5J7BA

The identification and pharmacological characterization of 6-(tert-butylsulfonyl)-n-(5-fluoro-1h-indazol-3-yl)quinolin-4-amine (gsk583), a highly potent and selective inhibitor of rip2 kinase, gsk583 complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
306
structure length
277
Chain Sequence
b'AICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLGTIIYMPPENYESRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor-interacting serine/threonine-protein kinase 2
publication title The Identification and Pharmacological Characterization of 6-(tert-Butylsulfonyl)-N-(5-fluoro-1H-indazol-3-yl)quinolin-4-amine (GSK583), a Highly Potent and Selective Inhibitor of RIP2 Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 277
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5j7bA00
3COMA 4AT4A 5EHYA 1Q8YA 4D9TA 2UW4A 4DLJA 2BRHA 2BUJA 3Q4CA 3S0OA 4L43A 1WAKA 3LCDA 5A46A 5AV2A 4OLIA 5FLFA 4H58A 3WF5A 2R64A 3UG2A 3F3WA 4EWQA 1UU3A 4BYIA 4C02A 3HMOA 4R5SA 4I3ZA 2V7AA 5LXMA 3MFSA 4O1OA 3WBLA 2OU7A 4WA9A 3K5UA 1JWHA 4PMMA 4JAIA 2R3FA 2XNNA 3EQBA 2WTJA 3AGMA 3VS2A 2X6DA 4RJ3A 4R7IA 1KE6A 2VN9A 2W1EA 4FTNA 5LCKA 4X2JA 3VULA 3HL7A 4BBMA 3GB2A 3AMBA 3VBXA 4F1TA 4PL4A 5AX9A 4FNYA 5HCXA 5HE3A 1H1SA 5BVOA 4YBJA 1WBWA 3BYSA 3BU3A 5I4NA 4RIWA 2ZMCA 1H1RA 5BYZA 4HW7A 3C50A 2Z7SA 2WKMA 5HGIA 5C26A 2C0IA 4ZK5A 5KNJA 2IVTA 1B38A 4F9AA 4HPUE 4GFMA 2Y6OA 1EH4A 2W96B 3DCVA 2WMWA 4FL1A 5IUHA 2X39A 2GNGA 4EL9A 5DHJA 3EIDA 3L8SA 5FXSA 4U41A 2ZOQA 3P1AA 5JQ5A 3A4OX 4OT6A 1ZOGA 4E5AX 3UO5A 2WELA 3OEZA 2PZIA 4U44A 4FKLA 4MXAA 5IZFA 3PA5A 4QTBA 3P79A 4EBWA 5CY3A 5I0BA 4S30A 5F95A 5EHLA 4K8AA 5BMMA 5CAUA 3IW4A 4JVGA 3GVUA 2AC5A 4XCUA 4UMTA 4JIKA 3FI2A 4YLLA 3VRZA 4LL0A 5HZNA 1S9IA 1UKIA 5DT3A 5FXRA 3RTPA 3JVSA 4YC8A 2W5AA 5M4CA 4JQEA 1ZYLA 3ZBXA 4E4MA 3IW7A 2WTDA 3KCKA 2GS7A 3KU2A 2WMXA 4F63A 4C59A 3Q53A 4QMVA 4YZNA 3C0HA 2G2FA 1BUHA 4GYGA 5CU4A 4Y72A 5DT0A 4DLIA 5HD7A 2GSFA 1MRUA 1RE8A 3ZLYA 3GCSA 2WQMA 4IVCA 4IHPA 3NIZA 4EBVA 4GU6A 4E26A 1MQ4A 3BKBA 2BZKB 4IACA 3QCXA 2NRYA 2WTCA 4YLKA 4EHEA 4C34A 3O7LB 3WZJA 4V05A 4EH6A 5I9ZA 3NW7A 3DY7A 4HCVA 4YHTA 5FBNC 3WF7A 1ZARA 2ZDUA 4M68A 4U7ZA 4H39A 4L68A 5AV4A 