4JDKA

Crystal structure of serine/threonine-protein kinase pak 4 f461v mutant in complex with paktide s peptide substrate
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
288
Chain Sequence
SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGVCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRAAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PAK 4
publication title Identification of a major determinant for serine-threonine kinase phosphoacceptor specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
total genus 93
structure length 288
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4jdkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4jdkA01
3K5UA 1GZNA 3ZEWA 4IZ5A 1Q8ZA 3COKA 4BBFA 4O6LA 2CPKE 4ASEA 5D9HA 5M4FA 1XQZA 3DB6A 3Q4UA 4FKJA 2RL5A 4FV6A 2B0QA 4XV9A 3TTIA 5EQPA 4F63A 5F9EA 2ITZA 1O6KA 3I6UA 1JKTA 4WT6A 3BPRA 4DC2A 1OUYA 2HCKA 4X3FB 4DLIA 5A4CA 3S1HA 5BUEA 4DG0E 4LMUA 3CQEA 3UVRA 4FL1A 3TKIA 2RFSA 4XP2A 3WF5A 4PMSA 2CN5A 1SVHA 4C2VA 5HVKA 5LVNA 3R8UA 3FMJA 2E9UA 1JKKA 3VF9A 2WD1A 5LMBA 4D2WA 4EOLA 2VWXA 1OKVA 2G2FA 2ZV8A 3KULB 3PPZA 5DH3A 2JAVA 5ETFA 3CTHA 3LXLA 5TKDA 1SVEA 2XP2A 1MQ4A 1R3CA 5EDQA 3OD6X 5CWZA 3TV4A 2PZRA 3OWKA 3R7VA 1YHVA 5K4JA 3VBYA 5KMIA 4Y83A 3FHIA 5AV2A 4M67A 1Y57A 4BYIA 5B2LA 2YDKA 4KKEA 1OITA 3R7IA 3F82A 3MJ2A 3WYXA 2HIWA 3D83A 4HYIA 1YWNA 4H36A 5D10A 4E5BA 5M56A 3VQHA 3NSZA 2UW5A 3Q6UA 3HP5A 2C6MA 2JITA 4IBMA 2VO3A 4NIFA 3T9IA 2Y4PA 2VN9A 1NXKA 4XMOA 4BCNA 3GXLA 2HENA 4BBEA 3KCKA 3ZSGA 4IHPA 5CANA 2GS7A 2HXQA 5EI2A 3R28A 5HI2A 5ITAA 4TWNA 3CBLA 4L6QA 4TXCA 4YBKA 3TJDA 4PNIA 4RLKA 4L3LA 2FSOX 2F2CB 3VBWA 4K9YA 4IDVA 3FXXA 4M7IA 4FKWA 3ZCLA 1OB3A 3OUKA 4FL3A 4PPAA 3ZU7A 5M08A 1A06A 5CY3A 5C8KA 4N57A 4FKIA 4FF8A 2I6LA 2PVLA 2VO6A 2YCQA 3EQBA 4L68A 4Y5HA 5EM7A 2UW6A 2BMCA 4EH5A 2B7AA 2OJJA 5JH6A 1OPJA 3RTPA 4AFEA 4UX9A 3VVHA 2VTPA 4YC3A 5C01A 4FR4A 5BVEA 2JDTA 2I7QA 2ONLC 3RAKA 2VNYA 4IZYA 4XCUA 4DF3A 2XYUA 1OL2A 3MA3A 2WAJA 3F6XA 5DT0A 1ZZ2A 2WTDA 1P14A 4KIQA 2CHLA 3W33A 4EH8A 4HVDA 5TO8A 2Z2WA 3ANRA 2VWZA 3NS9A 3ZXTA 3CPBA 2BDFA 5AWMA 4BKJA 5DFPA 4BWKA 5CEKA 1OL1A 4BIEA 4J53A 3FZTA 3ORXA 4I22A 4O38A 1K3AA 2HY81 2UW8A 2CGXA 5DA3A 4AUAA 4NW6A 4J52A 3BHVA 4FIHA 2UW0A 3RBWA 2I0HA 4XNEA 3GQLA 3VS1A 3Q2JA 5CAOA 3EIDA 2E9OA 2VTOA 2O8YA 3QRTA 4K0YA 2C5YA 2X2LA 3ROYA 4AS0A 4AOTA 3KQ7A 2NRUA 4RRVA 5IEVA 4OTQA 3E7OA 4F99A 4CKRA 2JDSA 5IUGA 5KX8A 3KXHA 4ALVA 4DEAA 5M07A 3FXWA 2ITXA 3NIZA 2O5KA 2FYSA 3IGOA 4RFYA 4BFMA 4FTTA 1LEWA 4ZY5A 2J0JA 1Y91A 5FD2A 4BKYA 3KMUA 3F2RA 2G01A 3P9JA 4M84A 3HDMA 1U54B 4TNBA 3ODZX 5A54A 5IU2A 4QMYA 1FOTA 4U0IA 3NEWA 3BHTA 4K6ZA 5FBNC 5ACKA 3RCJA 3SOAA 4LRJA 5TR6A 2EXCX 2XYNA 3A4PA 4BB4A 2ITWA 5G6VA 3GOPA 1XBBA 3PVWA 4GYGA 3QKLA 4I6BA 5EHOA 3LJ2A 3R7UA 4GV1A 4BIBA 5HE2A 2VD5A 4JBQA 4G9CA 4FTOA 4CTCA 3ITZA 3PIXA 4MAOA 4GCJA 1V1KA 4QPMA 5EQYA 4BCQA 4BCJA 2VWYA 3QQKA 1QMZA 3Q9ZA 2OIQA 4RPVA 2YM8A 4HYHA 2YIQA 3NUYA 3NWWA 3P79A 4XG4A 3UODA 1YVJA 5GHVA 3DU8A 3IW7A 3IK3A 4JJRA 5FGKA 3MGYA 4K1BA 5AUXA 4OTGA 3MPAA 5LVMA 1L3RE 4G17A 2X2MA 3UGCA 4IAKA 5C26A 1URCA 4I6FA 4E6DA 5JEBA 4BTKA 1DI8A 3NUSA 3D7ZA 3B8RA 3ZTXA 4KIOA 1J7IA 3MB6A 4RC2A 3DDPA 4XYFA 4FTIA 2X8EA 4UWYA 3RPSA 4FKUA 5IA0A 4WNPA 2BKZA 4TY1A 3TM0A 2EVAA 4FZDB 4G3EA 5E8WA 4FIJA 1XH4A 3REPA 4E26A 5IQCA 5DEYA 4CVAA 3DK7A 4C4EA 1J3HA 3Q96A 3SAYA 5EM6A 4LV5A 4YR8A 3W2PA 2CKOA 3TUBA 3QCQA 3G9LX 3GC9A 2O63A 4YHJA 5T6KA 4USFA 2VO0A 3QQLA 5M53A 3C4EA 4NEUA 4A07A 3DJ6A 2ITOA 5AUVA 3UIMA 4UWBA 4C61A 5E9EA 3BZ3A 4J7BA 3NCZA 3L9NA 5FWKK 3C4FA 2OIBA 4ZSLA 3WF9A 1Y8YA 1PHKA 3DAJA 4FSQA 2GFCA 4IAZA 1PY5A 3PJ2A 3R9DA 5BVFA 5K9IA 2AUHA 3E8DA 3WE4A 4N6YA 4O7WA 1FBNA 4I0TA 3O51A 4BGQA 4WNOA 4UB7A 5HLWA 2PZYA 5KMMA 4M8TA 4TWCA 4G2FA 4M0ZA 5IISA 3ETAA 3F88A 3WF6A 3TNQB 4WG5A 3OROA 4YU2A 4HJOA 1VR2A 5M06A 3KEXA 4LFIA 3BGQA 3GU8A 4NTSA 4O7TA 4ACGA 4B4LA 5DLSA 4YBJA 3RWQA 4UZHA 3TUDA 5HE0A 4YHFA 1TVOA 4LRMA 4H1JA 3CKXA 5FTQA 4O0UA 3RKBA 3L9PA 4RG0A 3RMFA 3ROCA 3M2WA 4EWQA 5EKOA 5JFXA 4L8MA 4DFNA 3G33A 3KRJA 3R73A 3TUCA 4KUJA 5JN2A 3WZDA 5LMAA 5AADA 4AA0A 5BVNA 5J79A 2WMWA 3SGCA 1GIIA 2ZOQA 1UU3A 4D4RA 3BBWA 5ANOA 1ZOHA 1WVYA 3ORKA 4GFMA 1YOLA 2YIXA 3DTCA 3F3UA 3R04A 4GG5A 4QOXA 3OCTA 1LEZA 3HDNA 4L01A 5LVLA 2VU3A 4E1ZA 4BZOA 2R3KA 4GRBA 4U44A 4EOKA 2PY3A 3IPHA 5CS6A 1MRVA 4IMYA 4H3PA 4F6SA 4XJ0A 2CLXA 4D2RA 4ZTRA 5AUYA 3LAUA 3V04A 4B6LA 3PG1A 3GT8A 5JGBA 1XH9A 1HCLA 2C6KA 4JRVA 3OBGA 3E64A 4J96A 3ZBFA 5C1QB 4QYHA 2JC6A 4RJ4A 3R8LA 2PPQA 3QU0A 3K54A 4XH6A 4IWDA 2QLQA 2UZUE 4LL0A 3EZVA 4IW0A 4MNEB 2RFEA 3EWHA 3VS6A 3QGWA 3POZA 2XBAA 3A4OX 3I4BA 3H0YA 3MI9A 3R2BA 4IZAA 2OKRA 4F9BA 4F9AA 4O82A 1YXXA 1UWHA 4BDFA 4II5A 3DJ7A 2WMQA 4J99A 4O0XA 4RVTA 5ANGA 5HU9A 3EFLA 5FTOA 5C8NA 1WZYA 2R3JA 4L9IA 4LI5A 4XP0A 3RHKA 3QUPA 4O0TA 3I81A 3IW8A 1DS5A 4U81A 4AOIA 5AP2A 2EB2A 4ZS0A 3OXTA 4IH8A 3DJ5A 4OTDA 3RI1A 5A4LA 4CG9A 4U8ZA 3COIA 2X8IA 3W2CA 4QQ5A 4UY9A 3LVPA 4D4SA 3IW4A 3E92A 4U45A 3M1SA 4GT4A 5DT3A 3UZTA 4FA2A 3V5PA 4ORKA 3FZPA 2JDVA 1HCKA 1GZ8A 4KRCA 4IM0A 