2WTCA

Crystal structure of chk2 in complex with an inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
302
structure length
284
Chain Sequence
VYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Identification and Characterisation of 2-Aminopyridine Inhibitors of Checkpoint Kinase 2
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 284
sequence length 302
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wtcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wtcA01
3D5VA 3DDPA 5CQUA 2YM5A 1KV1A 4FI1A 5BUIA 3I81A 5TE0A 4DLIA 5EQYA 1O6YA 4HZRA 2F4JA 5CSVA 4PPCA 5CAVA 2HOGA 3DZQA 1PMEA 2UVXA 2IVVA 5LVNA 3F2RA 3DBEA 3NAYA 4O84A 3MJ2A 4GRBA 3CY3A 4BDJA 4Q2AA 3AD4A 3ELJA 3NMUF 3GC9A 1SVEA 4CSVA 4JG6A 4YZCA 2GQRA 1XH7A 2YDKA 3E3BX 4LGDA 2C5VA 4FNXA 3TNQB 3POOA 4CMUA 3IGOA 3BGQA 5CI7A 5L8LA 4FSYA 3UYSA 2J51A 4FTIA 1A9UA 2HXQA 4OTDA 4XV3A 3LMIA 1URWA 4ANMA 3ENMA 3LXKA 4TYEA 5HCYA 3VRYA 2YACA 2ITOA 5A4CA 2R0UA 2BTSA 5KCVA 4M0ZA 5GIOE 3QTUA 3TNWA 1X8BA 2VN9A 3NLBA 1IAHA 2FSLX 1W84A 5DR6A 3RHXA 3U87A 1NT2A 4AOJA 5M51A 5DRBA 2ZB0A 3PA3A 4I1ZA 3FUPA 4DYMA 3SDJA 3PXFA 3LQ3A 2PE2A 2XCHA 2XIXA 4GU9A 4AUAA 2WPAA 2YAAA 2BROA 4JVGA 4U3ZA 4BI2A 3ACKA 4EK8A 4UN0C 5A54A 4WNPA 4PQNA 3FL5A 2QU5A 3WI6A 4P7EA 2PHKA 1OECA 1URCA 4BVUA 4D28A 3CGFA 3BHTA 2R3QA 4QP8A 2XP2A 4O7NA 4FSRA 5C8KA 4Y5HA 3R7GA 4TWCA 1J1BA 2PZRA 3UODA 4ZSAA 2PSQA 3NW5A 3FI2A 3IKAA 3R28A 2PZYA 4FV3A 4J96A 3V3VA 5M07A 4MQ1A 4BIEA 4D2VA 2HELA 3E3PA 3IG7A 3ENHA 3QYZA 2WEIA 3A7FA 2XIYA 3CE3A 4RRVA 5DT0A 5FLFA 4NKSA 1WBOA 4O83A 4YJRA 3VS6A 4I5CA 3H10A 2CCIA 4TWOA 3UIXA 4DT9A 4MBLA 2RG6A 4FNZA 3CR0A 2RG5A 1PYEA 2QOOA 3NZ0A 2X2MA 4BCOA 3ZS5A 4CXAA 3WZEA 4CYIA 4I93A 2QG7A 4WNKA 1IAJA 4P5ZA 4RX8A 4B99A 2XEYA 3NAXA 4I94A 3NWWA 5E8ZA 4HCUA 4V0GA 2WMVA 4GT3A 3NRMA 5IA5A 2FO0A 5AV4A 3ID6C 4QP4A 5EM8A 2QOLA 2QLUA 3FQHA 5I9YA 2A2AA 3CTQA 2X4ZA 2X9EA 4N0SA 1QL6A 5HO7A 4GUBA 4YJNA 5AR7A 3DBDA 3L1SA 2ITTA 4FNYA 4KS8A 1GY3A 4Z55A 1S9IA 2YHVA 5HTBA 3RZBA 5DPVA 3SOAA 3T3UA 3ORXA 1YXTA 2X7GA 2VTNA 4FICA 4I6BA 2C6MA 4I92A 3VHEA 3CGOA 1Y6AA 5KKRC 4I0SA 4EL9A 4JQEA 2WQBA 2J2IB 4NH1A 2QVSE 3BBWA 2R3GA 4RC2A 2W1CA 4BHNA 1OPKA 3R8VA 4XEYA 3R9OA 3D9VA 2YIXA 2QODA 5EH0A 4C33A 4KIKA 5AAEA 2YEXA 1IR3A 4RWJA 3QA0A 4R5SA 4B0GA 1MP8A 1MRUA 3OF0A 3TNPC 4ENYA 1UKHA 4USDA 3GOKA 4IXPA 3AD6A 1XO2B 2W06A 4D2PA 2V7OA 1KE5A 5GIPE 4U45A 4EHEA 3PZHA 3OHTA 3EQPA 3BRBA 2VTAA 2VX0A 3FMKA 5CU3A 4L46A 3ZRKA 4C34A 5E7RA 3TUBA 2WU6A 3N4UA 5FM3A 3GENA 3FI4A 3EFKA 2JDOA 3EL8A 4O2ZA 4RWIA 1GZNA 4XOYA 3ZBXA 1H1WA 4L6QA 2V62A 5IA2A 2UW6A 3BCEA 4MAOA 4RA5A 3V5LA 3OXZA 4DFNA 4HPUE 5L3AA 4PNIA 4C4EA 1H00A 4EKLA 4MKCA 2C47A 4XP3A 3ZDIA 1UU3A 2VX1A 2W7XA 3BYSA 5C01A 1KUTA 4W8EA 3U6HA 1Q8WA 5HG5A 3UO4A 4JBPA 3VBVA 4O7TA 3TT0A 3WBLA 1CMKE 3ZLWA 4ASZA 2DUVA 2CN5A 1OI9A 3H3CA 4DG0E 3GNIB 2GHGA 1H08A 2F57A 3OCSA 3PVGA 2BZKB 5F95A 5BUEA 4FUXA 2ZV2A 4CD0A 4DFZE 3PE2A 3W8LA 4BWPA 5H2UA 4MNEA 4B6LA 4I6QA 5L2SA 1GIHA 4ZJVA 4QNAA 4FNWA 3KQ7A 2BFXA 4C4IA 2A1AB 5M4UA 2QD9A 2IW6A 3RJCA 1LPUA 4MF1A 4U80A 4IE9A 3V8SA 2QLQA 3R1QA 2PZPA 4W4XA 5CTPA 5IQDA 1NW1A 4YTCA 4X2JA 5LVOA 3IO7A 4BN1A 3ULZA 2FSMX 2B52A 4E6QA 4YZBA 2ETKA 3II5A 1OIYA 1SNUA 4G3DA 5BYLA 2JFMA 4F9BA 3MESA 1OMWA 4MXAA 4RWKA 4Y83A 4EKKA 3NYOA 4YJPA 5IDNA 2WAJA 3BHYA 1CDKA 2F49A 4OBQA 3VUHA 4OGRA 4ASEA 4USFA 3V8TA 4UB7A 4LMNA 4C62A 4RFZA 4N6ZA 5CT7A 4DAWA 5EOBA 3Q5ZA 4CQEA 5IUGA 4U7ZA 3RINA 4EOJA 1G8SA 5TR6A 2UW3A 3LAUA 4IWQA 3WYXA 2QOCA 4EK4A 3RK9A 1KE7A 2HXLA 3RP9A 4O0WA 1WVYA 4OTWA 2ETMA 1V0BA 2FSTX 2GFSA 2RFNA 3QTWA 3UIBA 2XUUA 4A9YA 3E63A 5KMLA 5CVFA 4M66A 2QC6A 3KF7A 3MVJA 3NIEA 2XNNA 3ORPA 3QRUA 4GG5A 5HE1A 3ZSGA 4CKIA 3COMA 3R7YA 4YU2A 4QQJA 4ZTLA 3R7EA 4O38A 2XS0A 2VTLA 2Z02A 4R8QA 3GP0A 3GUBA 4GH2A 4O86A 4WSQA 3BZ3A 4U43A 3H0YA 4HPTE 3FZPA 4FTAA 1AQ1A 1U54A 3JY0A 4R3PA 2JEDA 3C4FA 4Q9SA 2I6LA 1Q8UA 4C3PA 2OJJA 5EQPA 3D5UA 2VWYA 3FMNA 4JX7A 4DITA 3AMBA 3UMWA 2B4SB 4BDAA 4HYUA 3ORNA 1O6KA 2QCSA 3AQVA 1NA7A 4RJ5A 4XG4A 3R7IA 5EYMA 4TWNA 4I23A 5JFVA 2OZAA 2YIQA 4F99A 3ORMA 3P7BA 1OZ1A 4QTAA 3KMWA 2OXDA 4ACMA 1TQIA 2QHNA 3T9TA 1JNKA 3KXNA 3DCVA 2DWBA 3IOPA 2Q0BA 3KRJA 5EG3A 3HGKA 4ZLYA 5IF1A 3LFBA 2GQSA 3L8VA 4DINA 2XMYA 4U97A 4JDIA 4BDGA 4MEDA 2RGPA 4YC6A 5E9EA 5M09A 3GC8A 2I0EA 2UZVA 4LOQA 3ANQA 3R7VA 4GW8A 3MFUA 3RPVA 2VNYA 4NW5A 3LCKA 2JAVA 3P23A 3R63A 4GCJA 4M69B 4ZTQA 5HIDA 5HTIA 2UV2A 3KY2A 4CLIA 3O51A 2R3HA 1YXUA 3MY5A 4FKWA 4GG7A 3U51A 4PWNA 4KIQA 3FHIA 3DAEA 2VWZA 5CEIA 2RL5A 4J8MA 4CG9A 2GHMA 5E8XA 3GFEA 3SLSA 4PP9A 2JDVA 5HCZA 2ITWA 3UMXA 2Y4PA 3LIJA 1BI7A 3VULA 3PVBA 3QL8A 3U6JA 3CSVA 3I79A 3LM0A 3Q4UA 3OWKA 4QTDA 3POZA 5AIRA 2WU7A 3PXKA 4EQMA 2X6DA 5FBNC 5AUZA 3RK5A 4OT5A 2VGOA 3B2TA 3F7ZA 3FV8A 5I9UA 5TKDA 3EYGA 2AYPA 3LQ8A 4ZMFA 4PUZA 2PZIA 3OC1A 5AR3A 5JZJA 2QOHA 2GMXA 3Q6WA 5EHYA 2CHLA 1DAWA 1WBSA 2YM8A 5IEVA 2NRUA 3DNDA 3QWJA 5HG8A 4LYNA 4GK3A 2EUFB 3BLQA 4QP1A 4HOKA 4RIYB 3SVVA 4E4MA 3ATSA 3MTFA 4RLLA 2O0UA 4TWPA 5KHXA 3RM7A 1IA8A 3BWJA 3KL8A 1YVJA 