1V0BA 3EYGA 3TKHA 4FVPA 4PF4A 4RZWA 1STCE 3CE3A 4ZS0A 3W10A 1OB3A 2PY3A 4K1BA 2Z8CA 4GT4A 3W1FA 4FKTA 4F1MA 2QR8A 2VAGA 5AA9A 3TZMA 5J5SA 3CGFA 3R8VA 1YXTA 4GVAA 4JAJA 5A4LA 4IH8A 5CWZA 4YC6A 3D94A 5B7VA 1JKTA 4E6DA 3F69A 2JIVA 5AV0A 2WMTA 3CR0A 3POZA 2QCSA 4X3FB 4GJ2A 4FIGA 5A14A 5L2IA 2YWPA 4RA5A 4C58A 1OITA 4R3RA 2QU5A 3QZHA 5A3XA 1YOMA 4U45A 4BGGA 4E5BA 4PWNA 5EM7A 4DFNA 2VU3A 5LCJA 4LV5A 4R1VA 5GNKA 3QHWA 1M2RA 5FRIA 1OIRA 1CM8A 4BWKA 1JKKA 3LCKA 4CKRA 5J7BA 3NUUA 4UMQA 2WGJA 3NAXA 4FK3A 4FKGA 4IDVA 1H1PA 4TNBA 3SLSA 3ZS5A 2BIYA 5LVLA 4BIBA 2W1DA 5CX9A 2XYUA 2QOOA 4II5A 2WIHA 4F0GA 2H9VA 3AC2A 3B2TA 2WQOA 1XBBA 1SVGA 3RPYA 4AA4A 4U42A 2CJMA 5DEWA 2GTNA 3Q6UA 2FO0A 3CQEA 5HBHA 3P86A 5CVGA 2R3IA 2J7TA 3I6WA 2JEDA 2XEZA 2WXVA 3RWPA 2VWZA 3TL8A 2C3KA 4IWQA 1KE9A 1Q5KA 2RFDA 3EKNA 3F3UA 3ORLA 4P4CA 4HVIA 4MD9E 4H3QA 4I4EA 4QYFA 5JRSA 5CU0A 3KMMA 3CD8A 1UV5A 3KFAA 4EC8A 3NNUA 2OIBA 3UMXA 3VBVA 2VTLA 2BIKB 4IC8A 1OUKA 4CVAA 5I3RA 3O8UA 4NIFB 3RGFA 3DQWA 4EH8A 4Y8DA 3OXZA 3H9FA 4BCJA 3FKNA 2R7BA 1ATPE 2YM4A 3DJ7A 4W4VA 5FG8A 3BIZA 2A2AA 1U5QA 5A6OA 5JT2A 3THBA 2PMIA 2BVAA 3I0OA 2XRUA 3BQRA 5AP0A 5EYMA 4OGRA 3MH0A 4LQMA 5IA0A 3EFWA 5I9UA 3VHKA 2FUMA 2B9FA 2VTMA 2ZM4A 4ALUA 5FEQA 1P2AA 3SW7A 4PDOA 2BHEA 3FXWA 1MQBA 4PP7A 4X7QA 5AR3A 4F65A 3AC8A 3IOKA 4W9WA 3VBQA 4RIXA 4CYJA 5K3YA 2OIDA 3DAJA 4FTOA 3QL8A 2YDIA 1WBSA 1AD5A 3QC9A 4RWLA 4HOKA 2CMWA 2BDJA 5HCZA 3A7HA 2XK4A 4C57A 3KCFA 4IVBA 4EI4A 5C1QB 2ZM1A 4J8MA 5FDXA 3NYOA 3BX5A 4YHJA 3W8QA 3CPBA 5JRQA 2BHHA 4FV1A 4ONAA 4XMOA 4G3GA 4W8EA 3LFQA 3DT1A 2RFSA 4M8TA 1Q8ZA 3ZU7A 4NU1A 4XP3A 2F7XE 4ZTLA 5CENA 5EDQA 4LUDA 5CSWA 2WMVA 5BUEA 4G3FA 5FP6A 4KBAA 4IC7A 5J1WA 3BHVA 3DTCA 1WFCA 3QTZA 3WYXA 2XCKA 1ZOHA 4JDKA 3RM6A 5IDPA 3LMGA 2QLUA 4F7JA 3G9LX 3UBDA 5IU2A 5EYDA 2ITQA 3QQHA 2QOQA 4LYNA 4YZCA 4EQCA 4MXOA 3LCSA 2NRUA 4YUQA 1GIIA 1CDKA 2WTIA 2YM5A 3R28A 3RP9A 1U46A 5DPVA 3HP5A 2OH4A 4EOIA 3ZZWA 2B52A 4OTHA 4XS2A 3LW0A 4IX3A 4BI0A 3LFEA 3MB7A 3PA4A 3ETAA 4WG4A 5LVMA 2A0CX 1OL1A 3ENHA 3ZSIA 3RCDA 3IGGA 4BGHA 3ODZX 3NUNA 5HG5A 2F49A 4X6RA 5KHXA 3FLYA 4ZSLA 3R01A 4KIQA 3UIXA 4UMUA 2VTOA 2Q0BA 2O3PA 2ITZA 3S1HA 2NPQA 2PL0A 4IB3A 4A9UA 1RDQE 4S32A 4BDCA 