2WTCA

Crystal structure of chk2 in complex with an inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
302
structure length
284
Chain Sequence
VYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Identification and Characterisation of 2-Aminopyridine Inhibitors of Checkpoint Kinase 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 284
sequence length 302
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wtcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wtcA01
2HENA 4DH3A 2RL5A 2X2LA 2HYYA 3IDCA 3VBQA 3W55A 3LE6A 4PNIA 5C8KA 3Q4UA 3RCJA 3QRKA 3UIBA 3FYKX 4CFUA 1NW1A 3GCSA 3RTPA 4YJSA 3DBQA 3BGPA 3NNUA 3R28A 3O7LD 4I21A 4I4FA 4PL3A 4V0GB 2NRUA 4UZHA 3ZDIA 1GZOA 5HCXA 4EZ7A 4F70A 2WMXA 4GUEA 4U6RA 2HWPA 3PLAE 3PP1A 4BN1A 3VBTA 4PY1A 4QP9A 3V5LA 1O6YA 5E1EA 4AGWA 5BMSA 2BZJA 3PIZA 3ZC6A 3ZFXA 4YTIA 4ASXA 2C68A 2PULA 4DTBA 2AYPA 3H10A 3RVGA 5LJJA 1OL7A 3HMMA 3K3IA 4YC6A 1TKIA 5LVOA 3ZUTA 4D2PA 2OIBA 5IG1A 1FINA 4HGSA 3PXZA 4I94A 4MNEB 4ZJIA 3ORTA 3REPA 1O6KA 3ID6C 3LQ5A 4BTFA 5CEKA 2WEIA 2QLQA 1QPEA 2R3RA 1YKRA 4TYEA 4E5AX 3HZTA 1PY5A 2XUUA 4WNOA 4G6NA 4ZZNA 3UG2A 2H34A 4E7WA 5B7VA 4CFFA 3HDNA 2VN9A 3VIDA 2HZIA 3SHEA 4QT1A 3ZSGA 5HICA 4DFBA 5IKWA 5CXHA 1OIYA 4DYMA 4ONAA 3IS5A 4WRSA 3UIXA 2QOCA 4DGNA 4ZLOA 3EHAA 2BRHA 4JG8A 4AT5A 3QWKA 5FXSA 2Y8OA 3ZUVA 4DG0E 3G90X 4U9AA 5IQCA 3R1YA 4FOCA 3II5A 4LGDA 4LOOA 2XNMA 4Z7GA 5B2KA 4A4XA 1Q61A 4XLIA 3UOHA 4CZTA 4E5BA 3U54A 5ANJA 1PYEA 3PE1A 3V8WA 5I0BA 5IA3A 1JOWB 5AR7A 3W16A 1OKVA 1STCE 2C6IA 2PVYA 5F95A 5HNGA 4NJ3A 3VULA 4NTSA 3I81A 4DGOA 4KABA 4RC3A 5IEYA 4QQTA 1UNGA 1SZMA 2PVKA 3PG3A 3R21A 1F5QA 5J87A 1A48A 2C0IA 4FIHA 3S95A 2RFDA 4TY1A 5GZ9A 2X8EA 4DC2A 4FTTA 4L3LA 4W8EA 4AOJA 5KMNA 4ZZMA 3P7AA 1K9AA 2X9FA 5A4LA 4KBAA 3ACJA 4BGQA 2RG6A 3ETAA 4Y5QA 4OAVB 3Q9WA 5CAPA 3OROA 3O7LB 4RFYA 2PZRA 3BGQA 4K33A 3VHEA 1KOBA 4EOJA 4D4RA 4HVSA 5IU2A 2DQ7X 2WFYA 3NNVA 3OXTA 3M1SA 3UGCA 3FV8A 3O2MA 5EG3A 5LMBA 2YIRA 4F64A 3HYHA 2F4JA 4NW6A 3BYVA 4XP0A 4IANA 3CD8A 3F9NA 2AC3A 3UIUA 5JGDA 2ERKA 2PUUA 3EN5A 3I5NA 4Y5HA 2YCSA 2EB3A 3VF8A 4CV8A 2O64A 3COHA 2UZDA 3FMHA 3PTGA 4L00A 4IX6A 4K8AA 4X3FB 5JRSA 3ZYAA 3UJGA 4A9UA 2WD1A 4YBKA 4UYNA 4NYEA 2VTMA 2C5YA 4RFMA 4MH7A 4CRLA 5LVMA 2WTJA 1YVJA 3FDNA 1QCFA 3C4FA 1JKTA 2C4GA 4FODA 5AR4A 2BIYA 4O7TA 2NP8A 3QCYA 4QD6A 4KSPA 2XIZA 4U5JA 3UMWA 4AT3A 2WELA 3F66A 4ITJA 3AT4A 4FMQA 4KIPA 3W1FA 3PY3A 4RIWB 3HEGA 4YJUA 3GEQA 4MCVA 3UTOA 5HCYA 2YN8A 1S9JA 2UZTA 2G15A 2JDRA 3FI3A 4NKAA 4XRLA 4BI0A 3E3BX 4BWKA 3KMMA 3FXZA 4U7ZA 4S34A 1NA7A 3OXIA 1IEPA 1ZZLA 1J1CA 4R77A 3ROYA 4YJQA 4DGMA 4UEUA 4A9RA 2G1TA 2FVDA 3D7TB 3NVMB 1M52A 2CNVA 3A8WA 3B8QA 4XG6A 1PXNA 3UPZA 4BF2A 3OD6X 4GJ3A 3UZPA 3DCVA 4FEWA 1O6LA 4UXQA 3PDTA 4RLKA 4WSYA 1G8AA 2OZOA 3DQWA 5GHVA 4BCFA 4I4EA 3HP5A 1RW8A 2PVMA 2W9ZB 4XX9A 5HVKA 2E9OA 4FEVA 4NEUA 3NUSA 4O7LA 3R7YA 3ZFYA 3RWPA 4DLJA 2XKCA 2R3QA 2PZPA 3JS2A 3NYXA 2PMIA 1MUOA 2G2HA 5C1QB 4AZEA 1YWRA 3RALA 2XH5A 3G15A 3EN6A 3CGFA 3NLBA 2OW3A 3QX2A 4C37A 2WIPA 4ZSJA 4EBVA 2YM5A 5K5XA 5M09A 4ID7A 3OW4A 4BCIA 2WQBA 3PVGA 4I41A 3D15A 5ANGA 4AA5A 4J7BA 4YZMA 2JD5A 2G2FA 5CI7A 1XBCA 2IZRA 3E62A 3O0GA 3W8QA 3O71A 5L2TA 3DKOA 3HAMA 4Z3VA 2J0KA 3OWLA 4O6LA 1IAJA 3KN5A 4O81A 3VBVA 1GOLA 4XG9A 4L53A 1OIUA 4RGJA 1J7IA 1J7LA 3RK5A 2JAMA 3EYHA 3QCQA 4WUAA 5I3OA 2ITTA 4AW2A 4DBXA 3CQWA 1GZ8A 2EWAA 3DKGA 4RC2A 3F5PA 1O9UA 4FR4A 3TZ8A 4LRKA 3JVRA 1ZMUA 4FT5A 3ZZWA 4DEIA 3GOPA 1JNKA 5FTOA 3TZ9A 2ZM4A 4GFGA 1UKIA 4QP7A 3RHXA 4DINA 5CANA 2GNIA 1XBBA 3THBA 4RBLA 5AX3A 1WBWA 4FYNA 4IJPA 5I5ZA 3LFBA 1UU9A 3L8SA 4XOZA 4PWNA 1H25A 5IQAA 3GOKA 3E8EA 4EH5A 4HNFA 3ZSIA 4HW7A 1QL6A 1ZARA 4BCHA 4RG0A 3LMIA 5EKNA 3DGKA 3AMAA 3OUKA 5C03A 3RZFA 3KK9A 3WBLA 2JITA 5E9EA 1YWNA 4ZS4A 5KKRC 4LV5A 2XIYA 3P79A 1BYGA 2BPMA 4USFA 4TXCA 5L2WA 3Q32A 3D83A 4WRGA 4DCAA 2WAJA 5CENA 2JDSA 3B8RA 4TT7A 2OFUA 4WKQA 4ZTLA 5K0XA 4DTAA 5IF1A 4FSWA 3QQFA 4FL1A 4LRMA 1PKGA 2GNFA 2UZNA 5GZ8A 2AC5A 3R8LA 3VBXA 3NAYA 5CF6A 5HNIX 3EJ1A 4FTCA 2C5VA 4NM3A 3DBEA 1SMHA 2ZM3A 3LPBA 2F9GA 2W5BA 2X4ZA 3R1SA 4IZAA 4MTAA 3TNQB 3W2PA 4D4SA 3KL8A 1GAGA 3P08A 3JUHA 3LXNA 1JPAA 3NSZA 4JI9A 3OUNB 5AX9A 3BCEA 5BVKA 3RGFA 2V22A 5DMZA 5I9VA 2HELA 4A9TA 1ZLTA 2H6DA 4XV1A 2Q0NA 3V3VA 4DH1A 4QMNA 4ASZA 1PXKA 4XCUA 1REJA 3CY3A 2ITQA 1A9UA 3NW5A 2FSOX 4HVGA 3OOGA 5CAQA 3BIZA 4JJRA 5HU9A 4J1RA 5GJGA 2X2MA 3OS3A 2DS1A 2W1ZA 4GCJA 4BDDA 1U5QA 2QR7A 3BRBA 2XCKA 4FZFB 4G3CA 4IC8A 2XVDA 4KD1A 3RPSA 4G1WA 2OZAB 2CN5A 4FTRA 4MK0A 2OG8A 4TYHB 4DFNA 4GYGA 2VX3A 4X21A 3TG1A 3UG1A 3QXOA 4FSTA 4QTAA 3C5UA 4YTHA 2XKFA 4QOXA 3Q04A 4OTFA 2SRCA 2X9EA 4HPTE 4RQKA 4Z16A 5A6NA 2CGUA 3BHYA 2XNEA 1R0PA 2WGJA 3MV5A 3FMKA 3QCXA 3DQXA 2CLQA 3EZRA 4H1JA 2Z8CA 4G2FA 4QYHA 2ZYBA 4OTIA 4APPA 4CKIA 2O0UA 2OXDA 2WMSA 5T3QA 3EKNA 4AQCA 4E20A 3NX8A 5L8JA 4BTMA 3FPMA 4FGBA 4EYJA 3BE2A 4HNIA 1FMOE 5M4IA 3P1AA 1MRUA 3DK3A 3TCPA 4IAKA 1SYKA 5AAFA 2A1AB 3GU7A 4C34A 4CG9A 5EI8A 3ZS5A 3LFSA 4N6YA 2C5XA 1AQ1A 4YC8A 3VS0A 3SG8A 3S3IA 5CU0A 2R3GA 2ZB0A 