4AA4A 3JUHA 2X6EA 2O65A 4QMVA 4KKHA 5J9LA 4UALA 5FEDA 4E73A 1M7QA 2F57A 3LQ5A 4EOJA 2R3NA 3QC9A 2HW6A 2R3FA 2UW3A 3AC5A 2HWOA 3OMVA 2JKQA 2QHNA 3CY3A 3DY7A 4ZZOA 3PRFA 4J95A 5A3XA 4B99A 2OW3A 5C27A 3C5IA 1PW2A 2VTMA 3H9FA 3AMBA 1H4LA 3II5A 2B54A 4HNIA 4L43A 4NCTA 4RJ3A 5IZFA 3EFKA 3QYWA 4J8MA 4L00A 3ELJA 4M69A 4TW9A 1GNGA 3R63A 4I0RA 4IM2A 5TF9A 2C6TA 3OHTA 2YZAA 5AP1A 3VIDA 4CFFA 3L8VA 2EWAA 3UZRA 4YTHA 2OZAA 3FUPA 3SXFA 4M14A 2XS0A 3NVMB 3ORZA 2Z7QA 3F2NA 5IUHA 3R22A 3HP2A 4UWCA 3MIAA 5CX9A 2VX3A 2W5BA 2GS6A 3DTWA 4RIWB 4C59A 4LYNA 5CZHA 4OUCA 4EOSA 1OUKA 3QA8A 1XBCA 2C3IB 3HUCA 2IZTA 4TNDA 4UMQA 3UYTA 4TWPA 4AX8A 1A48A 3QHRA 3NGAA 3ZDUA 4F6UA 2ZJWA 2Y8OA 3C0HA 3FMDA 2ZMCA 3BE2A 4D28A 5CT0A 4EH2A 3FLWA 4L42A 2XKDA 4FK3A 4WG3A 3HGKA 3LCOA 3MH2A 3NYVA 4LGHA 3CLYA 4V04A 3V5WA 1J7UA 3N4UA 5LVPA 2J0MB 3PIZA 3OC1A 3DKGA 1MRUA 2YWPA 1CMKE 1E9HA 2YM7A 3HRFA 1YRPA 3DB8A 4ZLZA 3I79A 4K2RA 4ZS4A 5EHLA 3UG1A 4CZTA 2JKOA 2OF4A 3LW0A 1PKDA 3L9MA 3P7BA 3UO6A 2XNNA 2OICA 4EUTA 1W83A 3IDCA 3ACKA 4KIKA 5CEQA 3UP2A 4CG8A 1DM2A 4NKAA 4BCIA 4R5YA 3PP1A 4FV5A 4I1ZA 4AN9A 4AW2A 2WO6A 3Q52A 1CSNA 3FL5A 3HRBA 3MIYA 4FSYA 5GZAA 3DLZA 5FM3A 4QYEA 4F9YA 4MQ2A 4D1XA 5GNKA 4F0IA 4GK4A 3WYYA 4LG4A 5M55A 3MPTA 4USEA 2IW9A 2Z7RA 2VTQA 1W8CA 3D15A 3NNWA 4BDGA 4Z7HA 1ZMWA 3QKKA 3RAHA 3R21A 4OGRA 5JK3A 5IKWA 4FKRA 4YMJA 5GJDA 3BLHA 4BTFA 3QRUA 4YLLA 4UMRA 4CCBA 3IKAA 3GVUA 3ZFYA 3I6WA 4PDPA 3G2FA 3ZUUA 3FZSA 3E8CA 3LFQA 5DEWA 2OJ9A 5CEIA 4J98A 4L53A 5I9UA 5J9YA 2DYLA 3VAPA 2GPHA 2F2UA 3LFDA 4HGLA 4NWMA 3MFSA 2Y4IC 2YERA 4CV9A 5LOHA 3SW7A 4FTJA 2X4FA 1JBPE 4EH6A 3U9CA 2VTIA 4KWPA 4QO9A 4E4LA 5HESA 3AMYA 5ANDA 4PF4A 2CCIA 2IPXA 4EC9A 3EQDA 5CAUA 3FC2A 4BDIA 3AT4A 3E7VA 3R83A 3AOXA 4YUQA 5EQEA 3G6HA 4GSBA 2WOUA 3DZOA 5B2MA 3F3ZA 3VUKA 5IQDA 3P0MA 4MXXA 5DPVA 3WILA 3EQPA 5F94A 1G8AA 2VRXA 3UC4A 3RAWA 4EH9A 2QHMA 2QU6A 4A4OA 2FGIA 4ASXA 4FIEA 3QRJA 4BR3A 5IUIA 3KFAA 4IB3A 1YWRA 4DT9A 4JDKA 4BI1A 2PTKA 3DBQA 5M57A 3TV7A 2NPQA 4ZLOA 2PWLA 4FTLA 4C4GA 4Y95A 3W2QA 2OZAB 3KXGA 2DQ7X 4Y46A 3U51A 2R4BA 4NM0A 4WD5A 4ANSA 5J7HA 3IDPA 4RA4A 5D12A 3RPYA 4EQUA 5CQWA 3QGYA 3F2AA 3QX4A 3C4CA 4B0GA 4HVSA 4IB0A 4FV4A 5H8EA 4Y5QA 5DBXA 1RE8A 2OFUA 3LJ1A 2YM6A 2WU6A 4PX6A 4IAAA 2WMAA 1NVRA 3ATSA 4FI1A 5KBQA 1LPUA 5IA3A 4ZJJA 1IASA 3Q5IA 4O2ZA 4YC6A 3LMHA 2DWBA 2PMOX 3E87A 2OSCA 4IVDA 2BIYA 3D0EA 3F5GA 3FZ1A 3POOA 1OKYA 2ZAZA 3GCVA 4G6OA 3TNPC 4CYIA 5HQ0A 5KKRC 5IDPA 2XNBA 3R8ZA 3SRVA 4F1MA 5KHWA 2PZIA 2R3OA 3KK9A 3KXMA 3PYYA 5BMSA 3P7AA 4ZP5A 2WIHA 3OFMA 4EK4A 1IAHA 3VS2A 3QQJA 5JSMA 3BU6A 3SC1A 2W1CA 3PA3A 2VWVA 2IWIA 3QWJA 4TRLA 4BVUA 5L8KA 1J1CA 2XF0A 3OZ6A 3DXQA 3P86A 5IDNA 3NX8A 4XG7A 4ITIA 2JEDA 1V0BA 1IG1A 2ITTA 3HYHA 4DFBA 3UC3A 4KIKB 3UDBA 4CMTA 4DBNA 4HCTA 5IQHA 1UNLA 4FEVA 1FVTA 4KSPA 4J8NA 5CXHA 2REIA 1YOJA 5GZ9A 3CTQA 4C62A 4DH3A 5HKMA 1W7HA 4HYUA 5E91A 5FXQA 4BDKA 4TL0A 5L6PA 2I0VA 3FL4A 4D0WA 5K4IA 2FVDA 4P7EA 4V0GB 3ZOSA 1Q5KA 1Q8UA 4C34A 2BDJA 5L2IA 4O86A 3OW3A 3GC0A 3A7IA 3HNGA 2QC6A 1Y6BA 3EOCA 1F5QA 5AA9A 4AG8A 4DGMA 3AC3A 2PL0A 3EL7A 3DDQA 3GOKA 3QF9A 1Z9XA 2YLEA 4FICA 4QYFA 2G1TA 3T9TA 3ZZEA 5CASA 5J5SA 4ZTSA 3CIKA 2OIDA 5DVRA 4YJSA 4M66A 4AACA 4CTBA 2HY0A 2UW7A 4ZLYA 5M44A 3U6IA 4EHZA 4I4FA 4BWPA 1B38A 3FKLA 2KTYA 1J7LA 5EHYA 2WFYA 3JVRA 4XG2A 2W06A 5EDPA 5FXRA 3HAVA 4IB5A 3VBQA 3LCSA 3R7OA 3WI6A 1R0PA 2QKRA 2OXDA 3QTZA 3ORNA 4WHZA 4FKTA 2RF9A 3A62A 4XG8A 4HCUA 2GFSA 1UVRA 5HD7A 4A06A 1BLXA 3IS5A 4FV1A 3K3JA 4RX8A 4Y8DA 4BHZA 4PDYA 4RX5A 4EBVA 2PUNA 4GG7A 2EXEA 3VHEA 3MFTA 4RJ7A 4JG7A 1M52A 2CGUA 3PLAE 3DV3A 2Z7LA 1XKKA 4JQ7A 1H1RA 3QCSA 4FSNA 2VO7A 2HOGA 4LL5A 3ZM9A 2E9PA 3DXNA 3LFFA 4EOPA 3I7BA 3C0IA 2XIXA 2JBPA 3BEAA 4FTCA 3PPKA 5ETCA 2BUJA 2OH0E 4GU9A 4QYYA 2VNWA 4O7RA 2W1EA 4S31A 4GJ3A 3CS9A 2CMWA 3KC3A 3PSDA 5HTBA 4FSUA 2J51A 4ZK5A 5GIOE 2QODA 3CR0A 2QLUA 3PJ3A 3OXZA 2XZSA 1KE9A 3LCDA 4RWIA 2CCHA 3S3IA 5IMXA 4XX9A 1XJDA 2PVRA 4YZBA 3ZDIA 1NY3A 5HX6A 5L2WA 4XG9A 1YHSA 4G6LA 3NUNA 4U5JA 5TE0A 4BN1A 4KSQA 3UMXA 4YJRA 3MY0A 3A8WA 5HBEA 3W2SA 5BQ0A 2NO3A 4O7LA 1PXMA 2V7OA 4H3BA 4MX9A 4AE6A 1QPEA 3LM0A 4OT6A 3FQHA 3SQQA 3PXQA 4RX9A 5BYZA 3TEIA 4ZIMA 2WQNA 4C4IA 2HELA 5AUTA 4KIPA 4HVGA 2YACA 2IW6A 3E5AA 2GNFA 5HG7A 3UOKA 5DE2A 3DNDA 3LPBA 2BHEA 2ZMDA 4FGRA 3SRVB 2UZDA 2P0CA 2XKEA 2ETMA 5M4UA 3P78A 3LIJA 1FPUA 4FYOA 4EYJA 4ZSEA 3V5QA 1JNKA 4RQKA 3ZXZA 5D41A 3QQUA 3WIKA 2XCKA 3OF0A 4CEGA 4JLCA 2W05A 1Q8YA 4RIXB 4IACA 4WKQA 1YWVA 3EQRA 4W4XA 1IAJA 3RPVA 2GU8A 3PZEA 4YZDA 1G5SA 3NUPA 5EYMA 2R3IA 3TN8A 5IA5A 5BVOA 4GEOA 1W0XC 4FG9A 5CSXA 3ZO2A 3ENHA 2J5EA 3FI3A 1H25A 2A4LA 3BEGA 4GYIA 2VTAA 3G6GA 4XG3A 3VS3A 3IOPA 2JIVA 3VUHA 4DYMA 4KB8A 4G1WA 2J2IB 1YXTA 4YPDA 4W4WA 3G90X 1P4FA 3NYXA 2PVMA 4GK2A 3ZLYA 3BX5A 4EHEA 2QO9A 1O9UA 5AV1A 1KE8A 5EFQA 4EC8A 1SYKA 1U4DA 4RJ6A 4EORA 5A6OA 5CSVA 3TACA 3R7EA 4PY1A 3ORMA 3SX9A 5AAEA 1Q97A 2R2PA 4IWQA 3RALA 1PJKA 4BCHA 5M09A 4FTAA 2WZJA 3EMGA 3NW5A 1XH6A 5CTPA 4ZMFA 3R9HA 2C0TA 4IX5A 4TWOA 3PA4A 4UXLA 4B9DA 3KMWA 4FTRA 4WBOA 4O83A 3FY0A 2ZM3A 4UBAA 1VYZA 