J97A 3IGOA 4B0GA 2JBOA 4FK6A 2W1HA 5EM8A 4Z7GA 5ACBC 3ZC6A 1M7QA 4IX3A 5B2LA 4LRKA 4IAKA 4UYAA 1OECA 3ORPA 3VHEA 4JQ8A 5HLNA 5HBJA 3NEWA 3E8CA 4D2WA 3MWUA 4G6NA 3RPYA 5DRDA 4APCA 2VTSA 1OGUA 3ZXTA 1JSVA 1P5EA 4EC8A 5AUTA 2QONA 3BE9A 4DH1A 4PMMA 4G5PA 3E64A 3ATTA 4JS8A 5E8ZA 2C5NA 4CLIA 3KMUA 3Q2MA 2FGIA 5E1EA 5EM6A 1M14A 2XK7A 4H1JA 4UWCA 1XH8A 3MY5A 5AR5A 3QUEA 5CF4A 4I0RA 4HYHA 4RFMA 1S9JA 3W33A 4EI4A 3KU2A 4HVGA 3FZRA 3N4UA 3HMIA 1WFCA 3MPTA 4RMZA 3TKUA 2YCSA 5DYJA 3DBFA 1XO2B 4RA4A 5LVPA 4L01A 3D5VA 2IW8A 3RMFA 3S3IA 5C8NA 3UIMA 5L2QA 2P2IA 4AUAA 5B0XA 3NNVA 4PDPA 3UYSA 1WBVA 1MRUA 5A6NA 1J1BA 2NPQA 2YA9A 5DVRA 4TL0A 4GFOA 4XHKB 2QO2A 5F94A 5J95A 2WQMA 1OL6A 2X9FA 2BVAA 5DNRA 3KN5A 2PWLA 2W4JA 3NYXA 1ZMUA 4FT3A 1EH4A 3WILA 2ETKA 3LXLA 3E8NA 4CRLA 5C9CA 4OBPA 2FSMX 3Q53A 3TZMA 3MI9A 4ZSLA 3QU0A 1UU7A 4I1ZA 1Z57A 3ZLWA 4BIDA 2Z7RA 5HG9A 2W05A 3QTUA 4BDAA 4BHZA 2YHVA 5FTQA 1UU9A 1H26A 3QHWA 3QRTA 4Y95A 4EH7A 3QTRA 4FODA 3C1XA 4CFMA 4NH1A 4UYNA 4HNFA 4YO4A 4LOQA 4RIYA 4K2RA 1K2PA 2C5YA 4RIWA 2XK4A 2OU7A 3TZ8A 1LEWA 2PYWA 2DYLA 4XG9A 3VBYA 3ZSIA 4S2ZA 1QPEA 3ZLSA 1MQBA 4C62A 2V55A 3W2RA 2ITVA 3P78A 3KRXA 5AM6A 2G2IA 2R3QA 4XG8A 3F9NA 3V04A 2RG6A 4C61A 3FMEA 3ODYX 2ZM1A 3G90X 5KE0A 5CEQA 3NGAA 3TUDA 2OGVA 1M52A 1Q8UA 4M3QA 3EQHA 2OJ9A 1OKYA 3OXTA 2YDKA 4WG4A 4DEIA 4EH9A 4MX9A 2BRHA 4DGGA 4ID7A 5BMMA 4IWQA 5HE2A 1DAYA 1NVRA 3FHIA 3HV6A 3VW8A 2YABA 4EUTA 1M2PA 5JSMA 3OOGA 5L2TA 3FLQA 3HP2A 2ITTA 2JFMA 5CAUA 2A4LA 1Q62A 4S33A 4YHFA 1P2AA 3L9LA 3NUSA 3NRMA 4RJ7A 4AZVA 2OFVA 2PE0A 4UALA 3D0EA 3DJ5A 4FL1A 4BCIA 3CY2A 2RIOA 4IANA 5BUJA 4L52A 2BZIB 3FQSA 3H0YA 3ZO3A 4ANQA 5TOZA 1KSWA 3V5JA 4IAFA 2QNJA 5AIRA 3ELJA 3Q5ZA 4EH3A 4AOTA 3V5QA 2J0KA 4H3BA 4MQ2A 3C0GA 3KQ7A 2W1CA 3DLZA 3UO4A 3KXGA 5KMLA 4O0TA 3W18A 2XEZA 4CYJA 2ZM3A 4B8LA 3RAKA 2QC6A 3ROYA 5I0BA 3KN6A 4BN1A 1MRVA 4IDVA 4NCTA 4G5JA 2ZV8A 3ZSHA 3OHTA 4FV9A 3HDMA 3FC2A 4WRSA 3BYMA 3RI1A 3DXNA 1PMNA 4D4YA 3U4WA 4KIKA 5BYZA 3RPVA 3F5GA 4DG2E 4FEUA 1ZOEA 3HMNA 4I92A 3VBXA 3HZTA 4D5HA 2CN8A 2WQEA 3O96A 3IW4A 4I5MA 4K6ZA 4ZJJA 4B7TA 4K1BA 4BCFA 3L8SA 4BKZA 4F1OA 5HVJA 2GFSA 4RLLA 4WT6A 5JFXA 3R6XA 4ACMA 5AAEA 4FR4A 4U3YA 4JOAA 5CEPA 3LM0A 5CAPA 3TKHA 4YZBA 3E62A 4DEGA 2VWYA 1Q99A 2E2BA 4KBAA 4E20A 5AA9A 4QMSA 1GJOA 4FG8A 3C9WA 3EN6A 4D2RA 3SKCA 5LJJA 1J1CA 1U54B 4X3FA 4JXFA 3G6GA 1H24A 2JDSA 4C33A 3MPAA 4AT3A 4H58A 4PMSA 5EW9A 1YVJA 3A4OX 4LRMA 2OK1A 2UVYA 3CY3A 5AP0A 5HG7A 2W17A 2WMQA 3UIUA 5K3YA 4EZ7A 3R9DA 4FIEA 3QZGA 4XG6A 4BDCA 4JG7A 4IFGA 4NWMA 2DUVA 1YI6A 2C3JA 1Q41A 1GNGA 3OT3A 3DGKA 3WARA 3ID6C 4BR3A 3BEGA 3C5UA 2OIBA 4PRJA 3FSFA 4EH6A 1REKA 1ZMWA 3CE3A 2VWWA 2YWPA 2H8HA 5T6KA 3ETAA 5F95A 4EHGA 1NY3A 3PJCA 4W4YA 4Y8DA 4CRSA 5EDQA 4RIYB 3AD6A 3I4BA 4E1ZA 2YN8A 2VD5A 5IZFA 3L8PA 2YZAA 3QQKA 4PTGA 2XKEA 2OJJA 4P90A 2ZV7A 3LVPA 4Y85A 4ZAUA 5JK3A 2BTRA 2J0JA 4UB7A 3LJ1A 5GZ9A 3CGFA 3JY9A 4AXAA 4F1TA 3UG1A 3E3PA 3BELA 2X2MA 3A8WA 3E8EA 5FBOA 1B6CB 3W55A 2XBAA 2BHEA 4FA2A 3OCSA 4FOBA 4MD9E 4F9CA 5KKRB 4ACGA 3TNIA 3UQFA 3DTWA 4RVLA 4E8AA 4H3QA 3BGPA 3D5XA 3KVXA 2QOKA 4GMYA 3JYAA 4RG0A 2WMXA 3VAPA 3BYUA 1GAGA 3DQWA 2NRYA 5EHLA 4C4HA 4D9TA 4FEWA 2JDTA 2REIA 1YW2A 3GFEA 5IUIA 4O0VA 4ASXA 3S1HA 4GCJA 4EZ3A 1WBWA 3WYXA 4IZ5A 4J53A 3EN7A 1LUFA 4L45A 3KEXA 3R21A 4QP4A 3R8VA 2UZLA 4E93A 4DH7A 2X81A 4XLIA 2C4GA 3BLHA 