4M0YA 1OGUA 4F9BA 4JAJA 5EDQA 3F61A 4ANOA 3KQ7A 4MBJA 4XMOA 5LMKC 3F5UA 3W18A 3OWKA 4CVAA 1P5EA 2GQSA 2Z02A 4FEUA 4CQEA 5DA3A 4FSZA 2VTRA 2F57A 4L8MA 2JBOA 2WPAA 4ZOGA 4RJ3A 3MIAA 2UZUE 4EUUA 5BPYA 1R1WA 2C5OA 2XIXA 3EQHA 4HVIA 4GEOA 5KBRA 4PQNA 4R78A 3W2RA 2HY0A 2WTIA 3ORIA 4AE9A 4X3JA 4CMUA 3R1NA 3FQHA 5BNJA 2C6TA 3ENMA 1M2PA 3IECA 4PMSA 4ENXA 2WMRA 3VO3A 2NRYA 4B4LA 4LG4A 4JIKA 2OF4A 3CGOA 3KXZA 3LM5A 4QRCA 3SRVB 2V0DA 5A6OA 4DEAA 4FE2A 2RSVA 2WMWA 2E9PA 3ORLA 3PXKA 5CSHA 4E4XA 4F63A 4AWIA 3DXQA 3BYMA 3H9RA 3NPCA 4YTFA 2YWVA 5EYKA 3TM0A 3S1HA 2B9FA 5AUUA 4KB8A 4J97A 4JBPA 5JZNA 5HO7A 5JFSA 3PSBA 1W84A 4J52A 4KIKB 5CNNA 2XK9A 2XNGA 3U4UA 4GKIA 3CTHA 4QYEA 3WF5A 3TUBA 3GQLA 4FT9A 4GIIA 4O0YA 4W9XA 5DWRA 3JYAA 3VW8A 3N51A 3CKWA 5CI6A 3AT2A 2F7XE 4HZSA 5IA0A 4YU2A 5EQPA 1JBPE 5KUPA 4IB3A 3KVWA 5E8TA 2V7AA 3N4UA 1BMKA 4FKSA 5CEQA 2QO9A 2YJRA 2R7BA 1JAMA 4M97A 4FSYA 1YQJA 5LQFA 2QI8A 2E9UA 4FT3A 3ZC5A 5AAEA 4YLLA 4EH4A 5AJQA 4E8AA 4XG2A 2X8IA 3AC2A 1OZ1A 5KZIA 4EQUA 4EH6A 2QURA 4AFEA 4KUJA 3COIA 2OJIA 2WXVA 1M14A 1PW2A 3SW7A 4H1MA 3VS1A 1W0XC 1H27A 3NUXA 1G3NA 4CYJA 4QTCA 4NH1A 3P0MA 2R3OA 3H4JA 3DBCA 4X3FC 3TWJA 2ONLA 3KRWA 2B52A 4K2RA 4AZSA 3V01A 5J7BA 3HV7A 3T9IA 2V5QA 1ZRZA 2V62A 2XIRA 3GC7A 2A19B 4GG7A 2GCDA 3LCSA 1EH4A 3GFEA 3FL5A 4ZLYA 4UMTA 3UVPA 3Q6UA 4U45A 5AMNA 4O0TA 5DN3A 4GT5A 1K3AA 4GFMA 3TNWA 2YEXA 3LM0A 4KA3A 4GV1A 5ANEA 4A06A 1DS5A 5IMXA 2X2KA 5M4UA 5FUTA 1XHAA 3VS2A 1G8SA 4L44A 5DNRA 1AD5A 2C0OA 3Q4ZA 4UN0C 4QMZA 3VUIA 4UYAA 4KIOA 3MIYA 2ZDUA 4JL9A 4TL0A 5LWNA 4CMOA 4XS2A 2JC6A 3ORKA 2PTKA 4WOVA 3MWUA 4LUEA 4U8ZA 4O0UA 3IOKA 3RNYA 3MH0A 5KCVA 2ITXA 4O86A 4JOAA 3N4TA 2GDOA 3C9WA 4X2KA 3QZGA 4ANMA 4EJ7A 1GJOA 3ORXA 3IW6A 5IUIA 3TN8A 4YPSA 3F82A 3R83A 3OC1A 2VWYA 2VZ6A 2YFXA 4D58A 5JN2A 2B53A 4O6EA 3DXPA 4AUAA 4EOIA 4XV9A 3DJ6A 3PVBA 3G0EA 3O8PA 4O2PA 4E73A 2HZ4A 2J4ZA 4ZTNA 3WZKA 3ZRMA 3EQPA 3R9OA 2Q83A 4JX3A 4YJRA 3R9NA 3PPKA 4X2JA 2QOHA 2VWVA 4OTHA 4E6DA 5FG8A 3DU8A 3BHTA 3FUPA 4R5YA 5GJDA 1OITA 3FHIA 3QL8A 3DKCA 3MY5A 3COKA 1VZOA 4J71A 1Q8UA 3NW6A 4JAIA 3MPAA 1YDSE 1ERKA 2XBAA 2FSLX 2CPKE 4GUBA 3QTQA 4OTPA 1U5RA 3AC4A 4IX5A 3U8WA 2OIQA 2I0YA 5FBOA 2I1MA 4FBXA 4U79A 3QZFA 4WNKA 5HTCA 3K2LA 4G17A 3A61A 4WUNA 4RWKA 4YZDA 4BBEA 1L8TA 3CPCA 2YCRA 3PJCA 4HVDA 2XNOA 3BLQA 3Q3BA 4RJ8A 3GC8A 3N9XA 4NTTA 3ROCA 3H9FA 3HRBA 3L9LA 2WQNA 3QLFA 3UYSA 1FBNA 4B7TA 4C3PA 4XP3A 4BDJA 2PVJA 1MRYA 5J79A 3FEGA 5C4LA 4CYIA 5EYMA 4XNEA 2JKQA 3CQUA 4IM2A 4XBUA 4FV2A 3LLAA 3UYTA 3E87A 5HTBA 3ZRKA 4DT8A 4D55A 4LM5A 1REKA 4ACGA 3ATTA 4KRCA 5H8BA 2ITNA 3EN9A 3NEWA 2YIWA 1OI9A 3GCQA 3OZ6A 3QAME 4WA9A 5CQWA 5IA4A 1PXLA 4QMMA 3UQFA 1OL6A 3F69A 4FKQA 5CF8A 1LR4A 2XS0A 1LEZA 4WG4A 2QKWB 2XMYA 3WE4A 2XM8A 5E8XA 4MXCA 5ETAA 1OPKA 4D0WA 1UWJA 1GIIA 2OJFE 4MX9A 1PXJA 2GS7A 2YDIA 5HG9A 1H24A 4I0RA 4KKHA 3PG1A 3QTZA 4HCVA 3R63A 4HGEA 4TRLA 3A4PA 3DTWA 4II5A 1VEBA 2R2PA 2F49A 1CM8A 5DE2A 4ZSAA 3VWAA 5A46A 4YZBA 2YZLA 4FYOA 3VUGA 5HX6A 1OL1A 2Y4PA 5FRIA 3NVKI 1SNXA 4BFMA 5EQEA 1PXOA 4FK3A 4KKEA 5EM5A 1FVVA 1YHSA 4QQJA 1LPUA 4F1OA 4RJ6A 2XNNA 2JFLA 5C27A 5K4IA 3FLSA 1FGKA 4IADA 5EW3A 1Q97A 1Q24A 4IW0A 3CLYA 3KXMA 3OT3A 2ITVA 2QCSA 3BEAA 3EWHA 3R22A 4O22A 4ZP5A 1IASA 3FSFA 2QVSE 1ND4A 1WBNA 3WOWA 4AN2A 1VJYA 1ZYJA 2IVSA 2UZBA 2OI4X 4PTEA 1H01A 2P55A 3O8TA 3B2TA 4ENYA 3DV3A 3GI3A 3DZOA 4C36A 4D2VA 3AQVA 1APME 2YLFA 1NVSA 3LLTA 4M14A 1V0OA 4YJPA 4EJNA 2UW9A 3G9NA 4XP2A 4YJNA 4F9AA 3MS9A 2W17A 4FKIA 3DBFA 2Z60A 4XG8A 4DH7A 3R7VA 2UVZA 1P4OA 2P2IA 4A4LA 4AA4A 4OUCA 4B0GA 2QU5A 3BX5A 5GJFA 5HQ0A 4N0SA 5IISA 3S4QA 4RMZA 3QYWA 4GG5A 4QMUA 4QPAA 3ATSA 2P0CA 4BDKA 4Q9ZA 2VV9A 5EFQA 4F6WA 4F7JA 1URWA 2WMBA 1RJBA 4MF1A 5T6KA 4BCOA 3WARA 2ZM1A 3QHRA 5CLPA 3ZLXA 4F9WA 4L46A 5FM2A 3TDWA 4GVJA 5E8VA 2CKOA 4R7BA 4EK8A 4QTDA 3R8MA 3A2CA 3LFEA 2YLEA 2GPHA 4FIJA 4JXFA 4FKLA 1WFCA 4DFYA 4FSUA 3NUAA 4FEXA 3P9JA 3U6JA 2XK8A 3KRRA 4BTJA 4APCA 3IOPA 3C13A 3R30A 4M8TA 3VS6A 2JIIA 2BROA 3NIEA 4DEDA 2O65A 5CYIA 3G51A 2Z7RA 4LQMA 4M15A 1WVWA 3VUDA 3MB7A 5D1JA 5HESA 2VTNA 5ANDA 4YGAA 2XB7A 4QQCA 4BZNA 4X0MA 3NZ0A 3NNXA 1ZY5A 4BIDA 4FV3A 3NAXA 5JSMA 2ZV9A 1BX6A 1I44A 4Q5EA 4QMWA 5CSWA 3UP7A 1Q8YA 2XBJA 3D9VA 4AW5A 2UW4A 5BQ0A 2PYWA 3E8CA 4FGRA 4W8DA 3NUNA 2EUFB 4XRJA 4YNOA 4A7CA 3KVXA 4ZSGA 3DAEA 5JFXA 5EKOA 3GGFA 3JVSA 4JVGA 4I23A 4WD5A 3A7JA 3AXWA 3EKKA 3WF7A 3ZLWA 1OPJA 4DEEA 2Y4IB 1PXPA 1ZMWA 2ZVAA 3OG7A 1Q8WA 3AC1A 4LOQA 3ZSHA 5IQEA 1OPLA 4FZ6A 3GU8A 4N4SA 1KV2A 2BMCA 5CWZA 4E26A 3RNIA 1DI8A 4HYSA 4HGTA 2XEYA 3HUBA 2J0IA 4IAZA 2OGVA 4GK2A 5EDPA 4BB4A 4FSRA 3FI2A 3G6HA 5DIAA 2XYNA 3M11A 3PJ1A 2UZOA 1Z5MA 4M69A 3KN6A 2CDZA 2QKRA 2HOGA 4KIQA 2VTAA 4MXZA 4RLLA 4XUFA 5J9YA 3R8VA 4QTEA 3ERKA 1LEWA 3A60A 4YO6A 5JFVA 2OKRA 2PVHA 4NM0A 4A9YA 3R7EA 4I1ZA 5GNKA 4MQ1A 4R1YA 3SAYA 4ITHA 5B2LA 2BZKB 1U54A 3JY9A 1OVEA 4IXPA 5D7AA 4NIFB 5C01A 4XG4A 4E3CA 3FMEA 1S9IA 1XH6A 2B9HA 2WTCA 5BMMA 3KXGA 2XK7A 4MD7E 4GVAA 4OT6A 1U4DA 2HXLA 4U3YA 4WSQA 4AFJA 4GT4A 4QMLA 2XA4A 2WQEA 3SXSA 3ZMMA 