4EZ7A 2BRGA 3RMFA 3DBFA 4L3LA 4ZXTA 5JMSA 3S95A 4C0TA 4ASDA 3QTSA 3DK6A 3ROYA 2J5FA 3QD4A 5CSXA 3RAWA 3S1HA 4E5BA 3UZRA 5AP1A 4XG9A 4LGGA 2XK4A 4DTBA 3VBQA 4EBWA 4FTTA 4F1MA 3IK3A 3ZFYA 3LJ2A 3GT8A 4KINA 4W4VA 4DGOA 5I5ZA 4L67A 3D5XA 3ALNA 3AC8A 3QC4A 4AOTA 3BHUA 1YWRA 2X7FA 2B54A 4FK3A 3SXRA 5CSWA 4G16A 4GMYA 1K9AA 2F7ZE 3KCKA 4JDJA 3VBYA 3EH9A 4BDEA 4M0YA 4X2KA 3I4BA 4GFGA 4AWIA 2X8DA 2XNMA 2E2BA 3W55A 1T46A 2JD5A 5ANDA 3SW4A 5K0KA 3ZO4A 3LE6A 3UJGA 2G15A 4WHZA 3PXZA 2Z7SA 4FYOA 4G6OA 1Y8YA 3CBLA 3KRXA 2IO6A 3KREA 1L8TA 2DQ7X 4AZWA 4BDFA 5HICA 3CJGA 2C68A 5IU2A 5FEEA 1JOWB 4L52A 5HCXA 4EH6A 5AUTA 4ANBA 4OAUC 4KABA 4MXXA 3RI1A 4C36A 2H9VA 4JL9A 4BTJA 5IQBA 4KIPA 4ZTNA 3TZMA 3W18A 2E9PA 3ORKA 3VUGA 5BVOA 1TQPA 4E1ZA 3GCQA 4YR8A 1A06A 4HVDA 3PE1A 3PJ3A 1WBTA 3OFMA 3JR1A 4BDHA 2EB3A 3EKKA 5HU3A 4RGJA 4YC8A 3SRVB 5T6KA 3MW1A 4EYJA 3WZDA 3PFQA 5M4IA 3LOKA 3RNIA 4BHZA 3W33A 1NY3A 4Y46A 4IAKA 5I0BA 2XYNA 3ETAA 3VQHA 3QQFA 1BL6A 3LKMA 3KXMA 1FBNA 1PXJA 4F9WA 3EQIA 3PDTA 4M84A 3DGKA 2BAQA 1YDRE 1M2RA 3TKUA 3MYGA 3D5WA 4BIDA 2HW6A 4FTCA 5DMZA 3LMGA 3A7HA 2C6IA 4CMTA 4KKEA 3LCDA 3KKVA 3N51A 4NZWB 2Z7RA 4AFEA 5J9ZA 4S33A 3ZRLA 5BX0A 1PYXA 5FDPA 5AMNA 4W9WA 3OBJA 4O7VA 4HVHA 3P7AA 1JSVA 1NVRA 2C0TA 3A4OX 1O6LA 4G34A 4FF8A 4QP9A 4JR3A 5EW3A 4D2RA 1YHSA 4QYFA 4YJSA 5F1ZA 3WZUA 5BVNA 1PXOA 4L00A 3FKLA 3QQGA 1OL2A 2PVHA 3QBNA 4M69A 3ZSHA 3FYKX 4CTCA 5CU0A 2ZDTA 3R2BA 2VTQA 3NYNA 4XMOA 3SQQA 1PJKA 4O91A 3U9CA 4U6RA 3CY2A 1YW2A 5FXQA 4EH3A 4F70A 3HLLA 2ESMA 3TKHA 4CFWA 5HQ0A 3SXFA 3PVWA 3SAYA 1OPJA 3FY2A 2IVSA 2XNPA 3AT4A 5M53A 2B1PA 5CEOA 4FYNA 2Y8OA 1L3RE 4IM3A 2W4OA 4YO6A 2OICA 1H8FA 3ORIA 2C6OA 3H9RA 4G3GA 3V5QA 3DXQA 3CTHA 4ZTHA 3C51A 4JS8A 1YXVA 3WE4A 3QHRA 4K33A 5T3QA 1JKTA 4MXYA 2UW7A 3PP1A 3I1AA 2NPQA 2WD1A 4PPAA 5TO8A 3CS9A 4MXOA 3HZTA 5EFQA 2UZOA 4UMQA 3EOCA 5AA8A 3K2LA 4I4EA 5FG8A 2I7QA 4XOZA 3KRWA 2YZAA 4FSWA 5DWRA 4DH8A 5K5XA 1HCKA 5BVDA 2XRWA 5AR2A 3IPHA 5F20A 2GU8A 3R7UA 1GIJA 3BBTB 1KE8A 4MD8E 3FEGA 3BQRA 5CF5A 3ZTXA 1MRVA 1ZZ2A 3GGFA 2G1TA 2OJFE 4RIYA 1UU9A 1JPAA 4O22A 4AZTA 1JAMA 1S9JA 1SMHA 3DFAA 1LEWA 3DTCA 3MPAA 4FTJA 4QNYA 4XP0A 2GQGA 4XHKB 1Y8GA 3P08A 5IPJA 1H1PA 4WOVA 1BI8A 3NDMA 2R3KA 3FC2A 2WMRA 3GU4A 3B8RA 2ZDUA 2ZJWA 4IWPA 5L6OA 3P1AA 5J1VA 2W17A 3UTOA 4Z7GA 5C03A 3I5NA 3MFTA 5L2TA 5IH4A 4H58A 4YLJA 5EHLA 3FXWA 3Q4CA 5E92A 2J50A 5AAGA 4YP8A 3TV7A 2QOQA 4A9SA 4PL3A 5LCKA 3PY1A 4UXLA 4X2FA 4XNEA 5AUYA 4BF2A 3FLYA 2QKRA 2XJ1A 5CENA 4EK5A 5LARA 2DYLA 2OU7A 3GU5A 2YIRA 4RLKA 2R2PA 4QMNA 3PYYA 5A4QA 1KE6A 3QQKA 5HE0A 2B9JA 1NVQA 5L8KA 4AQCA 3ZZEA 4QP7A 2GNLA 4UXQA 1RDQE 2ONLA 2QQ7A 2ZVAA 3HV4A 1YHVA 3LXPA 4MYGA 4XBRA 3QD3A 5DR9A 3FXZA 3TV6A 4C7TA 4YJOA 4RVKA 5BVEA 3WARA 2IZRA 5LOHA 2VRXA 5E8WA 2HAKA 3MFSA 3WILA 5FM2A 2I0VA 4TTHB 3UOHA 4NEUA 3VWAA 4CFMA 4L42A 2GFCA 2WIHA 3EMGA 3FI3A 2ONLC 3A99A 3CIKA 3FY0A 2FSOX 3GBZA 4FKTA 3TZ9A 5A6OA 3EN5A 5AADA 5LVPA 1TKIA 5IA1A 4ZSEA 3NUNA 3Q9YA 2JKKA 4PMTA 3IDCA 4I41A 4H05A 3ZEPA 2Y9QA 4I5PA 2I40A 3QQJA 1I44A 3W2OA 5LWNA 3DV3A 4YMJA 4RIOA 3RVGA 4FT5A 4FL2A 2W96B 4NTTA 3BKBA 1KOBA 2VZ6A 4ZOGA 3VBWA 1V1KA 2YDIA 3CD3A 3CD8A 3HRCA 2Y7JA 3ANRA 4FKPA 1JKLA 1PXKA 3ZC6A 3NYXA 2VTMA 4D9UA 2BFYA 5D12A 4BTKA 4YZ9A 4P4CA 3NW7A 3BYMA 4BDDA 2R4BA 2X9FA 2QOIA 1OL6A 2F9GA 5KX8A 2O2UA 2EXCX 3D2KA 2CNUA 3HMPA 1UNLA 5AP5A 2PUPA 3PUPA 3MIAA 5IQIA 2LAVA 2WTVA 3G0FA 4ANQA 3HNGA 5J1WA 5EKOA 4C61A 2LGCA 2VO0A 2WQMA 3U8WA 2YM6A 2JIVA 5IQCA 5GINE 3UO5A 4G5JA 3VBXA 4UX9A 3PXRA 5BPYA 1OKWA 2J0KA 4AZFA 2VD5A 3CQWA 2C30A 3F5UA 3FL4A 4XS2A 3IW8A 3JXWA 5FEQA 5A46A 3G2FA 3NUSA 3VAPA 4KSPA 5H3QA 1SM2A 3G6GA 3E62A 3WZKA 4FBXA 4R3CA 5CZIA 5AEPA 2YZLA 4D4RA 3VS0A 2XM9A 2OIBA 2CDZA 2X8EA 4YHTA 5FXSA 2OO8X 1REKA 3QKLA 4G3FA 3VS1A 2PVJA 5J87A 4XG3A 4QOXA 4CRSA 2QR7A 4NYEA 5AP2A 2BTRA 3KULB 4F09A 5TF9A 4B8LA 3FZRA 3REPA 3E5AA 2Q0NA 3FLQA 3F9NA 3QALE 1H25A 5B2MA 4DFLA 5I4NA 5HLNA 2W1DA 2HWOA 2FYSA 1PHKA 4DC2A 2B7AA 5BUJA 1FVVA 3H4JA 3UQGA 4IACA 4BC6A 5AWMA 3W8QA 1OPLA 4KSQA 3SOCA 4DGMA 2WTKB 1FINA 5HBJA 4ANSA 5HKMA 4LM5A 2Z2WA 4FG9A 4FSUA 4C3FA 4HGTA 3GU7A 1UA2A 1Y57A 3U55A 3OG7A 3PIXA 5HVKA 4C4JA 5CQWA 4F7NA 3UO6A 5DGZA 5M08A 2BPMA 5FQDC 4FZAB 1XH5A 3EZRA 4TW9A 4Q5EA 3GU6A 4ZS4A 3LHJA 3Q96A 3LQ5A 2R3NA 2XB7A 1NXKA 2Y6OA 4S2ZA 3MVMA 2OG8A 1M2QA 2JFLA 3R0TA 4FA2A 3MDYA 2Z60A 5AAFA 4DA5A 1BX6A 3CPCA 5AM6A 2O64A 1UKIA 1YOLA 2XK6A 4QMMA 1WCCA 4DEAA 4I5MA 1QPJA 3NS9A 3EFLA 5ANJA 3E7VA 4ZLZA 3UE4A 5IQHA 4H39A 1W7HA 1GAGA 2W1EA 4O2PA 4E4XA 4D5HA 2VO7A 2F7EE 3GVUA 3SC1A 3UZTA 1Q61A 2PTKA 3ROCA 1H24A 2YWPA 5ICPA 4RC3A 5JGDA 4BWXA 3PY3A 3D83A 4IWDA 3IQ7A 4TYJA 3MA3A 3MY1A 5DFPA 5L2QA 4O7SA 3FE3A 4Z9LA 5HESA 2XK3A 4TL0A 2CKOA 3M2WA 3U6IA 3D14A 4OTFA 4OLIA 1ZOEA 4J99A 3MH2A 4O0RA 3S2PA 4F1TA 2O3PA 3C0IA 1FVRA 3LFCA 2E9UA 3UGCA 4HVIA 5JK3A 4O7YA 4EOPA 5M44A 2GNHA 3UPXA 4BGQA 2GTMA 4XUFA 3KXHA 4EJNA 2XNOA 3EN7A 2P2HA 4JDKA 4QYYA 5ANEA 4DE4A 1NVSA 2IZTA 4R6VA 2HZ4A 2VTTA 3O50A 5CWZA 2R3JA 2P0CA 1IASA 3ORTA 4UMTA 3SGCA 3FSKA 3HV6A 3L8SA 