4JDKA

Crystal structure of serine/threonine-protein kinase pak 4 f461v mutant in complex with paktide s peptide substrate
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
288
Chain Sequence
SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGVCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRAAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of a major determinant for serine-threonine kinase phosphoacceptor specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
molecule keywords Serine/threonine-protein kinase PAK 4
total genus 93
structure length 288
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4jdkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4jdkA01
3O96A 1BL7A 1H1SA 2C6DA 3FI8A 3MIAA 2W5BA 3OS3A 4HYSA 5M4UA 2RFNA 4K0YA 4BDJA 4FSZA 1GNGA 5C9CA 4ITIA 5J5SA 1SNXA 1GZNA 3PFQA 2YITA 1NVSA 3PXYA 2JFMA 4JBQA 4U9AA 4X3FB 5C8MA 2XIZA 4IDVA 3ZOSA 3V51A 5H9BA 4AA0A 5HO7A 2QHMA 2JKQA 4IM0A 5HCXA 4GVAA 4AX8A 1QMZA 1ZYSA 4LGDA 5AR5A 3E93A 3IDBA 3VIDA 2WOUA 4JIAA 1ZYCA 3F7WA 1GIHA 4FSYA 4OAVB 2UW8A 2VO0A 3NGAA 4C02A 3QRIA 4Y85A 1YWRA 1FGKA 2XP2A 4O0RA 3PVGA 1ZRZA 4WSYA 4RJ4A 2C3LA 3VUTA 3WZUA 4JVGA 3KMMA 4BR3A 5DR9A 4J53A 4MWHA 1FQ1B 3ATSA 1YI4A 1DI9A 3R9NA 4HVDA 1H1PA 3BEAA 4YUQA 4IAFA 1KE9A 4YZBA 4W4XA 5HNGA 4ANSA 3IW7A 5IQIA 2Q0BA 4JRVA 1H4LA 4D28A 2OSCA 2WFYA 2WTWA 3FY2A 4KKEA 3DKCA 1XBBA 2VTMA 3FPMA 4I92A 4O7RA 3FKNA 1IASA 4QMSA 4APCA 2RG6A 2Z02A 2YIQA 5H8BA 2BKKA 3NUYA 2WQNA 4WD5A 3EOCA 2PYWA 4MF0A 3FLQA 2OJGA 3MWUA 4WRSA 4FSRA 4C2WA 4DH5A 3IW8A 5K9IA 3ZEPA 4BB4A 2W1EA 2HOGA 2OGVA 4AZEA 5M4FA 1KE8A 4ZSEA 2YACA 1P14A 2VN9A 1BX6A 2GDOA 2YWPA 1O6KA 3ORXA 3QRJA 4NCTC 5E1EA 2IW9A 4QMXA 4CYIA 4I3ZA 1NXKA 3ZSGA 3I81A 5JFWA 3DDQA 5K5XA 2P33A 4CT2A 5CANA 3P7CA 5TR6A 3BYSA 2RL5A 4I0RA 3M11A 2GU8A 4QTDA 4ACMA 3ET7A 4XV9A 3G0EA 4UMRA 4D2RA 3SOCA 4DEDA 3ACKA 3G9NA 3VUGA 2E2BA 4H3QA 5LWNA 5J1WA 3DCVA 1CDKA 3FKOA 3I4BA 3L8VA 3SW4A 5BUJA 2B1PA 5F20A 4ZZNA 3SRVA 2XH5A 3V8WA 4ZMFA 4OBPA 4L42A 3K2LA 4OGRA 4MD9E 3JVRA 4ERWA 4P5QA 3GC0A 4O27B 3R02A 4H3BA 4PMSA 4V04A 3QZHA 3SOAA 3QD3A 2UVZA 2OIQA 5JZNA 5GIOE 3W2CA 1Q99A 2R3KA 3DA6A 2YHVA 4IVBA 3KXNA 3QC9A 4IW0A 3PLSA 4QMYA 4CVAA 5IEVA 5L6PA 5IQHA 3FDNA 2BIYA 4XEYA 4BBFA 3CTHA 4D4YA 1SZMA 2B7AA 3Q4TA 4DEGA 1OIRA 4NIFA 3MB6A 4W9WA 2PVKA 3V8SA 5JSMA 4DCEA 2IJMA 4J8NA 3MA6A 2WO6A 4DC2A 5B2LA 3PXZA 3FI3A 4AN2A 2B4SB 4RPVA 3GB2A 4XRLA 2IVVA 5A3XA 1KUTA 3IQ7A 5F4NA 5I3RA 3Q32A 2YM3A 3VQUA 5D11A 4FKPA 4FG7A 4NU1A 5AP1A 4AZFA 3GFEA 3SW7A 4XG9A 3D5WA 2CCIA 2GHGA 4F0FA 2O8YA 4J1RA 3IOKA 4GG7A 2PVNA 3BV2A 2F7EE 2YLFA 3KXXA 4S33A 5HQ0A 4JRNA 3GCQA 2YLEA 2R3HA 4EK4A 5FTGA 3G90X 3QQFA 2JIIA 4PNIA 1GIIA 4H05A 4JIKA 3JPVA 4O6EA 4AACA 3OF0A 2R2PA 1OPKA 4CKJA 3QZGA 3SA0A 4IZ5A 4FZ7A 3RM7A 3FE3A 4FSWA 4FV7A 4RJ8A 3QU0A 2V22A 5C01A 3DS6A 4ZTMA 4LRJA 5AUXA 4QMTA 1PXIA 3F3TA 4DBXA 4K9YA 1U54B 4I21A 4R3RA 3D9VA 5M51A 3LMIA 3PP0A 3Q4ZA 4MD8E 4FNZA 2WEVA 4GW8A 3ROCA 5JGDA 4XYFA 3VS5A 2OH4A 3BKBA 3KN6A 1W0XC 2H8HA 3DNDA 3KKVA 4GK4A 5CSXA 3TT0A 3DXQA 1SMHA 2YAKA 4WT6A 3HMIA 3DFAA 4TTHB 5CF6A 1JKKA 3PLAE 5G6VA 4HGLA 4RRVA 5AUWA 2UW3A 3G6GA 4CZUA 3WZEA 5HIBA 4EH5A 1GAGA 4FX3A 5J9ZA 3PWDA 4RC2A 2CGUA 2UZBA 4CGAA 2WZJA 2UVXA 4A4LA 5HD7A 3KXHA 1JWHA 2QVSE 3MH1A 3UJGA 2XKCA 4E73A 2WMQA 4O7SA 3PY0A 3VW6A 3EKNA 4F9YA 3B2WA 3FMJA 1FVTA 3NUNA 3D15A 2V55A 5M4CA 2QODA 3CD8A 3JS2A 4CQGA 3CKXA 2LAVA 2QNJA 4A4OA 4II5A 4LUDA 4QP2A 2RG5A 5DVRA 4CMTA 3P23A 3A7HA 4GV1A 2BTRA 1CKIA 5C1QB 4FZFB 5CU6A 1OPJA 2W1DA 3UYTA 4KBCA 4TN6A 1J91A 5HLPA 5CNOA 2A4LA 5E92A 2JDRA 4MNEB 2VTOA 4XOZA 5F95A 2OFUA 3V5WA 3KRXA 4IACA 3MI9A 3MY0A 2XK9A 3D7TA 4JJRA 4RA5A 4WUAA 2QR8A 4HVIA 4B99A 5CSVA 2VTHA 5HCZA 4FSNA 3DGKA 4ZS0A 4ZTQA 2WQMA 3FI2A 3SD0A 4E6AA 3R8MA 1H27A 2IZTA 3MB7A 4MAOA 3CJGA 4UYAA 2XJ0A 3LFEA 5BVEA 2FH9A 1OUYA 3KULB 4I6FA 5JRSA 3MJ1A 2KULA 4UX9A 4KABA 5HBHA 3VS3A 5EQYA 4OTWA 1H1QA 3PG3A 4W9XA 5HVYA 5CEMA 4HGEA 1VYWA 2J51A 2UZWE 5TT7A 2CKPA 2BFXA 4EK6A 4ZLZA 4BDHA 1LR4A 4AA4A 3QA0A 4U81A 2CJMA 2WNTA 1E1XA 2BVAA 4AA5A 4EORA 4ANOA 5M44A 5HBEA 3L8PA 2F57A 1M17A 4FKIA 1GZKA 1XBAA 1T46A 2OU7A 5IH6A 3A61A 4O96A 2JDVA 2XNOA 3PZEA 4HZRA 1JBPE 3W2OA 4BGGA 4FT3A 3PJ2A 4GMYA 4MWIA 2Y4IB 4CKRA 5ITAA 1P2AA 5J9YA 2IW8A 2X6EA 3S4QA 4I6BA 3MH3A 1JNKA 4QOXA 2QQ7A 4EI4A 2XIKA 2ITOA 3NAYA 4EQUA 3UQFA 3PA4A 5CF8A 2XNMA 2YJRA 4IEBA 4GKHA 5FP6A 5CAVA 1OBGA 4UWYA 2IVTA 1APME 3TEIA 2BAJA 2HY0A 3PSCA 3E8EA 3T3VA 3WYYA 4EOIA 2ETKA 2PZ5A 2OIDA 2OW3A 3PSDA 3VS1A 1DS5A 3C51A 3SG8A 4ITJA 3QWKA 3AOXA 3QZFA 1XH6A 4EYJA 4UMTA 3WZJA 4PX6A 3F9NA 5FP5A 4D2TA 4BCMA 4D1ZA 1Y8YA 1OKYA 4OTPA 1O6LA 3M42A 3PYYA 3QCYA 4QMMA 3IECA 5C8KA 3GCPA 3E3BX 3SRVB 4BCJA 4DGGA 2F7ZE 5A6OA 3FXZA 3UOHA 4IX6A 4MVFA 4NM3A 1GZOA 3UO4A 2EUFB 2XF0A 4NEUA 3S2PA 4C7TA 4O7LA 3WF9A 1CTPE 3NCZA 1YDTE 3UOLA 5K0XA 3AT4A 3V6RA 3QAME 3ZSHA 5IH5A 4U43A 2X4FA 2J4ZA 4R5SA 4DT9A 4F1TA 3F61A 3QTZA 5CTPA 2CLXA 4FICA 3ZSIA 2GHLA 5FXRA 2ZV7A 3S00A 2RKUA 3V8TA 2YZLA 4DT8A 4G3EA 3H30A 2F9GA 4L67A 1DM2A 3A8WA 3DJ6A 4BWPA 4LUEA 