5DPVA 3ULIA 5JKGA 2FH9A 3ZXZA 1QMZA 2DWBA 2OXYA 2RKUA 4A9SA 2UW7A 3E5AA 2VWUA 2VO0A 2BAJA 3TKUA 4CV9A 5E7RA 2ZB1A 4G3EA 5HE2A 3KB7A 2O5KA 3PXFA 5CT0A 3SD0A 4AG8A 4FKWA 4CLIA 3KREA 5CU3A 4LYNA 3Q53A 4R6VA 5E8WA 3RCDA 3RBWA 1H8FA 3FHRA 3PIXA 4IZYA 3OOMA 4GRBA 3IKAA 4IVAA 3R8ZA 4E5WA 5HBJA 2PU8A 2R0UA 3O23A 3BGZA 5DR6A 3CS9A 5AP3A 3LJ1A 3UDBA 3W2QA 2J2IB 3RI1A 2VWWA 5A4TA 3FXXA 1R78A 3QUEA 2FB8A 2YIQA 3HA6A 1UNLA 2VTOA 4FNYA 4QMPA 4YHFA 4PP9A 4LL5A 2O63A 4X7QA 3PFQA 2VGOA 1CTPE 4FZ7A 5LVLA 2IW8A 4C57A 5IQFA 3EZVA 3FE3A 2IZUA 4BGHA 1NT2A 4FTOA 4O82A 2EXMA 2JLDA 2YABA 1B39A 4QO9A 3LJ0A 4DE4A 4UWCA 4IM3A 5KE0A 4FX3A 3TT0A 3VW6A 5HI2A 3PXRA 3D2KA 4EHVA 3KC3A 4E6CA 2J50A 4O7VA 5BYZA 4UMQA 3BU3A 4DTKA 1YXSA 5EYCA 3OBGA 4UB7A 2WU6A 1ZWSA 3ORMA 2WO6A 2QC6A 2XNPA 4OT5A 2X7FA 3FZTA 3R2BA 4RVTA 4XJ0A 3BE9A 5E8ZA 5H8EA 3RAWA 3VF9A 4CEGA 3LOKA 4G3FA 3G2FA 4UBAA 5D11A 3I4BA 4EZ5A 4YURA 2VNYA 5EI6A 5L6OA 2YM3A 2C3LA 3R7UA 3WZEA 3MY1A 1MRVA 4D28A 3BWJA 5AM6A 5IEVA 5FXQA 4P5QA 4QMYA 5IA1A 2XIKA 2GTNA 3F88A 4PTCA 4UALA 2EU9A 4F1MA 1GNGA 2OK1A 2W1DA 3OWPA 1PF8A 2BAQA 3PYYA 3QZHA 5CU2A 2R9SA 4UZDA 2QHMA 3E7VA 3F5GA 4XEYA 2C3IB 4JQ7A 4EOLA 3DDQA 5EM7A 4ZJJA 1WMKA 3KRLA 4I5CA 4TPTA 4ZSLA 3GC0A 4RIYA 2DYLA 3U6IA 1W83A 4JBOA 4DA5A 3QF9A 5DH3A 3VUKA 5CS6A 4BI2A 4EH7A 4R7IA 2W05A 5IH5A 2V55A 3ZRLA 4U40A 2JEDA 2PVFA 1JKKA 3JY0A 3D14A 2ITWA 4EYMA 4CD0A 4UMPA 1ZMVA 4MXYA 4ERWA 3QQGA 4DH8A 5LVNA 1BKXA 4FL3A 4X2FA 3QTWA 1UA2A 2ZMDA 2X81A 2NPQA 2ERZE 4EUTA 4LV8A 1GIJA 3BQCA 3OVVA 3BWFA 4I6FA 3I6UA 4E4LA 4Z55A 3AOXA 3KULA 4PX6A 1SVHA 3ZONA 4S2ZA 4EOKA 1SM2A 2J0MB 4ACMA 4D0XA 5CXZA 4ZTRA 2WIHA 4QYFA 4NCTA 2GU8A 4K9YA 4BDAA 4FKVA 5ACKA 2BALA 2GHLA 5EYDA 2BDJA 3FKLA 3DFCB 4O0XA 3R8PA 3NIZA 4IJ9A 5BVEA 4BIEA 5J9LA 3RPVA 3LAUA 2WQMA 4W4VA 3NYVA 2VTLA 5IUHA 2I0EA 5IUGA 3E7OA 2GSFA 4IMYA 4O1PA 4CKJA 4PUZA 3OHTA 2BVAA 3IGGA 3ZHPC 3FLZA 4HCUA 4ALWA 2JBPA 2B9JA 2ZJWA 2RFNA 1M7NA 4O38A 2VD5A 2PMLX 5IQHA 3WF6A 4UWBA 5K3YA 2XK3A 5AUTA 4FV1A 2X6DA 5EM8A 4KAOA 3TUDA 3PVUA 1ZY4A 2G9XA 1KE6A 2VO7A 3KXXA 3F3TA 2JDOA 4ZEGA 3A99A 2YIXA 3TJDA 4YHTA 4J96A 4NCTC 2Y9QA 2IWIA 3DZQA 3ODYX 3MVHA 1VYWA 4FL2A 4KS8A 4OTQA 4YZ9A 5BVWA 4AW1A 3I5ZA 4TYIA 5E8SA 2IVVA 4USDA 5LVPA 4TYJA 5EK7A 3S00A 2Y0AA 3D4QA 3DNEA 1RQQA 2X1NA 3MFUA 2VAGA 4P4CA 3DOGA 4RRVA 3ZH8A 2IJMA 3PRIA 2BAKA 4MBIA 4FI1A 4M68A 2VU3A 4C4IA 4GW8A 3I60A 2WU7A 2EXCX 4AOIA 2QOIA 3QWJA 4RA5A 3QHWA 3QYZA 3FWQA 5BUIA 4TW9A 3QQKA 3I1AA 4C33A 2O3PA 5IPJA 4FT7A 4RQVA 3RPYA 2OJ9A 3WILA 1XH7A 2JKMA 3LFFA 4GIHA 5HEZA 5J9ZA 2PZIA 4LMNA 4JQEA 2QOQA 3BLRA 2RFEA 2ZAZA 4D1SA 5BVFA 2XJ2A 5CT7A 3DBDA 3GT8A 3EOCA 4IIRA 4RX9A 4TYGA 2A0CX 2XP2A 4UXLA 2J9MA 2PVRA 2QG5A 3UVRA 2VTTA 4I6QA 3ZO4A 5AUZA 4MYGA 4PL5A 1W98A 2F2UA 4FTQA 3ZM4A 3QTUA 4V0GA 4IAAA 4FC0A 2HW7A 3Q9ZA 4L01A 4TWCA 4QP1A 4RC4A 5F4NA 4WT6A 5CVFA 4ASDA 4U43A 5EOBA 3NRMA 3DLSA 4EHGA 4BZOA 1OB3A 4S31A 5AEPA 2OWBA 3H30A 5E8YA 4IACA 4C2WA 3IK3A 4H3QA 4PDPA 5LWMA 3QCSA 4E4NA 3DK6A 1UV5A 3A7IA 3FQSA 4IB1A 4MNEA 1FVRA 4FV8A 4QP3A 4F9CA 5I9YA 4ZXTA 5LMKA 5T68A 4MKCA 3FMLA 4H3PA 2Y6OA 4TWPA 1BI7A 2ZOQA 4RZVA 4HVHA 4C2VA 3PP0A 2Y4IC 4QTBA 4GMYA 2O8YA 2PE1A 3H0ZA 3KF7A 3U9NA 4CT2A 3UIMA 4QQ5A 4YUQA 2W1CA 4AZTA 1BL7A 1WVXA 4ZTQA 2X8DA 4P7EA 4FTKA 5HNBA 1H1RA 4LGHA 4P90A 4W4YA 5J8IA 1W8CA 3WF9A 4L43A 3VVHA 5KMOA 3UO6A 4FVQA 3H3CA 5J1WA 3HMIA 1E1XA 3C4EA 4YZCA 3NW7A 3FBVA 4D2RA 2YAAA 3H0YA 4RZWA 3PWDA 2LGCA 2CGVA 1YXVA 4IH8A 3LQ3A 3PJ3A 1KWPA 5TKDA 3POZA 2GHGA 1KSWA 3MA6A 3TNHA 3P86A 3A62A 1YXTA 4OTGA 3VJNA 3V5QA 4AX8A 4PL4A 3T3VA 5IZFA 3QRUA 4JG7A 5AP1A 5HE0A 1Y57A 3K3JA 4ZTHA 5HVYA 1WBVA 2C5NA 4ANNA 3TL8A 3FSKA 2OH4A 3QU0A 5M4CA 3BYOA 3KFAA 1FVTA 3QD3A 2Z7SA 5HX8A 3V5PA 3R7GA 5KMLA 5B2MA 4BYJA 5A4EA 2RF9A 4FTJA 3Q52A 2GNHA 2Z2WA 3BKBA 4C02A 4GYIA 2BR1A 4RJ4A 1CKIA 4I0SA 5D41A 2QNJA 2RGPA 3GNIB 3R73A 2CN8A 4R3RA 2CMWA 1OECA 3I7CA 2X39A 1HCLA 2HZ0A 4QP2A 3TTIA 3MN3A 4IFGA 4JBVA 5JT2A 4WHZA 2H9VA 3EFWA 4X3FA 1GIHA 1M2RA 2BFYA 3EYGA 4NZWB 3NDMA 5DHJA 1QPCA 3OP5A 1GZNA 2WNTA 2G01A 3QLGA 2C1AA 4O0VA 5AV3A 2I40A 2W1GA 4BDGA 4IX4A 3ZM9A 4R1VA 2J5EA 4U81A 1OBGA 4ORKA 3UC3A 3D5VA 4BCGA 1XWSA 1Q99A 2W4JA 3TZMA 2W06A 3E63A 1ZOHA 2BTRA 5IQDA 3H9OA 3NUYA 4D5HA 1ZAOA 3IDPA 4RIWA 4BCMA 4YPDA 4CXAA 2I0HA 4CFWA 4HYIA 5JRQA 3IGOA 1M2QA 2UW6A 2VO6A 1R3CA 3PXYA 4IQ6A 4F08A 2YCFA 3EQFA 3F3WA 3PA3A 2VO3A 2WMAA 3AT3A 3F2AA 2PVNA 4IAYA 4CGAA 3HRFA 4IZ5A 1OIQA 4WG3A 4EOMA 3CBLA 4ZS0A 1TQIA 3PPJA 3UMXA 5BVNA 4XOYA 3FLQA 2R3PA 3R7IA 4O91A 3AGMA 3O8UA 3ULZA 4O7WA 5L2IA 4MAOA 3D7TA 3MFRA 1Q5KA 5AUXA 1UU3A 3R04A 3UZTA 5HKMA 2ACXA 2ITUA 3IW4A 4FA2A 3ACKA 4UX9A 3PLSA 4BKZA 1ZYCA 3DAJA 4DT9A 3OY3A 4AU8A 1OMWA 3FZOA 2I6LA 4WG5A 2WKMA 4F7NA 3W2SA 4QNYA 4JDJA 3C50A 4KSQA 3BEGA 3ZBFA 2R64A 2Z7LA 2ZV2A 5ITAA 5HLWA 4L67A 3LQ8A 3RJCA 1H00A 1KOAA 1T46A 4OTWA 3UO4A 4PDYA 5F1ZA 3RAIA 5DI1A 4EK6A 4PP7A 5L8KA 5L3AA 2I0VA 5GZAA 2YM8A 3LMGA 3TIZA 3V6RA 2PE2A 1TQMA 1X8BA 3ZEPA 4KNBA 5IMEA 3Q9XA 1NVRA 5DEYA 4BWPA 2H8HA 2EVAA 2BIKB 4GH2A 