4JDKA

Crystal structure of serine/threonine-protein kinase pak 4 f461v mutant in complex with paktide s peptide substrate
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
290
structure length
288
Chain Sequence
SHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGVCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRAAAELLKHPFLAKAGPPASIVPLMRQNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Identification of a major determinant for serine-threonine kinase phosphoacceptor specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/peptide
molecule keywords Serine/threonine-protein kinase PAK 4
total genus 93
structure length 288
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4jdkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4jdkA01
4ZJIA 2XNEA 4KNBA 4U97A 3W16A 2WMWA 2XYNA 5L6WL 1L3RE 3R2BA 5FDXA 3W2RA 1JNKA 4UX9A 1CKPA 3KRXA 4CXAA 1H1PA 3N4VA 1H07A 3MPMA 3C0HA 1YXXA 4PV0A 4R78A 3WE8A 4EC9A 2YZLA 4FVPA 4RIYA 4MXZA 5EOBA 2IZUA 5DN3A 2E9OA 4LGDA 5J9YA 3KMWA 4E5AX 2G1TA 2OZOA 4YURA 5T3QA 2YDKA 3PPZA 4F4PA 2RF9A 2XK6A 4FSZA 5KZ0A 3QZHA 3B2WA 3GUBA 5IDNA 5HCZA 1XH9A 4O6EA 3F3UA 3VS1A 2R4BA 4YTIA 3QHWA 4BDGA 4YO4A 4ITJA 5IA1A 2HW6A 3FMHA 3KCKA 4G34A 3R7VA 2KULA 3CLYA 4YUQA 3R6XA 2J0JA 4I22A 5L2SA 1FVVA 4FT0A 3R71A 4G3GA 3DKFA 5FEDA 2GQSA 3QLFA 1Y91A 3NS9A 3NIZA 3CC6A 3GU8A 1JQHA 4ALVA 4YU2A 4U9AA 2IPXA 3EIDA 2PYWA 4FV4A 5K5XA 3POZA 2XMYA 2Y6OA 3MVMA 4RMZA 2UVZA 3LCSA 3CY3A 1UKHA 3E5AA 5M4IA 4GYIA 4L67A 5ETFA 4V0GB 5IQHA 2BRMA 3MH2A 4K8AA 4IFCA 4KIKA 3PWYA 2H96A 5I3OA 4ACGA 3V8WA 4F0GA 1H00A 4BIEA 4MF1A 2GNGA 4RIOA 4ACDA 3AXWA 1H01A 3UC3A 4RWLA 3UQFA 3LM0A 1GAGA 4HVGA 3QX4A 3WF5A 2PVMA 3GU5A 4C59A 4BBFA 4QOXA 4JBPA 5FM2A 2ZV2A 4BDDA 4J95A 1GZNA 5GIOE 4L68A 1W83A 2CJMA 2HZ4A 2V62A 3ALOA 4R3PA 4TWCA 5KMLA 3OW4A 4G16A 1SNUA 3KN6A 1W8CA 3ZC6A 2YA9A 5CSPA 4F6SA 4DC2A 4BF2A 4EH3A 5J1WA 2R7BA 4AQCA 4I4FA 4RJ3A 5GINE 4XV9A 2OXDA 4EL9A 2C3KA 4F09A 4FV5A 4LG4A 3QRTA 4BWXA 3E7OA 4C57A 5J79A 3P08A 3LCDA 2Z7LA 5I4NA 4ZTHA 2BHHA 3QWKA 1GIHA 3ACJA 4X7QA 3VULA 1KOBA 2PWLA 5AUTA 3FPQA 4KKHA 5IA3A 3LJ0A 3WARA 5CALA 5LCKA 2CKOA 4AE6A 4BVUA 2VGOA 1JAMA 3LXLA 4IX6A 3OWJA 2NPQA 4YZDA 4K6ZA 3RMFA 3D14A 3LFAA 2VWWA 3ORIA 2UZNA 4JLCA 4O0UA 4JXFA 1BMKA 3MH3A 2BHEA 3V5WA 3ZZWA 4O7NA 3TG1A 3DCVA 5EDRA 5A6NA 3KKVA 3CGFA 2PTKA 5KHWA 5JFXA 1IASA 4I5HA 5M55A 3U55A 2QO9A 4AX8A 3E88A 4LMNA 4K1BA 5ETIA 2B9HA 3C0IA 5IA5A 1Z9XA 1IR3A 4ERWA 1XBBA 3A7GA 1Y6BA 3P5KA 2PVNA 4FT3A 1E9HA 4XG4A 3TWJA 3V5LA 5EHLA 3QC4A 3OVVA 2WEVA 3M1SA 4TY1A 3UC4A 4KUJA 4M12A 2RFSA 3LFBA 2CMWA 5FBNC 4B0GA 5LVMA 3FMDA 4DE4A 5K0XA 3MY1A 3QKLA 4QQTA 3F3VA 3THBA 4ZZNA 2IW6A 4O27B 3TACA 2NRYA 3PY1A 3WIKA 3C4FA 5HBEA 4ZTNA 4C58A 4HGEA 4QMYA 2JKQA 4PL4A 4UMUA 2WNTA 2XK9A 4O22A 4QTEA 1Q99A 3QLGA 3BV3A 3OOMA 4YLJA 1H0VA 3FI3A 4Y72A 4HGSA 4EOMA 3ORTA 3KA0A 4IM2A 1KE7A 5F94A 3A2CA 5F4NA 3R9RA 4FTJA 1ZOHA 3BV2A 2UVXA 3Q52A 4QP8A 2W96B 3RHXA 4XP2A 2WTJA 2W17A 4KWPA 3VRYA 4AN9A 4CRLA 3DLSA 3OWLA 3ACKA 2AC5A 1P4OA 1S9IA 4UYAA 4XG6A 2WELA 4XUFA 5J95A 2OK1A 3C7QA 4IX4A 4G3FA 4LOPA 3ORZA 1WBSA 2H9VA 4RLKA 3TI1A 5L2IA 3QRKA 3G15A 2WFYA 3Q6WA 3VUHA 2HWPA 5JEBA 4IB5A 3RK7A 3OC1A 4BI0A 1JBPE 4G3DA 2ONLC 3IW7A 2I7QA 4R77A 3MVHA 3HVCA 3TNWA 4CKRA 4LM5A 4FE2A 2YCRA 3EFLA 5H2UA 4CVAA 1ZYLA 3UJGA 4UV0A 5GHVA 3IS5A 4NCTA 4W9XA 4RA4A 4ID7A 3LM5A 5BVFA 1VZOA 3OZ6A 3W32A 2W1CA 1OI9A 4CT2A 5C9CA 2OBJA 2WPAA 4JG7A 4BGGA 4FSUA 3LCKA 4FVRA 3QZFA 1OPLA 1Q8YA 4RRVA 4YP8A 2EVAA 4ONAA 5EFQA 3DK6A 3I6UA 3RGFA 2WTCA 4FSRA 3QRIA 4E1ZA 5KZIA 3PRFA 4W4VA 3NNXA 4S2ZA 4FNZA 4FNYA 3C4WA 4IAKA 2DYLA 4BC6A 4JG8A 4ASDA 4BZNA 4RVLA 2LAVA 3E87A 3KREA 2PHKA 2V7OA 2PZRA 3PFQA 1GIIA 3MJ1A 4PL3A 4TYHA 5AR4A 4D28A 5HG8A 5GJFA 4RA5A 2X81A 5DLSA 2BZHB 3OHTA 4I0TA 3R21A 4BTKA 3V6SA 4YJTA 4L6QA 4QQCA 2VX0A 3E3PA 2UV2A 4RPVA 4QMLA 2BRBA 3MTLA 2R2PA 2VGPA 3NEWA 3NYXA 1I09A 2YJSA 2X6EA 1T45A 2BVAA 4F7SA 5CS6A 4BHZA 3QQUA 1A9UA 5HVJA 2GNFA 3EN7A 3KXZA 5DR6A 5AR7A 3D94A 5HKMA 1G8SA 3H9OA 2UW5A 5DIAA 2PVJA 5C8KA 1OL6A 2V22A 4ZY5A 5IQCA 3GCQA 1ZLTA 2W05A 5JFWA 4L3JA 3A7JA 2XKCA 3BYSA 3PY3A 3GVUA 4G2FA 3RPYA 3BEGA 3UG1A 4F0FA 1XJDA 1IRKA 2OU7A 2RFNA 2W9ZB 3HA8A 3KFAA 4Q5EA 4ACCA 3WZKA 5AV3A 5CENA 2QHNA 4ANOA 2YWPA 3RPOA 5JZNA 4C4EA 3GB2A 3PXYA 4YZ9A 4FK6A 3ENMA 3DZOA 3R8PA 3KK8A 4IWPA 4RGJA 4IE9A 1NVRA 3WZEA 4QTCA 1OGUA 4BDJA 3EFKA 2QO7A 2XUUA 3EB0A 3F82A 2BMCA 4JIAA 3UP7A 3PVUA 3QXPA 4EQUA 4KABA 4GL9A 4AZEA 4IJPA 3LOKA 2C47A 3FYKX 4XHKB 5E1SA 5LMAA 5L8KA 1REKA 2LGCA 4QMWA 2FB8A 4I0SA 4GRBA 1PXIA 3BU3A 3DBCA 5BVEA 4FUXA 4U80A 4BCMA 5BYYA 2A2AA 1W0XC 1OL7A 1LEWA 3EKNA 3PIXA 5IQBA 4ZTRA 3FLYA 1U54B 3PZEA 2XK8A 2JC6A 4FUYA 3HL7A 2W7XA 2GHMA 4QP1A 2PL0A 5J87A 3D83A 3MYGA 3PIYA 1DS5A 4CZTA 5GIPE 3HGKA 4RT7A 2ITQA 3ZFMA 4G3CA 3CPCA 3RNIA 5A4LA 3LLAA 2XRUA 5CT7A 4JAJA 3ZU7A 5E90A 4YZMA 4FEQA 2PZPA 4U43A 4EZ7A 3SLSA 3UVQA 4IW0A 5G6VA 2WMTA 4XX9A 3PXQA 3ZO2A 3ERKA 2PVHA 3ID6C 3OS3A 4G9CA 4FC0A 5HG7A 1J91A 5TO8A 4AG8A 4H58A 2B7AA 2HXQA 5LJJA 5D9HA 5DNRA 2EB3A 5AX9A 4EZ3A 4D0XA 4GFOA 