2PULA 3FXXA 3T9IA 4S30A 1J7IA 4ZP5A 3DB8A 4FL2A 1URCA 4AZWA 3PWYA 3KMUA 3G0FA 3QUEA 3KRRA 3MS9A 4X6RA 3RK9A 2QOKA 4KWPA 3DU8A 4Q2AA 2J0LA 3NZ0A 4YR8A 4FBXA 3KXMA 3ALOA 5B2MA 5JKGA 2RF9A 2FSTX 4FKWA 4CG8A 4X21A 5FM2A 2Y4IC 5FWKK 4PL4A 5HBJA 3DBDA 2GS6A 4F0GA 2EXMA 2GCDA 3L8XA 5HESA 4I23A 4L9IA 3TCPA 3VUMA 4Q9ZA 2WHBA 2OJJA 3QGWA 3R6XA 2XKDA 3C4CA 3FWQA 3UZRA 1OL6A 5FM3A 3C5UA 4R77A 4XV2A 3D5VA 3MVHA 4GEOA 3R7OA 2W1IA 4DEIA 5AX3A 2VZ6A 4DH1A 3HV5A 3RWPA 2P0CA 2ONLC 4EOQA 3QCSA 3SGCA 1QPDA 4ZTSA 4G6NA 1Y91A 2RFEA 3EFJA 3LFFA 5GHVA 2BDFA 1Y6BA 3DQXA 4BDBA 4ZJVA 4MD7E 5HX8A 4GSBA 5IQEA 3QYZA 4GL9A 3RWQA 4EKLA 2YM7A 3AC8A 4ACDA 3BRBA 4C3PA 2QOLA 5AP6A 3PVBA 2IW6A 1I44A 3NUUA 4YLJA 2DWBA 3TN8A 4JR3A 2UW7A 4GH2A 3RAWA 2W9FB 2PVRA 2VTJA 3BGZA 3KULA 4X2KA 3W2SA 2Y0AA 4TWOA 2ETMA 4XBUA 3TNIA 4LOQA 2OJFE 4FVPA 5A14A 3D14A 4ENXA 2GS2A 3DZOA 4FV2A 4MXXA 3H4JA 3P86A 4IMYA 2CHLA 3F7ZA 2IO6A 2X7GA 4O22A 4ANNA 4UZHA 3R73A 4A9YA 2BZJA 5D41A 3HRBA 4IVDA 5ACKA 2YCSA 3NUXA 3ZO4A 2R3IA 4ORKA 2WMSA 1GIJA 3GNIB 3FQHA 4W4WA 5CT0A 4U5JA 2OK1A 3QFVA 2VGPA 4YO4A 2BRHA 4ZSAA 1ZOHA 2CN8A 3OD6X 3OXTA 3MFTA 5ETCA 3VVHA 1WVXA 4OLIA 1SM2A 1WMKA 2B9IA 3NUPA 4RIYA 5FGKA 3VBYA 4O21A 4M3QA 3CGOA 4BF2A 4ACHA 2H96A 3PXKA 4BBMA 4FTLA 5ICPA 1YW2A 2XK3A 5IQBA 3D2IA 2VNWA 4BZOA 4WIHA 1TQMA 2F4JA 2R3OA 5LVLA 2X39A 4BCGA 2PZPA 3NEWA 3IONA 5EQEA 2Z7QA 5DWRA 2XJ2A 3QTIA 3TDVA 2Z7SA 5KZIA 3JUHA 1PW2A 2WIPA 4C4FA 1OITA 1LUFA 2BDJA 4O83A 2VWYA 4DA5A 4UY9A 2BRNA 5BVWA 1PMVA 1ZAOA 4RA4A 5KZ0A 4F63A 4CFFA 1M14A 2ZM4A 4BGHA 2C0OA 3FV8A 4ZY5A 3EMGA 4YZ9A 4ZTNA 3E3PA 3EQRA 3KRJA 5AX9A 5I9VA 3U51A 5J8IA 1E1VA 4IDTA 2CKEA 1BI8A 3VQHA 3W10A 4D1XA 5TKDA 2C3IB 3TIZA 1ZY5A 2FB8A 2GNLA 3PVWA 3JR1A 1WBTA 4GCJA 2GTNA 4HOKA 5KMKA 5BVFA 5HU9A 3KCFA 5JRQA 4P4CA 5LWMA 5BYLA 1H25A 4U97A 3RZFA 4QQTA 2VV9A 2VTNA 5CNNA 4R3PA 4JDHA 3E5AA 2OJ9A 3ORNA 1LEZA 2VWBA 3GOKA 3QX2A 4AGCA 2WTKC 4NKSA 4F6SA 3HP2A 4MBLA 5BYYA 3FUPA 3HV4A 2VX1A 4IAAA 1XWSA 1PMNA 5HD4A 5I9YA 2ONLA 2A2AA 4OTGA 3QD4A 3V5LA 3EYHA 3Q3BA 3KGAA 1CSNA 3ORLA 4JOAA 4IANA 5AMNA 4EOMA 3UDBA 2VWIA 2VX3A 5CLPA 4UWBA 4PY1A 4D9TA 4IC8A 5DG5A 4K33A 5AP5A 2BPMA 4C59A 1AGWA 4DFLA 4QMWA 3RINA 4OW8A 4PP9A 4ANQA 4DHFA 1J1CA 3R1QA 1DAWA 4FE2A 3DJ5A 3DKFA 4HCTA 4JQ7A 2ZYBA 3OMVA 4FK3A 4FSUA 3PRFA 2R7IA 1JLUE 3HLLA 2C6OA 4RT7A 5LCKA 1PJKA 4NYEA 4JG7A 3BU5A 4DFXE 3OWLA 4NK9A 4WSQA 3B8RA 3GCSA 4C35A 4F9AA 5JQ5A 4MCVA 3UPXA 2UW4A 3R8PA 1ZOEA 3QQGA 4O1PA 5AA9A 3TM0A 1OKWA 3NVKI 2IZRA 4PTEA 5EH0A 2J5EA 3LW0A 5HNBA 5KMOA 3T8OA 2HZ4A 2C69A 4X3FC 4ID7A 3REPA 3SVVA 2Z60A 4EOPA 4C33A 4QQ5A 4QMLA 4RMZA 1YRPA 1R39A 2NNWB 4A9RA 3UIXA 5IQCA 1M2RA 4MH7A 1LEWA 4FL1A 5BVKA 3C4XA 2BHEA 4GUEA 2R3FA 3TACA 2O2UA 1SYKA 2ERKA 3BYUA 2VWXA 3P7BA 4FNWA 4QTAA 3K3JA 5CVGA 4ZOGA 4BYIA 5CU4A 5I5ZA 3FMMA 5EM6A 4F4PA 4FI1A 3H0ZA 4YNEA 3SX9A 4U0IA 4CFMA 2ZMDA 2YABA 2YDIA 5AUTA 3I7BA 3JVSA 4QP8A 3HV3A 3VUKA 2XYNA 2JLDA 1U54A 4FEWA 4DFZE 4AOIA 4AG8A 4F0IA 4GJ3A 5DEWA 3Q60A 3U9NA 3FMHA 2XBJA 5CF5A 4J7BA 2QO9A 4GFGA 1ZY4A 3ROYA 3OY1A 3LXKA 4NM7A 4APPA 2JBOA 3D83A 1J7UA 2WTJA 4FV0A 3EB0A 4UV0A 1XHAA 4IWDA 5FXQA 4EC9A 2YM4A 3SC1A 4G31A 4GVJA 1S9IA 3DAJA 4K11A 1ZZLA 4EOOA 2PY3A 3VS4A 5E8ZA 4E6QA 3KXZA 5AR3A 2PMOX 3OP5A 1M7NA 3KA0A 3G2FA 2G2HA 5E8WA 4G3CA 4RQVA 5FEEA 4ZJJA 1M52A 4RWKA 3W33A 4BBEA 1Q61A 5AEPA 3DQWA 3FMLA 5J9LA 4R7HA 3FHIA 4QMOA 1B39A 4MKCA 4G9RA 2PZRA 1GJOA 4DAWA 4LFIA 4MK0A 4PMTA 5BUIA 1REJA 5I0BA 3MA3A 2GSFA 4FV4A 4PF4A 2P3GX 2EB2A 2XCHA 3Q6WA 4R7IA 5A4CA 2W17A 4O38A 5CSPA 1H1RA 3VWAA 3AMYA 3BQRA 3P78A 1XQZA 2I1MA 5A6NA 3Q96A 5DE2A 2QU5A 3HX4A 2BRBA 4YHJA 3GOPA 5IA0A 4IVCA 3ZZWA 5KO1A 3FZSA 4M66A 3ZH8A 4KRCA 4AGWA 5A46A 3MPTA 2VTRA 3HMOA 2BROA 4FKVA 3AC4A 3ZMMA 2I7QA 4EHVA 4LYNA 1REKA 5E9EA 5E7RA 1OKZA 5C4KA 5EYCA 3GUBA 4YHFA 2Y8OA 2VUWA 3A7IA 3MGYA 2XRWA 5AIRA 2B9FA 4MF1A 4PDOA 5DT0A 4QTBA 4XP3A 5HO8A 5DR2A 4B9DA 3R30A 3R1SA 4R5YA 5AADA 2WMRA 2C5VA 3CJFA 3GXLA 2YA9A 2PZYA 2VO7A 4FZ6A 3PUPA 3DDPA 3TI1A 4Y95A 1VJYA 4RC4A 4DGOA 4F6UA 1OB3A 4C4IA 2UZVA 4DEAA 1W7HA 1OVEA 5DRDA 4C57A 4L46A 4HVHA 4FT9A 2CMWA 3UMXA 3HGKA 4DG3E 3ZRLA 4WOVA 3BCEA 2V0DA 1NA7A 4Y46A 4YZCA 3EWHA 5C27A 3UZTA 4W4YA 3F3VA 4Y73A 4QTCA 3V5JA 2WEIA 1U59A 2I0VA 3TJCA 3DLSA 3L1SA 4C38A 3R04A 4E4LA 3OW4A 2OH0E 5CF4A 3GC9A 3BHVA 3OFMA 4MQ1A 3LZBA 4HNFA 2ITQA 3PTGA 3QTSA 4ALVA 1WCCA 2ITXA 4X2GA 3OCBA 5HIEA 1UNGA 4TWPA 2WD1A 4MXOA 5LARA 4EWHA 5BVDA 5L3AA 3PXRA 4FUXA 4N0SA 5JZJA 4B4LA 2W1HA 3FJQE 3FY0A 4FKRA 3SXSA 1RQQA 3C4EA 3C7QA 3LXPA 3C0GA 3NDMA 4LRMA 1P4FA 4W4VA 4E26A 1Q5KA 2JITA 3CQEA 4FTUA 4XJ0A 4IAZA 3RAKA 4BDGA 2WMUA 4XBRA 4Z3VA 4JG8A 4TNBA 5FG8A 2PUUA 4TXCA 2Y6OA 3O7LB 4E20A 4CCUA 5DBXA 4X7QA 3H3CA 4U41A 5EK7A 3O8UA 4LGHA 4C4GA 3QRKA 3LKMA 1MQBA 3K5VA 4CCBA 4N6ZA 1FMKA 1XH7A 3I0QA 4FTCA 3A7JA 2YCQA 3NW6A 3L9LA 4YJNA 5CZIA 3HRFA 4Z7HA 1CKJA 4QPMA 5DHJA 3U6IA 4FNXA 3BX5A 5EI2A 3TNPC 3GU5A 4HYIA 4D0XA 3E63A 3P1AA 2Z2WA 5EM8A 2C6IA 2QKWB 3TDWA 2C0IA 3FZTA 4X6QC 3PG1A 4EHZA 3A4OX 3ITZA 3Q2JA 3FC1X 4QO9A 5LCJA 4XLIA 3NIZA 4L44A 4USFA 4Q5HA 4OTIA 