2WTCA

Crystal structure of chk2 in complex with an inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
302
structure length
284
Chain Sequence
VYPKALRDEYIMSKTLGSEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILTSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Identification and Characterisation of 2-Aminopyridine Inhibitors of Checkpoint Kinase 2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 284
sequence length 302
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wtcA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wtcA01
3ZDUA 3OUKA 4UXQA 2PVJA 3NVMB 3IW6A 4NW6A 4NTTA 4HYIA 4K9YA 4YC8A 5GZ9A 3H30A 4WNPA 1VZOA 2VO7A 4PWNA 4YTCA 5JFXA 5KKRB 2C0IA 3JPVA 5C9CA 2B7AA 2WEIA 4WNMA 3P5KA 4NEUA 5C8KA 4IANA 1WBNA 1SNUA 5HI2A 3R63A 5TF9A 3ZUTA 3HECA 4O6EA 4F65A 5HX8A 3C7QA 1FVVA 1XBCA 2PZIA 1WVXA 5H8BA 5CXHA 3W32A 4IM0A 5JFSA 4FTCA 2XKEA 2JKMA 1GZKA 4PPCA 4Z3VA 4MNEA 4QMMA 4ZJJA 4IB0A 4WHZA 3MESA 4DT8A 2R3KA 5IKWA 3A7HA 5IQIA 2YIQA 3MY5A 3ZMMA 2JIVA 2WMWA 4FV5A 4IJPA 3Q5ZA 3NYXA 4QRCA 1ZLTA 3BHHA 3BGZA 2ZAZA 4CKIA 2PZYA 4R1VA 4F9WA 4FK3A 4IZ7A 4DHFA 5CVGA 2PUUA 2X1NA 4IM2A 3F6XA 3KRXA 4DBXA 3CGOA 4XEYA 4G1WA 3ALNA 4N57A 3RJCA 4RX8A 4ORKA 3PA4A 5D7VA 5DT0A 3SXRA 5JEBA 4LQMA 2OJIA 4MNEB 5DG5A 3WF9A 4DG3E 2UZDA 3UZTA 1OPJA 1LEWA 1UV5A 2AYPA 5C03A 4QNYA 4IWPA 4QMVA 2IVUA 3NW6A 2G01A 3FL4A 3HMIA 4IAAA 4RFZA 5HZNA 2HELA 5DMZA 4AS0A 4EHVA 3S0OA 5H2UA 2WMSA 4C4JA 4JQ7A 3Q4UA 3QTSA 4QQTA 3BELA 3UZPA 4X0MA 4C59A 2PZRA 4FVPA 3ZLSA 3LCKA 4NWMA 5JMSA 1YXXA 2RSVA 2E9PA 3QD4A 4PDSA 4U3ZA 5AR2A 3C4FA 4EQCA 3QWJA 4DCEA 2C0TA 4U43A 4D4RA 4F9BA 4O1OA 3QYZA 3OOGA 4E3CA 4FEWA 1KV2A 4OGRA 3F2AA 4P4CA 3FZPA 5I3RA 5T6KA 2YAKA 4JDHA 1CSNA 1IG1A 2FSLX 3MH3A 5HIBA 2XIKA 4QMOA 2OIDA 1ZY5A 1V0BA 2YCRA 3LM0A 4MWHA 2J0MB 1FPUA 4IE9A 1UU9A 3V6RA 3MV5A 4BIEA 3O71A 5C4KA 2R3QA 3KGAA 4FK6A 4OAUC 2UZTA 4EH8A 4CV8A 5M44A 4J97A 2CN5A 3U4UA 4TWCA 4G3GA 1P14A 2WMRA 3FBVA 2WMVA 2QOLA 3PG3A 4QQ5A 3RHKA 3WZJA 2UZBA 2H34A 3IDCA 3OT3A 5FTOA 4CQEA 3BHYA 3IW5A 2CDZA 2R5TA 5HORA 2GTNA 5T3QA 3UMWA 4FIEA 5FWKK 3C0GA 3M2WA 3MH1A 4O2ZA 4RVMA 2E9VA 4BDCA 1P5EA 3DKOA 3PVBA 3PVUA 4F0FA 5K0KA 2HW7A 3SV0A 3ZXZA 1OGUA 4Y5QA 4Z7HA 4YURA 1YDSE 2HOGA 3R30A 1SZMA 4CRSA 2Z02A 2Z7LA 3FMKA 3L8VA 1U46A 1O9UA 4QMLA 4M68A 3UVQA 5IA0A 4YJPA 3UG1A 4EBVA 4UWCA 2YACA 3K5VA 1YWRA 3QRIA 2VNYA 5DT4A 3SG8A 5HICA 2WMBA 2ONLA 4FIJA 5G6VA 4EONA 4AP7A 4GU6A 2Y7JA 3CD8A 3QRUA 2LGCA 1Y91A 4B99A 3NIEA 2W96B 5AAGA 3LW0A 2YIYA 3MS9A 5FP6A 3W1FA 4XV1A 1ZY4A 2CSNA 4R3PA 3PE1A 4LGGA 3AD5A 3DKCA 5H9BA 4KWPA 1XJDA 3R7YA 2YZAA 4FVQA 5A6OA 4J71A 4TNBA 4BCKA 4MXCA 4HNIA 3DK7A 4JDKA 2UW3A 1J91A 5FP5A 2RKUA 4FTAA 4ZOGA 4EK4A 3OXTA 4C3FA 3CPCA 4Z55A 2IO6A 3OG7A 2W17A 5J9LA 3MIYA 3OS3A 5I9WA 4ZZMA 3NYVA 2OLCA 3PXQA 4CTCA 1YOMA 4K33A 2Y8OA 4AW5A 1H07A 4A07A 4OBPA 4BI2A 3OCGA 3BHTA 4IFGA 2XNPA 2C1BA 3H9FA 4D4SA 4O7NA 4FBXA 2PTKA 3A62A 5HGIA 5DWRA 2R3NA 3EN5A 2YWPA 4F7LA 4MKCA 2CGUA 4EOSA 4IVDA 4XX9A 5LOHA 4FGRA 2EVAA 3HA8A 4RGJA 5HHWA 3UZRA 4I6HA 3MFUA 4JDJA 4EC8A 1JNKA 3OF0A 3SLSA 4HNFA 4YJQA 2XZSA 2CNVA 3KQ7A 2GS6A 2UW4A 5D9HA 4ZJIA 4LUEA 4CXAA 4YO6A 3DS6A 4NTSA 4P2KA 4OTIA 2WMUA 5ANJA 3AQVA 1I09A 2X9FA 2XKDA 3QRJA 3R7VA 1X8BA 3QXOA 2ZV8A 3EQRA 4MF0A 5J8IA 2YWVA 3ORZA 1OL2A 3NUPA 4RWIA 3AD4A 3AD6A 3QLFA 2HY81 2WQEA 2A19B 5LARA 3A61A 2Q0NA 4X3JA 2W1ZA 2X9EA 1TKIA 2W9ZB 4H05A 2E9NA 2ITYA 4O1PA 5AMNA 4TKSA 3QXPA 2PY3A 4ACCA 2BRNA 2CKEA 3MPTA 4QMPA 2PVLA 3CP9A 4DLJA 5F9EA 2V55A 4CYJA 2UVZA 2BFYA 3UE4A 2B55A 1OITA 1Y8YA 3I7CA 3KMWA 5CF6A 4JVGA 5HE0A 3N9XA 3UOJA 5K4JA 4YJSA 1PXPA 2ZM3A 3O23A 2XUUA 3BPRA 4FV6A 5HCZA 4AGWA 4FKWA 4Z7GA 4U9AA 4QQCA 4X3FC 4CZTA 3DXPA 2AC5A 3CJGA 5EQEA 3DNEA 4FNZA 2XBAA 5BPYA 4L67A 4C38A 4E7WA 2VRXA 3C4ZA 2IZTA 4EL9A 4IX3A 3VW6A 3T9IA 3BU3A 3EN4A 3A99A 3F5PA 3GCQA 4LOQA 4PMMA 5M55A 1CMKE 2JFLA 3I5NA 3NCGA 3E63A 2ZV9A 3S95A 4J95A 4CSVA 3UPXA 4RC2A 3DKGA 2YCSA 4O6LA 2WMTA 3OTVA 3OUNB 4YC3A 4XYFA 4B8MA 3QTUA 3QTXA 2J5FA 2R7IA 4IC7A 4C3PA 4W9XA 2X4FA 4YLJA 4F99A 2PULA 4D5KA 4A9YA 1CKJA 4JX3A 4MNFA 3NNWA 5CF8A 4RJ5A 4R78A 2OW3A 4FMQA 4I93A 1CKPA 4LMUA 5HNBA 4FUXA 3RGFA 4I24A 2BRHA 3I1AA 5A4LA 2ZYBA 4FNWA 1H01A 3PE2A 3VUIA 4QP4A 4A7CA 4OTPA 4QMZA 4RVLA 3NR9A 4QMTA 4E6AA 1KE5A 4R6VA 3DFAA 1R0PA 4MXZA 2GQGA 4EOPA 4CTBA 5IPJA 3FSFA 1JLUE 3E8EA 4WUNA 3D5UA 5GNKA 4AGDA 3OC1A 4MHAA 2C3IB 3EL8A 5FXRA 4LRKA 2WOUA 1G5SA 4UWBA 5LVLA 3O8UA 4EEVA 4USEA 4ZMFA 2I6LA 3P86A 5AR3A 3BV2A 5HO8A 5CU0A 4OAVB 5KNJA 4S34A 3DTCA 3ELJA 1R39A 3W8LA 4EOQA 3HP5A 4KB8A 4D1ZA 3HV3A 5DR9A 2NRYA 3M1SA 4LRMA 3ZSGA 4YNEA 1PXJA 4BGHA 3V5LA 3SXSA 2Z7QA 2W0JA 4MQ1A 4YMJA 1YWVA 1WAKA 4E1ZA 5DGZA 3F9NA 3N4VA 1JSUA 4L00A 3VUKA 4ZLYA 5J95A 5IG1A 2RFDA 4I0TA 2CLQA 2J0KA 3LJ1A 3NUSA 4FV2A 5HD4A 2ZVAA 4FG8A 5DA3A 4G5JA 4LGDA 3LE6A 5TO8A 4ZSAA 3ZEWA 4E6DA 4R77A 2JAMA 2RL5A 4D2SA 4K0YA 3U6HA 1IA9A 5BVWA 3KRWA 1U5RA 4E5BA 3QGWA 4S30A 1H1PA 5ACBC 3HKOA 3R00A 4AE9A 3WI6A 1OM1A 3VRYA 2WQOA 3F3UA 1OBGA 3TNWA 5IQDA 3PJ8A 1V0OA 5FEEA 4CFUA 