4DEDA 2X4ZA 4ERKA 4NYEA 3QZHA 2X6DA 2YM5A 4W8DA 5E8YA 4C0TA 3N51A 1ZZ2A 2WTCA 4O6LA 2Y7JA 5I9VA 1PXMA 5EI6A 3SG8A 2C3LA 3FMLA 3VBWA 5M08A 5DI1A 4N0SA 4W8EA 4BCOA 5HESA 4FTLA 4Z16A 2X6EA 4IB0A 3NYVA 2XNPA 5IQBA 2OKRA 2QCSA 5EI8A 3LKMA 1UKIA 3O8PA 3PE1A 1F3MC 2OZAA 2PVKA 3Q9YA 3QTQA 2F7EE 3PWYA 1ZAOA 4IMYA 4ZS0A 4CTBA 3QRKA 2KULA 3QGWA 4FL3A 4F9BA 5AFVA 4I5CA 3ORIA 3O17A 3LZBA 4ZZOA 5IQEA 2B9IA 2HELA 5ANKA 3C51A 3OCBA 3SOCA 3AC2A 3N4TA 4PDYA 1OUKA 4APPA 3NMUF 2WOUA 4KIKB 3ULZA 5KBQA 4DITA 3WE4A 2VU3A 3BQCA 2IG7A 4FEXA 4QT1A 4A4LA 4TKSA 2QLQA 5AP4A 5CNNA 2HXQA 4F70A 3W2PA 3SX9A 2OIQA 3R7UA 4CG8A 4C4GA 4E3CA 5KMMA 1PXOA 4UXQA 1MUOA 2I6LA 2YIRA 5HCYA 3NUYA 2ITUA 5CX9A 5H2UA 4DBXA 3ACKA 1DI8A 3ZM4A 4D0XA 4IWPA 1FVRA 2W06A 2IPXA 1B39A 5HICA 2E9PA 3OY1A 4U44A 4MXCA 3VF8A 1SVEA 4O27B 4MYGA 2HZ4A 3NUNA 1VYWA 4YJPA 4EOKA 3CGOA 3O51A 3RAWA 1XBBA 4U7ZA 2WMWA 3COIA 4ZZMA 1ERKA 3EYHA 4M69A 4C58A 4BI1A 4Z55A 2B0QA 3V51A 4TNBA 4L6QA 3O8UA 4G6OA 2CGVA 3V8SA 2QD9A 3OUNB 1H0VA 4EOPA 3R1SA 1KWPA 1UNHA 5ETFA 4XP2A 2CNQA 4A9UA 3D15A 4XRJA 2PUIA 3PJ3A 4PMPA 3ZZEA 4RX7A 5KCVA 1AGWA 1YWVA 2J50A 3GBZA 2YLEA 3FXXA 3QQUA 4JR3A 5CU3A 4DGNA 2XJ0A 3C4ZA 3NS9A 4DEEA 4I4EA 5HIEA 3HAMA 2ERZE 4FUXA 5HNIX 3MY1A 1UU3A 2XB7A 4AT5A 4F7JA 4AGWA 4NM3A 1XBAA 4FZAB 2WMSA 4F7NA 1BI7A 3PXQA 4MKCA 4M12A 2GMXA 3RBWA 3G5DA 4BTFA 2J0MB 5DIAA 1CTPE 2ITOA 4L9IA 4ANOA 4FV7A 4DEHA 2C0TA 3RK7A 3PYYA 5IDNA 3DDPA 4X2GA 3TIYA 2Y9QA 3G15A 2HXLA 4GT5A 3O71A 3JPVA 1OB3A 2XJ1A 5LMBA 2OW3A 2SRCA 1DS5A 3FL5A 3GU5A 3L1SA 2CHLA 3GC0A 4I6QA 4TWOA 2BUJA 5CS6A 1G5SA 3FC1X 3R7OA 4OR5A 1H08A 3SOAA 3D5WA 2IO6A 1YRPA 4FKVA 2VTHA 3U9CA 3EQIA 4QMZA 3TNHA 4D1ZA 1GZ8A 5LVLA 4XH6A 1YKRA 1I09A 3U6HA 5AR8A 4YZCA 2VTMA 4CGAA 4D55A 4FIIA 2Z02A 2PK9A 3PA4A 1FBNA 2WXVA 2V62A 2A1AB 3HA6A 5E8TA 4EJ7A 3OZ6A 2JEDA 4XG3A 3MIAA 4C4FA 3ZDUA 3L8VA 4PP7A 2PZPA 3QLGA 3ZRLA 1CKJA 3EIDA 1ZZLA 4JQ7A 4RLKA 4HGLA 3F3TA 2OLCA 3C5IA 4R3CA 3PA3A 1IA9A 5FP5A 3UO5A 3FXWA 3O7LB 4QP9A 2ITYA 2QVSE 3U54A 2OXDA 4XRLA 1Y6BA 4ENXA 3GI3A 3P7BA 3BEAA 3PLSA 3QQHA 5CSVA 2H96A 2YM4A 3HDNA 3OWJA 2JC6A 3F2NA 3DAKA 2P2HA 5JFWA 5LVNA 3FI8A 1OZ1A 5TO8A 4H3PA 4JIAA 3EQFA 3ZFYA 4CFNA 2R3JA 3SAYA 1ZLTA 4EOJA 3JXWA 4WBOA 4MXZA 3QQJA 4RVTA 2W5HA 4HGTA 5CAOA 4F7SA 2ZYBA 3HX4A 4X0MA 2VTLA 1TKIA 2R5TA 3PTGA 3R73A 3BLRA 4HW7A 4QTEA 4AZEA 2CCIA 5K5NA 3BQRA 2G15A 2QR7A 3QBNA 4CNHA 4OT6A 5AAFA 2ZDUA 5JH6A 5LXMA 2VTRA 4GG7A 4AN2A 5IA4A 3NAYA 4S32A 4M69B 2CJMA 3FXZA 3SRVA 4IWDA 4DCAA 4EOSA 4AFJA 3UODA 4QPSA 4PPBA 5DHJA 4U41A 3UVQA 4FTRA 5KBRA 5E8WA 4QPAA 1K3AA 5FWKK 4PDOA 4GFGA 4ARKA 3V3VA 2AUHA 4I5PA 3NPCA 5J1WA 3QZFA 4L43A 4EQUA 2WIHA 3LFAA 3DOGA 4E26A 1JKSA 2PMIA 4ZY4A 3AGLA 2HY81 3VULA 3VS7A 4O83A 4JAIA 3T9TA 5LWNA 2VWZA 4NM0A 3KCKA 2ZOQA 5B7VA 5I9WA 4OAUC 5L4QA 4BTMA 2O65A 2HAKA 5I5ZA 3JUHA 1J3HA 4EYMA 4OUCA 2PVNA 4N6ZA 3NZ0A 4EQMA 4OTQA 2DWBA 3IO7A 4EOLA 4O7LA 1SMHA 3V5LA 2IVUA 1QCFA 4JDHA 2J51A 5EKNA 4YU2A 4I41A 3ITZA 4F6WA 3R9HA 4YC8A 1E1XA 2F49A 4CKJA 3DXQA 2FSTX 3PIXA 4F7LA 4DA5A 4F0FA 3AC4A 2UW7A 3LCKA 4JRVA 2VRXA 4R3PA 2OH0E 4O0RA 4JBOA 3PPKA 4MF1A 3HGKA 4PF4A 4FC0A 2VO7A 3UP7A 1OITA 1ZMVA 2GNHA 2OH4A 5L8LA 4WHZA 3HV3A 4QMMA 5T3QA 3R9NA 4WBBB 5CT0A 1KE6A 2GU8A 4DEAA 4UMTA 4P4CA 1WVXA 2WTVA 2O5KA 1XH5A 4HCUA 5IISA 5IU2A 1MRYA 3GU7A 5E92A 5EW3A 4FMQA 4UY9A 4ZLOA 4KD1A 5CSWA 