2WTCA

Crystal structure of chk2 in complex with an inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
302
structure length
284
Chain Sequence
b'VYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Identification and Characterisation of 2-Aminopyridine Inhibitors of Checkpoint Kinase 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 284
sequence length 302
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wtcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wtcA01
4EORA 4I3ZA 3R8VA 1ZMVA 3NAXA 4A9YA 2ITUA 2UVXA 3ZO2A 3LMHA 2R2PA 5DT3A 4Q5HA 1IA8A 3VS3A 5AV2A 4QYEA 4O96A 2QLQA 3BGQA 3TEIA 4CXAA 3ENMA 4PNIA 4MNEA 4AF3A 2YITA 1P4OA 3S3IA 5LWNA 5CEOA 4OTRA 5CSVA 2RFSA 5M4CA 4I4EA 1YVJA 4QMOA 4X3FA 4EL9A 5EOBA 5HVKA 3P79A 4A9TA 5DR2A 3O71A 4BF2A 4EZ7A 1Q8ZA 4IVDA 2AYPA 2GMXA 2J50A 1GAGA 1WVWA 2XJ0A 2XNBA 3NGAA 4FGBA 3ZTXA 4DT8A 3BHYA 3D94A 4MXXA 4AQCA 3CCNA 5G1XA 3D83A 2ESMA 4BI2A 1JSVA 5TE0A 4BDDA 2E9VA 3JR1A 3QQHA 5JGBA 3DKFA 4Y8DA 4U41A 2YHVA 3VS1A 3BLRA 5IEVA 4PP9A 1ZYCA 4BDJA 4AOIA 4O0VA 5CNOA 4OBQA 3JUHA 3F5GA 5BVEA 4BFMA 4BGHA 4C3RA 1H28A 2XNMA 2QI8A 4C59A 1E1XA 1IEPA 3LQ8A 4JG8A 5DR9A 2PVRA 4ANLA 4F9CA 4F9WA 3KF7A 4HCVA 4KAOA 1MUOA 3IW7A 3R7EA 2JC6A 4O7WA 1H0WA 4ARKA 5CF6A 4JRNA 1B6CB 1R0PA 2X8EA 1Y6AA 3FKLA 4MAOA 3BQRA 4EK4A 3HMPA 4FKVA 3PJ2A 4EOOA 4TZRA 1KV1A 1OKZA 2G15A 2HCKA 4BKZA 2F7XE 4DC2A 2F7ZE 3VF8A 2C0TA 5IG1A 4RQVA 2VX0A 3ZO3A 4ANNA 4IZ5A 3LXKA 4CGAA 4GRBA 4EH6A 3P08A 2YIXA 1YXTA 1PKDA 2PUPA 3OUKA 4FICA 3Q9YA 3GC9A 3K5UA 2F49A 4FV6A 2B54A 1YDTE 1PXNA 4IZ7A 3MJ1A 4YPSA 4FTAA 2FH9A 3PDTA 4GT5A 5KZ0A 5TKDA 5KBQA 2REIA 4U97A 1FMKA 4AU8A 5GZ9A 2G2HA 4L7SA 1OZ1A 5CT7A 3UP7A 4F7NA 4GCJA 5CI7A 3CC6A 3EHAA 4MTAA 5CXZA 3BU5A 5AP0A 3IGOA 4F09A 4U42A 1PYEA 3DA6A 3IECA 3JY9A 4R1YA 4AZFA 4D4YA 5EM7A 2GQGA 2GS7A 3PIXA 3EZVA 3MYGA 3PYYA 2EB2A 2C3IB 4EJNA 4YC6A 5JZNA 4U3YA 3NUYA 4IX4A 2YEXA 3NUUA 1H25A 5HO7A 4K0YA 2BZJA 4FT7A 4RZVA 4U8ZA 1SVGA 4RVTA 1A9UA 4XG8A 4EOQA 3QWJA 4ANOA 3DBCA 4BCGA 4I5CA 4YJTA 4AZTA 4M13A 4JT3A 4MHAA 3DS6A 4D0WA 2XJ2A 1W98A 3TNIA 4FKRA 3U9CA 4IW0A 5AWMA 4U44A 5C27A 4S31A 3UOLA 4F6UA 4YU2A 5EQYA 1KE7A 2ZAZA 5AP7A 3IPHA 3H0YA 3QCYA 3A7JA 3AC2A 4Z7GA 5IKWA 3NUAA 4U45A 2XK7A 4FVPA 4L00A 4NM0A 3LFFA 2RGPA 1OVEA 4DH8A 4EOMA 2BRBA 2OXDA 4KBCA 3MFTA 5IA1A 4IMYA 5IA0A 1YI4A 2BHHA 3TKHA 2Z7SA 4GFOA 2B9HA 4C2VA 2IVTA 3GU7A 3KK9A 4CV8A 3FMLA 1H24A 4GJ2A 4BDFA 4N57A 1JKKA 2X7FA 5FTQA 5J9YA 5IQEA 2BAJA 4AZVA 4O7VA 4JDKA 3R1QA 3OF0A 4R7BA 4CCBA 3O96A 4OUCA 1U59A 3HX4A 3AG9A 2W5HA 4EK3A 3GNIB 3FI2A 4IM0A 4YZBA 3UYSA 3UVQA 4BDKA 2VWUA 3ANRA 3H10A 4DFXE 4EOPA 4Y72A 3AC8A 2JFMA 4IDTA 4YJUA 4QMSA 4PDPA 3C4WA 4AP7A 3R1SA 3KF4A 5M56A 3II5A 4D4SA 4QMLA 2PUIA 4IEBA 2EXMA 4TT7A 2PK9A 4B9DA 4UMUA 3PZHA 4XG7A 4XRLA 3SG8A 4H3PA 4FKJA 3H4JA 4EHEA 3NNXA 4FYNA 4RG0A 5AM6A 2P3GX 3OCSA 1DS5A 3AMYA 3L8SA 4U79A 3Q4TA 4MYGA 4L53A 3CS9A 3ZU7A 2YAAA 3U55A 3SDJA 3GP0A 4DFNA 3R9HA 5AP4A 4AA0A 3SA0A 2HYYA 4FL1A 4F99A 3NSZA 1M7NA 1UWHA 3OCTA 4PTEA 2X9FA 1ZLTA 4ZTNA 4E7WA 3O7LD 4AW1A 3VW6A 2BDWA 3OTUA 5AR5A 3ZSGA 3QTRA 4OTFA 3UC4A 3W32A 3R9OA 4FTKA 4AG8A 1IG1A 4C34A 1J7LA 5CTPA 3DAEA 4EH9A 4OTDA 5BVNA 5BYLA 2ITOA 5HCYA 3MPTA 4WRGA 3UODA 1OPKA 5CY3A 5E9EA 5CVHA 1OGUA 2YJSA 3PP0A 1Q97A 3R9RA 2VTTA 5TR6A 4BYIA 4EH4A 4EOKA 4MD7E 4J98A 5DGZA 2VGPA 3FZOA 4NT4A 5I3RA 4FTLA 4LL0A 4TYHA 2NPQA 4V05A 5ANGA 4JBVA 4XJ0A 5M53A 4HZRA 5HLPA 2PU8A 3U54A 4II5A 5EDRA 4MXAA 5IQCA 5A46A 3LM5A 2P2HA 3Q32A 2FSMX 4ZTHA 5I3OA 2XIZA 3QTIA 1XH5A 1UU7A 4UYNA 4FC0A 4XS2A 4BCMA 1Y8YA 1OPLA 2I0YA 2R3OA 3ZLXA 4IAYA 3T3UA 5CU2A 4UMTA 4TYEA 5DBXA 4QP8A 3MTFA 3QU0A 5J1VA 2QU6A 4FTMA 2Y8OA 1ZOGA 4IJ9A 2R3MA 4R5SA 3JPVA 5DWRA 3LZBA 1CKJA 3VS5A 4AFEA 4LOQA 3P78A 3PXYA 2X9EA 3QYWA 3VHEA 4A4OA 2WTDA 4D5HA 3BCEA 1H0VA 3OOGA 4RIYA 4PL3A 1JLUE 4FZ6A 1RJBA 2BIYA 3GCVA 1MP8A 2QKRA 2W1ZA 3OEFX 4D2TA 4TYIA 4KIPA 4ITJA 3L8XA 3R9NA 4I1ZA 1BUHA 3B2TA 2OLCA 3MV5A 5JQ5A 2P55A 4IVBA 5B2LA 4BCIA 5BUEA 1TQMA 2I40A 1WMKA 2OXYA 4ZSGA 3IDBA 2E9UA 4EUTA 2EXCX 2XEYA 4XBUA 5FXSA 2G2IA 4XUFA 5H8BA 3IGGA 4XX9A 4H3BA 4BICA 3DJ6A 5GZ8A 4O91A 3E3PA 3AC3A 3Q4ZA 2RFNA 3PJ3A 3DJ7A 4FKQA 2V62A 4EZ3A 4FG7A 3UBDA 4AT5A 2LGCA 3TTJA 5DOSA 3BU3A 3HYHA 3TG1A 3CGFA 1WCCA 1JKSA 3GU6A 3NCZA 3RAHA 3LLAA 1BLXA 3EKNA 4JDHA 3AGLA 4RFYA 3KXMA 3FE3A 4CKIA 5HCXA 4QPSA 1FINA 1OKYA 2ETMA 4O1OA 3WF5A 3V5LA 5DMZA 4YLJA 4O81A 2CNVA 5G6VA 2CNUA 2RFDA 5ACKA 4DFZE 4EK8A 4BZOA 1YOMA 4AZWA 5BYYA 3I5NA 1BX6A 1ZRZA 1W7HA 5TO8A 1K2PA 2X4ZA 3Q4UA 3BLQA 4FSYA 4WIHA 1OBGA 4ITIA 2CJMA 4MBJA 3RNIA 1PXOA 4JG7A 2R3QA 2V0DA 2OFVA 3HEGA 2ITPA 1WBVA 2XM8A 4UXLA 4DGGA 5M4IA 3NUXA 2ONLA 5M07A 5DEWA 4JOAA 2OIQA 4FKIA 5AP5A 2GPHA 4YJSA 5JEBA 5AP1A 5J8IA 2XK4A 2R3RA 1JPAA 3QD3A 2HWOA 4ACGA 3HV6A 4FV1A 3FZSA 3C51A 2R3FA 3O23A 4K33A 5HLNA 2C0OA 2C5YA 4PV0A 3LW0A 3BV3A 3VBTA 2C68A 3OHTA 3RAWA 1TQIA 3RHKA 1IRKA 2IW9A 3VIDA 1OI9A 2WMAA 4FG8A 4Y46A 2PSQA 4KB8A 1VYZA 3NYXA 2Y6OA 4ANBA 4YO4A 3HV7A 4IIRA 3MY0A 1KE6A 4LGHA 2W0JA 4QQ5A 3PXKA 