3V6SA 4OTIA 4EK6A 3QTUA 3Q4ZA 4ZZNA 3FZOA 3QD0A 4RJ5A 4L3JA 3NLBA 5DG5A 3UIBA 3ZRMA 2GS2A 1NW1A 4DHFA 4YTFA 3NYOA 3L8PA 5LVOA 4EWHA 4QTAA 4ZY6A 4CD0A 3CPCA 3CQUA 4CT2A 4WBBB 3UOHA 3TIZA 4GMYA 3COMA 1JPAA 4P2KA 3I0QA 1WBPA 1JWHA 2HZNA 5ETIA 3VQUA 3L8SA 2YDIA 4Q2AA 2F9GA 2UZLA 4BIDA 3R30A 1KUTA 2VZ6A 4Y73A 4MYGA 4TKSA 1ZOGA 2QOHA 1OIYA 4TYHB 4OR5A 3AD5A 4E5WA 3TG1A 2RG6A 5E8UA 3EKKA 5EI6A 4E4XA 4AW1A 5JFSA 1NT2A 4O7VA 5JMSA 5CF5A 4JVGA 4FZ6A 4RC3A 4RX7A 4AF3A 4KD1A 3UQCA 3PLSA 1ZYDA 4FT5A 4QT1A 4YO4A 2XEZA 3VBVA 5BYYA 1IRKA 2RFDA 2YLFA 1FGIA 2GNGA 2XK3A 3AXWA 4ANOA 4IXPA 3FAAA 3ZUVA 3ACJA 3PXYA 3GC7A 4ACHA 1GAGA 3NR9A 2C5XA 4NT4A 4QP2A 2P4IA 4JS8A 4JXFA 4S34A 4CLJA 3KRLA 2Q83A 3EKNA 2UZEA 2J0KA 3KVWA 5AAGA 4YJPA 2XUUA 3ORTA 3UO4A 4ANLA 5IQEA 3IONA 3OOMA 1SNXA 4C7TA 3KK8A 4UV0A 3VNTA 2J5FA 3FYKX 1RW8A 4C37A 3EQGA 3ZO4A 1H1SA 3G0FA 3CQWA 3IOKA 3LFAA 3LFEA 1PRYA 1WVWA 5AM6A 3ULIA 4NCTC 2WMTA 2IVUA 4GVJA 5CU3A 5AP7A 2OXXA 1UKIA 4KBCA 5AA8A 3AMAA 3ODYX 3QTWA 1NA7A 4IZ7A 2Y4IB 4JL9A 5JRQA 2BZIB 3W32A 2OK1A 3HMMA 5JFVA 5JGAA 2ZV2A 4PL4A 4IAFA 4NSTA 5L4QA 5M4IA 1JSVA 1OZ1A 3E8EA 4IIRA 3QQHA 3QD2B 4YNEA 2VX0A 5EW9A 3F61A 1YI3A 4C57A 3MPMA 3DK3A 3JY9A 1WMKA 2I0YA 2UUEA 3KRRA 5AUZA 5FDPA 1OL6A 4LM5A 1S9IA 2X39A 2HK5A 3ZUTA 2C30A 3KXNA 5EDRA 4FKLA 3DBEA 4O6EA 4ZSAA 3E88A 4FT7A 4RGJA 3QA0A 5E8ZA 1OPLA 4QQCA 4EI4A 2E9VA 4AZFA 4FBXA 2W9ZB 4F0FA 3GNIB 2BDWA 1M7NA 2AYPA 2BTSA 3KVXA 4QP9A 2PUUA 4E8AA 5HBHA 2XKCA 4IANA 3FWQA 4LV8A 2ERZE 2WMSA 4DT8A 3NAXA 4O2PA 3FJQE 2YM5A 1Q3WA 3GCSA 4A7CA 1XHAA 2VUWA 4IJPA 2PULA 4PPBA 3PWYA 3TNIA 5AEPA 4X7QA 1BUHA 4M0YA 5E1EA 4R7HA 4DH8A 4GUBA 4RVMA 3MJ1A 3OCGA 3UPXA 3DK6A 5AIRA 4NIFB 3TL8A 4R1YA 4YJUA 4FVQA 4IAYA 5HBJA 5DRBA 2PMIA 4PRJA 4X2FA 5JZJA 2VWUA 1A9UA 4G5JA 3V3VA 3DCVA 4EOOA 1DAYA 2CGVA 2R3PA 3OT3A 1U59A 1URWA 4IC8A 5C4LA 5HVJA 4IVCA 4M13A 4AGCA 1G8SA 5CLPA 4ZZMA 4R3RA 3FLNC 4W8DA 4ASZA 5KKRB 3V8WA 1WBOA 1R0EA 3IW5A 4OTHA 3U9NA 4ERWA 2XK7A 4EZ3A 4O7SA 4AA5A 2Y0AA 3ERKA 4I92A 2UW4A 3R6XA 1FQ1B 5BUIA 5IPJA 4DTAA 4F7LA 3CJFA 4H39A 4EJ7A 5CF4A 2QNJA 4CFMA 4IVBA 4AAAA 3JYAA 4QTEA 5LQFA 1ZYCA 2PVYA 1KV1A 5CF6A 4NFMA 3GFWA 4IQ6A 4CSVA 2W1DA 2GHMA 4M68A 2CJMA 3MTLA 5D7AA 1WBTA 2R3QA 1WBSA 5IH6A 3FPQA 3QHWA 4YO6A 1R1WA 2GCDA 1U5RA 3PSCA 4G5PA 4UEUA 4BDDA 1OGUA 2EUFB 2I1MA 2FA2A 4EK8A 3CGOA 4O7ZA 2C6DA 2UZTA 4ZMEA 2X6DA 2P2IA 3BYOA 2P3GX 3DA6A 3A7HA 1H1WA 3BRBA 4WOVA 4EHVA 2J0IA 4NFNA 4IEBA 1BMKA 1SVGA 3QAME 4PMMA 4ACMA 4L3PA 5EYCA 2UV2A 4NJ3A 4L67A 3ZLXA 5AR2A 4W4YA 4MBLA 4E6CA 4Z55A 2XIZA 3BHYA 3ZO1A 2PU8A 5H2UA 2W1IA 1ZYSA 1Q62A 2ZDUA 3LQ8A 5KMKA 4ENYA 4NL0A 4BCKA 4F9CA 3CY2A 4FKQA 4OAUC 4BCMA 3D2KA 2PMLX 4F70A 5CQUA 3CD8A 1ZMVA 2HW7A 4DEDA 4LOPA 3UPZA 3DQXA 1SZMA 5HICA 5CU4A 3HV3A 5DWRA 4FTKA 2F7ZE 4XS2A 3ZBXA 4GS6A 4PP7A 1ZOEA 1YDSE 3QFVA 3R01A 3KB7A 4RT7A 4CFWA 5KUPA 3ENMA 4O0WA 5LCKA 3BHHA 3F66A 3OUNB 3ZHPC 3PTGA 4E6AA 3DQWA 3R9RA 1GZKA 4U41A 5HCZA 2PVFA 3JPVA 4JX7A 4AP7A 4EYMA 3I7CA 3RM6A 4BZNA 4CFNA 5L2TA 4GIIA 3VHKA 2Q0BA 4ZSGA 3WZUA 5C03A 3W8LA 4EONA 4Z7GA 5JKGA 4PPCA 5IEYA 2IO6A 2XIRA 2A27A 4FZ7A 4I5CA 4YZMA 3VS4A 4AN3A 1W82A 1SMHA 3FC1X 1P5EA 4BC6A 3HMIA 4JR3A 1OM1A 3AGMA 3UNKA 3Q4TA 2UVZA 5LARA 2YFXA 4DEEA 3ORLA 4RFMA 5K3YA 3VRYA 4E7WA 1PXLA 2FSTX 5HU3A 2GMXA 4KS8A 3W16A 1MQBA 1LP4A 5JQ5A 1ZY5A 3B8QA 4C0TA 5CSWA 2W1GA 3GU7A 4AQCA 3UO5A 2PZ5A 4A4XA 2C68A 3THBA 2ITUA 2IVVA 3KCFA 4G6NA 5I3RA 4C58A 3EQFA 5IEXA 5L8LA 2VTSA 4QPSA 1XR1A 5I4NA 3ORPA 2OFVA 5I9XA 4NJDA 2BZKB 4GW8A 5HVYA 3WF7A 5J8IA 2C47A 2WTJA 3OT8A 3EB0A 4Q5HA 3A2CA 4JDIA 5ACBC 4A9SA 3KL8A 5LWNA 2BAJA 4U80A 3O8UA 4R1VA 3ZRKA 2VAGA 3SXSA 3IECA 4ANBA 4X2NA 2J90A 4TYEA 3DAKA 1MP8A 3VUIA 3NVKI 5BPYA 4YLJA 4Y72A 2ESMA 2VTRA 4ITJA 4D2VA 5LCJA 4NM7A 2YITA 2PVKA 2V62A 4M12A 4C35A 2RG5A 3GC8A 4W9XA 5L2SA 2BRMA 2QOCA 2GHLA 2WEIA 4C02A 4QMPA 3EQCA 4MHAA 1ZMUA 4EH4A 4P5QA 4RBLA 2QONA 4PMPA 1YQJA 1BL6A 3MBLA 4TYJA 3U8WA 1Z57A 4C3FA 4JG6A 2BRHA 5E7RA 3TI1A 2FSMX 5DN3A 3SV0A 4D1SA 4YPSA 3R7YA 1WBWA 2C1AA 2QQ7A 1ZYJA 4FUYA 4MH7A 1SNUA 4CXAA 1NVSA 3RHXA 3W2RA 4NTTA 4ZTHA 2YISA 4YJOA 2BIKB 3UNJA 5DI1A 4K11A 3GUBA 3EN5A 4D58A 2B53A 3JS2A 4FUXA 4MF1A 4R7IA 3PJ8A 5LXMA 3Q5ZA 3KF4A 3QTXA 1OBGA 4RFZA 2VTTA 3TKUA 3AC8A 3FI4A 4A9TA 1ZLTA 4YTCA 4MXCA 2BALA 2OG8A 3BLQA 2BROA 4GVAA 4S2ZA 3SKCA 3TTJA 3CCNA 5I9ZA 3DZQA 3C4ZA 1AQ1A 5B7VA 2JLDA 3DT1A 4AW0A 2B55A 3EYGA 3RJCA 4CV8A 3SHEA 1F3MC 1JQHA 4AN2A 3L9LA 1CKJA 5H9BA 3UIUA 3FQEA 3U4WA 2WMXA 4DA5A 3C4WA 5F20A 4AZVA 2XNOA 2UVXA 4QP1A 4DEBA 2ETKA 2YAKA 3C1XA 3R2YA 4HGEA 4DTBA 3W1FA 1PMVA 2GSFA 2V0DA 2PVJA 3D9VA 4FKSA 1PXNA 3EQIA 3PDTA 2WTIA 3I0OA 4O27B 4Q9ZA 4V01A 4QTCA 5B2KA 5JZNA 4APPA 2QCSA 2SRCA 2XVDA 4G3FA 4WSQA 5EM8A 2C69A 4G16A 4UYAA 2IVTA 1CKPA 2V7AA 4E5AX 3EN4A 3UNZA 1KSWA 2C6OA 3P23A 4NK9A 3FLZA 4YJVA 5HHWA 2EXMA 4H58A 4AGUA 4EK3A 4QQJA 2OJFE 2XJ2A 3GENA 2XM9A 2WEVA 4B8MA 4XOZA 4YJNA 4BL1A 5J9ZA 2IG7A 4MWHA 3BQRA 1PXOA 2P33A 2XNPA 4NKSA 4DE4A 4XUFA 5CSHA 4S32A 4JDJA 4IX4A 2C1BA 2ZB0A 3OWPA 3U87A 4I5MA 3UYSA 1YKRA 2W17A 1JKSA 3T8OA 1U46A 