1MUOA 3G9LX 1PXMA 4M13A 3F66A 3HUBA 3AMYA 3KRRA 5KE0A 2CKPA 4M15A 3UVQA 1OKYA 5M4FA 1XH9A 2W99B 3C0HA 4HCVA 3CCNA 4M8TA 1WBNA 2UZLA 3F5GA 4TNDA 2VTRA 4ONAA 3UC4A 3M1SA 3NX8A 5KO1A 3PA4A 4X21A 5CT0A 4BCFA 1Y91A 3M11A 3MY0A 2G2HA 3OOGA 1J3HA 3BPRA 4BY9E 4C2VA 3UG2A 4BIBA 4ZJIA 1P14A 2G2IA 3FZTA 3LFAA 3COIA 2W0JA 3KMMA 4P2KA 2AC5A 3M42A 3RPYA 3ZM4A 2XNBA 3DBQA 3LFNA 5ACBC 4M97A 1ZZLA 5T68A 3AOXA 3P7CA 1J7UA 4FTKA 4IX3A 3O2MA 1PY5A 4FGRA 5IUIA 3HRBA 5KZIA 4AS0A 3G5DA 2PK9A 5DIAA 2CCHA 4KAOA 1BKXA 3TM0A 4M67A 1KE9A 1YI6A 2UW8A 3KXZA 5KMOA 3KRLA 3CEKA 4QQTA 4KBCA 4PX6A 4D4SA 5KBRA 5IUHA 3SKCA 3CXWA 2WTDA 3ZYAA 1PKDA 3VS7A 5EI2A 4ALWA 1ATPE 3CPBA 2BIKB 5K0XA 3OWPA 3KK9A 4I20A 4KD1A 2CGUA 1AGWA 2R3LA 1K2PA 4CZYB 3HV5A 3THBA 5JGBA 1Z57A 3IW4A 2CPKE 5EI8A 5FXRA 1G8AA 3CKXA 4JQ8A 4MWHA 2NO3A 2OF4A 3MWUA 4IJPA 3O17A 5JRQA 4JNWA 2AC3A 2X7OA 4AA4A 1QPCA 3BE9A 3R9NA 2WOUA 2XVDA 3BYVA 3AC5A 4AE6A 5BNJA 4K6ZA 3RKBA 2IG7A 3EHAA 3DOGA 5HLPA 2XNEA 4ZJJA 2B55A 3V5WA 1R1WA 4BGGA 4NT4A 5IH5A 4JIAA 3Q6UA 3OBGA 2RF9A 5FDXA 4IC7A 3DDQA 1XH4A 3KFAA 1ZYCA 1M52A 3NW6A 4BCQA 2PVMA 2WTKC 1ZARA 2UZDA 4U42A 2Y4IB 3QA8A 4NIFB 1Z5MA 4EH7A 4F7SA 4UZDA 3ATTA 5ITAA 2ITYA 1H28A 3A8XA 1TQMA 2B9FA 5DVRA 4CT2A 5LWMA 4C59A 3Q32A 4KKGA 3MGYA 3PPZA 4D1SA 2ITQA 5J95A 1YDTE 4R7IA 2G9XA 3TACA 1PW2A 1STCE 3SG9A 4XG8A 4AN3A 3TCPA 4N57A 2C3KA 3PTGA 2W1GA 3IONA 1RW8A 3BU3A 2R64A 4FZ6A 4XG7A 1U4DA 5CEPA 3EYHA 4AZSA 1FQ1B 1ZRZA 4XV1A 4R7HA 4U5JA 5F94A 4UWBA 2VU3A 4L44A 4ERWA 4GFOA 2V5QA 1I09A 4QMVA 5DT4A 2GNGA 2WGJA 3R9DA 1M2PA 4TXCA 5HTCA 2I0YA 3IDBA 2YFXA 3LMHA 2C3LA 2R3OA 5DBXA 2YIYA 4R7BA 2H34A 5LVLA 3BHHA 2WKMA 3Q2MA 4C58A 3A4PA 4ENXA 2C5XA 2C6DA 1JQHA 2C5NA 4OW8A 4WUAA 3LCTA 3EKNA 5CU6A 3NNXA 3IW5A 4E6DA 2AUHA 3DLZA 2YJSA 3FLZA 3PIZA 1IG1A 2ZMDA 1VYZA 2QONA 2P3GX 1F3MC 1OITA 2QOBA 2RFDA 5D11A 2UZNA 2H6DA 3DKCA 5HOAA 4DTKA 4E6CA 3F7WA 2A0CX 4U81A 1XR1A 4HZSA 5KBQA 4ZTSA 2CSNA 3DS6A 5JRSA 5DR2A 3PLSA 4AW1A 4EH5A 3FPQA 4IVDA 4FTMA 4KBAA 4D55A 3I0OA 3B8QA 3G6HA 3I0QA 1DM2A 3PXYA 4IB0A 3KU2A 4E4NA 5IQAA 2ETRA 2BZHB 5JT2A 3SG8A 3RGFA 1CKPA 4DEGA 4ITIA 4YZDA 4X7QA 4S30A 2NNWB 2REIA 5IA0A 2GCDA 5CVHA 3WOWA 3C5IA 3CQUA 3CJFA 4G9RA 5EM6A 4WBOA 2ZAZA 1ZOGA 3FWQA 3QWKA 3EQDA 1PMNA 1U59A 2WMSA 4I6HA 4J52A 2C4GA 5D7VA 3W2PA 1GZKA 4EHGA 5FRIA 4HGEA 3OUNB 4E73A 4BDCA 4M7IA 2VO6A 3R04A 5DN3A 3SV0A 3VQUA 2BALA 3GCPA 3PJ1A 2R3PA 4XP2A 3K3JA 2C0IA 3EFWA 3IDPA 4KNBA 4RA4A 4D4YA 3UPZA 5C27A 4IH8A 4ORKA 4AFJA 2HY81 3OROA 3HMMA 5EK7A 5CAOA 4EK3A 4YHJA 4Y73A 3PVUA 5GZ9A 3NUUA 1UWHA 4LQMA 3P9JA 5HHWA 3RTPA 4TYHB 2VNWA 3A61A 3DAJA 4G17A 3R8PA 4FEWA 4NTSA 4IDTA 4QMLA 1QPDA 2YCFA 5AUVA 2H8HA 2PMOX 1QCFA 3PPKA 4DFYA 2FB8A 4O7ZA 5CU4A 4AN2A 4ID7A 4J53A 5FGKA 5GZAA 3HUCA 1H4LA 4IAAA 3ZSIA 1H0WA 4IAFA 1JLUE 4JBQA 4LUDA 3T8OA 1U5RA 4N6YA 2QR8A 4YC3A 4BCNA 4D0WA 2PVNA 1CKJA 4GIHA 3OCTA 2PZ5A 3HVCA 3BU6A 3MPMA 4LOPA 4QMPA 4Z7HA 4UMUA 3I6UA 5CAUA 4IFGA 3UBDA 3COKA 3G0EA 4FV4A 3BLHA 5AX9A 5K4IA 4QPAA 4L7SA 2XNGA 1WMKA 3P0MA 4IC8A 4FEVA 5AR5A 3HAMA 2Z7LA 4NKAA 5BYZA 5DNRA 2JAMA 1M7NA 2R5TA 5FP5A 4CCBA 4EOLA 4F1OA 5D1JA 2J7TA 3C0GA 1FMKA 2PL0A 3MTLA 4QTBA 3Q3BA 2J9MA 4D1ZA 1JKSA 2DS1A 2UZEA 2X81A 3FMMA 3K54A 2G01A 3MH0A 2CJMA 4FSTA 4GJ2A 1XQZA 4GVAA 4WA9A 3RPSA 4NIFA 4FOBA 4YLKA 5E1SA 3KCFA 4JXFA 3W2SA 3EFJA 3OVVA 4JG7A 4WD5A 2P55A 1LUFA 2BILB 4G1WA 3AC2A 4JX3A 4D0XA 4E6AA 2JGZA 5M4CA 2W5HA 3O0GA 4BCMA 2P2IA 3HRFA 4ZAUA 2O8YA 1P5EA 5JFSA 2QO9A 4MHAA 2Y4IC 1Z9XA 3FPMA 3AC1A 5EYCA 3A60A 3A8WA 4OTGA 4WSYA 4U0IA 2P33A 3C9WA 3L9MA 2BUJA 1YOJA 4J95A 2X2LA 2IVUA 4DCEA 5CEMA 5KMNA 3QFVA 4PMMA 3DLSA 3QGWA 4L3JA 4N4SA 5I3RA 4FT0A 4FTQA 3GFWA 4IDVA 3DJ6A 5A4EA 4C57A 5E8UA 4D1XA 4DH1A 1XHAA 4ZS0A 1YXXA 2IW9A 3AT2A 4OUCA 3NEWA 4FSNA 3OCBA 4IADA 3HP5A 2OFUA 3AGLA 5G1XA 3OXTA 2JDTA 1H07A 1TVOA 3ZRMA 4ZSLA 5B2LA 1P4FA 4HNFA 2R7BA 3OOMA 4K18A 4QQ5A 2EVAA 2XF0A 4I22A 5HU9A 1XWSA 3PSBA 3ZFXA 1XKKA 3VS5A 4EBVA 1HCLA 3H9OA 4ZY6A 4F9CA 2VTIA 4FKRA 4JT3A 5E91A 2JDSA 2WHBA 4EH9A 3F3VA 4NCTC 4ALUA 2VTPA 5L2WA 5A3XA 3W32A 4IAZA 5GNKA 5IQFA 3Q9XA 4YZNA 4E20A 3T3VA 3VBTA 3NNVA 4RIXB 2OZOA 3AC4A 1E1VA 1ZLTA 3DB6A 4FSMA 1EH4A 5E8VA 2PVYA 3V01A 2QO2A 1FVTA 3KEXA 2X6EA 3ET7A 1YOMA 4J71A 4B9DA 1UNGA 4ERKA 1UWJA 3BYUA 3ZFMA 5GJDA 4JOAA 1ZYLA 4QYGA 1ZOHA 4FTLA 1V0OA 4H36A 3LVPA 4AA0A 4QRCA 4C4FA 3NUAA 3NUPA 2G2FA 1ZMWA 3R21A 1PMUA 5HG9A 4EOMA 5KMKA 3PWDA 1FPUA 5EM7A 2ZV9A 4K2RA 3F3UA 4RQVA 3D94A 1VEBA 3FQEA 4ZY5A 4FTOA 4FV2A 4TYHA 4FEUA 3ZUUA 4JQ7A 3GXLA 4W9XA 4IEBA 5FTQA 2C69A 5FUTA 4BCHA 5CNOA 4MK0A 1B39A 4YSMA 4ANLA 5DA3A 3QUDA 1YI3A 2J0MB 5IDPA 2W4JA 2BZIB 3MI9A 3W2CA 3OTUA 5D9HA 2UW4A 4UY9A 3IOKA 4RJ6A 2PVFA 4YPDA 3C4EA 4FV5A 1FMOE 4X0MA 2J90A 3KN5A 4F7LA 2BRMA 4G9CA 2WNTA 3NCZA 4ANOA 2BDJA 2X4FA 2W1ZA 5HVYA 1OUKA 3KGAA 3MVHA 1UV5A 3UP2A 4A4XA 4D9TA 4CNHA 4E26A 4AG8A 1V0PA 3DQWA 1OL5A 3O23A 5FEDA 2WQEA 3H0ZA 1ZWSA 2H96A 4IVAA 5B0XA 3TZ7A 4UALA 2GNJA 3C4CA 3RAHA 3Q4ZA 3TJDA 4APPA 2WZJA 3EQRA 3GEQA 3CTJA 4FIHA 2RKUA 2VO3A 3KMUA 4GK2A 