3QQFA 4BDFA 4CKIA 3RVGA 4HPTE 2ZMDA 3A4PA 4KKEA 4XBUA 3TXOA 2HIWA 2OZOA 2I0EA 1L3RE 1ZYSA 1R0EA 3BHHA 3QRUA 3ZBXA 5M44A 4J52A 2BDJA 3EHAA 4RJ8A 4EL9A 3LLTA 2HCKA 3DKOA 4J8NA 4QTBA 4KUJA 2W1EA 4L68A 2JKKA 3PFQA 2WMAA 3DAJA 2Y0AA 3ORNA 4XV9A 1P4OA 3OS3A 2J6MA 1IASA 3IKAA 4RC2A 5DEWA 3ZYAA 4CFFA 4LMNA 3TL8A 3D7TA 1R3CA 2CKEA 2UW8A 3QYWA 3V5WA 3F7ZA 4DFBA 3CJGA 3MA6A 4BKJA 3COHA 4CCUA 3I60A 4O82A 4EOIA 4R7IA 4DG3E 2CPKE 4FF8A 4FVRA 2WZJA 4ZMFA 2Y6OA 3ZEPA 2XCHA 4CV8A 1IR3A 2CKQA 4FZ7A 3R9OA 3UIXA 1CSNA 5ANDA 4A06A 4DFNA 3PXRA 2PVLA 2XNMA 4BDDA 4AGUA 3NNUA 4YZ9A 3P7CA 4X2KA 4DG0E 3AC3A 3QUDA 2XIRA 5FQDC 4H36A 4WIHA 2BZKB 2HZIA 3H9FA 4CZTA 4YTIA 2XCKA 1WBOA 3R63A 4R8QA 3SRVB 2VN9A 3OF0A 3ORLA 1OL5A 2FSOX 4Y5QA 3N9XA 5FM3A 2PVMA 3DFAA 3EH9A 3NIZA 3CCNA 4AFEA 1PKDA 4QYFA 2VWVA 4FNZA 2GTMA 2VGOA 4IQ6A 4JL9A 4PPAA 2C6IA 3EFKA 4QP2A 4EWHA 5C8KA 3LMIA 3P7AA 3DBDA 4TRLA 2JKOA 2WB8A 5JGBA 4IJPA 3IOPA 3HKOA 4F1MA 3U6IA 2W7XA 1H1RA 2A27A 3PXKA 4ZK5A 3VNTA 3FMMA 3VJOA 4C2VA 4PNIA 4Q5EA 4ZTMA 1OM1A 4IJ9A 1W98A 4GG5A 4QMQA 4J95A 4XCUA 2ACXA 4MF0A 3TN8A 3MBLA 2R3LA 4BDKA 4E4MA 3SW7A 4PY1A 4ZIMA 5DWRA 3F5XA 4AOIA 3CXWA 4IHPA 2EWAA 3FL4A 3PJ2A 4RIXA 3ZMMA 3Q3BA 2GHGA 2PU8A 1JNKA 1RJBA 2C6MA 4R3RA 2F9GA 3JY0A 5J8IA 1BI8A 3WF5A 2C6DA 2C0OA 1ZRZA 4G3FA 2KTYA 3HLLA 1LEZA 3GCUA 2OBJA 1BL6A 3BHUA 4NM5A 3REPA 1IAJA 4BY9E 3D94A 4MXOA 4KS8A 5AUVA 3NYNA 4FSNA 4FSQA 3P23A 4U45A 5H8BA 2XIKA 4CEGA 1PMEA 4OT5A 5HNBA 3D83A 1E1VA 5AP6A 3D4QA 2OSCA 1Z9XA 4LG4A 5FDXA 2GFCA 4CT1A 4XG7A 2W96B 1WBSA 4FKWA 3LMHA 3D14A 4CQEA 4FYNA 1MQ4A 3ZUUA 1T45A 5HZNA 1GIIA 4BGQA 1WZYA 2UZNA 2Y6MA 2ZDTA 3HUBA 3G0FA 3QXOA 3TZ7A 2WU7A 3LE6A 4K18A 2XUUA 3G0EA 3RZBA 4RVKA 1R0PA 3RWPA 1M7NA 1IG1A 2UZOA 3FPQA 4GS6A 3UPXA 4ZZNA 1NVSA 3B8RA 5FM2A 5K4IA 2UZUE 2VTOA 3GU4A 1YWNA 4QQJA 5CENA 5AA8A 2AC3A 4GUBA 3RM7A 3QQLA 4RWJA 4O0WA 2YM8A 2WIPA 4FV3A 5A14A 5HOAA 2I1MA 5CEIA 3HAVA 4IM3A 5LCKA 4E7WA 1R78A 5CT7A 1A9UA 1JAMA 4Y46A 2FVDA 3Q4UA 2XK9A 3D7TB 3T9IA 4O7RA 4QMWA 3NW5A 3CC6A 4FKUA 5CI7A 3T3VA 5HO6A 3DDQA 2YIXA 4MHAA 3AT3A 5M56A 2CGXA 4BCQA 4WO5A 2R4BA 5L6WL 2JBPA 2LGCA 3GC8A 4FG9A 3R30A 3H4JA 3R22A 3OWLA 3UZPA 5TR6A 4NCTC 4KB8A 3RWQA 3ZCLA 5AP3A 3UP2A 2WU6A 3KVWA 4L46A 3MFTA 3GXLA 4ACDA 5DOSA 4DTKA 4EK5A 2W1ZA 1DM2A 1YHSA 3Q60A 1V1KA 3M11A 4B9DA 1PXLA 2QG7A 1UKHA 3LFBA 1PXNA 5DEYA 3W2CA 4F9YA 2PZ5A 3MSSA 4WD5A 3GC7A 5J7BA 2BIKB 3GENA 4U79A 1O6LA 4X6RA 1OKVA 3AC1A 3LFFA 2VNYA 4I0TA 2W5BA 2GNIA 4LOPA 2BAKA 2G9XA 4GIHA 2YJSA 4K33A 4YBJA 4CXAA 3FLNC 3GT8A 2V7AA 4FZFB 1TQMA 2YISA 4ACCA 2CSNA 3DJ7A 4I6BA 4N4SA 4M0YA 2GQSA 4AZTA 2CGUA 2F4JA 1JPAA 4YJUA 3ZEWA 2P3GX 2W9ZB 3HEGA 4X3FC 3RAIA 4QQTA 3BZ3A 3ZC5A 2JKQA 2QO9A 2VGPA 5A4LA 4BL1A 1FMOE 1XWSA 2E9VA 3Q6WA 4Y73A 4BIBA 2GCDA 4YC6A 3IECA 3P08A 4NU1A 5HD7A 4BC6A 1OBDA 3QKMA 3L9PA 4FSYA 4RIXB 2CNUA 4GJ2A 2UZWE 4R6VA 3IW5A 2VX1A 3HYHA 4YUQA 3PLAE 3S4QA 4CFXA 3BIZA 4NK9A 5E8VA 5IH5A 3ODZX 4DN5A 3UVPA 4FGRA 3EFLA 1U46A 5DR2A 3LMGA 1J7UA 4RX5A 2J4ZA 3IDPA 2EXMA 2RFEA 3E7OA 3DJ6A 2JDRA 4YLLA 5IQGA 5IQHA 5FGKA 5KZ0A 3FKNA 4PUZA 5F9EA 5ACKA 3LCSA 4FTJA 5ETIA 5IQCA 5CLPA 3C4WA 3EQDA 1Q61A 3HUCA 1J7LA 2UZVA 4MXAA 4HNIA 3L9NA 4MWHA 5CYIA 5AP5A 3WF8A 1JSTA 3ZTXA 4BWKA 4F65A 4II5A 4GU9A 4LUEA 1PMUA 3FMJA 4DTAA 4BB4A 2IJMA 2FYSA 4IC8A 3Q6UA 1F5QA 1H01A 4FOCA 2UW6A 4O6EA 4IVAA 5CF6A 5FUTA 3OTUA 