3ORNA 1AGWA 1Z9XA 4FTUA 1PMUA 2DUVA 4FKTA 5KBQA 3R8UA 2X6EA 1QPJA 2FGIA 3TI1A 3WYXA 5A54A 5H3QA 4BICA 3C0IA 5HORA 5GIOE 4J99A 5HBEA 5A4CA 5JH6A 5KMJA 5EH0A 4I22A 2C0TA 2J0JA 3LCOA 2JIVA 5HTIA 4U80A 3NCZA 5IQIA 2VWZA 2GQRA 4BGGA 3PSDA 3L1SA 2YERA 2B4SB 3MI9A 2QOKA 3IW7A 3QUPA 3CCNA 4JDHA 4D9UA 4YLJA 4CZUA 2QO2A 3EQCA 3E92A 4AGCA 2R3JA 3VRZA 4A07A 4EONA 1K2PA 3N4VA 4FKJA 4PMMA 1YXUA 4IB0A 4CCBA 3EQIA 4C35A 3C4ZA 4ZK5A 2QU6A 2C47A 3U51A 2JKOA 1SVGA 2R3MA 4IDVA 5HE1A 3BBTB 4IVDA 2PSQA 3QKKA 2VTPA 4XYFA 5LXMA 3AGLA 5HIDA 3LXLA 4D2WA 3KGAA 2C6KA 3BV3A 3AMBA 3BU5A 3O17A 3Q5IA 4FSQA 4V01A 3OBJA 3HUCA 5C8MA 1Y8GA 4FNWA 3VJOA 4O0SA 2P3GX 4TKSA 4I20A 3C5IA 3VUHA 2VTQA 3SGCA 1YDTE 4Y72A 4OBPA 4S30A 5AAGA 5IH4A 4I24A 4IM0A 2BRMA 3MW1A 5LARA 4EH9A 2YZAA 5CALA 2XF0A 1GY3A 4E6QA 5ICPA 2GNGA 4RSSA 3TNIA 3HNGA 1OUYA 2CSNA 2OICA 3BELA 4C58A 3UBDA 2QQ7A 5JQ5A 3A8XA 5ANKA 1PMNA 3LFCA 4DGGA 5A4QA 2ITOA 3ZO3A 4JX7A 1MQBA 4DG3E 1UVRA 3FMNA 3V04A 3PSCA 2J90A 4R7HA 4FZAB 3P23A 3FZPA 3PY0A 4W9WA 4EC9A 4AOTA 2CKQA 3RINA 1Q8TA 1JQHA 3K5UA 4D1ZA 1GZKA 4DBNA 5JZJA 5L2SA 3DNDA 4BCKA 3UOJA 4Y85A 5M07A 4G5PA 4C8BA 3FZSA 4CRSA 2J5FA 2OZAA 4D2SA 4R3PA 4TYHA 2C3KA 4MNFA 4RPVA 4XV2A 3WYYA 2PUNA 4YBJA 4FF8A 3OEZA 3FAAA 5FGKA 4H05A 3AMYA 4DEGA 2J7TA 4WNPA 3FC1X 1W7HA 3E8DA 4PDSA 3CJGA 3JXWA 3LJ2A 3OWJA 1WZYA 3ZO2A 3E88A 2ETMA 3CPBA 3OXZA 4M0ZA 1IA9A 3G9LX 5BYYA 1OIRA 3FKNA 3QGYA 1JSUA 3BBWA 5KMMA 1G5SA 2HY81 2RIOA 3CIKA 2XM9A 4IEBA 5FDXA 4BYIA 4GL9A 1P2AA 1Y6AA 5FDPA 3MPMA 3VS3A 4O7ZA 1Q3DA 4L6QA 3I0OA 4YHJA 1Q8ZA 4QPMA 4F1TA 1BUHA 3PXQA 1SNUA 4X6QC 2PMOX 4DG2E 2PWLA 3C1XA 3FJQE 3HX4A 4J8MA 4TZRA 4FTIA 3PE2A 3R9HA 4K6ZA 5CU4A 2OLCA 3KMUA 3F7ZA 3QX4A 4MD9E 5AIKA 2V7OA 3LFDA 3LFQA 3RMFA 3R1QA 4I6HA 1KE8A 3PA5A 4JLCA 1TQPA 5D7VA 3T8OA 4BBMA 5KMKA 4IWDA 1YOJA 4NUSA 2XK4A 1UU7A 3F3UA 3CJFA 5I3RA 1M7QA 2HW6A 4NWMA 2X4FA 3RZBA 5KHWA 3I79A 4IFCA 5KZ0A 3ZZEA 4U41A 1KE5A 4QYYA 4C4EA 4EORA 2KTYA 5M4FA 5FWKK 2VTIA 3UOKA 4QMVA 3COMA 2BZIB 4RA4A 3UNJA 3EN7A 4F09A 3HRCA 5FD2A 3SRVA 2QLUA 4EI4A 4NL0A 4O2ZA 4DFZE 1IRKA 3R02A 4RVMA 5C4KA 1V0BA 4N6ZA 3VS4A 4ZZOA 2IN6A 1H0VA 4AAAA 2J51A 5M08A 5LOHA 2C30A 2CKEA 2Q0BA 1F0QA 2QOFA 1OKYA 3HMPA 3L9NA 1VYZA 2O2UA 3W8LA 3RM7A 4KIKA 4IVBA 1E9HA 4NJDA 4AACA 4ALVA 5AA9A 2X7OA 4M66A 2W1FA 5KHXA 5HLNA 2VRXA 2FSMX 4U97A 2IW9A 4ANSA 2VTJA 4DEHA 3T9TA 1NXKA 4FSNA 4Q2AA 3GVUA 2OJJA 4ERKA 2CGXA 3A7HA 3LFAA 2HXQA 2YM7A 4EQCA 1KE7A 3V5WA 5A14A 3SA0A 3CSVA 2QHNA 3F3VA 3QQJA 3TV7A 2RFSA 1IA8A 3SOAA 5M57A 3QKMA 3SVVA 2YM6A 4O96A 4MF0A 2C6MA 3NWWA 5FBNC 5DT3A 2BZHB 1PHKA 2IO6A 2YITA 3PRFA 3ZU7A 1NY3A 4H39A 2Z7QA 4FKPA 4D1XA 2IG7A 3F5XA 3PPZA 4LL0A 4QMTA 3E8NA 2PE0A 4R3CA 5DBXA 4CSVA 5DGZA 3C4XA 4JDIA 3E3PA 4IVCA 3R2YA 4I6BA 4NSTA 4F6SA 3BPRA 3DPKA 5C8NA 4LOPA 3KK8A 3U87A 3VHKA 3F3ZA 3F2RA 5E90A 5J1VA 1URCA 1XKKA 3V6SA 1R39A 4PV0A 3UNKA 3ODZX 2BDWA 4LUDA 3WI6A 2CLXA 3OFMA 4KRDA 2QOOA 4EC8A 3HKOA 2XZSA 4AGUA 3L8XA 4BDHA 1H1QA 3ZTXA 3PZHA 5DR2A 5I9WA 4KS7A 1H08A 1FGIA 1Q41A 3BHHA 3DKFA 3P4KA 4G5JA 3I6WA 4L7FA 4FIGA 4EK3A 2ITZA 4EH2A 4FTAA 3G5DA 3OCBA 2R0IA 3NMUF 4EOPA 4QYGA 3QA0A 5BX0A 4BRXA 1PRYA 5IH6A 4AT4A 4EH8A 1Z57A 4QP8A 2I7QA 3W33A 4YJTA 5JFWA 2CNQA 3LXPA 3S2PA 3QD0A 2W5HA 1JKSA 3W10A 5ACBC 4JQ8A 4JBQA 1IG1A 5IA2A 4M13A 4L3PA 5DOSA 3FMJA 1CSNA 2R3FA 1H07A 2E9VA 3KCKA 4RWLA 3MA3A 4OGRA 3HV5A 5ETCA 5FTQA 5AUVA 4BDEA 3V8TA 2PK9A 3ET7A 3VQHA 1MQ4A 4EEVA 4DEBA 4ACHA 2JGZA 1B38A 4KKGA 3QFVA 4CFNA 1UKHA 4V04A 4ZSEA 4IZ7A 2X7GA 5K0KA 3F6XA 5L2QA 2CCHA 4BCNA 3S0OA 4XV3A 3GCVA 4F6UA 3PWYA 3EIDA 4AXAA 4FIFA 3DT1A 5FEQA 5TR6A 5ANIA 3Q4CA 4N57A 5FQDC 4FV5A 3GC9A 2G2IA 5FEDA 5HBHA 5CAUA 4QPSA 3VN9A 2B55A 1J7UA 3SC1A 3O50A 4ANBA 4DFXE 4X6RA 2W0JA 2A2AA 3MBLA 4K11A 2FA2A 3D5WA 4YJVA 4F0FA 4K1BA 2IPXA 2GMXA 2IVTA 2PMNX 3NUPA 4HYHA 1W82A 4EWHA 2WZJA 5CVGA 5E8UA 4NM7A 5DLSA 2YACA 3WZUA 3FZ1A 3IPHA 4JRNA 4MEDA 4EZ3A 5AP6A 5M44A 2VTHA 2WOTA 4ACDA 4AE6A 4O0WA 3MESA 3ALNA 1TVOA 5EW8A 5TF9A 1ZOGA 3AD4A 4EKKA 5AADA 4U0IA 4RWJA 4X2NA 4ACCA 3UO5A 1YOLA 2WTKB 3C0GA 2CNUA 1XH9A 4IC7A 4MXOA 4L9IA 2UZWE 2YHVA 5BUJA 4FV4A 5CSXA 2P4IA 5AP2A 3P7CA 1PMVA 3FQEA 3D5UA 3QUDA 3KF4A 3VBWA 1ZOEA 3A7GA 3LCDA 2ITYA 3R6XA 5H8GA 3QGWA 4YMJA 4PF4A 1UU8A 4BHNA 1FOTA 4TNDA 4ZMFA 2CKPA 3D0EA 2UV2A 5B0XA 3O51A 5DRDA 3ZOSA 2XRWA 1ZYSA 4RVLA 1QPDA 4YO4A 3VQUA 5CEPA 1YW2A 3GBZA 2A27A 3NUUA 4QMOA 3ZLSA 4F0GA 4O1OA 3UC4A 4G3GA 3Q4TA 4Y46A 2REIA 5E91A 5LCKA 5CAVA 3CTQA 3ORZA 1U46A 3TV6A 4C7TA 1XBAA 5E1SA 2WMQA 3VNTA 5DFPA 4WBBB 3KXHA 3DXNA 4OW8A 3NS9A 4AGDA 3FLYA 5TT7A 2OU7A 5AV0A 5J5TA 1J91A 4RWIA 5JK3A 4O0RA 2PUPA 2WTDA 3Q5ZA 3SXFA 3QA8A 3MFSA 5IEXA 4L42A 3EMGA 4HJOA 2KULA 4IWOA 4KBKA 4KINA 5F94A 4ZIMA 2JAVA 3IW8A 2J0LA 2XCHA 2FYSA 1FQ1B 4NW5A 2OBJA 3CQEA 5DT4A 1H28A 5CEOA 1DI9A 2BRNA 4QMXA 1MP8A 3CC6A 3NCGA 2ETKA 3R9DA 4YNEA 5BYLA 2ESMA 5I9XA 3W2OA 4RFZA 5KMIA 5GIPE 2CGWA 5EHOA 4ZTMA 1XO2B 3R01A 3DTCA 4FKOA 4FV6A 3MVLA 2GTMA 2PY3A 4WBOA 5EDRA 5HD7A 1YI6A 4XG7A 4TN6A 5DG5A 4FIEA 2NNWB 4FTNA 2C6EA 3I7BA 