4WKQA 4ZTRA 5BMMA 4BB4A 5I9XA 4BR3A 3HECA 3KXXA 3TI1A 2V7AA 2ACXA 4FVPA 2IN6A 4WIHA 2XKCA 2HZIA 1PRYA 4CQGA 3FI8A 3DBCA 3HMIA 4I3ZA 4XJ0A 5F9EA 4CV9A 2ERKA 4IM2A 4RVTA 2PPQA 3KB7A 2R7IA 4G6NA 5CU2A 2JIIA 4JBOA 4L43A 3UDBA 2YISA 1ZMUA 3GQIA 4YSJA 3DA6A 2PMIA 3R71A 5LXMA 4K11A 3BV2A 3Q9ZA 4P90A 5C4KA 2A4LA 5IEYA 2VTHA 3O71A 4U41A 2EWAA 1M17A 3TUDA 3DB8A 4RWLA 3QXOA 4ITJA 3DKGA 4NJDA 4AGUA 5BVFA 3O8PA 4PDPA 5ANGA 5IG1A 4TYIA 4RIWB 4IW0A 4O1PA 3U54A 3SXSA 5EDRA 3WZJA 4IIRA 4BZOA 3ZO2A 1M7QA 2O65A 5ETAA 4EQUA 4CV8A 3E87A 5G6VA 5B2KA 4FV6A 5EHOA 4ANNA 2QKWB 3RK7A 3G15A 3R9HA 1Q8TA 2C0OA 2RIOA 3OD6X 4BDKA 4LL0A 4APCA 4EWQA 4FL3A 5J7BA 2V55A 3JS2A 3V5TA 4YBJA 4QYHA 5LCJA 1KOAA 3SX9A 5CEKA 5K9IA 3WF9A 5DG5A 4MF0A 1OBGA 4CFXA 3HX4A 4TT7A 3DK3A 4AN9A 3F61A 3FZOA 4QP2A 3OY3A 2CGWA 3IS5A 1ZY4A 2QHMA 4MH7A 2HZNA 3EQCA 4O0TA 5IA4A 5JEBA 3Q04A 3Q4TA 3R1SA 2C1AA 3OW3A 3JVSA 2V22A 2E9VA 2OJIA 4O96A 3TTIA 2F2UA 3EB0A 4ACDA 4FV9A 2BDFA 3OEZA 3D15A 3ZEWA 1CSNA 4FT3A 3WYYA 4F65A 5CAQA 4ZSGA 5E4HA 3FMEA 4ARKA 5L2IA 3PIYA 2X0GA 2ZM4A 4R1VA 4YNOA 3WIKA 4MQ2A 1YI4A 3R22A 5CF6A 3NIZA 4ZZNA 1H27A 5J79A 1FGKA 3T9IA 5GHVA 3JPVA 5M06A 2VX3A 1DS5A 4CZTA 4N70A 4TKSA 5C9CA 3MH3A 3G33A 3C7QA 3F2NA 3LJ0A 3ERKA 3O96A 2XK8A 1BUHA 2C6EA 2OWBA 2YLFA 3C1XA 3LFSA 2VWWA 3DY7A 4MBJA 3SRVA 1IRKA 5IEXA 1GOLA 3UVPA 3R1NA 4GFMA 5HEZA 4GS6A 2J0IA 5F4NA 3RWQA 1Q3WA 2QI8A 3BELA 2OH0E 2WQOA 4QT1A 3ULIA 3MB6A 4OAVB 5KUPA 5HBEA 4OTQA 1T45A 3SD0A 2W9FB 4A06A 1W0XC 2YM3A 4AA5A 5BMSA 4O6EA 3U9NA 4ZY4A 3LCSA 3C4WA 4S34A 2XJ0A 4M3QA 3N4VA 4FZFB 4BDIA 3ACJA 4FVQA 4IZ7A 3VO3A 4FKQA 5CI6A 3VN9A 4BI1A 3E8CA 3TXOA 2BAJA 2UZTA 4EC8A 4DEHA 2R3IA 4RFMA 4YNEA 2OK1A 3OT8A 4EI4A 4KS7A 5I3OA 2VV9A 2VTSA 3E8EA 2OSCA 2PULA 3I60A 4YPSA 3HDNA 4LRKA 4NW6A 2C6KA 5ACKA 1KSWA 2OXXA 2GS2A 3DAKA 3ZO3A 4PRJA 5D41A 4EYMA 5CZHA 3S3IA 3QCQA 2CKEA 2HWPA 3RAKA 3A7JA 4GYIA 1YWVA 4RX9A 5ANOA 5DE2A 3FYJX 5KZ0A 4QTCA 3E88A 3D0EA 3RBWA 1PF8A 4EHZA 5DT3A 3L9PA 3ZONA 1WZYA 1OKVA 3I5ZA 2XM8A 2UVZA 4ZK5A 5CALA 2ERZE 2YCSA 3FMJA 3MIYA 3NUXA 4QD6A 4WNMA 4RZVA 5CSHA 2KTYA 5CY3A 5AIKA 2YIWA 5C1QB 3VRZA 3CKWA 4F6UA 3OWLA 2JKOA 4DCAA 5A6NA 2UUEA 2R3FA 4JG8A 4RPVA 5EKNA 3IECA 5LMKA 4HJOA 4WRSA 4LL5A 3BGPA 3DPKA 5EYDA 5JFWA 5CANA 4RQKA 3OMVA 4D4VA 3HKOA 4AT4A 4DFBA 3WE8A 4K1BA 3FMLA 2RSVA 4CFFA 3R8ZA 5IISA 3QTIA 4GKHA 4AX8A 4FV1A 4PPBA 4LOOA 4C37A 1Q99A 2ZV8A 1ZAOA 5LMKC 1XJDA 3QU0A 3QXPA 5CF4A 4BGHA 3UQFA 2PE1A 5JKGA 2GHLA 4CMOA 5HNBA 4PL4A 2C3JA 2PMNX 3G9NA 4H3PA 1OGUA 5D10A 3FDNA 3O8UA 4AGCA 1H1SA 4BCKA 4EZ3A 2Q83A 4C8BA 3QTXA 4F0IA 4DFUA 3GC7A 4F6SA 5IQGA 4WT6A 2BRNA 2YCQA 4LUEA 3LW0A 1LEZA 5CXHA 5A14A 3UOJA 4BYIA 4UYNA 3W2RA 4RMZA 5HVJA 3TDVA 4OBOA 4MVFA 3QYWA 3G51A 2OI4X 3FHRA 4YJVA 5AP7A 1XBBA 3ZBFA 4ACCA 1O9UA 3I7CA 4NU1A 4FIJA 3R1YA 4O7WA 1APME 1U5QA 5HD7A 4O0SA 5IZFA 1H0VA 2CLXA 4XCUA 4XBUA 4XG2A 4EQCA 4KIKB 4L68A 3TUCA 1XH8A 4RC4A 3UIMA 3FQSA 4FG8A 1Q8YA 3C50A 4JRVA 4H3QA 4RZWA 2E9NA 3F5XA 4TY1A 4I24A 2GS7A 3RPOA 3UG1A 5IA3A 1ND4A 3OWJA 3P4KA 1F0QA 4JDHA 2BCJA 4O82A 3HP2A 4JR7A 4UV0A 5CASA 3EWHA 2PU8A 3C13A 4WRGA 4I0RA 5J9YA 4RFYA 1XBAA 1MQBA 4FZDB 2XIKA 1QMZA 3NNUA 4L7FA 3TNIA 1H26A 2WXVA 1ERKA 2O5KA 3GU8A 3AC3A 3AT3A 3K5VA 3FSFA 4QMQA 3QD0A 4RJ8A 4AU8A 1M14A 4FE2A 4XLIA 5A4TA 3QRTA 3GQLA 1XBCA 3UZPA 3SHEA 3WF8A 4PNKA 5EYKA 3IGGA 3BHVA 5HX6A 2CN8A 4TPTA 4E3CA 4Z3VA 4JJRA 4MNFA 4F0FA 4IFCA 2XK9A 4EH4A 4I5HA 4B7TA 3KVXA 3Q53A 4IZAA 1YKRA 5E8YA 4DEEA 4MNEB 2EXEA 3LJ1A 3OZ6A 3QZFA 2ITZA 3BE2A 3A7IA 5EDPA 4EZ5A 3FMHA 4H3BA 2CGVA 4AXAA 3DZOA 2WIPA 1OIQA 1PXNA 2XBAA 5BVKA 3F3ZA 4J7BA 4DG2E 4EUUA 3DQXA 5HNGA 3FLWA 4BBEA 3E7OA 4FUYA 3EQFA 5E1EA 4EK6A 4Q9ZA 2XH5A 2XIZA 3JYAA 3KXGA 4C4GA 4O0VA 4YTFA 2C6LA 3RCJA 2KULA 3UNKA 4HYHA 3VJNA 2YERA 1VJYA 1WVXA 3FXXA 3TL8A 3VUIA 4BFMA 5HD4A 4G31A 2VWIA 2WEVA 3HYHA 4FSZA 4DT8A 4QYEA 4AW2A 4D2SA 4UWYA 1R0PA 4CFNA 1FGIA 2QNJA 3DXNA 3ZC5A 4FMQA 1IEPA 2ZYBA 2PVRA 3Q5IA 4QPSA 5L4QA 5AJQA 3PRIA 2WMBA 1CM8A 3HMNA 4BKJA 5E8SA 2OFVA 4XRLA 5L6WL 5C26A 4NJ3A 3KULA 4AACA 2YAKA 2VAGA 3D7TB 4WNOA 4DBNA 2ZB1A 3BEGA 4IVBA 4IB5A 2A27A 2W1FA 3QUEA 4OT6A 4FEXA 2J0JA 1P4OA 4BDBA 4JIKA 3RZFA 2JKQA 4C2WA 5LQFA 4FKLA 3KVWA 4PP7A 4RVMA 4LV5A 4MD7E 4KWPA 4F63A 3MS9A 2JDRA 2WMTA 2GSFA 4FOCA 4ZZOA 2F2CB 4JAJA 5J5SA 3AGMA 4ITHA 1RE8A 2BMCA 4ASXA 4GYGA 4PV0A 1U54B 4BICA 4IX5A 3R30A 1UNHA 4FGBA 2GPHA 2IVTA 1Q41A 2JITA 4YO4A 5HORA 3OTVA 4U44A 3WIGA 4IANA 4FKJA 5KNJA 4MWIA 3S0OA 4BTMA 4QTEA 4FKSA 2GNFA 5J8IA 4AGWA 3LM5A 5H8GA 2CNQA 3GB2A 2OZAB 3LFFA 4LV8A 5C8NA 2BR1A 3DKOA 3OUKA 5BQ0A 3RWPA 1B6CB 2CLQA 2XCKA 4WG5A 3VF9A 2VWVA 4R3RA 4DHFA 2WMAA 3DXPA 4O81A 4YLLA 2YM7A 5DI1A 1GZOA 2BKZA 2PY3A 3HA6A 3V5PA 3VW6A 2BHEA 5HNIX 3TDWA 4ZTMA 4EJ7A 4FL1A 4V01A 3HAVA 4G3CA 3QLGA 2JIUA 4EUTA 5EM5A 1QPEA 4U9AA 2X8IA 5H8EA 2EU9A 4F0GA 3R8MA 3UYTA 1Q8ZA 3E64A 3RALA 4NM3A 5EW9A 3BGZA 3VUTA 3PG1A 2ZOQA 4QMOA 4GUEA 4LG4A 2PMLX 3EQBA 4CFUA 3R83A 3HV3A 1R78A 5J5TA 4MXZA 4WG3A 5L6PA 2BVAA 5KMMA 2QU6A 3V6SA 3E93A 5HG7A 2HZ0A 3QAME 5KMIA 