5AX3A 4CMUA 4DLJA 2WXVA 1UWJA 4P5ZA 5LMKC 5HX8A 3N51A 3BELA 2J0LA 1VZOA 1CDKA 4U97A 4BWXA 4BI0A 4EOQA 1IA9A 5FM2A 3LXKA 2YDJA 2OXYA 4DEHA 3VW6A 3HVCA 3IG7A 2WOTA 1DI9A 3D7TA 2R7BA 2X9EA 3LFBA 4X0MA 4EH3A 4F1TA 4HZRA 3DOGA 4XP3A 4Z9LA 3ZC5A 4MQ1A 4JIAA 3RGFA 5T3QA 2WB8A 3OS3A 4R8QA 3Q04A 3R02A 4JAJA 4FSZA 5AP6A 2WMUA 5EK7A 4ZY4A 3HZTA 5AV0A 4FT9A 5AUWA 4FEWA 3ZEPA 3P08A 2XNMA 3HUBA 2XB7A 2VTJA 3IQ7A 5AP5A 4KA3A 3UVQA 4A4LA 4F6WA 3VRZA 4MTAA 5A46A 4AOJA 4RIYA 5E8YA 1GIJA 4QNYA 4TYIA 4YURA 1BX6A 4FEQA 4CFXA 4CKJA 3E3PA 3R1QA 4EHGA 2BRGA 2CKEA 4RZVA 4R6VA 2R3LA 3KY2A 4FKPA 3L1SA 3D5UA 3PWDA 4FTUA 4FV3A 4QP6A 4JBOA 4XLVA 3TZ7A 3FI2A 5CI7A 4M69B 4KINA 3PE2A 4L46A 5A4EA 5D1JA 5DGZA 3HV6A 4LQMA 4ZTLA 4FKVA 2A0CX 3GU5A 4DN5A 3FEGA 5C8MA 4AU8A 3MB7A 3PVBA 3HMNA 4CZYB 4RVKA 5TT7A 3NNVA 3MWUA 4PTCA 4DH5A 5A4TA 2ACXA 3VJOA 4FEUA 3NRMA 5CAPA 3W55A 1KOBA 1V0OA 3CJGA 4J97A 4C4FA 3LCTA 3SG9A 4Q9SA 4BGGA 1YXVA 3H30A 3BE9A 4DAWA 3BI6A 4P90A 1YXUA 4PMTA 3DKFA 5EI8A 2QR7A 5I9WA 4JNWA 1OI9A 4X6QC 3NCGA 3HMOA 5LWMA 2YZLA 5HIEA 5B0XA 3TT0A 3FMEA 4MF0A 3MFRA 2X7FA 3QALE 3QYZA 4FEXA 5FRIA 2BZJA 3F5PA 5HTCA 3FZRA 2W96B 3MVMA 3PZHA 2R3HA 2Z7SA 2R64A 4FKGA 1PYEA 3ET7A 3WZKA 1PYXA 3ZSIA 3EN7A 4BI2A 2J6MA 1OIRA 4U6RA 1Q61A 2X7OA 3OEFX 4G3CA 2QKWB 5IH4A 2GHGA 4L52A 4BICA 2WU7A 2G9XA 2Z8CA 4D2TA 3F7WA 4FSWA 1ZWSA 3WZEA 2UZWE 1OIUA 5KE0A 2OJIA 3A60A 3TWJA 2XH5A 5BX0A 3HL7A 4GJ2A 4BDJA 5IMEA 2QR8A 3PG3A 3TXOA 5K5NA 2V5QA 4PDOA 5T68A 5J5TA 3UQFA 5EW8A 2FH9A 3QRIA 1T46A 1OL5A 3ANQA 4GKHA 3I1AA 4I94A 5K0KA 4RVLA 2OBJA 3DBFA 4ZEGA 5KZIA 4UZDA 5IA4A 3OTVA 3V01A 4BZDA 1KE5A 4LMNA 3Q9YA 1K9AA 2OZOA 3N4TA 5EYKA 3FLQA 3A8XA 1X8BA 2C3JA 2Y6OA 3JY0A 3OY3A 2Y9QA 3R1NA 4X3FA 5HE1A 3UOLA 4ANNA 4F09A 1OBDA 3DKCA 3LFNA 4JBVA 4DGLC 3BGZA 2ZV9A 4ZAUA 5F4NA 3PXFA 5AR7A 2ITPA 3AD4A 3K5VA 4IAIA 3ZFMA 1VEBA 4D4VA 2O3PA 3CXWA 4KRDA 2V55A 4QMNA 1FMKA 3E63A 2JAMA 3CD3A 3H3CA 4P4CA 2QOQA 4I20A 5CVHA 2GQRA 2JIIA 3NMUF 2DUVA 3HA8A 2W4KA 5HIBA 3Q9XA 4QQTA 3NYNA 1XWSA 2UW9A 2IJMA 3PY1A 3DPKA 3D5WA 2CKQA 3KN6A 4MK0A 3TDVA 4F7NA 3M11A 1BKXA 4I41A 2HWPA 4ZTQA 4DFLA 4RIYB 4C4HA 3WOWA 2QO2A 2Y6MA 5E8VA 3LOKA 4FV9A 4O0VA 2QOLA 3EQHA 1R39A 3QZHA 2PE2A 5KMNA 3HAMA 5I9VA 2YWVA 1Q24A 3G0EA 3I60A 4OW8A 5I0BA 3PSBA 2E2BA 3M42A 4E4NA 5HCYA 5KNJA 4GKIA 4W4VA 2YCFA 1H1PA 2R0UA 3OW4A 2B9FA 4I6HA 5CAVA 4NYEA 2H9VA 5GINE 3MA6A 2AC3A 3O17A 4KBAA 4YNOA 4MKCA 4IFCA 4MWIA 5AJQA 3VJNA 2C6IA 4N0SA 1G3NA 1WCCA 5KHXA 4HPUE 2YJSA 4D55A 2CNUA 2ETRA 4AZSA 4QP3A 4C8BA 5E1SA 4BDCA 5FEEA 3C51A 3R1YA 3BBTB 4IDTA 4LOOA 1YHWA 2VTNA 2IZRA 1EH4A 2JDRA 3QUDA 1FMOE 4HPTE 4EK5A 4PTEA 3Q60A 4CRSA 1M2RA 5EOBA 2Q0NA 3C4XA 2QG7A 5HO8A 4FNWA 4XG6A 4GT3A 5DMZA 3TV6A 4CNHA 5LMKA 3K2LA 4KABA 1XO2B 3LHJA 5CEOA 2IVSA 4U9AA 3C7QA 3NDMA 3O50A 3KN5A 4BDEA 2YM4A 1YI4A 4WG4A 4R3CA 4QMQA 1H0VA 1XH7A 4DFXE 4RA5A 3G9NA 5BVDA 3VC4A 1QL6A 3GEQA 5A9UA 3ZYAA 2B9IA 2VWBA 3QC4A 3S2PA 4RQVA 4FVRA 3SVVA 4BTMA 4IWOA 4L7FA 3DGKA 4FZFB 2JFMA 1JLUE 4QTDA 4YGAA 4OTPA 1GJOA 2QOOA 3P4KA 3N4VA 5FLFA 3IW6A 4AZWA 3RZBA 2LGCA 4WIHA 4BDBA 3EL8A 5HNBA 2I0EA 2QOIA 5IA2A 3KRXA 2XK6A 4MD7E 5HOAA 2A2AA 2JFLA 3A7GA 3OVVA 3AC4A 3ZONA 5HORA 1U54A 2J9MA 3PXRA 4MD8E 4ITHA 1HOWA 4QYGA 5EOLA 4DH7A 3WIGA 2BPMA 3KXZA 2XNGA 4QMWA 2W4OA 5CNOA 4FTMA 4UMPA 5I5ZA 4PWNA 2C3LA 5HIDA 2RIOA 4JOAA 2B9HA 4RZWA 5GJFA 4FX3A 4F7SA 4AWIA 2BRNA 5CEPA 3RK5A 5I9YA 2PYWA 2CGWA 4WRSA 2X1NA 5M4CA 3LE6A 3FHRA 3QL8A 4EOIA 3Q4CA 3QTSA 3WZJA 3UG2A 1Z5MA 3OWJA 2W1FA 1KE6A 3W18A 5AIKA 3H4JA 3CEKA 5FP6A 3GGFA 3ZSHA 5C4KA 2QOBA 3Q6WA 4EZ7A 3MVHA 3PFQA 5H8BA 2NNWB 3TCPA 1PMUA 4I3ZA 4DGNA 2VGOA 2AC5A 2QI8A 2WHBA 3HV7A 2OGVA 3IGGA 4FTNA 1H27A 4LGDA 3RPOA 4NM3A 3RWPA 3V5JA 4AGDA 1Q99A 1H0WA 2WTKC 1ZYLA 4FIFA 3EYHA 3PVGA 5HG5A 2CNVA 4R7BA 5AFVA 1SM2A 3C0GA 3FMMA 5DR9A 3UVPA 4C38A 5CT7A 2R7IA 5DT4A 3R0TA 5F95A 3R9OA 3EH9A 1BL7A 5DYJA 4ONAA 2X0GA 2WKMA 1J91A 5ANEA 4ZJIA 4EOMA 3QLGA 3OTUA 3TZ8A 2PMNX 3G5DA 3VWAA 3S00A 4IM3A 2WQEA 2X9FA 4CQGA 2WTWA 3ZH8A 4MBJA 3DFAA 2B1PA 3A99A 3ZLWA 3UTOA 1APME 5AV4A 4HCVA 4IFGA 4J71A 4O1PA 2WMVA 3I5ZA 1PXPA 4DG3E 3MVLA 2WPAA 3ATTA 3NW7A 4KBKA 3L8XA 5L6WL 3FKOA 3PXZA 5J1WA 2CSNA 4ERKA 4O84A 1GOLA 3RPRA 3NNXA 4FTQA 1OIQA 4D5HA 3OBJA 3LXPA 5ANKA 3FYJX 4I0SA 3O8TA 3QWKA 1LUFA 4FV0A 3VUTA 5J7BA 3OCSA 2OWBA 1I09A 3GFEA 1OMWA 2ITNA 4B8LA 5IF1A 4DINA 3RK7A 2XBJA 1OL7A 4DFZE 4L45A 3ZC6A 3EJ1A 3E3BX 2O64A 4FC0A 2R3GA 4MNFA 4CFVA 1NVQA 1O6YA 5AM7A 3FLSA 4I4EA 4WUAA 4XOYA 2ZM1A 3FPMA 4G31A 4IC7A 1W98A 5BMMA 1BYGA 2R0IA 3R8MA 4WNKA 5BNJA 3O71A 4BY9E 4K8AA 1OECA 3FI8A 4EBWA 5JT2A 2XEYA 3EZRA 4IX6A 3LCKA 2KULA 2XCHA 4N4SA 4DEIA 1BI8A 3QUEA 3LMIA 5DRDA 5EW3A 2EU9A 4GUEA 5CU2A 4YZCA 3GCUA 5M51A 4IJ9A 4EQMA 2WTVA 3LLTA 1GIHA 1JSTA 2XIYA 3AT3A 2XM8A 3CTJA 3PY3A 5HNIX 4QMXA 4UYNA 1IR3A 5EH0A 2PE0A 3VS0A 1ATPE 2ZB1A 1QPJA 3TDWA 2H96A 3U55A 3EHAA 5A14A 1O6LA 1YDTE 4U7ZA 4I6QA 3MDYA 4DITA 3GBZA 3SOCA 5AR4A 5L2QA 4ACDA 5JRSA 5TOZA 5IQFA 5HLNA 1QPDA 5GZ8A 3D4QA 3Q3BA 3TKHA 5HE3A 3RVGA 2HYYA 5F1ZA 2VWWA 2BVAA 5CAQA 2WELA 4Q5EA 4TN6A 