1ATPE 4CMTA 1XH4A 3EQGA 3OW3A 4J53A 4FEQA 4ZTSA 4FG9A 1KV1A 4BHZA 3FY2A 1YRPA 2R5TA 2GFCA 2B9IA 4RIXB 2XYUA 3RK7A 3UP2A 5D9HA 4AA0A 2OO8X 2Y6MA 5LCJA 2F2CB 3PVWA 4K77A 1OL5A 5JGBA 2HCKA 2JDTA 4E93A 4O84A 2GS2A 3RHKA 2ZV8A 3NYOA 4PMPA 5JMSA 5DRBA 2W9FB 4BDCA 2B7AA 3PIYA 4BI1A 3EB0A 5AR3A 1OBDA 3EFKA 3ZBXA 5BVOA 1PMEA 3AC5A 1P4FA 2JDVA 2GQGA 3C0HA 3I0QA 2BUJA 2XNBA 1H1SA 3D94A 4Y95A 3MH1A 5CF4A 3TDVA 4F65A 2VUWA 3BV2A 5AP0A 3SV0A 3GFWA 4MXAA 4Q5HA 3QTSA 5DVRA 3R7OA 3CY2A 3GCPA 4FVPA 4B9DA 1XH5A 4FSMA 3UOLA 4FG7A 5AUYA 4G6OA 4IAFA 4YP8A 4FKRA 2H96A 3KXNA 3DLZA 3WZDA 3PY1A 1F3MC 4FIIA 3PJ2A 3R9RA 2QODA 3V5TA 2NO3A 1BI8A 3D7ZA 2XKDA 1I09A 2CJMA 5AUWA 4BDFA 3DAKA 4JNWA 3ZO1A 4EOOA 5CZIA 2QR8A 1L3RE 4U44A 4N70A 3LVPA 3OF0A 2R7IA 3ITZA 4GS6A 4M7IA 4XLVA 4ALUA 3FI8A 2WTWA 3HMNA 4MXXA 3PZEA 4D5KA 1Y6BA 4UV0A 3LZBA 2Y7JA 2ZMCA 4F7SA 2ETRA 2BCJA 1V0PA 3HL7A 4Z9LA 4C4GA 2X0GA 3FZRA 1M17A 1Y91A 2UVYA 4J95A 4UMRA 4JG6A 4CG8A 3KU2A 3NR9A 5CNOA 4L68A 5ETIA 3CR0A 3TZ7A 3BQRA 4IWPA 3C4WA 3GQIA 3MY0A 1OKWA 2QOBA 4BBFA 3KY2A 3LCTA 4R8QA 3TACA 4F4PA 3EL8A 3QKLA 3RAHA 2C69A 4CTBA 2WMTA 4EK4A 1ZYDA 3DK7A 4KBCA 4LI5A 4AF3A 4PNKA 2XRUA 3QD2B 2E9NA 4MWIA 1XJDA 4X2GA 2JIUA 4I5HA 3SX9A 3KEXA 4CQGA 5F9EA 3AC3A 4LFIA 4AZFA 4B6LA 3TUCA 4P2KA 3WIGA 2A4LA 3GCUA 5L6PA 5L8LA 4OLIA 2ZV7A 3VBYA 4Y8DA 1PKDA 3A7FA 3MPTA 3B2WA 4NIFA 4USEA 4BWXA 3PA4A 4D4VA 5I4NA 5E4HA 3HMOA 2CCIA 3NYNA 4BR3A 2YCQA 3QTIA 4YZNA 1XH8A 1OUKA 4Q9SA 4YJOA 4DN5A 1J1BA 3DB8A 4EHZA 4OAUC 3QD4A 5HCZA 2QONA 5HD4A 4FTLA 5IDNA 1PXMA 2BHHA 3BI6A 1CKPA 3FY0A 4IBMA 4MD8E 4FUXA 4MWHA 4AZVA 4E6AA 5HZNA 4W4WA 1YHVA 5CY3A 2IZTA 4XH6A 3CXWA 3E64A 3V51A 2BKKA 3HAVA 3VUMA 4TTHB 1JLUE 4FUYA 4BZDA 4NFMA 3LW0A 2WQOA 4CFXA 4HGLA 2WB8A 1YHWA 5IQBA 3UZRA 4B8MA 1OL2A 2EB2A 4WO5A 3P5KA 4HCTA 3BYSA 2OIDA 2OSCA 1YI4A 3Q9YA 4BC6A 1ZYLA 3QTRA 3QXPA 5DEWA 3GB2A 1P14A 5HLPA 5ANOA 1DAWA 2UW3A 2IW6A 2P2HA 5HG7A 4C4JA 4CNHA 4G34A 3EFLA 3L8VA 3MH2A 2PZYA 3W32A 4FV7A 2WMUA 4IHPA 3FLWA 1FPUA 4JIAA 5FM3A 2R3NA 3CKXA 4C4HA 3LXKA 5J7HA 1KUTA 1H4LA 5K9IA 1E1VA 2UUEA 3QQLA 2W1HA 3MVMA 2FO0A 2JFMA 4FV0A 3QRTA 5EM6A 2J6MA 4AS0A 5EQYA 1JSVA 4ANQA 3OCGA 3GU5A 3HLLA 4J8NA 5CAOA 1R0EA 3SQQA 3LCKA 2YIYA 4PRJA 3FC2A 2WMVA 2ZDTA 4QMSA 3FYJX 3SOCA 4CTCA 2OH0E 4PDOA 4CKRA 2BTSA 3U4WA 3RM6A 1RDQE 2F7EE 4AW0A 2UW0A 3IO7A 4PTGA 3VUTA 1WVYA 4FZDB 3F7WA 2ITPA 4YSMA 3ENHA 2BHEA 4I5MA 5F20A 2VX0A 3MH3A 3MJ2A 5CVHA 3R00A 4O83A 3BHUA 3FXWA 3OTVA 4M3QA 5EHLA 5AV2A 1FMKA 4QMQA 3Q2MA 3EQDA 4DHFA 3ZFMA 3LMHA 4RX8A 2PZ5A 4FNXA 2E2BA 3KRJA 2B0QA 3HVCA 3QZIA 4BTKA 5BVDA 4P5ZA 2XJ0A 4OTDA 3SXRA 3C4CA 3FLNC 3PUPA 4U3ZA 3ANQA 5AP7A 5BUEA 4BKYA 4DITA 3MB6A 5CX9A 1YWVA 3QBNA 4NK9A 5CTPA 3RPOA 5DR9A 2C6DA 2C6OA 4ZAUA 2GS6A 3BU6A 3CD3A 3EL7A 3FL4A 4EH3A 3UPXA 1JVPP 4QP4A 3GP0A 5CEMA 2B1PA 5K5NA 3CTJA 4YSJA 2WTVA 2BDFA 2OXXA 3BLHA 5AWMA 4EWQA 4F7LA 3QRIA 4GKHA 1YI3A 3TV4A 4PPBA 4O27B 5FP5A 2UZVA 1A06A 3ALOA 3AD5A 3BZ3A 2PPQA 4OTRA 5HG5A 3RWQA 3ZUUA 2VTSA 4TNBA 4DH5A 2OFVA 3HGKA 4HPUE 1HOWA 4NM5A 5A3XA 4F9YA 4GU6A 3EN4A 2OF2A 2WTKC 4ZLZA 3P78A 4D4YA 4Y83A 5M53A 2IVUA 3K5VA 3Q6WA 3RKBA 1KE9A 4IB5A 5G6VA 5IA5A 3MVJA 2OJGA 4BVUA 5AFVA 4NKSA 5M06A 2F7ZE 4TWOA 4BCPA 4IWQA 5D12A 4DAWA 4FNZA 4M69B 5EW9A 5H2UA 4WIHA 1VR2A 2JKKA 4HZRA 3EQBA 3DS6A 4MQ2A 4E1ZA 5AP4A 4AN3A 1Q3WA 1H1WA 2IZSA 2YM4A 4Z7HA 2BFXA 2WHBA 3HP2A 2HK5A 3SDJA 4BCQA 2QOLA 4L3JA 4NT4A 5G1XA 1HCKA 4I5PA 5EHYA 4RIOA 4CFMA 4FT0A 4EQMA 5HO6A 3MFTA 4ANLA 4I3ZA 4O7NA 2UVXA 3ZDUA 3ZCLA 1U54B 4YR8A 1Q62A 4ZMEA 3RPRA 1OM1A 2UZLA 3OMVA 5HU3A 3JR1A 4KWPA 3R71A 2PVLA 4IDTA 5DT0A 2BKZA 3GU4A 2YAKA 3NNWA 5TO8A 3P7BA 1NVQA 2R3IA 2W96B 3POOA 4HYUA 2FUMA 2R4BA 4GFOA 2YISA 5K4JA 3NGAA 3AD6A 2PL0A 3ANRA 3KKVA 2VWBA 4G3DA 3MDYA 4HOKA 3TKIA 4UMUA 4I0TA 2C1BA 2W1EA 4RIXA 4A4OA 4FKUA 4IX3A 4BDBA 2ONLC 3PJ8A 3SG9A 4DF3A 4W4XA 3LIJA 5HHWA 1ZZ2A 4FG8A 4YC3A 2WEVA 3GENA 4L52A 5CSPA 2W4OA 3HV4A 1H1PA 3TKHA 3C51A 4EL9A 3QRJA 2YWPA 2RG5A 3QQUA 5EOLA 3UQCA 3G33A 2YDJA 2HAKA 3L9MA 1DM2A 5EI2A 5HIBA 5M56A 3QQHA 4WNMA 5CF5A 1WBOA 2W5AA 1Q4LA 5AR5A 5FP6A 4EK5A 1UWHA 1OKZA 5CZHA 2PUIA 4CFVA 1SVEA 4M12A 3D2IA 3ELJA 3EFJA 5AV1A 3MGYA 4M67A 4O7YA 4C59A 3M2WA 1WBTA 4S33A 3U55A 2BRGA 3V5JA 3GU6A 3Q60A 5AR8A 3OT8A 3DA6A 4G9RA 3V8SA 3TIYA 2CHLA 3SKCA 4ZJVA 5E92A 1WCCA 3KA0A 5CEIA 4RX7A 4IAIA 5AA8A 4FV9A 4GT3A 4AN9A 4H3BA 2QO7A 3KRXA 3BYUA 4CZYB 5DYJA 4RJ7A 4MHAA 4FICA 4RT7A 5A9UA 1JSTA 3MTFA 3TEIA 1WAKA 5FEEA 4BCJA 1LUFA 1JKLA 3VRYA 2QD9A 3BHVA 4V05A 3ZEWA 4D2TA 4R5SA 4JT3A 1YOMA 2EXEA 5AV4A 4G9CA 3FPQA 4FVRA 2QG7A 2W4KA 1DAYA 3KMWA 5KX8A 1UNHA 3AC8A 3HV6A 5HOAA 5KNJA 3DDPA 4GK3A 2P33A 2UW8A 3U9CA 3TTJA 3VAPA 3IDBA 4BIBA 3EQRA 3E93A 4F99A 5FXRA 4O7RA 5CASA 2VGPA 2UZEA 4BDIA 4DFUA 3DY7A 3ZLYA 1PYXA 5L6WL 1J3HA 4PPAA 4D9TA 3DJ7A 4YLKA 3LFNA 4O7SA 4YTCA 4GJ2A 4G16A 5LMAA 5AIRA 5HVJA 3RP9A 4C4FA 4OR5A 4I93A 5TE0A 4NFNA 3MTLA 4AZWA 4RIYB 5CSVA 1WBPA 3IG7A 2W1IA 2PHKA 3FKOA 4I92A 3MJ1A 4QNAA 5KO1A 3G0FA 2VWXA 2FSTX 4H36A 3VC4A 4GU9A 5C26A 4B99A 