4UMPA 3QX4A 4OR5A 5AFVA 5I9VA 3CQEA 4Y5QA 2Y0AA 4BCPA 4ZMEA 4RJ4A 4UWCA 2VTJA 1WBVA 5I9WA 3EIDA 3D4QA 3SA0A 2J6MA 4PTCA 5AV2A 4PDOA 3RHKA 4YBKA 1A48A 3RCDA 3AXWA 1RQQA 3SW7A 3BLRA 4FSQA 5AUUA 4QMZA 3QQHA 4USEA 1DAYA 4RG0A 3FBVA 4S31A 3PPJA 3UP7A 5J7HA 3EQHA 4IMYA 3E8DA 1G3NA 2HK5A 3ORLA 3PJ2A 4FTNA 4UZHA 4PY1A 4PMPA 1WAKA 2UZWE 5JH6A 3PWYA 1R39A 4CKRA 5JQ8A 1P2AA 2GNIA 4AE9A 2QOFA 4BBMA 2WELA 4DG3E 4IX6A 1FOTA 1GNGA 4HGSA 3U4WA 3PRFA 3QD2B 4K0YA 5HE3A 5HX8A 3VIDA 4M12A 3EN6A 4C3RA 4FKUA 4XH6A 4D2WA 2V0DA 3D7ZA 4FIEA 3HA8A 2F7XE 4YJUA 5HE2A 3S4QA 1OB3A 4RVLA 3A7GA 4DGNA 2OF2A 3QX2A 5FP6A 5AP0A 2C5YA 4U40A 4Z16A 4L9IA 4UYAA 3COHA 1Q4LA 4TZRA 4CGAA 2ITXA 5TT7A 3AMAA 4YUQA 3O7LD 2W5BA 4TRLA 1J7LA 2C5OA 4EEVA 4LRMA 3PXQA 5GZ8A 2FA2A 2RFEA 4H1MA 5CS6A 2IPXA 4LRJA 2ITUA 3NSZA 3TG1A 4CZUA 3Q2JA 3LPBA 2OKRA 3A62A 4GV1A 4J98A 3EN9A 3P78A 5EW8A 3B2WA 4ZP5A 2WOTA 3LLAA 1XH6A 4GEOA 4JAIA 2IJMA 3BQCA 1UU8A 4E5AX 4YGAA 4MXCA 3D7TA 4X6QC 3LCOA 4A7CA 5KMJA 3F2AA 3C4XA 3PSCA 5DH3A 5TOZA 4V04A 4YTHA 3TN8A 5HO8A 3VHKA 5AA9A 5CF8A 2XEZA 5FTOA 4D58A 4QMUA 2OW3A 2YDJA 4EOSA 5HZNA 2CNVA 1GJOA 4RJ7A 4OTPA 4GK4A 4X2NA 3TJCA 1VYWA 1YHWA 4HCTA 4IB1A 3RAIA 3LXNA 3ZLXA 4F64A 4F9YA 4FIGA 3MA6A 4IX4A 2GTNA 3BIZA 1B38A 5EOLA 3VS4A 2IWIA 5IMEA 1HOWA 2XBJA 3F82A 2IZSA 4BCGA 4X3FB 3QCXA 3WF6A 1W82A 4XLVA 3NR9A 3EJ1A 4XV2A 2FGIA 2NP8A 3FZ1A 3U4UA 3HEGA 2RFSA 2YLEA 5CLPA 3ZZWA 3TV4A 2R3RA 2WMWA 3QTRA 3ZCLA 3DJ7A 2OJ9A 4V05A 4XYFA 2JBOA 4FTRA 1OL7A 4KUJA 4GJ3A 3DT1A 3ORZA 5DOSA 1YQJA 3GOPA 4G2FA 3H30A 2PE0A 3DJ5A 4QP3A 5M55A 4DH7A 2FUMA 2WQNA 3GC0A 2XA4A 4U8ZA 3ZUVA 4I4FA 3R7OA 3I7BA 3BU5A 1AD5A 4NM7A 4BCIA 3PA5A 5K3YA 2P4IA 4AT3A 4IZ5A 2BDWA 5AR4A 4B8MA 3F88A 3GCUA 5FBOA 2YWVA 3MV5A 2HY0A 5ETCA 3OS3A 3FLNC 4FKIA 4GVJA 4EONA 2OXYA 1WVWA 3VS2A 5AV3A 1Q3DA 4F08A 3BX5A 4PMSA 3EQGA 5DEYA 4PTEA 2EB2A 2WO6A 2X39A 3ITZA 3QF9A 3JUHA 1SNXA 4GT5A 4O1OA 4Y95A 4NM5A 4AGDA 1BLXA 4DBXA 3K5UA 2XZSA 2VWUA 3NNWA 2PUUA 4BBFA 1H1QA 2W5AA 4NCTA 3ZMMA 3PG3A 4CEGA 3PY0A 5IQEA 1Q24A 4W4YA 3ZM9A 4II5A 1J1CA 4GL9A 4FT9A 4CTBA 2XJ2A 4KBKA 4L8MA 2FVDA 4O0XA 3QTQA 5AP4A 2QG5A 3L9LA 4D5KA 4Y72A 3F69A 3KA0A 4E4LA 1WBPA 4AT5A 4DFXE 3V51A 2UZUE 4R77A 3PLAE 5ETIA 2YN8A 3F3WA 4KRCA 4ZIMA 1WFCA 5A9UA 5E8TA 1ZMVA 1DI9A 4NFMA 3I6WA 2W9ZB 5JSMA 1OUYA 3O8TA 3R8UA 4FR4A 3QCSA 2W4KA 5HBHA 4FC0A 3QC9A 3MFRA 2PUNA 3FLSA 4R1YA 5FTGA 2PUIA 2B53A 3UOKA 4ACGA 3P5KA 4EOOA 5GJFA 4E93A 2OBJA 3VW8A 2WTWA 3N9XA 3Q52A 2XKEA 2W1HA 4IQ6A 4X6RA 3DKFA 3VUKA 4A4LA 2ZMCA 4DGGA 2XIRA 4E7WA 1JBPE 2JLDA 1OIRA 4FV0A 4K8AA 3MJ1A 4CFVA 3K3IA 4O7RA 3R73A 4DTAA 4GU6A 3QRIA 5AM7A 4ACHA 4DEIA 4CG8A 1W8CA 2VGPA 1ZXEA 5EI6A 4YHFA 2R3MA 4DF3A 1OVEA 4HYIA 2XKDA 4X3JA 2X2KA 4A9RA 4AZVA 4F9AA 4RX5A 2WFYA 1Q5KA 3D2IA 4O27B 5H8BA 4A9TA 3ZLYA 2ZM1A 4NM0A 5CSPA 3NVMB 3VJOA 1OM1A 3ZUTA 1W83A 2PWLA 4PDSA 3QHWA 4R5YA 4P5QA 5BVWA 4WUNA 4EWHA 3HV7A 2B9IA 4IB3A 3N4TA 5HLWA 3ODZX 1JSTA 2UW9A 3BYOA 5CVGA 4UBAA 2A19B 5AV0A 5FWKK 3TNHA 4PF4A 1BL7A 4W4WA 1BYGA 3HL7A 4YZMA 2CGXA 3CP9A 4YURA 4NL0A 4F7JA 3OY1A 2WTCA 4C38A 2ITPA 2ITVA 3C4ZA 2Z7QA 1R0EA 5DHJA 2BZJA 2VWXA 3QZGA 3KF4A 4KIOA 3OP5A 4KB8A 4QP6A 2IW8A 4WBBB 1F5QA 1JWHA 1CKIA 4EH2A 1REJA 2PVKA 2VUWA 4QMWA 4X3FA 3ZOSA 5H9BA 2Y6MA 4O0YA 3RM6A 4O7LA 4G3EA 4CKJA 3PZEA 2CKQA 3PSDA 1SYKA 4JRNA 2EXMA 5ANKA 3ZXTA 4PL5A 3WF5A 3EZVA 5DYJA 5AP3A 3ODYX 4BZDA 4NK9A 4L53A 1U46A 4QMTA 3TTJA 1YDSE 4LMUA 4OTRA 4UEUA 3L9NA 4HGLA 4FTUA 4TNBA 4CVAA 1MQ4A 4J1RA 5J9LA 5DLSA 4X3FC 5LVMA 4BKZA 2FH9A 3ZU7A 2I1MA 4I6FA 3W2QA 4IAYA 4DLJA 3FAAA 1E1XA 4TN6A 4GKIA 3LFQA 3MVLA 2J5EA 4IJ9A 4NSTA 5C8MA 4FEQA 5CXZA 5C4LA 2WB8A 4K77A 4FKOA 4ZSJA 4FKGA 3CC6A 4DN5A 1OIUA 3G90X 3QGYA 4IWOA 3MH1A 3UNJA 4C35A 3BWFA 4E8AA 4ZLOA 3R00A 4KRDA 2C6TA 1SVHA 5HIBA 3WF7A 5EQEA 4TYGA 3NGAA 4OBPA 3W16A 3FKOA 2XYUA 4L45A 4HVSA 2NRYA 4EOIA 1R3CA 2J0LA 3NPCA 4I21A 4GT4A 4F4PA 4FV7A 3QZHA 4J97A 5JFXA 2IZUA 3CLYA 1ZYDA 4HYSA 3MSSA 3QZIA 3VNTA 4NUSA 2OLCA 3IW6A 2CMWA 4NFNA 4L3PA 2ITNA 2Z8CA 4CCUA 2HENA 1LR4A 4BL1A 1YXSA 5HO6A 3E92A 3QTZA 4L01A 4DEBA 3ZLSA 2SRCA 4MTAA 2XKFA 2I0HA 2ZM3A 1K3AA 2UVYA 4PTGA 4Q5HA 4U3YA 4XRJA 5D7AA 3R8LA 1PKGA 3QRKA 4YJQA 4DEDA 2OJGA 4XX9A 3FZSA 3P86A 4AW5A 2UW0A 2GDOA 1J7IA 2HW7A 3BEAA 4EOQA 4XG6A 3P79A 3F6XA 2WTJA 4DH5A 4RJ3A 2C1BA 4YJTA 4M14A 2ZV7A 4QO9A 4OTHA 4I0TA 3AG9A 2OGVA 3TKIA 4CYJA 4BWKA 2R9SA 4UMRA 4M68A 4RIXA 3QCYA 3RNYA 3MBLA 2YJRA 3KK8A 3R2YA 3DK7A 3NUYA 2UZBA 4IAIA 2OH4A 2XK7A 3VC4A 4GIIA 4WG4A 4D2TA 3MB7A 4RBLA 2QOKA 4FT7A 2HYYA 1E9HA 4HNIA 4MCVA 4BI0A 5JGAA 4JI9A 3FKNA 3NVKI 1J91A 3MN3A 3UC3A 4HW7A 3KC3A 3VUMA 2HIWA 5K4JA 3VVHA 4IHPA 4FKVA 3FC1X 4O0UA 3PJCA 2JC6A 3JVRA 3S00A 3Q60A 3FJQE 4GSBA 2HCKA 4FIIA 4QPMA 4JLCA 4EORA 1YRPA 2E9OA 5IKWA 2C3IB 3Q9WA 5L8JA 4IVCA 4C02A 4IM0A 1JSUA 3GCSA 3LZBA 1BMKA 1YWNA 2XRUA 4FVRA 4C4HA 4DGLC 1IA9A 1KWPA 1PXPA 4FK6A 4J8NA 4H1JA 4AOIA 1KV2A 3F5PA 2BRBA 3FMDA 3L8PA 4OTIA 4AP7A 3VUDA 3QKMA 3ZHPC 3V8WA 2GS6A 3JY9A 3TWJA 2WMUA 4Y85A 3OW4A 4S32A 3H9FA 1ZYSA 3UQCA 3C5UA 