1ZY4A 4QNAA 3MPMA 2DUVA 2X1NA 4YZMA 5FEEA 2XH5A 3ZXZA 2PY3A 4IAKA 3CTQA 3R1YA 4PMPA 1XKKA 4BCNA 2PYWA 3C4ZA 3KULA 3ZRMA 3TM0A 1OL5A 4WUNA 3KRXA 4UYAA 4FUYA 3E5AA 4P5ZA 4ZTMA 3MIYA 5CEMA 4FV9A 5AV0A 3TV7A 4BRXA 2IZRA 2WGJA 1V0BA 3BEAA 3ZLSA 2HZ0A 2IW8A 4Z7HA 1WAKA 3KGAA 5IQHA 1U54A 4BBEA 3Q60A 3OCGA 4O0TA 2O3PA 3G5DA 2JDVA 4F0FA 4AA4A 2C5NA 3A8XA 5K9IA 4FEUA 3HV3A 2XIYA 2OJGA 4B7TA 1G5SA 4QQCA 4FNWA 4BVUA 4RC3A 4TPTA 4GMYA 4I5PA 4X3FB 1H4LA 2E9OA 3FUPA 4LYNA 3SLSA 4CSVA 4NWMA 1LPUA 2GHLA 3L8PA 4J96A 4N4SA 5BVOA 2YJRA 1RE8A 3P9JA 2NRUA 1U5RA 5ETAA 2J5FA 2A1AB 5ETCA 4LGGA 4M67A 2BRGA 4OT6A 3VUIA 1QL6A 3KN6A 2KTYA 4RQKA 4HVDA 5CANA 5LMAA 3PPKA 4RPVA 4CVAA 3WZKA 4FV4A 4X2FA 4J8MA 4RFZA 5CX9A 4FX3A 4J8NA 5AADA 1J7UA 3CP9A 4J7BA 2VO0A 1VZOA 4FL3A 3PPZA 4GV1A 1IASA 4HYIA 3V5QA 3D5VA 4C62A 2HENA 4UMQA 3NS9A 4G5PA 3KREA 1PHKA 2F2UA 4UZHA 3MA3A 2WQMA 3MY1A 3NYOA 3HV5A 4U7ZA 4KIKB 5IUIA 1PXKA 3EQRA 4NKSA 3V04A 4BCHA 2ITZA 4RJ8A 5CAQA 3R7GA 2XKCA 3AD5A 3C0HA 4FV2A 2C6IA 2PVKA 4ZMEA 3ROYA 4D2VA 4DEIA 5I0BA 2ITNA 2WMVA 5M4FA 1LEWA 1W8CA 1QPCA 2RFEA 1L8TA 1WVYA 4N6ZA 4NM7A 2NO3A 1RQQA 5E8TA 4GKHA 2XKFA 4DN5A 1REKA 3I1AA 5EKOA 5M44A 3W2PA 4I0SA 2CKEA 1SVEA 2XBAA 4IB1A 4O38A 5GINE 3ODZX 5EYKA 3ID6C 5DPVA 2WOTA 2X6DA 3LMGA 2O64A 3V5WA 1DM2A 1H08A 5I9XA 2QO9A 2YIYA 3GI3A 4DEEA 4N70A 3A7HA 4MXYA 2HXQA 2WOUA 1G8AA 3RGFA 2OU7A 3A99A 5EH0A 3ZFMA 3ZXTA 4IANA 4WG5A 3DZQA 3EN6A 3Q5IA 4YURA 3AQVA 3EQCA 4YO6A 3G0EA 4FZAB 2WTCA 3ORZA 1OBDA 5E8ZA 4RZWA 4UWBA 4NH1A 4FI1A 4ZY4A 5LCJA 5DIAA 2P4IA 1OKWA 3IO7A 2XB7A 4I93A 3CPCA 4YMJA 4HPUE 2OJJA 4FSQA 4GU6A 4Z16A 4IBMA 4YPDA 3LHJA 5D9HA 3NPCA 4E5BA 3Q9ZA 3ZSIA 5D12A 3ELJA 3KKVA 2C69A 4CCUA 4CRSA 1KOAA 4QP7A 3FMJA 4NFNA 4CTCA 4C4GA 3NNWA 3ROCA 2VWXA 2BROA 1FMOE 4HYHA 1HCLA 3CQEA 3QZGA 3UIUA 3TNWA 4M8TA 3NUSA 3HMIA 1DAWA 5FRIA 4BHNA 2YM7A 5JFWA 4ZIMA 3DXPA 3PVGA 3MWUA 2QODA 4QMZA 4DAWA 2J6MA 3F3VA 3QD2B 2XNEA 5I9YA 2V7OA 2XVDA 3ACKA 3MVHA 4QPAA 3PPJA 2UW3A 4FUXA 4H1JA 5AA9A 4UEUA 4GVJA 3R71A 3V6RA 5A14A 1FVVA 1QPEA 1BMKA 4FT9A 5K5XA 4O7ZA 3E8NA 1ZYDA 2C5OA 2VD5A 4FTJA 3QTWA 4KIOA 5IMEA 5J5TA 4YZDA 4C4FA 3RI1A 2C5XA 4WNOA 2VO6A 3OW3A 3P1AA 4RX8A 4YTCA 4PRJA 5DH3A 3MW1A 4O86A 3GCPA 3QXPA 1QPDA 2C6OA 2WQEA 4IVCA 3V51A 4DH5A 4F70A 3DKCA 2DS1A 4IWDA 3L8VA 4F64A 2GQRA 3O8TA 4JX7A 3B8RA 2BZHB 1UNGA 3FLNC 5FGKA 4YSMA 3V8SA 2CCIA 4YLLA 5KCVA 2EWAA 5DHJA 3O8PA 3BRBA 4Y5QA 4QYGA 3Q3BA 4G9CA 4FNZA 3R2YA 3VNTA 3FXZA 2O65A 3CPBA 1K9AA 5KX8A 1F0QA 4J52A 3W18A 4BKYA 5LMKC 5HIDA 4G6LA 1RDQE 5B0XA 2PUNA 5KMNA 2QURA 2YLFA 2QONA 5JRSA 3UZPA 5L6WL 3D9VA 4U81A 4CFVA 5CVGA 2UZDA 4GG7A 4DG0E 5AUTA 1NW1A 3H9OA 2PVNA 3O50A 4X2NA 2PVHA 4EHGA 2BKKA 3LFQA 1JWHA 4RX5A 1MRUA 2QO2A 4RT7A 4A9SA 4KBAA 3K5VA 3LCOA 4IWQA 3VJOA 2YA9A 1H8FA 2B1PA 4O27B 3ZSHA 4P4CA 3LFCA 3R63A 5HLWA 3HMOA 3BHTA 3TZ9A 4YBKA 2A0CX 5L2TA 2PZRA 3VUMA 4RVLA 1Q4LA 1R78A 5DRBA 1GIIA 5M57A 3QLFA 4TYHB 5FEDA 4LRKA 5JFSA 4ZMFA 4TWCA 3NEWA 2R0UA 4K9YA 4BIEA 2A19B 3EOCA 2XIKA 3UO4A 3V5JA 3U6JA 4EHZA 4KA3A 2J0MB 2OBJA 3ORLA 5CALA 3QRIA 3IW6A 4O0RA 5DG5A 1G8SA 3VS0A 4DINA 1T46A 4NSTA 4ORKA 4L44A 4WOVA 4FTUA 1IA9A 3GXLA 3R7VA 3F2RA 2UVYA 2WIHA 4RIWA 3RMFA 3I7CA 4KIQA 3UNKA 3UQGA 2WMQA 1PMVA 1T45A 3HV4A 1H00A 5CSWA 4FKTA 4FEQA 3OEZA 2J0KA 4IAIA 4QMPA 5FP5A 3LJ2A 5CI6A 3R8MA 3VS6A 4BTMA 2R4BA 4BDCA 5KO1A 3R73A 2I0HA 4X2JA 4RIYB 2HXLA 4G6OA 3AC1A 4EEVA 3CJFA 4AS0A 4IZAA 1ZYLA 4W9XA 3VBQA 2XNPA 2X7GA 3PIYA 4S33A 2RF9A 5A3XA 4WKQA 2B9JA 3B2WA 4YTHA 5BNJA 1H27A 3WILA 2W1GA 3QQFA 4HPTE 3SHEA 1PXJA 3WIKA 3EFLA 1J3HA 4C33A 4C02A 3DAKA 3VAPA 4FT5A 1BKXA 5D7VA 4ZLOA 3SGCA 4RGJA 5HG8A 5CLPA 3A2CA 5KMLA 3PUPA 2GS2A 3CQUA 4FEWA 2PMNX 3RAKA 4AW2A 2XYNA 4BYJA 2H6DA 5T3QA 4G3CA 4L7FA 4Z9LA 5LMBA 4BBFA 3DFAA 2VWIA 2CN5A 4M14A 3F82A 3MVLA 4M69B 3BX5A 4CQGA 2VGOA 4FTOA 2B53A 2PZIA 4Y83A 4TN6A 2XK9A 1O6YA 4JVGA 3QTZA 4HJOA 2W05A 4KBKA 5C9CA 1CDKA 3ORKA 3KL8A 2JKQA 3BYMA 4HGTA 3V8TA 4BN1A 2Z60A 2XRWA 1YWRA 2WD1A 4QD6A 3PTGA 4KKEA 4ZXTA 5E7RA 3ZCLA 1KWPA 2JITA 3DDQA 3R21A 3G15A 3ZDUA 4MCVA 1YXVA 1LEZA 5HG9A 2ZV7A 5JMSA 2G2FA 4DH1A 2WKMA 1XBAA 3AMAA 4R8QA 4XRJA 4YC3A 5HO8A 3LOKA 2LAVA 3WZDA 4BHZA 3CLYA 5E1SA 4E4LA 5DE2A 5BUJA 4S30A 1F3MC 3QF9A 3KXXA 4RFMA 5KKRC 1JKTA 5FD2A 3UYTA 3AGMA 3NUPA 4C36A 4DTBA 2WTKB 2X2KA 3BI6A 5CSXA 2CHLA 3BGZA 4R7HA 3VQHA 3RK9A 1AGWA 5L6OA 4JQEA 1XJDA 1KE9A 2V55A 4ONAA 3ZZEA 2OK1A 2CLQA 1KE8A 4FTCA 4EONA 3R6XA 5CF5A 3HMNA 4E5WA 3P7AA 3P86A 3QLGA 4XH6A 4C4EA 4TTHB 4BTFA 4R5YA 2V5QA 4XG4A 4G16A 1V1KA 4J95A 3QD0A 4ALWA 4PPAA 2QVSE 4AN3A 1VJYA 5CAOA 4CKRA 3PLAE 3KULB 3JVSA 3C7QA 3NDMA 3QRKA 3R8ZA 4EKLA 3SOCA 3HKOA 4ALVA 1M17A 1MQ4A 2QOIA 4W9WA 5C4KA 3QZFA 4IADA 5KUPA 4BCKA 5EI8A 3PJCA 2VU3A 3GB2A 3LM0A 3ORIA 3RTPA 2QOLA 4KIKA 4WSYA 3KFAA 5D7AA 3KC3A 5CYIA 3DB6A 3T9IA 4X3JA 1U54B 2IW6A 3NCGA 5AV3A 3TV6A 3V01A 3FSFA 3FV8A 3UDBA 3WF8A 3NW6A 2R64A 3ULZA 3VULA 5CNNA 5JK3A 4ZZNA 5HTIA 2GU8A 3F5UA 2WELA 4W4VA 2DQ7X 2XS0A 5H3QA 1JVPP 5KHXA 2JDOA 1YWNA 3QZHA 2FUMA 3TZMA 4ACHA 4D4VA 1GZOA 