3NMUF 2RG5A 3AD5A 3JYAA 3IW6A 4EOSA 5CAVA 3S0OA 4CQGA 3COIA 3QCXA 4QP6A 4WSYA 5IH4A 3OD6X 3PG1A 3ORNA 2GFSA 1WBPA 4CFUA 5GJDA 4DEHA 4DEDA 4DFUA 4X3FB 4Q9ZA 2UW9A 3K3IA 4E5WA 4X0MA 2I40A 2C0TA 1XR1A 1KE5A 3KXHA 2RKUA 2Y7JA 1OZ1A 4LV8A 3QL8A 3DK7A 4W4YA 4AXAA 3R9NA 4AW2A 4O6LA 5CQUA 5M57A 4MHAA 4RVKA 3NW5A 3IONA 3AGLA 4ITHA 1OL2A 3VIDA 5IQEA 3MY5A 4ZSJA 3IKAA 4WKQA 2JDRA 3LFDA 4U8ZA 3R7OA 3SRVA 2H34A 4R3RA 3LJ2A 5EK7A 1J7UA 5DT4A 2CN5A 3W2SA 3GEQA 4LFIA 3CQUA 4FKIA 2C5NA 2ZM3A 4JDJA 4NT4A 3QZIA 5HNGA 4D9TA 1Q8UA 3RTPA 1YWVA 3Q04A 1KE8A 2B52A 3EL8A 3TV4A 4R3CA 5BNJA 1U5QA 4HYHA 4CMOA 3D7TB 3AMBA 4YPDA 3DFAA 3KXMA 4B4LA 5DVRA 2W1EA 3SD0A 1W84A 4JDIA 2YM7A 5EQPA 3DLZA 4Z7HA 1JKLA 4LGGA 4F9BA 1XO2B 2E2BA 3LFCA 2C3JA 5FEQA 3EQFA 1YXTA 4IZ5A 1U46A 4RWIA 2B0QA 1B6CB 1YI4A 2OIQA 3FZSA 3DBEA 4K33A 1CDKA 5FLFA 3FKNA 3O7LB 3PP0A 5HE3A 4DTBA 1JOWB 3RPVA 4BIDA 4C34A 2WQOA 4DGMA 3FAAA 3HRBA 1XKKA 3VBYA 4O0YA 4CV9A 2BRHA 5EW9A 5JQ5A 5CNOA 3VBVA 3PJ2A 2V55A 4IDVA 4DG3E 3AC4A 3GNIB 4ANSA 2VWVA 3Q96A 5LVLA 3PXZA 3PE1A 4RJ7A 4ZTQA 4O38A 4FR4A 4DFYA 2CCHA 2VWIA 2R3MA 3DU8A 5IEVA 3MB7A 4P4CA 2UW7A 4BTMA 2CNVA 2CCIA 3QYWA 1BYGA 3GC0A 3P23A 4LL0A 4U81A 1LUFA 3BI6A 2JIUA 3Q4UA 4OTWA 3VBQA 3VQUA 1MRVA 4W4WA 4EHVA 3V5QA 3L9NA 4W8DA 3NCZA 3TDVA 4GVJA 1OMWA 4C62A 1OL5A 3MFTA 3PLSA 3MBLA 1TQMA 5HTBA 4MCVA 3E8NA 5AP4A 5AP6A 4Q5HA 2XVDA 3GP0A 4LUEA 5HQ0A 2C30A 3OWKA 3FKLA 2XJ2A 2R3RA 3R0TA 3V5JA 2X9FA 3HX4A 4IXPA 2FUMA 2W5HA 2HENA 4E93A 4FF8A 4X6QC 5FWKK 5M4CA 3FMJA 2C6KA 3CY2A 4UWYA 2W06A 4LOQA 4A9UA 5DI1A 4BCGA 2ITZA 1PYEA 3MPTA 4JT3A 4E4LA 4QMQA 5D12A 3FL4A 2UZWE 4JJRA 4L7SA 4GK2A 4NFMA 5AJQA 5K3YA 2NP8A 4BFMA 4EORA 4L43A 4YZBA 5G1XA 3W1FA 4BYIA 2YCQA 2F2CB 1O6YA 3NUSA 4MQ2A 5CU4A 3A7FA 4V05A 5FRIA 5HOAA 4BTFA 3UOJA 2Z60A 2WMUA 3ZBXA 4XV3A 5AV4A 4QTBA 3I7BA 5EKNA 4JVGA 4Q2AA 2UW3A 4TYIA 3D2IA 3FMMA 1G8AA 3EN9A 2PVYA 1UU9A 3GU7A 4RWKA 3BPRA 1BI7A 4D55A 3RAKA 4FYNA 5AM7A 3MFSA 3R7UA 5K5NA 4AA0A 4FV1A 3QBNA 4AN3A 4X2FA 4FGRA 5CVGA 3F3TA 4IH8A 5FGKA 4KBCA 3R01A 4BY9E 2WGJA 5JK3A 1QCFA 1E1VA 4BBMA 4DH8A 5HLNA 4DLIA 5BVKA 2QD9A 1P4FA 2C6OA 4BCPA 4CYIA 4KD1A 2QOBA 5LWMA 1FMKA 3FMEA 3CTQA 3EZVA 2ZMDA 4QP9A 5DR2A 5BVWA 3R8LA 3VAPA 4H1JA 4TPTA 1F3MC 3VS4A 3EQDA 2F9GA 2X8DA 2F57A 5K4JA 1XWSA 4QP3A 1Q4LA 1K2PA 3KB7A 4G3EA 4U42A 5F95A 3HDMA 4UXQA 3C51A 3F6XA 3OWPA 2VTNA 2XM9A 3QAME 4EZ5A 2QKRA 4NJ3A 4AWIA 3D5XA 2C6TA 3U6JA 2BROA 4JQEA 4DTKA 4C4GA 1WCCA 3OXZA 2ONLA 4QTAA 4CFFA 5E9EA 2Y0AA 4GJ3A 1Y6AA 2JDSA 2VTPA 3QWJA 3IO7A 3UNJA 2WOUA 1JKKA 2J0KA 2DS1A 3G51A 3GCUA 3MWUA 3QA0A 4I93A 4NCTC 3TKIA 3QTRA 4FKSA 4OTHA 3ZO1A 3Q5ZA 3I60A 2AC3A 2BFYA 4I20A 3BWJA 1PMNA 4N70A 4UEUA 4GSBA 4GV1A 5A4CA 4F9WA 1FVRA 3ZEWA 3GC9A 5LMKC 3EQRA 3I1AA 4IAIA 2FSLX 3V01A 4YTFA 5IH5A 3ZFXA 2CGVA 3SX9A 4RJ6A 3CS9A 3C0GA 5HLWA 3OXTA 4GJ2A 5E8SA 4IEBA 3W2CA 1ZARA 2XEZA 3PJ1A 2QOLA 2VWZA 4NIFA 1GZKA 3GOKA 3F7WA 2A4LA 3SXRA 5I9ZA 4OT6A 4MEDA 5HI2A 3CBLA 4CD0A 4FV7A 1CKIA 2XNGA 3WIGA 3R8VA 1VYWA 1OUYA 4FEUA 1ATPE 4FSTA 4C36A 3ZHPC 3EHAA 2QQ7A 3WF8A 1ZMVA 2ZMCA 2C6IA 3RAHA 3NDMA 4FV6A 4Y85A 3CSVA 4FKVA 4HVHA 2JFMA 5KUPA 3PJ3A 4P2KA 5KMIA 4FTRA 3HUBA 4O1OA 4RVMA 4XP3A 2WIHA 3Q9WA 1H4LA 2C5YA 4I41A 4WD5A 5DT3A 5E8VA 2ITPA 4PPCA 4MAOA 5AIKA 3QD0A 5FG8A 5CEPA 3BHYA 2IO6A 4A06A 3TZ9A 3DAEA 4FA2A 3DS6A 4CFMA 4EH4A 3FMLA 5CLPA 3QQHA 4AOTA 5KO1A 3TTIA 3UODA 1MUOA 2UW0A 4NTSA 5FTQA 5IUIA 1FMOE 4DFNA 2F2UA 3N4UA 3L8PA 5AV1A 3ZDIA 4ZY4A 3PYYA 3KRWA 3ZRMA 4CEGA 2GPHA 1R0EA 3VHKA 5E8YA 3D2KA 3NVKI 4GS6A 1NA7A 5A9UA 3EQIA 3SDJA 2YERA 3NUYA 2HXLA 5ITAA 3EWHA 4X3FC 2JLDA 5BUJA 3KXXA 3TUDA 3CQWA 2GHLA 1TKIA 3AC3A 1OB3A 3UYTA 3EYHA 5HTCA 4DG2E 3GC8A 3R1YA 4HOKA 2O65A 3MH1A 1JSUA 3VO3A 1PKDA 4OAVB 4CV8A 3ZO4A 5HICA 4RC3A 2QONA 2NRUA 2X7GA 5C27A 1FINA 2R3HA 4X2GA 1ZYSA 5ANGA 4AA4A 3FHRA 3NUXA 5LWNA 3FY0A 3FPMA 3RM6A 3VVHA 4C33A 1MRUA 2CKEA 3BU5A 5EM7A 3A8XA 5AR3A 3QQGA 2HELA 1H1WA 2J9MA 4FZFB 4C2WA 2OG8A 2P3GX 3GFEA 1L8TA 1M14A 4JI9A 3LE6A 4OR5A 2R3JA 4I1ZA 4XJ0A 5L2WA 3L8XA 3W8QA 3A4PA 1FVTA 3ZLWA 3RINA 2QHMA 4J96A 4PF4A 5KX8A 1W82A 1URWA 2J7TA 5EW8A 4F0IA 1SNXA 1ERKA 3ORLA 4FIGA 4IFGA 4BDAA 1PF8A 4AS0A 5EYDA 3COKA 4EOKA 2W4OA 4HYUA 4M13A 4DH7A 2BDWA 4UMQA 4R8QA 5F20A 4O7YA 2PK9A 3W2QA 4WNKA 5IH6A 2Z7RA 4F1OA 4EHGA 1WVWA 4U41A 4GT4A 3E93A 1WBVA 2GNIA 4EOLA 5HG9A 1KSWA 4XG9A 5AAGA 2XKFA 2ZDTA 4BIBA 4F08A 4AN2A 5LVNA 4M97A 5K9IA 3ETAA 3DXPA 3I79A 2XJ1A 3P9JA 4MD9E 1RQQA 4ZSEA 3SG8A 2RIOA 1A06A 1YXVA 3IGGA 4R5SA 3VW6A 5AV0A 4F6WA 4HPUE 3HP5A 4M7IA 2R7IA 2OJFE 4YJNA 4AGDA 2RGPA 4PPAA 3GCPA 5IA4A 3K5VA 1R3CA 4ZEGA 2VWXA 3MY0A 3FZ1A 3I5ZA 5KBQA 2WTWA 1W7HA 3G5DA 1P14A 5GNKA 2XK4A 4E73A 4ZJVA 4IIRA 4QQJA 4I23A 2JIVA 3NUUA 1WFCA 1BUHA 2CHLA 2R9SA 3NNVA 3PXFA 3ORKA 1LP4A 1VR2A 2ZV7A 5IQGA 4YPSA 3TNPC 3W55A 3RKBA 4WBBB 3BHUA 3PRIA 4IBMA 2VTOA 3OY1A 5EYKA 3DNEA 4LRKA 4USDA 5HCXA 5CSXA 5BMMA 1Q8WA 4IZYA 4AP7A 3CJFA 2WIPA 5E1EA 1JPAA 5ANIA 3UMXA 4EYJA 2WZJA 2OZAA 3ELJA 4LUDA 5HESA 3AD6A 4WNPA 3ZC5A 4EOIA 5C26A 4U79A 5LXMA 2A19B 2XRWA 3C4XA 2CNQA 2OLCA 2AYPA 5BX0A 2JITA 