1Q4LA 4F9WA 5CU0A 2UZBA 2I40A 1K2PA 1H08A 3NIEA 4GK3A 4FKOA 3VS5A 5CYIA 5DOSA 3AGLA 1H24A 3HLLA 5AMNA 3R8PA 4F64A 5H8GA 4JG8A 3QQGA 2YHVA 3TJCA 3CGFA 4PP9A 4JIKA 3OG7A 2V22A 3LXNA 2J50A 1RDQE 3MH3A 4MNEA 5E8XA 4FNZA 3V8SA 3AD6A 4F4PA 3BLRA 2HXLA 4HYSA 2ITVA 2GNHA 3PVUA 4E3CA 2GNJA 5HLPA 1MRYA 4A9YA 1ND4A 2GTMA 4XEYA 5IQGA 1UV5A 4D9UA 2DS1A 1PXJA 1YXSA 2H34A 4O81A 5D11A 3HV4A 4YZNA 1UA2A 2BFYA 3LM5A 4YJTA 5E92A 4CCUA 4R77A 2P2HA 4FODA 4E6QA 2UZOA 3QRKA 4M15A 3O2MA 2QVSE 3BQCA 2C5OA 2WMBA 3KMMA 4JDHA 4O0SA 1IA8A 4AGWA 3V51A 5FDXA 3CP9A 4GL9A 3LFCA 4R5SA 3H9RA 4FG8A 3CC6A 2UZVA 5HEZA 3FSFA 3HV5A 4I5PA 5CALA 2XJ1A 5AR5A 3O7LD 2HZIA 4QMZA 2YIYA 1H26A 2O2UA 3D94A 4MBIA 4NW5A 5DHJA 4AZTA 5ICPA 2BKKA 2BHHA 3AC1A 4YTIA 4ANQA 2B52A 4AFJA 3TIYA 5GJGA 4J1RA 4HNFA 4RWJA 5DR2A 2GDOA 4A9RA 3BWFA 3DBDA 3LJ0A 1Q8WA 4OBOA 3QTRA 1QCFA 2P55A 4QD6A 5C9CA 2C6EA 5AR3A 4BDHA 2FUMA 3BYVA 3HRCA 4BYJA 4FG7A 4ZOGA 2JD5A 2W5HA 3Q2MA 1CKIA 4R78A 3FXZA 1KE7A 2E9NA 3AQVA 3R1SA 3ZMMA 5K0XA 3S95A 2OF2A 2B9JA 3H10A 4LRKA 3KRWA 3UOJA 4DGOA 4XRLA 3QD3A 4RIWA 1TKIA 3UP7A 1RJBA 4OBPA 4PTGA 4RC4A 2VV9A 5HGIA 2J7TA 4NH1A 4OBQA 4YSJA 3QZFA 4G3GA 1H28A 4BKZA 3PJ1A 4UXQA 3RM7A 3MY1A 1FGKA 4ASDA 2XRUA 2IN6A 4IB1A 1WAKA 4FZAB 4DCAA 2JBOA 1Q3DA 1UNGA 3OWLA 2YJRA 2B4SB 2G2IA 3FMHA 4FSRA 2BCJA 4O22A 3DFCB 5AR8A 3TZ9A 2PUIA 3SG8A 4WO5A 2WQBA 3VF8A 2WMRA 3ID6C 2O0UA 3MTFA 3BV2A 2XIKA 4QTBA 5HCXA 2UVYA 4F0GA 3OY1A 4RSSA 3KU2A 3T3UA 2LAVA 3PIYA 1I44A 3BYSA 3P1AA 2C0OA 4XV3A 3IO7A 1WFCA 3PPJA 4JQ8A 4U42A 5EM5A 3LQ3A 5FTGA 4CT1A 3GCQA 4BDAA 2ZV7A 3N9XA 1TQIA 4C33A 4FV7A 3DAEA 3KGAA 5G1XA 1H00A 3BU5A 3ZLSA 4BCOA 2G15A 3U4UA 1REKA 3FMNA 1M2PA 3O8PA 5AUUA 3LLAA 3V5TA 3AC2A 4FIIA 1JSUA 4IX3A 4LUDA 1DAWA 1STCE 4OTRA 3VN9A 1H1QA 3D5VA 3K3IA 3SXRA 2JIUA 5CSPA 2NRYA 2Z60A 2C5NA 4XLIA 5A4QA 4CGAA 4BF2A 3W8QA 4JX3A 1Q8TA 2X81A 4E93A 4YSMA 3VULA 3JVSA 4OTWA 4O21A 4XV2A 1CTPE 2ZVAA 3NUUA 1L8TA 4FVPA 4YHTA 2PVHA 2BZHB 4CRLA 5HO7A 2F49A 2XNEA 3F3TA 4K33A 4LUEA 4XBRA 3DLSA 2ONLA 2WNTA 3FDNA 2WQMA 4PL3A 4FOCA 1GY3A 2OH4A 3KXXA 5HNGA 3QBNA 5HZNA 3QXOA 5AP3A 4C3RA 3ZRLA 1JAMA 1KOAA 4QMOA 4C3PA 3AT2A 1KV2A 3F3VA 1UU8A 2ZM4A 3NW6A 5IA1A 1UU9A 3NZ0A 4PUZA 5ETAA 3CE3A 2BAQA 2CNQA 3ULZA 4KNBA 2WIPA 3UJGA 2PK9A 2QU5A 1V0PA 2OJGA 4MXOA 2F7EE 4X3FC 4ZTNA 4D1ZA 2ITYA 3IDBA 1J1BA 5AV3A 5LJJA 3RINA 3MFUA 1S9JA 1JVPP 3G51A 1YW2A 1PF8A 1U5QA 3TNHA 2JKKA 1QPCA 2VTLA 4KS7A 2QO7A 4TYGA 4CLIA 4MVFA 3VS7A 2VWIA 5HG8A 4MXAA 4N6ZA 5KO1A 1ZRZA 4U3YA 5BVKA 1VYWA 3V5LA 2WGJA 2R9SA 2W0JA 2C0IA 3BIZA 3NUAA 4N70A 2JGZA 3R00A 4NUSA 3FBVA 3ALOA 3GU4A 3I5NA 4D9TA 2XK9A 3GI3A 3Q9WA 2A1AB 3E93A 4AW5A 2QOKA 4Y85A 5A6NA 1H07A 3V6RA 3FMKA 4X21A 3HEGA 4IWPA 2IZUA 3GU6A 3VBXA 3FLYA 2YIRA 1B39A 4A9UA 4QP8A 4ANMA 3RK9A 3QZGA 3S4QA 2Y7JA 1YDRE 4TT7A 1ZARA 4XBUA 3SW4A 5EG3A 4QRCA 3DXPA 4G3DA 2UZNA 5AP4A 5CVFA 2GNLA 3BWJA 3OEZA 4JR7A 3MVJA 4FSMA 5I3OA 1T45A 2GTNA 2FSLX 3JXWA 3R71A 4CKIA 4EH7A 4DBXA 5GIPE 3MW1A 5BUJA 5KCVA 1Y6AA 4O96A 4ACCA 4WSYA 3U54A 4QMLA 4BGHA 1FVVA 3MH1A 4O1OA 1BI7A 2ERKA 4F7JA 3EFJA 4I5HA 5D7VA 1E1XA 3EFWA 2BAKA 1ZAOA 2WTKB 1ZY4A 2GNIA 1ZXEA 2W1HA 4TPTA 5DIAA 2IW8A 5L3AA 3CSVA 4FMQA 3W10A 3G15A 4I93A 1IEPA 2BILB 5KMOA 3QXPA 2XK8A 2JKMA 3AG9A 3C13A 3MH0A 2BR1A 5IG1A 4U79A 4I23A 2YIWA 4MEDA 2PE1A 2PVNA 3HKOA 3QTIA 5CU6A 3RP9A 1UU7A 4AZEA 4UMUA 3GP0A 5IQIA 4D2SA 4U43A 3FV8A 3VUDA 3ALNA 3Q53A 3R8VA 1UNHA 4FOBA 1ZZLA 4DEGA 4FGBA 5K5XA 4CZUA 4FV2A 2CDZA 3VW8A 5JQ8A 3VBTA 1XH5A 4JAIA 5E8SA 2XMYA 4KKGA 4WA9A 4W9WA 4V0GA 4CYJA 1ERKA 4JRNA 3R7GA 4IVAA 2JDOA 4MD9E 1H01A 4BTJA 4M3QA 5J87A 3ZS5A 2XA4A 2HZ0A 4QNAA 4R3PA 3SD0A 2OI4X 4NM5A 3WF8A 2C4GA 4FT3A 3FMLA 3DKOA 3LKMA 4K77A 4H05A 4M97A 3RNYA 1JOWB 3QQFA 1FVRA 3DS6A 3DBCA 4HGTA 4W8EA 2XRWA 5FG8A 5EKNA 3CKWA 3ZM4A 5HTIA 5KMJA 1M2QA 3SA0A 3NAYA 2BTRA 3PY0A 4YC8A 2X7GA 5E8TA 3B2TA 5E4HA 4MCVA 1YOMA 3TNWA 3H0ZA 4AT4A 5KBRA 5CXZA 2GQSA 4FL2A 4RMZA 4GIHA 4ALUA 4I24A 3QD4A 4MXYA 2ZYBA 4EEVA 2QURA 4K18A 3RAIA 3KA0A 1P4OA 2X8DA 1AD5A 1KWPA 4XHKB 4OTFA 5L8JA 4AE9A 4D2PA 4ALWA 1LR4A 4G34A 5DNRA 1TQMA 5DR6A 3O0GA 3U6JA 3GQIA 4TTHB 4MXZA 3F5XA 1MUOA 3FE3A 3FY2A 3KF7A 4PDSA 4IADA 3TZMA 4O7NA 3ZO3A 3OCBA 4X3JA 4B7TA 1REJA 3FKNA 1JKLA 3FQSA 3HX4A 3MN3A 3F9NA 4U40A 2CN8A 4JT3A 2YCSA 5CEMA 4V05A 5AP0A 3NNUA 2C3KA 1W84A 4QMSA 4F65A 3F3WA 2YN8A 2FB8A 2W9FB 4X6RA 4CFUA 4U3ZA 4PL5A 4ZJVA 3JR1A 2PUPA 2XJ0A 4EQCA 3QCYA 4QPAA 4FE2A 4FNXA 3U6HA 4D0XA 4DCEA 3VUGA 3RNIA 4ID7A 2OLCA 4HVHA 3P7CA 4S33A 3QTQA 3S0OA 4AT5A 3PUPA 3PE1A 3A7JA 2X4ZA 3PXKA 3VUMA 4PNKA 2FO0A 3QX2A 4D4YA 3MY5A 2IZSA 4GT5A 4O0RA 3LFSA 4APCA 4FSTA 2OO8X 2W99B 1AGWA 4EJNA 4ENXA 4O7YA 2BFXA 4ZSJA 1Y8GA 2Z02A 3OP5A 4HGSA 4O0YA 5KZ0A 4EUUA 4E4MA 1PXKA 4X2KA 3MYGA 3UMWA 3HECA 2HAKA 2C5VA 4IE9A 3O96A 2CLQA 4BCFA 4F08A 5HO6A 4EZ5A 3E8NA 5FXSA 5CNNA 1OKZA 5HD4A 1GZOA 2RGPA 1WVXA 2G2HA 1OPKA 2A19B 1OKWA 3A7FA 4X2GA 1M17A 4CQEA 4E20A 4EL9A 5BYLA 4BRXA 3E62A 4O91A 1B6CB 4RIXA 1VJYA 4C36A 3HA6A 1M14A 3MS9A 4QMTA 4WNMA 3QCXA 2YM3A 4PQNA 4XV1A 4HVIA 4KAOA 5CZIA 5EYDA 2PSQA 