3DB8A 4LGDA 2UW8A 4B0GA 3OT8A 4OTRA 5L8LA 3QA8A 4IM3A 4UYNA 2QOKA 3OWPA 4U6RA 4FSRA 4EEVA 4XH6A 3SAYA 3V3VA 2CLXA 4Z16A 3KKVA 2JBOA 3BQCA 5EHOA 3KQ7A 4DH3A 4PRJA 5CZIA 1CKPA 3DTWA 4YURA 4HCUA 4XG8A 3EQIA 5EG3A 3KVXA 4Q2AA 2W5BA 3FY2A 3ZEWA 3MW1A 3UC3A 1X8BA 2ZV2A 3AT4A 2F7ZE 2UW7A 3EN4A 2HY0A 3P0MA 2XS0A 4EOMA 3IPHA 2XZSA 2B1PA 4AQCA 5AX3A 2QLQA 2R4BA 1T46A 3BEGA 4AZSA 3IW8A 4EH7A 2BFYA 4HZRA 4CTBA 2VO0A 2V5QA 3FUPA 4XX9A 4YZMA 4WO5A 5FM2A 2R2PA 3E63A 4FT5A 5IEYA 4XBRA 4XHKB 3AMAA 4XV9A 4M0ZA 4RBLA 1GJOA 3ULIA 3QALE 4FVRA 2IWIA 3RMFA 4GEOA 3CKWA 2OXYA 5GZ8A 4LGHA 1Q97A 2J0KA 1H1WA 4RVLA 4AGDA 4PNIA 2WU6A 3TIYA 3I7BA 1B6CB 3AD5A 4U0IA 4X6QC 4BGQA 3OF0A 3G51A 4FSMA 4M14A 4ACMA 3NRMA 1OL5A 1WBPA 4WBBB 1YRPA 5HKMA 4DBNA 5IEVA 3KVWA 3VS4A 5K4IA 3GT8A 2BAQA 3TCPA 4FNZA 5E90A 1UU7A 4NKSA 3O51A 1WZYA 1YXXA 5FWKK 3HZTA 2YCFA 1WCCA 4ZSEA 3EN6A 5KZIA 4EK8A 1UNLA 4GCJA 2YISA 2RG5A 5E8YA 3UQCA 3R8PA 2XRWA 4YZDA 3SKCA 5CEKA 4I5MA 1UU9A 3AQVA 4L42A 2HENA 3GU5A 5E8SA 5FBOA 4KIKA 4GVJA 2O2UA 3UQGA 2OK1A 5AV1A 2VD5A 5J87A 1NVSA 2R3OA 5CSXA 3VBTA 2X2MA 2BTRA 4AE6A 5BMSA 4RFYA 3ZUUA 4MCVA 5CANA 2WPAA 3GNIB 3NUXA 4R3PA 4C0TA 4F08A 2RFNA 5CI6A 1H1QA 4G5JA 4O91A 4QO9A 4CRSA 4EKKA 4UX9A 2GTMA 3LFDA 3PVUA 4IDTA 3NS9A 2OXXA 3FY0A 5H9BA 4JX3A 4YJUA 3OC1A 4R3CA 5BUIA 5BNJA 1E9HA 3QRJA 2O63A 4IZ7A 3BHTA 2O65A 2YIQA 4EH5A 4FTIA 2I1MA 4DG3E 5C8NA 2VX3A 4D5HA 4UV0A 4CFFA 3QF9A 2X9FA 3KF7A 4FZFB 1GZNA 4J95A 4C38A 2HK5A 3PFQA 3OVVA 2WMQA 1PXOA 1R39A 2CLQA 5CQWA 3W8LA 1NA7A 2HY81 3QLFA 4MXYA 2PMNX 4QMLA 5EOLA 3KY2A 5CTPA 4D1ZA 5HIBA 3CD3A 4MYGA 4FTRA 3COKA 4XRJA 5BVEA 1SVEA 4GK2A 2QG5A 2W1CA 1REJA 3LFBA 3UVRA 5HLNA 3SA0A 3D7ZA 4KS7A 2VUWA 4QYHA 5C03A 1RQQA 2F2UA 3Q2MA 2JKOA 5BVDA 3D15A 2OFUA 3MA6A 4O0RA 1ZOEA 4I5CA 5H8EA 4D0WA 1XQZA 4DTKA 2CGVA 3R22A 1M7NA 5AP5A 3TV4A 3NYXA 3FZSA 1RW8A 3U51A 2UVZA 4MBLA 4RIYB 2RKUA 2V7OA 4H1MA 3NPCA 1G5SA 3K54A 3EH9A 4QMUA 4AU8A 3EJ1A 5HNIX 3O8PA 3DGKA 5IISA 3Q60A 4MHAA 4ASEA 1LEZA 4YJRA 3F6XA 4RSSA 1SVHA 3NX8A 3WZUA 4BCNA 5HORA 3LLTA 4GJ3A 1PXIA 1LUFA 2UZTA 4FV9A 3TNHA 1U59A 4IXPA 4D2TA 2QO9A 4ZIMA 4K11A 4YJOA 2BZJA 4IFGA 2W1ZA 3AC4A 3M2WA 3UPXA 5EYKA 1W8CA 4GU9A 1PJKA 3F5PA 1ZMUA 4XG7A 5HBEA 