4QMNA 4I0SA 4E7WA 1UU7A 4FTAA 2VD5A 3AC1A 4QYHA 1OL5A 1STCE 3BIZA 2ZOQA 3QD2B 1PYEA 2BZIB 2JDOA 4EC8A 2VWUA 5J95A 3KXGA 3NAXA 4M68A 3R9OA 4BCOA 4F64A 2JDTA 3EQBA 3RMFA 3KFAA 4NL0A 1LPUA 3LLAA 4ENYA 4JQEA 4MQ2A 2E9UA 3JXWA 4KRDA 4MXAA 4LM5A 1YHWA 2GNIA 4HGTA 3D2KA 3QKKA 5D1JA 1H08A 4IAYA 3VRZA 3EQFA 4UXLA 3OWPA 4IX5A 4QP9A 5AAFA 3I79A 4TY1A 4RWLA 5AR8A 3RPVA 3DTCA 3IDCA 3LM5A 4FT0A 1Z57A 4MXCA 4F9WA 4O7NA 4V01A 2J0IA 2ETRA 5EI8A 4YURA 4RIXA 4G5JA 3LQ3A 3HVCA 4XRJA 3R7VA 4DH3A 4JL9A 3P7AA 4E3CA 4KIOA 2C4GA 2R4BA 4L43A 4NUSA 3NRMA 4D55A 1DAYA 4YLLA 3RVGA 5BYZA 3T9TA 3ZUVA 5KMIA 4TT7A 2HENA 2F49A 3DTWA 3NIEA 4FTOA 2OZAA 4IC7A 4JDKA 4I6HA 5EW3A 3ZLXA 4D2VA 2QKRA 4EWQA 5HNIX 2X7FA 2XNEA 2NP8A 3IGOA 2W7XA 3OBGA 4AW0A 2JAVA 3EJ1A 2O63A 3F3ZA 3MPAA 2ZJWA 3VHEA 2DUVA 3D94A 5IKWA 3MW1A 3C0HA 2JEDA 2WU6A 1ZARA 2X8IA 4J52A 5LMKC 3AT2A 5G1XA 2OF4A 2OLCA 4ZZMA 4C4HA 4FR4A 2BZHB 4QPAA 4YJQA 3AQVA 3NYVA 3ORZA 3OT3A 3RPRA 4WHZA 3R28A 4Q9SA 2BDWA 4HVSA 3KL8A 3TTJA 3FAAA 1ZYDA 2HW6A 5LVOA 5FDPA 4IVAA 4D4SA 2YJSA 1HCLA 2QHNA 3GU4A 4HJOA 3UG1A 3BU3A 3RP9A 3VHKA 2XA4A 5DT3A 2HZ0A 5KE0A 5LVPA 1RW8A 4ZMEA 4RIYB 4QP4A 5FXSA 3O2MA 1R78A 2GNJA 3KMWA 2JBPA 3GGFA 4RFMA 3QLGA 5TOZA 4ACGA 5LQFA 4GFMA 1H8FA 4O0XA 4BIEA 4KIKA 3LAUA 1BKXA 3KU2A 4RX7A 4A9UA 3N51A 3MTFA 2ERZE 3ODYX 4IB0A 5FTQA 3QZIA 2WQEA 3EN5A 4FYOA 3LJ1A 1Q24A 2XIRA 3DXNA 3W55A 3BWFA 2I0EA 3E8NA 4U44A 3UNJA 2DS1A 4D0WA 4O7TA 5FUTA 1B6CB 3FSKA 3NYOA 3HA6A 4XMOA 3SXFA 1YOJA 3UVQA 5JN2A 3S3IA 5HCYA 3ORMA 4I5HA 3F6XA 1M2PA 2OI4X 4LL0A 4U79A 1UWHA 3R71A 5D7VA 1XH8A 2EVAA 2QLUA 2YIXA 2WTCA 3GC7A 4BCHA 5K4IA 4I5MA 3U4WA 4AT3A 4EJNA 3UQCA 5GIPE 4JT3A 5HG7A 4CLJA 4FG9A 1FINA 2WQBA 3TV6A 3WF5A 4AN3A 3FZRA 4CQEA 3EZVA 3WZDA 5T3QA 3R00A 2PVLA 4HNIA 4BDKA 2J5FA 4XV3A 3KVXA 3BLHA 3DNEA 2PE1A 3FMNA 5ANOA 1KE7A 4YTIA 3Q04A 1T45A 3HP5A 2CN5A 5HKMA 4BVUA 2UW6A 4C4EA 4DINA 1HCKA 3ZDUA 1YQJA 4DLIA 4J95A 4J71A 3NNUA 3V01A 1YXUA 5CAUA 4QMZA 3EZRA 2CGXA 4BZNA 4ZTHA 2BFYA 2XM9A 3GU8A 3TNQB 2BRGA 3QQJA 3Q9WA 4NM0A 2ACXA 4FSQA 5HHWA 3WF6A 4BIBA 3C50A 5DA3A 1OMWA 4RSSA 5ETAA 5T68A 3TZMA 1UNLA 4Y5HA 3EYGA 1UU3A 4YJOA 5HVJA 3TKHA 2EXEA 3QCXA 2XEYA 3P4KA 4NSTA 1OKVA 5CU2A 4NH1A 5JFVA 3UO6A 3F5UA 3Q9ZA 4J8MA 2J0JA 4TYJA 2GQRA 3WILA 2XKFA 4RQKA 3POOA 4O0VA 4E93A 3BHYA 3F3UA 3CC6A 3ZFXA 3R01A 3COKA 4EK3A 2PUIA 5DT4A 4AFEA 5EOBA 3VBWA 4AZSA 4AF3A 3UOJA 4ZLOA 2I6LA 2BALA 3MFSA 2RIOA 3QTWA 3QYWA 3EFWA 3FC2A 4IAKA 3ZLWA 4BTJA 2NRYA 4R6VA 5AUZA 4I4EA 4OR5A 4O0YA 2YCFA 3GEQA 1JOWB 3HV6A 4FEVA 3TG1A 5GJFA 5M57A 4FG8A 4GIIA 5TO8A 2VTAA 1F5QA 2ZV8A 4FVQA 3PDTA 3O8TA 1XBCA 2VO6A 3QKMA 2IZUA 3QTUA 2C0TA 4RIOA 3BHUA 5DNRA 3HDMA 3A7GA 3EN6A 1GY3A 4IH8A 4LI5A 5AP3A 4KSPA 4RG0A 2QONA 4YMJA 5AUUA 3F2NA 5DH3A 3GQLA 5IMXA 4FZDB 4MX9A 3G6HA 4EONA 1JAMA 3BPRA 3AT3A 4DTBA 5LJJA 5GJDA 2GHMA 4BCKA 3FLSA 3MTLA 5CS6A 1R0PA 4Z7GA 4X2JA 5IH4A 3QF9A 2G01A 3H9FA 4YC8A 4ANLA 3NNVA 5HE1A 3TNWA 5K0KA 3TIYA 4CMUA 5B7VA 4WNKA 4DEHA 1A06A 4P7EA 1MUOA 2BAKA 5HE2A 5J79A 4FKQA 2X9EA 3UP7A 3JY9A 4DEEA 3R0TA 4ASZA 4YGAA 4H58A 1YKRA 2R3QA 4U8ZA 4HVGA 3OY3A 3JY0A 1R0EA 3PJ8A 4M15A 4FTNA 4KIQA 1WAKA 4GU9A 4KS7A 4M97A 3TV7A 1CMKE 4CT1A 1TVOA 3H0YA 4LV5A 4NCTA 5BVOA 5AFVA 3GP0A 3QHRA 2WMXA 4O81A 3RHXA 1RDQE 2UZEA 2WOTA 4OTRA 2HELA 4TYEA 1PKDA 3NLBA 3EQDA 2RGPA 3Q53A 3D5UA 3ANRA 5GZ8A 2R3PA 5IEYA 3GT8A 3HEGA 4DITA 4G9CA 4B8MA 2HXLA 1KOBA 2OWBA 3P08A 3O51A 3A8XA 4KSQA 4PMMA 4TYGA 5AR7A 4BCNA 4EK8A 5BUEA 5F9EA 4P90A 5LOHA 4FKGA 4BDFA 4DBNA 4TPTA 3VAPA 2QO7A 3F88A 3K5UA 4RVMA 4K1BA 5HU3A 3QHWA 2ZDUA 3DK6A 2QURA 2JC6A 4PPBA 4F1MA 4EZ5A 2WMAA 5JQ8A 3LJ2A 2NO3A 3MY1A 4YSJA 2YIYA 4OBQA 2W5HA 4F1OA 5I9ZA 2OXDA 4YJUA 4YSMA 2HAKA 4JS8A 1JSTA 4E4MA 2X1NA 3TUDA 5HLWA 5L4QA 4JAIA 5KBRA 4O84A 3QQUA 4YU2A 2R7BA 1G8SA 5CENA 1WVYA 3V5QA 1YOLA 2ZVAA 3QC4A 1OGUA 4E5BA 1I09A 1XJDA 1Z9XA 2VTIA 2WGJA 3CE3A 3PA3A 4G3DA 4X3FA 4YPDA 4AFJA 4KBAA 4MXYA 1H26A 4IWOA 4X2NA 5LMAA 4KAOA 5JFXA 3C4WA 4Y83A 1YHSA 4BRXA 3IK3A 4C61A 1UNHA 2AYPA 2BRMA 3G9LX 5EYKA 1UKIA 2XRUA 3ZTXA 4AZVA 3UIMA 1NVQA 3FYJX 2R3RA 5CSWA 5FLFA 3IW5A 3VBTA 4AE9A 4AS0A 4D4RA 2HY81 4DFYA 4EOLA 3Q5ZA 2HWPA 3FKLA 3TUBA 5J7BA 1AQ1A 4XG3A 3IDPA 4CXAA 3UOKA 3PE2A 3BBWA 1PMEA 2QI8A 5ETIA 1V1KA 4FSTA 4YZNA 3WBLA 4AW1A 3HUBA 4IZ7A 4O0TA 3MFUA 2FUMA 4IM2A 3EFLA 3BYMA 4CRSA 2OZOA 4EHEA 2PL0A 4ZAUA 1M7QA 3CLYA 4JXFA 3NCGA 3EHAA 2ZMCA 4L3JA 4V05A 3VBQA 4EOKA 4RGJA 5EM7A 3ZZEA 5EKNA 4KIKB 1WBSA 3OOGA 4CKIA 5HVKA 4G16A 4G17A 2UZLA 3PRIA 5HE3A 3WIKA 4YTCA 2LGCA 3L9PA 3PIXA 3OUKA 3R2YA 4L6QA 4Y5QA 5CEIA 4YO6A 4C8BA 4XG4A 3BWJA 4AQCA 4A7CA 5KNJA 2O5KA 3QA8A 4JBVA 3E7VA 3MESA 4KBKA 5AM7A 4QD6A 3EQIA 2W1CA 2OBJA 3OROA 3QTRA 2BHHA 2OKRA 5IDPA 2OXXA 3COMA 4I4FA 1BMKA 1UU9A 2C3JA 4C36A 1VEBA 3NW7A 4O0SA 4BTFA 3NUSA 3W2QA 2PWLA 2G1TA 3HZTA 4JBOA 3VULA 4GT4A 4CFUA 2JIVA 5A4EA 1SVHA 2XNNA 5L2WA 5J5TA 5E91A 4FL3A 3Q4UA 1JVPP 3CQWA 4QYEA 3SG9A 3R9DA 3CPBA 3AMAA 3EN7A 2XUUA 2H6DA 3QUPA 5AM6A 2OXYA 3FSFA 2VTQA 4I20A 4LV8A 4F9CA 4XUFA 1TQPA 4EBWA 1BI7A 1OZ1A 1A48A 1WBWA 5CI6A 3AC2A 3O7LD 