3EOCA 1RE8A 4RVTA 4XHKB 4FSMA 2PU8A 3GQIA 3UP2A 5IUGA 5A6NA 2W9FB 5HBHA 2BCJA 3LCOA 4YJTA 5J79A 4EK3A 3ERKA 5H8GA 4XG8A 3R8LA 3ULIA 3RPVA 4DFXE 5EKNA 4M12A 4FSNA 4IFCA 3R9NA 3R2BA 4AT4A 3KXHA 3EQCA 4ZLZA 1KE7A 1BLXA 2IZRA 4UZHA 4ZTRA 4CFFA 5ANGA 5HTIA 3U55A 1BI7A 4GUBA 4FIIA 4PMPA 4U8ZA 5BQ0A 3POOA 5EHOA 3PWDA 4LM5A 3UOLA 3OZ6A 5KMJA 3ACJA 2XH5A 1BX6A 5E9EA 2UZUE 5FG8A 3CE3A 1KOAA 3Q3BA 4J98A 4U6RA 3FI4A 2WELA 4S32A 5CI7A 3HRBA 3BBWA 4JR3A 2VTMA 4BICA 4P90A 2XJ0A 4OW8A 2BRMA 2XCHA 3A2CA 4WG5A 2PVMA 4XS2A 3P78A 3FLNC 3QZIA 4CZYB 4MXYA 5CY3A 2UZNA 3DBCA 4DA5A 2VWUA 4HVIA 5BYLA 4OTQA 3FYJX 3ROYA 3VS2A 4WNKA 3FI8A 2ZB1A 3ZUVA 3C9WA 2YCFA 3FI3A 4IAIA 3NUNA 3PTGA 4YZBA 5IDNA 2XKFA 5D41A 3R7OA 4E8AA 2JAVA 5HU3A 3L9PA 2V5QA 2Z60A 5JFWA 1HCLA 1BMKA 4BCNA 5BUJA 1XH9A 3ZONA 4IZYA 4BN1A 4CV9A 3COHA 1SYKA 2R3LA 2YM4A 3HV5A 4QMWA 4CEGA 3DB8A 2YDJA 4MX9A 3RCJA 4D2VA 2OI4X 2VWIA 4BHZA 4LV8A 5EYKA 5B2MA 3MH2A 1P4FA 4XV9A 1WBPA 4ZIMA 5M51A 2XK7A 3DCVA 1XBAA 2BDWA 3DY7A 4BZDA 5LJJA 3EN6A 5HNGA 3PLAE 1O6KA 1G3NA 4J99A 1XH5A 3EN7A 2UW6A 4JAIA 4AOIA 1I44A 1VR2A 2QCSA 3QHWA 2BMCA 3QX4A 4PDPA 4M14A 3ZOSA 2X7FA 3UP7A 4FSQA 3ZXTA 4NT4A 1YQJA 3MI9A 3RHXA 4QMNA 3SA0A 2GHGA 4PTEA 3I0QA 5EM6A 4NM0A 4FT3A 1B6CB 5HCXA 4Q9ZA 1PRYA 3RI1A 4X2JA 5JGBA 2IN6A 1J3HA 3D5XA 2CGVA 1K2PA 3EQFA 4C4GA 4NYEA 3PPZA 4DINA 3W2QA 2BIYA 3G0FA 5B2LA 3N4TA 2ETKA 1Q41A 5HVYA 4PMSA 3L1SA 2A4LA 5IQCA 4TW9A 2OSCA 2XK6A 4O2PA 3DAJA 5F4NA 2X4ZA 4AZSA 4UB7A 4FT7A 2WU7A 5DOSA 4F64A 3HEGA 2WFYA 5KMLA 3OEZA 3C50A 3HA6A 2BZIB 5EW3A 4EHZA 2X8DA 3TJCA 2QOQA 3QCYA 4ZZOA 3V5QA 2J6MA 5FUTA 5HTCA 4F70A 3E7VA 2A1AB 1BL7A 3OCSA 2W1FA 2W4JA 2C1AA 3DA6A 1ZOGA 3ULZA 4FT5A 3LHJA 4WOVA 2XP2A 4R8QA 3KN5A 2QOIA 5HE1A 4IVAA 2IG7A 3DFCB 4PTCA 3TJDA 2XNBA 1M14A 4C3RA 4TRLA 2GTMA 5DLSA 3VUMA 1Z9XA 3OROA 4QTDA 4Z9LA 3GNIB 4BBFA 3HX4A 3NNXA 4E73A 3DJ5A 4EYJA 3PYYA 5F1ZA 3ZHPC 4BVUA 3P08A 5J1WA 2VU3A 3HMNA 3MIAA 4NSTA 2QO9A 2UV2A 4W8DA 5L6WL 3AT2A 5JGAA 3COMA 5BUIA 3OD6X 4B9DA 3BRBA 4WRGA 3UIMA 4D9TA 2OH0E 3RP9A 4KA3A 5AP2A 5AM6A 4EWQA 3ZO4A 4D1SA 1GOLA 4PY1A 2UZWE 3VWAA 4LMNA 2XYUA 1XBBA 5J5SA 4YTIA 4D1XA 1YOJA 4ZSJA 4BHNA 4RBLA 2KTYA 2OJ9A 4TWNA 3E8NA 5CEKA 4ZY5A 2PYWA 2RFSA 4QO9A 3CLYA 3BEAA 4WKQA 3VHEA 4AZFA 3D2IA 1BYGA 3OVVA 2VGOA 3ORKA 3F66A 4F1TA 4EJNA 1STCE 3LCTA 5AV3A 5L2IA 2UW5A 5LCJA 4D58A 2Y4PA 4H3QA 3TKIA 5I9ZA 4RSSA 3UMXA 2BVAA 3QQLA 2WTIA 1FGKA 4FTTA 1DM2A 4I23A 3HAMA 5IQAA 5IEXA 2IVVA 2W1DA 3KL8A 4GV1A 4WSYA 4MD9E 2F49A 1UWHA 4NL0A 4DLIA 3EKNA 3OMVA 5H8EA 4E5AX 3QL8A 5KUPA 2YCQA 1XWSA 4QMQA 4O7VA 4G3FA 3AC8A 4EK6A 2BZKB 4H3BA 3LQ8A 3G9LX 4NIFA 5LMBA 2B54A 4AZEA 4D2PA 2YEXA 5DPVA 1ERKA 4ITHA 3Q4ZA 2XK4A 3U51A 5EI2A 2BHEA 4BKYA 5HE3A 3DV3A 4HPUE 2RG6A 4BDAA 2QG7A 3OW4A 4BDIA 1JOWB 3ZFXA 3KRLA 4DH7A 1H00A 3PZEA 3G6HA 4ASEA 5HCYA 3U6IA 3PFQA 3UGCA 5HEZA 5JH6A 3ACKA 1L8TA 5CF4A 3KK8A 2ETMA 2X7OA 3KMMA 4Z16A 1OZ1A 1M2PA 4O22A 4X6RA 4KBAA 3AC3A 3DK3A 4NIFB 4NCTA 4QMUA 5AV2A 1V1KA 4FTOA 5EOLA 2Q0BA 3U8WA 4RZVA 4FKUA 3L9LA 4BCIA 4FE2A 3TUBA 1AQ1A 5LMAA 5IA2A 2GMXA 4CZUA 4BCOA 2HZIA 2QVSE 1MRVA 3IECA 2H8HA 2QHNA 2QOCA 4QTAA 1XH7A 5DH3A 3LFQA 4M8TA 3QCSA 3IG7A 3VQUA 3V5JA 4BI1A 4EI4A 3EQGA 2J0IA 2HXQA 3PIYA 4JBQA 4LOOA 3TZ7A 4G2FA 4Q5EA 3WF8A 3ZLXA 3O0GA 4YJOA 4BWPA 4A9SA 4XH6A 2VTTA 2G1TA 5KO1A 1H1SA 2NPQA 4AFJA 4EC9A 3LLTA 1ZZ2A 2WPAA 4XG6A 3QX2A 1KE6A 4FIGA 2IW8A 2VX0A 3TDVA 2YHVA 2PE1A 4UN0C 2Y4IC 2WHBA 4AAAA 2OJGA 5EFQA 2WNTA 4DEIA 5IF1A 2XBJA 3BYUA 4CQGA 4FR4A 5FGKA 2J0JA 1VEBA 2X6DA 3DZQA 3QWKA 4HVHA 3CY2A 3DB6A 3QZFA 2P2IA 3K54A 2C3LA 3RK9A 3C0HA 3DJ7A 4AN3A 4AXAA 3E92A 2OJFE 4NW5A 4FSRA 4IDVA 4UALA 3R9OA 3DDQA 3I81A 3BKBA 3FMJA 3DDPA 4C2WA 4DEAA 3OHTA 1OIRA 1Q99A 5HQ0A 4IB1A 4FZ7A 4EHGA 3VBYA 4KBKA 1Q8ZA 2X0GA 2FGIA 4ZEGA 3TN8A 3LVPA 2QOKA 2ITOA 4CFMA 4U41A 2ZM4A 5FTQA 3KU2A 2BAKA 4QQJA 4ZTLA 4ZXTA 1FINA 3GVUA 4PP9A 3KVXA 1UA2A 2Y9QA 2P4IA 4AGCA 2G2IA 3QA8A 3R1NA 4Q9SA 5L6PA 4IW0A 1YHWA 3ZRMA 5IQGA 3VS7A 1G8SA 3NSZA 4KIPA 2B9IA 4EHEA 5C1QB 3UIBA 4DGLC 5K5NA 1H08A 5CU3A 2JDOA 5C01A 2XM8A 2JIIA 3H4JA 2F7XE 4RQKA 3VQHA 3TM0A 3ZRLA 3E8DA 2HWPA 3FV8A 3G5DA 3VHKA 4BDDA 5LMKC 3V5PA 3FQHA 3PXZA 4YR8A 5KKRC 4FKVA 5AV0A 5B7VA 1PY5A 1PXIA 1NY3A 4FL2A 4QYFA 3SVVA 2XB7A 1PXNA 4GJ2A 2DWBA 3DK6A 4QPSA 5AUTA 3LFAA 3MPAA 3QUDA 4I20A 4ENXA 2VAGA 4P5ZA 2XNEA 3FPMA 4WBOA 4BFMA 3UQFA 4XOYA 3GI3A 1H1RA 2PZPA 4Y95A 1UWJA 4UMTA 2PE0A 2JD5A 4RFMA 2JKOA 2YN8A 2WAJA 4TYEA 4DTBA 3BYVA 2YDIA 3ITZA 3E62A 1UU7A 4CRLA 5IDPA 2JKQA 2W1CA 1PXMA 4TN6A 1ZMVA 5E91A 3R28A 3ZCLA 2IPXA 3QZGA 2AC3A 2BRBA 3L8XA 4JRNA 4P7EA 3MN3A 1NVSA 2DUVA 1YVJA 4JR7A 3TACA 3NNVA 3EZRA 4FICA 5ITAA 4JNWA 4V04A 4I5PA 4FF8A 3EQIA 1JWHA 3ZS5A 2QG5A 3KRJA 3ODZX 3A7IA 3OW3A 4GH2A 3A8WA 4OT6A 4UEUA 2I0YA 3W2CA 3ZRKA 3FMDA 2I1MA 4FT9A 2F9GA 2IW9A 3F69A 5IMXA 3KB7A 2F2UA 3K2LA 4FZ6A 4NH1A 4HCTA 1ZAOA 2PMNX 1CM8A 2UVXA 5M4FA 4YTFA 3CQUA 4F7JA 4IX4A 3AC4A 2OZAA 4I5HA 4O0YA 3HV6A 5HO6A 3THBA 4MVFA 1Q62A 4O7TA 1E9HA 4I92A 3ZC5A 5HESA 3OBGA 5IA1A 1GNGA 2W1EA 2X6EA 3DBEA 