4M3QA 2UZEA 3KRRA 3UP2A 5HX6A 5J5TA 3OEFX 1Q61A 3TM0A 2QOQA 4L46A 4M68A 2Y6MA 1UV5A 4XS2A 4BDKA 3GENA 1UNGA 4TWNA 3LMGA 4UXLA 5HE2A 2E9PA 1YWRA 4PTEA 3PG3A 5IQDA 3AT3A 3U6IA 4RX7A 4HCTA 3W10A 1DI9A 1DI8A 4DH1A 4PY1A 5CZIA 3A7HA 2ITTA 1E1XA 4MNEA 4DGGA 3FBVA 3DJ5A 3NUAA 5BUIA 5CXHA 4QMXA 5E8ZA 3TJDA 4L45A 2O5KA 4M67A 4OBQA 5IF1A 3SAYA 5CT0A 2QVSE 3AQVA 2G9XA 3VHEA 1MQBA 3SW4A 1ZMUA 4QO9A 4EYMA 3ZYAA 4F7LA 4DFZE 3QTQA 4M15A 3SRVB 1PXPA 1FBNA 5C4LA 4GKHA 5HE0A 2YLEA 4BDBA 2VO3A 4QYHA 5CQWA 3JY9A 5DFPA 4KINA 3T3VA 4PNIA 3MDYA 2C0IA 1MRYA 3M11A 3K2LA 4PRJA 3WZUA 3HP2A 3HV7A 2F4JA 3QTIA 3QFVA 3ULZA 3UOKA 1OIRA 3D7TA 3IW8A 3QC9A 5E91A 2VUWA 4CFWA 2V0DA 2X2MA 4M69B 2XK3A 2IJMA 3A4OX 5AUVA 4Z55A 1T46A 3MPAA 4IAAA 4FKQA 2R3NA 3VBWA 5KCVA 3DBFA 4D5HA 5CVHA 2Z8CA 3UIMA 1PMEA 3PP1A 2NO3A 4J97A 5B2LA 4ALWA 5HD4A 2X0GA 5HG5A 4NWMA 2JD5A 3ZEPA 4X3FA 1PXOA 4KRDA 3PA3A 3KGAA 5HU3A 5M09A 4GEOA 4O0XA 2G2FA 2PZ5A 5JGAA 1PXJA 2IVVA 5KKRB 1PW2A 1H0WA 2BZIB 4CFXA 4JG6A 3RZBA 2C3LA 3VS2A 3NNWA 4DEEA 4FTOA 4QPAA 4AW1A 3O8TA 3HUCA 3H4JA 4OTIA 2BIKB 2GS6A 2XF0A 3SOCA 4MVFA 4ORKA 4ACHA 2VTMA 4DEIA 1BKXA 3RBWA 1WVXA 5HEZA 3CXWA 1JSTA 3D5UA 3FLNC 3ZONA 2ESMA 4AT5A 4IJ9A 3H9RA 3ITZA 1J7IA 4CFNA 2O64A 2AUHA 4EC8A 3DGKA 4O0SA 3BIZA 4IWDA 2QODA 4KS8A 3U6HA 2VTRA 4KIQA 4X21A 4XG7A 4I5PA 4OBPA 4HZSA 3GQLA 3OROA 4KKEA 3CD3A 3GGFA 3NRMA 4YBKA 5E7RA 4F7NA 5A4EA 5IMEA 2UZLA 2I1MA 4MTAA 2XNMA 3UVPA 2WB8A 4CG8A 4I21A 2PMOX 1ZMWA 4HNIA 1F0QA 3PY0A 5CU3A 2WQMA 4RJ8A 2ZM1A 4G6NA 4UB7A 3T9TA 1I44A 3P4KA 2GNJA 2X8EA 3C9WA 4I4EA 2ITYA 3NYOA 1B38A 3Q32A 3C5UA 4J71A 2ERKA 5ANKA 4TZRA 2UZUE 5K0KA 4OLIA 4Y5HA 5EQEA 3H10A 3PIZA 5EQYA 4JL9A 4UWCA 4O83A 4BDHA 3ZTXA 3OTUA 1Z5MA 4WOVA 4UMPA 3RI1A 4FV9A 5CEKA 4FSWA 2O0UA 2R3QA 4RIWB 4ZAUA 4J7BA 3JUHA 3BU6A 3ATTA 4U3YA 5HNIX 2IW9A 4PPBA 5EHOA 4YLLA 4D2VA 3HAMA 4HVDA 5IEXA 4RLLA 3A8WA 5AUWA 1IG1A 3FWQA 3S95A 2UZTA 5JRSA 5FP5A 4FK3A 2VWBA 4B8LA 4DLJA 3EFWA 4YNOA 1TQIA 2QURA 3KL8A 4NU1A 2QLUA 2ITUA 4QMPA 4WG3A 4AAAA 2BCJA 3EQPA 3HMPA 4O86A 4NEUA 1DAYA 2GTMA 2QKWB 5L3AA 1UNHA 3SHEA 4JX7A 4I6QA 4FKRA 4H3QA 3M42A 3PA4A 3RAWA 4EK5A 3DJ7A 3MIAA 5HD7A 2O2UA 2OF4A 2RL5A 2CLXA 4OTRA 3CE3A 2BRGA 4V0GA 3QX2A 4WIHA 5J8IA 3ODYX 4PMTA 1WZYA 2XIXA 4MQ1A 5E8WA 4AF3A 5AR5A 4FEXA 4GUEA 3FLWA 2FO0A 2X6DA 4BWKA 3S3IA 1BL7A 4MBIA 5GJGA 2PMIA 3GBZA 2E9NA 1U4DA 4EHZA 1VYZA 5I5ZA 3EOCA 5IU2A 4H39A 4NYEA 1OBGA 3R8ZA 5AV2A 4Z16A 3L9MA 1Q5KA 3VQHA 4O1PA 5AP5A 3UPXA 3DAJA 4JR7A 2YN8A 4J53A 1M2RA 3WYYA 4I5MA 5IUGA 3COHA 4V04A 2J51A 2W5AA 4DTAA 1UKIA 1V0PA 1Z57A 3CKWA 3OF0A 1TVOA 3ORPA 4R6VA 4YC3A 3ZLSA 4EQCA 4U3ZA 3DQXA 4NM5A 2OXXA 4J8MA 3ZLXA 3A7IA 3HV3A 1PHKA 3ANRA 4C4FA 4EQMA 3DTWA 3QF9A 4E8AA 4BN1A 2CPKE 2WMAA 5J5SA 2VX3A 1NY3A 2IN6A 4QNYA 2P2IA 3BHTA 3JY0A 4NIFB 1OKVA 3DB6A 4C3FA 4G17A 2WTKC 5HTIA 2PUIA 2PUUA 4XRJA 4Y95A 4I0RA 3GU6A 2QR8A 3UTOA 5H8EA 4CKIA 3OXIA 4GT5A 3OMVA 5L6PA 5KKRC 1YOMA 3RVGA 3NX8A 4FKTA 4FKGA 1KOAA 2HCKA 3F66A 2JDOA 2JKMA 1OIUA 1WMKA 4AACA 2B1PA 4XEYA 3EH9A 4KA3A 1IEPA 3FY2A 2YACA 3CGOA 2B4SB 5HLPA 3RALA 3ZFYA 4YSMA 4JQ8A 3O8PA 2X9EA 4RX5A 3TUCA 2Z7SA 3DXQA 2WD1A 2VX1A 4GIIA 3MW1A 2ERZE 2X4FA 4IB0A 3QHRA 2B9FA 3VUDA 5EI8A 5DMZA 3E92A 3HAVA 4JDKA 2QC6A 4FG9A 3VRZA 5ANOA 3UPZA 3TUBA 4TNDA 3VN9A 4BDEA 3C1XA 3PVWA 5TE0A 3DJ6A 4O0TA 3FLZA 4B6LA 4FT7A 4YNEA 3VUGA 4C35A 5AUYA 4O82A 3FSKA 5CI6A 1Q8ZA 1ZY4A 4F9CA 3PTGA 3SG9A 1CKJA 2J50A 5CU2A 2XK7A 4IWOA 5HBHA 5M06A 1WVYA 4IB1A 2OO8X 5ACKA 1R39A 2H8HA 4H36A 3LQ8A 3OW3A 3TCPA 1H8FA 3T9IA 1U59A 5KMNA 4B7TA 4O7SA 2EB2A 3LVPA 4K77A 2UW6A 5I9XA 2ZV8A 5L4QA 5HIBA 3ZZEA 4DITA 2G2HA 2GTNA 2F7EE 3CIKA 4RG0A 5EM5A 4DGNA 4E26A 2XIZA 2HYYA 4E4MA 3F2RA 2R3PA 2QI8A 1REJA 3ATSA 4GKIA 2UZDA 4FKUA 1EH4A 2BTSA 4YHFA 2YLFA 4NSTA 3ZSGA 3MJ2A 4CYJA 3LQ3A 5BYLA 2YAKA 3ZUTA 3FXWA 4A9RA 4NM7A 2WMRA 1SVHA 2ITNA 2J0LA 5DT0A 2ZB1A 2B9IA 2ITWA 2QLQA 2QG5A 4XLIA 3WF7A 4D0WA 1OL1A 2ZAZA 3U8WA 5IUHA 1TQPA 3RK5A 3JR1A 5J7BA 4YHTA 3I5NA 3PPJA 2IZRA 4RBLA 4EH6A 2H6DA 1O6KA 4BB4A 2YDJA 2ZVAA 2W1DA 3MVLA 4I3ZA 4IC8A 5HO8A 3ULIA 1Y8GA 4MWHA 3VS7A 3BE2A 3WI6A 3UZRA 4PP9A 3V51A 4C4IA 4L53A 5HCYA 3FL5A 4ZZMA 4EOPA 4EUTA 2CKQA 4CFVA 2XNNA 5A3XA 2WU7A 4PDPA 4GU6A 4L01A 2R3LA 4D4YA 3PSDA 4BICA 2C6DA 2Y8OA 4C37A 2GSFA 4EI4A 2XKEA 2WMQA 4AOIA 1V1KA 4HCVA 1BI8A 3QQLA 3UIBA 3OUNB 4PDSA 4EOOA 4N0SA 4KIKB 5IKWA 5J1VA 3FXZA 4LRMA 1YOLA 4IAFA 2W9FB 5FM3A 3TT0A 2FA2A 1Q24A 4C3RA 2IG7A 4O7TA 5DOSA 4S31A 1BLXA 5HNBA 5CU0A 2OF2A 3OUKA 3UO4A 1GOLA 4IVCA 1OPKA 3NCGA 4G5JA 4WHZA 1QPJA 3BKBA 3FQHA 2OSCA 4EHEA 3PXKA 2Q0NA 3RK9A 4P7EA 3GU4A 3TNQB 1U5RA 4HCUA 3DY7A 4BBEA 1XH6A 4BYJA 1YVJA 3C5IA 3C4ZA 3HRFA 1H28A 3R73A 3Q3BA 5J9ZA 4E20A 5M44A 3EQCA 3DB8A 3VNTA 4U7ZA 2ZM4A 4C3PA 5A54A 2WQBA 3MV5A 4EH5A 5C1QB 5LOHA 4O2ZA 1ZZLA 4FSYA 3KVXA 4DA5A 4MBLA 4C02A 5FDPA 2PVLA 4IX5A 1LPUA 2WQNA 3KMUA 2XA4A 3FI4A 4D1XA 3CTHA 1A48A 4YGAA 1J1BA 3Q4TA 4A4XA 2YIRA 3V8TA 2OIBA 3AC2A 2G2IA 2VU3A 1RJBA 3EN5A 1G5SA 3ANQA 3VF8A 2WTIA 3TV6A 2OFVA 4PTCA 4EONA 3WOWA 5DR9A 4RZVA 2HWOA 4CRSA 2WTKB 3PJ8A 3CCNA 1KV1A 2YISA 