5ANDA 5E1SA 3MH0A 4USDA 5HX6A 3MVMA 4RIXB 4HCVA 3U55A 2XZSA 5EOLA 3DK7A 2C6KA 3EIDA 4UEUA 1OECA 2VWWA 3E92A 4AUAA 4QPSA 5E8XA 3R8LA 2W0JA 1FBNA 1PRYA 4E5WA 4EL9A 4MHAA 3RI1A 4DFUA 4JG6A 4NT4A 3NUAA 5CZHA 1ZLTA 4H39A 5I9XA 3C1XA 1QPJA 3PPZA 5FQDC 3GENA 2AC3A 3ELJA 2UVYA 2KTYA 4IZYA 4C3RA 3PJ3A 5K3YA 3U6JA 2JFLA 2OG8A 3RCJA 3ZLSA 4ZY4A 3KEXA 3ZLYA 2B9HA 3WE8A 3MV5A 3THBA 2YDKA 4EK5A 5C03A 1IEPA 2QOIA 3CIKA 3Q9XA 4QMVA 2WMWA 4D58A 3CTJA 1O9UA 1PXLA 2V62A 1F0QA 3OCGA 4EH3A 3DBCA 5IDNA 3P79A 3COIA 1JSVA 3P9JA 2ZM1A 4FTIA 4N6YA 3VN9A 3NVMB 3FZ1A 1L8TA 4M12A 3U8WA 2QD9A 2NPQA 2X6DA 3BI6A 3A99A 3NNXA 4KB8A 1ZMVA 4LOOA 3OHTA 4MBJA 4NZWB 3U9CA 1Y57A 5HTCA 3OUNB 1OL1A 2WTIA 4RLKA 2F2CB 5E8UA 2G9XA 4FTJA 4A9TA 4CZYB 4D4VA 2WMTA 2Y6MA 5HGIA 2YCRA 3BE2A 3M1SA 4O7WA 4FTQA 2R64A 1PXKA 4DFNA 4PL3A 4FT5A 3NS9A 3OT8A 4JX3A 3ULZA 3WI6A 3QL8A 4MXZA 3CXWA 3WARA 4E5AX 5L2TA 4A07A 3TZ9A 2W1ZA 3U6HA 4RFZA 5AV3A 3UPZA 2ZB0A 3KC3A 3QWJA 4AGUA 4CFVA 2GQGA 4XP0A 4S34A 5AUVA 3HMPA 3I6WA 2PZIA 3LCTA 3RAIA 4YC3A 5F94A 1ZWSA 3ATTA 4CV8A 3C13A 3NWWA 3ZONA 4HW7A 3K54A 4BDDA 4XG7A 4NFMA 4USEA 4FKSA 5L8KA 4GK2A 4YZMA 4AT4A 4BI2A 4CTCA 4F7LA 2E9OA 4BY9E 3MY5A 5E90A 5CAPA 3PP1A 2EWAA 4BKJA 1NW1A 1IA8A 5AAEA 3RK7A 2PVJA 1Z5MA 2ITYA 2QOBA 3OZ6A 2OZAB 4EQMA 4UMUA 1V0BA 2C1AA 4H1MA 4H3PA 5BX0A 4QNYA 2OICA 2WTDA 3LFSA 4RX9A 3ORTA 3UODA 4U3ZA 4ZSLA 4DG0E 3R7IA 4BGQA 4EH9A 2FSLX 2VAGA 3BEGA 3CD3A 3F3WA 3LFBA 4FYNA 4C4JA 4D2WA 5DEYA 3CTQA 2X0GA 5B0XA 3ZO3A 3SDJA 2W1FA 5H2UA 5ANGA 4DEBA 2QOQA 2JKKA 1KV1A 2GFCA 1YVJA 3PXQA 5HZNA 4AWIA 4EH4A 5CASA 4LMUA 2C3KA 5KMLA 4A9SA 4O7VA 3AMBA 2UV2A 3ENHA 3F82A 4L00A 4I24A 1OL2A 4CRLA 3CPCA 3KF7A 3TZ7A 3DBEA 1YHVA 4NTSA 1Q8UA 4FV1A 1P5EA 5A4QA 3BYVA 2HWOA 3ZM4A 5L8JA 2Y9QA 5AJQA 3ID6C 5KMJA 4ZIMA 4BCPA 4FIFA 1Q3DA 2WB8A 3QX4A 4WO5A 1Y6AA 4XP2A 3RPSA 4A06A 3LCDA 4IXPA 4S2ZA 4CEGA 2B0QA 5AP4A 2OF2A 2ITWA 4ZLYA 3FLWA 3D7ZA 3CKWA 4QYYA 2P2IA 2C6LA 3ZYAA 4ANBA 1JSUA 3COHA 5DPVA 4L52A 3S1HA 2Q0NA 2J50A 4G34A 2PK9A 4K2RA 1Q8TA 1Q62A 1YXSA 2VO3A 2C68A 3DY7A 1V0PA 2C1BA 3AD4A 4IJPA 4RVTA 1NY3A 5DGZA 5H8EA 4ASEA 1QPEA 2WMVA 2QOCA 3EN9A 2QG5A 4PDYA 1FMOE 5DRBA 3UIUA 3II5A 1Q41A 2ESMA 5AP2A 2IG7A 4TYHB 4GYIA 2E9VA 4C62A 1X8BA 3BQCA 3LM0A 2I40A 2FSMX 2X4ZA 3BE9A 3RNIA 3LPBA 3VBXA 3WIGA 4QQJA 3VF8A 1U5RA 2J0MB 3DFCB 3HDNA 1YXTA 4JX7A 4EUUA 3EFKA 2FO0A 4XS2A 4DN5A 1ZYJA 3ETAA 2YDJA 3R22A 5DIAA 4EUTA 4F08A 4XG8A 4NW5A 4YTFA 2RFSA 2XNBA 2XK4A 1VR2A 4AOTA 1MRUA 2HYYA 4BHZA 2I0HA 4NJ3A 1W83A 3ERKA 3OBJA 1R1WA 4FKLA 3FI4A 4EH8A 3TKUA 4FIJA 3DT1A 2VTTA 4UB7A 4DH7A 4YBKA 5CU3A 2C30A 1S9JA 3UMWA 5EFQA 2W1GA 4V0GA 3CQUA 4HYHA 5C4LA 3RNYA 3NYNA 3RALA 4I5PA 4XCUA 4F09A 3LJ0A 5BNJA 5LMKA 4QQCA 2XK7A 3O50A 2HCKA 4QMPA 4DYMA 1WBPA 3ZU7A 4IM3A 4P5ZA 5IUHA 4G5PA 1WVWA 4LQMA 5AAGA 3FPQA 5LMBA 2BCJA 4FV3A 2IN6A 2H9VA 2B52A 3H9RA 1YI3A 2AC5A 2ITUA 4J97A 4FTMA 1EH4A 4IJ9A 4OTFA 4TWCA 3E64A 5H3QA 5AIKA 3BHHA 4U42A 3BV3A 3FYKX 3NYXA 4YPSA 4WG5A 5AR4A 3DKOA 4PWNA 2PMIA 2J6MA 4CSVA 2O64A 1PMUA 5IUIA 3KRWA 2FGIA 3E8CA 3V04A 4EHGA 3Q6UA 4RZWA 4O7ZA 2CGWA 3B2TA 3QD0A 4IFGA 4L53A 2UW0A 1V0OA 3EL8A 4ALWA 1W82A 3FBVA 3LLTA 2WKMA 3L8SA 2B55A 4ONAA 3VS7A 4DFBA 4IADA 4ZTLA 4KKGA 3Q4CA 3CP9A 4JDJA 3W2PA 3PVUA 4EH6A 4D5HA 3R8VA 1XH4A 2CKOA 3UTOA 5CALA 4P2KA 3UE4A 2Z7LA 4O0UA 4C37A 2QOHA 3I5ZA 2R3GA 4KD1A 3CS9A 5CEKA 2YN8A 3R83A 5EYMA 4R7BA 3IKAA 5BPYA 2PVMA 3N4VA 4IE9A 4AZTA 2E9NA 4QP6A 3JYAA 2QOOA 4RWIA 3VBVA 4KINA 2O3PA 5EG3A 3F5XA 3V5PA 4FNYA 3VRYA 4G6OA 4E6DA 3RM6A 3OWKA 2IPXA 5AV0A 3CY3A 3M2WA 2WU7A 2BTSA 4NWMA 4J98A 4Z55A 1PKGA 3OEFX 2IWIA 4GT5A 3HL7A 3SQQA 4I94A 4M69A 2CNQA 4HCUA 5E4HA 4A4XA 4BCQA 3R63A 2IVUA 4ZZOA 5BMSA 1K2PA 3RBWA 3RJCA 2GNFA 2WELA 5J1VA 5CVFA 2ZV2A 2PHKA 5FTOA 2CGVA 4CYJA 4BYJA 2QU6A 3BLQA 2HZNA 4UMQA 5DI1A 4DGNA 3S95A 4JDIA 4M0ZA 5FBNC 3DV3A 3GVUA 3IPHA 4M8TA 1IR3A 4OBOA 1XKKA 4FIIA 3N4UA 2A0CX 3QQLA 3ACJA 2FSOX 4F9BA 3LCSA 4RBLA 2XIXA 3ZFMA 3FEGA 2JIUA 3C4ZA 5M53A 5HG5A 3PIZA 2X7OA 4R3CA 3UVRA 5JMSA 3UNZA 3W18A 4WBOA 3VW8A 4Y8DA 3E7OA 5KUPA 3PZHA 4PUZA 4PV0A 2YM8A 3LXNA 5KHWA 3I6UA 3RK5A 3ORIA 2HXQA 3U87A 4CG9A 4U6RA 3VS6A 3U4UA 5I3OA 3RGFA 1AD5A 5DYJA 1G3NA 1PXPA 4FV6A 4RJ5A 4WG4A 4AAAA 4FOCA 4Y72A 4JQ8A 3HAVA 4BDAA 2PVHA 2ITZA 3UZPA 3FHRA 4W8DA 1IRKA 5EI6A 4LG4A 4ZJIA 1PF8A 5JGBA 1OUKA 4O82A 3C9WA 4UMPA 1WFCA 4G6LA 1YXXA 3FMKA 3QGYA 4U80A 2F7XE 5A4TA 5EKOA 2CLQA 4X2FA 2CSNA 3TKIA 4X0MA 5EHYA 4AW2A 3L9NA 1UWJA 3P5KA 4E4XA 5L8LA 4EZ3A 2XS0A 3OXZA 3UO5A 2FYSA 2F2UA 2R0UA 1H00A 4HPUE 4IB1A 4CMOA 5IPJA 5IQDA 5EYDA 5CI7A 5FBOA 3W16A 5LXMA 3BU6A 4RX5A 1VZOA 4AXAA 4PP7A 2AUHA 1SVGA 4ZXTA 4GJ2A 4DTAA 2V7AA 4BKYA 5L2SA 1DI8A 5JH6A 5HICA 1MQ4A 3LFNA 2R3LA 3E8DA 2PSQA 4H1JA 3ZRKA 2XEZA 2G2FA 4CFWA 4KNBA 3VNTA 4BICA 5CQWA 4FTKA 4IB3A 5DMZA 1WBOA 4PQNA 3PXFA 4K8AA 4PTCA 4FA2A 5AP0A 4C0TA 3R7EA 4F65A 2VTPA 4R8QA 4L45A 4AOJA 3ZC5A 4ANMA 3KRLA 4XX9A 5IEXA 1XH9A 4BI0A 3NW5A 2V7OA 1Q8YA 4WG3A 5IA5A 4NTTA 3UVPA 3ORKA 3ZEWA 1MRYA 4F6WA 2PVFA 4WRGA 5GNKA 4DE4A 3QCQA 2J9MA 2PUPA 2EXCX 4GYGA 4OTQA 4ARKA 