4ERKA 2WOUA 4S2ZA 4O0SA 4DFYA 4EOQA 1UA2A 2R3MA 5CAPA 3ELJA 3Q9XA 5IG1A 3TUDA 5HE2A 1OM1A 5KE0A 4LRKA 3QQGA 2ZM3A 4Z9LA 4ZZMA 3ZCLA 3DK7A 2J2IB 4RFZA 5M4FA 4WBOA 4KD1A 3RNYA 1KE7A 1R3CA 3I5NA 2JKKA 2QNJA 2YHVA 4MAOA 5DGZA 4D2RA 5IH5A 2XVDA 3BLRA 5D10A 4Z3VA 3F3ZA 4DEIA 4A9RA 3BRBA 3OUKA 4FKIA 3TUBA 2FSMX 5J1VA 2XK7A 2VNWA 3H0YA 1Z5MA 4C4JA 5TOZA 1PMNA 3PG3A 5IUGA 4YSMA 2JKMA 1Q62A 2UUEA 4H1JA 3NSZA 1YXUA 2X8EA 5HO7A 3MN3A 4TKSA 3BWJA 4R1YA 3ROYA 5LMKA 3HKOA 4WG5A 5EI8A 1JAMA 3II5A 2VO6A 5EH0A 2V62A 2PSQA 3C0GA 3ZSGA 4BBFA 4AGCA 4BBEA 4E73A 4NT4A 4EC9A 3WZDA 2IZUA 1H25A 3EWHA 3WZKA 2JIIA 1Y6AA 5DLSA 5HG7A 5CF6A 2B4SB 4CFXA 5I9XA 4YTHA 2NO3A 2UZDA 5LARA 3Q5ZA 3QWJA 2BAKA 3KK8A 4KINA 4D2WA 4DGMA 4RJ6A 4DEEA 1E1VA 2HXQA 3V5WA 3WE4A 3PTGA 5AAFA 3G33A 2Q0NA 2WOTA 1CSNA 4OTWA 4FT9A 4PDSA 3RK7A 5AP1A 4CFNA 5LMBA 4E8AA 3D0EA 4ZSJA 3I5ZA 3TNPC 3KRXA 2R7IA 3E88A 3BELA 2B9HA 1P5EA 4TPTA 5JN2A 2R3HA 5AP2A 4FIJA 4LUEA 2G01A 3GEQA 2ITOA 4IADA 3FSKA 4JRNA 4O6EA 5ETCA 4UYAA 2RG6A 3VS3A 3NYVA 2GQGA 2QOFA 2XJ0A 4IX5A 5JQ8A 4C36A 3OCBA 3Q9ZA 3BEAA 3MH2A 2GNHA 5CSPA 1SNUA 4FYNA 3R7GA 4BHNA 4YR8A 4F6WA 1U54B 3OCTA 4X2NA 4MNEA 4QP7A 2PE2A 4D28A 1V1KA 3L9PA 4D55A 3WI6A 5K5NA 4QMOA 1M2PA 4F1OA 3IW6A 4DFZE 2BROA 4FV7A 2BZIB 5HCYA 4XJ0A 5L4QA 3HUBA 1OKYA 1LPUA 3QD3A 3GFEA 4QMSA 2OO8X 4GYIA 3P08A 2Y9QA 4F9BA 1CKJA 4D4YA 4FKWA 3IDBA 4BI2A 4JJRA 2EB2A 4X3JA 4RJ8A 3H3CA 3TZ9A 4U43A 3HLLA 1MP8A 3O96A 2J4ZA 5A54A 3ZFMA 4RVKA 4FSWA 2X0GA 4QMTA 4DEAA 3V04A 3LAUA 2VTRA 2Z2WA 4ZEGA 2WD1A 4BC6A 5M55A 4FKPA 2VX0A 4E6QA 3P78A 4EJNA 2OKRA 4ANLA 3RM7A 3F3VA 5KMKA 1QPDA 3C0IA 2YIWA 2I0VA 4XV2A 1W82A 2YM3A 3M1SA 4EOOA 1OL7A 4IJPA 4KA3A 3QAME 4GFGA 2YCRA 5LQFA 2R9SA 3FXZA 4BDGA 3UO6A 3UZPA 4IW0A 3W2SA 4YJPA 2UZLA 5FEEA 4AAAA 4C2WA 3F2AA 3KN6A 1OIQA 2VGOA 3R9OA 4PUZA 5E8WA 1U5RA 3O17A 3P5KA 2H96A 3V5JA 5A4QA 4BL1A 1IG1A 2C0OA 2R3PA 3QTIA 5I9YA 3FWQA 4MX9A 1UWJA 2YLFA 3I4BA 4DH5A 3KL8A 3UYSA 3ZUTA 3FYJX 3HA6A 4O2PA 4QT1A 4M66A 3WZEA 4MVFA 3FI3A 2XNEA 4JIAA 3QD2B 2R3NA 4X3FC 3IKAA 1ZYDA 3LXLA 3CIKA 3ZHPC 4A06A 1E1XA 5DI1A 5HU9A 1OMWA 4BCPA 4JG8A 5CT0A 4EOLA 1OIUA 3MTLA 4ASDA 2YEXA 3QTSA 3H9RA 4M69A 5F1ZA 5M53A 2W0JA 3NGAA 3CTHA 4QRCA 