5AUXA 1YRPA 1QPDA 1H24A 5AAEA 3LMIA 5HIEA 2P4IA 3PJCA 3R63A 2OZAB 5HHWA 5M08A 3QTWA 3PVGA 3NSZA 3VJNA 4CMUA 1P2AA 5JGBA 3G90X 4CLIA 3CP9A 4MXCA 2UZOA 4CG9A 5JN2A 4QMZA 3FQSA 3I4BA 5BPYA 3LMHA 2FGIA 4BCNA 5DRBA 3F5GA 3UQCA 1FPUA 3UBDA 2YEXA 4FICA 4UALA 4TRLA 3H3CA 3UZPA 4BZDA 5DE2A 3QTSA 3PDTA 2OFUA 4ZTSA 5C8MA 3BYMA 5H9BA 1J3HA 5DA3A 3VBXA 4ZLYA 4JRVA 4APPA 5JFSA 3LPBA 2WOTA 4F1MA 1O6LA 2VNYA 1Y57A 2GQRA 4NJDA 3FMNA 3N9XA 2EWAA 3BGPA 4FTMA 3BCEA 3EQHA 3FLQA 4OT5A 4OTGA 3Q9YA 3BZ3A 2YITA 2BALA 3KULA 3Q53A 4AW0A 5ETCA 4AZSA 1PXNA 4LI5A 5GZ8A 3W33A 4YC8A 2YM5A 4H1MA 4JIKA 1PMUA 3PVBA 5FEEA 3ZUUA 1IAJA 5TR6A 2PPQA 2G01A 4UN0C 3AD4A 4CTBA 2WTVA 1XQZA 2WU6A 4DG0E 4DGLC 3MB6A 4WNOA 1BX6A 1XH8A 1YHWA 4MKCA 3ZMMA 4C7TA 4FTIA 2NNWB 3F88A 1RW8A 2Q0BA 5AUUA 4AZVA 3DKOA 5A4QA 3HEGA 4L7FA 3FKOA 2BKKA 3KF7A 4WA9A 3K5UA 3FJQE 2VTIA 2CLQA 2FH9A 3A62A 1GNGA 3PZHA 4A7CA 4K2RA 4YO6A 2A0CX 4QMNA 4XG8A 2YDIA 1VJYA 4JDHA 4X2KA 4C61A 3DXNA 4FV8A 4IVBA 4OTDA 1OKWA 3QQKA 2JKOA 4LQMA 4IX3A 1GY3A 4UY9A 2YM4A 5EI6A 4CCBA 4FGBA 2GQGA 5BYZA 1SYKA 4ANNA 4BCKA 4O7RA 4WO5A 5AIRA 2GFCA 4O0WA 1FGKA 5CXZA 5JKGA 3B2TA 3V04A 5KBRA 2XBJA 3ENHA 4FNXA 1GIJA 3IK3A 2OGVA 2HOGA 4QMVA 1JSVA 3HYHA 4F63A 3MS9A 4RIYB 5A14A 3MIYA 2Z2WA 1B39A 3DBDA 3EFJA 2E9VA 3RWQA 4MXXA 2EXMA 4DHFA 4I6FA 4QQ5A 3JVRA 3U87A 3QD3A 1PJKA 2BIYA 4QPMA 5DGZA 3JXWA 4DEAA 1HCLA 3U4WA 2RFEA 3FHIA 4FIJA 2OI4X 4FMQA 3AGMA 3HMOA 1UWJA 1YWNA 4HVSA 4MX9A 4XV2A 3FE3A 4YZNA 1ZYDA 4F9AA 2WKMA 2YM6A 4D2RA 5BQ0A 3UZTA 3HMIA 3PUPA 4GYGA 5H3QA 4ZJJA 3NVMB 3PE2A 3UVRA 2BDFA 3HECA 5K4IA 4CTCA 2BTRA 2HAKA 4F99A 2YABA 3I7CA 2B55A 2VAGA 3BYVA 4Q9SA 1F5QA 1SVGA 3E64A 2R0UA 5CAOA 5CANA 1XH7A 3VUMA 3HV4A 4UYNA 4K11A 2PU8A 3QUDA 4W4XA 2YWVA 5JT2A 3KVWA 4I6HA 4ALUA 4ANMA 2IVUA 4AGWA 4DH3A 1STCE 2XNBA 5AMNA 4FEWA 3N51A 3QRJA 1Q3WA 3BELA 3ZRLA 5ACBC 1R1WA 1YDSE 5C8NA 3CEKA 3QUPA 3QXOA 3HNGA 3KN5A 2PE1A 4QP4A 4MD7E 4ASXA 4GFGA 3ZLYA 3N4TA 4X2NA 1JKTA 4CSVA 3F7ZA 1UU3A 3FXXA 3NW7A 4TYJA 5EHYA 3VC4A 5DWRA 4TW9A 3PXRA 2GHGA 4CQEA 3R30A 4J98A 3MI9A 5EH0A 5FBOA 2GNHA 4IM0A 2YHVA 5CSWA 5I9WA 1YHSA 4DT8A 3VUIA 2CN8A 2A1AB 4FTQA 4O7LA 5IQFA 1M7QA 3BHHA 2PMNX 4AT4A 4KIOA 4ENYA 4DAWA 4RWJA 5E8XA 4IHPA 3EZRA 3W8LA 3BRBA 5AAFA 2QCSA 3G9NA 4D4VA 2CSNA 2W1HA 3O0GA 4RX8A 4I5CA 5H8GA 1YI3A 1JKSA 2HK5A 3DDPA 3LQ5A 3G6HA 2YFXA 5BVDA 1FOTA 1OECA 4F7JA 4E3CA 4QMMA 4RZWA 5AP2A 4JOAA 2W0JA 4FSMA 4R5YA 4ANLA 4ZSAA 4GW8A 4IADA 3AG9A 3ZCLA 3FI2A 2IWIA 3P1AA 2IZSA 1Q97A 2IZTA 2WTDA 2R5TA 3R04A 4FTLA 5CEMA 3SVVA 2J0IA 3TV7A 5A46A 1QMZA 2W99B 4YBJA 5CASA 4ASEA 2WAJA 2XIRA 4FKPA 3U4UA 4NKSA 4I92A 5KMOA 5EOLA 5M4FA 1ND4A 2REIA 5I0BA 1LR4A 4FTKA 4OBOA 4XLVA 4JNWA 4RFYA 1PKGA 2Y9QA 4KRCA 4BR3A 3AT4A 5E92A 4HPTE 1DM2A 3KULB 5I9UA 3RWPA 3SKCA 2QU5A 1YQJA 3E8CA 2WMVA 2VWYA 3F5UA 3M2WA 3SXFA 2UW8A 1FGIA 4YSJA 5M51A 3A61A 3RPSA 3C4EA 3IW5A 1YW2A 5CSVA 3UOLA 2ETMA 2WEIA 3BYOA 3F61A 5JRQA 4EWQA 3O51A 5FXRA 3QALE 2HIWA 4O91A 1JWHA 3MFUA 3Q4ZA 3D5VA 4PMMA 4DEGA 4XBRA 4L00A 3S4QA 5CY3A 4ZIMA 2P33A 4X6RA 2JGZA 2X8IA 4AE9A 5D41A 2OJGA 2OW3A 2R64A 4I6BA 1MP8A 2BDJA 2X2LA 4G9RA 4FL2A 3GC7A 3DA6A 4FTCA 4NZWB 5L2QA 3VS5A 3IW4A 3Q5IA 2X1NA 1UU8A 1OBDA 4MXOA 5EW3A 2J4ZA 3NYVA 4IDTA 5CF5A 2GDOA 2Z02A 1YI6A 4DF3A 3ET7A 3RHKA 3TIZA 3DOGA 4CCUA 2HZ0A 3D15A 1IA9A 3GCVA 4WBOA 4BCOA 5LARA 3SOAA 4FIIA 2PE2A 2HZNA 5AR8A 1H08A 3IDCA 4FI1A 2F49A 2GS7A 3LFEA 3PPKA 2J6MA 4IAYA 4ZP5A 5D1JA 5CNNA 3SXSA 3E3BX 5HO7A 4M69A 3FZOA 3V3VA 2JDTA 2C0OA 3RAIA 5E8TA 2XYUA 3BBTB 5M53A 3LFFA 2PE0A 5F9EA 4H05A 2HY81 3NPCA 3ZBFA 5IQAA 1MQ4A 3R83A 1NW1A 3ZUVA 1SZMA 3F5XA 4AZFA 3NUNA 4FYOA 4YLKA 5LVOA 1J1CA 4A4LA 2WMXA 3D5WA 3TL8A 2XH5A 1ZXEA 2QOIA 2UZVA 5KMKA 3SW7A 4O21A 3R7EA 4CLJA 2KTYA 1X8BA 4FG8A 4KSQA 3KF4A 4GG5A 3IG7A 4BTJA 4C0TA 1XHAA 3D0EA 4JAIA 4D58A 5F1ZA 4PNKA 2ZJWA 4UWBA 4FNWA 4CNHA 5BVOA 2EXCX 3I6WA 4J52A 4JR3A 4OW8A 4DCEA 4FIFA 4ZS4A 4PDOA 3BLRA 4GIHA 5HVYA 3P7BA 2F7XE 3SA0A 4KBKA 3NAYA 3WILA 3O23A 4NTTA 3UGCA 3HDNA 3CTJA 3P0MA 2QR7A 4ZLOA 5D11A 4NKAA 4E4XA 4NM3A 4E6AA 4FL1A 2QO2A 3ODZX 2V5QA 2GCDA 3NW6A 2C5VA 4OGRA 4RC4A 4QYGA 4ZTLA 3DKCA 4N6ZA 5AEPA 2I0VA 4HYSA 4FG7A 3MFRA 4FZ7A 4YJRA 4YHJA 3O2MA 4DFXE 2HZIA 4U5JA 3S2PA 3DDQA 3GQIA 4L3LA 4BDIA 3DTCA 4NH1A 3H30A 2I0EA 2VWUA 4TWOA 2VO6A 4O96A 4IANA 3R9OA 2GU8A 3NZ0A 5IISA 2C6MA 4FV2A 3KXNA 4R1VA 3T3UA 3RZFA 2W5BA 2XZSA 3DNDA 3R7GA 3NGAA 4BHNA 5C03A 5CZHA 5B2MA 2ZYBA 4FZDB 4U44A 1GJOA 3O17A 5FTGA 5HIDA 5AA8A 3TKUA 2R3FA 4PQNA 3DPKA 4FBXA 2IVSA 5B0XA 2Y4PA 4BZOA 4NW6A 4B99A 1XBCA 1GZ8A 2P2HA 3BLQA 2SRCA 4WNMA 1OPJA 2QNJA 3E8EA 3FZTA 4NK9A 4R7IA 4JBOA 5J9LA 4YMJA 4RIWA 5DHJA 4OTQA 4FTNA 2OXYA 2JIIA 1M2PA 4GVAA 3F2AA 4KKGA 4L42A 3WYXA 3PWDA 1RE8A 3OBGA 2R3KA 5KNJA 3ALNA 4IB3A 2PZIA 5ETAA 5FQDC 3II5A 4MXAA 2YCFA 1YHVA 4C38A 3QQFA 2CGWA 5CEOA 4WT6A 2XCKA 4EOQA 1WBOA 1AQ1A 1HOWA 3VJOA 5CF6A 4XH6A 5DPVA 3L1SA 4M0ZA 3OOGA 3ROCA 4BCQA 4C8BA 3TEIA 1K9AA 5HORA 3E62A 4LV5A 5DBXA 3NAXA 5GZ9A 3FI8A 2BAQA 3F3WA 4GK3A 3V5PA 4UZDA 1P5EA 3PA5A 4U40A 3MA3A 3HRCA 4YJPA 4DT9A 3P79A 4P90A 4QP7A 4ACMA 