3LVPA 4XHKB 2QCSA 2ZAZA 4FODA 4K77A 3OXIA 3GCUA 5CQUA 3ANQA 2ZDTA 4HPTE 2UUEA 3UP2A 3HRCA 4IFCA 1FVVA 2H34A 3A62A 3R1YA 3IW4A 3KVWA 2YZAA 5T6KA 3W8QA 4PMPA 5BVNA 5KKRC 5E8TA 4RFYA 4R1VA 3LFQA 4FKOA 5J7HA 3U54A 1PXOA 1R3CA 4E4NA 5BQ0A 3MDYA 1YOMA 3HECA 4D2SA 1G5SA 2WAJA 3AC3A 2XIYA 4UYNA 3W8LA 4EBVA 2ITVA 3CGFA 4LMNA 3QRUA 5L6OA 5HG9A 3ZDIA 1BL6A 2JDSA 2UZUE 4M14A 4L8MA 4IB5A 3RCDA 5I9WA 4M67A 4FTRA 3VO3A 3TUCA 3RPOA 3GQIA 3FZPA 3LMGA 3RPYA 4E1ZA 3G5DA 3QTQA 2C5YA 2YEXA 3KK9A 5A9UA 4I22A 3B8QA 4O2ZA 4IWPA 4RWJA 2G15A 4TW9A 3FQEA 3K3IA 4LGGA 2GMXA 2ITNA 2BUJA 2CCHA 5KBQA 4BDIA 1FGIA 4I41A 3E87A 5AP7A 2WMBA 5IMEA 5TF9A 3QLFA 1J7LA 5ANJA 3IO7A 2R5TA 2ZV9A 3QUDA 4WNPA 4I5CA 5AWMA 1OIUA 1UV5A 2XK6A 3E62A 4IWQA 3R8ZA 1XR1A 3MVJA 1PXNA 4FV8A 4K6ZA 4D5KA 3NX8A 5M56A 4BWKA 2P4IA 1U5QA 1G8AA 3ZUUA 1KE6A 5CEQA 4FMQA 4ERKA 4LRKA 1Q8WA 4YC6A 3C0IA 3EL7A 4BTMA 2UZOA 5M55A 1L3RE 5EHOA 3BHTA 1IG1A 1SVEA 1OPLA 1YXVA 5AV1A 3OVVA 4G2FA 1WZYA 1Y8GA 5JT2A 2QG7A 3WYXA 4WUNA 3F5GA 4FIEA 5HIDA 4JBPA 4C3FA 4RIWB 3CBLA 3N9XA 5IISA 2IVSA 3R7YA 5HOAA 2A1AB 4XG2A 2W4JA 4BN1A 1YWNA 4GKIA 3BZ3A 5TE0A 3F5PA 3LFAA 4ZSGA 1RE8A 3V5TA 5M4IA 5IG1A 1CM8A 5GZAA 1A9UA 2HZIA 3FLYA 4JLCA 4TZRA 1YDSE 4YJVA 3S0OA 5GINE 4L01A 4BCIA 5JGAA 3O8PA 3BGPA 4G1WA 1TQIA 5M08A 1UU8A 1ZYLA 4UALA 3WF7A 1ZXEA 3D0EA 3G33A 3NSZA 4IBMA 4N70A 4M7IA 2XBAA 5J87A 3UNKA 3CSVA 4FEUA 5LVNA 3F2AA 4CNHA 3ZC6A 4FTTA 3QBNA 3FLNC 3I0OA 4QTEA 2QOFA 3C5IA 5CU0A 4NM5A 4U3YA 3ULIA 1FVRA 4RVLA 1CKPA 2J90A 5CEPA 4GT3A 4GG5A 5GJGA 3VS2A 1OL7A 4KKHA 5ANKA 4I93A 3ZBFA 4M69B 5CAOA 1BUHA 3MJ2A 2BZKB 4BDEA 3LMHA 3PIYA 4E8AA 1H1WA 1VYZA 3HAMA 3E88A 1PY5A 2X8DA 3HKOA 3NPCA 3ZRMA 4G3GA 4DCAA 5FRIA 5IUGA 2QR7A 4O91A 3W32A 2W06A 3O0GA 4FOBA 3RKBA 3VS0A 3KREA 1W98A 1JKLA 2PMLX 4DLJA 4GFOA 3T3UA 2W05A 3QXOA 3ZO1A 3OCSA 4EH2A 3FLZA 3DAEA 5CX9A 1J3HA 1KOAA 4ITHA 1YI6A 2WIHA 3R1NA 3D5XA 1H01A 2PU8A 2J2IB 2FA2A 3TWJA 1ERKA 2GTMA 2UW5A 1SNUA 3A4PA 4YNOA 3H10A 1BYGA 1YDRE 3LHJA 1BLXA 4U45A 3WOWA 2YM6A 1UA2A 2X8EA 4JI9A 3TV4A 2WTKB 5HO6A 3ZHPC 4XNEA 4GU6A 4AGDA 4IX3A 4QYGA 2X2KA 2BAQA 2C6EA 3I7CA 3RHKA 4PPCA 2R3NA 4FGBA 4YZDA 2BILB 4KUJA 4YP8A 5KKRB 4N57A 4L68A 1MP8A 4TKSA 5CEOA 3MBLA 3DOGA 1F3MC 4X3JA 2SRCA 5FEDA 2EB3A 4NW6A 4UWCA 4DGLC 1IAJA 4QT1A 1Q8ZA 4TYIA 3PY3A 5KMNA 3EN4A 2B54A 4C34A 5IF1A 2IZSA 2YERA 4ACCA 2HIWA 1KV2A 4U7ZA 4WBBB 2B53A 3I1AA 4RJ7A 2VX0A 4RJ3A 3IG7A 1PXMA 4L7SA 2VTLA 4PL5A 5D9HA 5L2QA 5HTIA 2YAAA 4EJ7A 4YJSA 4TWNA 1MRVA 2PE2A 4JNWA 4FIGA 4YJTA 2GQSA 2RFDA 1P4OA 3MIYA 4NJDA 5E8SA 1KWPA 3QQKA 5EDRA 3R9RA 2VWVA 4LOPA 4NFNA 3SV0A 3A7FA 3QALE 4QYFA 3DPKA 3MFRA 4YBJA 3TJDA 3OTUA 4WA9A 4PDSA 3ZXTA 5DR6A 1IAHA 4XV1A 3KY2A 4B6LA 5IQFA 3DJ7A 2JKMA 4WNOA 5CY3A 3FMEA 4OUCA 5IA2A 1IA9A 3ZM9A 4RJ6A 4BWXA 4MTAA 5EDQA 3SAYA 3WE4A 4MNFA 4QNAA 2RSVA 3OEZA 2ITPA 3UGCA 1JQHA 4IZAA 4QMUA 3UYSA 3FQSA 2CPKE 5EDPA 5E8YA 4W8EA 3NMUF 3TNHA 2ZB1A 4DF3A 5AA8A 2BMCA 3W1FA 4QP7A 3CR0A 4BC6A 4ALUA 2GNHA 4B7TA 5H8GA 3DBQA 2G2IA 2VGOA 2C47A 3IGGA 4B8LA 4AU8A 4CLIA 3G15A 3VC4A 5KMMA 2VRXA 3Q2MA 4BHNA 1NVRA 2W4OA 3NR9A 4AT5A 2O65A 2C6TA 2XB7A 1ZOGA 4HGSA 4FIHA 1ND4A 4J99A 4XH6A 4KS8A 2P2HA 3ALNA 1JKTA 5DLSA 5IA3A 4C58A 4J96A 3CEKA 5D7AA 2A19B 4GRBA 3Q52A 4O1OA 5HLNA 2Y4PA 1H07A 1W84A 4D2PA 3ZBXA 2J7TA 2XNGA 1OBDA 3AXWA 2UZDA 2W99B 3DLZA 4PNKA 1ATPE 4CZTA 2V5QA 3MH2A 3Q9YA 2VU3A 4EZ7A 2BR1A 3PPJA 1JKSA 3BBTB 3ZUTA 2UZTA 5JK3A 2XK8A 4FF8A 3QXPA 4CTBA 3KF4A 4EQCA 4QP1A 4BKZA 1B38A 4L3LA 5DOSA 3ZO2A 4FC0A 2W5AA 2Y7JA 4MNEA 5FDXA 2CDZA 2X2LA 4AW5A 3PJ1A 3MN3A 3LQ8A 3QQHA 4RC3A 4V0GB 3HA8A 3Q5IA 3VUHA 2W4KA 4JAJA 1KE5A 4D1SA 1PXJA 5D12A 1YWVA 2Z8CA 3MVLA 5DFPA 3VF9A 5C8NA 3UC3A 3GFWA 3TXOA 5C26A 5CSHA 5KX8A 5IU2A 5CWZA 1OM1A 1NT2A 4JR7A 4PDPA 3BYOA 3UG2A 5ANIA 3I5NA 2PVYA 4S31A 3AC5A 2WQOA 2QO2A 2C5OA 4FT7A 4I6QA 2XKEA 4O6LA 4OT6A 4EOSA 1HOWA 4CFXA 4UBAA 5BMMA 5I4NA 5EW9A 4FV5A 3WZKA 4S32A 3V3VA 4RVKA 3POZA 2C5XA 3LXLA 4YJPA 4ASXA 4IX4A 2XMYA 2OIBA 1H28A 3HUCA 4PTGA 4F7JA 2J0KA 4CV9A 1ZZ2A 4FV9A 5EHLA 4ASDA 1H0WA 3KQ7A 3UC4A 3GC8A 4M13A 4EEVA 5HORA 2B9JA 3EKKA 1UKHA 2YIWA 4O7YA 2XJ1A 1JPAA 3FL5A 2GS7A 5B2KA 3R7GA 4Z16A 4ZK5A 2VTSA 2E9PA 2XCKA 4BTKA 2YIRA 4RLLA 5CT7A 4FVRA 4FZAB 5ETFA 3OTVA 4I1ZA 3LCKA 4O0WA 5CXZA 5M07A 2HW7A 3IS5A 4FEXA 4BIDA 3UIBA 5KCVA 3LFCA 4FKJA 3RZBA 3DAKA 4L3PA 2C5NA 3R8UA 5L2IA 2ZM3A 4EOJA 3OOMA 2JAMA 4WKQA 4GIHA 4OTHA 4YLKA 2Q83A 4NKAA 3KN5A 1U4DA 4BL1A 3OCTA 3BGQA 5HEZA 3F66A 4R78A 1K3AA 3GU7A 2PUNA 2YWVA 3ORPA 3GBZA 3QKLA 3TZ8A 2GFSA 2VNYA 4N4SA 4UZDA 5IA1A 5K5NA 2A27A 4HYUA 3FL4A 1GOLA 2OFVA 3F2RA 3VJNA 2WPAA 5CVHA 3HYHA 4DGMA 2R3JA 3DZQA 4MYGA 4IQ6A 5E8VA 2ITTA 4BFMA 4B0GA 2PPQA 4OTDA 1WBVA 3O71A 3UQGA 4FGRA 5IQGA 1PYXA 2YM5A 4D9UA 1Q4LA 2FVDA 3LIJA 3PA5A 4UN0C 5IZFA 4QP3A 1OIYA 3C4FA 5L6WL 4AP7A 4I0TA 3CCNA 2X9FA 3TTIA 3AD6A 3O23A 1GZ8A 4YHTA 5CYIA 3WF8A 3F69A 3PSBA 4O2PA 4PRJA 3SKCA 5AR2A 5A54A 4GS6A 4EYMA 5EM5A 3KK8A 3ENMA 3QTXA 4H36A 4TNDA 4OT5A 3BLRA 3DBFA 2P55A 4EH7A 5AUYA 3H9OA 1K9AA 3RTPA 2GPHA 4RX8A 2X2MA 4M84A 3EH9A 4R1YA 3D7TB 3IOPA 