3U87A 5BUEA 3BCEA 5CEOA 4IACA 5IF1A 4NL0A 5BVFA 5HTBA 4XP0A 2QLUA 4IZYA 4F99A 5BVKA 4O84A 4NM7A 4TYGA 3ZU7A 2X8IA 4Z9LA 5EI2A 5HIDA 4F64A 4L7FA 3B2TA 2B52A 5F4NA 5JN2A 1Q8ZA 4V0GA 2W1IA 4O7VA 3AMYA 3G2FA 2G1TA 4YTFA 4G3DA 4JBQA 3I0QA 2EXEA 5AR3A 5IMXA 5IQIA 4DINA 4JNWA 5HO8A 1M2QA 4RFZA 3HRFA 5AV1A 4TY1A 2JITA 4FTNA 4P5ZA 3SC1A 5CANA 3FZOA 4DT9A 3CD8A 4IVBA 5CU6A 3VBQA 2O0UA 1ZY4A 3BU6A 1BL7A 3V6SA 3KXMA 4MBIA 4IM2A 2O2UA 2WQOA 2R3MA 3HECA 4I24A 2VWBA 5DT0A 3UZTA 3UPZA 1JOWB 4WG5A 3EJ1A 5AV4A 4D0WA 3T3UA 4RPVA 4BBFA 4RT7A 3PSDA 1KUTA 2PMOX 3ZOSA 5M06A 4PX6A 5CU4A 5CSPA 4O0UA 3E3BX 5FEDA 2C1AA 4TNDA 5HEZA 3ZSGA 4BGGA 4QTDA 3RJCA 4FZ6A 1V0PA 4GYGA 3P79A 2V0DA 2QKRA 2JIUA 4CD0A 1UWJA 5JMSA 3PA5A 4FV1A 4I6FA 4MTAA 3AMAA 2XIXA 3UGCA 5J5TA 4WNMA 1OUYA 4BRXA 3IG7A 1W8CA 3DTCA 4YP8A 3VQHA 5BUIA 2PMNX 4ZTLA 3RPRA 5AUZA 1TVOA 4J8MA 3NNXA 4AF3A 2X2KA 2ITXA 2PVFA 2HWOA 3WYYA 3HNGA 5C01A 4BGHA 2EVAA 1FOTA 1CMKE 3KULA 3EL7A 1STCE 1TQPA 3O23A 5FLFA 3Q4TA 2OJIA 1PF8A 1WBNA 3DBQA 2HOGA 4ONAA 4QMNA 4HOKA 4M15A 3IQ7A 4NT4A 2ERKA 3F7WA 3MH3A 2RF9A 1JQHA 2X1NA 3OXIA 4GL9A 3QTZA 4RIWB 4MK0A 3DNEA 5D9HA 4G17A 4I21A 5JFSA 1WCCA 5CU2A 4K8AA 5DR6A 2WKMA 4R7HA 5C03A 4C02A 4GRBA 5AAGA 3L9MA 4NKAA 2RGPA 3QCQA 3CTHA 4JBVA 4YBKA 4ZTRA 2XKDA 2Q83A 4RGJA 2PE2A 4N57A 2PSQA 3UQCA 4YMJA 1PMVA 2FH9A 3PY3A 2XH5A 4KIQA 4O2PA 4C3FA 4C4IA 5LMKA 4G3CA 3BHTA 5AR7A 3HV4A 4IX4A 4X3JA 3MFRA 3HMOA 2H6DA 3QALE 1I44A 4LL0A 2GNFA 2H34A 2UW3A 5HG5A 5I3RA 4O7SA 4MD7E 5JQ5A 3TTIA 4YLKA 3VS0A 3QWJA 4JR7A 3DZQA 4ANMA 1LP4A 1JKTA 5BYYA 2BHHA 5JFVA 2ESMA 1ZOHA 3EFWA 4DYMA 4FV6A 3UMWA 1H1SA 3EQCA 2B9JA 4TYJA 3UDBA 5AUUA 5TKDA 3BWFA 3VRZA 2OJGA 3ET7A 5JZNA 4CTCA 4MCVA 4DFLA 1OKWA 2WGJA 5FEEA 3EN4A 3NWWA 2XMYA 4FICA 3F69A 5CNOA 4V0GB 2F2CB 4FKIA 2QODA 3GUBA 4UMQA 4EK4A 4KKGA 4XOYA 3BE2A 3NR9A 4HZSA 3RINA 5DT3A 4E4NA 5CAVA 1CDKA 2F7XE 4CLJA 4RFYA 2C5XA 5KUPA 1OL2A 4AA4A 1K9AA 2IWIA 3R1YA 2C6LA 5TT7A 2XS0A 3OT8A 5CZHA 2Z7LA 4L67A 5EQYA 3HV5A 4IVCA 3VUTA 4X21A 3TJDA 4YZDA 4I4FA 3QHRA 4ITIA 4AA5A 1JWHA 3ZLYA 3F5UA 4QYGA 3MFUA 4ZJIA 1GZOA 3AOXA 3CJFA 3E88A 4FTUA 4FV0A 4U5JA 3SW4A 2R3OA 5C8MA 2VTTA 3DBCA 3QA8A 1REJA 5ETAA 3PG3A 4D4VA 3QTIA 2IW6A 2ZJWA 3H10A 5EOLA 4BIEA 3EOCA 3OEZA 1BX6A 4W9WA 3WOWA 4EUUA 3ZLXA 1XHAA 3QF9A 4MBJA 5A3XA 1QL6A 4Q2AA 2UW9A 5D10A 1YHVA 4FEVA 4L8MA 4MAOA 2ETRA 4RJ4A 4U3ZA 5H9BA 5GNKA 4QTCA 4AWIA 5M09A 1Q97A 3PSCA 4R1VA 2QURA 4FV8A 3E5AA 2ITZA 4QMTA 1VEBA 5J87A 4JAJA 3TZ9A 1Q8WA 4GKIA 4UEUA 2O63A 2QOQA 3PXZA 3NVMB 5BX0A 3PPZA 4ITHA 2V7OA 1XH6A 3KRWA 3FZTA 5K4JA 4X3FB 4RZWA 3VW6A 5LVMA 4J96A 2BCJA 1Q24A 2X9EA 1WVWA 4RA5A 3WZDA 5FEQA 1H28A 4WSYA 4BKYA 4TZRA 3DA6A 4L00A 4F4PA 4JG8A 4BCNA 5HX8A 4G2FA 4FIFA 4ZS4A 3ENHA 4GEOA 4RJ6A 4AQCA 2UVZA 3VS2A 2YWVA 4FX3A 1APME 2I7QA 2XJ2A 2JLDA 3MTFA 4N70A 3MS9A 5HBEA 3FMNA 3DFCB 1KE8A 3EMGA 1PXIA 3G9LX 4KA3A 3Q4ZA 4JJRA 4DH5A 3ZO4A 4JDJA 4USDA 3WF7A 2UZBA 1GZKA 2OF2A 3OXZA 5AX9A 4GFMA 4LGDA 4Z7HA 2XK8A 5CQWA 2X7GA 4YJOA 4AAAA 2GS7A 4BZDA 4IWOA 1XR1A 4EKLA 4FTQA 4NFMA 5I9XA 3BV2A 3IGGA 5HI2A 3LFEA 4IIRA 2R64A 5L8KA 3Q96A 5IEVA 5BYLA 3VS6A 2VV9A 3RZFA 4H39A 4FKGA 4ANNA 5HX6A
chains in the Genus database with same CATH superfamily