1M17A 3ZXTA 5HGIA 3DK3A 4FTAA 1M52A 4EH9A 4XOZA 5HU9A 2J5FA 3IPHA 3KMMA 4BCIA 3R2YA 4KIPA 3IOPA 2WMBA 4PX6A 4QT1A 3NLBA 4HVIA 3UMWA 3O71A 3GOPA 4TKSA 5IEYA 3K3JA 3R1QA 3LCTA 3R8MA 1J7LA 1ZYCA 3QCSA 2YM3A 1QPEA 4TYEA 3WF9A 4D5KA 4FKWA 3SC1A 4MYGA 3L8SA 4APCA 4QTDA 3CJGA 3I0OA 4C4HA 1PXKA 5E8UA 1KV2A 3PLAE 1H26A 1FQ1B 2V7AA 4ITIA 5EYMA 3OT3A 3IOKA 3UOHA 4L9IA 3W18A 4E6CA 4J8NA 3OCTA 3F9NA 3R1SA 5DG5A 3OCGA 2FYSA 4LGHA 3IDPA 4IM3A 4KAOA 3H0YA 2C6LA 3ZM4A 5J7HA 4ASZA 2XCHA 4Y73A 4ZZOA 5M4UA 1UWHA 3WF6A 4AOJA 2ZOQA 5H8BA 4CZYB 5CWZA 3RCDA 3OP5A 4USEA 3R00A 1JVPP 5EM6A 2RG6A 1KE9A 4XRLA 2R0IA 3EL7A 4NM0A 4OUCA 5L6OA 2OJ9A 1OIQA 2UZBA 2W1GA 1UA2A 3QKKA 3W2PA 1NVQA 5AWMA 4EBWA 1PXLA 2XP2A 4W8EA 2XB7A 1GZOA 1H1QA 3UNKA 3QCYA 3O7LD 4FOCA 1ZZ2A 4EJ7A 3AMYA 2C5OA 3GFWA 1H1SA 1ZOGA 2WO6A 2VO7A 3DBQA 3OTVA 4YC6A 3VW8A 3BX5A 3Q9ZA 4EUUA 3PSBA 1ZWSA 3R1NA 1SVEA 2UW4A 2O8YA 4XNEA 3E8DA 1NT2A 2FSTX 3AC5A 4ZOGA 4D4RA 3G33A 2PZYA 2OJIA 4GCJA 4XYFA 1LEZA 2BAJA 2PULA 2PUNA 5AP0A 1H25A 4E5BA 2YCSA 4GK4A 5CF4A 1URCA 4IVDA 3DT1A 4QYFA 1YXUA 4IZAA 5E4HA 2C5XA 1PXMA 5EDQA 4DYMA 3VS3A 2RSVA 4L8MA 4Z9LA 3CQEA 4ZSLA 4LYNA 5AP1A 5T6KA 1Q62A 4FVQA 3U54A 3TXOA 5L8JA 3UYSA 2XBAA 5L2TA 5A4TA 1OM1A 4MWIA 4BDCA 4QYYA 3DQWA 3OEZA 2YAAA 4F9YA 1ZY5A 3LKMA 2PSQA 4JRNA 1NXKA 4GG7A 3NWWA 2FVDA 5AX3A 2GMXA 3LW0A 1OVEA 4I94A 2PVKA 4QPSA 1JLUE 2A27A 2XKDA 5TF9A 4LMUA 4IACA 5DEYA 4DBNA 2YIXA 3BQCA 4HJOA 5KHXA 3P86A 3AMAA 1R0PA 3R22A 4DCAA 4TYHB 2F7ZE 2RFDA 3FC2A 3LXPA 1V0OA 4XBUA 4KSPA 3BYUA 3AT2A 4WRGA 4FODA 3WZDA 1QPCA 2EXEA 4EH8A 3D9VA 5HVKA 1R78A 3UDBA 4WUNA 3TKHA 2CNUA 2B53A 1UNLA 4CT1A 2XIKA 2I0HA 4DINA 4O84A 2OICA 2C3IB 4GFMA 5T68A 4D2SA 3LFNA 2XS0A 2CGXA 3EQGA 5D10A 3F69A 3G0EA 4S34A 4AGCA 5IA0A 5M56A 3LIJA 2QOOA 4EWHA 4WG4A 3P78A 4FT9A 4P5QA 5BMSA 3MESA 3O50A 4Y8DA 1YOJA 3LZBA 2P55A 4FOBA 2VRXA 4QMSA 3RM7A 4AFEA 4BI2A 3KRLA 4J99A 3HV6A 4YZCA 2OH4A 3G9LX 2P0CA 5EDPA 3UQGA 4M8TA 4FV0A 3S00A 2C4GA 4DH5A 2ITVA 4II5A 5KE0A 5AFVA 1YDRE 4D1SA 3ZS5A 3QUEA 2HW7A 4G31A 4F70A 3Q6UA 2QG7A 3FV8A 1IA8A 2VTSA 4IWQA 3OFMA 5DYJA 4K9YA 4FKOA 5KMMA 5LCJA 3EYGA 4IZ7A 4BKZA 3KQ7A 3U9NA 3OCBA 4RSSA 3QTUA 4ANQA 4EJNA 4O7VA 3I81A 4CGAA 2JKKA 4IC7A 5EI2A 5TOZA 1UVRA 3G2FA 4A9YA 3DV3A 4BCHA 5EG3A 1WBWA 4DBXA 4OAUC 4PWNA 4AZTA 3BGZA 4AW5A 2J0MB 3LJ1A 5CAPA 2JBOA 2FSMX 1YKRA 4RQVA 4RVTA 4X2JA 3BWFA 4Y83A 3IECA 2WQEA 1O9UA 2C69A 2Z7QA 3UO5A 4IQ6A 4FTTA 1W98A 3KEXA 2VD5A 4PP7A 3I0QA 4L52A 5C01A 3JVSA 3NIEA 4XV1A 2QOHA 4FX3A 5FTOA 5AUZA 3D7ZA 4HGTA 4Z3VA 4XMOA 4GH2A 3NNUA 4KB8A 3GXLA 5ANJA 4DEBA 4ZTMA 3TNIA 1KUTA 3C13A 4BKJA 2VTAA 4FL3A 3RP9A 3EN6A 3LFSA 5EM8A 2Y4IC 2VO0A 2GNLA 2W1FA 3NR9A 3QTXA 4MNEB 4A9SA 5FUTA 3A99A 5IMXA 3B8RA 2YIQA 2ZV9A 2OH0E 4ZXTA 5CAQA 2W4JA 3EQBA 1H1RA 5HZNA 3BE9A 4ZY6A 2Y4IB 3UNZA 5CSHA 1ZYJA 1OITA 1Y8YA 2BZJA 3TJCA 3MSSA 3UIUA 5LQFA 3R02A 4EOJA 4Y46A 3LCOA 3R9DA 4MD8E 3MGYA 4YTCA 2VV9A 4UZHA 5IZFA 4TXCA 2PVFA 3ZRKA 4AFJA 1YDTE 1CSNA 2B9JA 2HY0A 4MF0A 2VNWA 4Y5QA 4W9WA 2QOFA 1SM2A 3LHJA 3UG2A 4BGQA 4E6DA 4F6UA 4R7HA 4O7WA 3AC8A 2X7OA 3ORMA 4O0RA 3ROYA 1Q8TA 2BPMA 3BEAA 5I3RA 3TN8A 4D2WA 4IMYA 3OT8A 3EKKA 1SMHA 2R3GA 4FV3A 3COMA 3E7VA 3FUPA 3KY2A 1OKZA 4GMYA 4OTPA 4FKJA 5FP6A 3TNHA 5I9YA 4JX3A 3SQQA 4YR8A 3L9PA 2QOKA 4MH7A 1HCKA 1WBTA 2FSOX 4M84A 4JS8A 4RJ5A 4Z7GA 4M66A 3FYJX 2OWBA 4HYIA 5CVFA 3U9CA 4BKYA 3UE4A 5DRDA 3RNYA 3Q2MA 5IDPA 3A60A 4YJVA 3C4CA 4D2TA 4DFLA 4EK8A 3H9FA 4RQKA 4C2VA 3VWAA 3FSFA 4FIEA 3HKOA 5HE1A 3D4QA 3CR0A 4RC2A 4XG3A 4IAZA 4S33A 3W2OA 4F1TA 5LMBA 4XCUA 4ZS0A 1XH5A 1PRYA 4QMOA 4EBVA 3LXKA 4ZMEA 4QYEA 4X3JA 4EH7A 2O3PA 4UMRA 5AA9A 4MXYA 2VTHA 3BQRA 2ZB0A 2JAVA 4G6LA 4QMTA 5HO6A 2VTTA 4E4NA 2X7FA 3V6RA 4ARKA 2DWBA 4UBAA 3IGOA 5JH6A 3VF9A 3VUTA 5DEWA 3GI3A 3ZDUA 5BUEA 3F5PA 2XM8A 2YJRA 3R7IA 2ITXA 3CKXA 2BKZA 2X4ZA 4PMPA 3L9LA 4JBQA 3ZOSA 4E6QA 2EU9A 1Q41A 3R9HA 2CDZA 5CU6A 4S30A 2OKRA 3MA6A 5CF8A 4N4SA 4XOYA 4D9UA 2BAKA 3REPA 1DAWA 2O63A 3CD8A 3JS2A 3K54A 4GUBA 4XG2A 2JDVA 4RFZA 3BLHA 5JFVA 3Q2JA 3NUPA 5JQ8A 2XNOA 2ZDUA 3BHVA 3UIXA 4G6OA 4PL5A 4R1YA 3FZRA 3SV0A 4ZLZA 4PMSA 5CEIA 4HNFA 4CMTA 5I9VA 3DFCB 2ITOA 1G3NA 3QZGA 4H3BA 3OBJA 3R28A 4L44A 2GS2A 3ORXA 4C4JA 1AD5A 4ENXA 4MK0A 5CEQA 2I0YA 5AR2A 4M0YA 4EEVA 3LXNA 3CPBA 2VZ6A 3MN3A 4JQ7A 3F3ZA 4U45A 1QL6A 1XBAA 3EMGA 3TTJA 4TWPA 1PMVA 3KRJA 2J5EA 3HMNA 1XH4A 3MTFA 4HZRA 3GT8A 3HZTA 4F65A 4YJOA 4K0YA 2IVTA 3FZPA 5D7AA 3V8SA 5TT7A 4YJQA 1IAHA 3ZO3A 1OIYA 1KE6A 2YZAA 4QD6A 4HGLA 1U54A 1RDQE 4G5PA 5BVNA 3KXGA 3T8OA 5IA2A 2X2KA 5AP3A 5B2KA 4CZUA 2WXVA 4EK4A 5IPJA 2BILB 2I6LA 2PUPA 4TTHB 3FEGA 2B54A 4O81A 2WHBA 4QMUA 3WZJA 5FXQA 4FSQA 4TL0A 2X39A 2EUFB 2C1AA 4LL5A 4G1WA 4ZK5A 4S32A 3TIYA 1AGWA 4EK3A 4J1RA 5CTPA 3L8VA 2QOCA 4HW7A 3Q9XA 4QNAA 2OJJA 5AADA 1ZAOA 4AUAA 3FMKA 3P7CA 3QGYA 4BL1A 2BZKB 2XIYA 3KC3A 2ETRA 3EJ1A 4WUAA 4EH2A 3RJCA 3KCFA 3QU0A 3C50A 3WE4A 2VTLA 4D2PA 4O2PA 3F2NA 3OG7A 1APME 3DZQA 2XEYA 4TYGA 3TZ8A 4M14A 4RJ4A 4BCJA 4D1ZA 3QTZA 3LLTA 4NUSA 4F64A 4TT7A 2BR1A 4DGOA 2YIYA 3MH0A 3QGWA 3ZH8A 5IQIA 5LVPA 1VEBA 2CGUA 3PSCA 4FSNA 