4LL5A 4CFNA 4QMQA 4RZVA 2W9ZB 5HE0A 4MBIA 4XLVA 1FPUA 2R0IA 2BIKB 5CAQA 1QPCA 3CY2A 3KCKA 3MSSA 2OO8X 2XM8A 3R2BA 2DYLA 2EU9A 5HI2A 2XNPA 3OG7A 4F99A 5ANEA 3FXWA 4IHPA 2NRUA 4KIPA 1H24A 4Z9LA 3FZOA 3DXPA 1LP4A 4EKKA 3R21A 2HK5A 4ZEGA 4NIFB 3N4TA 2UW9A 3PJCA 5HG8A 4BI1A 4AE6A 1H0VA 4F70A 3AGLA 1WBNA 2UZNA 4KA3A 4YJRA 4XG6A 2CNUA 1E9HA 2QLQA 4AN9A 5HTBA 4FK6A 3HMMA 3AG9A 2BKZA 3ODZX 3PE1A 2Z7RA 3HMNA 1KSWA 4FEQA 5EQPA 4CD0A 5M06A 3ZS5A 2PTKA 4TYHA 3SHEA 5IA4A 3PPKA 4BDCA 2R9SA 4TRLA 5FD2A 2REIA 1OIQA 3SXRA 3W2RA 3LQ5A 1O6YA 3TL8A 5K4JA 4M0YA 5KHXA 4DG2E 4FKUA 5LVMA 2PMNX 4TL0A 4ZSJA 4FUYA 4ZS4A 5AV4A 4HZSA 2CNVA 3OW3A 4E6CA 2R3MA 3DB6A 4F7NA 5DN3A 2OJIA 1M2QA 1URWA 3I60A 4GUBA 2W96B 4IIRA 3DK3A 3KB7A 3ZCLA 2YISA 3AGMA 1J1BA 2JD5A 2O0UA 3PY1A 4ZY6A 4DTKA 2CKQA 5JFSA 3SLSA 2XVDA 1QCFA 1UVRA 4OAUC 1ZMWA 5IQAA 3D4QA 3L9MA 2I0YA 4YTHA 3BELA 5EW8A 3DKGA 1XO2B 2PE0A 1PHKA 4FKTA 3RAHA 1QL6A 3EQGA 5AV2A 4F7SA 5JEBA 4RIWA 3EQPA 3GU6A 4PPAA 5GZ9A 2C6MA 3HV7A 3V6SA 3ZXZA 5FEQA 4MEDA 1TKIA 2VWZA 4IAIA 4G3FA 3OC1A 3ZFYA 5A4LA 1Q97A 1U46A 4C2VA 3VUIA 4Q5EA 3VUDA 2JGZA 4O86A 4L7FA 5CXHA 5I9UA 3LE6A 2GNGA 4BZDA 3NNWA 4QRCA 1OI9A 3OWJA 2WTVA 5M09A 5F1ZA 4UXQA 3LFDA 3GCVA 4XOYA 1Q3WA 3P0MA 4K18A 1RJBA 2QC6A 1W8CA 3A2CA 4GK3A 4FSMA 3EQCA 3G51A 3O17A 1XH5A 2JKOA 3LCOA 3MYGA 3UBDA 2WXVA 4WNMA 5D10A 2XYUA 3R7UA 3GI3A 2DQ7X 3FMDA 1FOTA 3AD5A 3QRTA 3EQHA 1ZMUA 3IW6A 4ZTRA 3R9HA 5ACBC 4DH8A 2X81A 3HNGA 3LOKA 3MPMA 4U40A 2YFXA 4BCFA 3VJOA 3A60A
chains in the Genus database with same CATH superfamily
3O96A 1BL7A 1H1SA 2C6DA 3FI8A 3MIAA 2W5BA 3OS3A 4HYSA 5M4UA 2RFNA 4K0YA 4BDJA 4FSZA 1GNGA 5C9CA 4ITIA 5J5SA 1SNXA 1GZNA 3PFQA 2YITA 1NVSA 3PXYA 2JFMA 4JBQA 4U9AA 4X3FB 5C8MA 2XIZA 1G8KA 4IDVA 3ZOSA 3V51A 5H9BA 4AA0A 5HO7A 2QHMA 2JKQA 4IM0A 5HCXA 4GVAA 4AX8A 1QMZA 1ZYSA 4LGDA 5AR5A 3E93A 3IDBA 3VIDA 2WOUA 4JIAA 1ZYCA 3F7WA 1GIHA 4FSYA 4OAVB 2UW8A 2VO0A 3NGAA 4C02A 3QRIA 4Y85A 1YWRA 1FGKA 2XP2A 4O0RA 3PVGA 1ZRZA 4WSYA 4RJ4A 2C3LA 3VUTA 3WZUA 4JVGA 3KMMA 4BR3A 5DR9A 4J53A 4MWHA 1FQ1B 3ATSA 1YI4A 1DI9A 3R9NA 4HVDA 1H1PA 3BEAA 4YUQA 4IAFA 1KE9A 4YZBA 4W4XA 5HNGA 4ANSA 3IW7A 5IQIA 2Q0BA 4JRVA 1H4LA 4D28A 2OSCA 2WFYA 2WTWA 3FY2A 4KKEA 3DKCA 1XBBA 2VTMA 3FPMA 4I92A 4O7RA 3FKNA 1IASA 4QMSA 4APCA 2RG6A 2Z02A 2YIQA 5H8BA 1W2FA 2BKKA 3NUYA 2WQNA 4WD5A 3EOCA 2PYWA 4MF0A 3FLQA 2OJGA 3MWUA 4WRSA 4FSRA 4C2WA 4DH5A 3IW8A 5K9IA 3ZEPA 4BB4A 2W1EA 2HOGA 2OGVA 4AZEA 5M4FA 1KE8A 4ZSEA 2YACA 1P14A 2VN9A 1BX6A 2GDOA 2YWPA 1O6KA 3ORXA 3QRJA 4NCTC 5E1EA 2IW9A 4QMXA 4CYIA 4I3ZA 3W0MA 1NXKA 3ZSGA 3I81A 5JFWA 3DDQA 5K5XA 2P33A 4CT2A 5CANA 3P7CA 5TR6A 3BYSA 2RL5A 4I0RA 3M11A 2GU8A 4QTDA 4ACMA 3ET7A 4XV9A 3G0EA 4UMRA 4D2RA 3SOCA 4DEDA 3ACKA 3G9NA 3VUGA 2E2BA 4H3QA 5LWNA 5J1WA 3DCVA 1CDKA 3FKOA 3I4BA 3L8VA 3SW4A 5BUJA 2B1PA 5F20A 4ZZNA 3SRVA 2XH5A 3V8WA 4ZMFA 4OBPA 4L42A 3K2LA 4OGRA 4MD9E 3JVRA 4ERWA 4P5QA 3GC0A 4O27B 3R02A 4H3BA 4PMSA 4V04A 3QZHA 3SOAA 3QD3A 2UVZA 2OIQA 5JZNA 5GIOE 3W2CA 1Q99A 2R3KA 3DA6A 2YHVA 4IVBA 3KXNA 3QC9A 4IW0A 3PLSA 4QMYA 4CVAA 5IEVA 5L6PA 5IQHA 3FDNA 2BIYA 4XEYA 4BBFA 3CTHA 4D4YA 1SZMA 2B7AA 3Q4TA 4DEGA 1OIRA 4NIFA 3MB6A 4W9WA 2PVKA 3V8SA 5JSMA 4DCEA 2IJMA 4J8NA 3MA6A 2WO6A 4DC2A 5B2LA 3PXZA 3FI3A 4AN2A 2B4SB 4RPVA 3GB2A 4XRLA 2IVVA 5A3XA 1KUTA 3IQ7A 5F4NA 5I3RA 3Q32A 2YM3A 3VQUA 5D11A 4FKPA 1TZDA 4FG7A 4NU1A 5AP1A 4AZFA 3GFEA 3SW7A 4XG9A 3D5WA 2CCIA 2GHGA 4F0FA 2O8YA 4J1RA 3IOKA 4GG7A 2PVNA 3BV2A 2F7EE 2YLFA 3KXXA 4S33A 5HQ0A 4JRNA 3GCQA 2YLEA 2R3HA 4EK4A 5FTGA 3G90X 3QQFA 2JIIA 4PNIA 1GIIA 4H05A 4JIKA 3JPVA 4O6EA 4AACA 3OF0A 2R2PA 1OPKA 4CKJA 3QZGA 3SA0A 4IZ5A 4FZ7A 3RM7A 3FE3A 4FSWA 4FV7A 4RJ8A 3QU0A 2V22A 5C01A 3DS6A 4ZTMA 4LRJA 5AUXA 4QMTA 1PXIA 3F3TA 4DBXA 4K9YA 1U54B 4I21A 4R3RA 3D9VA 5M51A 3LMIA 3PP0A 3Q4ZA 4MD8E 4FNZA 2WEVA 4GW8A 3ROCA 5JGDA 4XYFA 3VS5A 2OH4A 3BKBA 3KN6A 1W0XC 2H8HA 3DNDA 3KKVA 4GK4A 5CSXA 3TT0A 3DXQA 1SMHA 2YAKA 4WT6A 3HMIA 3DFAA 4TTHB 5CF6A 1JKKA 3PLAE 5G6VA 4HGLA 4RRVA 5AUWA 2UW3A 3G6GA 4CZUA 2AEGA 3WZEA 5HIBA 4EH5A 1GAGA 4FX3A 5J9ZA 3PWDA 4RC2A 2CGUA 2UZBA 4CGAA 2WZJA 2UVXA 4A4LA 5HD7A 3KXHA 1JWHA 2QVSE 3MH1A 3UJGA 2XKCA 4E73A 2WMQA 4O7SA 3PY0A 3VW6A 3EKNA 4F9YA 3B2WA 3FMJA 1FVTA 3NUNA 3D15A 2V55A 5M4CA 2QODA 3CD8A 3JS2A 4CQGA 3CKXA 2LAVA 2QNJA 4A4OA 4II5A 4LUDA 4QP2A 2RG5A 5DVRA 4CMTA 3P23A 3A7HA 4GV1A 2BTRA 1CKIA 5C1QB 4FZFB 5CU6A 1OPJA 2W1DA 3UYTA 4KBCA 4TN6A 1J91A 5HLPA 5CNOA 2A4LA 5E92A 2JDRA 4MNEB 2VTOA 4XOZA 5F95A 2OFUA 3V5WA 3KRXA 4IACA 3MI9A 3MY0A 2XK9A 3D7TA 4JJRA 4RA5A 4WUAA 2QR8A 4HVIA 4B99A 5CSVA 2VTHA 5HCZA 4FSNA 3DGKA 4ZS0A 4ZTQA 2WQMA 3FI2A 3SD0A 4E6AA 4O4FA 3R8MA 1H27A 2IZTA 3MB7A 4MAOA 3CJGA 4UYAA 2XJ0A 3LFEA 5BVEA 2FH9A 1OUYA 3KULB 4I6FA 5JRSA 3MJ1A 2KULA 4UX9A 4KABA 5HBHA 3VS3A 5EQYA 2IF8A 4OTWA 1H1QA 3PG3A 4W9XA 5HVYA 5CEMA 4HGEA 1VYWA 2J51A 2UZWE 5TT7A 2CKPA 2BFXA 4EK6A 2AQXA 4BDHA 4ZLZA 1LR4A 4AA4A 3QA0A 4U81A 2CJMA 2WNTA 1E1XA 2BVAA 4AA5A 4EORA 4ANOA 5M44A 5HBEA 3L8PA 2F57A 1M17A 4FKIA 1GZKA 3UDTA 1XBAA 3UDZA 1T46A 2OU7A 5IH6A 3A61A 4O96A 