3DTWA 4RT7A 4ZLOA 4OTRA 3R83A 4KUJA 3Q6WA 5E8ZA 2EXMA 3R8ZA 4EUTA 1TQMA 3OCTA 5AX3A 4DFUA 4JLCA 1J7IA 3GT8A 1OKYA 3QZHA 3VBQA 3D7ZA 2WEVA 3VVHA 3HZTA 4RA4A 4KINA 3EQPA 3RNYA 5CEQA 3IO7A 4XLIA 1M2QA 5C26A 1WBWA 4DH8A 3UC3A 3QTWA 5BVEA 4AT5A 4BTJA 5LVOA 3R0TA 3V3VA 2BAQA 5AEPA 2WIPA 5AP3A 3DBQA 4FYOA 3EJ1A 3R6XA 2WKMA 2C5YA 3MY0A 1OI9A 4EYMA 4PQNA 4C4HA 1V0PA 1LEZA 2W1GA 4KIKA 3LM5A 4ANBA 3HNGA 5CSWA 4CMTA 2OXDA 4TYIA 4FZAB 3SXFA 4FKLA 1W8CA 3C13A 5F95A 4BBMA 4F6WA 5KBRA 5GIOE 4JG7A 3BYMA 1U5QA 3TNQB 3N51A 4W4XA 4EWHA 5IQFA 3EFKA 4BWKA 1M7QA 1OB3A 3FKNA 4CMUA 2C0OA 3Q04A 4F0GA 4F63A 2HZ0A 4GMYA 2DYLA 2W7XA 1NW1A 2VWXA 4QYEA 3G0EA 3MJ1A 5CQUA 4OBOA 3P9JA 4KIKB 3ZO1A 2ITTA 4GKIA 3CJFA 4DH3A 2XNMA 2VTIA 5CZHA 3E88A 4PL4A 3GC7A 4AZWA 4YHTA 1OVEA 4IC8A 1WBSA 5LXMA 3CTJA 1WZYA 3F61A 1ZYSA 1NVRA 4IX6A 2BZHB 3MA3A 1W7HA 5L2WA 5BVOA 2W5AA 4FT0A 3R9RA 3GOKA 4FSUA 3QYWA 4ZTNA 2IVSA 3ZDIA 2VTAA 4U5JA 4WT6A 2ACXA 4KRDA 3IOKA 1YOLA 4G16A 4U7ZA 2QO7A 3EFJA 3FY0A 4XP3A 5FM3A 2PSQA 4DTKA 3RTPA 3VBWA 3JS2A 3UG2A 1GIIA 3GCSA 5CI6A 3NNUA 4L7SA 4MAOA 5K5XA 4AOTA 4FV7A 4QT1A 3LXLA 5L3AA 3QTQA 1GAGA 2ITZA 4IAZA 5FM2A 3AC2A 3ID6C 1PXOA 4HZRA 5AP0A 3EIDA 3SQQA 4EOMA 4UWYA 4EZ7A 5AIKA 3D15A 4BDEA 5CX9A 3SC1A 4NU1A 3GU7A 3KA0A 1H0VA 1E1VA 3TCPA 1REKA 3WE4A 1FMKA 3V04A 1GZ8A 1P4OA 4DE4A 1OPLA 4CCUA 1ZWSA 4DFYA 5IH5A 3ROCA 2C3JA 2C3KA 4WO5A 5AUXA 3KULA 5HG9A 4UMQA 3L8SA 3UO4A 4OUCA 4ANOA 3TUCA 2RFNA 4GFOA 4EQMA 3FWQA 3HMPA 2V22A 3IDPA 3ORPA 3KXZA 4ALWA 2EU9A 3ENMA 4R1YA 3POZA 5E8YA 5G1XA 4UMRA 4XV2A 2C69A 3ZH8A 2X39A 2YIRA 4B4LA 4ANNA 2FH9A 2RG5A 4L3JA 4EK5A 4LV5A 3GC9A 3KULB 1KUTA 3QQKA 1ZYJA 3Q4TA 3ZBXA 3JY0A 4H1MA 4NKAA 4GK3A 3TG1A 3UVPA 1KE8A 4PNKA 4GFGA 4YBKA 3SD0A 1H27A 1TVOA 3EN9A 3FHIA 4L01A 2PWLA 3VF8A 3E93A 5JT2A 3R21A 3QC4A 4YO4A 1VJYA 5JN2A 3S3IA 4RX5A 2B4SB 4R7IA 3GC8A 4TT7A 3H9RA 1NVQA 5IH4A 2JIUA 5TKDA 3CKXA 3ORNA 3P1AA 4RJ4A 4EOJA 5EKOA 2O8YA 4FSWA 1SVEA 4QMSA 3HLLA 2BHHA 4DGNA 5KZ0A 5DBXA 3WYYA 4EQUA 3KMUA 1S9IA 3VS5A 2XIYA 3D14A 3CTHA 1FGIA 4A06A 3LCDA 5TE0A 1OBDA 3K3IA 1PMUA 2XIRA 2XYNA 1DI8A 4HGEA 3PJCA 2GU8A 2CPKE 3K3JA 4J8NA 4ALVA 4BDGA 4UX9A 5E8TA 2R3RA 3O7LD 2YLEA 3UYTA 4A9UA 5J87A 5ETCA 5FEQA 5L8JA 4CGAA 4WG3A 3UOKA 3VW8A 5BX0A 3IK3A 3KF7A 1WVWA 1WVYA 2BROA 3PVGA 4QP2A 4GIIA 4U79A 3GCVA 3MH0A 3RM6A 4E20A 3I6UA 4AZTA 4C57A 4WIHA 3HGKA 2HENA 4O0SA 3WIGA 1TQPA 5IEVA 2YJRA 4FKOA 4GKHA 3VF9A 1M2RA 2VTSA 4IBMA 3FLSA 4GS6A 4GG5A 1MRUA 2PVNA 4GYIA 4OTHA 4TWPA 1K3AA 4I1ZA 3ANQA 2XK3A 4I5CA 1JAMA 4GSBA 3C4WA 4DEDA 2PHKA 5EW9A 4D2TA 3RAWA 3LJ0A 4UY9A 3Q9XA 4FYNA 4C35A 3SG9A 2F4JA 3PSDA 4XG4A 4DGGA 4KKHA 2P55A 1OL1A 2JBOA 4XRJA 3RAKA 3UNZA 3PSCA 2CLXA 4G6LA 4NUSA 5HNIX 3PIZA 3W18A 2YM7A 3AMYA 2X81A 2J0LA 4HCVA 2B52A 4GT5A 4Y8DA 3ZZEA 3MFSA 3QGYA 4YLKA 3TV7A 2JDSA 2X2KA 3CTQA 3HV4A 3LFDA 3QCQA 3COKA 1QPJA 3DKFA 2BZJA 3HRCA 1PYEA 2XIZA 3A8XA 1FQ1B 3NPCA 4FKPA 4L45A 5AR8A 2UW8A 2GNFA 2ITUA 2XCKA 3I60A 3PG1A 2XNOA 4LG4A 3Q32A 4I4EA 4BCHA 4DEGA 2ITQA 4B0GA 1KSWA 2PVKA 4ENYA 5KMIA 5HE2A 2X7GA 1ZRZA 3Q9ZA 1UVRA 4CFWA 3FLYA 3RKBA 3DXQA 1RQQA 4JAJA 4QP7A 3CGFA 4F1OA 3CQEA 5E8VA 4GEOA 5DFPA 2VX3A 1M17A 2C6IA 4ZTSA 4O0WA 3HYHA 3LLAA 4O0VA 1Q3DA 2QOOA 2XEYA 3UIXA 4MBLA 4J1RA 2WU6A 4ZS4A 2JFMA 2W1HA 3UYSA 3D0EA 5EM7A 5EQYA 1PXLA 5CWZA 1JSTA 4FTJA 1HCKA 3O8PA 4K77A 3JVSA 2JBPA 4X2FA 3BHUA 3GENA 4NK9A 5AM7A 3HUCA 4ANLA 1OIYA 1OIQA 3UBDA 4CLJA 4CKJA 4FEVA 4BDFA 3BQCA 5E8WA 3R8PA 2OH4A 4Y83A 3W8QA 4BTKA 4BY9E 1SMHA 1YRPA 2VWWA 2H96A 2BDFA 2EB2A 4AA4A 2QR7A 5FLFA 5T68A 4E4XA 4FV1A 5ETFA 2BTSA 2WXVA 4LRJA 3LAUA 1H24A 3UNJA 5ANEA 4B8LA 3R02A 4RX7A 3H9OA 4D9UA 3FQEA 2GNGA 1J1BA 1XHAA 3R1SA 5GJDA 5J5TA 3OP5A 3PA3A 4G3EA 4EH6A 4USFA 3GU4A 4HVDA 3QLGA 1W0XC 2OIBA 3Q96A 5A4QA 2WGJA 3ORXA 4I4FA 4AA5A 4CKRA 5KHWA 5JQ5A 1F0QA 5CVFA 2QKWB 2VWZA 2Y6OA 3R1YA 3VJNA 5L6OA 2QOHA 5CSPA 4EKLA 2YIWA 2CGXA 4Y46A 5AUWA 1PMEA 1LUFA 3VRZA 2OBJA 1IRKA 4L43A 5EI6A 2XA4A 2FVDA 1MQBA 4QPAA 5BNJA 4JG6A 2VGPA 1BL6A 1UKHA 2VNWA 3QKLA 4FKGA 4V0GA 4YTHA 3ENHA 3BI6A 3WF5A 4EH9A 4OTFA 4II5A 4XBUA 4FKJA 4EKKA 3Q6UA 3KCFA 4KKEA 3KC3A 3C5IA 4P5QA 3RPYA 2HW6A 4S33A 5FRIA 4FOCA 3ET7A 3PVWA 3RM7A 3H0YA 5I5ZA 5E92A 4KSPA 3KREA 3ZM4A 4N4SA 1H28A 5ANDA 4KS8A 2BKKA 5DEWA 3U9CA 4E6QA 3NYOA 2QI8A 4YPDA 5JGDA 1QL6A 5D10A 2R7BA 3B2TA 1WFCA 1JKSA 4D5HA 4FIHA 3FLQA 5FQDC 5EYDA 5KMOA 2WQNA 1ZOEA 3GU6A 4PL3A 3H10A 4Y73A 1PJKA 3RALA 5M09A 3QQGA 5IUIA 4V0GB 4EORA 3R04A 2GNIA 1YXUA 2HAKA 2XK8A 5FD2A 4MXOA 1XH4A 4XG2A 4E4MA 4PRJA 4W4VA 2YERA 4ZTQA 3V01A 5HLWA 3LMGA 3D5WA 1SVHA 4QP8A 5TOZA 3OWLA 2OKRA 3AG9A 5IQEA 3TV6A 3UVRA 2JEDA 3MVMA 3IDBA 4H58A 4L68A 3D4QA 4K18A 4RZWA 3R01A 4AN9A 4GJ3A 2O65A 1UU3A 4FX3A 5LVNA 2WTJA 5EG3A 3U6JA 4I5MA 3JUHA 3MB7A 4PTGA 3GGFA 1OUKA 2E2BA 3RNIA 3V6SA 4EBWA 5EHYA 5IUHA 2GQRA 4RC4A 3NLBA 4XRLA 2IZSA 5AP5A 4F6UA 3OOMA 4H36A 4DEBA 4F6SA 5EM8A 3BCEA 4ZTHA 5IH6A 5KX8A 4JOAA 4NFMA 4QP3A 4E6CA 1ZYDA 2OICA 2YM8A 3WILA 4RIWA 5I9VA 4DFBA 5AX9A 3G33A 4FTNA 2Z8CA 2OFVA 4IM3A 2PE2A 5M06A 2I0EA 