3ORPA 1V1KA 4S32A 2W7XA 5TOZA 2GFSA 3QC9A 3IQ7A 5AR2A 2XJ1A 4XHKB 3TXOA 3AG9A 4C3FA 5GINE 3FMDA 4G6LA 3FI4A 4AP7A 2YA9A 4MBLA 4RX5A 4K18A 4PMTA 3QC4A 3A4OX 1T45A 2HIWA 4O21A 4IE9A 3KCFA 4FKGA 4OBOA 5FLFA 4F0IA 3CEKA 1BL6A 3K54A 4C0TA 5I9ZA 3ZXTA 3KULB 3SW4A 3Q96A 3L8PA 3UQGA 4JS8A 3WE8A 4XG3A 1PXIA 2R3HA 5ETFA 3TJCA 4BL1A 2R3LA 5J95A 4CT1A 5J5SA 3IW5A 4K0YA 4XBRA 4ZY6A 5IQGA 2B54A 3UODA 3M42A 3WZJA 4CCUA 3HA8A 4L45A 3TNPC 3DFAA 5HE3A 2W99B 4LGGA 2WOUA 4QP6A 2BRBA 1LP4A 4FOBA 2VWIA 4BKJA 4ITIA 4JR3A 4CLJA 5KKRB 1CDKA 2GNJA 3L9PA 3QALE 4LMUA 4M84A 3RK9A 3WF8A 3F2NA 3O96A 4ZY5A 3IONA 3VS5A 3G6GA 1PJKA 4TWNA 5H9BA 3OCTA 4C38A 4C3RA 3CP9A 1WBSA 4C62A 3CE3A 5L4QA 2GNLA 2HWOA 3UVQA 4UY9A 2C3JA 1BLXA 3LKMA 3UNZA 3C7QA 4JR7A 4C61A 5AP5A 3LHJA 4GK4A 1YDRE 4EHEA 3W2CA 5IDPA 5D10A 3T3UA 5FTGA 1RE8A 4U42A 2UW5A 4JRVA 3MYGA 3OEFX 5C9CA 4LRJA 1H26A 4B8LA 3GUBA 4ARKA 2LAVA 5HIEA 3HV3A 1B6CB 5CU6A 3OTUA 1XQZA 2XK6A 3GXLA 4G31A 5HG8A 3SLSA 2BILB 2YJSA 4OBQA 1IAHA 4NU1A 5M51A 2R3KA 4DFLA 1ZXEA 3R0TA 1U59A 2VX1A 3EH9A 4L7SA 4Y73A 4DGLC 2XKEA 5HGIA 2YDKA 4FK6A 4EOQA 3HECA 4FTMA 1IR3A 3MSSA 3WIKA 4MVFA 3HDMA 4E4MA 4ZY4A 3D5XA 5HO8A 5CQUA 5JEBA 1H0WA 2HZNA 5I9UA 5M55A 4UWYA 5AM7A 3DB6A 1YXXA 4GSBA 1CKJA 3FMMA 3RAKA 4RVKA 2C6LA 3U6HA 1JWHA 3JPVA 3VS7A 4DCEA 3Q2JA 4H58A 4EKLA 2GHMA 3DJ5A 4BY9E 4EBWA 4JDKA 2VNWA 5JQ8A 4ASEA 4RJ5A 1XR1A 3OY1A 4PPCA 3QTXA 1CMKE 5JGAA 2AUHA 2XEZA 4DLIA 3OCSA 1Y8YA 4J98A 4EOSA 3UE4A
chains in the Genus database with same CATH superfamily
2HENA 4DH3A 2RL5A 2X2LA 2HYYA 3IDCA 3VBQA 3W55A 3LE6A 4PNIA 5C8KA 3Q4UA 3RCJA 3QRKA 3UIBA 3FYKX 4CFUA 1NW1A 3GCSA 3RTPA 4YJSA 3DBQA 3BGPA 3NNUA 3R28A 3O7LD 4I21A 4I4FA 4PL3A 4V0GB 2NRUA 4UZHA 3ZDIA 1GZOA 5HCXA 4EZ7A 4F70A 2WMXA 4GUEA 4U6RA 2HWPA 3PLAE 3PP1A 4BN1A 3VBTA 4PY1A 4QP9A 3V5LA 1O6YA 5E1EA 4AGWA 5BMSA 2BZJA 3PIZA 3ZC6A 3ZFXA 4YTIA 4ASXA 2C68A 2PULA 4DTBA 2AYPA 3H10A 3RVGA 5LJJA 1OL7A 3HMMA 3K3IA 4YC6A 1TKIA 5LVOA 3ZUTA 4D2PA 2OIBA 5IG1A 1FINA 4HGSA 3PXZA 4I94A 4MNEB 4ZJIA 3ORTA 3REPA 1O6KA 3ID6C 3LQ5A 4BTFA 5CEKA 2WEIA 2QLQA 1QPEA 2R3RA 1YKRA 4TYEA 4E5AX 1ST4A 3HZTA 1PY5A 2XUUA 4WNOA 4G6NA 4ZZNA 3UG2A 2H34A 4E7WA 5B7VA 4CFFA 3HDNA 2VN9A 3VIDA 2HZIA 3SHEA 4QT1A 3ZSGA 5HICA 4DFBA 5IKWA 5CXHA 1OIYA 4DYMA 4ONAA 3IS5A 4WRSA 3UIXA 2QOCA 4DGNA 4ZLOA 3EHAA 2BRHA 4JG8A 4AT5A 3QWKA 5FXSA 2Y8OA 3ZUVA 4DG0E 3G90X 4U9AA 5IQCA 3R1YA 4FOCA 3II5A 4LGDA 4LOOA 2XNMA 4Z7GA 5B2KA 1ST0A 4A4XA 1Q61A 4XLIA 3UOHA 4CZTA 4E5BA 3U54A 5ANJA 1PYEA 3PE1A 3V8WA 5I0BA 5IA3A 1JOWB 5AR7A 3W16A 1OKVA 1STCE 2C6IA 2PVYA 5F95A 5HNGA 4NJ3A 3VULA 4FJVA 4NTSA 3I81A 4DGOA 4KABA 4RC3A 5IEYA 4QQTA 1UNGA 1SZMA 2PVKA 3PG3A 3R21A 1F5QA 5J87A 1A48A 2C0IA 4FIHA 3S95A 2RFDA 4TY1A 5GZ9A 2X8EA 4DC2A 4FTTA 4L3LA 4W8EA 4AOJA 5KMNA 4ZZMA 3P7AA 1K9AA 2X9FA 5A4LA 4KBAA 3ACJA 4BGQA 2RG6A 3ETAA 4Y5QA 4OAVB 3Q9WA 5CAPA 3OROA 3O7LB 4RFYA 2PZRA 3BGQA 4K33A 3VHEA 1KOBA 4EOJA 4D4RA 4HVSA 5IU2A 2DQ7X 2WFYA 3NNVA 3OXTA 3M1SA 3UGCA 3FV8A 3O2MA 5EG3A 5LMBA 2YIRA 4F64A 4LV7A 3HYHA 2F4JA 4NW6A 3BYVA 4XP0A 4IANA 3CD8A 3F9NA 2AC3A 3UIUA 5JGDA 2ERKA 2PUUA 3EN5A 3I5NA 4Y5HA 2YCSA 2EB3A 3VF8A 4CV8A 2O64A 3COHA 2UZDA 3FMHA 3PTGA 4L00A 4IX6A 4K8AA 4X3FB 5JRSA 3ZYAA 3UJGA 4A9UA 2WD1A 4YBKA 4UYNA 4NYEA 2VTMA 2C5YA 4RFMA 4MH7A 4CRLA 5LVMA 2WTJA 1YVJA 3FDNA 1QCFA 3C4FA 1JKTA 2C4GA 4FODA 5AR4A 2BIYA 4O7TA 2NP8A 3QCYA 4QD6A 4KSPA 2XIZA 4U5JA 3UMWA 4AT3A 2WELA 3F66A 4ITJA 3AT4A 4FMQA 4KIPA 3W1FA 3PY3A 4RIWB 3HEGA 4YJUA 3GEQA 4MCVA 1W2FA 3UTOA 5HCYA 2YN8A 1S9JA 2UZTA 2G15A 2JDRA 3FI3A 4NKAA 4XRLA 4BI0A 3E3BX 4BWKA 3KMMA 3FXZA 4U7ZA 4S34A 1NA7A 3OXIA 1IEPA 1ZZLA 1J1CA 4R77A 3ROYA 4YJQA 4DGMA 4UEUA 4A9RA 2G1TA 2FVDA 3W0MA 3D7TB 3NVMB 1M52A 2CNVA 3A8WA 3B8QA 4XG6A 1PXNA 3UPZA 4BF2A 3OD6X 4GJ3A 3UZPA 3DCVA 4FEWA 1O6LA 4UXQA 3PDTA 4RLKA 4WSYA 1G8AA 2OZOA 3DQWA 5GHVA 4BCFA 4I4EA 3HP5A 1RW8A 2PVMA 2W9ZB 4XX9A 5HVKA 2E9OA 4FEVA 4NEUA 3NUSA 4O7LA 3R7YA 3ZFYA 3RWPA 4DLJA 2XKCA 2R3QA 2PZPA 3JS2A 3NYXA 2PMIA 1MUOA 2G2HA 5C1QB 4AZEA 1YWRA 3RALA 2XH5A 3G15A 3EN6A 3CGFA 3NLBA 2OW3A 3QX2A 4C37A 2WIPA 4ZSJA 4EBVA 2YM5A 5K5XA 5M09A 4ID7A 3OW4A 4BCIA 2WQBA 3PVGA 4I41A 3D15A 5ANGA 4AA5A 4J7BA 4YZMA 2JD5A 2G2FA 5CI7A 1XBCA 2IZRA 3E62A 3O0GA 3W8QA 3O71A 5L2TA 3DKOA 3HAMA 4Z3VA 2J0KA 3OWLA 4O6LA 1IAJA 3KN5A 2NYAA 4O81A 3VBVA 1GOLA 4XG9A 4L53A 1OIUA 4RGJA 1J7IA 1J7LA 3RK5A 2JAMA 3EYHA 3QCQA 4WUAA 5I3OA 2ITTA 4AW2A 4DBXA 3CQWA 1GZ8A 2EWAA 3DKGA 4RC2A 3F5PA 1O9UA 4FR4A 3TZ8A 4LRKA 3JVRA 1ZMUA 4FT5A 3ZZWA 4DEIA 3GOPA 1JNKA 5FTOA 3TZ9A 2ZM4A 4GFGA 1UKIA 4QP7A 3RHXA 4DINA 5CANA 2GNIA 1XBBA 3THBA 4RBLA 5AX3A 1WBWA 4FYNA 4IJPA 5I5ZA 3LFBA 3UDSA 1UU9A 3L8SA 4XOZA 4PWNA 1H25A 5IQAA 3GOKA 3E8EA 4EH5A 4HNFA 3ZSIA 4HW7A 1QL6A 1ZARA 4BCHA 4RG0A 3LMIA 5EKNA 3DGKA 3AMAA 3OUKA 5C03A 3RZFA 3KK9A 3WBLA 2JITA 5E9EA 1YWNA 4ZS4A 5KKRC 4LV5A 2XIYA 3P79A 1BYGA 2BPMA 4USFA 4TXCA 5L2WA 3Q32A 3D83A 4WRGA 4DCAA 2WAJA 5CENA 2JDSA 3B8RA 4TT7A 2OFUA 1G8JA 4WKQA 4ZTLA 5K0XA 2XANA 5IF1A 4DTAA 4FSWA 3QQFA 4FL1A 