4QMYA 2WTIA 3R01A 3RPRA 5AV1A 5HI2A 2BRHA 3BV3A 2W1IA 4QQCA 3VS3A 1PMVA 2VTOA 5AP6A 5AUXA 4CLJA 4G6LA 4MD9E 1WBWA 4XV9A 4AZEA 1OKZA 2YCRA 3EN4A 3QKKA 5CAPA 1JKKA 3E8NA 4Y8DA 1G5SA 1ZYJA 1Q97A 4YTIA 5LMAA 3F3TA 4FV8A 3R02A 3DFCB 5JZNA 4DH3A 4U79A 4EH8A 3HDMA 4B4LA 5EDQA 4O6LA 4PDYA 2W05A 3O7LB 5ANIA 3UIUA 2YABA 4BCJA 4AW0A 1PXIA 3PP0A 5LJJA 5DEWA 2WMXA 5B7VA 4LGHA 4EOKA 4KKHA 1OL1A 4BRXA 5IH6A 5LMBA 2O63A 1PXLA 1ZY5A 3OEFX 4FODA 3QLFA 3OT3A 2PVLA 4FX3A 2B9HA 4G5PA 4A4OA 4K9YA 2BAKA 2B0QA 3QRJA 5HIEA 1H1RA 4RX7A 2OIQA 5IMXA 1JVPP 1SZMA 3OCGA 5CNNA 3IW7A 5M57A 4MX9A 4BKYA 3LFDA 5I9ZA 5DRDA 2QURA 5AR8A 3TZ8A 3A2CA 3R6XA 4KA3A 1SVGA 4QMXA 4ALVA 4FIFA 1GIIA 5BYYA 4O21A 2UW5A 5CEQA 4AF3A 4LFIA 4ZZMA 4EC9A 2JBPA 3DU8A 4HVGA 3DTWA 4RIWA 1UVRA 2YA9A 2VWBA 3HMOA 3ZDUA 3L8XA 5HGIA 1UU7A 4RT7A 4W8DA 1W98A 2OIDA 1VZOA 2X1NA 4BYJA 4F6WA 3LFEA 1Q62A 5E90A 4A9UA 3LLTA 3QQUA 3ALOA 4V0GB 3V5JA 4CT1A 3GCVA 1MRYA 3MPTA 3TIYA 4NWMA 5FD2A 2PYWA 1Y6BA 4FG7A 4WO5A 4BTFA 5AX3A 4AAAA 1RJBA 3AD5A 1GZ8A 3TIZA 5AUWA 5A4LA 3GI3A 3TEIA 5KKRB 1VR2A 2BHHA 1CTPE 4EHVA 3ZO1A 5GJGA 5CX9A 4LI5A 1DI8A 4IZYA 3EL7A 2YITA 4QMSA 4X2GA 3UOLA 5ETFA 4A07A 5KHWA 3ZH8A 3UNZA 4E5WA 2QO7A 4IBMA 5JQ5A 5JN2A 3V6RA 5K5NA 3QQLA 1OBDA 2J4ZA 3KN6A 2BKKA 5CYIA 4FZ7A 3V04A 3UVRA 4R78A 4RSSA 2R0IA 4BZNA 3W1FA 3DNEA 5M56A 3BI6A 2YM4A 3PJ8A 3NYVA 2WMQA 1H01A 3LXLA 3OXIA 3ZXZA 2BIYA 4CRLA 3R9RA 4ZEGA 2JKMA 4JBVA 3VF8A 3NCGA 4MBIA 3W10A 3QUPA 1LP4A
chains in the Genus database with same CATH superfamily
3D5VA 3DDPA 5CQUA 2YM5A 1KV1A 4FI1A 5BUIA 3I81A 5TE0A 4DLIA 5EQYA 1O6YA 4HZRA 2F4JA 5CSVA 4PPCA 5CAVA 2HOGA 3DZQA 1PMEA 2UVXA 2IVVA 5LVNA 3F2RA 3DBEA 3NAYA 4O84A 3MJ2A 4GRBA 3CY3A 4BDJA 4Q2AA 3AD4A 3ELJA 3NMUF 3GC9A 1SVEA 4CSVA 4JG6A 4YZCA 2GQRA 1XH7A 2YDKA 3E3BX 4LGDA 2C5VA 4FNXA 3TNQB 3POOA 4CMUA 3IGOA 3BGQA 5CI7A 5L8LA 4FSYA 3UYSA 2J51A 4FTIA 1A9UA 2HXQA 4OTDA 4XV3A 3LMIA 1URWA 4ANMA 3ENMA 3LXKA 4TYEA 5HCYA 3VRYA 2YACA 2ITOA 5A4CA 2R0UA 2BTSA 5KCVA 4M0ZA 5GIOE 3QTUA 3TNWA 4F78A 1X8BA 2VN9A 3NLBA 1IAHA 2FSLX 1W84A 5DR6A 3RHXA 3U87A 1NT2A 4AOJA 5M51A 5DRBA 2ZB0A 3PA3A 4I1ZA 3FUPA 4DYMA 3SDJA 3PXFA 3LQ3A 2PE2A 2XCHA 2XIXA 4GU9A 4AUAA 2WPAA 2YAAA 2BROA 4JVGA 4U3ZA 4BI2A 3ACKA 4EK8A 4UN0C 5A54A 4WNPA 4PQNA 3FL5A 2QU5A 3WI6A 4P7EA 2PHKA 1OECA 1URCA 4BVUA 4D28A 3CGFA 3BHTA 2R3QA 4QP8A 2XP2A 4O7NA 4FSRA 5C8KA 4Y5HA 3R7GA 4TWCA 1J1BA 2PZRA 3UODA 4ZSAA 2PSQA 3NW5A 3FI2A 3IKAA 3R28A 2PZYA 4FV3A 4J96A 3V3VA 5M07A 4MQ1A 4BIEA 4D2VA 2HELA 3E3PA 3IG7A 3ENHA 3QYZA 2WEIA 3A7FA 2XIYA 3CE3A 4RRVA 5DT0A 5FLFA 4NKSA 1WBOA 4O83A 4YJRA 3VS6A 4I5CA 3H10A 2CCIA 4TWOA 3UIXA 4DT9A 4MBLA 2RG6A 4FNZA 3CR0A 2RG5A 4DHIB 1PYEA 2QOOA 3NZ0A 2X2MA 4BCOA 3ZS5A 4CXAA 3WZEA 4CYIA 4I93A 2QG7A 4WNKA 1IAJA 4P5ZA 4RX8A 4B99A 2XEYA 3NAXA 4I94A 3NWWA 5E8ZA 4HCUA 4V0GA 2WMVA 4GT3A 3NRMA 5IA5A 2FO0A 5AV4A 3ID6C 3PUFC 4QP4A 5EM8A 2QOLA 2QLUA 3FQHA 5I9YA 2A2AA 3CTQA 2X4ZA 2X9EA 4N0SA 1QL6A 5HO7A 4GUBA 4YJNA 5AR7A 3DBDA 3L1SA 2ITTA 4FNYA 4KS8A 1GY3A 4Z55A 1S9IA 2YHVA 5HTBA 3RZBA 5DPVA 3SOAA 3T3UA 3ORXA 1YXTA 2X7GA 2VTNA 4FICA 4I6BA 2C6MA 4I92A 3VHEA 3CGOA 1Y6AA 5KKRC 4I0SA 4EL9A 4JQEA 2WQBA 2J2IB 4NH1A 2QVSE 3BBWA 2R3GA 4RC2A 2W1CA 4BHNA 1OPKA 3R8VA 4XEYA 3R9OA 3D9VA 2YIXA 2QODA 5EH0A 4C33A 4KIKA 5AAEA 2YEXA 1IR3A 4RWJA 3QA0A 4R5SA 4B0GA 1MP8A 1MRUA 2X0QA 3OF0A 3TNPC 4ENYA 1UKHA 4USDA 3GOKA 4IXPA 3AD6A 1XO2B 2W06A 4D2PA 2V7OA 1KE5A 5GIPE 4U45A 4EHEA 3PZHA 3OHTA 4QDVA 3EQPA 3BRBA 2VTAA 2VX0A 3FMKA 5CU3A 4L46A 3ZRKA 4C34A 5E7RA 3TUBA 2WU6A 3N4UA 5FM3A 3GENA 3FI4A 3EFKA 2JDOA 3EL8A 4O2ZA 4RWIA 1GZNA 4XOYA 3ZBXA 1H1WA 4L6QA 2V62A 5IA2A 2UW6A 3BCEA 4MAOA 4RA5A 3V5LA 3OXZA 4DFNA 4HPUE 5L3AA 4PNIA 4C4EA 1H00A 4EKLA 4MKCA 2C47A 4XP3A 3ZDIA 1UU3A 2VX1A 2W7XA 3BYSA 5C01A 1KUTA 4W8EA 3U6HA 1Q8WA 5HG5A 3UO4A 4JBPA 3VBVA 4O7TA 3TT0A 3WBLA 1CMKE 3ZLWA 4ASZA 2DUVA 2CN5A 1OI9A 3H3CA 4DG0E 3GNIB 2GHGA 1H08A 2F57A 3OCSA 3PVGA 2BZKB 5F95A 5BUEA 4FUXA 2ZV2A 4CD0A 4DFZE 3PE2A 3W8LA 4BWPA 5H2UA 4MNEA 4B6LA 4I6QA 5L2SA 1GIHA 4ZJVA 4QNAA 4FNWA 3KQ7A 2BFXA 4C4IA 2A1AB 5M4UA 2QD9A 2IW6A 3RJCA 1LPUA 4MF1A 4U80A 4IE9A 3V8SA 2QLQA 3R1QA 2PZPA 4W4XA 5CTPA 5IQDA 1NW1A 4YTCA 4X2JA 5LVOA 3IO7A 4BN1A 3ULZA 2FSMX 2B52A 4E6QA 1XMMA 4YZBA 2ETKA 3II5A 1OIYA 1SNUA 4G3DA 5BYLA 2JFMA 4F9BA 3MESA 1OMWA 4MXAA 4RWKA 4Y83A 4EKKA 3NYOA 4YJPA 5IDNA 2WAJA 3BHYA 1CDKA 2F49A 4OBQA 3VUHA 4OGRA 4ASEA 4USFA 3V8TA 4UB7A 4LMNA 4C62A 4RFZA 4N6ZA 5CT7A 4DAWA 5EOBA 3Q5ZA 4CQEA 5IUGA 4U7ZA 3RINA 4EOJA 1G8SA 5TR6A 2UW3A 3LAUA 4IWQA 3WYXA 2QOCA 4EK4A 3RK9A 1KE7A 2HXLA 3RP9A 4O0WA 4JMQA 1WVYA 4OTWA 2ETMA 1V0BA 2FSTX 2GFSA 2RFNA 3QTWA 3UIBA 2XUUA 4A9YA 3E63A 5KMLA 5CVFA 4M66A 2QC6A 3KF7A 3MVJA 3NIEA 2XNNA 3ORPA 3QRUA 4GG5A 5HE1A 3ZSGA 4CKIA 3COMA 3R7YA 4YU2A 4QQJA 4ZTLA 3R7EA 4O38A 2XS0A 2VTLA 2Z02A 4R8QA 3GP0A 3GUBA 4GH2A 4O86A 4WSQA 3BZ3A 4U43A 3H0YA 4HPTE 3FZPA 4FTAA 1AQ1A 1U54A 3JY0A 4O4FA 4R3PA 2JEDA 3C4FA 4Q9SA 2I6LA 1Q8UA 4C3PA 2OJJA 5EQPA 3D5UA 2VWYA 3FMNA 4JX7A 4DITA 3AMBA 3UMWA 