2JDVA 2XNOA 3PZEA 4HZRA 1JBPE 3W2OA 4BGGA 4FT3A 3PJ2A 4GMYA 4MWIA 2Y4IB 4CKRA 5ITAA 3KIOC 1P2AA 5J9YA 2IW8A 2X6EA 3S4QA 3W0SA 4I6BA 3MH3A 1JNKA 4QOXA 2QQ7A 4EI4A 2XIKA 2ITOA 3NAYA 4EQUA 3UQFA 3PA4A 5CF8A 2XNMA 2YJRA 4IEBA 4GKHA 5FP6A 5CAVA 1OBGA 4UWYA 2IVTA 1APME 3TEIA 2BAJA 2HY0A 3PSCA 3E8EA 3T3VA 3WYYA 4EOIA 2ETKA 2PZ5A 2OIDA 2OW3A 3PSDA 3VS1A 1DS5A 3C51A 3SG8A 4ITJA 3QWKA 3AOXA 3QZFA 1XH6A 4EYJA 4UMTA 3WZJA 4PX6A 3F9NA 5FP5A 4D2TA 4BCMA 4D1ZA 1Y8YA 1OKYA 4OTPA 1O6LA 3M42A 3PYYA 3QCYA 4QMMA 3IECA 5C8KA 3GCPA 3E3BX 3SRVB 4BCJA 4DGGA 2F7ZE 5A6OA 3FXZA 4DDIA 3UOHA 4IX6A 4MVFA 4NM3A 1GZOA 3UO4A 2EUFB 2XF0A 4NEUA 3S2PA 4C7TA 4O7LA 3WF9A 1CTPE 3NCZA 1YDTE 3UOLA 5K0XA 3AT4A 3V6RA 3QAME 3ZSHA 5IH5A 4QDVA 4U43A 2X4FA 2J4ZA 4R5SA 4DT9A 4F1TA 3F61A 3QTZA 5CTPA 2CLXA 4FICA 3ZSIA 2GHLA 5FXRA 2ZV7A 3S00A 1ST4A 2RKUA 3V8TA 2YZLA 4DT8A 4G3EA 3H30A 2F9GA 4L67A 1DM2A 3A8WA 3DJ6A 4BWPA 4LUEA 2PULA 3FXXA 3T9IA 4S30A 1J7IA 4ZP5A 3DB8A 4FL2A 1URCA 4AZWA 3PWYA 3KMUA 3G0FA 3QUEA 3KRRA 3MS9A 4X6RA 3RK9A 2QOKA 4KWPA 3DU8A 4Q2AA 2J0LA 3NZ0A 4YR8A 4FBXA 3KXMA 3ALOA 5B2MA 5JKGA 2RF9A 2FSTX 4FKWA 4CG8A 4X21A 5FM2A 2Y4IC 5FWKK 4PL4A 5HBJA 3DBDA 2GS6A 4F0GA 2EXMA 2GCDA 3L8XA 5HESA 4I23A 4L9IA 3TCPA 3VUMA 4Q9ZA 2WHBA 2OJJA 3QGWA 3R6XA 2XKDA 3C4CA 3FWQA 3UZRA 1OL6A 5FM3A 3C5UA 4R77A 4XV2A 3D5VA 3MVHA 4GEOA 3R7OA 2W1IA 4DEIA 5AX3A 2VZ6A 4DH1A 3HV5A 3RWPA 2P0CA 2ONLC 4EOQA 3QCSA 3SGCA 1QPDA 4ZTSA 4G6NA 1Y91A 2RFEA 3EFJA 3LFFA 5GHVA 2BDFA 1Y6BA 3DQXA 4BDBA 4ZJVA 4MD7E 5HX8A 4GSBA 5IQEA 3QYZA 4GL9A 3RWQA 4EKLA 3P5JC 2YM7A 3AC8A 4ACDA 3BRBA 4C3PA 2QOLA 5AP6A 3PVBA 2IW6A 1I44A 3NUUA 4YLJA 2DWBA 3TN8A 4JR3A 2UW7A 4GH2A 3RAWA 2W9FB 2PVRA 2VTJA 3BGZA 3KULA 4X2KA 3W2SA 2Y0AA 4TWOA 2ETMA 4XBUA 3TNIA 4LOQA 2OJFE 4FVPA 5A14A 3D14A 4ENXA 2GS2A 3DZOA 4FV2A 4MXXA 3H4JA 3P86A 4IMYA 2CHLA 3F7ZA 2IO6A 2X7GA 4O22A 4ANNA 4UZHA 3R73A 4A9YA 2BZJA 5D41A 3HRBA 4IVDA 5ACKA 2YCSA 3NUXA 3ZO4A 2R3IA 4ORKA 2WMSA 1GIJA 3GNIB 3FQHA 4W4WA 5CT0A 4U5JA 2OK1A 3QFVA 2VGPA 4YO4A 2BRHA 4ZSAA 1ZOHA 2CN8A 3OD6X 3OXTA 3MFTA 5ETCA 3VVHA 1WVXA 4OLIA 1SM2A 1WMKA 2B9IA 3NUPA 4FJVA 4RIYA 5FGKA 3VBYA 4O21A 4M3QA 3CGOA 4BF2A 4ACHA 2H96A 3PXKA 4BBMA 4FTLA 5ICPA 1YW2A 2XK3A 5IQBA 3D2IA 2VNWA 4BZOA 4WIHA 1TQMA 2F4JA 2R3OA 5LVLA 2X39A 4BCGA 2PZPA 3NEWA 3IONA 5EQEA 2Z7QA 5DWRA 2XJ2A 3QTIA 3TDVA 2Z7SA 5KZIA 3JUHA 1PW2A 2WIPA 4C4FA 1OITA 1LUFA 2BDJA 4O83A 2VWYA 4DA5A 4UY9A 2BRNA 5BVWA 1PMVA 1ZAOA 4RA4A 5KZ0A 4F63A 4CFFA 1M14A 2ZM4A 4BGHA 2C0OA 3FV8A 4ZY5A 3EMGA 4YZ9A 4ZTNA 3E3PA 3EQRA 3KRJA 5AX9A 5I9VA 3U51A 5J8IA 1E1VA 4IDTA 2CKEA 1BI8A 3VQHA 3W10A 4D1XA 5TKDA 2C3IB 3TIZA 1ZY5A 2FB8A 2GNLA 3PVWA 3JR1A 1WBTA 4GCJA 2GTNA 4HOKA 5KMKA 5BVFA 5HU9A 4MUQA 3KCFA 5JRQA 4P4CA 5LWMA 5BYLA 3AKJA 1H25A 4U97A 3RZFA 4QQTA 2VV9A 2VTNA 5CNNA 4R3PA 4JDHA 3E5AA 2OJ9A 3ORNA 1LEZA 2VWBA 3GOKA 3QX2A 4AGCA 2WTKC 4NKSA 4F6SA 3HP2A 4MBLA 5BYYA 3FUPA 3HV4A 2VX1A 4IAAA 1XWSA 1PMNA 5HD4A 5I9YA 2ONLA 2A2AA 4OTGA 3QD4A 3V5LA 3EYHA 3Q3BA 3KGAA 1CSNA 3ORLA 4JOAA 4IANA 5AMNA 4EOMA 3UDBA 2VWIA 2VX3A 5CLPA 4UWBA 4PY1A 4D9TA 4IC8A 5DG5A 4K33A 1OGYA 5AP5A 2BPMA 4C59A 1AGWA 4DFLA 4QMWA 3RINA 1VLRA 4OW8A 4PP9A 4ANQA 1G8JA 4DHFA 1J1CA 3R1QA 1DAWA 4FE2A 3DJ5A 3DKFA 4HCTA 4JQ7A 2ZYBA 3OMVA 4FK3A 4FSUA 3PRFA 4DHZA 2R7IA 1JLUE 3HLLA 2C6OA 4RT7A 5LCKA 1PJKA 4NYEA 4JG7A 3BU5A 4DFXE 3OWLA 4NK9A 4WSQA 3B8RA 3GCSA 4C35A 4F9AA 5JQ5A 4MCVA 3UPXA 2UW4A 3R8PA 1ZOEA 3QQGA 4O1PA 5AA9A 3TM0A 1OKWA 3NVKI 2IZRA 4PTEA 5EH0A 2J5EA 3LW0A 5HNBA 5KMOA 3T8OA 2HZ4A 2C69A 4X3FC 4ID7A 3REPA 3SVVA 2Z60A 4EOPA 4C33A 4QQ5A 4QMLA 4RMZA 1YRPA 1R39A 2NNWB 4A9RA 3UIXA 5IQCA 1M2RA 4MH7A 1LEWA 4FL1A 5BVKA 3C4XA 2BHEA 4GUEA 2R3FA 3TACA 2O2UA 1SYKA 2ERKA 3BYUA 2VWXA 3P7BA 4FNWA 4QTAA 3K3JA 5CVGA 4ZOGA 4BYIA 5CU4A 5I5ZA 3FMMA 5EM6A 4F4PA 4FI1A 3H0ZA 4YNEA 3SX9A 4U0IA 4CFMA 2ZMDA 2YABA 2YDIA 5AUTA 3I7BA 3JVSA 4QP8A 3HV3A 3VUKA 3AKLA 2XYNA 2JLDA 1U54A 4FEWA 4DFZE 4AOIA 4AG8A 4F0IA 4DHJA 4GJ3A 5DEWA 3Q60A 3U9NA 3FMHA 2XBJA 5CF5A 4J7BA 2QO9A 4GFGA 1ZY4A 3ROYA 3OY1A 3LXKA 4NM7A 4APPA 2JBOA 3D83A 1J7UA 2WTJA 4FV0A 3EB0A 4UV0A 1XHAA 4IWDA 4O4EA 5FXQA 4EC9A 3TMOA 2YM4A 3SC1A 4G31A 4GVJA 1S9IA 3DAJA 4K11A 1ZZLA 4EOOA 2PY3A 3VS4A 5E8ZA 4E6QA 3KXZA 5AR3A 2PMOX 3OP5A 1M7NA 3KA0A 3G2FA 2G2HA 5E8WA 4G3CA 4RQVA 5FEEA 4ZJJA 1M52A 4RWKA 3W33A 4BBEA 1Q61A 5AEPA 3DQWA 3FMLA 5J9LA 4R7HA 3FHIA 4QMOA 4QDEA 1B39A 4MKCA 4G9RA 2PZRA 1GJOA 4DAWA 4LFIA 4MK0A 4PMTA 5BUIA 1REJA 5I0BA 3MA3A 2GSFA 4FV4A 4PF4A 2P3GX 2EB2A 2XCHA 3Q6WA 4R7IA 5A4CA 2W17A 4O38A 5CSPA 1H1RA 3VWAA 3AMYA 3BQRA 3P78A 4AXDA 1XQZA 2I1MA 5A6NA 3Q96A 5DE2A 2QU5A 3HX4A 2BRBA 4YHJA 3GOPA 5IA0A 4IVCA 3ZZWA 5KO1A 3FZSA 4M66A 3ZH8A 4KRCA 4AGWA 5A46A 3MPTA 2VTRA 3HMOA 2BROA 4FKVA 3AC4A 3ZMMA 2I7QA 4EHVA 4LYNA 1REKA 5E9EA 5E7RA 1OKZA 5C4KA 4DHIB 5EYCA 3GUBA 4YHFA 2Y8OA 2VUWA 3A7IA 3MGYA 2XRWA 5AIRA 2B9FA 4MF1A 4PDOA 5DT0A 4QTBA 4XP3A 5HO8A 5DR2A 4B9DA 3R30A 3R1SA 4R5YA 5AADA 2WMRA 2C5VA 3CJFA 3GXLA 2YA9A 2PZYA 2VO7A 4FZ6A 3PUPA 3DDPA 3TI1A 4Y95A 1VJYA 4RC4A 4DGOA 4F6UA 4AXEA 1OB3A 