3HRFA 4FX3A 2QR7A 1TKIA 1YDTE 4HGEA 4QQ5A 3DKGA 3P4KA 3FMDA 1BYGA 4QP1A 1JPAA 5H8BA 5IEXA 5JH6A 3ZSHA 4G6OA 5KMIA 3DAEA 3TZ7A 3VC4A 3DBEA 3TJDA 4PMPA 4GG7A 3CLYA 4RRVA 5ANEA 1DAYA 1URCA 1Y8YA 2HZ0A 2ITUA 3EL8A 3EQDA 3PXRA 4LRJA 5EDRA 4F70A 5HTIA 5DA3A 3DK3A 3R9DA 2E9VA 5L6OA 2QKWB 2OF4A 3T3UA 4KAOA 2AUHA 4KSQA 3LFSA 3QTRA 1K2PA 3BU6A 3L1SA 3QA0A 4ACGA 4N0SA 4MK0A 4QQTA 1H08A 2C6OA 5AR8A 3FAAA 4YJVA 4YJNA 4EHZA 2YIYA 3VUHA 4BDDA 3AOXA 4IAAA 3QBNA 3IW5A 4BCQA 3ACJA 1R1WA 4P5ZA 3BLQA 3OT3A 3VF8A 3ZOSA 4O22A 3W2QA 3SQQA 4F7NA 2VTNA 4BTJA 1PW2A 2AYPA 1YWVA 3NWWA 2W1HA 4QYGA 2W4OA 4EQMA 4RJ7A 1BLXA 1PKGA 5D12A 3FLZA 3TV7A 5CLPA 3V8WA 4BICA 4PNKA 5HVKA 4U81A 3R04A 4A9TA 2DYLA 3C9WA 4N6YA 3QUDA 1ZXEA 4I20A 4AOIA 3PE1A 2BFXA 4RWJA 3WF6A 3BPRA 3NNVA 3FC2A 3OBGA 3AT2A 4RA4A 1HCKA 5ANOA 3SXRA 4GSBA 2ITPA 2W4KA 1HCLA 3IECA 4IAFA 2W05A 2ETRA 2JDRA 4FIFA 5H2UA 4JLCA 2ETMA 3LXKA 5FP5A 3PSDA 4GK4A 3BGPA 4XG4A 4A07A 5AJQA 4NM7A 5JFSA 5L2WA 4AFEA 1H0WA 2QOCA 4I92A 2C69A 4K6ZA 3OOMA 4RC4A 3VW6A 3ZDUA 1Q8UA 4F0FA 5A4EA 5DG5A 3F82A 4K9YA 5EW8A 3VUIA 4G6LA 3HV7A 2XK6A 3EYHA 4IQ6A 4M3QA 2BRNA 3MVLA 4K18A 5C8MA 4FSZA 4FVQA 4BCHA 2CHLA 3MWUA 4GUEA 4AA0A 2YCQA 4FG7A 3GU6A 4WOVA 3BV3A 5EKNA 1OPJA 3WIGA 3BI6A 2IVSA 3VIDA 3LM0A 4I23A 2QOLA 3LE6A 3VO3A 5K5XA 3ZUVA 3UOLA 3VN9A 3MYGA 3OXTA 3ORNA 3I0QA 3F66A 5HIEA 4TWOA 3I60A 4GFOA 4Q5EA 3FLNC 3OCSA 4Y46A 4A4OA 4BDAA 2YCSA 4LRMA 2PVJA 5TR6A 1P4FA 4QD6A 5TF9A 4U40A 4NFMA 2WB8A 2WTVA 1MRYA 4IZ5A 4BWXA 3FLWA 4QMZA 5ACKA 1BMKA 1P4OA 3OY1A 4O6LA 5CEPA 4FT7A 3A8WA 3R2YA 4BZNA 4TW9A 3V8TA 5B0XA 3HNGA 4PTGA 4DYMA 5E91A 1JKSA 1GY3A 3GP0A 4AG8A 2BDFA 5EFQA 2FB8A 4IB5A 1BI7A 3HRBA 3EQGA 2KULA 2HWOA 2GNFA 4J96A 4UWYA 5FGKA 1P14A 2J5EA 3E93A 1Q8TA 3OEFX 1FVVA 2HZ4A 3QD4A 4AXAA 4BVUA 4IM2A 3TNWA 4C4EA 3ODYX 4ZLZA 4FTTA 2QOBA 3UE4A 4BCKA 3PXYA 2ONLA 2QODA 3G6HA 1SM2A 4JI9A 3AD6A 4I0TA 5CXHA 5AWMA 3SX9A 4G3EA 4CMTA 2EWAA 2CSNA 5DH3A 3LFAA 4Q9SA 5BVKA 4W4YA 3RPSA 4HCTA 1PHKA 3Q5IA 4QP2A 4AW0A 3R7YA 3AGLA 3PWDA 3R2BA 1CMKE 5CYIA 2R3KA 3UVQA 2C30A 4KKGA 2E9UA 3EQRA 4BTFA 1A06A 3HECA 5T68A 4ZXTA 2ZAZA 4ZTHA 5AIRA 3UNKA 4CQGA 3QQUA 4CRLA 5KCVA 2OJGA 5J8IA 1XWSA 1XKKA 3PPZA 1Z9XA 3KK9A 4FL3A 