2B4SB 4BDAA 4HYUA 3ORNA 1O6KA 2QCSA 3AQVA 1NA7A 4RJ5A 4XG4A 3R7IA 5EYMA 4TWNA 4I23A 5JFVA 2OZAA 2YIQA 4F99A 3ORMA 3P7BA 1OZ1A 4QTAA 3KMWA 2OXDA 4ACMA 1TQIA 2QHNA 3T9TA 1JNKA 3KXNA 3DCVA 2DWBA 3IOPA 2Q0BA 3KRJA 5EG3A 3HGKA 4ZLYA 5IF1A 3LFBA 2GQSA 3L8VA 4DINA 3AKJA 2XMYA 1ST0A 4U97A 4JDIA 4BDGA 4MEDA 2RGPA 4YC6A 5E9EA 5M09A 3GC8A 2I0EA 2UZVA 4LOQA 3ANQA 3R7VA 4GW8A 3MFUA 3RPVA 2VNYA 4NW5A 3LCKA 2JAVA 3P23A 3R63A 4GCJA 4M69B 4ZTQA 5HIDA 5HTIA 2UV2A 3KY2A 4CLIA 3O51A 2R3HA 1YXUA 3MY5A 4FKWA 4GG7A 3U51A 4PWNA 4KIQA 3FHIA 3DAEA 2VWZA 5CEIA 2RL5A 4J8MA 4CG9A 2GHMA 5E8XA 3GFEA 3SLSA 4PP9A 2JDVA 5HCZA 2ITWA 3UMXA 2Y4PA 3LIJA 1BI7A 3VULA 3PVBA 3QL8A 3U6JA 3CSVA 3I79A 3LM0A 3Q4UA 3OWKA 4QTDA 3POZA 5AIRA 2WU7A 3PXKA 4EQMA 2X6DA 5FBNC 5AUZA 3RK5A 4OT5A 2VGOA 3B2TA 3F7ZA 3FV8A 5I9UA 5TKDA 3EYGA 2AYPA 3LQ8A 4ZMFA 4PUZA 2PZIA 3OC1A 5AR3A 5JZJA 2QOHA 2GMXA 3Q6WA 5EHYA 2CHLA 1DAWA 1WBSA 2YM8A 5IEVA 2NRUA 3DNDA 3QWJA 5HG8A 4LYNA 4GK3A 2EUFB 3BLQA 4QP1A 4HOKA 4RIYB 3SVVA 4E4MA 3ATSA 3MTFA 4RLLA 2O0UA 4TWPA 5KHXA 3RM7A 1IA8A 3BWJA 3KL8A 1YVJA 4EZ7A 2BRGA 3RMFA 3DBFA 4L3LA 4ZXTA 5JMSA 3S95A 4C0TA 4ASDA 3QTSA 3DK6A 3ROYA 2J5FA 3QD4A 5CSXA 3RAWA 3S1HA 4E5BA 3UZRA 5AP1A 4XG9A 4LGGA 2XK4A 4DTBA 3VBQA 4EBWA 4FTTA 4F1MA 3IK3A 3ZFYA 3LJ2A 3GT8A 4KINA 4W4VA 4DGOA 5I5ZA 4L67A 3D5XA 3ALNA 3W0QA 3AC8A 3QC4A 4AOTA 3BHUA 1YWRA 2X7FA 2B54A 4FK3A 3SXRA 5CSWA 4G16A 4GMYA 1K9AA 2F7ZE 3KCKA 4JDJA 3VBYA 3EH9A 4BDEA 4M0YA 4X2KA 3I4BA 4GFGA 4AWIA 2X8DA 2XNMA 2E2BA 3W55A 1T46A 2JD5A 5ANDA 3SW4A 5K0KA 3ZO4A 3LE6A 3UJGA 2G15A 4WHZA 3PXZA 2Z7SA 4FYOA 4G6OA 1Y8YA 3CBLA 3KRXA 2IO6A 3KREA 1L8TA 2DQ7X 4AZWA 4BDFA 5HICA 3CJGA 2C68A 5IU2A 5FEEA 1JOWB 4L52A 5HCXA 4EH6A 5AUTA 4ANBA 4OAUC 4KABA 4MXXA 3RI1A 4C36A 2H9VA 4JL9A 4BTJA 5IQBA 4KIPA 4ZTNA 3TZMA 3W18A 2E9PA 3ORKA 3VUGA 5BVOA 1TQPA 4E1ZA 3GCQA 4YR8A 1A06A 4HVDA 3PE1A 3PJ3A 1WBTA 3OFMA 3JR1A 4BDHA 2EB3A 3EKKA 5HU3A 4RGJA 4YC8A 3SRVB 5T6KA 3MW1A 4EYJA 3WZDA 3PFQA 5M4IA 3LOKA 3RNIA 4BHZA 3W33A 1NY3A 4Y46A 4IAKA 5I0BA 2XYNA 3ETAA 3VQHA 3QQFA 1BL6A 3LKMA 3KXMA 1FBNA 1PXJA 4F9WA 3EQIA 3PDTA 4M84A 3DGKA 2BAQA 1YDRE 1M2RA 3TKUA 3MYGA 3D5WA 4BIDA 2HW6A 4FTCA 5DMZA 3LMGA 3A7HA 2C6IA 4CMTA 4KKEA 3LCDA 3KKVA 3N51A 4NZWB 2Z7RA 4AFEA 5J9ZA 4S33A 3ZRLA 5BX0A 1PYXA 5FDPA 5AMNA 4W9WA 3OBJA 4O7VA 4HVHA 3P7AA 1JSVA 1NVRA 2C0TA 3A4OX 1O6LA 4G34A 4FF8A 4QP9A 4JR3A 5EW3A 4D2RA 1YHSA 4QYFA 4YJSA 5F1ZA 3WZUA 5BVNA 1PXOA 4L00A 3FKLA 3QQGA 1OL2A 2PVHA 3QBNA 4M69A 3ZSHA 3FYKX 4CTCA 5BV3A 5CU0A 2ZDTA 3R2BA 2VTQA 3NYNA 4XMOA 3SQQA 1PJKA 4O91A 3U9CA 4U6RA 3CY2A 1YW2A 5FXQA 4EH3A 4F70A 3HLLA 2ESMA 3TKHA 4CFWA 5HQ0A 3SXFA 3PVWA 3SAYA 1OPJA 3FY2A 2IVSA 2XNPA 3AT4A 5M53A 2B1PA 5CEOA 4FYNA 2Y8OA 1L3RE 4IM3A 2W4OA 4YO6A 2OICA 1H8FA 3ORIA 2C6OA 3H9RA 4G3GA 3V5QA 3DXQA 3CTHA 4ZTHA 3C51A 4JS8A 1YXVA 3WE4A 3QHRA 4K33A 5T3QA 1JKTA 4MXYA 2UW7A 3PP1A 3I1AA 2NPQA 2WD1A 4PPAA 5TO8A 3CS9A 4MXOA 3HZTA 5EFQA 2UZOA 4UMQA 3EOCA 5AA8A 3K2LA 4I4EA 5FG8A 2I7QA 4XOZA 3KRWA 2YZAA 4FSWA 5DWRA 4DH8A 5K5XA 1HCKA 5BVDA 2XRWA 5AR2A 3IPHA 5F20A 2GU8A 3R7UA 1GIJA 3BBTB 1KE8A 4MD8E 3FEGA 3BQRA 5CF5A 3ZTXA 1MRVA 1ZZ2A 3GGFA 2G1TA 2OJFE 4RIYA 1UU9A 1JPAA 4O22A 4AZTA 1JAMA 1S9JA 1SMHA 3DFAA 1LEWA 3DTCA 3MPAA 4FTJA 4QNYA 4XP0A 2GQGA 4XHKB 1Y8GA 3P08A 5IPJA 1H1PA 4WOVA 1BI8A 3NDMA 2R3KA 3FC2A 2WMRA 3GU4A 3B8RA 2ZDUA 2ZJWA 4IWPA 5L6OA 3P1AA 5J1VA 2W17A 3UTOA 4Z7GA 5C03A 3I5NA 3MFTA 5L2TA 5IH4A 4H58A 4YLJA 5EHLA 3FXWA 3Q4CA 5E92A 2J50A 5AAGA 4O4DA 4YP8A 3TV7A 2QOQA 4A9SA 4PL3A 5LCKA 3PY1A 4UXLA 4X2FA 4XNEA 5AUYA 4BF2A 3FLYA 2QKRA 2XJ1A 5CENA 4EK5A 5LARA 4AQKA 2DYLA 2OU7A 3GU5A 2YIRA 4RLKA 3O5AA 2R2PA 4QMNA 3PYYA 5A4QA 1KE6A 3QQKA 5HE0A 2B9JA 1NVQA 5L8KA 4AQCA 3ZZEA 4QP7A 2GNLA 4UXQA 1RDQE 2ONLA 2QQ7A 2ZVAA 3HV4A 1YHVA 3LXPA 4MYGA 4XBRA 3QD3A 5DR9A 3FXZA 3TV6A 4C7TA 4YJOA 4RVKA 5BVEA 3WARA 2IZRA 5LOHA 2VRXA 5E8WA 2HAKA 3MFSA 3WILA 5FM2A 2I0VA 4TTHB 3UOHA 4NEUA 3VWAA 4CFMA 4L42A 2GFCA 2WIHA 3EMGA 3FI3A 2ONLC 3A99A 3CIKA 3FY0A 2FSOX 3GBZA 4FKTA 2XAMA 3TZ9A 5A6OA 3EN5A 5AADA 5LVPA 1TKIA 5IA1A 4ZSEA 3NUNA 3Q9YA 2JKKA 4PMTA 3IDCA 4I41A 4H05A 3ZEPA 2Y9QA 4I5PA 2I40A 3QQJA 1I44A 3W2OA 5LWNA 3DV3A 4YMJA 4RIOA 3RVGA 4FT5A 4FL2A 2W96B 4NTTA 3BKBA 1KOBA 2VZ6A 4ZOGA 3VBWA 1V1KA 2YDIA 3CD3A 3CD8A 3HRCA 2Y7JA 3ANRA 4FKPA 1JKLA 1PXKA 3ZC6A 3NYXA 2VTMA 4D9UA 2BFYA 5D12A 4BTKA 4YZ9A 4P4CA 3NW7A 3BYMA 4BDDA 2R4BA 2X9FA 2QOIA 1OL6A 2F9GA 5KX8A 2O2UA 2EXCX 3D2KA 2CNUA 3HMPA 1UNLA 5AP5A 2PUPA 3PUPA 3MIAA 5IQIA 2LAVA 2WTVA 3G0FA 4ANQA 3HNGA 5J1WA 5EKOA 4C61A 2LGCA 2VO0A 2WQMA 3U8WA 2YM6A 2JIVA 5IQCA 5GINE 3UO5A 4G5JA 3VBXA 4UX9A 3PXRA 5BPYA 1OKWA 2J0KA 4AZFA 3UDZA 2VD5A 3CQWA 2C30A 3F5UA 3FL4A 4XS2A 3IW8A 3JXWA 4BJJB 5FEQA 5A46A 3G2FA 3NUSA 4O4BB 4KSPA 5H3QA 1SM2A 3VAPA 3G6GA 3E62A 3WZKA 4FBXA 4R3CA 5CZIA 5AEPA 2YZLA 4D4RA 3VS0A 2XM9A 2OIBA 2CDZA 2X8EA 4YHTA 5FXSA 2OO8X 1REKA 3QKLA 4G3FA 3VS1A 2PVJA 5J87A 4XG3A 4QOXA 4CRSA 2QR7A 4NYEA 5AP2A 2BTRA 3KULB 4F09A 5TF9A 4B8LA 3FZRA 3REPA 3E5AA 2Q0NA 3FLQA 3F9NA 