3U51A 3UO6A 4E7WA 4L3PA 4YJSA 4AT3A 5L8LA 3IDBA 5D7VA 4FZ6A 4FTUA 4I24A 3QYZA 4FT5A 3BGQA 4JBVA 4KBAA 3POOA 1ZOEA 3Q60A 4AZWA 4EKKA 3LFQA 5IG1A 5A6OA 3BBWA 4ZSGA 4ZMFA 4FEVA 2WMSA 5HBJA 2JAMA 3LAUA 4LRJA 3QD2B 1M7NA 3Q4CA 2W1ZA 2C6EA 4NW5A 4BDFA 3MVJA 4MBJA 3G0FA 1OUKA 2ETKA 3HV5A 4WRSA 1V0BA 4FZAB 3FDNA 5EKOA 4EKLA 1CMKE 5ANDA 1OKYA 3G6GA 5HX8A 3QD4A 4D4SA 2VTQA 3DKGA 4BGHA 2JBPA 3R8UA 4GU9A 4U0IA 2BRNA 4YJUA 2VN9A 5DH3A 3WBLA 4N6YA 3ZM9A 5JSMA 3VS0A 3VUKA 3OY3A 4H3PA 4CKJA 5KMJA 4FKLA 4IVAA 3TZ7A 4QP2A 2JFLA 3QRUA 5LMKA 5M07A 2YM8A 3O8UA 2PMLX 4OTFA 2W1IA 4NL0A 3AC1A 3TZMA 3H0ZA 4O0VA 1CM8A 3P7AA 4DFBA 3IQ7A 2UVYA 4AU8A 3NYNA 4BRXA 5B7VA 3VS6A 4R7BA 4BCFA 4UMTA 2R3IA 4RIXA 5JGDA 2E9UA 5CX9A 4RX9A 2R3OA 4KS7A 4PUZA 3VBTA 3FC1X 3AOXA 4YTHA 4USFA 3HMMA 3QKMA 3OCSA 3KK9A 4B9DA 2J90A 5AM6A 2IW8A 2VTJA 4P5ZA 4WSQA 3FQEA 3R7YA 5JMSA 4AGUA 4QRCA 3TDWA 3JPVA 5ICPA 2CKPA 5AP7A 2JEDA 4LOOA 4ANBA 3RCJA 4BI1A 3S1HA 4DN5A 4O7ZA 4PDYA 4NFNA 4B8MA 4BWPA 5JZJA 3EN4A 1CTPE 4ERKA 4XP0A 4RIXB 3DAKA 3QA8A 4MNFA 4PTGA 4N57A 2W4KA 5GZAA 4U6RA 1YXSA 4EK6A 3KU2A 5EYCA 1K3AA 5ANEA 1KWPA 3FLSA 1S9JA 2QU6A 4TNBA 3V5TA 4A07A 2BUJA 2Q83A 5CYIA 5CAUA 2C1BA 3E63A 2ACXA 1WBNA 3O96A 4RFMA 5FD2A 4A4OA 5FXSA 2YIWA 4TN6A 2OIDA 4GT3A 1WAKA 2BFXA 1ZRZA 2XJ0A 1M2QA 3RPRA 4AA5A 1Q3DA 2J2IB 4WG5A 3SGCA 4A9TA 1UU7A 2PVRA 2PY3A 3ZSHA 1H27A 2DUVA 4V01A 5C4KA 3QQJA 5TKDA 4FIHA 3ZSIA 3ZXZA 3GCSA 1NVSA 4K18A 1PYXA 3HA6A 3HLLA 3QCQA 5CI7A 2C68A 1PY5A 3B8QA 2G15A 2UUEA 2XNPA 1BL6A 2DQ7X
chains in the Genus database with same CATH superfamily
4O4CA 4ZJIA 2XNEA 4KNBA 4U97A 3W16A 2WMWA 2XYNA 5L6WL 1L3RE 3R2BA 5FDXA 3W2RA 1JNKA 4UX9A 1CKPA 3KRXA 4DDGA 4CXAA 1H1PA 3N4VA 1H07A 3MPMA 3C0HA 1YXXA 4PV0A 4R78A 3WE8A 4EC9A 2YZLA 4LV7A 4FVPA 4RIYA 4MXZA 5EOBA 2IZUA 5DN3A 2E9OA 4LGDA 5J9YA 3KMWA 4E5AX 2G1TA 2OZOA 4YURA 5T3QA 2YDKA 3PPZA 4F4PA 2RF9A 2XK6A 4FSZA 5KZ0A 3QZHA 3B2WA 3GUBA 5IDNA 5HCZA 1XH9A 4O6EA 3F3UA 3VS1A 2R4BA 4YTIA 3QHWA 4BDGA 4YO4A 4ITJA 5IA1A 2HW6A 3FMHA 3KCKA 4G34A 3R7VA 2KULA 3CLYA 4YUQA 3R6XA 1W2DA 2J0JA 4I22A 5L2SA 1FVVA 4FT0A 3R71A 4G3GA 3O5AA 3DKFA 5FEDA 2GQSA 3QLFA 1Y91A 3AKLA 3NS9A 3NIZA 3CC6A 3GU8A 1JQHA 4ALVA 4YU2A 4U9AA 2IPXA 3EIDA 2PYWA 4FV4A 5K5XA 3POZA 2XMYA 2Y6OA 3MVMA 4RMZA 2UVZA 3LCSA 3CY3A 1UKHA 3E5AA 5M4IA 4GYIA 4L67A 5ETFA 4V0GB 5IQHA 2BRMA 3MH2A 4K8AA 4IFCA 4KIKA 3PWYA 2H96A 5I3OA 4ACGA 3V8WA 4F0GA 1H00A 4BIEA 4MF1A 2GNGA 4RIOA 4ACDA 3AXWA 1H01A 3UC3A 4RWLA 3UQFA 3LM0A 1GAGA 4HVGA 3QX4A 3WF5A 2PVMA 3GU5A 4C59A 4BBFA 4QOXA 4JBPA 5FM2A 2ZV2A 4BDDA 4J95A 1GZNA 5GIOE 4L68A 1W83A 2CJMA 2HZ4A 2V62A 3ALOA 4R3PA 4TWCA 5KMLA 3OW4A 4G16A 1SNUA 3KN6A 1W8CA 3ZC6A 2YA9A 5CSPA 4F6SA 4DC2A 4BF2A 4EH3A 5J1WA 2R7BA 4AQCA 4I4FA 4RJ3A 5GINE 4XV9A 2OXDA 4EL9A 2C3KA 4F09A 4FV5A 4LG4A 3QRTA 4DDIA 4BWXA 3E7OA 4C57A 5J79A 3P08A 3LCDA 2Z7LA 5I4NA 4ZTHA 2BHHA 3QWKA 1GIHA 3ACJA 4X7QA 3VULA 1KOBA 2PWLA 5AUTA 3FPQA 4KKHA 5IA3A 3LJ0A 3WARA 5CALA 5LCKA 2CKOA 4AE6A 4BVUA 2VGOA 1JAMA 3LXLA 4IX6A 3OWJA 2NPQA 4YZDA 4AXDA 4K6ZA 3RMFA 3D14A 3LFAA 2VWWA 3ORIA 2UZNA 4JLCA 4O0UA 4JXFA 1BMKA 3MH3A 2BHEA 3V5WA 3ZZWA 4O7NA 3TG1A 3DCVA 5EDRA 5A6NA 3KKVA 3CGFA 2PTKA 5KHWA 5JFXA 1IASA 4I5HA 5M55A 3U55A 2QO9A 4AX8A 3E88A 4LMNA 4K1BA 5ETIA 2B9HA 3C0IA 5IA5A 1Z9XA 1IR3A 4ERWA 1XBBA 3BLAA 3A7GA 1Y6BA 3P5KA 2PVNA 4FT3A 1E9HA 4XG4A 3TWJA 3V5LA 5EHLA 3QC4A 3OVVA 2WEVA 3M1SA 4TY1A 3UC4A 4KUJA 4M12A 2RFSA 3LFBA 2CMWA 5FBNC 4B0GA 5LVMA 3FMDA 4DE4A 5K0XA 3MY1A 3QKLA 4QQTA 3F3VA 3THBA 4ZZNA 2IW6A 4O27B 3TACA 2NRYA 3PY1A 3WIKA 3C4FA 5HBEA 4ZTNA 4C58A 4HGEA 4QMYA 2JKQA 4PL4A 4UMUA 2WNTA 2XK9A 4O22A 4QTEA 1Q99A 3QLGA 3BV3A 3OOMA 4YLJA 1H0VA 3FI3A 4Y72A 4HGSA 4EOMA 3ORTA 3KA0A 4IM2A 1KE7A 5F94A 3A2CA 5F4NA 3R9RA 4FTJA 1ZOHA 3BV2A 2UVXA 3Q52A 4QP8A 2W96B 3RHXA 4XP2A 2WTJA 2W17A 4KWPA 3VRYA 4AN9A 4CRLA 3DLSA 3OWLA 3ACKA 2AC5A 1P4OA 1S9IA 4UYAA 4XG6A 2WELA 4XUFA 5J95A 2OK1A 3C7QA 4IX4A 4G3FA 4LOPA 3ORZA 1WBSA 2H9VA 4RLKA 3TI1A 5L2IA 3QRKA 3G15A 2WFYA 3Q6WA 3VUHA 2HWPA 5JEBA 4IB5A 3RK7A 3OC1A 4BI0A 1JBPE 4G3DA 2ONLC 3IW7A 2I7QA 4R77A 3MVHA 3HVCA 3TNWA 4CKRA 4LM5A 4FE2A 2YCRA 3EFLA 5H2UA 4CVAA 1ZYLA 3UJGA 4UV0A 5GHVA 3IS5A 4NCTA 4W9XA 4RA4A 4ID7A 3LM5A 5BVFA 1OGYA 1VZOA 3OZ6A 3W32A 2W1CA 1OI9A 4CT2A 5C9CA 2OBJA 2WPAA 4JG7A 4BGGA 4FSUA 3LCKA 4FVRA 3QZFA 1OPLA 1Q8YA 4RRVA 4AXCA 4YP8A 2EVAA 4ONAA 5EFQA 3DK6A 3I6UA 3RGFA 2WTCA 4FSRA 3QRIA 4E1ZA 5KZIA 3PRFA 4W4VA 3NNXA 4S2ZA 4FNZA 4FNYA 3C4WA 4IAKA 2DYLA 4BC6A 4JG8A 4ASDA 4BZNA 4RVLA 2LAVA 3E87A 3KREA 2PHKA 2V7OA 2PZRA 3PFQA 1GIIA 3MJ1A 4PL3A 4TYHA 5AR4A 4D28A 5HG8A 5GJFA 4RA5A 2X81A 5DLSA 2BZHB 3OHTA 4I0TA 3R21A 4BTKA 3V6SA 4YJTA 4L6QA 4QQCA 2VX0A 3E3PA 2UV2A 4RPVA 4QMLA 2BRBA 3MTLA 2R2PA 2VGPA 3NEWA 3NYXA 1I09A 2YJSA 2X6EA 1T45A 2BVAA 4F7SA 5CS6A 4BHZA 3QQUA 1A9UA 5HVJA 2GNFA 3EN7A 3KXZA 5DR6A 5AR7A 3D94A 5HKMA 1G8SA 3H9OA 2UW5A 5DIAA 2PVJA 5C8KA 1OL6A 2V22A 4ZY5A 1G8JA 5IQCA 3GCQA 1ZLTA 2W05A 5JFWA 4L3JA 3A7JA 2XKCA 3BYSA 3PY3A 3GVUA 4G2FA 3RPYA 3BEGA 3UG1A 4F0FA 1XJDA 1IRKA 2OU7A 2RFNA 2W9ZB 3HA8A 