5H8GA 4FT0A 3DZOA 2UZTA 3GVUA 3AT2A 4BDJA 2QOCA 5DG5A 4CMTA 4UWBA 3W2SA 4EWQA 4I6HA 4V04A 4O7WA 5I3OA 3ALOA 2F57A 2B7AA 2OG8A 2VWIA 5IUHA 3MIYA 5M4FA 3A60A 4FIGA 4KBCA 1H07A 3S00A 5J1VA 3SLSA 1SZMA 3MVLA 1FGKA 3FAAA 3NUAA 3O5AA 3MH2A 4V01A 4C4EA 4WG3A 4GKHA 3E63A 2QOIA 4OTWA 3RCDA 5F1ZA 4NTSA 1OIUA 3BLQA 2GQRA 4WUAA 1O6KA 3OWPA 4UZDA 5HCZA 3ZO2A 3ALNA 2WTWA 5DMZA 3S0OA 3WZKA 3ORZA 3ZO1A 4LYNA 4U81A 2RFNA 3E87A 4XBRA 5K5XA 1WBTA 3C13A 4OBOA 3FE3A 3A99A 3DKFA 4P5QA 5HNGA 4AGCA 1H0WA 1NA7A 3R0TA 5IDPA 4IM0A 2OZAB 4QQCA 4DGLC 4F09A 4UV0A 4UMPA 2CMWA 3KCFA 4BDEA 5IEYA 1GIHA 1SVHA 3EQGA 4O7ZA 4YC3A 4Y72A 3R01A 4JDIA 4LM5A 3PVGA 1U4DA 2CKOA 5M07A 3FZ1A 4M84A 2BILB 4FTMA 3UNKA 3F3VA 1YI4A 1H00A 2WNTA 3DNDA 4ZY6A 4YPSA 5AR4A 2QR8A 2BKKA 4KRDA 2XM9A 4DTBA 4I3ZA 3F82A 4RRVA 5IQDA 4NKSA 4LI5A 1O6YA 3TNQB 4AN9A 1UU8A 2ZVAA 4LGHA 2UW4A 4ZJVA 3KMMA 2XP2A 3GCPA 3OTVA 4YJQA 4EQCA 3LXNA 2VO3A 4BWPA 1JSUA 2R3HA 4BWXA 4ZSJA 3AQVA 4FKTA 4DFXE 4IX6A 4HVHA 3VF9A 2YCFA 3ZM9A 2C47A 1YOJA 4ZTSA 2UZDA 2VTAA 2W1DA 3A7GA 5CWZA 3TG1A 3WE8A 4EZ5A 5CALA 1ATPE 2JKMA 3PP1A 3HMMA 4FSMA 1NW1A 3EZVA 4AU8A 4AZSA 4C4JA 2X7OA 3GNIB 3Q04A 3R7EA 3FKOA 2WTKB 3OBGA 2XM8A 3PJ1A 4ZLZA 2I0HA 5CAQA 3R9RA 3CQEA 3RGFA 4FSRA 3GEQA 3ORXA 3WIGA 5EFQA 4UWYA 2CN5A 3FPMA 4NW5A 2DS1A 4C8BA 4R7BA 2BFYA 3ZBFA 4I93A 4FV4A 2R3GA 3FZPA 3RHKA 3C0HA 3LOKA 4YJTA 3HVCA 5EHYA 4J99A 2DQ7X 4NSTA 5HTIA 2WTIA 4TWCA 4YGAA 4FKPA 3WI6A 5A4CA 2ZV9A 3WF9A 2J9MA 4IAAA 3W16A 4FBXA 2ITWA 5IA0A 2VUWA 3PXYA 2I40A 2OFUA 4MQ1A 1V0BA 4BTKA 3ERKA 2YM3A 4NJ3A 4UMRA 5H8EA 1PXJA 3O7LD 2C6KA 2ONLA 3IS5A 3RM6A 4EEVA 3P5KA 5CSXA 5I9ZA 4I6LA 2GNGA 2JIIA 1A48A 2Z7QA 3TWJA 2HK5A 1VYZA 2YCQA 5M4CA 3ZZWA 4ERWA 4TYIA 5EDPA 2P33A 2WQBA 2C0IA 3EN9A 3R71A 5LWMA 3OROA 3V8TA 3GCVA 3DY7A 5DPVA 3U9NA 4A4OA 4DHFA 3C4EA 2GS6A 1ZYCA 5AWMA 5GJGA 2UV2A 2WQNA 3CQUA 2FA2A 4QYEA 3QKKA 1FMKA 4HGSA 2B53A 5DH3A 3ZDIA 4EOMA 2JFLA 5JGAA 3QCSA 4O91A 4PP9A 3QGYA 5CSHA 4L3PA 4KBKA 4AT4A 2B1PA 4JVGA 2XNBA 1P4FA 3OWKA 3I6WA 3I0OA 3EZRA 4QNAA 4G34A 3ORTA 3CSVA 4NIFA 2FO0A 3UYTA 4IB5A 3RTPA 3VUHA 4QPMA 4YJVA 4U0IA 2BRBA 5KZIA 3QAME 4S31A 5K9IA 3PIYA 3ANQA 1ZYJA 4QP6A 4UZHA 4BJJA 3PE2A 3O2MA 4IXPA 5E9EA 2C6EA 5E91A 2Z8CA 4FSZA 5BVWA 4JX3A 1XH9A 2ITQA 4FT9A 3QQGA 2B55A 1Y6AA 3LCOA 4EOQA 2BR1A 5IH4A 1OBGA 4XX9A 4WKQA 2AYPA 4R1YA 4FNXA 2GDOA 4O7NA 2A19B 3R7VA 4D58A 5FG8A 5AM7A 5E7RA 2PVRA 2PZYA 4PNKA 2BIYA 1OL1A 4HVIA 5IMEA 2VO0A 3UBDA 2E9OA 4KKHA 5CZIA 3AD4A 1SNXA 3KKVA 3OP5A 3Q9WA 4JT3A 5FD2A 2BTSA 3QCXA 5HO7A 3IK3A 2YITA 5HVKA 4O7TA 3CEKA 4D28A 4BCKA 5KHWA 4QYYA 5DA3A 3RCJA 2R9SA 2VWUA 4E73A 1FGIA 5BQ0A 2RKUA 1S9IA 3TYKA 1YOLA 1WAKA 4TT7A 3OC1A 3VUKA 2GS2A 2BFXA 2WD1A 3DS6A 4XP3A 2UW0A 2GNJA 2C5VA 3OUKA 3UE4A 4DH8A 4HYUA 3QD3A 4E5BA 4KSQA 3MTLA 1TZDA 5DN3A 3LFQA 3WIKA 1CM8A 5KMIA 1YOMA 5A4EA 3UO6A 4OTRA 4BI0A 3MB7A 4HVDA 3K54A 3CTQA 4RWLA 5E8XA 3TM0A 4YURA 2ZMCA 3NUXA 3I7BA 5AR2A 2EUFB 3SD0A 3RP9A 5ANOA 4XUFA 3NX8A 4E4LA 1HCLA 4AXFA 3BWJA 4EJNA 3TNWA 2GSFA 3FZSA 4XG4A 3MH1A 4BCMA 4JDKA 5HTCA 4Z3VA 4C3PA 1URWA 4PDSA 3D5UA 3COMA 5BNJA 4OTPA 1SVGA 4GK4A 1XJDA 5LCJA 3BYVA 4G31A 3I79A 2CDZA 5GZAA 5EM5A 4DFUA 1YDTE 2YJRA 4DEBA 4QMOA 3QTSA 5AP2A 3IDCA 1H1PA 1LR4A 4C36A 2IVVA 2QOFA 4KNBA 2OJFE 2WFYA 3FLWA 3W1FA 4A7CA 4AACA 2HENA 1CKPA 3E93A 3KRLA 2PVHA 3RPOA 3VUMA 1ZARA 4ITJA 4RX8A 3NCGA 1W7HA 3ANRA 3NUUA 5D7VA 3U8WA 4BZNA 4IW0A 4JRNA 3OW4A 4EOOA 2R0IA 3PZHA 2YAKA 4D1XA 4QD6A 5ETCA 2QG5A 4WNPA 4WOVA 5LVOA 