3C9WA 2YCRA 5AX9A 4BCGA 3UZPA 2RFNA 4GFGA 1YI6A 4WRGA 2ITQA 1UKHA 2CKPA 3B2WA 3RCDA 3EN9A 1H8FA 4YLKA 3OOGA 4OLIA 3D7TB 3QZIA 1PMNA 2PHKA 2VX1A 4FV8A 5L6OA 4LGGA 3DNEA 3MESA 5JGDA 3BCEA 2H6DA 4TZRA 1RQQA 4UN0C 4OT5A 2W7XA 4C4JA 4DFUA 3KULA 3RZFA 3WE8A 4D5KA 2F7XE 3LMGA 4QP4A 5E90A 3UBDA 3ZFXA 3D5XA 3VO3A 4DGGA 4L7SA 3F69A 3QLFA 2XK4A 3HMPA 5KMLA 4BCPA 4FT0A 2R3RA 3D14A 2ZDTA 4QMUA 5CVGA 3R9NA 4FNYA 2W4JA 4OAVB 4RLLA 3BKBA 1CM8A 2NP8A 2VGPA 3MV5A 2R5TA 2QOFA 3FSKA 3COHA 3V8TA 3ORIA 1OVEA 3P5KA 3PRIA 4NZWB 3F5UA 3UE4A 2F4JA 3UQGA 4JQEA 4L44A 3WARA 2WTCA 4C2WA 4YJQA 4RWKA 3KKVA 4PV0A 5CF8A 1F0QA 4EKKA 3PJCA 4DH1A 2QG5A 4GFOA 3WBLA 3KREA 4Z16A 5IQBA 2RSVA 4JBPA 4AXAA 5H3QA 2J4ZA 4YP8A 5BVWA 5FUTA 3A61A 4HOKA 4LOQA 4RJ8A 3SDJA 4NU1A 5FQDC 1P2AA 5IH5A 3C5UA 4RIOA 1PMEA 4BBMA 3BV3A 1PXIA 2C6LA 4QP7A 1TQPA 3BGPA 4Z3VA 3GCPA 1FINA 4JI9A 5CI6A 5J1VA 4I21A 3LZBA 3Q32A 3EN6A 3O23A 5IQAA 4TYHA 4F1OA 1WBVA 2YEXA 4DFYA 3BYMA 2OU7A 4FK6A 4XRJA 5J95A 5ANJA 1WBNA 2QD9A 2VTHA 4AT3A 2YAAA 2W1ZA 1PKGA 3GB2A 4CMOA 4H1MA 4RWLA 4DTKA 4HW7A 4UMTA 2XKFA 3BU3A 5FEQA 2H8HA 5HG9A 3ZZWA 4BHNA 2PZPA 4USDA 1XBAA 4ARKA 3PA5A 4EKLA 3F7ZA 3D2IA 4HZSA 4FYNA 4WUNA 2W5AA 2X2KA 3O7LB 3UIXA 2YABA 3BHUA 3PP0A 1XH8A 1Q41A 4GH2A 3MSSA 4G9RA 3QKMA 3BYUA 4X2JA 1E1VA 2WQOA 5AAFA 3W2OA 2BRBA 3H9OA 1R78A 3OXIA 4FIGA 4ZTMA 3C50A 3NUXA 2RKUA 3T3VA 3NPCA 4S30A 4DG2E 2R3MA 2GQGA 5JFWA 5CENA 4QMMA 5FBOA 4ZXTA 2HZ4A 2EB3A 4YZ9A 5FP5A 5ANIA 4H3QA 4GU6A 2YA9A 3SLSA
chains in the Genus database with same CATH superfamily
3K5UA 1GZNA 3ZEWA 4IZ5A 2XANA 1Q8ZA 3COKA 4BBFA 4O6LA 2CPKE 4ASEA 5D9HA 5M4FA 1XQZA 3DB6A 3Q4UA 4FKJA 2RL5A 4FV6A 2B0QA 4XV9A 3TTIA 3AKKA 5EQPA 4F63A 5F9EA 2IEWA 2ITZA 1O6KA 3I6UA 1JKTA 4WT6A 3BPRA 4DC2A 1OUYA 2HCKA 4X3FB 4DLIA 5A4CA 3S1HA 5BUEA 4DG0E 4LMUA 3CQEA 3UVRA 4FL1A 3TKIA 2RFSA 4XP2A 3WF5A 4PMSA 2CN5A 1SVHA 4C2VA 5HVKA 5LVNA 3R8UA 3FMJA 2E9UA 1JKKA 4DYMA 3VF9A 2WD1A 5LMBA 4D2WA 4EOLA 2VWXA 1OKVA 2G2FA 5BV3A 2ZV8A 3KULB 3PPZA 5DH3A 2JAVA 5ETFA 3CTHA 3LXLA 5TKDA 1SVEA 2XP2A 1MQ4A 1R3CA 5EDQA 3OD6X 5CWZA 3TV4A 2PZRA 3OWKA 3R7VA 1YHVA 5K4JA 3VBYA 5KMIA 4Y83A 3FHIA 5AV2A 4M67A 1Y57A 4BYIA 5B2LA 3W0PA 2YDKA 4KKEA 1OITA 3R7IA 3F82A 3MJ2A 3WYXA 2HIWA 3D83A 4HYIA 1YWNA 4H36A 5D10A 4E5BA 5M56A 3VQHA 3NSZA 2UW5A 3Q6UA 3HP5A 2C6MA 2JITA 4IBMA 2VO3A 4NIFA 3T9IA 2Y4PA 2VN9A 1NXKA 4XMOA 4BCNA 3GXLA 2HENA 4BBEA 3KCKA 3ZSGA 4IHPA 5CANA 2GS7A 2HXQA 5EI2A 3R28A 5HI2A 5ITAA 4TWNA 3CBLA 4L6QA 4TXCA 4YBKA 3TJDA 4PNIA 4RLKA 4L3LA 2FSOX 2F2CB 3VBWA 4K9YA 4IDVA 3FXXA 4M7IA 4FKWA 3ZCLA 1OB3A 3OUKA 4FL3A 4PPAA 3ZU7A 5M08A 1A06A 5CY3A 5C8KA 4N57A 4FKIA 4FF8A 2I6LA 2PVLA 2VO6A 2YCQA 3EQBA 4L68A 4Y5HA 5EM7A 2UW6A 2BMCA 4EH5A 2B7AA 2OJJA 5JH6A 1OPJA 3RTPA 4AFEA 4UX9A 3VVHA 2VTPA 4YC3A 5C01A 4FR4A 5BVEA 2JDTA 2I7QA 2ONLC 3RAKA 2VNYA 4IZYA 4XCUA 4DF3A 2XYUA 1OL2A 3MA3A 2WAJA 3F6XA 5DT0A 1ZZ2A 2WTDA 1P14A 4KIQA 2CHLA 3W33A 4EH8A 4HVDA 5TO8A 2Z2WA 3ANRA 2VWZA 3NS9A 3ZXTA 3CPBA 2BDFA 5AWMA 4BKJA 5DFPA 4BWKA 5CEKA 1OL1A 4BIEA 4J53A 3FZTA 3ORXA 4I22A 4O38A 1K3AA 2HY81 2UW8A 2CGXA 5DA3A 4AUAA 4NW6A 4J52A 3BHVA 4FIHA 2UW0A 3RBWA 2I0HA 4XNEA 3GQLA 3PFYA 3VS1A 3Q2JA 5CAOA 3EIDA 2E9OA 2VTOA 2O8YA 3QRTA 4K0YA 2C5YA 2X2LA 3ROYA 4AS0A 4AOTA 3KQ7A 2NRUA 4RRVA 5IEVA 4OTQA 3E7OA 4F99A 4CKRA 2JDSA 5IUGA 5KX8A 3KXHA 4ALVA 4DEAA 5M07A 3FXWA 2ITXA 3NIZA 2O5KA 2FYSA 3IGOA 4RFYA 4BFMA 4FTTA 1LEWA 4ZY5A 2J0JA 1Y91A 5FD2A 4BKYA 3KMUA 3F2RA 4O4EA 2G01A 3P9JA 4M84A 3HDMA 1U54B 4TNBA 3ODZX 5A54A 5IU2A 4QMYA 1FOTA 4U0IA 3NEWA 3BHTA 4K6ZA 5FBNC 5ACKA 3RCJA 3SOAA 4LRJA 5TR6A 2EXCX 2XYNA 3A4PA 4BB4A 2ITWA 5G6VA 3GOPA 1XBBA 3PVWA 4GYGA 3QKLA 4I6BA 5EHOA 3LJ2A 3R7UA 4GV1A 4BIBA 5HE2A 2VD5A 4JBQA 4G9CA 4FTOA 4CTCA 3ITZA 3PIXA 4MAOA 4GCJA 1V1KA 4QPMA 5EQYA 4BCQA 4BCJA 2VWYA 3QQKA 1QMZA 3Q9ZA 2OIQA 4RPVA 2YM8A 4HYHA 2YIQA 3NUYA 3NWWA 3P79A 4XG4A 3UODA 1YVJA 5GHVA 3DU8A 3IW7A 3IK3A 4JJRA 5FGKA 3MGYA 4K1BA 5AUXA 4OTGA 3MPAA 5LVMA 1L3RE 4G17A 2X2MA 3UGCA 4IAKA 5C26A 1URCA 4I6FA 4E6DA 5JEBA 4BTKA 1DI8A 3NUSA 3D7ZA 3B8RA 3ZTXA 4KIOA 1J7IA 3MB6A 4RC2A 3DDPA 4XYFA 4FTIA 2X8EA 4UWYA 3RPSA 4FKUA 5IA0A 4WNPA 2BKZA 4TY1A 3TM0A 2EVAA 4FZDB 1ST0A 4G3EA 5E8WA 4FIJA 1XH4A 3REPA 4E26A 5IQCA 5DEYA 4CVAA 3DK7A 4C4EA 1J3HA 3Q96A 3SAYA 5EM6A 4LV5A 4YR8A 3W2PA 2CKOA 3TUBA 3QCQA 3G9LX 3GC9A 2O63A 4YHJA 5T6KA 4USFA 2VO0A 3QQLA 5M53A 3C4EA 4NEUA 4A07A 3DJ6A 2ITOA 5AUVA 3UIMA 4UWBA 4C61A 5E9EA 3BZ3A 4J7BA 3NCZA 3L9NA 5FWKK 3C4FA 2OIBA 4ZSLA 3WF9A 1Y8YA 1PHKA 3DAJA 4FSQA 2XALA 2GFCA 4IAZA 1PY5A 3PJ2A 3R9DA 5BVFA 5K9IA 2AUHA 3E8DA 3WE4A 4N6YA 4O7WA 1FBNA 4I0TA 3O51A 4BGQA 4WNOA 4UB7A 5HLWA 2PZYA 5KMMA 2AEGA 4M8TA 4TWCA 4G2FA 4M0ZA 5IISA 3ETAA 3F88A 3WF6A 3TNQB 4WG5A 3OROA 4YU2A 4HJOA 1VR2A 5M06A 3KEXA 4LFIA 3BGQA 3GU8A 4NTSA 4O7TA 4ACGA 4B4LA 5DLSA 4YBJA 3RWQA 4UZHA 3TUDA 5HE0A 4YHFA 1TVOA 4LRMA 4H1JA 3CKXA 5FTQA 4O0UA 3RKBA 3L9PA 4RG0A 3RMFA 3ROCA 3M2WA 4EWQA 5EKOA 5JFXA 4L8MA 4DFNA 3G33A 3KRJA 3R73A 3TUCA 4KUJA 5JN2A 3WZDA 5LMAA 5AADA 4AA0A 5BVNA 5J79A 2WMWA 3SGCA 1GIIA 2ZOQA 