3KFAA 4Q5EA 4ACCA 3WZKA 5AV3A 5CENA 2QHNA 4ANOA 2YWPA 3RPOA 5JZNA 4C4EA 3GB2A 3PXYA 4YZ9A 4FK6A 3ENMA 3DZOA 3R8PA 3KK8A 4IWPA 4RGJA 4IE9A 1NVRA 3WZEA 4QTCA 1OGUA 4BDJA 2XARA 3EFKA 2QO7A 2XUUA 3EB0A 3F82A 2BMCA 4JIAA 3UP7A 3PVUA 3QXPA 4EQUA 4KABA 4GL9A 4AZEA 4IJPA 3LOKA 2C47A 3FYKX 4XHKB 5E1SA 5LMAA 5L8KA 1REKA 2LGCA 4QMWA 2FB8A 4I0SA 4GRBA 1PXIA 2X0PA 3BU3A 3DBCA 5BVEA 4FUXA 4U80A 4BCMA 5BYYA 2A2AA 1W0XC 1OL7A 1LEWA 3EKNA 3PIXA 5IQBA 4ZTRA 3FLYA 1U54B 3PZEA 2XK8A 2JC6A 4FUYA 3HL7A 2W7XA 2GHMA 4QP1A 2PL0A 5J87A 3D83A 3MYGA 3PIYA 1DS5A 4CZTA 5GIPE 3HGKA 4RT7A 2ITQA 3ZFMA 4G3CA 3CPCA 3RNIA 5A4LA 3LLAA 2XRUA 5CT7A 4JAJA 3ZU7A 5E90A 4YZMA 4FEQA 2PZPA 4U43A 4EZ7A 3SLSA 3UVQA 4IW0A 5G6VA 2WMTA 4XX9A 3PXQA 3ZO2A 3ERKA 2PVHA 3ID6C 3OS3A 4G9CA 4FC0A 5HG7A 1J91A 5TO8A 4AG8A 4H58A 2B7AA 2HXQA 5LJJA 5D9HA 5DNRA 2EB3A 5AX9A 4EZ3A 4D0XA 4GFOA 3NMUF 2RG5A 3AD5A 3JYAA 3IW6A 4EOSA 5CAVA 3S0OA 4CQGA 3W0SA 3COIA 3QCXA 4QP6A 4WSYA 5IH4A 3OD6X 3PG1A 3ORNA 2GFSA 1WBPA 4CFUA 5GJDA 4DEHA 4DEDA 4DFUA 4X3FB 4Q9ZA 2UW9A 3K3IA 4E5WA 4X0MA 2I40A 2C0TA 1XR1A 1KE5A 3KXHA 2RKUA 2Y7JA 1OZ1A 4LV8A 3QL8A 3DK7A 4W4YA 4AXAA 3R9NA 4AW2A 4O6LA 5CQUA 5M57A 4MHAA 4RVKA 3NW5A 3IONA 3AGLA 4ITHA 1OL2A 3VIDA 5IQEA 3MY5A 4ZSJA 3IKAA 4WKQA 2JDRA 3LFDA 4U8ZA 3R7OA 3SRVA 2H34A 4R3RA 3LJ2A 5EK7A 1J7UA 5DT4A 2CN5A 3W2SA 3GEQA 4LFIA 3CQUA 4FKIA 2C5NA 2ZM3A 4JDJA 4NT4A 3QZIA 5HNGA 4D9TA 1Q8UA 3RTPA 1YWVA 3Q04A 1KE8A 2B52A 3EL8A 3TV4A 4R3CA 5BNJA 1U5QA 4HYHA 4CMOA 3D7TB 3AMBA 4YPDA 3DFAA 3KXMA 4B4LA 5DVRA 2W1EA 3SD0A 1W84A 4JDIA 2YM7A 5EQPA 3DLZA 4Z7HA 1JKLA 4LGGA 4F9BA 1XO2B 2E2BA 4QDEA 3LFCA 2C3JA 5FEQA 3EQFA 1YXTA 4IZ5A 1U46A 4RWIA 2B0QA 1B6CB 1YI4A 2OIQA 3FZSA 3DBEA 4K33A 1CDKA 5FLFA 3FKNA 3O7LB 3PP0A 5HE3A 4DTBA 1JOWB 3RPVA 4BIDA 4C34A 2WQOA 4DGMA 3FAAA 3HRBA 1XKKA 3VBYA 4O0YA 4CV9A 2BRHA 5EW9A 5JQ5A 5CNOA 3VBVA 3PJ2A 2V55A 4IDVA 4DG3E 3AC4A 3GNIB 4ANSA 2VWVA 3Q96A 5LVLA 3PXZA 3PE1A 4RJ7A 4ZTQA 4O38A 4FR4A 4DFYA 2CCHA 2VWIA 2R3MA 3DU8A 5IEVA 3MB7A 4P4CA 2UW7A 4BTMA 2CNVA 2CCIA 3QYWA 1BYGA 4QDVA 3GC0A 3P23A 4LL0A 4U81A 1LUFA 3BI6A 2JIUA 3Q4UA 4OTWA 3VBQA 3VQUA 1MRVA 4W4WA 4EHVA 3V5QA 3L9NA 4W8DA 3NCZA 3TDVA 4GVJA 1OMWA 4C62A 1OL5A 3MFTA 3PLSA 3MBLA 1TQMA 5HTBA 4MCVA 3E8NA 5AP4A 5AP6A 4Q5HA 2XVDA 3GP0A 4LUEA 5HQ0A 2C30A 3OWKA 3FKLA 2XJ2A 2R3RA 3R0TA 4FJVA 3V5JA 2X9FA 3HX4A 4IXPA 2FUMA 2W5HA 2HENA 4E93A 4FF8A 4X6QC 5FWKK 5M4CA 3FMJA 2C6KA 3CY2A 3W0RA 4UWYA 2W06A 4LOQA 4A9UA 5DI1A 4BCGA 2ITZA 1PYEA 3MPTA 4JT3A 4E4LA 4QMQA 5D12A 3FL4A 2UZWE 4JJRA 4L7SA 4GK2A 4NFMA 5AJQA 5K3YA 2NP8A 4O4DA 4BFMA 4L43A 4YZBA 5G1XA 3W1FA 4BYIA 2YCQA 2F2CB 1O6YA 3NUSA 4MQ2A 5CU4A 3A7FA 4V05A 5FRIA 5HOAA 4BTFA 3UOJA 2Z60A 2WMUA 3ZBXA 4XV3A 5AV4A 4QTBA 3I7BA 5EKNA 4JVGA 4Q2AA 2UW3A 4TYIA 3D2IA 3FMMA 1G8AA 3EN9A 2PVYA 1UU9A 3GU7A 4RWKA 3BPRA 1BI7A 4D55A 3RAKA 4FYNA 5AM7A 3MFSA 3R7UA 5K5NA 3BL7A 4AA0A 4FV1A 3QBNA 4AN3A 4X2FA 4FGRA 5CVGA 4AQKA 3F3TA 4IH8A 5FGKA 4KBCA 3R01A 4BY9E 2WGJA 5JK3A 1QCFA 1E1VA 4BBMA 3UDTA 4DH8A 5HLNA 4DLIA 5BVKA 2QD9A 1P4FA 2C6OA 4BCPA 4CYIA 4KD1A 2QOBA 5LWMA 1FMKA 3FMEA 3CTQA 3EZVA 2ZMDA 4QP9A 1G8KA 5DR2A 5BVWA 3R8LA 3VAPA 4H1JA 4TPTA 1F3MC 3VS4A 3EQDA 2F9GA 2X8DA 2F57A 5K4JA 1XWSA 4QP3A 1Q4LA 1K2PA 3KB7A 4G3EA 4U42A 5F95A 3HDMA 4UXQA 3C51A 3F6XA 3OWPA 2VTNA 2XM9A 3QAME 4EZ5A 2QKRA 4NJ3A 4AWIA 3D5XA 2C6TA 3U6JA 2BROA 4JQEA 4DTKA 4C4GA 1WCCA 3OXZA 2ONLA 4QTAA 4CFFA 4F78A 5E9EA 2Y0AA 4GJ3A 1Y6AA 2JDSA 2VTPA 3QWJA 2XALA 3IO7A 3UNJA 2WOUA 1JKKA 2J0KA 2DS1A 3G51A 3GCUA 3MWUA 3QA0A 4I93A 4NCTC 3TKIA 3QTRA 4FKSA 4OTHA 3ZO1A 3Q5ZA 3I60A 2AC3A 2BFYA 4I20A 3BWJA 1PMNA 4N70A 4UEUA 4GSBA 4GV1A 5A4CA 4F9WA 1FVRA 3ZEWA 3GC9A 5LMKC 3EQRA 3I1AA 4IAIA 2FSLX 3V01A 4YTFA 5IH5A 3ZFXA 2CGVA 3SX9A 4RJ6A 3CS9A 3C0GA 5HLWA 3OXTA 4GJ2A 5E8SA 4IEBA 3W2CA 1ZARA 2XEZA 3PJ1A 2QOLA 2VWZA 4NIFA 1GZKA 3GOKA 3F7WA 2A4LA 3SXRA 5I9ZA 4OT6A 4MEDA 5HI2A 3CBLA 4CD0A 1TFFA 4FV7A 1CKIA 2XNGA 3WIGA 3R8VA 1VYWA 1OUYA 4FEUA 1ATPE 4FSTA 4C36A 3ZHPC 3EHAA 2QQ7A 3WF8A 1ZMVA 2ZMCA 2C6IA 3RAHA 3NDMA 4FV6A 4Y85A 3CSVA 4FKVA 4HVHA 2JFMA 5KUPA 3PJ3A 4P2KA 5KMIA 4FTRA 3HUBA 4O1OA 4RVMA 4XP3A 2WIHA 3Q9WA 1H4LA 2C5YA 4I41A 4WD5A 5DT3A 5E8VA 2ITPA 4PPCA 4MAOA 5AIKA 3QD0A 5FG8A 5CEPA 3BHYA 2IO6A 4A06A 3TZ9A 3DAEA 4FA2A 3DS6A 4CFMA 4EH4A 3FMLA 5CLPA 3QQHA 4AOTA 5KO1A 3TTIA 3UODA 1MUOA 2UW0A 4NTSA 5FTQA 5IUIA 1FMOE 4DFNA 2F2UA 3N4UA 3L8PA 5AV1A 3ZDIA 4ZY4A 3PYYA 3KRWA 3ZRMA 4CEGA 2GPHA 1R0EA 3VHKA 5E8YA 3D2KA 3NVKI 4GS6A 1NA7A 4JMQA 5A9UA 3EQIA 3SDJA 2YERA 3NUYA 2HXLA 5ITAA 3EWHA 4X3FC 2JLDA 5BUJA 3KXXA 3TUDA 3CQWA 2GHLA 1TKIA 3AC3A 1OB3A 3UYTA 4O4EA 3EYHA 5HTCA 4DG2E 3GC8A 3R1YA 4HOKA 2O65A 3MH1A 1JSUA 3VO3A 1PKDA 4OAVB 4CV8A 3ZO4A 5HICA 4RC3A 2QONA 2NRUA 2X7GA 5C27A 1FINA 2R3HA 4X2GA 1ZYSA 5ANGA 4AA4A 3FHRA 3NUXA 5LWNA 3FY0A 3FPMA 3RM6A 3VVHA 4C33A 1MRUA 2CKEA 3BU5A 5EM7A 3A8XA 5AR3A 3QQGA 2HELA 1H1WA 2J9MA 4FZFB 3BL9A 4C2WA 2OG8A 2P3GX 3GFEA 1L8TA 1M14A 4JI9A 3LE6A 4OR5A 2R3JA 4I1ZA 4XJ0A 5L2WA 3L8XA 3W8QA 3A4PA 1FVTA 3ZLWA 3RINA 2QHMA 4J96A 4PF4A 5KX8A 1W82A 1URWA 2J7TA 