5EQPA 1PY5A 4GL9A 5EI6A 5BUIA 4Z3VA 2B7AA 4NFMA 2IN6A 1M7QA 3NZ0A 2O2UA 2J0JA 3UNZA 2C47A 1Z9XA 3OW4A 3IQ7A 2GSFA 2QQ7A 4KSQA 4XG9A 4BGGA 3HRCA 3ZEWA 4ZK5A 2GQSA 5FWKK 5F94A 4FGRA 3KMWA 4WHZA 4IB0A 3BYVA 5C01A 2UZNA 4DGLC 4YJPA 4AGCA 3BIZA 3FSKA 3FPMA 5BVFA 5EQEA 3IOKA 2VTRA 2VV9A 2QG5A 4ZSLA 3IG7A 3WI6A 1PKGA 2A2AA 5HBEA 3HAMA 1CTPE 3EQGA 3IKAA 3MJ2A 1CKPA 5LVOA 3CD8A 3GC0A 3TNHA 4IQ6A 2BDJA 2OJFE 2W4KA 3EQFA 2FYSA 3UVRA 2JGZA 5CEQA 3PJ1A 4YNOA 4CZTA 4EWHA 3TUBA 5EOLA 5H8EA 4MBLA 2ZV8A 3D15A 3GT8A 4MVFA 3FY0A 3PIZA 3MH0A 4E1ZA 2Y4PA 2ZOQA 3RKBA 2IVVA 5JZJA 5BYZA 4QYYA 3EN5A 2Y4IC 3HZTA 2Z7LA 3RPYA 1ZYSA 3QX4A 2E2BA 4GK4A 5AFVA 4EBVA 5IISA 2R3IA 1P4FA 5DI1A 3MVMA 4HVSA 3DFCB 2OXXA 3GGFA 3WZJA 5FTGA 3PSBA 4UMRA 1B39A 1NVQA 4AXAA 3OS3A 3SKCA 2CGVA 4LV5A 2CKOA 5F95A 1YI6A 5EM8A 2ITVA 4ZTRA 2C3LA 2PMIA 4NU1A 3F66A 3E8CA 3RWPA 5HO6A 4KNBA 3REPA 5EYMA 1PYXA 3EJ1A 4X3FC 5AR2A 1PXIA 3ZS5A 2WEIA 4O0UA 4S34A 5B7VA 4LGDA 5IEXA 4RX7A 5K0XA 2GNFA 3NYVA 5HE1A 2RG5A 2QOCA 3IW8A 3W2OA 2P0CA 3QBNA 4DEGA 4O7YA 3NW5A 5KZIA 4JXFA 2ZVAA 3O7LB 4I6BA 4YZCA 4AAAA 4CFNA 2BIKB 4DG3E 3WIGA 5AP6A 3Q9WA 3PWYA 4YNEA 4H05A 4B99A 3CE3A 4LG4A 2W1IA 2QOKA 4OR5A 3COKA 3FI8A 1V0PA 4TW9A 3ODYX 3KXNA 3LXNA 1Z57A 3OFMA 3TWJA 2R7IA 3C5UA 3T3VA 1A48A 1NXKA 2UUEA 4P5QA 3W16A 4C58A 5M06A 4OAUC 2R3LA 2BMCA 1BYGA 1Q41A 1UWJA 3BEGA 4I5HA 4YBJA 5ETFA 4DGOA 4EOIA 3QHRA 1Y8GA 4XV9A 3MFSA 2I0VA 3QGYA 4OTWA 4PUZA 1W82A 3DOGA 5E92A 5IQGA 2BHEA 4K6ZA 2C6KA 4LI5A 4O0YA 4ZTLA 4AN9A 3NIZA 2W1DA 4TWNA 4WD5A 4XP0A 3R02A 5J9LA 2YZLA 4TL0A 4JS8A 3D2KA 1UKHA 3BE2A 2BRMA 4AGUA 3CTJA 3HAVA 1ZMWA 4U5JA 3BYSA 4FKWA 4GIHA 4GSBA 4C57A 3UQCA 5AAEA 4MXZA 3DBEA 2YZAA 5F1ZA 4FE2A 3PY3A 5D10A 4PY1A 2VRXA 4FV0A 3COHA 5AR8A 3FMHA 4WBBB 4A7CA 5I9VA 3H0ZA 5EW8A 4C4IA 2C6LA 2C6TA 1KE5A 3PFQA 4DGMA 1BI8A 1OB3A 3I4BA 4LMNA 1F5QA 2VUWA 3KK8A 5CVFA 3EN4A 3OVVA 2EB3A 3E64A 3FL5A 3ZHPC 4BY9E 4OLIA 3OBJA 1BL7A 2WTIA 3IOPA 3QZIA 4ACMA 4KS8A 5I9WA 5IDPA 1Q3WA 2YFXA 3M1SA 3F3ZA 5HIEA 2VWVA 2VTIA 3QRJA 1P14A 3UTOA 3TNQB 2YIWA 3C13A 4XNEA 1WBTA 3S1HA 4FSNA 4RVMA 2CCHA 2XCHA 2ITYA 3JXWA 3W8LA 2ZDTA 3QALE 1SNXA 1OIQA 5D11A 3PVBA 3V3VA 1I09A 2GNHA 4FG9A 4GVAA 4DA5A 4X21A 2OIDA 1JQHA 3MN3A 2RIOA 4H58A 5A6OA 2FSOX 3FKOA 3QQUA 4FF8A 2VO7A 4KKGA 1WBSA 1YWVA 4EQMA 2XNNA 4V01A 4ANQA 2JDTA 2XBJA 4AOTA 5KMOA 5B2KA 5FXQA 5L8JA 4WRSA 4PL5A 5ANDA 2Y7JA 5AUXA 1JOWB 4FNYA 2O5KA 1IAHA 4R78A 2OW3A 3ZZWA 4ZS0A 4M7IA 4QT1A 4MNFA 3RALA 2BAKA 5EM5A 1ZMUA 2QKWB 3FZRA 3GCUA 4EYJA 4G3GA 3THBA 4BTJA 3FYJX 4FODA 4F6SA 2IZSA 4TNBA 3R9DA 5IPJA 4NW6A 2C3JA 5CWZA 1ZOEA 3ET7A 1Q8UA 1H26A 2YCFA 3IW5A 3JYAA 5ANOA 4G3FA 2ZMCA 4NCTA 5CZHA 3F3UA 4RJ4A 4AE9A 3UMXA 2GNJA 4JAIA 3KCKA 2HZNA 4FSUA 3PA3A 4JLCA 2OI4X 4E4MA 3TUDA 5DNRA 2VWZA 3BBWA 3GFEA 2PULA 4UV0A 3UQFA 2PVFA 3TT0A 3QA0A 3NIEA 4GFGA 3ORMA 4G31A 4ZP5A 4RIWB 3ORPA 4FSWA 4M69A 4YZ9A 3VVHA 2CKQA 3O8UA 4M3QA 4BWKA 4LL5A 4XLVA 2J2IB 2PMOX 2BRHA 3HUCA 4ALUA 3VF9A 2F7EE 2PE2A 2SRCA 1FGIA 4NTSA 5E8UA 5AIRA 3LLTA 3DV3A 4JDIA 3TZ8A 2EUFB 4P90A 4M0YA 4GYGA 2RSVA 3TUCA 1YOJA 4I24A 4RC4A 2WMSA 1S9JA 2XM9A 5M55A 4C37A 3DTCA 2ACXA 3I6WA 3EL8A 4FSRA 2W1EA 4GFMA 3PXQA 4F4PA 1OUKA 3PE1A 2PMLX 3F5PA 1WBPA 4GK3A 5AV4A 3OBGA 4QNYA 3FL4A 3HLLA 3PP1A 4G1WA 5H8GA 4CQEA 4EHVA 1YRPA 2QOHA 3O17A 1ZOHA 4QMXA 4B0GA 3DY7A 3F9NA 3UPZA 4WNKA 4DT9A 4NK9A 3NVKI 2W99B 2ZM1A 4EI4A 4FT0A 3BPRA 4O6LA 5E91A 5JQ8A 3N4TA 3DK7A 4YC8A 3BWFA 3A7FA 2VTHA 3R2BA 5AR7A 4F9YA 2X8IA 3BKBA 5HHWA 3G6HA 3OWPA 5AUZA 4DLIA 2G1TA 1U4DA 3GU8A 4A9RA 3ORTA 4TKSA 3KY2A 3FHRA 5DT0A 1JSTA 1PMEA 3LFNA 5AR4A 3GU4A 1Y6BA 3FLWA 3HP5A 4U43A 4BZNA 4UB7A 4MXOA 2WMXA 4QP9A 5AUWA 4UX9A 3DTWA 2CNQA 3C4FA 3TDWA 1SZMA 1XWSA 3DXNA 5CEKA 2JAVA 4QO9A 5IQFA 4N6YA 2R3NA 3HP2A 3W2SA 3RK7A 4P2KA 2YN8A 2VWWA 4FOCA 4AE6A 5M4UA 5J1WA 4OTGA 3LFSA 4L9IA 2GHMA 2VTPA 3R0TA 2XMYA 4IACA 3JS2A 4IFGA 4D1ZA 4FTRA 4FYOA 4TYJA 5BMMA 3E88A 2Z8CA 3PSCA 4AT4A 4IX6A 2GNLA 3KMUA 5AMNA 4LRMA 5CT0A 5HGIA 1VR2A 3OWLA 4A06A 1Q99A 3UO6A 3KA0A 2Q0BA 4K77A 4BZDA 3KRJA 3MH2A 5L2SA 4C7TA 1JSUA 5C1QB 2R3PA 3A62A 4JIAA 3SW4A 3GBZA 5A4TA 5FP6A 2OIBA 3PG1A 3FKNA 3SXSA 3VBWA 5IEYA 1L3RE 5FUTA 2R3HA 4ZTQA 4EH5A 3VUGA 4XG2A 5DT4A 3ZUVA 4XMOA 5L8KA 4JR7A 5E8VA 4XOZA 4OBPA 2IZUA 2ITTA 3PWDA 3UPXA 2YM3A 3FZTA 3LAUA 2XJ1A 3QTUA 3DBFA 4O84A 4MF0A 4OW8A 4RA4A 3F69A 4E8AA 4XV2A 4PP7A 2YM4A 1APME 1VYWA 1OIUA 4FKGA 5HG5A 4EUUA 4GKIA 4FK6A 4HGLA 4FTTA 4JQ8A 3F3WA 3DLZA 5CS6A 3QTQA 2ETRA 1H1SA 4XG6A 4GJ3A 3TJDA 1URWA 3SQQA 3EYHA 4PQNA 4BCQA 1UU8A 1DAYA 1OL6A 3FMNA 4YGAA 3EZRA 3QA8A 3EL7A 4BDBA 3E62A 3KU2A 4RVKA 4U0IA 5FLFA 1GZ8A 2XIXA 4I0RA 4FOBA 4PNKA 4FVQA 3LJ1A 1PMNA 2ONLC 1Q24A 1OITA 2OF4A 4A9UA 5AP3A 5AIKA 5K3YA 2G9XA 4USEA 1XH4A 5EHYA 1GOLA 2B9IA 2ITXA 2V22A 1Q8YA 5GZAA 2E9PA 2VX3A 3BLHA 4DTAA 5JT2A 3VRZA 3WF6A 3NNVA 1UNHA 5KNJA 3ANQA 2CDZA 5HCZA 2HK5A 3VS4A 1R39A 2VNWA 2GFCA 5ANKA 2WTKC 4WBOA 3V6SA 4IC8A 4LOOA 1CKIA 4JIKA 5I9ZA 5E4HA 1OPJA 3H9RA 3L9LA 3C0GA 5IQDA 5CEIA 4FTQA 4RJ5A 3WF7A 3QUEA 4F1MA 