4JBVA 4O0RA 5DR2A 4C4EA 4QP9A 1ATPE 2CJMA 2VO3A 3KRRA 3VUHA 4FA2A 1UKIA 1JKLA 4FG7A 3NW7A 3FYKX 3FMHA 4GVJA 3T9TA 2PK9A 4LGHA 4IAYA 5FDXA 3U4WA 5BYYA 5DE2A 4EK8A 4BTFA 2ETRA 1Y6BA 3AC1A 4FKIA 3NCZA 4RIWB 2Z2WA 3EL7A 4ERKA 5CTPA 3Q2JA 3RAIA 2RF9A 2WIHA 3F5XA 4HJOA 4DG2E 3RAHA 1OKVA 3PUPA 2WO6A 1YHSA 5IA5A 4RWLA 2XMYA 5EM5A 3R2YA 5HD7A 3BU5A 4IX5A 1YI4A 5M4IA 4O0UA 3U54A 2C30A 2BKZA 2G2HA 4G31A 3MYGA 1Y8GA 2NNWB 5L4QA 4JG8A 5IMEA 1GIHA 1SNXA 1JBPE 5CEOA 3GEQA 1ZZLA 4FIFA 3EHAA 2BTRA 4IMYA 3QQFA 2QU6A 2CGWA 3GP0A 4K8AA 4X21A 4XJ0A 3ZZWA 2O5KA 4CNHA 1RDQE 2FSOX 2REIA 2R3MA 1QMZA 2GPHA 2IW6A 2ERZE 1GY3A 2VN9A 5A9UA 4O38A 4FEXA 4IWQA 4XNEA 4M67A 4KAOA 4EJ7A 3GBZA 2VWYA 4FTIA 5KE0A 3F82A 3PJ1A 5CZIA 3AOXA 4JIKA 4M7IA 3LPBA 2B9FA 3I79A 1H0WA 2H6DA 5HKMA 3BGPA 3DAEA 3LFCA 1GZNA 3TZ8A 3FLWA 5K3YA 3ZFYA 5E90A 3FL5A 5FXQA 2OF2A 3DZOA 4G5PA 4KABA 2C5OA 5EHLA 2J50A 4PUZA 4R3RA 4C7TA 3R7GA 4TYGA 3VN9A 2R3PA 2YABA 2PUPA 2R64A 3F3WA 4LUDA 3B2WA 3D2KA 3GFEA 3RZFA 2CN8A 5LWNA 3MB6A 3CD3A 5L8KA 1U54A 4CD0A 1UNLA 2VTQA 3HMMA 3SGCA 4O81A 4AW1A 4M97A 4BCFA 5IA3A 4G9CA 1BUHA 3OWJA 4J96A 4H1JA 3NUAA 2QOFA 2C6DA 3AMBA 3E64A 2C6MA 5K4IA 4DEEA 3S4QA 2R3GA 3UO5A 4O91A 2Z7SA 2PMOX 2QC6A 3T3UA 4CFNA 5J9ZA 3PWYA 2GHLA 2IVTA 2OXYA 3RINA 3TZMA 1Z5MA 3OBJA 3W16A 4ANMA 4TZRA 1U54B 2YM6A 4FG9A 4NM5A 4K11A 4JS8A 4BF2A 1Q5KA 4TYHA 4YC6A 4FV8A 4FEQA 5JRSA 3TKHA 5AFVA 1WBVA 3AGLA 4AQCA 3DLSA 2R3IA 3QBNA 5CU4A 1YXSA 2YM5A 4YJVA 4G3CA 2R3OA 4BIBA 2R0IA 1A06A 3HDNA 3UPZA 2V7AA 2VWBA 2BUJA 3FZ1A 3GQLA 4PX6A 3GU8A 1PMVA 4UMUA 3P7BA 3SKCA 1J7LA 4ACHA 2UUEA 4M66A 5IZFA 5AAFA 3SDJA 2BFXA 3WOWA 3DT1A 4D4YA 1DI9A 5HLPA 2C4GA 1DAYA 3EFWA 3TV4A 3TXOA 2F7ZE 4TYHB 2WTKC 1OKWA 1YWNA 4WD5A 5HG5A 3F7ZA 4O7RA 2VTPA 4N70A 2WB8A 3LOKA 4W4YA 1Q8WA 3H0ZA 4FV9A 2B1PA 3F88A 5EOBA 4EUUA 2HZ4A 4FTUA 4GRBA 4C58A 2XK9A 2PUIA 4MTAA 1UU8A 3OCBA 3CSVA 3IGGA 1L3RE 3FZTA 1MRYA 4MH7A 4G6NA 4O7WA 2XIXA 3FMLA 4XG9A 1UNHA 2AUHA 4IDTA 3Q9YA 3RPSA 3KXXA 4FZFB 4KKGA 2F2CB 3ZBFA 4A4XA 3PXRA 1Q8TA 4X2NA 4F7NA 5AR7A 4M13A 4DGOA 3CKWA 2W5HA 5KMMA 3CS9A 2FSMX 2C6TA 4GK2A 3Q4CA 2OFUA 4U45A 5DEYA 4H39A 4HGTA 2YDKA 4BB4A 4ANSA 1VYWA 1JSVA 3NAYA 2G9XA 1Q8UA 2G2FA 1OL5A 3K5UA 5DR6A 4C4IA 4HOKA 1OECA 5DHJA 4CMOA 1IR3A 4CLIA 2LAVA 2J2IB 3VS3A 1J1CA 3V8TA 5IU2A 3LFBA 4I41A 3TWJA 4AGUA 4JQ8A 3ZSHA 1G8AA 5AUVA 3C51A 4ZJVA 1JQHA 2O0UA 4UXLA 3DJ6A 3R7UA 3RPOA 5L2SA 5ANKA 2EUFB 5EK7A 3IW8A 2VTRA 5JFVA 5LCKA 4BR3A 1F3MC 3B8QA 3IPHA 3MSSA 3T3VA 3EQBA 2UZLA 2HZNA 3GOPA 1MUOA 2I0VA 2W06A 5HVKA 2VTHA 2R4BA 2VZ6A 4C02A 4W9WA 3PRFA 3SW7A 2XM9A 3V8WA 3BQRA 4BDHA 5KHXA 3MW1A 4B6LA 3VS0A 4IJ9A 3O96A 3QD3A 3REPA 4BDKA 3IS5A 3U9NA 1GJOA 4MWIA 5KCVA 5DRDA 4YLLA 4NFNA 3VJOA 2GFSA 3Q52A 4XP2A 4BKJA 4PF4A 3HMOA 4M15A 3VS6A 3E8CA 3Q53A 4DG0E 4YSJA 3KXGA 3CY3A 3R8VA 4DGMA 3VS1A 3NYNA 2QKRA 2XEZA 1APME 5EYCA 4BCQA 1JKKA 4U44A 3ZC6A 3WE8A 3QQJA 5AA9A 1JVPP 5KBQA 5LMKA 5AP6A 3W2RA 1LR4A 4C61A 4HPTE 2Y0AA 4IVBA 3C4CA 2H9VA 4AN2A 2XS0A 3G15A 2GS2A 3UO6A 5I9XA 3TIYA 2QD9A 2R2PA 3QQUA 4ZS0A 4E93A 4RLLA 5BVFA 2VD5A 2WTVA 1YDTE 3DXNA 1LP4A 1SVGA 3I7BA 4GT4A 3BHVA 2PPQA 5GIPE 1SM2A 1W82A 4BWXA 5FDPA 3RWQA 5DIAA 2OO8X 4LFIA 3B8RA 4PL5A 4BRXA 4C8BA 5J7HA 4OBQA 3P7CA 1OUYA 2OXXA 5E7RA 4ZTMA 3D9VA 3HV7A 1EH4A 2OIQA 2CNUA 3KVWA 3DLZA 3EMGA 4GL9A 1NA7A 4QPMA 2J4ZA 3O8TA 3FAAA 5CQWA 5EDQA 1AD5A 4K2RA 5CNOA 4I6BA 5F94A 1Q3WA 4ANQA 4HW7A 2GNLA 2VX1A 3G6GA 3SHEA 2ZJWA 5CAUA 4DH1A 4IZAA 4TYJA 5KZIA 1XH6A 2QU5A 3AMAA 3FSKA 3Q2MA 4XG3A 1ZYLA 3QF9A 4MCVA 1VYZA 2X8EA 4RG0A 3ZFMA 1QPDA 4KNBA 4TL0A 4A9TA 4FVRA 4ALUA 3AC5A 4QYYA 4GT3A 4F1MA 4FGBA 4EOOA 3BU6A 2OU7A 4HGSA 4G9RA 4IAFA 3HDMA 3F3ZA 4G34A 2XF0A 2QONA 1U4DA 3RK5A 4FV4A 5DN3A 2OZAB 4WG4A 5EQPA 5I9UA 4BGGA 3ZO2A 2CCHA 4BL1A 2ITVA 4A4LA 3A60A 1Y6AA 4YBJA 4AX8A 3FHRA 4RA5A 5E1EA 3TTIA 3PY0A 2ZM1A 4JX7A 4QNAA 4JI9A 4S2ZA 4R3CA 3WIKA 3TDWA 5M53A 3ATTA 1PKGA 2QLUA 5JQ8A 2F57A 5HBEA 3MBLA 4HVSA 2B0QA 3M11A 1CKIA 4I6QA 4KD1A 4TWOA 4U80A 2I7QA 1URWA 1IA8A 4Q2AA 4CFVA 3F2NA 3FEGA 5IQHA 5L2QA 3S00A 3V5WA 5AADA 3NS9A 5AUUA 2C6LA 4MQ2A 3PLSA 5CU2A 5LQFA 4O7LA 3KF4A 4LL0A 1R1WA 5IISA 4JQEA 3VUDA 1H25A 3G2FA 3P79A 2P3GX 3MTFA 3ZEPA 3FPQA 4IWOA 4I3ZA 4EOLA 2OZOA 5GHVA 2C6EA 2UW0A 2IZUA 4UMPA 1Q24A 3FY2A 3LKMA 5JKGA 4DT9A 2W4KA 4D0XA 1UNGA 1YXVA 3F5UA 3PXKA 4YHJA 5CSXA 4EH3A 2HXLA 5E8SA 4FNYA 3A7GA 2YAAA 3BX5A 3EQDA 4EH7A 4OTGA 3BWJA 1IAHA 3M42A 3NIZA 5A14A 3NMUF 1JKTA 2QOBA 1PMNA 3O17A 3DU8A 1YW2A 3I4BA 5JRQA 4PPBA 3OEFX 4AG8A 4FODA 2ONLC 2WQBA 4QMYA 4C2VA 3LFFA 4RC3A 3O51A 3DNDA 5ACKA 4IZ5A 4R7BA 4O96A 4UZDA 5JK3A 4AWIA 4O21A 1OMWA 5DYJA 2E9UA 3CQWA 1PHKA 4IACA 3UQCA 3BLQA 4R7HA 3I0OA 4U0IA 3MPMA 4N6YA 1W84A 5BVKA 3I6WA 3UODA 5BYZA 1KV1A 2ITNA 3FZRA 3QUEA 3TZ9A 4G3DA 2PUNA 5AAEA 2P33A 3EQHA 5BMMA 1H26A 2VTNA 1BKXA 3E3BX 4OR5A 4AFEA 2A0CX 4J53A 4DF3A 4GU9A 1QCFA 2C68A 5J1VA 3BE2A 2DS1A 4ZK5A 3IGOA 3MVLA 5EH0A 2ZMDA 3FMMA 4LOPA 5AA8A 5I4NA 3OTUA 3WZDA 4U42A 3D7TA 2GDOA 2CNQA 3PXFA 4RRVA 4AZVA 1Q8YA 2B9JA 2EWAA 4FC0A 4JXFA 3OXIA 