5EW8A 4F0IA 1SNXA 1ERKA 3ORLA 4FIGA 4IFGA 4BDAA 1PF8A 4AS0A 5EYDA 3COKA 4EOKA 2W4OA 3KIOC 4HYUA 4M13A 4DH7A 2BDWA 4UMQA 4R8QA 5F20A 4O7YA 3TYKA 2PK9A 3W2QA 4WNKA 5IH6A 2ZFYA 2Z7RA 4F1OA 4EHGA 1WVWA 4U41A 4GT4A 3E93A 1WBVA 2GNIA 4EOLA 5HG9A 1KSWA 4XG9A 5AAGA 2XKFA 2ZDTA 4BIBA 4F08A 4AN2A 5LVNA 4M97A 5K9IA 3ETAA 3DXPA 3I79A 2XJ1A 3P9JA 4MD9E 1RQQA 4ZSEA 3SG8A 2RIOA 1A06A 1YXVA 3IGGA 4R5SA 3VW6A 5AV0A 4F6WA 4HPUE 4BJJA 3HP5A 4M7IA 2R7IA 2OJFE 4YJNA 4AGDA 2RGPA 4PPAA 3GCPA 5IA4A 3K5VA 1R3CA 4ZEGA 2VWXA 3MY0A 3FZ1A 3I5ZA 5KBQA 2WTWA 1W7HA 3G5DA 1P14A 5GNKA 2XK4A 4E73A 4ZJVA 4IIRA 4QQJA 4I23A 2JIVA 3W0NA 3NUUA 1WFCA 1BUHA 2CHLA 2R9SA 3NNVA 3PXFA 3ORKA 1LP4A 1VR2A 2ZV7A 5IQGA 4YPSA 3TNPC 4BJJB 3W55A 3RKBA 4WBBB 3BHUA 3PRIA 4IBMA 2VTOA 3OY1A 5EYKA 3DNEA 4LRKA 4USDA 5HCXA 5CSXA 5BMMA 1Q8WA 4IZYA 4AP7A 3CJFA 2WIPA 5E1EA 1JPAA 5ANIA 3UMXA 4EYJA 2WZJA 2OZAA 3ELJA 4LUDA 5HESA 3AD6A 4WNPA 2XAOA 3ZC5A 4EOIA 5C26A 4U79A 5LXMA 2A19B 2XRWA 3C4XA 2CNQA 2OLCA 2AYPA 5BX0A 2JITA 4M3QA 2UZEA 3KRRA 3UP2A 5HX6A 5J5TA 3OEFX 1Q61A 3TM0A 2QOQA 4L46A 4M68A 2Y6MA 1UV5A 4XS2A 4BDKA 3GENA 1UNGA 4TWNA 3LMGA 4UXLA 5HE2A 2XANA 2E9PA 1YWRA 4PTEA 3PG3A 5IQDA 3AT3A 3U6IA 4RX7A 4HCTA 3W10A 1DI9A 1DI8A 4DH1A 4PY1A 5CZIA 3A7HA 2ITTA 1E1XA 4MNEA 4DGGA 3FBVA 3DJ5A 3NUAA 5BUIA 5CXHA 4QMXA 5E8ZA 3TJDA 4L45A 2O5KA 4M67A 4OBQA 5IF1A 3SAYA 5CT0A 2QVSE 3AQVA 2G9XA 3VHEA 1MQBA 3SW4A 1ZMUA 4QO9A 4EYMA 3ZYAA 4F7LA 4DFZE 3QTQA 4M15A 3SRVB 1PXPA 1FBNA 5C4LA 4GKHA 5HE0A 2YLEA 4BDBA 2VO3A 4QYHA 5CQWA 3JY9A 5DFPA 4KINA 3T3VA 4PNIA 3MDYA 2C0IA 1MRYA 3M11A 3K2LA 4PRJA 3WZUA 3HP2A 3HV7A 2F4JA 3QTIA 3QFVA 3ULZA 3UOKA 1OIRA 3D7TA 3IW8A 3QC9A 5E91A 2VUWA 4CFWA 2V0DA 2X2MA 4M69B 2XK3A 2IJMA 3A4OX 5AUVA 4Z55A 3P5JC 1T46A 3MPAA 4IAAA 4FKQA 2R3NA 3VBWA 5KCVA 3DBFA 4D5HA 5CVHA 2Z8CA 3UIMA 1PMEA 3PP1A 2NO3A 4J97A 5B2LA 4ALWA 5HD4A 2X0GA 5HG5A 4NWMA 2JD5A 3ZEPA 4X3FA 1PXOA 4KRDA 3PA3A 3KGAA 5HU3A 5M09A 4GEOA 4O0XA 2G2FA 2PZ5A 5JGAA 1PXJA 2IVVA 5KKRB 1PW2A 1H0WA 2BZIB 4CFXA 4JG6A 3RZBA 2C3LA 3VS2A 3NNWA 4DEEA 4FTOA 4QPAA 4AW1A 3O8TA 3HUCA 3H4JA 4OTIA 2BIKB 2XF0A 2GS6A 3SOCA 4MVFA 4ORKA 4ACHA 2VTMA 4DEIA 1BKXA 3RBWA 1WVXA 5HEZA 3CXWA 1JSTA 3D5UA 3FLNC 3ZONA 2ESMA 4AT5A 4IJ9A 3H9RA 3ITZA 1J7IA 4CFNA 2O64A 2AUHA 4EC8A 3DGKA 4O0SA 3BIZA 4IWDA 2QODA 4KS8A 3U6HA 2VTRA 4KIQA 4X21A 4XG7A 4I5PA 4OBPA 4HZSA 3GQLA 3OROA 4KKEA 3CD3A 3GGFA 3NRMA 4YBKA 5E7RA 4F7NA 5A4EA 5IMEA 2UZLA 2I1MA 4MTAA 2XNMA 3UVPA 2WB8A 4CG8A 4I21A 2PMOX 1ZMWA 4HNIA 1F0QA 3PY0A 5CU3A 2WQMA 4RJ8A 2ZM1A 4G6NA 4UB7A 3T9TA 1I44A 3P4KA 2GNJA 2X8EA 3C9WA 4I4EA 2ITYA 3NYOA 1B38A 3Q32A 3C5UA 4J71A 2ERKA 5ANKA 4TZRA 2UZUE 5K0KA 4OLIA 4Y5HA 5EQEA 3H10A 3PIZA 5EQYA 4JL9A 4UWCA 4O83A 4BDHA 3ZTXA 3OTUA 1Z5MA 4WOVA 4UMPA 3RI1A 4FV9A 5CEKA 4FSWA 2O0UA 2R3QA 4RIWB 4ZAUA 4J7BA 3JUHA 3BU6A 3ATTA 4U3YA 5HNIX 2IW9A 4PPBA 5EHOA 4YLLA 4D2VA 3HAMA 4HVDA 5IEXA 4RLLA 3A8WA 5AUWA 1IG1A 3FWQA 3S95A 2UZTA 5JRSA 5FP5A 4FK3A 2VWBA 4B8LA 4DLJA 3EFWA 4YNOA 1TQIA 2QURA 3KL8A 4NU1A 2QLUA 2ITUA 4QMPA 4WG3A 4AAAA 2BCJA 3EQPA 3HMPA 4O86A 4NEUA 1DAYA 2GTMA 2QKWB 5L3AA 1UNHA 3SHEA 4JX7A 1VLRA 4I6QA 4FKRA 4H3QA 3M42A 3PA4A 3RAWA 4EK5A 3DJ7A 3MIAA 5HD7A 2O2UA 2OF4A 2RL5A 2CLXA 4OTRA 3CE3A 2BRGA 4V0GA 3QX2A 4WIHA 5J8IA 3ODYX 4PMTA 1WZYA 2XIXA 4MQ1A 5E8WA 4AF3A 5AR5A 4FEXA 4GUEA 3FLWA 2FO0A 2X6DA 4BWKA 3S3IA 1BL7A 4MBIA 5GJGA 2PMIA 3GBZA 2E9NA 1U4DA 4EHZA 1VYZA 5I5ZA 3EOCA 5IU2A 4H39A 4NYEA 1OBGA 3R8ZA 5AV2A 4Z16A 3L9MA 1Q5KA 3VQHA 4O1PA 5AP5A 3UPXA 3DAJA 4JR7A 2YN8A 4J53A 1M2RA 3WYYA 4I5MA 5IUGA 3COHA 4V04A 2J51A 2W5AA 4DTAA 1UKIA 1V0PA 1Z57A 3CKWA 3OF0A 1TVOA 3ORPA 4R6VA 4YC3A 3ZLSA 4EQCA 4U3ZA 3DQXA 4NM5A 2OXXA 4J8MA 3ZLXA 3A7IA 3HV3A 1PHKA 3ANRA 4C4FA 4EQMA 3DTWA 3QF9A 4E8AA 4BN1A 2CPKE 2WMAA 5J5SA 2VX3A 1NY3A 2IN6A 4QNYA 2P2IA 3BHTA 3JY0A 4NIFB 1OKVA 3DB6A 4O4BB 4C3FA 4G17A 2WTKC 5HTIA 2PUIA 2PUUA 4XRJA 4Y95A 4I0RA 3GU6A 2QR8A 3UTOA 5H8EA 4CKIA 3OXIA 4GT5A 3OMVA 5L6PA 5KKRC 1YOMA 3RVGA 3NX8A 4FKTA 4FKGA 1KOAA 2HCKA 3F66A 2JDOA 2JKMA 1OIUA 1WMKA 4AACA 2B1PA 4XEYA 3EH9A 4KA3A 1IEPA 3FY2A 2YACA 3CGOA 2B4SB 5HLPA 3RALA 3ZFYA 4YSMA 4JQ8A 3O8PA 2X9EA 4RX5A 3TUCA 2Z7SA 3DXQA 2WD1A 2VX1A 4GIIA 3MW1A 2ERZE 2X4FA 4IB0A 3QHRA 2B9FA 3VUDA 5EI8A 5DMZA 3E92A 3HAVA 4JDKA 2QC6A 4FG9A 3VRZA 5ANOA 3UPZA 3UDZA 3TUBA 4TNDA 3VN9A 4BDEA 3C1XA 3PVWA 5TE0A 3DJ6A 4O0TA 3FLZA 4B6LA 4FT7A 4YNEA 3VUGA 4C35A 5AUYA 4O82A 3FSKA 5CI6A 1Q8ZA 1ZY4A 4F9CA 3PTGA 3SG9A 1CKJA 2J50A 5CU2A 2XK7A 4IWOA 5HBHA 5M06A 1WVYA 4IB1A 2OO8X 5ACKA 1R39A 2H8HA 4H36A 3LQ8A 3OW3A 3TCPA 1H8FA 3T9IA 1U59A 5KMNA 4B7TA 4O7SA 2EB2A 3LVPA 4K77A 2UW6A 5I9XA 2ZV8A 5L4QA 5HIBA 3ZZEA 4DITA 2G2HA 2GTNA 2F7EE 3CIKA 4RG0A 5EM5A 4DGNA 4E26A 2XIZA 2HYYA 4E4MA 3F2RA 2R3PA 2QI8A 1REJA 3ATSA 4GKIA 2UZDA 4FKUA 1EH4A 2BTSA 4YHFA 2YLFA 4NSTA 3ZSGA 3MJ2A 4CYJA 3LQ3A 5BYLA 2YAKA 3ZUTA 3FXWA 4A9RA 4NM7A 4MUQA 2WMRA 1SVHA 2ITNA 2J0LA 5DT0A 2ZB1A 2B9IA 2ITWA 2QLQA 2QG5A 4XLIA 3WF7A 4D0WA 1OL1A 2ZAZA 3U8WA 5IUHA 1TQPA 3RK5A 3JR1A 5J7BA 4YHTA 3I5NA 3PPJA 2IZRA 4RBLA 4EH6A 2H6DA 1O6KA 4BB4A