4R7HA 2W1GA 4GUBA 4L8MA 4U80A 3RI1A 4KABA 5CVFA 5DRBA 4FT0A 4ZP5A 1W98A 4U9AA 4YBKA 3CJFA 4FKSA 4GL9A 2XYNA 3W2PA 4BTKA 1YHWA 2I40A 3NUPA 3ROCA 5CAQA 1XBCA 2R3JA 3A62A 1XH7A 3DBFA 4HZSA 3B2WA 5E8TA 5TO8A 4UMPA 3QHRA 4I22A 1BI8A 2BR1A 4NEUA 4LOPA 4D4SA 3G90X 1CTPE 2VTAA 3Q9YA 3RCJA 3R1QA 4O0WA 2B7AA 2W06A 3OTVA 3MGYA 1QMZA 2WAJA 2G15A 2WEIA 4WNOA 3UIBA 2C1BA 4KBKA 4E4XA 5EM8A 4IX6A 2C6TA 2XNGA 5AP3A 4QMYA 2CKEA 4XLIA 2XM8A 1URWA 4R8QA 5CVHA 3CEKA 4FSUA 4TWNA 1M2QA 1U4DA 4LMNA 1YKRA 2PVFA 4TRLA 3T9TA 4EK5A 3K3JA 2P3GX 4X3FA 2VTTA 3ZZEA 3TTJA 4R6VA 3QZIA 5J95A 4EZ3A 4F7LA 2CGUA 3R71A 5CT7A 4PTEA 3R0TA 2GNIA 2ZV9A 2CGXA 4JNWA 1A9UA 3R7IA 1SZMA 4E4NA 2XJ1A 4FIHA 1BKXA 4ANSA 5JMSA 2YN8A 1GOLA 3RKBA 5TKDA 1ZYSA 3HEGA 3IOPA 3DNEA 3R00A 5KZ0A 4BDKA 3G5DA 4OTGA 5IDNA 4HGTA 4DFLA 2BPMA 4BFMA 3A7FA 2FSOX 1YOJA 3ERKA 3DPKA 2P0CA 2GHLA 3CQWA 4CFWA 2WMBA 4ZTMA 3SRVB 4I4FA 1F0QA 1K3AA 4PY1A 4YTFA 3OWJA 4L7SA 2FA2A 4EUTA 2R3LA 2R3GA 4UBAA 3U6IA 2BILB 2J9MA 3FE3A 4NIFA 2FSTX 3PLSA 2HYYA 4FKOA 4GT3A 3W16A 2X7OA 2C6IA 4CXAA 1F3MC 4LFIA 3PYYA 2GU8A 2XJ2A 5K4JA 3MH3A 4MTAA 5IKWA 1YDSE 2C0TA 1KE8A 4USEA 1YWRA 3MVHA 4FTKA 1OUYA 3QRIA 3QXOA 4FIIA 4EORA 3R1SA 4XYFA 5HI2A 5A9UA 2XIKA 1M7QA 3BLHA 3P23A 1GZOA 2VWYA 3EMGA 4FA2A 2UVYA 4EH4A 3LZBA 3NNWA 1PXMA 2XMYA 4G1WA 4DC2A 4EH3A 4HGLA 3PXQA 4AZEA 4FZAB 4G34A 5E8ZA 3UIUA 2WIPA 4CYIA 3ZO1A 4IZAA 3T8OA 2CPKE 2WFYA 3RVGA 2HELA 3E8NA 3FLSA 4IB0A 4PMSA 2XK8A 4BRXA 1ZAOA 4TL0A 1R78A 4RX7A 4NJDA 5LMAA 4D1SA 1OZ1A 2OG8A 5KHWA 3FZTA 1JSUA 3DBDA 1F5QA 3VVHA 3E8DA 5TT7A 2BRBA 3BBTB 3WF8A 2YM6A 1H28A 1JOWB 1ZY5A 3GU8A 3TZ8A 3D5XA 4N70A 3GQIA 4ZTSA 1UU8A 1O9UA 3F7WA 2HW6A 4UY9A 4XV3A 1AGWA 4FF8A 4J97A 2VO3A 3DB6A 4P2KA 4F9WA 4ZZOA 5D7AA 3IO7A 4L44A 1REKA 2C5VA 2OXDA 4DEGA 2WMAA 4CTCA 4AW5A 4TYIA 3IK3A 3SOAA 4FL2A 3QTQA 3IQ7A 5JEBA 4HVGA 4NCTC 2V22A 5LOHA 3E64A 3R7EA 5M44A 4IWOA 3KXNA 3DNDA 5CEOA 4JG6A 4JL9A 4BIEA 3UP2A 3KXHA 4KS8A 1H01A 1OL6A 5CF5A 3E7VA 2ACXA 1M17A 1OKWA 1YI6A 2VTQA 2B55A 3PXKA 1OPLA 4V0GB 4FSYA 4C3PA 4CQEA 4Q9ZA 2ZB1A 4Y85A 4OAVB 4W4XA 1JLUE 5M4UA 5T6KA 5AR7A 1XO2B 4JBQA 1KWPA 1QPEA 4FG9A 3R8LA 3RAKA 3ZRMA 2QVSE 3MSSA 2VWVA 1SMHA 4KWPA 3R9HA 3JY9A 4QPMA 3D2KA 