3SG9A 2PHKA 2X2LA 3TV6A 3UC4A 3MFSA 5KMKA 2YACA 4RBLA 4E5WA 2IVTA 3QX2A 4C57A 5BMSA 2J2IB 4GVJA 2BROA 3FI3A 2GTNA 1TQIA 3P0MA 3TACA 2HWPA 3WBLA 3UC3A 2RG5A 5HE3A 4D9UA 5GIPE 3D2KA 4X7QA 5JRSA 4AX8A 3TNPC 5EQPA 5GHVA 4AN3A 3A7IA 4YR8A 5ANGA 3C7QA 5I9YA 3PSBA 3ZXZA 2X7FA 3DAEA 4YJSA 4BJJB 2J90A 3PJ8A 1BKXA 2XA4A 2B9HA 3M1SA 3CR0A 3DQXA 2CLXA 2HZ0A 4F9AA 3M2WA 5CEMA 2PVYA 2WTDA 3A7FA 4GT4A 2YCRA 4XS2A 3RHXA 1ZXEA 4QP7A 3R8LA 4DCEA 3DK6A 2XNGA 5L2IA 1H25A 2Z60A 3OBJA 2VX3A 4XV1A 5HHWA 3KRRA 1L8TA 4EH5A 1DAWA 3GCSA 4FI1A 3MDYA 3MVHA 4FIHA 4KS7A 1J91A 4J71A 2WTJA 4IZ7A 1T46A 4QO9A 1VZOA 3LCTA 5DT4A 5TF9A 1G8JA 4C7TA 2RSVA 4ALWA 3KY2A 5EH0A 1U5RA 3R8PA 4E6QA 5IPJA 5AP7A 4L42A 2PE1A 4BBMA 5L6OA 4AZWA 3MV5A 5IQAA 2WOTA 2WMBA 2Q0NA 5DRBA 3CD3A 3K3IA 4CQGA 1H4LA 4OGRA 1KV2A 4IE9A 1W2CA 3CS9A 1WMKA 4EK8A 1Y57A 4NFNA 4ALUA 1FINA 3QKLA 4FKJA 4IH8A 4Y83A 3TTJA 4FTIA 4GU6A 4YJRA 1Q3WA 4QYHA 3W10A 3MVMA 3MY0A 4YSJA 1Z5MA 1OPKA 4TYHA 4CFUA 3KREA 3W0MA 5IQFA 2V5QA 5KMNA 1RE8A 4I0SA 4RX9A 5HG8A 3R8MA 3ZRKA 4EHVA 3NLBA 5JEBA 5GZ8A 1SYKA 1IAHA 4DH3A 2IZRA 1G3NA 3SQQA 4ZP5A 4O38A 2XVDA 4EH4A 3C4XA 4BDBA 4CMOA 2JAVA 4FL2A 2VTPA 2CLQA 1PHKA 2NP8A 3EB0A 2C5OA 2ZB0A 3O50A 3QXPA 4DC2A 4CZYB 1U54A 4P7EA 2BZHB 3QYZA 5DGZA 3W2OA 3UZRA 3EQBA 3FYKX 2UUEA 3BHVA 3FQHA 5EW8A 1IRKA 3I5ZA 3R2BA 3HL7A 3WZJA 4OBQA 3LJ0A 3PXFA 4KINA 3D7ZA 2WAJA 3IW7A 3R1QA 4U9AA 3RK9A 4ASEA 4D2VA 4X2FA 4D2SA 5A9UA 4A9SA 1OI9A 4USEA 3R2YA 2CGWA 4MNFA 2PULA 3TMOA 4AW5A 3POZA 3R02A 3VC4A 4LQMA 2EB2A 2BRMA 3OCTA 5ITAA 2IVSA 1Q5KA 4PL5A 5FP6A 4I94A 2QOBA 5A54A 4FKOA 3VBVA 4C35A 5D7AA 2ZFYA 5C4KA 4IBMA 4UN0C 4PTEA 4IVDA 3ZS5A 4F9WA 3DBEA 4M68A 4XYFA 3GB2A 3ACJA 4M13A 2PUPA 5IA3A 3F3UA 2PZIA 2R2PA 4RIOA 1Y8YA 4X2JA 3OCGA 5LMKC 3UOKA 3NUPA 4O0XA 2VX0A 5ANIA 2WELA 4ZEGA 4A4XA 2XALA 5C1QB 1PXKA 2BAJA 3Q2JA 4GK3A 1UNGA 3DB8A 4H05A 4DT8A 3F88A 4RVMA 4BDGA 1OMWA 2R3NA 4GYIA 4R78A 3MA3A 5EQEA 1O9UA 3H30A 4ANBA 2IN6A 4QMPA 3V6RA 5E8SA 3FKLA 1URCA 4TWNA 3I5NA 3H9RA 1FQ1B 3K5VA 4WSQA 4WNOA 4EK3A 3OW3A 3R28A 4IADA 3WF6A 3Q4CA 3BHYA 2YERA 4LV5A 2XNOA 4V05A 4QRCA 4XV3A 2ITNA 4IC7A 4U42A 3HA8A 4USFA 2XIYA 3CKWA 3TCPA 2BRGA 4HGEA 2CNVA 1Q8YA 3MYGA 1AD5A 3I1AA 1W84A 5DLSA 3EQPA 4KABA 4QOXA 4XLVA 4ENYA 3DPKA 4TYEA 1GOLA 1U59A 1X8BA 2BKZA 2W9FB 2BDFA 3H3CA 3PIZA 3Q9ZA 3PY1A 4C38A 2HW6A 3ORMA 3ORKA 3QX4A 1KOAA 3WZEA 5A46A 3ULIA 3CLYA 3PVBA 2OI4X 3E92A 2I0YA 4XOZA 3K5UA 1MP8A 1B38A 4I23A 5AP1A 3LIJA 2W0JA 3GFWA 5CXHA 4D4SA 2VTIA 4B4LA 3U4UA 5L3AA 3QA0A 3R7YA 3ATSA 4CV9A 3F6XA 4KWPA 3NYOA 2E9UA 2YLFA 3TI1A 3UOHA 3R04A 2WEIA 2VO6A 3NFGB 3MJ1A 4K11A 1FVVA 3R1NA 2J5EA 2R3IA 2UW5A 4I5HA 4TYHB 5HBHA 4ORKA 4CFWA 4HVSA 3KK9A 3QTXA 2XKCA 2HZNA 5AX3A 3PZEA 2IZSA 4ZMEA 2VWXA 5EYCA 4C34A 4WA9A 4WRGA 5AMNA 4YSMA 3PUFC 5D1JA 4ASZA 5M53A 4RJ5A 4BYJA 4O1OA 3KB7A 2X4FA 4M14A 3RK5A 1KE7A 4PMTA 5B2KA 4BCGA 2J0LA 5IH6A 1ZOGA 3KK8A 4OLIA 4EBWA 4P2KA 1W83A 2GNLA 2O64A 3V01A 5IA1A 2WTKC 4RWKA 4A07A 5FTOA 1YXXA 4E6CA 2QOHA 3VIDA 3U6JA 4J1RA 1YXSA 3GQIA 4J7BA 5KNJA 2XRWA 4YTHA 2EU9A 3WZUA 2C3KA 2YM6A 5AADA 4XMOA 5EM7A 1ZYDA 3G9NA 3KMWA 4ALVA 3VS5A 4ANSA 4IEBA 4O4EA 2E9NA 3QUPA 3HMPA 3VBTA 4K0YA 3L8XA 2O8YA 1W82A 5CVHA 4LRJA 3S95A 4ZXTA 4GW8A 2QI8A 4JIKA 2HYYA 4TXCA 5EKOA 4ZSEA 4F6SA 4BTJA 3I81A 4CFVA 5HD4A 4FYOA 4EH8A 3P5JC 3OVVA 3NSZA 3UJGA 3VS1A 3W8LA 1HCKA 4GSBA 