4C4IA 2UZVA 4DEAA 1W7HA 1OVEA 5DRDA 4C57A 4L46A 4HVHA 4FT9A 2CMWA 3UMXA 3HGKA 4DG3E 3ZRLA 4WOVA 3BCEA 2V0DA 1NA7A 4Y46A 4YZCA 3EWHA 5C27A 3UZTA 4W4YA 3F3VA 4Y73A 4QTCA 3V5JA 2WEIA 1U59A 2I0VA 3TJCA 3DLSA 3L1SA 4C38A 3R04A 4E4LA 3OW4A 2OH0E 5CF4A 3GC9A 3BHVA 3OFMA 4MQ1A 3LZBA 4HNFA 2ITQA 3PTGA 3QTSA 4ALVA 1WCCA 2ITXA 4X2GA 3OCBA 5HIEA 1UNGA 4TWPA 2WD1A 4MXOA 5LARA 4EWHA 5BVDA 5L3AA 3PXRA 4FUXA 4N0SA 5JZJA 4B4LA 2W1HA 3FJQE 3FY0A 4FKRA 3SXSA 1RQQA 3C4EA 3C7QA 3LXPA 3C0GA 3NDMA 4LRMA 1P4FA 4W4VA 4E26A 1Q5KA 2JITA 3CQEA 4FTUA 4XJ0A 4IAZA 3RAKA 4BDGA 2WMUA 4XBRA 2XALA 4Z3VA 4JG8A 4TNBA 5FG8A 2PUUA 4TXCA 2Y6OA 3O7LB 4E20A 4CCUA 5DBXA 4X7QA 3H3CA 4U41A 5EK7A 3O8UA 4LGHA 4C4GA 3QRKA 3LKMA 1MQBA 3K5VA 4CCBA 4N6ZA 1FMKA 1XH7A 3I0QA 4FTCA 3A7JA 2YCQA 3NW6A 3L9LA 4YJNA 5CZIA 3HRFA 4Z7HA 1CKJA 4QPMA 5DHJA 3U6IA 4FNXA 3BX5A 5EI2A 3TNPC 3GU5A 4HYIA 4D0XA 3E63A 3P1AA 2Z2WA 5EM8A 2C6IA 2QKWB 3TDWA 2C0IA 3FZTA 4X6QC 3PG1A 4EHZA 3W0RA 3A4OX 3ITZA 3Q2JA 3FC1X 4QO9A 5LCJA 4XLIA 3NIZA 4L44A 4USFA 4Q5HA 4OTIA 4QMNA 4I0SA 4E7WA 1UU7A 4FTAA 2VD5A 3AC1A 4QYHA 1OL5A 1STCE 3BIZA 2ZOQA 3QD2B 1PYEA 2BZIB 2JDOA 4EC8A 2VWUA 5J95A 3KXGA 3NAXA 4M68A 3R9OA 4BCOA 4F64A 3PFYA 2JDTA 3EQBA 3RMFA 3KFAA 4NL0A 1LPUA 3LLAA 4ENYA 4JQEA 4MQ2A 2E9UA 3JXWA 4KRDA 4MXAA 4LM5A 1YHWA 2GNIA 4HGTA 3D2KA 3QKKA 5D1JA 1H08A 4IAYA 3VRZA 3EQFA 4UXLA 3OWPA 4IX5A 4QP9A 5AAFA 3I79A 4TY1A 4RWLA 5AR8A 3RPVA 3DTCA 3IDCA 3LM5A 4FT0A 1Z57A 4MXCA 4F9WA 4O7NA 4V01A 2J0IA 2ETRA 5EI8A 4YURA 4RIXA 4G5JA 3LQ3A 3HVCA 4XRJA 3R7VA 4DH3A 4JL9A 3P7AA 4E3CA 4KIOA 2C4GA 2R4BA 4L43A 4NUSA 3NRMA 4D55A 1DAYA 4YLLA 3RVGA 5BYZA 3T9TA 3ZUVA 5KMIA 4TT7A 2HENA 4QEBA 2F49A 3DTWA 3NIEA 4FTOA 2OZAA 4IC7A 4JDKA 4I6HA 5EW3A 3ZLXA 4D2VA 2QKRA 4EWQA 5HNIX 2X7FA 3ML1A 2XNEA 2NP8A 3IGOA 2W7XA 3OBGA 4AW0A 2JAVA 3EJ1A 2O63A 3F3ZA 3MPAA 2ZJWA 3VHEA 2DUVA 3D94A 5IKWA 3MW1A 3C0HA 2JEDA 2WU6A 1ZARA 2X8IA 4J52A 5LMKC 3AT2A 5G1XA 2OF4A 2OLCA 4ZZMA 4C4HA 4FR4A 2BZHB 4QPAA 4YJQA 3AQVA 3NYVA 3ORZA 3OT3A 3RPRA 4WHZA 3R28A 4Q9SA 2BDWA 4HVSA 3KL8A 3TTJA 3FAAA 1ZYDA 4AXFA 2HW6A 5LVOA 5FDPA 4IVAA 4D4SA 2YJSA 1HCLA 2QHNA 3GU4A 4HJOA 3UG1A 3BU3A 3RP9A 3VHKA 2XA4A 5DT3A 2HZ0A 5KE0A 5LVPA 1RW8A 4ZMEA 4RIYB 4QP4A 5FXSA 3O2MA 1R78A 2GNJA 1ST0A 2XAMA 3KMWA 2JBPA 3GGFA 4RFMA 3QLGA 5TOZA 4ACGA 5LQFA 4GFMA 1H8FA 4O0XA 4BIEA 4KIKA 3LAUA 1BKXA 3KU2A 4RX7A 4A9UA 3N51A 3MTFA 2ERZE 3ODYX 4IB0A 5FTQA 3QZIA 2WQEA 3EN5A 4FYOA 3LJ1A 1Q24A 2XIRA 3DXNA 3W55A 3BWFA 2I0EA 3E8NA 4U44A 3UNJA 2DS1A 4D0WA 4JMQA 4O7TA 5FUTA 1B6CB 3FSKA 3NYOA 3HA6A 4XMOA 3SXFA 1YOJA 3UVQA 5JN2A 3S3IA 5HCYA 3ORMA 4I5HA 3F6XA 1M2PA 2OI4X 4LL0A 4U79A 1UWHA 3R71A 5D7VA 1XH8A 2EVAA 2QLUA 2YIXA 2WTCA 3GC7A 4BCHA 5K4IA 4I5MA 3U4WA 4AT3A 4EJNA 3UQCA 5GIPE 4JT3A 5HG7A 4CLJA 4FG9A 1FINA 2WQBA 3TV6A 3WF5A 4AN3A 3FZRA 4CQEA 3EZVA 3WZDA 5T3QA 3R00A 2PVLA 4HNIA 4BDKA 2J5FA 4XV3A 3KVXA 3BLHA 3DNEA 2PE1A 3FMNA 5ANOA 1KE7A 4YTIA 4AAYA 3Q04A 1T45A 3HP5A 2CN5A 5HKMA 4BVUA 2UW6A 4C4EA 4DINA 1HCKA 3ZDUA 1YQJA 4DLIA 4J95A 4J71A 3NNUA 3V01A 1YXUA 4BJJA 5CAUA 4QMZA 3EZRA 2CGXA 4BZNA 4ZTHA 2BFYA 2XM9A 3GU8A 3TNQB 2BRGA 3QQJA 3Q9WA 4NM0A 2ACXA 4FSQA 5HHWA 3WF6A 4BIBA 3C50A 5DA3A 1OMWA 4RSSA 5ETAA 5T68A 3TZMA 1UNLA 4Y5HA 3EYGA 1UU3A 4YJOA 5HVJA 3TKHA 2EXEA 3QCXA 2XEYA 3P4KA 4NSTA 1OKVA 5CU2A 4NH1A 5JFVA 3UO6A 3F5UA 3Q9ZA 4J8MA 2J0JA 4TYJA 2GQRA 3WILA 2XKFA 4RQKA 3POOA 4O0VA 4E93A 3BHYA 3F3UA 3CC6A 3ZFXA 3R01A 3COKA 4EK3A 2PUIA 5DT4A 4AFEA 5EOBA 3VBWA 4AZSA 4AF3A 3UOJA 4ZLOA 2I6LA 2BALA 3MFSA 2RIOA 3QTWA 3QYWA 3EFWA 3FC2A 4IAKA 4O4CA 3ZLWA 4BTJA 2NRYA 4R6VA 5AUZA 4I4EA 3BLAA 4OR5A 4O0YA 2YCFA 3GEQA 1JOWB 3HV6A 4FEVA 3TG1A 5GJFA 5M57A 4FG8A 4GIIA 5TO8A 2VTAA 1F5QA 2ZV8A 4FVQA 3PDTA 3O8TA 1XBCA 2VO6A 3QKMA 2IZUA 3QTUA 2C0TA 4RIOA 3BHUA 5DNRA 3HDMA 3A7GA 3EN6A 1GY3A 4IH8A 4LI5A 5AP3A 4KSPA 4RG0A 2QONA 4YMJA 5AUUA 3F2NA 5DH3A 3GQLA 5IMXA 4FZDB 4MX9A 3G6HA 4EONA 1JAMA 3BPRA 3AT3A 4DTBA 5LJJA 5GJDA 2GHMA 4BCKA 3BL7A 3FLSA 3MTLA 5CS6A 1R0PA 4Z7GA 4X2JA 5IH4A 3QF9A 2G01A 3H9FA 4YC8A 4ANLA 3NNVA 5HE1A 3TNWA 2X0QA 5K0KA 3TIYA 4CMUA 5B7VA 4WNKA 4DEHA 1A06A 4P7EA 1MUOA 2BAKA 5HE2A 5J79A 4FKQA 2X9EA 3UP7A 3JY9A 4DEEA 3R0TA 4ASZA 4YGAA 4H58A 1YKRA 2R3QA 4U8ZA 4HVGA 3OY3A 3JY0A 1R0EA 3PJ8A 4M15A 4FTNA 4KIQA 1WAKA 4GU9A 4KS7A 4M97A 3TV7A 1CMKE 4CT1A 1TVOA 3H0YA 4LV5A 4NCTA 5BVOA 5AFVA 3GP0A 3QHRA 2WMXA 4O81A 3RHXA 1RDQE 2UZEA 2WOTA 4OTRA 2HELA 4TYEA 1PKDA 3NLBA 3EQDA 2RGPA 3Q53A 3D5UA 3ANRA 5GZ8A 2R3PA 5IEYA 3GT8A 3HEGA 4DITA 4G9CA 4B8MA 2HXLA 1KOBA 2OWBA 3P08A 3O51A 3A8XA 4KSQA 4PMMA 4TYGA 5AR7A 4BCNA 4EK8A 5BUEA 5F9EA 4P90A 5LOHA 4FKGA 4BDFA 4DBNA 4TPTA 3VAPA 2QO7A 3F88A 3K5UA 4RVMA 4K1BA 5HU3A 3QHWA 2ZDUA 3DK6A 2QURA 2JC6A 4PPBA 4F1MA 4EZ5A 2X0PA 2WMAA 5JQ8A 3LJ2A 2NO3A 3MY1A 4YSJA 2YIYA 4OBQA 2W5HA 4F1OA 5I9ZA 2OXDA 4YJUA 4YSMA 2HAKA 4JS8A 1JSTA 4E4MA 2X1NA 3TUDA 5HLWA 5L4QA 4JAIA 5KBRA 4O84A 3QQUA 4YU2A 2R7BA 1G8SA 5CENA 1WVYA 3V5QA 1YOLA 2ZVAA 3QC4A 1OGUA 4E5BA 1I09A 1XJDA 1Z9XA 2VTIA 2WGJA 3CE3A 3PA3A 4G3DA 4X3FA 4YPDA 4AFJA 4KBAA 4MXYA 1H26A 4IWOA