4LRMA 1PKGA 2GNFA 2UZNA 1XMMA 5GZ8A 2AC5A 3R8LA 3VBXA 3NAYA 5CF6A 5HNIX 3EJ1A 4FTCA 2C5VA 4NM3A 3DBEA 1SMHA 2ZM3A 3LPBA 2F9GA 2W5BA 2X4ZA 3R1SA 4IZAA 4MTAA 3TNQB 3W2PA 4D4SA 3KL8A 1GAGA 3P08A 3JUHA 3LXNA 1JPAA 3NSZA 4JI9A 3OUNB 5AX9A 3BCEA 5BVKA 3RGFA 2V22A 5DMZA 5I9VA 2HELA 4A9TA 1ZLTA 2H6DA 4XV1A 2Q0NA 3V3VA 4DH1A 4QMNA 4I6LA 4ASZA 1PXKA 4XCUA 1REJA 3CY3A 2ITQA 1A9UA 3NW5A 2FSOX 4HVGA 3OOGA 5CAQA 3BIZA 4JJRA 5HU9A 4J1RA 5GJGA 2X2MA 3OS3A 2DS1A 2W1ZA 4GCJA 4BDDA 1U5QA 2QR7A 3BRBA 2XCKA 4FZFB 4G3CA 4IC8A 2XVDA 4KD1A 3RPSA 4G1WA 2OZAB 2CN5A 4FTRA 4MK0A 2OG8A 4TYHB 4DFNA 4GYGA 2VX3A 4X21A 3TG1A 3UG1A 3QXOA 4FSTA 4QTAA 3C5UA 4YTHA 2XKFA 4QOXA 3Q04A 4OTFA 2SRCA 2X9EA 4HPTE 4RQKA 4Z16A 5A6NA 2CGUA 3BHYA 2XNEA 1R0PA 2WGJA 3MV5A 3FMKA 3QCXA 3DQXA 2CLQA 3EZRA 4H1JA 2Z8CA 4G2FA 4QYHA 2ZYBA 4OTIA 4APPA 4CKIA 2O0UA 2OXDA 2WMSA 5T3QA 3EKNA 4AQCA 4E20A 3NX8A 5L8JA 4BTMA 4QEBA 3FPMA 4FGBA 4EYJA 3BE2A 4HNIA 1FMOE 5M4IA 3P1AA 1MRUA 3DK3A 3TCPA 4IAKA 1SYKA 5AAFA 2A1AB 3GU7A 4C34A 4CG9A 5EI8A 3ZS5A 3LFSA 4N6YA 2C5XA 1AQ1A 4YC8A 3VS0A 3SG8A 4AXFA 3S3IA 5CU0A 2R3GA 2ZB0A 4M0YA 1OGUA 4F9BA 4JAJA 5EDQA 3F61A 4ANOA 3KQ7A 4MBJA 4XMOA 5LMKC 3F5UA 3W18A 3OWKA 4CVAA 1P5EA 2GQSA 2Z02A 4FEUA 4CQEA 5DA3A 4FSZA 2VTRA 2F57A 4L8MA 2JBOA 2WPAA 4ZOGA 4RJ3A 3MIAA 2UZUE 4EUUA 5BPYA 1R1WA 2C5OA 2XIXA 3EQHA 4HVIA 4GEOA 5KBRA 4BY9E 4PQNA 4R78A 3W2RA 2HY0A 2WTIA 3ORIA 4AE9A 4X3JA 4CMUA 3R1NA 3FQHA 5BNJA 2C6TA 3ENMA 1M2PA 3IECA 4PMSA 4ENXA 2WMRA 3VO3A 2NRYA 4B4LA 4LG4A 4JIKA 2OF4A 3CGOA 3KXZA 3LM5A 4QRCA 3SRVB 2V0DA 5A6OA 4DEAA 2XARA 4FE2A 2RSVA 2WMWA 2E9PA 3ORLA 3PXKA 5CSHA 4E4XA 4F63A 4AWIA 3DXQA 3BYMA 3H9RA 3NPCA 4YTFA 2YWVA 5EYKA 3TM0A 3S1HA 2B9FA 5AUUA 4KB8A 4LDTA 4J97A 4JBPA 5JZNA 5HO7A 5JFSA 3PSBA 1W84A 4J52A 4KIKB 5CNNA 2XK9A 2XNGA 3U4UA 4GKIA 3CTHA 4QYEA 3WF5A 3TUBA 3GQLA 4FT9A 4GIIA 4O0YA 4W9XA 5DWRA 3JYAA 3VW8A 3N51A 3CKWA 5CI6A 3AT2A 2F7XE 4HZSA 5IA0A 4YU2A 5EQPA 1JBPE 5KUPA 4IB3A 3KVWA 5E8TA 2V7AA 3N4UA 1BMKA 4FKSA 5CEQA 2QO9A 2YJRA 2R7BA 1JAMA 4M97A 4FSYA 1YQJA 5LQFA 2QI8A 2E9UA 4FT3A 3ZC5A 5AAEA 4YLLA 4EH4A 5AJQA 4E8AA 4XG2A 2X8IA 3AC2A 1OZ1A 5KZIA 4EQUA 4EH6A 2QURA 4AFEA 4KUJA 3COIA 2OJIA 2WXVA 1M14A 1PW2A 3SW7A 4H1MA 3VS1A 1W0XC 1H27A 3NUXA 1G3NA 4CYJA 4QTCA 4NH1A 3P0MA 2R3OA 3H4JA 3DBCA 4X3FC 3TWJA 3PUFC 2ONLA 4DHIB 3KRWA 2B52A 4K2RA 4AZSA 3V01A 5J7BA 3HV7A 3T9IA 2V5QA 1ZRZA 2V62A 2XIRA 3GC7A 2A19B 4GG7A 2GCDA 3LCSA 1EH4A 3GFEA 3FL5A 4ZLYA 4UMTA 3UVPA 3Q6UA 4U45A 5AMNA 4O0TA 5DN3A 4GT5A 1K3AA 4GFMA 3TNWA 2YEXA 3LM0A 4KA3A 4GV1A 5ANEA 4A06A 1DS5A 5IMXA 2X2KA 5M4UA 5FUTA 1XHAA 3VS2A 1G8SA 4L44A 5DNRA 1AD5A 2C0OA 3Q4ZA 4UN0C 4QMZA 3VUIA 4UYAA 4KIOA 3MIYA 2ZDUA 4JL9A 4TL0A 5LWNA 4CMOA 4XS2A 2JC6A 3ORKA 2PTKA 4WOVA 3MWUA 4LUEA 4U8ZA 4O0UA 3IOKA 3RNYA 3MH0A 5KCVA 2ITXA 4O86A 4JOAA 3N4TA 2GDOA 3C9WA 4X2KA 3QZGA 4ANMA 4EJ7A 1GJOA 3ORXA 3IW6A 5IUIA 3TN8A 4YPSA 3F82A 3R83A 3OC1A 2VWYA 2VZ6A 3O5AA 2YFXA 4D58A 5JN2A 2B53A 4O6EA 3DXPA 4AUAA 4EOIA 4XV9A 3DJ6A 3PVBA 3G0EA 3O8PA 4O2PA 4E73A 2HZ4A 2J4ZA 4ZTNA 3WZKA 3ZRMA 3EQPA 3R9OA 2Q83A 4JX3A 4YJRA 3R9NA 4QDEA 3PPKA 4X2JA 2QOHA 2VWVA 4OTHA 4E6DA 5FG8A 3DU8A 3BHTA 3FUPA 4R5YA 5GJDA 1OITA 3FHIA 3QL8A 3DKCA 3MY5A 3COKA 1VZOA 4J71A 1Q8UA 3NW6A 4JAIA 3MPAA 1YDSE 1ERKA 2XBAA 2FSLX 2CPKE 4GUBA 3QTQA 4OTPA 1U5RA 3AC4A 4IX5A 3U8WA 2OIQA 2I0YA 5FBOA 2I1MA 4FBXA 4U79A 3QZFA 4WNKA 5HTCA 3K2LA 3BLAA 4G17A 3A61A 4WUNA 4RWKA 4YZDA 4BBEA 1L8TA 3CPCA 2YCRA 3PJCA 4HVDA 2XNOA 3BLQA 3Q3BA 4RJ8A 3GC8A 3N9XA 4NTTA 3ROCA 3H9FA 3HRBA 3L9LA 2WQNA 2AQXA 3QLFA 3UYSA 1FBNA 4B7TA 4C3PA 4XP3A 4BDJA 2PVJA 1MRYA 5J79A 3FEGA 5C4LA 4CYIA 5EYMA 1OGYA 4XNEA 3BL9A 2JKQA 3CQUA 4IM2A 4XBUA 4FV2A 3LLAA 3UYTA 3E87A 5HTBA 3ZRKA 4DT8A 4D55A 4LM5A 1REKA 4ACGA 3ATTA 4KRCA 5H8BA 2ITNA 3EN9A 3NEWA 3UDTA 2YIWA 1OI9A 3GCQA 3OZ6A 3QAME 4WA9A 5CQWA 5IA4A 1PXLA 4QMMA 3UQFA 1OL6A 3F69A 4FKQA 5CF8A 1LR4A 2XS0A 1LEZA 4WG4A 2QKWB 2XMYA 3WE4A 2XM8A 5E8XA 4MXCA 5ETAA 1OPKA 4D0WA 1UWJA 1GIIA 2OJFE 4MX9A 1PXJA 2GS7A 2YDIA 5HG9A 1H24A 4I0RA 4KKHA 3PG1A 3QTZA 4HCVA 3R63A 4HGEA 4TRLA 3A4PA 3DTWA 4II5A 1VEBA 2R2PA 2F49A 1CM8A 5DE2A 4ZSAA 3VWAA 5A46A 4YZBA 2YZLA 4FYOA 3VUGA 5HX6A 1OL1A 2Y4PA 5FRIA 3NVKI 1SNXA 4BFMA 5EQEA 1PXOA 4FK3A 4KKEA 5EM5A 1FVVA 1YHSA 4QQJA 1LPUA 4F1OA 4RJ6A 2XNNA 2JFLA 5C27A 5K4IA 3FLSA 1FGKA 4IADA 5EW3A 1Q97A 1Q24A 4IW0A 3CLYA 3KXMA 3OT3A 2ITVA 2QCSA 3BEAA 3EWHA 3R22A 4O22A 4ZP5A 1IASA 3FSFA 2QVSE 1ND4A 1WBNA 3WOWA 4AN2A 1VJYA 1ZYJA 2IVSA 2UZBA 2OI4X 4PTEA 1H01A 2P55A 3O8TA 3B2TA 4ENYA 3DV3A 3GI3A 3DZOA 4C36A 4D2VA 3AQVA 1APME 2YLFA 1NVSA 3LLTA 4M14A 1V0OA 4YJPA 4EJNA 2UW9A 3G9NA 4XP2A 4YJNA 4F9AA 3MS9A 2W17A 4FKIA 3DBFA 2Z60A 4XG8A 4DH7A 3R7VA 2UVZA 1P4OA 2P2IA 4A4LA 4AA4A 4OUCA 4B0GA 2QU5A 3BX5A 5GJFA 5HQ0A 4N0SA 5IISA 3S4QA 4RMZA 3QYWA 4GG5A 4QMUA 4QPAA 3ATSA 2P0CA 4BDKA 4Q9ZA 3W0NA 2VV9A 5EFQA 4F6WA 4F7JA 1URWA 2WMBA 1RJBA 4MF1A 5T6KA 4BCOA 3WARA 2ZM1A 3QHRA 5CLPA 3ZLXA 4F9WA 4L46A 5FM2A 3TDWA 4GVJA 5E8VA 2CKOA 4R7BA 4EK8A 4QTDA 3R8MA 3A2CA 