1UU3A 4D4RA 3BBWA 5ANOA 1ZOHA 1WVYA 3ORKA 4GFMA 1YOLA 2YIXA 3DTCA 3F3UA 3R04A 4GG5A 4QOXA 3OCTA 1LEZA 3HDNA 4L01A 5LVLA 2VU3A 4E1ZA 4BZOA 2R3KA 4GRBA 4U44A 4EOKA 2PY3A 3IPHA 3BL9A 5CS6A 1MRVA 4IMYA 4H3PA 4F6SA 4XJ0A 2CLXA 4D2RA 4ZTRA 5AUYA 3LAUA 3V04A 4B6LA 3PG1A 3GT8A 5JGBA 1XH9A 1HCLA 2C6KA 4JRVA 3OBGA 4O4DA 3E64A 4J96A 3ZBFA 5C1QB 4QYHA 2JC6A 4RJ4A 3R8LA 2PPQA 3QU0A 3K54A 4XH6A 4IWDA 2QLQA 2UZUE 4LL0A 3EZVA 4IW0A 4MNEB 2RFEA 3EWHA 3VS6A 3QGWA 3POZA 2XBAA 3A4OX 3I4BA 3H0YA 3MI9A 3R2BA 4IZAA 2OKRA 4F9BA 4F9AA 4O82A 1YXXA 1UWHA 4BDFA 4II5A 3DJ7A 2WMQA 4J99A 4O0XA 4RVTA 5ANGA 5HU9A 3EFLA 5FTOA 5C8NA 1WZYA 2R3JA 4L9IA 4LI5A 4XP0A 3RHKA 3QUPA 4O0TA 3I81A 3IW8A 1DS5A 4U81A 4AOIA 5AP2A 2EB2A 4ZS0A 3OXTA 4IH8A 3DJ5A 4OTDA 3RI1A 5A4LA 4CG9A 4U8ZA 3COIA 2X8IA 3W2CA 4QQ5A 4UY9A 3LVPA 4D4SA 3IW4A 3E92A 2NYAA 4U45A 3M1SA 4GT4A 5DT3A 3UZTA 4FA2A 3V5PA 4ORKA 3FZPA 2JDVA 1HCKA 1GZ8A 4KRCA 4IM0A 4AA4A 3JUHA 2X6EA 2O65A 4QMVA 4AXDA 4KKHA 5J9LA 4UALA 5FEDA 4E73A 1M7QA 2F57A 3LQ5A 4EOJA 2R3NA 3QC9A 2HW6A 2R3FA 2UW3A 3AC5A 2HWOA 3OMVA 2JKQA 2QHNA 3CY3A 3DY7A 4ZZOA 3PRFA 4J95A 5A3XA 4B99A 2OW3A 5C27A 3C5IA 1PW2A 2VTMA 3H9FA 3AMBA 1H4LA 3II5A 2B54A 4HNIA 4L43A 4NCTA 4RJ3A 5IZFA 3EFKA 3QYWA 4J8MA 4L00A 3ELJA 4M69A 4TW9A 1GNGA 3R63A 4I0RA 4IM2A 5TF9A 2C6TA 3OHTA 2YZAA 5AP1A 3VIDA 4CFFA 3L8VA 2EWAA 3UZRA 4YTHA 2OZAA 3FUPA 3SXFA 4M14A 2XS0A 3NVMB 3ORZA 2Z7QA 3F2NA 5IUHA 3R22A 3HP2A 4UWCA 3MIAA 5CX9A 2VX3A 2W5BA 2GS6A 3DTWA 4RIWB 4C59A 4LYNA 5CZHA 4OUCA 4EOSA 1OUKA 3QA8A 1XBCA 2C3IB 3HUCA 2IZTA 4TNDA 4UMQA 3UYTA 4TWPA 4AX8A 1A48A 3QHRA 4QEBA 3NGAA 3ZDUA 4F6UA 2ZJWA 2Y8OA 3C0HA 3FMDA 2ZMCA 3BE2A 4D28A 5CT0A 4EH2A 3FLWA 4L42A 2XKDA 4FK3A 4WG3A 3HGKA 3LCOA 3MH2A 3NYVA 4LGHA 3CLYA 4V04A 3V5WA 1J7UA 3N4UA 5LVPA 2J0MB 3PIZA 3OC1A 3DKGA 1MRUA 2YWPA 1CMKE 1E9HA 2YM7A 3HRFA 1YRPA 3DB8A 4ZLZA 3I79A 4K2RA 4ZS4A 5EHLA 3UG1A 4CZTA 2JKOA 2OF4A 3LW0A 1PKDA 3L9MA 3P7BA 3UO6A 3AKJA 2XNNA 2OICA 4EUTA 1W83A 3IDCA 3ACKA 4KIKA 5CEQA 3UP2A 4CG8A 1DM2A 4NKAA 4BCIA 4R5YA 3PP1A 4FV5A 4I1ZA 4AN9A 4AW2A 4DDGA 2WO6A 3Q52A 1CSNA 3FL5A 3HRBA 3MIYA 4FSYA 5GZAA 3DLZA 5FM3A 4QYEA 4F9YA 4MQ2A 4D1XA 5GNKA 4F0IA 4GK4A 3WYYA 4LG4A 5M55A 3MPTA 4USEA 2IW9A 2Z7RA 2VTQA 1W8CA 3D15A 3NNWA 4BDGA 4Z7HA 1ZMWA 3QKKA 3RAHA 3R21A 4OGRA 5JK3A 5IKWA 4FKRA 4YMJA 5GJDA 3BLHA 4BTFA 3QRUA 4YLLA 4UMRA 4CCBA 3IKAA 3GVUA 3ZFYA 3I6WA 4PDPA 3G2FA 3ZUUA 3FZSA 3E8CA 3LFQA 5DEWA 2OJ9A 5CEIA 4J98A 4L53A 5I9UA 5J9YA 2DYLA 3VAPA 2GPHA 2F2UA 3LFDA 4HGLA 4NWMA 3MFSA 2Y4IC 2YERA 4CV9A 5LOHA 3SW7A 4FTJA 2X4FA 1JBPE 4EH6A 3U9CA 2VTIA 4KWPA 4QO9A 4E4LA 5HESA 3AMYA 5ANDA 4PF4A 2CCIA 2IPXA 4EC9A 3EQDA 5CAUA 3FC2A 4BDIA 3AT4A 3E7VA 3R83A 3AOXA 4YUQA 5EQEA 3G6HA 4GSBA 2WOUA 3DZOA 5B2MA 3F3ZA 3VUKA 5IQDA 3P0MA 4MXXA 5DPVA 3WILA 3EQPA 5F94A 1G8AA 2VRXA 3UC4A 3RAWA 4EH9A 2QHMA 2QU6A 4A4OA 2FGIA 4ASXA 4FIEA 3QRJA 3KIOC 5IUIA 3KFAA 4IB3A 1YWRA 4BR3A 4DT9A 4JDKA 4BI1A 2PTKA 3DBQA 5M57A 3TV7A 2NPQA 4ZLOA 2PWLA 4FTLA 4C4GA 4Y95A 3W2QA 2OZAB 2XAMA 3KXGA 2DQ7X 4Y46A 3U51A 2R4BA 4NM0A 4WD5A 4ANSA 5J7HA 3IDPA 4RA4A 5D12A 3RPYA 4EQUA 5CQWA 3QGYA 3F2AA 3QX4A 3C4CA 4B0GA 4HVSA 4IB0A 4FV4A 5H8EA 4Y5QA 5DBXA 1RE8A 4AXCA 2OFUA 2X0QA 3LJ1A 2YM6A 2WU6A 4PX6A 4IAAA 2WMAA 1NVRA 3ATSA 4FI1A 5KBQA 1LPUA 5IA3A 4ZJJA 1IASA 3Q5IA 4O2ZA 4YC6A 3LMHA 2DWBA 2PMOX 3E87A 2OSCA 4IVDA 2BIYA 3D0EA 3F5GA 3FZ1A 3POOA 1OKYA 2ZAZA 3GCVA 4G6OA 3TNPC 4CYIA 5HQ0A 5KKRC 5IDPA 2XNBA 3R8ZA 3SRVA 4F1MA 5KHWA 2PZIA 2R3OA 3KK9A 3KXMA 3PYYA 5BMSA 3P7AA 4ZP5A 2WIHA 3OFMA 4EK4A 1IAHA 3VS2A 3QQJA 5JSMA 3BU6A 3SC1A 2W1CA 3PA3A 2VWVA 2IWIA 3QWJA 4TRLA 4BVUA 5L8KA 1J1CA 2XF0A 3OZ6A 3DXQA 3P86A 5IDNA 3NX8A 4XG7A 4ITIA 2JEDA 1V0BA 1IG1A 2ITTA 3HYHA 4DFBA 3UC3A 4KIKB 3UDBA 4CMTA 4DBNA 4HCTA 5IQHA 1UNLA 4FEVA 1FVTA 4KSPA 4J8NA 5CXHA 2REIA 1YOJA 5GZ9A 3CTQA 4C62A 4DH3A 5HKMA 1W7HA 2XAOA 4HYUA 5E91A 5FXQA 4BDKA 4TL0A 5L6PA 2I0VA 3FL4A 4D0WA 5K4IA 2FVDA 4P7EA 4V0GB 3ZOSA 1Q5KA 1Q8UA 4C34A 2BDJA 5L2IA 4O86A 3NFGB 3OW3A 3GC0A 3A7IA 3HNGA 2QC6A 1Y6BA 3EOCA 1F5QA 5AA9A 4AG8A 4DGMA 3AC3A 2PL0A 3EL7A 3DDQA 3GOKA 3QF9A 1Z9XA 2YLEA 4FICA 4QYFA 2G1TA 3T9TA 3ZZEA 5CASA 5J5SA 4ZTSA 3CIKA 2OIDA 5DVRA 3AKLA 4YJSA 4M66A 4AACA 4CTBA 2HY0A 2UW7A 4ZLYA 5M44A 3U6IA 4EHZA 4I4FA 4BWPA 1B38A 3FKLA 2KTYA 1J7LA 5EHYA 2WFYA 3JVRA 1ST4A 4XG2A 2W06A 5EDPA 5FXRA 3HAVA 4IB5A 3VBQA 3LCSA 3R7OA 3WI6A 1R0PA 2QKRA 2OXDA 3QTZA 3ORNA 4WHZA 4FKTA 2RF9A 3A62A 4XG8A 4HCUA 2GFSA 1UVRA 5HD7A 4A06A 1BLXA 3IS5A 4FV1A 3K3JA 4RX8A 4Y8DA 4BHZA 4PDYA 4RX5A 4EBVA 2PUNA 4GG7A 2EXEA 3VHEA 3MFTA 4RJ7A 4JG7A 1M52A 2CGUA 3PLAE 3DV3A 2Z7LA 1XKKA 4JQ7A 1H1RA 3QCSA 4FSNA 2VO7A 2HOGA 4LL5A 3ZM9A 2E9PA 3DXNA 3LFFA 4EOPA 3I7BA 3C0IA 2XIXA 2JBPA 3BEAA 4FTCA 3PPKA 5ETCA 2BUJA 2OH0E 4GU9A 4QYYA 2VNWA 4O7RA 2W1EA 4S31A 4GJ3A 3CS9A 2CMWA 3KC3A 3PSDA 5HTBA 4FSUA 2J51A 4ZK5A 5GIOE 2QODA 3CR0A 2QLUA 3PJ3A 3OXZA 2XZSA 1KE9A 3LCDA 4RWIA 2CCHA 3S3IA 5IMXA 4XX9A 1XJDA 2PVRA 4YZBA 3ZDIA 1NY3A 5HX6A 5L2WA 4XG9A 1YHSA 4G6LA 3NUNA 4U5JA 5TE0A 4BN1A 4KSQA 3UMXA 4YJRA 3MY0A 3A8WA 5HBEA 