3EH9A 4KIOA 3GC0A 1PW2A 3SX9A 4C4FA 4PDYA 3EWHA 4PMTA 4RVKA 4ZZNA 4ACDA 4L44A 3FUPA 3PY3A 4CG9A 1FMOE 4NJDA 4XBRA 4V01A 1ZYCA 3QU0A 5J9YA 1XR1A 2P2HA 3FJQE 3QA0A 2XRWA 4HYHA 2ITPA 4L52A 2GNHA 2UW9A 4APCA 5CF5A 4GK4A 5CNNA 4IIRA 2J90A 4L46A 5ETAA 3VC4A 4XUFA 5J7BA 3NUUA 3F5GA 1XO2B 3G9NA 4WUAA 3D7TB 4BZOA 4U3YA 4GUEA 5M56A 3WF6A 3QALE 4MXAA 2NO3A 1H1QA 4O27B 2ZV7A 3RZBA 3R71A 4NM3A 5AP7A 3S2PA 4BIDA 4IHPA 4FKRA 3BYSA 4FZDB 3A7FA 4RLKA 5C27A 4OLIA 2BDJA 2QHMA 3P0MA 5E4HA 4RWKA 2HYYA 2CHLA 3PA5A 4XP0A 3RMFA 4MF1A 4N0SA 1FVRA 4R5SA 3JXWA 3R8UA 4A9RA 5HLNA 3CXWA 5CALA 4RIYA 3N4UA 4J7BA 3W2PA 3P23A 3VBVA 4YZ9A 2ZDTA 3BWFA 2CKPA 3OY1A 5I9YA 5GINE 1S9JA 4RJ8A 2UVYA 4FSZA 3T8OA 5K0XA 4LYNA 4G6OA 4ID7A 3KN6A 4BZNA 2R0UA 3E7OA 4FI1A 2PZ5A 4TPTA 2WTWA 3NEWA 4DYMA 4DC2A 2BAJA 3PIXA 4YNOA 4GVAA 2HY0A 1RW8A 2WTCA 5BVNA 2CKOA 1XH8A 3E3PA 5B0XA 4IADA 3DAKA 2UZOA 2VV9A 3MDYA 4BYJA 4RIYB 4BGQA 5L8LA 4YZNA 3Q5IA 4ZSGA 1WBOA 3S1HA 2CKQA 5CAVA 5BVDA 1BI8A 3NUYA 3EB0A 4JBOA 4AW0A 2W4OA 2F7EE 2IJMA 3CC6A 1FOTA 2YISA 4IEBA 4DEHA 2WMAA 4EH5A 4EOKA 3PJ2A 4YU2A 5LVMA 3NW5A 4FKTA 3KFAA 4U81A 4UV0A 4N6ZA 4X3FA 4ASZA 4BDJA 4DBNA 2R3FA 3FZOA 1PKDA 4BCMA 4DFLA 4TNDA 5GZAA 4J8MA 3C0IA 5D12A 3L8PA 4ZSEA 4CCBA 4DITA 5E1SA 5AWMA 4QOXA 3C5UA 4F0IA 3VBTA 3ZTXA 2GNJA 1T46A 1WMKA 5A54A 5ANIA 5JZNA 3UOHA 4J52A 3F7WA 3MY1A 4F9YA 2HWOA 4FSTA 2ZB0A 4UBAA 4MBJA 4S31A 1IASA 1IEPA 1P2AA 2VTJA 2ZMCA 3O50A 4U40A 3WARA 1M7NA 3NGAA 4MD8E 3QC9A 3UJGA 5M4UA 3DQXA 2A2AA 1ZMUA 3A4OX 3UQGA 4X2GA 4X3FB 4YZMA 3PY1A 3MFRA 3JR1A 4ITJA 4OT5A 3QRKA 2EXEA 4C36A 4USDA 2RIOA 3OT8A 3R22A 4YJUA 3QUPA 1NT2A 2ZV2A 3PPJA 3QHRA 1B39A 2EB3A 4HZSA 4DFNA 3L9MA 2XNGA 5CLPA 5A3XA 5HTBA 2RFEA 3GU5A 1URCA 2QNJA 4QYGA 3MVHA 4ZP5A 3ZSIA 2W1IA 3EFLA 1Q97A 2VWVA 3BEGA 1YHVA 2FYSA 3LIJA 3MWUA 1Q61A 4D55A 5LVPA 2R3HA 1JPAA 4AACA 3BYOA 4M0ZA 3R7IA 2WTDA 3LXKA 4PNIA 4OTDA 4FTKA 3V8SA 4YSMA 4C34A 2UZEA 4RIXA 3R7EA 1PYXA 4GYGA 4KRCA 5HBJA 2JC6A 3ANRA 3EZVA 4RMZA 2I0HA 5DRBA 2PL0A 2JKKA 3TIZA 5HX6A 3LFNA 4FOBA 2WD1A 3WZKA 2C6OA 1YI6A 2YA9A 2NRUA 3FMNA 2OG8A 3ORIA 4F08A 2YITA 4O86A 1GZOA 4E5WA 4E26A 4TXCA 5TT7A 4X7QA 4EH4A 4IB3A 4C62A 1KOBA 2ESMA 1R3CA 2P0CA 2BIKB 1YXTA 3FC1X 4GIHA 4QP1A 4RIXB 4I0RA 3UIUA 3KXMA 3CIKA 3EYGA 3JYAA 3CBLA 3C4XA 4RX9A 5AUZA 1PXKA 2YLFA 3HL7A 2FB8A 5C4LA 4YPSA 2BILB 2HIWA 2XJ2A 3FKLA 2CCIA 3RWPA 4ACMA 5CEPA 4H3PA 4FTRA 3LXNA 3PP0A 1O6LA 2GCDA 4MBIA 4NZWB 4FNXA 4AOJA 2C47A 2XJ1A 3FDNA 3FQSA 4FL3A 1YI3A 1REJA 3LFSA 3SOAA 3BGQA 4X2KA 3SRVA 3FC2A 4E4LA 3LQ3A 4I0SA 3RVGA 1DS5A 3TNPC 3PJ3A 2V62A 3FKOA 4GFMA 1YKRA 2WMQA 1T45A 5CAOA 5CT0A 5I3OA 3VAPA 4XOZA 4IQ6A 1H1WA 4BBEA 4ZMEA 2WMXA 4FV3A 4NJ3A 1WBTA 3IONA 5GJFA 4WNOA 3VUGA 1Y57A 5F20A 3P7AA 5TR6A 4KIQA 4KSQA 2E9OA 3W2SA 4AW2A 3AGMA 4XLVA 3HRFA 3NRMA 5CS6A 3A4PA 2G15A 1H8FA 3OY3A 4R5YA 3ZLWA 4NM7A 2BALA 3SRVB 3QKMA 2BPMA 4GCJA 4HVGA 4JT3A 1ND4A 4EH2A 3DOGA 5CENA 3FLZA 2JLDA 3W55A 1OL6A 2J5EA 4AU8A 4DH5A 4D28A 3GXLA 3RBWA 2VUWA 3QTRA 3VO3A 1KWPA 2X2MA 3COIA 3ALOA 3SAYA 3TTJA 3CPBA 4YZDA 5AP4A 3ODYX 4DN5A 3IOPA 3JY9A 3W33A 4BKZA 4L53A 4EOIA 5FTGA 5GZ8A 2VO6A 2YM3A 4A4OA 1O6YA 3W10A 4DCAA 1OKZA 4QYHA 3RK7A 2X8IA 2GQSA 4JIAA 5JSMA 4WRSA 4PDOA 3ZYAA 3TUDA 1A48A 4RJ7A 4PPAA 1H4LA 5EYMA 3E5AA 4HYSA 3BLRA 4M0YA 3FE3A 3GUBA 4ZY6A 3VULA 4WBBB 3EKKA 3TNIA 3IQ7A 1W98A 1HOWA 3AT4A 3MGYA 4MEDA 4MXXA 5CEIA 5CAQA 2PVHA 2QQ7A 5EDRA 4FSYA 3Q9WA 4CT2A 5AJQA 2ITXA 3I5ZA 5ICPA 2ERKA 3ORLA 3PRIA 1PF8A 4GG7A 3QTIA 3SOCA 4IAKA 1QPEA 4XG7A 3IW4A 5HU9A 3Q60A 4O82A 3NX8A 4PV0A 5BUEA 2GS7A 2QO2A 1YDRE 2GHMA 3H3CA 3R73A 3VUTA 2JDRA 3W2OA 4TY1A 4RWJA 1CTPE 3FI2A 5CU6A 5AIRA 5LWMA 3GFWA 4FEUA 4IB5A 5ETIA 4ASXA 4Y5HA 2O64A 3L9NA 3RCDA 5IA4A 3E87A 5FBNC 4HCUA 5AR4A 4EZ3A 5HG8A 3NVKI 3O2MA 4DFZE 5KMKA 4FKSA 4JJRA 4XV3A 4V05A 2IWIA 3LZBA 1MQ4A 2C5XA 5E8UA 4BC6A 5M07A 3BBTB 4O83A 3QFVA 2W99B 3UTOA 2C5NA 3FXZA 2X2LA 4O7YA 4BCPA 1K9AA 4QTEA 2DQ7X 4U97A 1J7UA 4QTCA 4O84A 4I21A 4QTBA 4D2RA 3VNTA 3MJ2A 3DBDA 4JDIA 3LMHA 5M4CA 3ZU7A 4O7ZA 5IQBA 3WZUA 2J7TA 2FO0A 2QODA 3QRTA 5H3QA 2R3JA 3GCUA 3P4KA 3OFMA 2OK1A 3HUBA 3MFTA 4F09A 4WA9A 5I0BA 4D2WA 4CVAA 3QAME 3G90X 3C4EA 4G17A 1E1XA 5B2KA 2XNNA 4ITIA 5C8MA 3DPKA 4FTQA 3KK9A 5FXSA 1KE9A 2PVFA 4RFYA 3RPRA 3PXYA 3LMIA 3QKKA 4MD7E 4ZSLA 3ORMA 4ZAUA 5HIEA 4RPVA 1Z57A 3NDMA 4YP8A 3HAVA 4CT1A 2VTOA 3LQ5A 4DAWA 1XKKA 1ZOHA 4AT3A 2O3PA 3QTZA 3FXWA 5FBOA 5JZJA 5CSVA 5D11A 4GW8A 2XKCA 3OXZA 1XQZA 4Y85A 3WYXA 2J51A 2SRCA 3NAXA 4BDBA 4TTHB 4M69A 1FBNA 5GJGA 4MK0A 4IH8A 5CAPA 2Y6MA 3AT3A 5ANOA 4LI5A 4CG8A 1RJBA 3KEXA 1W83A 4F9CA 5AUYA 5AV4A 3KXNA 4RJ3A 2FA2A 4CYIA 3UC4A 4CFXA 2YJSA 1M52A 4K6ZA 4L42A 1AGWA 2GFCA 3R8MA 1OIUA 2OJJA 3O7LB 2C5VA 4ONAA 3BE9A 4FUYA 5AV1A 3EYHA 3PZHA 1OPKA 4JL9A 5A4EA 5BMSA 2V0DA 4M84A 5CEMA 3GB2A 2RGPA 5HOAA 4O0TA 5D1JA 4AA0A 4C33A 3TKUA 4BCGA 3UNKA 4NCTC 3TT0A 5M08A 4M69B 4C37A 2A27A 3GCPA 4L7FA 4BI0A 3NWWA 4E4NA 4XCUA 3TNHA 1LPUA 4KS7A 3ZUUA 4HYUA 4XMOA 4DTAA 3MTLA 4L6QA 3V5TA 3V51A 2VTLA 2YIXA 3VBXA 2Q83A 1IAJA 3PDTA 2QR8A 