4GIIA 3UDSA 2NRUA 3QRIA 4FKSA 3IW8A 4FT7A 2WMUA 3OD6X 4DAWA 4W4XA 4BI2A 4TW9A 3S2PA 1UVRA 4M97A 4RJ3A 2R7BA 1UA2A 3R8UA 4JLCA 3T8OA 4ZOGA 4LL5A 5BVEA 1XBCA 3LAUA 5C27A 3EN5A 3V5PA 4U97A 1OVEA 2YFXA 2X0QA 2XRUA 3KXXA 3PWDA 4W9XA 1R1WA 4O86A 4AA0A 4O81A 1JVPP 3KC3A 4M7IA 4FKRA 4IB1A 3FLSA 3FMDA 3QD4A 4OTFA 3TJCA 1QPDA 2RFDA 2VTNA 5CEKA 3W0RA 2ZM4A 4UBAA 4QDEA 5LARA 4LUDA 4BFMA 3ZHPC 4C2WA 4D2TA 2PUNA 3DKCA 2BZJA 4LOOA 2P4IA 3TUBA 5C26A 4AP7A 2C69A 2I0VA 5D12A 4B6LA 2R0UA 4FNYA 4EHEA 1WBPA 1FVTA 4FTAA 3E8DA 4DGOA 3UIBA 4BYIA 4LFIA 1RDQE 3EFJA 4DLJA 4MEDA 2QU5A 3COKA 4FTCA 5GINE 3GCQA 4FUYA 4I20A 1FPUA 3W2QA 1JKLA 2ZB1A 5FBNC 3ZRMA 4RWIA 4MNEA 5HVYA 3W32A 3Q9XA 4G6LA 2XNEA 3FJQE 2YM7A 3Q52A 3PG1A 4KIOA 3SDJA 2BALA 5FXRA 3MW1A 3LLAA 5CF5A 3P1AA 5B2MA 2WMTA 3G6HA 3DCVA 3FMHA 2R7IA 4EORA 3SHEA 1BYGA 3C4CA 3QD2B 4BDIA 3SXRA 1JLUE 4JBPA 3V5TA 4GV1A 5M55A 2PTKA 3MGYA 4A9TA 4CCBA 3TUCA 4M0ZA 2C3IB 4HYIA 3FMKA 4O2ZA 1BLXA 4U6RA 3BL7A 4FV5A 2ITPA 3F66A 5HORA 4U8ZA 2YAAA 2WMRA 3H0ZA 5CI6A 1PXPA 5JGDA 4ANLA 3ENMA 3LCDA 3NW7A 2A2AA 4KRCA 4OTDA 1V0OA 3GP0A 4AE9A 3PUPA 4L3JA 4IAYA 3HRBA 3NFFB 3IPHA 4FSTA 2AC5A 3PP0A 3OOMA 3IW6A 4R77A 3OEFX 5HGIA 3BBWA 3KF4A 1U5QA 4A9RA 5ANJA 4IX5A 2OF4A 3LFSA 4F63A 3TDWA 3D9VA 1H8FA 3A8XA 2PPQA 1AQ1A 3M42A 2JAMA 5EYMA 4FEQA 3KULB 3PPJA 3TT0A 4CSVA 5AUXA 4CVAA 3AKLA 3PVWA 4FKQA 3LXKA 3AC5A 2LAVA 2JDOA 2OO8X 2QQ7A 2XF0A 2W1FA 3LM5A 3BV3A 3VS3A 4L3LA 2GHMA 3FWQA 3U55A 3LFCA 4HPUE 3QZIA 4EH2A 2IW9A 4ZTQA 3JR1A 3UOJA 4HCVA 1VR2A 4GVAA 4E6DA 2G01A 3I6UA 5A4TA 3G51A 5JKGA 1W0XC 3ZONA 3FEGA 4XEYA 2OXXA 4YZMA 2J5FA 2PZRA 2R3KA 3POOA 3R7GA 3RPSA 5CU0A 2F2UA 4E4XA 5CQUA 4EHZA 5FDPA 4D5KA 3A2CA 5HLWA 3KXHA 4O0YA 4LMUA 2G2FA 2Z2WA 3IOKA 4X2NA 3R7IA 2JDVA 3R8ZA 4EYJA 3MB6A 4EBVA 4MBLA 3N4VA 4CYIA 1SNUA 1NXKA 5J9YA 4YLJA 2ONLC 3KFAA 4NTTA 4AG8A 3SV0A 1OIYA 4G9CA 4DFZE 1YDRE 3BRBA 4FTKA 3VHKA 4O1PA 4UXLA 4MXXA 2UZEA 3AG9A 4QMYA 3FY2A 1J7IA 3BI6A 4G3GA 5T68A 1ZYLA 5J9LA 1Q4LA 2QHNA 4XV2A 2Y4IC 1RQQA 3UQGA 4DE4A 4CMUA 5CXZA 1GIJA 5LOHA 3A7JA 2JGZA 2FUMA 5AEPA 5K0XA 3C50A 4S34A 3R83A 5FXQA 3LQ8A 4BCHA 4D2PA 4EONA 3LQ3A 4AS0A 5E90A 4NJDA 3GC9A 4HZRA 3AT4A 1H1QA 3ZH8A 3PVUA 3NNWA 5LMAA 4C3RA 3F2AA 4YTCA 2R3RA 3HRCA 4TWPA 5HKMA 2WMVA 3VO3A 2VZ6A 3DK7A 3FV8A 4AOJA 4C37A 4U40A 1H1WA 1OL7A 2VNWA 2OXYA 4FGBA 4E6AA 5BVDA 3LPBA 5HLPA 1GY3A 3EQRA 3TEIA 2YIYA 4OTHA 4ZSAA 2QO7A 2W5AA 2B54A 3HP5A 1G8SA 4YHTA 4MNEB 5EDRA 3TIZA 3DXPA 4U43A 4RZVA 1H27A 5HQ0A 5EG3A 1HOWA 2PL0A 2OICA 3LJ2A 4WNKA 3A61A 2XYUA 3G33A 3QCYA 4AZFA 4EKKA 4RSSA 3PDTA 2V22A 3F3WA 4G16A 2OIDA 4H1MA 2EB3A 3PRIA 2BPMA 3DT1A 4R5SA 4R5YA 4UX9A 1PJKA 2VTJA 2C1BA 3QWKA 4IAIA 4RQKA 4QMUA 2QOLA 3ZUVA 4PL3A 2GHLA 5G6VA 2JD5A 3KF7A 4I22A 3H9OA 5G1XA 5GJFA 4QP1A 1YWRA 4F0IA 3QLFA 4OAVB 3MESA 3VUDA 2XEYA 3UTOA 3EYGA 4CKRA 3FI2A 5IUGA 2BAQA 4QP3A 3GOKA 4M8TA 2ZAZA 3IONA 4A9YA 3P86A 4UMUA 5HU3A 4PPCA 2QHMA 2WHBA 2ETMA 4YHJA 5I4NA 5GJDA 4GH2A 5IG1A 3TV7A 2WPAA 3UNZA 3NVKI 4AE6A 5AV3A 2BMCA 5K0KA 4LV8A 1QPJA 4O21A 1PRYA 1YI3A 5CY3A 3C0IA 1BMKA 1Q8TA 2Z7SA 4FTTA 1GZNA 4ACHA 3NIEA 3U51A 3QTWA 2IZUA 3FQEA 3B8QA 4PV0A 1YHWA 5IA2A 5AV0A 4FVQA 4QMXA 1WVYA 3MJ2A 3O0GA 3AC8A 3FLZA 3F61A 4L53A 4C59A 4YZNA 3GQLA 5J79A 4XG2A 5KHXA 4QMLA 3ZFMA 1XQZA 4Q9SA 3UNJA 4X6QC 2YDIA 2JIVA 5IEXA 1BUHA 3BU5A 3BX5A 4F08A 5JZJA 3R00A 1XKKA 