3QUPA 1RJBA 2BDWA 2BMCA 3EZVA 3VNTA 1O6YA 4XBUA 2F9GA 5HVJA 1DM2A 1Y6BA 5JFVA 3AC1A 5A6NA 5DR9A 5DWRA 3F5UA 3CS9A 4CKIA 2WTKC 2REIA 5JGAA 4MXCA 2OWBA 3ZH8A 3MPAA 2PZ5A 3FZRA 1GZKA 4ASXA 5D1JA 4YO6A 3SW4A 4QMWA 4U3YA 3D5VA 4IX4A 2CGWA 1R0PA 2HZIA 2YZAA 3DU8A 3JUHA 3ORIA 3O23A 4BDHA 1W0XC 1FOTA 3E3BX 1TQIA 3HV4A 2DS1A 3OBJA 3LXPA 3HV6A 4TZRA 4BDFA 5AUUA 2HXLA 4LG4A 4CSVA 3D7TB 2VNYA 3LQ5A 4TWPA 4EOKA 3UMWA 5GHVA 4J1RA 4BYJA 4FG8A 4PQNA 1WVWA 3QTXA 1PF8A 4ANOA 2R3QA 3RJCA 4BZDA 2ETKA 4OBPA 3OW3A 4P5QA 4C4HA 2QQ7A 4MF0A 4K2RA 2J90A 3QCQA 4FTQA 3EFLA 3FZOA 3IG7A 3QRTA 2V0DA 4EONA 4O0YA 3GGFA 2P2IA 4MBIA 3FMEA 2XA4A 3LVPA 3ORPA 4PTCA 3TXOA 5L2SA 4V0GA 5CS6A 4WG3A 3Q4UA 4USDA 5FEDA 5HTBA 4NUSA 3KRWA 4OBOA 3BU5A 3O50A 5CZHA 4J7BA 4I94A 3CQUA 3FPMA 3HRCA 3UODA 3NW5A 2DWBA 3QCSA 4ANNA 2P55A 1Q41A 2IW9A 1PYEA 1KE5A 2PK9A 2EU9A 5AAGA 2W5HA 4AZWA 1IASA 3UNZA 3NYNA 5DR6A 4NFNA 3GCUA 1UNGA 2PMLX 3AD4A 3G2FA 3DBQA 3FHRA 3KGAA 4W9XA 2A19B 4KIPA 3DKFA 1XH6A 5LJJA 3FYKX 2W17A 2XH5A 4WSYA 4JXFA 5T3QA 4QMNA 3DXNA 4IJ9A 5JFWA 4CFMA 5CF8A 3PWYA 4APPA 1XH9A 3EQHA 3PZEA 4JBVA 2GNJA 3QTUA 5KX8A 4BCGA 4O1PA 4FIEA 4IAKA 5I5ZA 5BYYA 4I1ZA 4FTJA 3R1NA 3RBWA 1M52A 3I6UA 1S9JA 3OROA 5L2QA 3ZO4A 3IONA 4AGWA 2XNOA 1W83A 4CMOA 4CT1A 4IAYA 3L9MA 3MFTA 2NP8A 1YXSA 3RZFA 5GZ9A 2XIZA 2C6MA 5L6WL 5CAOA 4NK9A 2RFEA 4BCFA 4E7WA 3FKOA 3H4JA 4QYEA 1PXPA 3TIZA 2RGPA 1H00A 1OECA 5DE2A 4ZTNA 4CT2A 3S00A 1H24A 2W7XA 3BYMA 4HPTE 3V01A 2BAJA 3FQEA 2B53A 3MTFA 4L3LA 5DBXA 4G5PA 4XOYA 2AC3A 3NUSA 4L9IA 3U4UA 2WEVA 3QCYA 5DRDA 3F2NA 4BF2A 5KMNA 3EQPA 3ZBFA 2VWIA 2VTHA 4OTPA 3A4PA 4KKHA 5AR2A 2C6DA 4IWPA 4XNEA 3WOWA 3UIMA 3UGCA 3SOCA 3QZFA 2ERZE 3GENA 4LMUA 4S34A 4U97A 1BL7A 2XKFA 4UXQA 2IJMA 3COIA 3KMWA 5AP4A 4O38A 4A4LA 3A2CA 4F9YA 3CTQA 3CPCA 4ZY5A 3MFUA 5EK7A 1LR4A 4NM0A 3F5XA 4NTTA 5IMEA 2OSCA 4BDEA 4YNEA 4RVTA 5KMOA 1KV1A 2IZTA 4I5HA 4RIYA 4TXCA 3FZPA 1KV2A 2RIOA 3I7CA 4FOBA 3EB0A 4QMPA 5EW3A 2XUUA 1NVQA 3PPJA 3MIAA 3L9NA 5FTOA 3W2CA 4QPAA 4DG0E 4JQ8A 2PVMA 3K5VA 1FMOE 4FUYA 3MV5A 4GIHA 2F7EE 2R0IA 4WRSA 3WILA 4XUFA 2WTKB 3DQXA 5AR4A 4BKYA 4WUNA 3TV6A 3V6SA 4IIRA 3AXWA 4WKQA 3TI1A 2C1AA 3F3TA 3C4FA 1R0EA 4J8NA 2YERA 4N6ZA 3CP9A 4RX5A 