3BV3A 3WBLA 3ZO3A 3QD0A 4KBCA 3KY2A 3JVRA 3QCXA 4K1BA 4M3QA 3LXPA 5EDPA 3AXWA 4O0XA 2OF4A 3R9DA 5CT7A 4BYIA 4EZ5A 2WOTA 5DI1A 2QURA 1GIJA 2KULA 3IKAA 1FVTA 3F3TA 2BR1A 4FV0A 4F7SA 5K9IA 5HVJA 4I94A 3TI1A 3D83A 3DGKA 4FKQA 1DAWA 2WZJA 3KCKA 3WF7A 4B7TA 3BZ3A 2GSFA 4IWDA 3ORTA 4WSQA 2ZDUA 3QD2B 1F5QA 3LJ2A 4OTWA 5CXZA 4Y72A 4AF3A 4BTMA 2VO0A 4NKSA 4JBPA 5E8XA 3VIDA 1QPCA 2B53A 4C0TA 3U87A 3UDBA 2V7OA 3LFEA 4L9IA 4FL1A 1R0EA 4RIOA 4YGAA 5L2TA 2FSTX 3TL8A 1ZXEA 2FUMA 3CEKA 3D5VA 3G51A 2W05A 3D94A 3FZSA 2PVYA 3OWKA 3PSBA 4L3PA 4ZY4A 3A7JA 5A4TA 3C1XA 3ZM9A 1CDKA 3R1QA 4L3LA 1WCCA 2B9HA 2ZOQA 5EW8A 2JDVA 4ARKA 5C8NA 3II5A 4MYGA 3NUXA 4W4WA 3CR0A 3IW7A 3MA6A 4ASDA 5DVRA 2JGZA 2HCKA 2UZVA 3SW4A 2YFXA 3KKVA 1OL7A 3DQWA 4YHFA 5CASA 2CMWA 4YJNA 4IVCA 5HG7A 3VS4A 4O7SA 2WQMA 2R9SA 2QLQA 4I6FA 4QD6A 3NZ0A 4IXPA 3R9HA 1ZMWA 2JITA 4L8MA 2PMIA 5IEYA 2WTKB 4Q5HA 5A46A 2O63A 3PP1A 3MVJA 3PPKA 5CANA 3OWPA 4RJ6A 3F2RA 3F3VA 4ERWA 4APPA 5D7AA 5CVHA 2O2UA 3WZEA 5CYIA 4QMXA 2UW7A 2XRUA 2Y4IB 3BLHA 1TQIA 5AP1A 3ZLYA 5A4CA 2EXCX 4UYAA 3DBFA 5CSHA 4D4VA 3LCSA 1Q4LA 3FMEA 2OWBA 4LL5A 1R78A 5EI8A 2XVDA 4JRVA 5HO7A 4I22A 5DT3A 2PMLX 3BIZA 3HVCA 4FTMA 5DNRA 5FEDA 2NP8A 2C6KA 4UYNA 4YUQA 2W5BA 3ETAA 1MP8A 4X6QC 3QQHA 2OGVA 4QP6A 5HIDA 3TEIA 3ATSA 2ITWA 1A9UA 5KMNA 1ZARA 5M57A 5AR5A 4AUAA 1U59A 4AE6A 4PP7A 2YZLA 2PVRA 4HGLA 2HK5A 4ACGA 4YJRA 3HP2A 4YZCA 2BRGA 4W8EA 1NXKA 4RQVA 2Z7RA 2I40A 4FTLA 3CCNA 4BCJA 2J9MA 4F4PA 4D0WA 2JDTA 4F9AA 1B38A 3FXXA
chains in the Genus database with same CATH superfamily
3ZDUA 3OUKA 4UXQA 4LV7A 2PVJA 3NVMB 3IW6A 4NW6A 4NTTA 4HYIA 4K9YA 4YC8A 5GZ9A 3H30A 4WNPA 1VZOA 2VO7A 4PWNA 4YTCA 5JFXA 5KKRB 2C0IA 3JPVA 5C9CA 2B7AA 2WEIA 3NFFB 4WNMA 3P5KA 4NEUA 5C8KA 1G8JA 4IANA 1WBNA 1SNUA 5HI2A 3R63A 5TF9A 3ZUTA 3HECA 4O6EA 4F65A 5HX8A 3C7QA 1FVVA 1XBCA 2PZIA 1WVXA 5H8BA 5CXHA 3W32A 4IM0A 5JFSA 4FTCA 2XKEA 2JKMA 1GZKA 4PPCA 4Z3VA 4MNEA 4QMMA 4ZJJA 4IB0A 4WHZA 3MESA 4DT8A 2R3KA 5IKWA 3A7HA 4O4BB 5IQIA 2YIQA 3MY5A 3ZMMA 2JIVA 2WMWA 4FV5A 4IJPA 3Q5ZA 3NYXA 4QRCA 1ZLTA 3BHHA 3BGZA 2ZAZA 4CKIA 2PZYA 4R1VA 4F9WA 4FK3A 4IZ7A 4DHFA 5CVGA 2PUUA 2X1NA 4IM2A 3F6XA 3KRXA 4DBXA 3CGOA 4XEYA 4G1WA 3ALNA 4N57A 3RJCA 4RX8A 4ORKA 3PA4A 5D7VA 5DT0A 3SXRA 5JEBA 4LQMA 2OJIA 4MNEB 5DG5A 3WF9A 4DG3E 2UZDA 3UZTA 1OPJA 1LEWA 1UV5A 2AYPA 5C03A 4QNYA 4IWPA 4QMVA 2IVUA 3NW6A 2G01A 3FL4A 3HMIA 4IAAA 4RFZA 5HZNA 2HELA 5DMZA 4AS0A 4EHVA 3S0OA 5H2UA 2WMSA 4C4JA 4JQ7A 3Q4UA 3QTSA 4QQTA 3BELA 3UZPA 4X0MA 4C59A 2PZRA 4FVPA 3ZLSA 3LCKA 4NWMA 5JMSA 1YXXA 2RSVA 2E9PA 3QD4A 4PDSA 4U3ZA 5AR2A 3C4FA 4EQCA 3QWJA 4DCEA 1W2FA 2C0TA 4U43A 4D4RA 4F9BA 4O1OA 3QYZA 3OOGA 4E3CA 4FEWA 1KV2A 4OGRA 3F2AA 4P4CA 3FZPA 5I3RA 5T6KA 2YAKA 4JDHA 1CSNA 1IG1A 2FSLX 3MH3A 5HIBA 2XIKA 4QMOA 2OIDA 1ZY5A 1V0BA 2YCRA 3LM0A 4MWHA 2J0MB 1FPUA 4IE9A 1UU9A 3V6RA 3MV5A 4BIEA 3O71A 5C4KA 2R3QA 3KGAA 4FK6A 4OAUC 2UZTA 4EH8A 4CV8A 5M44A 4J97A 2CN5A 3U4UA 4TWCA 4G3GA 1P14A 2WMRA 3FBVA 3UDTA 2WMVA 2QOLA 3PG3A 4QQ5A 3RHKA 3WZJA 2UZBA 2H34A 3IDCA 3OT3A 5FTOA 4CQEA 3BHYA 3IW5A 2CDZA 2R5TA 5HORA 2GTNA 5T3QA 3UMWA 4FIEA 5FWKK 3C0GA 3M2WA 3MH1A 4O2ZA 4RVMA 2E9VA 4BDCA 1P5EA 3DKOA 3PVBA 3PVUA 4F0FA 5K0KA 2HW7A 3SV0A 3ZXZA 1OGUA 4Y5QA 4Z7HA 3W0MA 4YURA 1YDSE 2HOGA 3R30A 1SZMA 4CRSA 2Z02A 2Z7LA 3FMKA 3L8VA 1U46A 1O9UA 4QMLA 4M68A 3UVQA 5IA0A 4YJPA 3UG1A 4EBVA 4UWCA 2YACA 3K5VA 1YWRA 3QRIA 2VNYA 5DT4A 3SG8A 5HICA 2WMBA 2ONLA 4FIJA 5G6VA 4EONA 4AP7A 4GU6A 2Y7JA 3CD8A 3QRUA 2LGCA 1Y91A 4B99A 3NIEA 2W96B 5AAGA 3LW0A 2YIYA 3MS9A 5FP6A 3W1FA 4XV1A 1ZY4A 2CSNA 4R3PA 3PE1A 4LGGA 3AD5A 3DKCA 5H9BA 4KWPA 1XJDA 3R7YA 2YZAA 4FVQA 5A6OA 4J71A 4TNBA 4BCKA 4MXCA 4HNIA 3DK7A 4JDKA 2UW3A 1J91A 5FP5A 2RKUA 4FTAA 4QDVA 4ZOGA 4EK4A 3OXTA 4C3FA 3CPCA 4Z55A 2IO6A 3OG7A 2W17A 5J9LA 3MIYA 3BL7A 3OS3A 5I9WA 4ZZMA 3NYVA 2OLCA 3PXQA 4CTCA 1YOMA 4K33A 2Y8OA 4AW5A 1H07A 4A07A 4OBPA 4BI2A 3OCGA 3BHTA 4IFGA 2XNPA 2C1BA 3H9FA 4D4SA 4O7NA 4FBXA 2PTKA 3A62A 5HGIA 5DWRA 2R3NA 3EN5A 2YWPA 4F7LA 4MKCA 2CGUA 4EOSA 4IVDA 4XX9A 5LOHA 3AKKA 2EVAA 3HA8A 4RGJA 5HHWA 4FGRA 4I6HA 3UZRA 3MFUA 4JDJA 4EC8A 1JNKA 3OF0A 3SLSA 2XANA 4HNFA 4YJQA 2XZSA 2CNVA 3KQ7A 2GS6A 2UW4A 5D9HA 4ZJIA 4LUEA 4CXAA 4YO6A 3DS6A 4NTSA 4P2KA 4OTIA 2WMUA 5ANJA 3AQVA 1I09A 2X9FA 2XKDA 3QRJA 3R7VA 1X8BA 3QXOA 2ZV8A 3EQRA 4MF0A 5J8IA 2YWVA 3ORZA 1OL2A 3NUPA 4RWIA 3AD4A 3AD6A 3QLFA 2HY81 2WQEA 2A19B 5LARA 3A61A 2Q0NA 4X3JA 2W1ZA 2X9EA 1TKIA 2W9ZB 4H05A 2E9NA 2ITYA 4O1PA 5AMNA 4TKSA 3QXPA 2PY3A 4ACCA 2BRNA 2CKEA 3MPTA 4QMPA 2PVLA 3CP9A 4DLJA 5F9EA 2V55A 4CYJA 2UVZA 2BFYA 3UE4A 2B55A 1OITA 1Y8YA 3I7CA 3KMWA 1W2DA 4JVGA 5CF6A 5HE0A 3N9XA 3UOJA 5K4JA 4YJSA 1PXPA 2ZM3A 3O23A 2XUUA 3BPRA 4FV6A 5HCZA 4AGWA 4FKWA 4Z7GA 4U9AA 4QQCA 4X3FC 4CZTA 3DXPA 2AC5A 3CJGA 5EQEA 3DNEA 4FNZA 2XBAA 5BPYA 4L67A 4C38A 4E7WA 2VRXA 3C4ZA 2IZTA 4EL9A 4IX3A 3VW6A 3T9IA 3BU3A 3EN4A 3A99A 3F5PA 3GCQA 4LOQA 4PMMA 5M55A 1CMKE 2JFLA 3I5NA 3NCGA 3E63A 2ZV9A 3S95A 4J95A 4CSVA 3UPXA 4RC2A 3DKGA 2YCSA 4O6LA 2WMTA 3OTVA 3OUNB 4YC3A 4XYFA 