2YDJA 1R39A 2FSLX 1IEPA 3FYJX 1DI9A 3C4FA 4N6YA 4JQEA 3FSKA 4JX7A 2XK6A 1LPUA 3CTJA 3RNYA 3VVHA 5KMJA 2C30A 3I7CA 4AW2A 1PY5A 5C4LA 2XIZA 3JS2A 4WUNA 3QD0A 5D41A 4BCJA 3SVVA 4AW0A 4DF3A 5FTGA 2FB8A 5LQFA 5IA5A 1YQJA 2X8DA 2XNNA 2RL5A 4W4VA 3CIKA 3MPMA 5L6PA 3CQWA 4GUEA 4RQVA 4CT2A 5ICPA 3LXPA 3UVRA 3K2LA 4NW6A 5M4IA 3P4KA 4S30A 4ZTHA 5H3QA 5CVFA 3V8WA 3FUPA 4D1SA 5JT2A 1JBPE 2NO3A 2BRNA 3DLSA 4FTOA 2QU6A 4G1WA 1ZWSA 4NEUA 4ZLYA 2RFSA 3VN9A 3KRJA 3LHJA 3P9JA 2C6TA 3FI4A 5DBXA 1YDSE 5CTPA 4FSWA 1Y8GA 1PKGA 4E5AX 5A6OA 1ND4A 3W0NA 4GK2A 4DDGA 1KV1A 1KE5A 4FT5A 2B9FA 2WO6A 3UMXA 4AW1A 4FNWA 3F2RA 2YIWA 4FV2A 3BU3A 4HJOA 4RC3A 5AJQA 4QNYA 2BDWA 3SA0A 3NW6A 3NDMA 3OG7A 4Y5HA 5EOBA 2YIQA 2YEXA 1Q3DA 2X0GA 3QL8A 1M2RA 5EK7A 1OIRA 4MVFA 5GIOE 3DV3A 4PWNA 2P55A 4M66A 4OTIA 3DK3A 4DGMA 3TDVA 4FKLA 4O0SA 4W4WA 4PQNA 5FXSA 3RALA 4DBNA 5M57A 5L2SA 3LW0A 3KGAA 4O7YA 5HE0A 5BVNA 4LDTA 3II5A 5F20A 2W4OA 5KO1A 1A06A 5AIKA 1UV5A 4PL4A 3VJNA 1VJYA 2XK3A 2G2HA 3AD5A 2YZLA 5TE0A 3NAXA 5CVGA 4Q9ZA 1PW2A 5CASA 4MH7A 4YNOA 2O3PA 3W8QA 2IZTA 2HW7A 3D2IA 4K9YA 1E9HA 4FK3A 2W99B 5AV2A 2Y8OA 4D4RA 5J7HA 4RC4A 4YPDA 3F3ZA 3BGQA 4AGDA 4O96A 3DKGA 3AGMA 1CKIA 4MD8E 4M67A 4OTGA 5KMOA 3LFDA 1ZY5A 4K77A 4DHJA 4FIJA 4KAOA 4QMVA 4BF2A 2NNWB 1OPLA 4JG6A 3BGZA 4QP8A 3AMBA 3TV4A 2CKPA 1M17A 5JQ8A 3MVJA 2VTQA 4PTCA 5IKWA 5E4HA 2J0IA 3LQ5A 3UDTA 3KA0A 4DLIA 1YXTA 2PMLX 4MWIA 4G9RA 4CG9A 3CP9A 3O8TA 4BZOA 3QFVA 4FVPA 5HU9A 4LV7A 3F5PA 5EYKA 3VUIA 2WEVA 4TTHB 3HV7A 5M51A 3FY0A 2QKWB 4HYSA 4MXYA 3VS4A 1QPCA 3OY3A 3PY0A 3BBTB 3UG2A 3QC9A 3SXSA 5DFPA 3ZFXA 4FE2A 4IB3A 1YXUA 4L44A 5HIBA 3RAHA 5M4UA 4YO6A 3BYSA 5L8JA 3GU8A 3AXWA 4HCTA 5J5SA 3JVRA 4CZUA 3VQUA 3TKIA 4KSPA 2C68A 3FBVA 5ANEA 4IZAA 4FG7A 4FZDB 2R3PA 4B8MA 1QMZA 4ZTNA 1SM2A 4G3EA 4NUSA 3A62A 2J7TA 1IA8A 4F6UA 4QQ5A 3RNIA 2UVXA 5L2WA 1G8KA 1P14A 4ZY5A 2Q0BA 2W1GA 5BPYA 1NVQA 4BDHA 3BPRA 3CKXA 3GU6A 3JVSA 1PYEA 4Q5HA 5E1SA 5CF8A 3CPCA 4IFCA 4DFYA 1KOBA 2Y4IB 4KIPA 1OPJA 2X39A 2EXCX 5FRIA 4BBEA 5KX8A 5EYDA 3KXZA 4O4FA 2VAGA 5A4QA 2XBJA 3VRYA 5DR9A 3KXNA 2Y4PA 2R3FA 2OWBA 3EKKA 1XH4A 2XZSA 3NCZA 4NZWB 3RKBA 3GGFA 3OMVA 3QC4A 3EL8A 4YJNA 3MH0A 1XH7A 5I9UA 2X0PA 4B99A 3ROCA 1RW8A 3BYOA 3UOLA 4J98A 1KE9A 3A7HA 4EC9A 3Q32A 1OIQA 4EK6A 3W0OA 5HE1A 3VUGA 4ZSGA 3MN3A 4F0GA 5J9ZA 5AUYA 4QTAA 4JI9A 4NIFB 5BVOA 2P0CA 4XJ0A 4OW8A 3FDNA 4U80A 1OKZA 3THBA 2PUUA 1NT2A 3SGCA 2GPHA 3OFMA 1Y91A 3VWAA 3IDBA 4IDTA 1UNLA 3FLYA 2B4SB 4TPTA 4O22A 2NYAA 1F0QA 2X8EA 4LGGA 1PYXA 1W2DA 3CBLA 4XNEA 3ZUTA 2A0CX 4YNEA 3E7VA 5HCXA 5D11A 1G8AA 4BICA 1YXVA 2ZV2A 5KKRC 3DU8A 2QOOA 3LFNA 4IAZA 2XYNA 4ASDA 2C6OA 2XKFA 3B2WA 4BCPA 3CPBA 2HY0A 4L7SA 5E8UA 3EKNA 4GT3A 5EHOA 3K3JA 3PRFA 4BVUA 2H9VA 3QRJA 3EWHA 3SXFA 2PY3A 5DE2A 3KL8A 5JRQA 1UWHA 4GJ3A 4FSUA 3BKBA 2PVJA 2F7ZE 3Q5IA 2GQGA 4TN6A 2CCHA 5AUWA 2W4KA 4BHNA 1JKKA 3GOPA 3FHRA 3DB6A 4J97A 3IGOA 4B0GA 2JBOA 4FK6A 2W1HA 5EM8A 4Z7GA 5ACBC 3ZC6A 1M7QA 4IX3A 5B2LA 4LRKA 4DDIA 4IAKA 4UYAA 1OECA 3ORPA 3VHEA 4JQ8A 5HLNA 5HBJA 3NEWA 3E8CA 4D2WA 3MWUA 4G6NA 3RPYA 5DRDA 4APCA 2VTSA 1OGUA 3ZXTA 1JSVA 1P5EA 4EC8A 5AUTA 2QONA 3BE9A 4DH1A 4PMMA 3BL9A 4G5PA 3E64A 3ATTA 4JS8A 5E8ZA 2C5NA 4CLIA 3KMUA 3Q2MA 2FGIA 5E1EA 5EM6A 1M14A 2XK7A 4H1JA 4UWCA 1XH8A 3MY5A 5AR5A 3QUEA 5CF4A 4I0RA 4HYHA 4RFMA 1S9JA 3W33A 4EI4A 3KU2A 4HVGA 3FZRA 3N4UA 3HMIA