3LFEA 2YLEA 2GPHA 1XMLA 4FIJA 4JXFA 4FKLA 1WFCA 4DFYA 4FSUA 3NUAA 4FEXA 3P9JA 3U6JA 3W0PA 2XK8A 3KRRA 4BTJA 4APCA 4AXEA 3IOPA 3C13A 3R30A 4M8TA 3VS6A 2JIIA 2BROA 3NIEA 4DEDA 2O65A 5CYIA 3G51A 2Z7RA 4LQMA 4M15A 1WVWA 3VUDA 3MB7A 5D1JA 5HESA 2VTNA 5ANDA 4YGAA 2XB7A 4QQCA 4BZNA 4X0MA 3NZ0A 3NNXA 1ZY5A 4BIDA 4FV3A 3NAXA 5JSMA 2ZV9A 1BX6A 1I44A 4Q5EA 4QMWA 5CSWA 3UP7A 1Q8YA 2XBJA 3D9VA 4AW5A 2UW4A 5BQ0A 2PYWA 3E8CA 4FGRA 4W8DA 3NUNA 2EUFB 4XRJA 4YNOA 4A7CA 3KVXA 4ZSGA 3DAEA 5JFXA 5EKOA 3GGFA 3JVSA 4JVGA 4I23A 4WD5A 3A7JA 3AXWA 3EKKA 3WF7A 3ZLWA 1OPJA 4DEEA 2Y4IB 1PXPA 1ZMWA 2ZVAA 3OG7A 1Q8WA 3AC1A 4LOQA 3ZSHA 5IQEA 1OPLA 4FZ6A 3GU8A 4N4SA 2XAOA 1KV2A 2BMCA 5CWZA 4E26A 3RNIA 1DI8A 4HYSA 4HGTA 2XEYA 3HUBA 2J0IA 4IAZA 2OGVA 4GK2A 5EDPA 4BB4A 4FSRA 1VLRA 3FI2A 3G6HA 5DIAA 2XYNA 3M11A 3PJ1A 2UZOA 1Z5MA 4M69A 3KN6A 2CDZA 2QKRA 2HOGA 4KIQA 2VTAA 4MXZA 4RLLA 4XUFA 5J9YA 3R8VA 4QTEA 3ERKA 1LEWA 3A60A 4YO6A 5JFVA 2OKRA 2PVHA 4NM0A 4A9YA 3R7EA 4I1ZA 5GNKA 4MQ1A 4R1YA 3SAYA 4ITHA 5B2LA 2BZKB 1U54A 3JY9A 1OVEA 4IXPA 5D7AA 4NIFB 3ML1A 5C01A 4XG4A 4E3CA 3FMEA 1S9IA 1XH6A 2B9HA 2WTCA 5BMMA 3KXGA 2XK7A 4MD7E 4GVAA 4OT6A 1U4DA 2HXLA 4U3YA 4WSQA 4AFJA 4GT4A 4QMLA 2XA4A 2WQEA 3SXSA 3ZMMA 5DPVA 3ULIA 5JKGA 2FH9A 3ZXZA 1QMZA 2DWBA 2OXYA 2RKUA 4A9SA 2UW7A 3E5AA 2VWUA 2VO0A 2BAJA 3TKUA 4CV9A 5E7RA 2ZB1A 4G3EA 5HE2A 3KB7A 2O5KA 3PXFA 5CT0A 3SD0A 4AG8A 4FKWA 4CLIA 3KREA 5CU3A 4LYNA 3Q53A 4R6VA 5E8WA 3RCDA 3RBWA 1H8FA 3FHRA 3PIXA 4IZYA 3OOMA 4GRBA 3IKAA 4IVAA 3R8ZA 4E5WA 5HBJA 2PU8A 2R0UA 3O23A 3BGZA 5DR6A 3CS9A 5AP3A 3LJ1A 3UDBA 3W2QA 2J2IB 3RI1A 2VWWA 5A4TA 3FXXA 1R78A 3QUEA 2FB8A 2YIQA 3HA6A 1UNLA 2VTOA 4FNYA 4QMPA 4YHFA 4PP9A 4LL5A 2O63A 4X7QA 3PFQA 2VGOA 1CTPE 4FZ7A 5LVLA 2IW8A 4C57A 5IQFA 3EZVA 3FE3A 2IZUA 4BGHA 1NT2A 4FTOA 4O82A 2EXMA 2JLDA 2YABA 1B39A 4QO9A 3LJ0A 4AAYA 4DE4A 4UWCA 4IM3A 5KE0A 4FX3A 3TT0A 3VW6A 5HI2A 3PXRA 3D2KA 4EHVA 3KC3A 4E6CA 2J50A 4O7VA 5BYZA 4UMQA 3BU3A 4DTKA 1YXSA 5EYCA 3OBGA 4UB7A 2WU6A 1ZWSA 3ORMA 2WO6A 2QC6A 2XNPA 4OT5A 2X7FA 3FZTA 3R2BA 4RVTA 4XJ0A 3BE9A 5E8ZA 5H8EA 3RAWA 3VF9A 4CEGA 3LOKA 4G3FA 3G2FA 4UBAA 5D11A 3I4BA 4EZ5A 4YURA 2VNYA 5EI6A 5L6OA 2YM3A 2C3LA 3R7UA 3WZEA 3MY1A 1MRVA 4D28A 3BWJA 5AM6A 5IEVA 5FXQA 4P5QA 4QMYA 5IA1A 2XIKA 2GTNA 3F88A 4PTCA 4UALA 2EU9A 4F1MA 1GNGA 2OK1A 2W1DA 3OWPA 1PF8A 2BAQA 4BJJB 3PYYA 3QZHA 5CU2A 2R9SA 4UZDA 2QHMA 3E7VA 3F5GA 4XEYA 4MUQA 2C3IB 4JQ7A 4EOLA 3DDQA 5EM7A 4ZJJA 1WMKA 3KRLA 4I5CA 4TPTA 4ZSLA 3GC0A 4RIYA 2DYLA 3U6IA 1W83A 4JBOA 4DA5A 3QF9A 5DH3A 3VUKA 5CS6A 4BI2A 4EH7A 4R7IA 2W05A 5IH5A 2V55A 1G8KA 3ZRLA 4U40A 2JEDA 2PVFA 1JKKA 3JY0A 3D14A 2ITWA 4EYMA 4CD0A 4UMPA 1ZMVA 4MXYA 4ERWA 3QQGA 4DH8A 5LVNA 1BKXA 4FL3A 4X2FA 3QTWA 1UA2A 2ZMDA 2X81A 2NPQA 2ERZE 4EUTA 4LV8A 1GIJA 3BQCA 3OVVA 3BWFA 4I6FA 3I6UA 4E4LA 4Z55A 3AOXA 3KULA 4PX6A 1SVHA 3ZONA 4S2ZA 4EOKA 1SM2A 2J0MB 4ACMA 4D0XA 5CXZA 4ZTRA 2WIHA 4QYFA 4NCTA 2GU8A 4K9YA 4BDAA 4FKVA 5ACKA 2BALA 2GHLA 5EYDA 2BDJA 3FKLA 3DFCB 4O0XA 3R8PA 3NIZA 4IJ9A 5BVEA 4BIEA 5J9LA 3RPVA 3LAUA 2WQMA 4W4VA 3NYVA 2VTLA 5IUHA 2I0EA 5IUGA 3E7OA 2GSFA 4IMYA 4O1PA 4CKJA 4PUZA 3OHTA 2BVAA 3IGGA 3ZHPC 3FLZA 4HCUA 4ALWA 2JBPA 2B9JA 2ZJWA 2RFNA 1M7NA 4O38A 2VD5A 2PMLX 5IQHA 3WF6A 4UWBA 5K3YA 2XK3A 5AUTA 4FV1A 2X6DA 5EM8A 4KAOA 3TUDA 3PVUA 1ZY4A 2G9XA 1KE6A 2VO7A 3KXXA 3F3TA 2JDOA 4ZEGA 3A99A 2YIXA 3TJDA 4YHTA 4J96A 4NCTC 2Y9QA 2IWIA 3DZQA 3ODYX 3MVHA 1VYWA 4FL2A 4KS8A 4OTQA 4YZ9A 5BVWA 4AW1A 3I5ZA 4TYIA 5E8SA 2IVVA 4USDA 5LVPA 4TYJA 5EK7A 3S00A 2Y0AA 3D4QA 3DNEA 1RQQA 2X1NA 3MFUA 2VAGA 4P4CA 3DOGA 4RRVA 3ZH8A 2IJMA 3PRIA 2BAKA 4MBIA 4FI1A 4M68A 2VU3A 4C4IA 4GW8A 3I60A 2WU7A 2EXCX 4AOIA 2QOIA 3QWJA 4RA5A 3QHWA 3QYZA 3FWQA 5BUIA 4TW9A 3QQKA 3I1AA 4C33A 2O3PA 5IPJA 4FT7A 4RQVA 3RPYA 2OJ9A 3WILA 1XH7A 2JKMA 3LFFA 4GIHA 5HEZA 5J9ZA 2PZIA 4LMNA 4JQEA 2QOQA 3BLRA 2RFEA 2ZAZA 4D1SA 5BVFA 2XJ2A 5CT7A 3DBDA 3GT8A 3EOCA 1W2DA 4IIRA 4RX9A 4TYGA 2A0CX 2XP2A 4UXLA 2J9MA 2PVRA 2QG5A 3UVRA 2VTTA 4I6QA 3ZO4A 3PFYA 5AUZA 4MYGA 4PL5A 1W98A 2F2UA 4FTQA 3ZM4A 3QTUA 4V0GA 4IAAA 4FC0A 2HW7A 3Q9ZA 4L01A 4TWCA 4QP1A 4RC4A 5F4NA 4WT6A 5CVFA 4ASDA 4U43A 5EOBA 3NRMA 3DLSA 4EHGA 4BZOA 1OB3A 4S31A 5AEPA 2OWBA 3H30A 5E8YA 4IACA 4C2WA 3IK3A 4H3QA 4PDPA 5LWMA 3QCSA 4E4NA 3DK6A 1UV5A 3A7IA 3FQSA 4IB1A 4MNEA 1FVRA 4FV8A 4QP3A 4F9CA 5I9YA 4ZXTA 5LMKA 5T68A 4MKCA 3FMLA 4H3PA 2Y6OA 4TWPA 1BI7A 2ZOQA 4RZVA 4HVHA 4C2VA 3PP0A 2Y4IC 4QTBA 4GMYA 2O8YA 2PE1A 2X0PA 3H0ZA 3KF7A 3U9NA 4CT2A 3UIMA 4QQ5A 4YUQA 2W1CA 4AZTA 1BL7A 1WVXA 4ZTQA 2X8DA 4P7EA 4FTKA 5HNBA 1H1RA 4LGHA 4P90A 4W4YA 5J8IA 1W8CA 3WF9A 4L43A 3VVHA 5KMOA 3UO6A 4FVQA 3H3CA 5J1WA 3HMIA 1E1XA 3C4EA 4YZCA 3NW7A 3FBVA 4D2RA 2YAAA 3H0YA 4RZWA 3PWDA 2LGCA 2CGVA 1YXVA 4IH8A 3LQ3A 3PJ3A 1KWPA 5TKDA 3POZA 2GHGA 1KSWA 3MA6A 3TNHA 2IEWA 3P86A 3A62A 1YXTA 4OTGA 3VJNA 3V5QA 4AX8A 4PL4A 3T3VA 5IZFA 3QRUA 4JG7A 5AP1A 5HE0A 1Y57A 3K3JA 4ZTHA 5HVYA 1WBVA 2C5NA 4ANNA 3TL8A 3FSKA 2OH4A 3QU0A 5M4CA 3BYOA 3KFAA 1FVTA 3QD3A 2Z7SA 5HX8A 3V5PA 3R7GA 5KMLA 5B2MA