5BX0A 2HW6A 2VTQA 1Z5MA 5AR3A 1NY3A 2P33A 3WBLA 3I81A 2XNGA 2IG7A 1O9UA 2X6EA 4JAJA 4NIFA 5M08A 1YHWA 3BE9A 4EC9A 4MKCA 1ZZ2A 3SD0A 2WXVA 4I5MA 3G6GA 5AUYA 3TKIA 3ATTA 4E20A 4CYJA 3U4UA 4W8EA 4FTIA 2GS6A 5E90A 2IO6A 5JFVA 4XCUA 4L42A 5I9UA 3ZO1A 3GQLA 4LUDA 4AZSA 2ZV2A 4I4FA 3AMBA 3TTIA 3UP2A 5C03A 4FKSA 2I7QA 3ZH8A 4O1PA 4YJNA 3QQGA 3VO3A 2CKPA 3SG9A 2UW7A 2W96B 2ZV9A 5GJFA 4F63A 4OTHA 1YXSA 4KUJA 2W1FA 4I6FA 3OWJA 2HAKA 2R0IA 3RNYA 2XK3A 4HVGA 4ZS4A 3EMGA 4K18A 2EVAA 3GFWA 4NKAA 3COIA 4E3CA 2JKOA 3PRIA 1YQJA 3ALNA 4NYEA 4BBMA 3SXRA 4BB4A 1XO2B 2UW6A 3ZC6A 3A4PA 3QC9A 4U80A 3H30A 3DPKA 4IFCA 4D2WA 3E87A 1J91A 3F88A 4HZSA 1H1RA 4QRCA 1PXMA 3HECA 2YWVA 1JNKA 3OXIA 1YDRE 3ITZA 4OBOA 3KN5A 5HICA 3KMMA 4DBXA 2FGIA 3B8QA 4XYFA 5IMXA 2NNWB 5C26A 2PE0A 4K2RA 2XEZA 3ZMMA 4ZJIA 2GCDA 3F61A 1W83A 5K4JA 5E8YA 4C3FA 2X8DA 4L3JA 5BVKA 3HL7A 3QTXA 3HGKA 3E93A 3F2NA 2FVDA 3QCQA 4QYFA 3R7IA 4O0XA 4ZAUA 3PY0A 5LWMA 3G0FA 3NW7A 3DU8A 5EW3A 3OG7A 2YERA 2VZ6A 3DJ5A 4CMOA 4CT1A 5E8WA 3MBLA 4MWIA 2HZIA 3AT4A 2OICA 3Q2MA 5HOAA 3ZLWA 5IDNA 3NX8A 3RPVA 2J0LA 3HRBA 2WMWA 2C3KA 2IZTA 3FMDA 4QP4A 3UG1A 2GNIA 4ZOGA 3OZ6A 5D41A 4FKLA 3LE6A 4F1OA 3UOJA 4AOJA 4K8AA 5JN2A 5J79A 1HCKA 4A07A 3F7ZA 1FQ1B 1MRYA 2BILB 3HA8A 3VS7A 4QQTA 1R3CA 2VTOA 3K3JA 4E4NA 3UZTA 4XEYA 1GNGA 4IB5A 3L1SA 1XQZA 4PX6A 3HMMA 4EC8A 5GIPE 1RW8A 2BKZA 5EHOA 4QYHA 2BFXA 3I60A 3UOHA 4RSSA 3DGKA 1JKLA 4I23A 2JEDA 2CGUA 2PVYA 3LVPA 1CMKE 4W4WA 3EQPA 4RLKA 4AN2A 1HOWA 4Q9SA 4ASEA 5JH6A 3SC1A 1LUFA 4CFWA 3KEXA 4G17A 3ZO4A 2XKEA 3QD4A 3OWKA 2BZIB 4HYUA 4MD8E 4USFA 4H39A 4C2WA 3FMMA 3LCKA 4KRCA 2JKMA 4CRLA 2ERKA 3TI1A 4S2ZA 5HVYA 5BQ0A 4QTDA 2W1CA 3GOPA 1MRVA 1YW2A 2W1HA 3HUBA 3ZEPA 5J7HA 1ZYJA 5ANEA 5LQFA 3CIKA 3OOMA 4FIJA 4MWHA 5DN3A 3PVWA 5AX9A 1JBPE 2WMBA 4QTBA 2O0UA 5I4NA 3QUDA 4G34A 3UIXA 4BIBA 3FAAA 3W33A 4K1BA 3BV2A 3CR0A 3BYOA 3I7BA 3RWQA 2UZVA 2WU7A 3KB7A 1SYKA 3CKXA 3RPSA 4EH7A 2PPQA 2VTSA 3ZRLA 2IVUA 1CM8A 3E8EA 5K0KA 4I22A 3NRMA 3EIDA 3MIAA 3EN9A 2OJIA 4G3EA 4JBOA 5EK7A 5HORA 2QG7A 1Q3DA 4L43A 5EYDA 4EH3A 2Z7QA 4AW0A 1UV5A 2AC3A 4DFBA 1M52A 2X2LA 3FZPA 2C1AA 3OXZA 4PDOA 4FZ7A 4Q2AA 4YTIA 3U8WA 5CAVA 3KCFA 3CBLA 3RVGA 3PA5A 3HVCA 2CGWA 2PZPA 4TY1A 4C61A 1E9HA 4DTKA 4OT5A 3OT8A 5TOZA 5HTBA 3FLQA 2Q83A 4M15A 1PF8A 1WZYA 3P5KA 5DVRA 2JBPA 3EFKA 2YCRA 1QMZA 3VBYA 2J9MA 4W4YA 4CFFA 3S2PA 3QWKA 4RJ7A 1NVSA 3QRTA 3VW8A 5HVJA 2UZTA 4E93A 5TF9A 1BI7A 1ZARA 3ULIA 5DLSA 4FV5A 4L45A 1P2AA 3K54A 5IU2A 3U6HA 3A60A 3KVWA 4YJVA 5CSPA 4GT4A 1FOTA 4D2SA 2H8HA 5F4NA 4O82A 4YHFA 1VEBA 2VTMA 4GUBA 3TDVA 4QMVA 2C4GA 4RIXA 3G9LX 4XV3A 3DZOA 5D1JA 3AC5A 3D5UA 4U6RA 4IWOA 1YI3A 2X39A 3RINA 4ERKA 5LVLA 1ZY5A 2QD9A 3WYYA 4GT3A 3AD4A 5AM7A 4M97A 2UV2A 4BI1A 3OXTA 4MEDA 1TVOA 1O6KA 3VN9A 2AUHA 4Q9ZA 4D0XA 1A06A 2QR8A 2VWYA 4HGEA 4PTGA 1IAJA 3OP5A 5ITAA 3PXRA 3MTLA 3R7YA 5CAPA 3I79A 3EB0A 4CG8A 5IUGA 2YABA 2IPXA 2XZSA 5T68A 1R0EA 4YHJA 4C0TA 5HQ0A 3L9MA 4DGNA 2B4SB 3AT2A 3N9XA 4USDA 3ERKA 4H36A 5ICPA 4M0ZA 1OL2A 2QHNA 3KVXA 1KV2A 4KWPA 4BGQA 2UVZA 1NT2A 4X7QA 4XBRA 3RCDA 3TXOA 4I94A 3LQ5A 5F9EA 5DFPA 5JRQA 4DCAA 4EK6A 3FBVA 3T9TA 2YCSA 4FL2A 5AAGA 4M68A 3GCQA 4PDSA 2EXEA 4H1MA 2FB8A 3EN7A 2YM6A 3C5IA 5DYJA 1PJKA 2QHMA 3F6XA 3DKOA 5HBHA 3AD6A 2QU5A 4M84A 3D2IA 2Y0AA 3V5TA 4ASDA 3OROA 5KE0A 2OZOA 4IHPA 4V0GB 4BI0A 3PRFA 2PTKA 3SV0A 2XUUA 3AC4A 3R83A 3GC7A 2ITQA 3TZ7A 5HG7A 4A4XA 4FSTA 1X8BA 3NWWA 5EW9A 4AWIA 2XF0A 3EFJA 4MF1A 3VBVA 4NJDA 3LCDA 4ZZOA 3MY5A 4IH8A 2PVMA 4L67A 4CYIA 5IH6A 5L2IA 5LOHA 2JBOA 4O7RA 4PMTA 1KUTA 3SOAA 4LQMA 3QX2A 5E1EA 3DK3A 5M09A 5IA4A 3KXZA 5CU6A 3TKUA 3IK3A 4FIEA 3VUDA 2F57A 3R00A 5DEYA 1H1PA 2EU9A 4L8MA 3TJCA 3EQDA 4D9UA 4I20A 4C4HA 3FZ1A 2WEVA 2CN8A 2OJ9A 1SM2A 3C0IA 2I1MA 3QL8A 1XH8A 2XIRA 5AAFA 4A4LA 1ERKA 4V04A 2GTMA 5TT7A 3M2WA 2HZ4A 4ZEGA 3C4EA 1W84A 3QHWA 4L01A 3W2CA 4CEGA 3FQEA 3DBDA 2FSLX 3PZEA 5HI2A 3ORNA 3CJGA 2BUJA 1XR1A 1J1BA 2P2IA 3ACJA 3ZC5A 2BPMA 4E6DA 3FQSA 3ZFXA 5ANJA 3AOXA 4DH3A 5FXRA 2C1BA 4FSMA 3O51A 4JI9A 4LRJA 1AQ1A 2H9VA 4FV7A 5A4EA 4E6CA 4RWJA 5AA8A 4EYMA 3DCVA 3UOKA 4DFLA 1YOLA 1WBOA 4D1SA 4CFXA 2XYUA 3MB6A 4Q5EA 4DBNA 5EHLA 4AGDA 3CY2A 1Q8WA 4J1RA 1GZNA 4GG5A 4KS7A 3CXWA 2CSNA 3FHIA 3ZONA 2RL5A 2R3JA 4AX8A 1DI9A 2JIUA 1LP4A 3O2MA 3R28A 4C8BA 3UZRA 4F1TA 2BZKB 4IM3A 4YTFA 4D4RA 3E7OA 3FLZA 3OCBA 3Q4CA 3R7UA 2JDSA 3ZBXA 5C8KA 3C9WA 2PVJA 2BALA 2YWPA 3EQHA 4O6EA 5BPYA 4DCEA 4GYIA 4CD0A 3DQXA 4I0TA 4PWNA 2X7OA 3GOKA 3QQJA 4G3DA 2QLUA 5KMKA 4MH7A 5KHWA 3L9NA 4IZYA 4FK3A 3UMWA 3EH9A 4WUAA 5CF8A 3UO5A 5FM3A 4O21A 3HA6A 5L2QA 4CLJA 2O63A 4EH2A 3FMKA 2X2MA 1KOBA 3S00A 1Q5KA 3QCXA 4PL4A 4Y5HA 2IJMA 4WG4A 2JAMA 3SAYA 3Q04A 3BHVA 3QXOA 4DYMA 4EOSA 4GS6A 4D1XA 4E26A 2FSTX 4CMUA 1OM1A 4DG2E 5L2WA 3QCSA 1IR3A 1ZWSA 2WAJA 4NIFB 1H01A 4F0GA 3VWAA 1UVRA 3MPAA 2OZAB 5K4IA 2UZWE 5ACBC 2WMUA 4TWOA 5FBNC 3UC3A 2PL0A 4LM5A 1GY3A 5EKNA 2R3KA 5CF4A 4ZY6A 4FIIA 4BDGA 4LOPA 3VUTA 3LFDA 4UMPA 1M2QA 2H34A 3QKMA 3RZBA 4NM5A 4F7SA 2UZUE 3FDNA 5E8SA 1M2RA 1UU9A 4JG6A 4JNWA 5K5NA 3TCPA 