4B8MA 3QTUA 3QTXA 2J5FA 2R7IA 4IC7A 4C3PA 4W9XA 2X4FA 4YLJA 4F99A 2PULA 4D5KA 4A9YA 1CKJA 4JX3A 4MNFA 3NNWA 5CF8A 4RJ5A 4R78A 2OW3A 4FMQA 4I93A 1CKPA 4LMUA 5HNBA 4FUXA 3RGFA 4I24A 2BRHA 3I1AA 5A4LA 2ZYBA 4FNWA 1H01A 3PE2A 3VUIA 4QP4A 4A7CA 4OTPA 4QMZA 4RVLA 3NR9A 4QMTA 4E6AA 1KE5A 4R6VA 3DFAA 1R0PA 4MXZA 2GQGA 4EOPA 4CTBA 5IPJA 3FSFA 1JLUE 3E8EA 4WUNA 3D5UA 5GNKA 4AGDA 3OC1A 4MHAA 2C3IB 3EL8A 5FXRA 4LRKA 2WOUA 1G5SA 4UWBA 5LVLA 3O8UA 4EEVA 4USEA 4ZMFA 2I6LA 3P86A 5AR3A 3BV2A 5HO8A 5CU0A 4OAVB 5KNJA 4S34A 3DTCA 3ELJA 1R39A 3W8LA 4EOQA 3HP5A 4KB8A 4D1ZA 3HV3A 5DR9A 2NRYA 3M1SA 4LRMA 3ZSGA 4YNEA 1PXJA 4BGHA 3V5LA 3SXSA 2Z7QA 2W0JA 4MQ1A 4YMJA 1YWVA 1WAKA 4E1ZA 5DGZA 3F9NA 3N4VA 1JSUA 4L00A 3VUKA 4ZLYA 5J95A 5IG1A 2RFDA 4I0TA 2CLQA 2J0KA 3LJ1A 3NUSA 4FV2A 5HD4A 2ZVAA 4FG8A 5DA3A 4G5JA 4LGDA 3LE6A 5TO8A 4ZSAA 3ZEWA 4E6DA 1OGYA 4R77A 2JAMA 2RL5A 4D2SA 4K0YA 3U6HA 1IA9A 5BVWA 3KRWA 1U5RA 4E5BA 3QGWA 4S30A 1H1PA 5ACBC 3HKOA 3R00A 4AE9A 3WI6A 1OM1A 3VRYA 2WQOA 3F3UA 1OBGA 3TNWA 5IQDA 3PJ8A 1V0OA 5FEEA 4CFUA 3EOCA 1RE8A 4RVTA 4XHKB 4FSMA 2PU8A 3GQIA 3UP2A 5IUGA 5A6NA 2W9FB 5HBHA 2BCJA 3LCOA 4YJTA 5J79A 4EK3A 3ERKA 5H8GA 4XG8A 3R8LA 3ULIA 3RPVA 4DFXE 5EKNA 4M12A 4FSNA 4IFCA 3R9NA 3R2BA 4AT4A 3KXHA 3EQCA 4ZLZA 1KE7A 1BLXA 2IZRA 4UZHA 4ZTRA 4CFFA 5ANGA 5HTIA 3U55A 1BI7A 4GUBA 4FIIA 4PMPA 4U8ZA 5BQ0A 3POOA 5EHOA 3PWDA 4LM5A 3UOLA 3OZ6A 5KMJA 3ACJA 2XH5A 1BX6A 5E9EA 2UZUE 5FG8A 3CE3A 1KOAA 3Q3BA 4J98A 4U6RA 3FI4A 2WELA 4S32A 5CI7A 3HRBA 3BBWA 4JR3A 2VTMA 4BICA 4P90A 2XJ0A 4OW8A 2BRMA 2XCHA 3A2CA 4WG5A 2PVMA 4XS2A 3P78A 3FLNC 3QZIA 4CZYB 4MXYA 5CY3A 2UZNA 3DBCA 4DA5A 2VWUA 4HVIA 5BYLA 4OTQA 3FYJX 3ROYA 3VS2A 4WNKA 3FI8A 2ZB1A 3ZUVA 3C9WA 2YCFA 3FI3A 4IAIA 3NUNA 3PTGA 4YZBA 5IDNA 2XKFA 5D41A 3R7OA 4E8AA 2JAVA 5HU3A 3L9PA 2V5QA 2Z60A 5JFWA 1HCLA 1BMKA 4BCNA 5BUJA 1XH9A 3ZONA 4IZYA 4BN1A 4CV9A 3COHA 1SYKA 2R3LA 2YM4A 3HV5A 4QMWA 4CEGA 3DB8A 2YDJA 4MX9A 3RCJA 4D2VA 2OI4X 2VWIA 4BHZA 4LV8A 5EYKA 5B2MA 3MH2A 1P4FA 4XV9A 1WBPA 4ZIMA 5M51A 2XK7A 3DCVA 1XBAA 2BDWA 3DY7A 4BZDA 5LJJA 3EN6A 5HNGA 3PLAE 1O6KA 1G3NA 4J99A 1XH5A 3EN7A 2UW6A 4JAIA 4AOIA 1I44A 1VR2A 2QCSA 3QHWA 2BMCA 3QX4A 4PDPA 4M14A 3ZOSA 2X7FA 2XALA 3PUFC 3UP7A 4FSQA 3ZXTA 4NT4A 1YQJA 3MI9A 3RHXA 4QMNA 3SA0A 2GHGA 4PTEA 3I0QA 5EM6A 4NM0A 4FT3A 1B6CB 5HCXA 4Q9ZA 1PRYA 3RI1A 4X2JA 5JGBA 2IN6A 1J3HA 3D5XA 2CGVA 1K2PA 3EQFA 4C4GA 4NYEA 3PPZA 4DINA 3W2QA 2BIYA 3G0FA 5B2LA 3N4TA 2ETKA 1Q41A 5HVYA 4PMSA 4QEBA 3L1SA 2A4LA 5IQCA 4O4CA 2OSCA 4TW9A 2XK6A 4O2PA 3DAJA 5F4NA 2X4ZA 4AZSA 4UB7A 4FT7A 2WU7A 5DOSA 4F64A 3HEGA 2WFYA 5KMLA 3OEZA 3C50A 3HA6A 2BZIB 5EW3A 4EHZA 2X8DA 3TJCA 2QOQA 3QCYA 4ZZOA 3V5QA 2J6MA 5FUTA 5HTCA 4F70A 3E7VA 2A1AB 1BL7A 3OCSA 2W1FA 2W4JA 2C1AA 3DA6A 1ZOGA 3ULZA 4FT5A 3LHJA 4WOVA 2XP2A 4R8QA 3KN5A 2QOIA 5HE1A 4IVAA 2IG7A 3DFCB 4PTCA 3TJDA 2XNBA 1M14A 4C3RA 4TRLA 2GTMA 5DLSA 3VUMA 1Z9XA 3OROA 4QTDA 4Z9LA 3GNIB 4BBFA 3HX4A 3NNXA 4E73A 3DJ5A 4EYJA 3PYYA 5F1ZA 3ZHPC 4BVUA 2XARA 3P08A 5J1WA 4AXCA 2VU3A 3HMNA 3MIAA 4NSTA 2QO9A 2UV2A 4W8DA 5L6WL 3AT2A 5JGAA 3COMA 5BUIA 3OD6X 4B9DA 3BRBA 4WRGA 3UIMA 4D9TA 2OH0E 3RP9A 4KA3A 5AP2A 5AM6A 4EWQA 3ZO4A 4D1SA 1GOLA 4PY1A 2UZWE 3VWAA 4LMNA 2XYUA 1XBBA 5J5SA 4YTIA 4D1XA 1YOJA 4ZSJA 4BHNA 4RBLA 2KTYA 2OJ9A 4TWNA 3E8NA 5CEKA 4ZY5A 2PYWA 2RFSA 4QO9A 3CLYA 3BEAA 4WKQA 3VHEA 4AZFA 3D2IA 1BYGA 3OVVA 2VGOA 3ORKA 3F66A 4F1TA 4EJNA 1STCE 3LCTA 5AV3A 5L2IA 2UW5A 5LCJA 4D58A 2Y4PA 4H3QA 3TKIA 5I9ZA 4RSSA 3UMXA 2BVAA 3QQLA 2WTIA 1FGKA 4FTTA 1DM2A 4I23A 3HAMA 5IQAA 5IEXA 2IVVA 2W1DA 3KL8A 4GV1A 4WSYA 4MD9E 2F49A 1UWHA 4NL0A 4DLIA 3EKNA 3OMVA 5H8EA 4E5AX 3QL8A 5KUPA 2YCQA 3W0QA 1XWSA 4QMQA 4O7VA 4G3FA 3AC8A 4EK6A 2BZKB 4H3BA 3LQ8A 3G9LX 4NIFA 5LMBA 2B54A 4AZEA 4D2PA 2YEXA 5DPVA 1ERKA 4ITHA 4AXEA 3Q4ZA 2XK4A 3U51A 5EI2A 2BHEA 4BKYA 5HE3A 3DV3A 4HPUE 2RG6A 4BDAA 2QG7A 3OW4A 4BDIA 1JOWB 3ZFXA 3KRLA 4DH7A 1H00A 3PZEA 3G6HA 4ASEA 5HCYA 3U6IA 3PFQA 3W0PA 3UGCA 5HEZA 5JH6A 3ACKA 1L8TA 5CF4A 3KK8A 2ETMA 2X7OA 3KMMA 4Z16A 1OZ1A 1M2PA 4O22A 4X6RA 4KBAA 3AC3A 3DK3A 4NIFB 4NCTA 4QMUA 5AV2A 1V1KA 4FTOA 5EOLA 3PFYA 2Q0BA 3U8WA 4RZVA 4FKUA 3L9LA 4BCIA 4FE2A 3TUBA 1AQ1A 5LMAA 5IA2A 2GMXA 4CZUA 4BCOA 2HZIA 2QVSE 1MRVA 3IECA 2H8HA 2QHNA 2QOCA 4QTAA 1XH7A 5DH3A 3LFQA 4M8TA 3QCSA 3IG7A 3VQUA 3V5JA 4BI1A 4EI4A 3EQGA 2J0IA 2HXQA 3PIYA 4JBQA 4LOOA 3TZ7A 4G2FA 4Q5EA 3WF8A 3ZLXA 3O0GA 4YJOA 4BWPA 4A9SA 4XH6A 2VTTA 2G1TA 5KO1A 1H1SA 2NPQA 4AFJA 4EC9A 3LLTA 1ZZ2A 2WPAA 4XG6A 3QX2A 1KE6A 4FIGA 2IW8A 2VX0A 3TDVA 2YHVA 2PE1A 4UN0C 2Y4IC 2WHBA 4AAAA 2OJGA 5EFQA 2WNTA 4DEIA 5IF1A 2XBJA 3BYUA 4CQGA 4FR4A 5FGKA 2J0JA 1VEBA 2X6DA 3DZQA 3QWKA 4HVHA 3CY2A 3DB6A 3QZFA 2P2IA 3K54A 2C3LA 3RK9A 3C0HA 3DJ7A 4AN3A 4AXAA 3E92A 2OJFE 4NW5A 4FSRA 4IDVA 4UALA 3R9OA 3DDQA 4AQKA 3I81A 3BKBA 3FMJA 3DDPA 4C2WA 4DEAA 3OHTA 1OIRA 1Q99A 5HQ0A 4IB1A 4FZ7A 4EHGA 3VBYA 4KBKA 1Q8ZA 2X0GA 2FGIA 4ZEGA 3TN8A 3LVPA 2QOKA 2ITOA 4CFMA 4U41A 2ZM4A 5FTQA 3KU2A 2BAKA 4QQJA 4ZTLA 4ZXTA 1FINA 3GVUA 4PP9A 3KVXA 1UA2A 2Y9QA 2P4IA 