3W2SA 5BQ0A 2NO3A 4O7LA 1PXMA 2V7OA 4H3BA 4MX9A 4AE6A 1QPEA 3LM0A 4OT6A 3FQHA 3SQQA 3PXQA 4RX9A 5BYZA 3TEIA 4ZIMA 2WQNA 4C4IA 2HELA 5AUTA 4KIPA 4HVGA 2YACA 3UDSA 2IW6A 3E5AA 2GNFA 5HG7A 3UOKA 5DE2A 3DNDA 3LPBA 2BHEA 2ZMDA 4FGRA 3SRVB 2UZDA 2P0CA 2XKEA 2ETMA 5M4UA 3P78A 3LIJA 1FPUA 4FYOA 4EYJA 4ZSEA 3V5QA 1JNKA 4RQKA 3ZXZA 5D41A 3QQUA 3WIKA 2XCKA 3OF0A 4CEGA 4JLCA 2W05A 4FJVA 1Q8YA 4RIXB 4IACA 4WKQA 1YWVA 3EQRA 4W4XA 1IAJA 3RPVA 2GU8A 3PZEA 4YZDA 1G5SA 3NUPA 5EYMA 2R3IA 3TN8A 5IA5A 5BVOA 4GEOA 1W0XC 4FG9A 5CSXA 3ZO2A 3ENHA 3BLAA 2J5EA 3FI3A 1H25A 2A4LA 3BEGA 4GYIA 2VTAA 3G6GA 1W2FA 4XG3A 3IOPA 2JIVA 3VS3A 3VUHA 4KB8A 4G1WA 2J2IB 1YXTA 4YPDA 4W4WA 3G90X 1P4FA 3NYXA 2PVMA 4GK2A 3ZLYA 3BX5A 4EHEA 2QO9A 1O9UA 5AV1A 1KE8A 5EFQA 4EC8A 1SYKA 1U4DA 4RJ6A 4EORA 5A6OA 4DHJA 5CSVA 3TACA 3R7EA 4PY1A 3PUFC 3ORMA 3SX9A 5AAEA 1Q97A 2R2PA 4IWQA 3RALA 1PJKA 4BCHA 5M09A 4FTAA 2WZJA 3EMGA 3NW5A 1XH6A 5CTPA 4ZMFA 3R9HA 2C0TA 4IX5A 4TWOA 3PA4A 4UXLA 4B9DA 3KMWA 4FTRA 4WBOA 4O83A 3FY0A 2ZM3A 4UBAA 1VYZA 3V6SA 4OTIA 4EK6A 3QTUA 3Q4ZA 4ZZNA 3FZOA 3QD0A 4RJ5A 4L3JA 3NLBA 5DG5A 3UIBA 3ZRMA 2GS2A 1NW1A 4DHFA 4YTFA 3NYOA 3L8PA 5LVOA 4EWHA 4QTAA 4ZY6A 4CD0A 3CPCA 3CQUA 4CT2A 4WBBB 3UOHA 3TIZA 4GMYA 3COMA 1JPAA 4P2KA 3I0QA 3BL7A 1WBPA 1JWHA 2HZNA 5ETIA 3VQUA 3L8SA 2YDIA 4Q2AA 2F9GA 2UZLA 4BIDA 3R30A 1KUTA 2VZ6A 4Y73A 4MYGA 4TKSA 1ZOGA 2QOHA 1OIYA 4TYHB 4OR5A 3AD5A 4E5WA 3TG1A 2RG6A 5E8UA 3EKKA 5EI6A 4E4XA 4AW1A 5JFSA 1NT2A 4O7VA 5JMSA 5CF5A 4JVGA 4FZ6A 4RC3A 4RX7A 4AF3A 4KD1A 3UQCA 3PLSA 1ZYDA 4FT5A 4QT1A 4YO4A 2XEZA 3VBVA 5BYYA 1IRKA 2RFDA 2YLFA 1FGIA 2GNGA 2XK3A 3AXWA 4ANOA 4IXPA 3FAAA 3ZUVA 3ACJA 3PXYA 3GC7A 4ACHA 1GAGA 3NR9A 2C5XA 4DHIB 4NT4A 4QP2A 2P4IA 4JS8A 4JXFA 4S34A 4CLJA 3KRLA 2Q83A 3EKNA 2UZEA 2J0KA 3KVWA 5AAGA 4YJPA 2XUUA 3ORTA 3UO4A 4ANLA 5IQEA 3IONA 3OOMA 1SNXA 4C7TA 3KK8A 4UV0A 3VNTA 2J5FA 3FYKX 1RW8A 4C37A 3EQGA 3ZO4A 1H1SA 3G0FA 3CQWA 3IOKA 3LFAA 3LFEA 1PRYA 1WVWA 5AM6A 3ULIA 4NCTC 2WMTA 2IVUA 4GVJA 5CU3A 5AP7A 2OXXA 1UKIA 4KBCA 5AA8A 3AMAA 3ODYX 3QTWA 1NA7A 4IZ7A 2Y4IB 4JL9A 5JRQA 2BZIB 3W32A 2OK1A 3HMMA 5JFVA 5JGAA 2ZV2A 4PL4A 4IAFA 4NSTA 5L4QA 5M4IA 1JSVA 1OZ1A 3E8EA 4IIRA 3QQHA 3QD2B 4YNEA 2VX0A 5EW9A 3F61A 1YI3A 4C57A 3MPMA 3DK3A 3JY9A 1WMKA 2I0YA 2UUEA 3KRRA 5AUZA 5FDPA 1OL6A 4LM5A 1S9IA 2X39A 2HK5A 3ZUTA 2C30A 3KXNA 5EDRA 4FKLA 3DBEA 4O6EA 4ZSAA 3E88A 4FT7A 4RGJA 3QA0A 5E8ZA 3VONA 1OPLA 4QQCA 4EI4A 2E9VA 4AZFA 4FBXA 2W9ZB 4F0FA 3GNIB 2BDWA 1M7NA 2AYPA 2BTSA 3KVXA 4QP9A 2PUUA 4E8AA 5HBHA 2XKCA 4IANA 3FWQA 4LV8A 2ERZE 2WMSA 4DT8A 3NAXA 4O2PA 3FJQE 2YM5A 1Q3WA 3GCSA 4A7CA 1XHAA 2VUWA 4IJPA 2PULA 4PPBA 3PWYA 3TNIA 5AEPA 4X7QA 1BUHA 4M0YA 5E1EA 3TYKA 4R7HA 4DH8A 4GUBA 4RVMA 3MJ1A 3OCGA 3UPXA 3DK6A 5AIRA 4NIFB 3TL8A 4R1YA 4YJUA 4FVQA 4IAYA 5HBJA 5DRBA 2PMIA 4PRJA 4X2FA 5JZJA 1TFFA 2VWUA 1A9UA 4G5JA 3V3VA 3DCVA 4EOOA 1DAYA 2CGVA 2R3PA 3OT3A 1U59A 1URWA 4IC8A 5C4LA 5HVJA 4IVCA 4M13A 4AGCA 1G8SA 5CLPA 4ZZMA 4R3RA 3FLNC 4W8DA 4ASZA 5KKRB 3V8WA 1WBOA 1R0EA 3IW5A 4OTHA 3U9NA 4ERWA 2XK7A 4EZ3A 4O7SA 4AA5A 2Y0AA 3ERKA 4I92A 1W2DA 2UW4A 3R6XA 1FQ1B 5BUIA 5IPJA 4DTAA 4F7LA 3CJFA 4H39A 4EJ7A 5CF4A 2QNJA 4CFMA 4IVBA 4AAAA 3JYAA 4QTEA 5LQFA 1ZYCA 2PVYA 1KV1A 5CF6A 4NFMA 3GFWA 4IQ6A 4CSVA 2W1DA 2GHMA 4M68A 2CJMA 3MTLA 5D7AA 1WBTA 2R3QA 1WBSA 5IH6A 3FPQA 3QHWA 4YO6A 1R1WA 2GCDA 1U5RA 3PSCA 4G5PA 4UEUA 4BDDA 1OGUA 2EUFB 2I1MA 2FA2A 4EK8A 3CGOA 4O7ZA 2C6DA 2UZTA 4ZMEA 2X6DA 2P2IA 3BYOA 2P3GX 3DA6A 3A7HA 1H1WA 3BRBA 4WOVA 4EHVA 2J0IA 4NFNA 4IEBA 1BMKA 1SVGA 3QAME 4PMMA 4ACMA 4L3PA 5EYCA 2UV2A 4NJ3A 4L67A 3ZLXA 5AR2A 4W4YA 4MBLA 4E6CA 4Z55A 3O5AA 2XIZA 3BHYA 3ZO1A 2PU8A 5H2UA 2W1IA 1ZYSA 1Q62A 2ZDUA 3LQ8A 5KMKA 4ENYA 4NL0A 4BCKA 4F9CA 3CY2A 4FKQA 4OAUC 4BCMA 3D2KA 2PMLX 4F70A 5CQUA 3CD8A 1ZMVA 2HW7A 4DEDA 4LOPA 4QDVA 3UPZA 3DQXA 1SZMA 5HICA 5CU4A 2IF8A 3HV3A 5DWRA 4FTKA 2F7ZE 4XS2A 3ZBXA 4GS6A 4PP7A 1ZOEA 1YDSE 3QFVA 3R01A 3KB7A 4RT7A 4CFWA 5KUPA 3ENMA 4O0WA 5LCKA 3BHHA 3F66A 3OUNB 3ZHPC 3PTGA 4E6AA 3DQWA 3R9RA 1GZKA 4U41A 5HCZA 2PVFA 3JPVA 4JX7A 4AP7A 4O4FA 4EYMA 3I7CA 3RM6A 4BZNA 4CFNA 5L2TA 4GIIA 3VHKA 2Q0BA 4ZSGA 3WZUA 5C03A 3W8LA 4EONA 4Z7GA 5JKGA 4PPCA 5IEYA 2IO6A 2XIRA 2A27A 4FZ7A 4I5CA 4YZMA 3VS4A 4AN3A 1W82A 1SMHA 3FC1X 1P5EA 4BC6A 3HMIA 4JR3A 1OM1A 3AGMA 3UNKA 3Q4TA 2UVZA 5LARA 2YFXA 4DEEA 3ORLA 4RFMA 5K3YA 3VRYA 4E7WA 1PXLA 2FSTX 5HU3A 2GMXA 4KS8A 3W16A 1MQBA 1LP4A 5JQ5A 1ZY5A 3B8QA 4C0TA 5CSWA 2W1GA 3GU7A 4AQCA 3UO5A 1G8JA 2PZ5A 4A4XA 2C68A 3THBA 2ITUA 2IVVA 3KCFA 4G6NA 5I3RA 4C58A 3EQFA 5IEXA 5L8LA 2VTSA 4QPSA 1XMMA 1XR1A 5I4NA 3ORPA 2OFVA 5I9XA 4NJDA 2BZKB 4GW8A 5HVYA 3WF7A 5J8IA 2A98A 2C47A 2WTJA 3OT8A 3EB0A 4Q5HA 3A2CA 4JDIA 5ACBC 4A9SA 3KL8A 5LWNA 2BAJA 4U80A 3O8UA 4R1VA 3ZRKA 2VAGA 3SXSA 3IECA 4ANBA 4X2NA 2J90A 4TYEA 3DAKA 1MP8A 3VUIA 3NVKI 5BPYA 4YLJA 4Y72A 2ESMA 2VTRA 4ITJA 4D2VA 5LCJA 4NM7A 2YITA 2PVKA 2V62A 4M12A 4C35A 2RG5A 3GC8A 4W9XA 5L2SA 2BRMA 2QOCA 2GHLA 2WEIA 4C02A 3W0RA 4QMPA 3EQCA 4MHAA 1ZMUA 4EH4A 4P5QA 4RBLA 2QONA 4PMPA 4AXFA 1YQJA 1BL6A 3MBLA 4TYJA