4F9BA 2VWBA 4EWQA 1R1WA 3KXHA 4J71A 5A4CA 5FTOA 3QQLA 4CZYB 2YIQA 2UW9A 2WFYA 4B8LA 2OH0E 2IVSA 3LFEA 4RX9A 4FKUA 4BTKA 4FEVA 3TL8A 2HELA 3SW7A 1GJOA 3DQWA 4GIIA 3LJ0A 4HVHA 4IE9A 3UNJA 2VTLA 4R1VA 4FR4A 4IDVA 1GZKA 5JSMA 2J7TA 4OTPA 4YUQA 5KBRA 2XK6A 3OT3A 4ENYA 3TN8A 4ERWA 4Z55A 5HX8A 4WG3A 1M14A 2G01A 4RJ6A 4ASZA 2C0IA 1QPJA 3QUPA 4I6QA 2BRNA 1YXXA 4GU9A 4IVAA 4EQUA 4QP2A 4CMTA 4AFJA 2W06A 1P5EA 5HU9A 5IH5A 2B0QA 4GEOA 1Q8TA 1OL7A 2R5TA 3FLYA 3VRYA 4CT2A 3BYUA 2W4JA 3MGYA 4CLIA 2X4FA 5HNIX 4HGSA 2IWIA 4NUSA 2UZEA 1XBCA 2WTVA 3U9NA 2WQOA 2YIRA 4KRDA 5CENA 4ENXA 4F65A 4Y73A 5M51A 2WIPA 5FDPA 1G3NA 3W2RA 5IQAA 3CGOA 4LUEA 4DEBA 3FPQA 3VS2A 1GIHA 5HIBA 4PTCA 4BR3A 3SRVB 3ZUUA 2YLEA 3Q96A 3ZLYA 4JX3A 4KABA 3LXPA 4O2PA 2BAQA 3EYGA 4CFUA 1FVRA 3LQ3A 4EJ7A 3UIBA 2HY0A 3VBXA 5EFQA 4DEHA 1XH6A 3OC1A 2XRUA 4QMYA 4EK5A 1ZAOA 1LR4A 4L52A 3KQ7A 5LVNA 3A61A 4R6VA 4GW8A 2YDKA 2GDOA 1FGKA 3G90X 3FXWA 2VO3A 3FC1X 2WQBA 3FXXA 1YHVA 2PVLA 4JDJA 3U51A 4FKOA 3PJ8A 4WSQA 3W1FA 5IF1A 3CKWA 4MXCA 3RHXA 5IA2A 3A7IA 3S0OA 3GEQA 3RJCA 2OKRA 4F9AA 2JIVA 2WTWA 5IUHA 2QCSA 3U87A 5KKRB 1TQPA 1XBBA 5L3AA 2XA4A 1STCE 4JBPA 4PMMA 1PW2A 3RAIA 4IAAA 4F08A 3PG3A 3OUNB 1UNLA 3PA4A 3U4WA 4PDYA 1H07A 4FIHA 3OD6X 4AGWA 5CASA 4WT6A 1Y91A 4QP3A 1U5QA 2PZYA 5CAUA 5IZFA 4NEUA 4QMWA 2XCKA 4QMMA 4EQCA 3DXQA 2JDRA 3D7TA 2ZMDA 4PPBA 4C3PA 4JRVA 3GENA 5GNKA 2YDIA 4I41A 2WB8A 4RWIA 4QP1A 5HE0A 2VAGA 4I21A 3IW4A 3MSSA 1URCA 4YHTA 5HEZA 4UN0C 4DF3A 3IS5A 5EDQA 5HBJA 3Q6WA 1M2PA 1O6LA 1YXUA 1OECA 4EKKA 5FEQA 2WHBA 3HNGA 3QC4A 3LCSA 2F4JA 4J97A 4UY9A 3GVUA 3D5WA 2V7AA 2FO0A 2X81A 4MD9E 5H2UA 5AUUA 2UW8A 3HRFA 3KXGA 3C4CA 2B9FA 2QOQA 2JD5A 2O8YA 2ZYBA 3WZUA 4D28A 3D0EA 5IQIA 2HWPA 3VUHA 5GJGA 5CZIA 4BDIA 3N4VA 5IQBA 5H9BA 5LXMA 3SVVA 4D2RA 2J4ZA 4L6QA 4PPCA 4YP8A 3PSDA 4BWPA 5HU3A 2WTJA 2CLXA 3CY3A 3GCSA 3MFUA 4XHKB 3W2QA 3MVJA 3UVPA 2R3GA 3QAME 3ALOA 3MA6A 4M66A 5HZNA 3FJQE 5BVWA 2BCJA 4NJ3A 4XV1A 3A8WA 2X0GA 3P7CA 4HCTA 3MS9A 3RBWA 3Q2JA 3E7VA 4I92A 3QQKA 3Q9XA 2J51A 2GFSA 4HNIA 4HYSA 4I6HA 3FC2A 4AUAA 3LMIA 5HTCA 3QRUA 3BHHA 5E8XA 4FBXA 3RPOA 3S95A 2PHKA 3EKKA 3W55A 3VUKA 2BTRA 4YLKA 4XP3A 3RM6A 3PY1A 2ZJWA 3Q6UA 5ANIA 2W9FB 4EBWA 4DH7A 1ATPE 3RCJA 4IWPA 2W17A 3QKKA 4RIXB 4R7IA 3ETAA 4AA5A 4F6WA 2UZBA 4RBLA 4YR8A 3C4XA 3EFWA 3W10A 4TXCA 1FVTA 4W4XA 3MI9A 3FY2A 4FV8A 5JGDA 4FMQA 5GJDA 4AACA 3C1XA 4ANMA 4V0GA 3OTVA 2PWLA 4FT3A 4QOXA 3VC4A 3I6UA 4QMNA 3L9PA 5IH4A 4TRLA 4NL0A 1SVHA 3I0OA 3R04A 3GC8A 3R1NA 1REJA 4OTIA 3WE4A 1UKIA 2Y4IB 5ETIA 3RP9A 4F7JA 3LPBA 3NMUF 1W0XC 3IONA 4O7LA 4J53A 5HKMA 2OF2A 2YDJA 3D14A 3D5XA 4MX9A 2R9SA 2NP8A 2A27A 3VJNA 2UW4A 2OWBA 2ZDUA 4MNEB 3K2LA 2W5AA 4QPMA 2WMTA 3D7ZA 2WO6A 1JAMA 3BBTB 4E6QA 4MQ1A 3SXFA 1V0OA 3M42A 1PRYA 4Y85A 3KRLA 3ZRKA 4XP2A 1SNUA 4BDEA 4IX5A 5A4LA 3RPRA 2I0EA 5HX6A 3P0MA 4RLLA 2W4OA 4APCA 1ND4A 3ZFYA 4NCTC 1K3AA 2OFUA 5A9UA 4G5JA 2Q0NA 4U3ZA 3KRRA 4UWYA 5EG3A 5LVMA 3RK5A 4O2ZA 4L3PA 3DNDA 2OGVA 2DYLA 4FZDB 4E4XA 4CZUA 3FEGA 4HNFA 1WFCA 2F2CB 4MK0A 5DR6A 2VX1A 4C4JA 4ZLYA 3MDYA 3R22A 3IDPA 2YCQA 1WBNA 3DAJA 4KD1A 4ACCA 4DEAA 4XLIA 4EZ5A 4BWXA 3E63A 4B6LA 4JQ7A 3CQWA 4C38A 1XH7A 2DWBA 4L68A 3OY3A 4DFUA 2QR7A 5DRDA 4NW5A 3TNPC 4C35A 2OH4A 3H9FA 5EYCA 3AXWA 1S9IA 3D4QA 3KRWA 4IM2A 5LMKA 4CFMA 2WMRA 3E92A 4UALA 4IAZA 2J5EA 2HIWA 2ITWA 4GK2A 5CU4A 5AV1A 2YISA 2OO8X 3G33A 1ZXEA 4IB3A 5A6NA 4CKJA 3JVRA 5CQWA 2YM5A 1GIJA 2YM8A 4FNXA 3DB8A 4ZLZA 5HESA 4FTNA 3PE2A 3NR9A 3DKGA 3WF9A 1UU3A 4IXPA 3BGPA 3OMVA 3POZA 4IAFA 2OG8A 2VTAA 3UIMA 4O7SA 4PMSA 4IJPA 4DHFA 5JFXA 4EOJA 4BDAA 4OGRA 3E3BX 3ATSA 3F5XA 1J1CA 5AP2A 5BVDA 5L6PA 3ZM4A 4QMQA 3BQCA 5EDPA 3WOWA 4ZY5A 2FA2A 4M12A 1XH9A 5LJJA 4QTAA 3V5PA 1FPUA 3ZOSA 3F3TA 3FLSA 3FYKX 1E1VA 1EH4A 2JLDA 2OZAA 4KKHA 3G51A 4QTCA 3SX9A 3W8QA 4OAVB 3ZM9A 3TIYA 1UA2A 4FZFB 5T6KA 5HD4A 4WO5A 4N0SA 3QYZA 3CD3A 1WBWA 3LIJA 4JJRA 3FMEA 3R8PA 2WZJA 2Y6MA 4W8DA 1DI8A 2PE1A 4D9TA 4O83A 3FQHA 5J87A 4E73A 5I5ZA 1U46A 4FIFA 5KMJA 3NUNA 3DLSA 4ZSEA 3NVMB 2AC5A 2W7XA 4E6AA 3H3CA 5FG8A 1J7IA 3UJGA 2QOOA 4TYGA 4WNPA 3ZUTA 3ZDIA 3C50A 1PMUA 4R3PA 4ANSA 4ZSAA 2QO7A 3PLSA 1PXLA 1KSWA 4BCJA 2H96A 2JKKA 2VTNA 2BDFA 5AEPA 4G2FA 4L3LA 2KULA 4F0IA 2BTSA 3G2FA 1NA7A 4BC6A 1SMHA 3Q5ZA 4D55A 4IC7A 4QP6A 3MFRA 5KMMA 1OKVA 4LV8A 4JR3A 4R3CA 5J5SA 5A4QA 3MH1A 2W5BA 3QFVA 2CPKE 2Z2WA 1ZZLA 3POOA 2J0IA 2GTNA 4PF4A 5J9ZA 3HDMA 5GIOE 4FV3A 4S32A 4UXQA 1B38A 4FEXA 3A7GA 5AX3A 1FBNA 2C5VA 3WE8A 4LFIA 1OUYA 3NNUA 5IA5A 4BCFA 4HW7A 5BMSA 2A4LA 3HDNA 3GUBA 3K3IA 3R7OA 4D58A 5J95A 4JL9A 3RM7A 4TNDA 3JY0A 4X2GA 5C8NA 4FSZA 5B2MA 5LCKA 3S4QA 5KMIA 3CSVA 2C6EA 4ZJJA 4AW5A 5IA3A 4EOLA 2BVAA 3PVUA 3SRVA 4GUEA 4DITA 4YJRA 4KINA 5HNGA 2RKUA 3P7BA 4LMUA 4U9AA 2F9GA 4G9RA 3QGWA 5EI2A 5HE2A 2GNGA 2NRYA 3ORXA 5LARA 4OTQA 2OSCA 4P7EA 3DT1A 4HOKA 3DK6A 3P23A 5JGAA 3CTHA 3F7WA 2QC6A 5FBOA 4RIOA 3R30A 3MB7A 2WPAA 4WA9A 4D2PA 3MESA 4O7NA 3DDPA 4WNMA 3EWHA 2JFLA 1YHSA 2QOFA 4G6NA 1PXPA 3P4KA 3N4UA 3BHUA 3LFAA 5L8LA 4BIDA 3T8OA 3QTSA 3AT3A 4BDHA 3LKMA 