3QALE 1H25A 5B2MA 4DFLA 5I4NA 5HLNA 2W1DA 2HWOA 2FYSA 1PHKA 4DC2A 2B7AA 5BUJA 1FVVA 3H4JA 3UQGA 4IACA 4BC6A 5AWMA 3W8QA 1TZDA 1OPLA 4KSQA 3SOCA 4DGMA 2WTKB 1FINA 5HBJA 4ANSA 5HKMA 4LM5A 2Z2WA 4FG9A 4FSUA 4C3FA 4HGTA 3GU7A 1UA2A 1Y57A 3U55A 3OG7A 3PIXA 5HVKA 4C4JA 5CQWA 4F7NA 3UO6A 4AXDA 5DGZA 5M08A 2BPMA 5FQDC 4FZAB 1XH5A 3EZRA 4TW9A 4Q5EA 3GU6A 4ZS4A 3LHJA 3Q96A 3LQ5A 2R3NA 2XB7A 1NXKA 2Y6OA 4S2ZA 3MVMA 2OG8A 1M2QA 2JFLA 3R0TA 4FA2A 3MDYA 2Z60A 5AAFA 4DA5A 1BX6A 3CPCA 5AM6A 2O64A 1UKIA 1YOLA 2XK6A 4QMMA 3ML1A 1WCCA 4DEAA 4I5MA 1QPJA 3NS9A 3EFLA 5ANJA 3E7VA 4ZLZA 3UE4A 5IQHA 4H39A 1W7HA 1GAGA 2W1EA 4O2PA 4E4XA 4D5HA 2VO7A 2F7EE 3GVUA 3SC1A 3UZTA 1Q61A 2PTKA 3ROCA 1H24A 2YWPA 5ICPA 4RC3A 5JGDA 4BWXA 3PY3A 3D83A 4IWDA 3IQ7A 4TYJA 3MA3A 3MY1A 5DFPA 5L2QA 4O7SA 3FE3A 4Z9LA 5HESA 2XK3A 4TL0A 2CKOA 3M2WA 3U6IA 3D14A 4OTFA 4OLIA 1ZOEA 4J99A 3MH2A 4O0RA 3S2PA 4F1TA 2O3PA 3C0IA 1FVRA 3LFCA 2E9UA 3UGCA 4HVIA 5JK3A 4O7YA 4EOPA 5M44A 2GNHA 3UPXA 4BGQA 2GTMA 4XUFA 3KXHA 4EJNA 2XNOA 3EN7A 2P2HA 4JDKA 4QYYA 5ANEA 4DE4A 1NVSA 2IZTA 4R6VA 2HZ4A 2VTTA 3O50A 5CWZA 2R3JA 2P0CA 1IASA 3ORTA 4UMTA 3SGCA 3FSKA 3HV6A 3L8SA 1MUOA 3G9LX 1PXMA 4M13A 3F66A 3HUBA 3AMYA 3KRRA 5KE0A 2CKPA 4M15A 3UVQA 1OKYA 5M4FA 1XH9A 2W99B 3C0HA 4HCVA 3CCNA 4M8TA 1WBNA 2UZLA 3F5GA 4TNDA 3PFYA 2VTRA 4ONAA 3UC4A 3M1SA 3NX8A 5KO1A 3PA4A 4X21A 5CT0A 4BCFA 1Y91A 3M11A 3MY0A 2G2HA 3OOGA 1J3HA 3BPRA 4BY9E 4C2VA 3UG2A 4BIBA 4ZJIA 1P14A 4DHZA 2G2IA 3FZTA 3LFAA 3COIA 2W0JA 3KMMA 4P2KA 2AC5A 3M42A 3RPYA 3ZM4A 2XNBA 3DBQA 3LFNA 5ACBC 4M97A 1ZZLA 5T68A 3AOXA 3P7CA 1J7UA 4FTKA 4IX3A 3O2MA 1PY5A 4FGRA 5IUIA 3HRBA 4BJJA 5KZIA 4AS0A 3G5DA 2PK9A 2AQXA 5DIAA 2CCHA 4KAOA 1BKXA 3TM0A 4M67A 1KE9A 1YI6A 2UW8A 3KXZA 5KMOA 3KRLA 3CEKA 4QQTA 4KBCA 4PX6A 4D4SA 5KBRA 5IUHA 3SKCA 3CXWA 2WTDA 3ZYAA 1PKDA 3VS7A 5EI2A 4ALWA 1ATPE 3CPBA 2BIKB 5K0XA 3OWPA 3KK9A 4I20A 4KD1A 2CGUA 1AGWA 2R3LA 1K2PA 4CZYB 3HV5A 3THBA 5JGBA 1Z57A 4MUQA 3IW4A 2CPKE 5EI8A 5FXRA 1G8AA 3CKXA 4JQ8A 4MWHA 2NO3A 2OF4A 3MWUA 4IJPA 3O17A 5JRQA 4JNWA 2AC3A 2X7OA 4AA4A 1QPCA 3BE9A 3R9NA 2WOUA 2XVDA 3BYVA 3AC5A 4AE6A 5BNJA 4K6ZA 3RKBA 2IG7A 3EHAA 3DOGA 5HLPA 1W2DA 2XNEA 4ZJJA 2B55A 3V5WA 1R1WA 4BGGA 4NT4A 5IH5A 4JIAA 3Q6UA 3OBGA 2RF9A 5FDXA 4IC7A 3DDQA 1XH4A 3KFAA 1ZYCA 1M52A 3NW6A 4BCQA 2PVMA 1ST4A 2WTKC 1ZARA 2UZDA 4U42A 2Y4IB 3QA8A 4NIFB 1Z5MA 4EH7A 4F7SA 4UZDA 3ATTA 5ITAA 2ITYA 1H28A 3A8XA 1TQMA 2B9FA 5DVRA 4CT2A 5LWMA 4C59A 3Q32A 4KKGA 3MGYA 3PPZA 4D1SA 2ITQA 5J95A 1YDTE 4R7IA 2G9XA 3TACA 1PW2A 1STCE 3SG9A 4XG8A 4AN3A 3TCPA 3NFFB 4N57A 2C3KA 3PTGA 2W1GA 3IONA 1RW8A 3BU3A 2R64A 4FZ6A 4XG7A 1U4DA 5CEPA 3EYHA 4AZSA 1FQ1B 1ZRZA 4XV1A 4R7HA 4U5JA 5F94A 4UWBA 2VU3A 4L44A 4ERWA 4GFOA 2V5QA 1I09A 4QMVA 5DT4A 2GNGA 2WGJA 3R9DA 1M2PA 4TXCA 5HTCA 2I0YA 3IDBA 2YFXA 3LMHA 2C3LA 2R3OA 5DBXA 2YIYA 4R7BA 2H34A 5LVLA 3BHHA 2WKMA 3Q2MA 4C58A 3A4PA 4ENXA 4QDEA 2C5XA 2C6DA 1JQHA 2C5NA 4OW8A 4WUAA 3LCTA 3EKNA 5CU6A 3NNXA 3IW5A 4E6DA 2AUHA 3DLZA 2YJSA 3FLZA 3PIZA 1IG1A 2ZMDA 1VYZA 2QONA 2P3GX 1F3MC 1OITA 2QOBA 2RFDA 5D11A 2UZNA 2H6DA 3DKCA 5HOAA 4DTKA 4E6CA 3F7WA 2A0CX 4U81A 1XR1A 1TFFA 4HZSA 5KBQA 4ZTSA 2CSNA 3DS6A 5JRSA 5DR2A 3PLSA 4AW1A 4EH5A 3FPQA 4IVDA 4FTMA 4KBAA 4D55A 3I0OA 3B8QA 3G6HA 3I0QA 1DM2A 3PXYA 4IB0A 3KU2A 4E4NA 5IQAA 2ETRA 2BZHB 5JT2A 3SG8A 3RGFA 1CKPA 4DEGA 4ITIA 4YZDA 4X7QA 4S30A 2NNWB 2REIA 5IA0A 2GCDA 5CVHA 3WOWA 3C5IA 3CQUA 3CJFA 4G9RA 5EM6A 4WBOA 2ZAZA 1ZOGA 3FWQA 4LDTA 3QWKA 3EQDA 1PMNA 1U59A 2WMSA 4I6HA 4J52A 2C4GA 5D7VA 3W2PA 1GZKA 4FRFA 4EHGA 5FRIA 4HGEA 3OUNB 4E73A 4BDCA 4M7IA 2VO6A 3R04A 5DN3A 3SV0A 3VQUA 2BALA 3GCPA 3PJ1A 2R3PA 4XP2A 3K3JA 2C0IA 3EFWA 3IDPA 4KNBA 4RA4A 4D4YA 3UPZA 5C27A 4IH8A 4ORKA 4AFJA 2HY81 3OROA 3HMMA 5EK7A 5HD4A 5CAOA 4EK3A 4YHJA 4Y73A 3PVUA 5GZ9A 3NUUA 1UWHA 4LQMA 3P9JA 5HHWA 3RTPA 4TYHB 2VNWA 3A61A 3DAJA 4G17A 3R8PA 4FEWA 4NTSA 4IDTA 4QMLA 1QPDA 2YCFA 5AUVA 2H8HA 2PMOX 1QCFA 3PPKA 4DFYA 2FB8A 4O7ZA 5CU4A 4AN2A 4ID7A 4J53A 5FGKA 5GZAA 3HUCA 1H4LA 4IAAA 3ZSIA 1H0WA 4IAFA 1JLUE 4JBQA 4LUDA 3T8OA 1U5RA 4N6YA 2QR8A 4YC3A 4BCNA 4D0WA 2PVNA 1CKJA 4GIHA 3OCTA 2PZ5A 3HVCA 3BU6A 3MPMA 4LOPA 4QMPA 4Z7HA 4UMUA 3I6UA 5CAUA 4IFGA 3UBDA 3COKA 3G0EA 4FV4A 3BLHA 5AX9A 5K4IA 4QPAA 4L7SA 2XNGA 1WMKA 3P0MA 1XMLA 4IC8A 4FEVA 5AR5A 3HAMA 2Z7LA 4NKAA 5BYZA 5DNRA 2JAMA 1M7NA 2R5TA 5FP5A 4CCBA 4EOLA 4F1OA 5D1JA 2J7TA 3C0GA 1FMKA 2PL0A 3MTLA 4QTBA 3Q3BA 2J9MA 4D1ZA 1JKSA 2DS1A 2UZEA 2X81A 3FMMA 3K54A 2G01A 3MH0A 2CJMA 4FSTA 4GJ2A 1XQZA 4GVAA 4WA9A 3RPSA 4NIFA 4FOBA 4YLKA 5E1SA 3KCFA 4JXFA 3W2SA 3EFJA 3OVVA 4JG7A 4WD5A 2P55A 1LUFA 2BILB 4G1WA 3AC2A 4JX3A 4D0XA 4E6AA 2JGZA 5M4CA 2W5HA 3O0GA 4BCMA 2P2IA 3HRFA 4ZAUA 2O8YA 1P5EA 5JFSA 2QO9A 4MHAA 2Y4IC 1Z9XA 3FPMA 3AC1A 5EYCA 3A60A 3A8WA 4OTGA 4WSYA 4U0IA 2P33A 3C9WA 3L9MA 2NYAA 2BUJA 1YOJA 4J95A 2X2LA 2IVUA 4DCEA 5CEMA 5KMNA 3QFVA 4PMMA 3DLSA 3QGWA 4L3JA 4N4SA 5I3RA 4FT0A 4FTQA 3GFWA 4IDVA 3DJ6A 5A4EA 4C57A 5E8UA 4D1XA 4DH1A 1XHAA 4ZS0A 1YXXA 2IW9A 3AT2A 4OUCA 3NEWA 4FSNA 3OCBA