4AGCA 2G2IA 3QA8A 3R1NA 4Q9SA 5L6PA 4IW0A 1YHWA 3ZRMA 5IQGA 3VS7A 1G8SA 3NSZA 4KIPA 2B9IA 4EHEA 5C1QB 3UIBA 4DGLC 5K5NA 1H08A 5CU3A 2JDOA 5C01A 2XM8A 2JIIA 3H4JA 2F7XE 4RQKA 3VQHA 3TM0A 3W0RA 3ZRLA 3E8DA 2HWPA 3FV8A 3G5DA 3VHKA 4BDDA 5LMKC 3V5PA 3FQHA 3PXZA 4YR8A 5KKRC 4FKVA 5AV0A 5B7VA 1PY5A 1PXIA 1NY3A 4FL2A 4QYFA 3SVVA 3AKLA 2XB7A 1PXNA 4GJ2A 2DWBA 3DK6A 4QPSA 5AUTA 3LFAA 3MPAA 3QUDA 4I20A 4ENXA 2VAGA 4P5ZA 2XNEA 3FPMA 4WBOA 4BFMA 3UQFA 4XOYA 4DDGA 3GI3A 1H1RA 2PZPA 4Y95A 1UWJA 4UMTA 2PE0A 2JD5A 4RFMA 2JKOA 2YN8A 2WAJA 4TYEA 4DTBA 3BYVA 2YDIA 3ITZA 3E62A 1UU7A 4CRLA 5IDPA 2JKQA 2W1CA 1PXMA 4TN6A 1ZMVA 5E91A 3R28A 3ZCLA 2IPXA 3QZGA 2AC3A 2BRBA 3L8XA 4JRNA 4P7EA 3MN3A 1NVSA 2DUVA 1YVJA 4QDEA 4JR7A 3TACA 3NNVA 3EZRA 4FICA 5ITAA 4JNWA 4V04A 4I5PA 4FF8A 3EQIA 1JWHA 3ZS5A 2QG5A 3KRJA 3ODZX 3A7IA 3OW3A 4GH2A 3A8WA 4OT6A 4UEUA 2I0YA 3W2CA 3ZRKA 3FMDA 4AAYA 2I1MA 4FT9A 2F9GA 2IW9A 3F69A 5IMXA 3KB7A 2F2UA 3K2LA 4FZ6A 4NH1A 4HCTA 1ZAOA 2PMNX 1CM8A 2UVXA 5M4FA 4YTFA 3CQUA 4F7JA 4IX4A 3AC4A 4F78A 2OZAA 4I5HA 4O0YA 3HV6A 5HO6A 3THBA 4MVFA 1Q62A 4O7TA 1E9HA 4I92A 3ZC5A 5HESA 3OBGA 5IA1A 1GNGA 2W1EA 2X6EA 3DBEA 3DTWA 4RT7A 4ZLOA 4OTRA 3R83A 4KUJA 3Q6WA 5E8ZA 2EXMA 3R8ZA 4EUTA 2A98A 1TQMA 3OCTA 5AX3A 4DFUA 4JLCA 1J7IA 3GT8A 1OKYA 3QZHA 3VBQA 3D7ZA 2WEVA 3VVHA 3HZTA 4RA4A 4KINA 3EQPA 3RNYA 5CEQA 3IO7A 4XLIA 1M2QA 5C26A 1WBWA 4DH8A 3UC3A 3QTWA 5BVEA 4AT5A 4BTJA 5LVOA 3R0TA 3V3VA 2BAQA 5AEPA 2WIPA 5AP3A 3DBQA 4FYOA 3EJ1A 3R6XA 2WKMA 2C5YA 3MY0A 1OI9A 4EYMA 4PQNA 4C4HA 1V0PA 1LEZA 2W1GA 4KIKA 3LM5A 4ANBA 3HNGA 5CSWA 4CMTA 2OXDA 4TYIA 4FZAB 3SXFA 4FKLA 1W8CA 3C13A 5F95A 4BBMA 4F6WA 5KBRA 5GIOE 4JG7A 3BYMA 1U5QA 3TNQB 3N51A 4W4XA 4EWHA 5IQFA 3EFKA 4BWKA 1M7QA 1OB3A 3FKNA 4CMUA 2C0OA 3Q04A 4F0GA 4F63A 2HZ0A 4GMYA 2DYLA 2W7XA 1NW1A 2VWXA 4QYEA 3G0EA 3MJ1A 5CQUA 4OBOA 3P9JA 4KIKB 3ZO1A 2ITTA 4GKIA 3CJFA 4DH3A 2XNMA 2VTIA 5CZHA 3E88A 4PL4A 3GC7A 4AZWA 4YHTA 2IEWA 1OVEA 4IC8A 1WBSA 5LXMA 3CTJA 1WZYA 3F61A 1ZYSA 1NVRA 4IX6A 2BZHB 3MA3A 1W7HA 5L2WA 5BVOA 2W5AA 4FT0A 3R9RA 3GOKA 4FSUA 3QYWA 4ZTNA 2IVSA 3ZDIA 2VTAA 4U5JA 4WT6A 2ACXA 4KRDA 3IOKA 1YOLA 4G16A 4U7ZA 2QO7A 3EFJA 3FY0A 4XP3A 5FM3A 2PSQA 4DTKA 3RTPA 3VBWA 3JS2A 3UG2A 1GIIA 3GCSA 5CI6A 3NNUA 4L7SA 4MAOA 5K5XA 4AOTA 3W0NA 4FV7A 4QT1A 3LXLA 5L3AA 3QTQA 1GAGA 2ITZA 4IAZA 5FM2A 3AC2A 3ID6C 1PXOA 4HZRA 5AP0A 3EIDA 3SQQA 4EOMA 4UWYA 4EZ7A 5AIKA 3D15A 4BDEA 5CX9A 3SC1A 4NU1A 3GU7A 3KA0A 1H0VA 1E1VA 3TCPA 1REKA 2NYAA 3WE4A 1FMKA 3V04A 1GZ8A 4AXDA 1P4OA 4DE4A 1OPLA 4CCUA 1ZWSA 4DFYA 5IH5A 3ROCA 2C3JA 2C3KA 4WO5A 5AUXA 3KULA 5HG9A 4UMQA 3L8SA 3UO4A 4OUCA 4ANOA 3TUCA 2RFNA 4GFOA 4EQMA 3FWQA 3HMPA 2V22A 3IDPA 3ORPA 3KXZA 4ALWA 2EU9A 3ENMA 4R1YA 3POZA 5E8YA 5G1XA 4UMRA 4XV2A 2C69A 3ZH8A 2X39A 2YIRA 4B4LA 4ANNA 2FH9A 2RG5A 4L3JA 4EK5A 4LV5A 4FJVA 3GC9A 3KULB 1KUTA 3QQKA 1ZYJA 3Q4TA 3ZBXA 3JY0A 4H1MA 4NKAA 4GK3A 4DHZA 3TG1A 3UVPA 1KE8A 4PNKA 4GFGA 4YBKA 3SD0A 1H27A 1TVOA 3EN9A 3FHIA 4L01A 2PWLA 3VF8A 3E93A 5JT2A 3R21A 3QC4A 4YO4A 1VJYA 5JN2A 3S3IA 4RX5A 2B4SB 4R7IA 3GC8A 4TT7A 3H9RA 1NVQA 5IH4A 2JIUA 5TKDA 3CKXA 3ORNA 3P1AA 4RJ4A 4EOJA 5EKOA 2O8YA 4FSWA 1SVEA 4QMSA 3HLLA 2BHHA 4DGNA 5KZ0A 5DBXA 3WYYA 4EQUA 3KMUA 1S9IA 3VS5A 2XIYA 3D14A 3CTHA 1FGIA 4A06A 3LCDA 5TE0A 1OBDA 3K3IA 1PMUA 2XIRA 2XYNA 1DI8A 4HGEA 3PJCA 2GU8A 2CPKE 3K3JA 4J8NA 4ALVA 4BDGA 4UX9A 5E8TA 2R3RA 3O7LD 2YLEA 3UYTA 4A9UA 5J87A 5ETCA 5FEQA 5L8JA 4CGAA 4WG3A 3UOKA 3VW8A 5BX0A 3IK3A 3KF7A 1WVWA 1WVYA 2BROA 3PVGA 4QP2A 4GIIA 4U79A 3GCVA 3MH0A 3RM6A 4E20A 3I6UA 4AZTA 4C57A 4WIHA 3HGKA 2HENA 4O0SA 3WIGA 1TQPA 5IEVA 2YJRA 4FKOA 4GKHA 3VF9A 1M2RA 2VTSA 4IBMA 3FLSA 4GS6A 4GG5A 1MRUA 2PVNA 4GYIA 4OTHA 4TWPA 1K3AA 4O4FA 4I1ZA 3ANQA 2XK3A 4I5CA 1JAMA 4GSBA 3C4WA 4DEDA 2PHKA 5EW9A 4D2TA 3RAWA 3LJ0A 4UY9A 3Q9XA 4FYNA 4C35A 3SG9A 2F4JA 3PSDA 4XG4A 4DGGA 4KKHA 2P55A 1OL1A 2JBOA 4XRJA 3RAKA 3UNZA 3PSCA 2CLXA 4G6LA 4NUSA 5HNIX 3PIZA 3W18A 2YM7A 3AMYA 2X81A 2J0LA 4HCVA 2B52A 4GT5A 4Y8DA 3ZZEA 3MFSA 3QGYA 4YLKA 3TV7A 2JDSA 2X2KA 3CTQA 3HV4A 3LFDA 3QCQA 3COKA 1QPJA 3DKFA 2BZJA 3HRCA 1PYEA 2XIZA 3A8XA 1FQ1B 3NPCA 4FKPA 4L45A 5AR8A 2UW8A 2GNFA 2ITUA 2XCKA 3I60A 3PG1A 2XNOA 4LG4A 3Q32A 4I4EA 4BCHA 4DEGA 2ITQA 4B0GA 5BV3A 1KSWA 2PVKA 4ENYA 5KMIA 5HE2A 2X7GA 1ZRZA 3Q9ZA 1UVRA 4CFWA 3FLYA 3RKBA 3DXQA 1RQQA 4JAJA 4QP7A 3CGFA 4F1OA 3CQEA 5E8VA 4GEOA 5DFPA 2VX3A 1M17A 2C6IA 4ZTSA 4O0WA 3HYHA 3LLAA 4O0VA 1Q3DA 2QOOA 2XEYA 3UIXA 4MBLA 4J1RA 2WU6A 4ZS4A 2JFMA 2W1HA 3UYSA 3D0EA 5EM7A 5EQYA 1PXLA 5CWZA 1JSTA 4FTJA 1HCKA 3O8PA 4K77A 3JVSA 2JBPA 4X2FA 3BHUA 3GENA 4NK9A 5AM7A 3HUCA 4ANLA 1OIYA 1OIQA 3UBDA 4CLJA 4CKJA 4FEVA 4BDFA 3BQCA 5E8WA 3R8PA 2OH4A 4Y83A 3W8QA 4BTKA 4BY9E 1SMHA 1YRPA 2VWWA 2H96A 2BDFA 2EB2A 4AA4A 2QR7A 5FLFA 5T68A 4E4XA 4FV1A 5ETFA 2BTSA 2WXVA 4LRJA 3LAUA 1H24A 3UNJA 5ANEA 4B8LA 3R02A 4RX7A 3H9OA 4D9UA 3FQEA 2GNGA 1J1BA 1XHAA 3R1SA 5GJDA 5J5TA 3OP5A 3PA3A 4G3EA 4EH6A 4USFA 3GU4A 4HVDA 3QLGA 1ST4A 1W0XC 2OIBA 3Q96A 5A4QA 2WGJA 3ORXA 4I4FA 4AA5A 4CKRA 5KHWA 5JQ5A