2ETKA 5HE3A 4FIGA 5C4LA 5CU0A 3O0GA 4L46A 4E5AX 4ZTSA 5L4QA 4QQJA 3RZFA 4B4LA 4R77A 2I6LA 5FDXA 2UZOA 4O7TA 2WQNA 1OMWA 1Q61A 3I0QA 3R8UA 3TV4A 4ZSJA 4YZNA 4HVIA 5A54A 2Y9QA 4DLJA 4NZWB 2HOGA 1Y57A 2ERZE 3BU6A 4UBAA 5J7BA 1OL1A 4X6QC 1CSNA 2HY81 2UW0A 3GU5A 4ITHA 4O22A 2E9NA 2YAKA 3QKLA 4RWKA 3I5ZA 4H3QA 5CXHA 4D5KA 5F20A 4ZZMA 2VNYA 4NTTA 1OIRA 1QCFA 2XK8A 3FI3A 3TACA 4BKJA 3CEKA 4CNHA 4R3RA 4CV9A 3FWQA 4X2KA 2CGXA 3F2AA 2WU6A 4RMZA 4HCUA 3WYXA 3ZYAA 4MQ2A 5AJQA 3WZEA 4BL1A 2QNJA 4B8MA 4CTBA 1YDSE 4QMTA 2BFYA 3Q53A 4ACDA 3VHKA 4JBQA 4DFYA 3NYNA 1AD5A 4ID7A 3NAYA 4MBIA 3UG2A 3GQIA 4RA5A 4YJQA 5FM2A 5C8MA 1I44A 2C6DA 3DNEA 1H1WA 4YJOA 4GH2A 4RJ3A 3VQUA 4DEDA 4Y95A 3COMA 2W9ZB 3PXZA 2XP2A 3UGCA 4YSJA 2C30A 3ZBFA 3WARA 4EH8A 4CG9A 2GHGA 1BL6A 4RRVA 4RWLA 4O0WA 4BCPA 4X0MA 4UWCA 4U40A 5LVPA 1Q62A 3BELA 5EM6A 1MQBA 3Q52A 4QMUA 4J99A 2VN9A 1OIYA 2B55A 2WNTA 2YACA 3PXFA 5CSHA 5CU3A 5HD7A 2R7BA 4K11A 1WVXA 2C6MA 2XKDA 4FKPA 2ZM4A 3D7TB 4UZDA 5GHVA 1XHAA 3A4OX 3LCTA 4TWPA 2PZ5A 2J90A 1H1QA 3M11A 2BR1A 4IX3A 2XNOA 2ZM3A 1TKIA 3E8DA 2Z7RA 4XOYA 3R8LA 1NVRA 3UE4A 4ZJVA 3BZ3A 5HNBA 2UZLA 2QOBA 3LFBA 3U6IA 2JIIA 4O0SA 5CQUA 2ZB0A 4NM3A 4F7LA 4FA2A 3TIZA 4FVRA 3BWJA 1YKRA 4DE4A 2VTJA 4X6RA 4RC2A 3DBQA 2ZB1A 3IDCA 5JKGA 4APPA 4BCOA 3EQIA 3OY1A 4KSPA 3ENHA 3N51A 3LXLA 3MH3A 5FQDC 4AT3A 3FI4A 3EQBA 3V8WA 3R01A 2UW5A 2PUUA 3NLBA 4XG3A 5DA3A 4AZEA 2Z02A 5CEPA 2B52A 2HW7A 2CMWA 4QTEA 3G9NA 2RG6A 4ASXA 5AUVA
chains in the Genus database with same CATH superfamily
4EORA 4I3ZA 3R8VA 1ZMVA 3NAXA 4A9YA 2ITUA 2UVXA 3ZO2A 3LMHA 2R2PA 5DT3A 4Q5HA 1IA8A 3VS3A 5AV2A 4QYEA 4O96A 2QLQA 3BGQA 3TEIA 4CXAA 3ENMA 4PNIA 4MNEA 4AF3A 2YITA 1P4OA 3S3IA 5LWNA 5CEOA 4OTRA 5CSVA 2RFSA 5M4CA 3W0NA 4I4EA 1YVJA 4QMOA 4X3FA 4EL9A 5EOBA 5HVKA 3P79A 4A9TA 5DR2A 3O71A 4BF2A 4EZ7A 1Q8ZA 4IVDA 2AYPA 2GMXA 2J50A 1GAGA 1WVWA 2XJ0A 2XNBA 3NGAA 4FGBA 3ZTXA 4DT8A 3BHYA 3D94A 4MXXA 4AQCA 3CCNA 5G1XA 3D83A 2ESMA 4BI2A 1JSVA 5TE0A 4BDDA 2E9VA 3JR1A 3QQHA 5JGBA 3DKFA 4Y8DA 4U41A 2YHVA 3VS1A 3BLRA 5IEVA 4PP9A 1ZYCA 4BDJA 4AOIA 4O0VA 5CNOA 4OBQA 3JUHA 3F5GA 5BVEA 4BFMA 4BGHA 4C3RA 1H28A 2XNMA 2QI8A 4C59A 1E1XA 1IEPA 3LQ8A 4JG8A 5DR9A 2PVRA 4ANLA 4F9CA 4F9WA 3KF7A 4HCVA 4KAOA 1MUOA 3IW7A 3R7EA 2JC6A 4O7WA 1H0WA 4ARKA 5CF6A 4JRNA 1B6CB 1R0PA 2X8EA 1Y6AA 3FKLA 4MAOA 3BQRA 4EK4A 3HMPA 4FKVA 4O4BB 3PJ2A 4EOOA 4TZRA 1KV1A 1OKZA 2G15A 2HCKA 4BKZA 2F7XE 4DC2A 2F7ZE 3VF8A 2C0TA 5IG1A 4RQVA 2VX0A 3ZO3A 4ANNA 4IZ5A 3LXKA 4CGAA 4GRBA 4EH6A 3P08A 2YIXA 1YXTA 1PKDA 2PUPA 3OUKA 4FICA 3Q9YA 3GC9A 3K5UA 2F49A 4FV6A 2B54A 1YDTE 3W0SA 1PXNA 4IZ7A 3MJ1A 3W0QA 4YPSA 4FTAA 2FH9A 3PDTA 4GT5A 5KZ0A 5TKDA 5KBQA 2REIA 4U97A 1FMKA 4AU8A 5GZ9A 2G2HA 4L7SA 1OZ1A 5CT7A 3UP7A 4F7NA 1G8KA 4GCJA 5CI7A 3CC6A 3EHAA 4MTAA 5CXZA 3BU5A 5AP0A 3IGOA 4F09A 4U42A 1PYEA 3DA6A 3IECA 3JY9A 4R1YA 4AZFA 4D4YA 5EM7A 3W0RA 2GQGA 2GS7A 3PIXA 3EZVA 3MYGA 3PYYA 2EB2A 2C3IB 4EJNA 4YC6A 5JZNA 4U3YA 3NUYA 4IX4A 2YEXA 3NUUA 1H25A 5HO7A 4K0YA 2BZJA 4FT7A 4RZVA 4U8ZA 1SVGA 4RVTA 1A9UA 4XG8A 4EOQA 3QWJA 4ANOA 1XMLA 3DBCA 4BCGA 4I5CA 4YJTA 4AZTA 4M13A 4JT3A 4MHAA 3DS6A 4D0WA 2XJ2A 1W98A 3TNIA 4FKRA 3U9CA 4IW0A 5AWMA 4U44A 5C27A 4S31A 3UOLA 4F6UA 4YU2A 5EQYA 1KE7A 2ZAZA 5AP7A 3IPHA 3H0YA 3QCYA 3A7JA 3AC2A 4Z7GA 5IKWA 3NUAA 4U45A 2XK7A 4FVPA 4L00A 4NM0A 3LFFA 2RGPA 1OVEA 4DH8A 4EOMA 2BRBA 2OXDA 4KBCA 3MFTA 5IA1A 4IMYA 5IA0A 1YI4A 2BHHA 3TKHA 2Z7SA 4GFOA 2B9HA 4C2VA 2IVTA 3GU7A 3KK9A 4CV8A 3FMLA 1H24A 4GJ2A 4BDFA 4N57A 1JKKA 2X7FA 5FTQA 5J9YA 4AXEA 5IQEA 2BAJA 4AZVA 4O7VA 4JDKA 3R1QA 3OF0A 3NFGB 4R7BA 4CCBA 3O96A 4OUCA 1U59A 3HX4A 3AG9A 2W5HA 4EK3A 3GNIB 3FI2A 4IM0A 4YZBA 3UYSA 3UVQA 4BDKA 1VLRA 2VWUA 3ANRA 3H10A 4DFXE 4EOPA 4Y72A 3AC8A 2JFMA 4IDTA 4YJUA 4QMSA 4PDPA 3C4WA 4AP7A 3R1SA 3KF4A 5M56A 3II5A 4D4SA 4QMLA 2PUIA 4IEBA 2EXMA 4TT7A 2PK9A 4B9DA 4UMUA 3PZHA 4XG7A 4XRLA 3SG8A 4H3PA 4FKJA 3H4JA 4EHEA 3NNXA 4FYNA 4RG0A 5AM6A 2P3GX 3OCSA 1DS5A 3AMYA 3L8SA 4U79A 3Q4TA 4MYGA 4L53A 3CS9A 3ZU7A 2YAAA 4I6LA 3U55A 3SDJA 3GP0A 4DFNA 3R9HA 5AP4A 4AA0A 3SA0A 2HYYA 4FL1A 4F99A 3NSZA 1M7NA 1UWHA 3OCTA 4PTEA 2X9FA 1ZLTA 4ZTNA 4E7WA 3O7LD 4AW1A 3VW6A 2BDWA 3OTUA 5AR5A 3ZSGA 3QTRA 4OTFA 3UC4A 3W32A 3R9OA 4FTKA 4AG8A 1IG1A 4C34A 1J7LA 5CTPA 3DAEA 4EH9A 4OTDA 5BVNA 5BYLA 2ITOA 5HCYA 3MPTA 4WRGA 3UODA 1OPKA 5CY3A 3AKKA 5E9EA 5CVHA 1OGUA 2YJSA 3PP0A 1Q97A 3R9RA 2VTTA 5TR6A 4BYIA 4EH4A 4EOKA 4MD7E 4J98A 5DGZA 2VGPA 3FZOA 4NT4A 5I3RA 4FTLA 4LL0A 4TYHA 2NPQA 4V05A 5ANGA 4JBVA 4XJ0A 5M53A 4HZRA 5HLPA 2PU8A 3U54A 4II5A 5EDRA 4MXAA 5IQCA 5A46A 3LM5A 2P2HA 3Q32A 2FSMX 4ZTHA 5I3OA 2XIZA 3QTIA 1XH5A 1UU7A 4UYNA 4AXCA 4FC0A 4XS2A 4BCMA 1Y8YA 1OPLA 2I0YA 2R3OA 3ZLXA 4IAYA 3T3UA 5CU2A 4UMTA 4TYEA 5DBXA 4QP8A 3MTFA 3QU0A 5J1VA 2QU6A 4FTMA 2Y8OA 1ZOGA 4IJ9A 2R3MA 4R5SA 3JPVA 5DWRA 3LZBA 1CKJA 3VS5A 4AFEA 4LOQA 3P78A 3PXYA 2X9EA 3QYWA 3VHEA 4A4OA 2WTDA 4D5HA 3BCEA 1H0VA 3OOGA 4RIYA 4PL3A 1JLUE 4FZ6A 1RJBA 4JMQA 2BIYA 3GCVA 1MP8A 2QKRA 2W1ZA 3OEFX 4D2TA 4TYIA 4KIPA 4ITJA 3L8XA 3R9NA 4I1ZA 1BUHA 3B2TA 2OLCA 3MV5A 5JQ5A 2P55A 4IVBA 5B2LA 4BCIA 5BUEA 1TQMA 2I40A 1WMKA 2OXYA 4ZSGA 3IDBA 2E9UA 4EUTA 2EXCX 2XEYA 4XBUA 5FXSA 2G2IA 4XUFA 5H8BA 3IGGA 4XX9A 4H3BA 4BICA 3DJ6A 5GZ8A 4O91A 3E3PA 3AC3A 3Q4ZA 2RFNA 3PJ3A 3DJ7A 4FKQA 2V62A 4EZ3A 4FG7A 3UBDA 4AT5A 2LGCA 3TTJA 5DOSA 3BU3A 3HYHA 3TG1A 3CGFA 1WCCA 1JKSA 3GU6A 3NCZA 3RAHA 3LLAA 1BLXA 3EKNA 4JDHA 4MUQA 3AGLA 4RFYA 3KXMA 3FE3A 4CKIA 5HCXA 4QPSA 1FINA 1OKYA 2ETMA 4O1OA 3WF5A 3V5LA 5DMZA 4YLJA 4O81A 2CNVA 5G6VA 2CNUA 2RFDA 5ACKA 4DFZE 4EK8A 4BZOA 1YOMA 4AZWA 5BYYA 3I5NA 1BX6A 1ZRZA 1W7HA 5TO8A 1K2PA 2X4ZA 3Q4UA 3BLQA 4FSYA 4WIHA 1OBGA 4ITIA 2CJMA 4MBJA 3RNIA 1PXOA 4JG7A 2R3QA 2V0DA 2OFVA 3HEGA 2ITPA 1WBVA 2XM8A 4UXLA 4DGGA 5M4IA 3NUXA 2ONLA 5M07A 5DEWA 4JOAA 2OIQA 4FKIA 1TZDA 5AP5A 2GPHA 4YJSA 5JEBA 5AP1A 5J8IA 2XK4A 2R3RA 1JPAA 3QD3A 2HWOA 4ACGA 3HV6A 4FV1A 3FZSA 3C51A 2R3FA 3O23A 4K33A 5HLNA 2C0OA 2C5YA 4PV0A 3LW0A 3BV3A 3VBTA 2C68A 3OHTA 3RAWA 1TQIA 3RHKA 1IRKA 2IW9A 3VIDA 1OI9A 2WMAA 4FG8A 4Y46A 2PSQA 4KB8A 1VYZA 3NYXA 2Y6OA 4ANBA 4YO4A 3HV7A 4IIRA 3MY0A 1KE6A 4LGHA 2W0JA 4QQ5A 3PXKA 1ZY4A 4QNAA 3MPMA 2DUVA 2X1NA 4YZMA 5FEEA 2XH5A 3ZXZA 2PY3A 4IAKA 3CTQA 3R1YA 4PMPA 1XKKA 4BCNA 2PYWA 3C4ZA 3KULA 3ZRMA 3TM0A 1OL5A 4WUNA 3KRXA 4UYAA 4FUYA 3NFFB 3E5AA 4P5ZA 4ZTMA 3MIYA 5CEMA 4FV9A 5AV0A 3TV7A 4BRXA 2IZRA 2WGJA 1V0BA 3BEAA 3ZLSA 2HZ0A 2IW8A 4Z7HA 4DHJA 1WAKA 3KGAA 2X0PA 5IQHA 1U54A 4BBEA 3Q60A 3OCGA 4O0TA 2O3PA 3G5DA 2JDVA 4F0FA 4AA4A 2C5NA 3A8XA 5K9IA 4FEUA 3HV3A 2XIYA 2OJGA 4B7TA 1G5SA 4QQCA 4FNWA 4BVUA 4RC3A 4TPTA 4GMYA 4I5PA 4X3FB 1H4LA 2E9OA 3FUPA 4LYNA 3SLSA 4CSVA 4NWMA 1LPUA 2GHLA 3L8PA 4J96A 4N4SA 5BVOA 2YJRA 1RE8A 3P9JA 2NRUA 1U5RA 5ETAA 2J5FA 2A1AB 5ETCA 4LGGA 4M67A 2BRGA 4OT6A 3VUIA 1QL6A 3KN6A 2KTYA 4RQKA 4HVDA 5CANA 5LMAA 3PPKA 4RPVA 4CVAA 3WZKA 4FV4A 4X2FA 4J8MA 4RFZA 5CX9A 4FX3A 4J8NA 5AADA 1J7UA 3CP9A 4J7BA 2VO0A 1VZOA 4FL3A 3PPZA 4GV1A 1IASA 4HYIA 3V5QA 3D5VA 4C62A 2HENA 4UMQA 3NS9A 4G5PA 3KREA 1PHKA 2F2UA 4UZHA 3MA3A 2WQMA 3MY1A 3NYOA 3HV5A 4U7ZA 4KIKB 5IUIA 1PXKA 3EQRA 4NKSA 3V04A 4BCHA 2ITZA 2X0OA 4RJ8A 4LDTA 3R7GA 2XKCA 3AD5A 3C0HA 4FV2A 2C6IA 2PVKA 4ZMEA 4AXFA 3ROYA 4D2VA 4DEIA 5I0BA 2ITNA 2WMVA 5M4FA 1LEWA 1W8CA 1QPCA 2RFEA 1L8TA 1WVYA 4N6ZA 4NM7A 2NO3A 1RQQA 5E8TA 4GKHA 2XKFA 4DN5A 1REKA 3I1AA 5EKOA 5M44A 3W2PA 4I0SA 1ST0A 2CKEA 1SVEA 2XBAA 4IB1A 4O38A 5GINE 3ODZX 5EYKA 3ID6C 5DPVA 2WOTA 2X6DA 3LMGA 2O64A 3V5WA 1DM2A 1H08A 5I9XA 2QO9A 2YIYA 3GI3A 2ZFYA 4DEEA 4N70A 3A7HA 4MXYA 2HXQA 2WOUA 1G8AA 3RGFA 3AKLA 2OU7A 3A99A 5EH0A 3ZFMA 3ZXTA 4IANA 4WG5A 3DZQA 3EN6A 3Q5IA 4YURA 3AQVA 3EQCA 4YO6A 3G0EA 4FZAB 2WTCA 3ORZA 1OBDA 5E8ZA 4RZWA 4UWBA 4NH1A 4FI1A 4ZY4A 5LCJA 5DIAA 2P4IA 1OKWA 3IO7A 2XB7A 4I93A 3CPCA 4YMJA 4HPUE 2OJJA 4FSQA 4GU6A 4Z16A 4IBMA 4YPDA 3LHJA 5D9HA 3NPCA 4E5BA 3Q9ZA 3ZSIA 5D12A 3ELJA 3KKVA 2C69A 4CCUA 4CRSA 1KOAA 4QP7A 3FMJA 4NFNA 4CTCA 4C4GA 3NNWA 3ROCA 2VWXA 1TFFA 2BROA 1FMOE 4HYHA 1HCLA 3CQEA 3QZGA 3UIUA 3TMOA 3TNWA 4M8TA 3NUSA 3HMIA 1DAWA 5FRIA 4BHNA 2YM7A 5JFWA 4ZIMA 3DXPA 3PVGA 3MWUA 2QODA 4QMZA 4DAWA 2J6MA 3F3VA 3QD2B 2XNEA 5I9YA 2V7OA 2XVDA 3ACKA 3MVHA 4QPAA 3PPJA 2UW3A 4FUXA 4H1JA 5AA9A 4UEUA 4GVJA 3R71A 3V6RA 5A14A 1FVVA 1QPEA 1BMKA 4FT9A 5K5XA 4O7ZA 3E8NA 1ZYDA 2C5OA 2VD5A 4FTJA 3QTWA 4KIOA 5IMEA 5J5TA 4YZDA 4C4FA 3RI1A 2C5XA 4WNOA 2VO6A 3OW3A 3P1AA 4RX8A 4YTCA 4PRJA 5DH3A 3MW1A 4O86A 3GCPA 3QXPA 1QPDA 2C6OA 2WQEA 4IVCA 3V51A 4DH5A 4F70A 3DKCA 2DS1A 4IWDA 3L8VA 4F64A 2GQRA 3O8TA 4JX7A 3B8RA 2BZHB 1UNGA 3FLNC 5FGKA 4YSMA 3V8SA 2CCIA 4YLLA 5KCVA 2EWAA 5DHJA 3O8PA 3BRBA 4Y5QA 2XALA 4QYGA 3Q3BA 4G9CA 4FNZA 2AEGA 3R2YA 3VNTA 3FXZA 2O65A 3CPBA 1K9AA 5KX8A 1F0QA 4J52A 3W18A 4BKYA 5LMKC 4AQKA 5HIDA 4G6LA 1RDQE 5B0XA 2PUNA 5KMNA 2QURA 2YLFA 2QONA 5JRSA 3UZPA 5L6WL 3D9VA 4U81A 4CFVA 5CVGA 2UZDA 4GG7A 4DG0E 5AUTA 1NW1A 3H9OA 2PVNA 3O50A 4X2NA 2PVHA 4EHGA 2BKKA 3LFQA 1JWHA 4RX5A 1MRUA 2QO2A 4RT7A 4A9SA 4KBAA 3K5VA 3LCOA 4IWQA 3VJOA 2YA9A 1H8FA 2B1PA 4O27B 3ZSHA 4P4CA 3LFCA 3R63A 5HLWA 3HMOA 3BHTA 3TZ9A 4YBKA 2A0CX 5L2TA 2PZRA 3VUMA 4RVLA 1Q4LA 1R78A 5DRBA 1GIIA 5M57A 3QLFA 4TYHB 5FEDA 4LRKA 5JFSA 4ZMFA 4TWCA 3NEWA 2R0UA 4K9YA 4BIEA 2A19B 3EOCA 2XIKA 3UO4A 3V5JA 3U6JA 4EHZA 4KA3A 2J0MB 2OBJA 3ORLA 5CALA 3QRIA 3IW6A 4O0RA 5DG5A 1G8SA 3VS0A 4DINA 1T46A 4NSTA 4ORKA 4L44A 4WOVA 4FTUA 1IA9A 3GXLA 3R7VA 3F2RA 2UVYA 2WIHA 4RIWA 3RMFA 3I7CA 4KIQA 3UNKA 3UQGA 2WMQA 1PMVA 4QEBA 1T45A 3HV4A 1H00A 5CSWA 4FKTA 4FEQA 3OEZA 2J0KA 4IAIA 4QMPA 5FP5A 3LJ2A 5CI6A 3R8MA 3VS6A 4BTMA 2R4BA 4BDCA 5KO1A 3R73A 2I0HA 4X2JA 4RIYB 2HXLA 4G6OA 3AC1A 4EEVA 3CJFA 4AS0A 1ST4A 4O4FA 4IZAA 1ZYLA 4W9XA 3VBQA 2XNPA 2X7GA 3PIYA 4S33A 2RF9A 5A3XA 4WKQA 2B9JA 3B2WA 4YTHA 5BNJA 1H27A 3WILA 2W1GA 3QQFA 4HPTE 3SHEA 1PXJA 3WIKA 3EFLA 1J3HA 4C33A 4C02A 3DAKA 3VAPA 4FT5A 1BKXA 5D7VA 4ZLOA 3SGCA 4RGJA 5HG8A 5CLPA 3A2CA 5KMLA 3PUPA 2GS2A 3CQUA 4FEWA 2PMNX 3RAKA 4AW2A 2XYNA 4BYJA 2H6DA 5T3QA 4G3CA 4L7FA 4Z9LA 5LMBA 4BBFA 3DFAA 2VWIA 2CN5A 4M14A 3F82A 3MVLA 4M69B 3BX5A 4CQGA 2VGOA 4FTOA 2B53A 2PZIA 4Y83A 4TN6A 2XK9A 1O6YA 4JVGA 3QTZA 4HJOA 2W05A 4KBKA 5C9CA 2XANA 1CDKA 3ORKA 3KL8A 2JKQA 3BYMA 4HGTA 3V8TA 4BN1A 2Z60A 2XRWA 1YWRA 2WD1A 4QD6A 3PTGA 4KKEA 4ZXTA 5E7RA 3ZCLA 1KWPA 2JITA 3DDQA 3R21A 3G15A 3ZDUA 4MCVA 1YXVA 1LEZA 5HG9A 2ZV7A 5JMSA 2G2FA 4DH1A 2WKMA 1XBAA 3AMAA 4R8QA 4XRJA 4YC3A 5HO8A 3LOKA 2LAVA 3WZDA 4BHZA 3CLYA 5E1SA 4E4LA 5DE2A 5BUJA 4S30A 1F3MC 3QF9A 3KXXA 4RFMA 5KKRC 1JKTA 5FD2A 3UYTA 3AGMA 3NUPA 4C36A 4DTBA 2WTKB 2X2KA 3BI6A 5CSXA 2CHLA 3BGZA 4R7HA 3VQHA 3RK9A 1AGWA 5L6OA 4JQEA 1XJDA 1KE9A 2V55A 4ONAA 3ZZEA 2OK1A 2CLQA 1KE8A 4FTCA 4EONA 3R6XA 5CF5A 3HMNA 4E5WA 3P7AA 3P86A 3QLGA 4XH6A 4C4EA 4TTHB 4BTFA 4R5YA 2V5QA 4XG4A 4G16A 1V1KA 4J95A 3QD0A 4ALWA 4PPAA 2QVSE 4AN3A 1VJYA 5CAOA 4CKRA 3PLAE 3KULB 3JVSA 3C7QA 3NDMA 3QRKA 3R8ZA 4EKLA 3SOCA 3HKOA 4ALVA 1M17A 1MQ4A 2QOIA 4W9WA 5C4KA 3QZFA 4IADA 5KUPA 4BCKA 5EI8A 3PJCA 2VU3A 3GB2A 3LM0A 4F78A 3ORIA 3RTPA 2QOLA 4KIKA 4WSYA 3KFAA 5D7AA 3KC3A 5CYIA 3DB6A 3T9IA 4X3JA 1U54B 2IW6A 3NCGA 5AV3A 3TV6A 3V01A 3FSFA 3FV8A 3UDBA 3WF8A 3NW6A 2R64A 3ULZA 3VULA 5CNNA 5JK3A 4ZZNA 5HTIA 2GU8A 3F5UA 2WELA 4W4VA 2DQ7X 2XS0A 5H3QA 1JVPP 5KHXA 2JDOA 1YWNA 3QZHA 2FUMA 3TZMA 4ACHA 4D4VA 1GZOA 5EQPA 1PY5A 4GL9A 5EI6A 5BUIA 4Z3VA 2B7AA 4NFMA 2IN6A 1M7QA 3NZ0A 2O2UA 2J0JA 3UNZA 2C47A 1Z9XA 3OW4A 3IQ7A 2GSFA 2QQ7A 4KSQA 4XG9A 4BGGA 3HRCA 3ZEWA 4ZK5A 2GQSA 5FWKK 5F94A 4FGRA 3KMWA 4WHZA 4IB0A 3BYVA 5C01A 2UZNA 4DGLC 4YJPA 4AGCA 3BIZA 3FSKA 3FPMA 5BVFA 5EQEA 3IOKA 2VTRA 2VV9A 2QG5A 4ZSLA 3IG7A 3WI6A 1PKGA 2A2AA 5HBEA 3HAMA 1CTPE 3EQGA 3IKAA 3MJ2A 1CKPA 5LVOA 3CD8A 3GC0A 3TNHA 4IQ6A 2BDJA 2OJFE 2W4KA 3EQFA 2FYSA 3UVRA 2JGZA 5CEQA 3PJ1A 4YNOA 4CZTA 4EWHA 3TUBA 5EOLA 5H8EA 4MBLA 2ZV8A 3D15A 3GT8A 4MVFA 3FY0A 3PIZA 3MH0A 4E1ZA 2Y4PA 2ZOQA 3RKBA 2IVVA 5JZJA 5BYZA 4QYYA 3EN5A 2Y4IC 3HZTA 2Z7LA 3RPYA 1ZYSA 3QX4A 2E2BA 4GK4A 5AFVA 4EBVA 5IISA 2R3IA 1P4FA 5DI1A 3MVMA 4HVSA 3DFCB 2OXXA 3GGFA 3WZJA 5FTGA 3PSBA 4UMRA 1B39A 1NVQA 4AXAA 3OS3A 3SKCA 2CGVA 4LV5A 2CKOA 5F95A 1YI6A 5EM8A 2ITVA 4ZTRA 2C3LA 2PMIA 4NU1A 3F66A 3E8CA 3RWPA 5HO6A 4KNBA 3REPA 5EYMA 1PYXA 3EJ1A 4X3FC 5AR2A 1PXIA 3ZS5A 2WEIA 4O0UA 4S34A 5B7VA 4LGDA 5IEXA 5BV3A 4RX7A 5K0XA 2GNFA 3NYVA 5HE1A 2RG5A 2QOCA 3IW8A 3W2OA 2P0CA 3QBNA 4DEGA 4O7YA 3NW5A 5KZIA 4JXFA 2ZVAA 3O7LB 4I6BA 4YZCA 4AAAA 4CFNA 2BIKB 4DG3E 3WIGA 5AP6A 3Q9WA 3PWYA 4YNEA 4H05A 4B99A 3CE3A 4LG4A 2W1IA 2QOKA 4OR5A 3COKA 3FI8A 1V0PA 4TW9A 3ODYX 3KXNA 3LXNA 1Z57A 3OFMA 3TWJA 2R7IA 3C5UA 3T3VA 1A48A 1NXKA 2UUEA 4P5QA 3W16A 4C58A 5M06A 4OAUC 2R3LA 2BMCA 1BYGA 1Q41A 1UWJA 3BEGA 4I5HA 4YBJA 5ETFA 4DGOA 4EOIA 3QHRA 1Y8GA 4XV9A 3MFSA 2I0VA 3QGYA 4OTWA 4PUZA 1W82A 3DOGA 5E92A 5IQGA 2BHEA 4K6ZA 2C6KA 4LI5A 4O0YA 4ZTLA 4AN9A 3NIZA 2W1DA 4TWNA 4WD5A 4XP0A 3R02A 5J9LA 2YZLA 4TL0A 4JS8A 3D2KA 1UKHA 3BE2A 2BRMA 4AGUA 3CTJA 3HAVA 1ZMWA 4U5JA 3BYSA 4FKWA 4GIHA 4GSBA 4C57A 3UQCA 5AAEA 4MXZA 3DBEA 2YZAA 5F1ZA 4FE2A 3PY3A 5D10A 4PY1A 2VRXA 4FV0A 3COHA 5AR8A 3FMHA 4WBBB 4A7CA 5I9VA 3H0ZA 5EW8A 4C4IA 2C6LA 2C6TA 1KE5A 3PFQA 4DGMA 1BI8A 1OB3A 3I4BA 4LMNA 1F5QA 2VUWA 3KK8A 5CVFA 3EN4A 3OVVA 2EB3A 3E64A 3FL5A 3ZHPC 4QDEA 4BY9E 4OLIA 3OBJA 1BL7A 2WTIA 3IOPA 3QZIA 4ACMA 4KS8A 5I9WA 5IDPA 4AAYA 1Q3WA 2YFXA 3M1SA 3F3ZA 5HIEA 2VWVA 2VTIA 3QRJA 1P14A 3UTOA 3TNQB 2YIWA 3C13A 4XNEA 1WBTA 3S1HA 4FSNA 4RVMA 2CCHA 2XCHA 2ITYA 3JXWA 3W8LA 3ML1A 2ZDTA 3QALE 1SNXA 1OIQA 5D11A 3PVBA 3V3VA 1I09A 2GNHA 4FG9A 4GVAA 4DA5A 4X21A 2OIDA 1JQHA 3MN3A 2RIOA 4H58A 5A6OA 2FSOX 3FKOA 3QQUA 4FF8A 2VO7A 4KKGA 1WBSA 1YWVA 4EQMA 2XNNA 4V01A 4ANQA 2JDTA 2XBJA 4AOTA 5KMOA 5B2KA 5FXQA 5L8JA 4WRSA 4PL5A 5ANDA 2Y7JA 5AUXA 1JOWB 4FNYA 2O5KA 1IAHA 4R78A 2OW3A 3ZZWA 4ZS0A 4M7IA 4QT1A 4MNFA 3RALA 2BAKA 5EM5A 1ZMUA 2QKWB 3FZRA 3GCUA 4EYJA 4G3GA 3THBA 4BTJA 3FYJX 4FODA 4F6SA 2IZSA 4TNBA 3R9DA 5IPJA 4NW6A 2C3JA 5CWZA 1ZOEA 3ET7A 1Q8UA 1H26A 2YCFA 3IW5A 3JYAA 5ANOA 4G3FA 2ZMCA 4NCTA 5CZHA 3F3UA 4RJ4A 4AE9A 3UMXA 2GNJA 4JAIA 3KCKA 2HZNA 4FSUA 3PA3A 4JLCA 2OI4X 4E4MA 3TUDA 5DNRA 2VWZA 3BBWA 3GFEA 2PULA 4UV0A 3UQFA 2PVFA 3TT0A 3QA0A 3NIEA 4GFGA 3ORMA 4G31A 4ZP5A 4RIWB 3ORPA 4FSWA 4M69A 4YZ9A 3VVHA 2CKQA 3O8UA 4M3QA 4BWKA 4LL5A 4XLVA 2J2IB 2PMOX 2BRHA 3HUCA 4ALUA 3VF9A 2F7EE 2PE2A 2SRCA 1FGIA 4NTSA 5E8UA 5AIRA 3LLTA 3DV3A 4JDIA 3TZ8A 2EUFB 4P90A 4M0YA 4GYGA 2RSVA 3TUCA 1YOJA 4I24A 4RC4A 2WMSA 1S9JA 2XM9A 5M55A 4C37A 3DTCA 2ACXA 3I6WA 3EL8A 4FSRA 2W1EA 4GFMA 3PXQA 4F4PA 1OUKA 3PE1A 2PMLX 3F5PA 1WBPA 4GK3A 5AV4A 3OBGA 4QNYA 3FL4A 3W0PA 3HLLA 3PP1A 4G1WA 5H8GA 4CQEA 4EHVA 1YRPA 2QOHA 3O17A 1ZOHA 4QMXA 4B0GA 3DY7A 3F9NA 3UPZA 4WNKA 4DT9A 4NK9A 3NVKI 2W99B 2ZM1A 4EI4A 4FT0A 3BPRA 4O6LA 5E91A 5JQ8A 3N4TA 3DK7A 4YC8A 3BWFA 3A7FA 2VTHA 3R2BA 5AR7A 4F9YA 2X8IA 3BKBA 5HHWA 3G6HA 3OWPA 5AUZA 4DLIA 2G1TA 1U4DA 3GU8A 4A9RA 3ORTA 4TKSA 3KY2A 3FHRA 5DT0A 1XMMA 1JSTA 1PMEA 3LFNA 5AR4A 3GU4A 1Y6BA 3FLWA 3HP5A 4U43A 4BZNA 4UB7A 4MXOA 2WMXA 4QP9A 5AUWA 4UX9A 3DTWA 2CNQA 3C4FA 3TDWA 1SZMA 1XWSA 3DXNA 5CEKA 2JAVA 4QO9A 5IQFA 4N6YA