5BUJA 3SVVA 3EL7A 4ANBA 3OWKA 3NNXA 5CAVA 4EZ7A 4JT3A 5AV3A 4YTCA 5JGBA 4CLIA 3QD0A 3QYWA 2X2KA 4W8DA 3MY0A 5HVYA 3QKLA 3R8UA 4EK6A 4F0IA 3KRLA 2UZWE 3ORKA 5JZNA 2O0UA 4ACCA 4AT5A 4JBOA 4RLKA 3RPVA 4BN1A 1ZY4A 3U6HA 1I44A 3BHUA 2X9EA 2WQEA 2J0IA 3CY2A 4B8MA 3IS5A 3PRIA 3DLZA 4NW5A 1Q99A 3OFMA 3FI4A 2R5TA 4L00A 4M97A 2UZBA 3BHYA 4NSTA 2DQ7X 1YW2A 2QHMA 3DK6A 2QONA 3BCEA 5L2TA 4ALVA 5HNBA 2WQNA 1GAGA 4MF1A 4RT7A 3ZFYA 4C33A 4D4VA 3UG1A 2GFCA 3BZ3A 4TYHB 1ZWSA 2HZNA 3OHTA 5CXZA 4CFVA 4WNKA 2B9JA 2EVAA 3UTOA 2JFMA 3DOGA 1J3HA 4FTLA 4FTCA 3R9NA 4AACA 3Q6WA 3W55A 4TNDA 4ARKA 2XM9A 3PVWA 2CN8A 2J0JA 5EM5A 3GCVA 3HVCA 1JSVA 2OJJA 4IVAA 4YPDA 3I79A 5EYCA 2YIXA 1WVXA 3PIYA 5DN3A 2WMUA 5HLPA 3UYTA 2YAAA 5L8KA 3SV0A 4ZZNA 2ZJWA 4AWIA 4OUCA 3RAHA 3TACA 4Z55A 2G1TA 3PIXA 4YJQA 2XBAA 3R8MA 4GRBA 3ENMA 3VS5A 2YABA 4BCIA 4ZTQA 2J5FA 2QURA 1J91A 3DFCB 4ENYA 3KXGA 2R3RA 3PIZA 3QTWA 2OBJA 5I9VA 5J7HA 4YZBA 4DAWA 3R1YA 1TQMA 2UW6A 4G17A 1FGIA 4YTIA 5HU3A 2GNLA 3QLGA 2P2HA 4YSJA 4RX9A 3EZRA 4ALWA 2W9ZB 4AE9A 5IA5A 3DKOA 4WD5A 4GH2A 5HESA 2J6MA 4CZTA 1J1CA 4M13A 2C68A 4HNFA 1J1BA 1U54A 3ACKA 4JS8A 1XH4A 4GIIA 4BHZA 2Y6MA 1IRKA 3UPZA 4P90A 2XIRA 4WIHA 4RGJA 5KUPA 3IDCA 3DDPA 4C62A 5LWNA 3OMVA 3QQJA 1YXVA 3LJ2A 4FNWA 5EKOA 3TTIA 4EOPA 4RMZA 5F20A 2PVKA 5C9CA 4GG5A 1Q8WA 5BVWA 4HYIA 5GZAA 2QO7A 4EYJA 4C37A 4UZDA 1DAWA 2O8YA 1TVOA 4AOJA 2YAKA 3B8RA 3OOGA 4KKEA 4TYHA 3RHKA 2FSLX 4UZHA 4YJSA 4FKRA 4LM5A 3PXZA 1Y91A 3O0GA 4RIWB 3B8QA 3VUTA 2H6DA 2UZOA 5LVOA 3C4WA 1VYWA 4JDIA 2ZB0A 4Y5QA 4IBMA 4NW6A 4PDPA 2YACA 4QP4A 4RZVA 4WT6A 5ETFA 4YLJA 3TWJA 2WTWA 4BB4A 2VWWA 3C4CA 1WBOA 4AUAA 3Q52A 4JR3A 4LV8A 4NTSA 3VBWA 4F9CA 3D5UA 3FMMA 2V55A 3I81A 3KULB 4O96A 2E9NA 5FTQA 4KIOA 3ZRKA 4ACHA 1PXJA 2YLEA 4NM3A 1BX6A 2GS6A 3KF4A 3PY1A 4Y5HA 3R7UA 1LEWA 4R5YA 4IFCA 4ENXA 4B7TA 3QQFA 4U79A 4CLJA 2J51A 3C7QA 3VHEA 2EXEA 4H3BA 4A9SA 1UKHA 3DFAA 4IZYA 4I6BA 4RX8A 5IA1A 3MBLA 2UW0A 4MXZA 4ZY6A 4KBCA 4L3JA 3GC0A 4RC2A 5IA4A 2A1AB 4XP0A 2RSVA 2ZDTA 2IO6A 2XKEA 3W32A 4TTHB 3SHEA 5CU3A 2JC6A 3U9NA 2CDZA 5M51A 3W18A 4I41A 1T45A 3HGKA 3D5WA 3U8WA 4AN3A 2VWBA 4DH8A 3MY1A 1Q3DA 2BRGA 1I09A 3QX4A 3QGWA 2O5KA 2WU7A 3FC1X 4QTAA 3TN8A 5JKGA 3MI9A 2HCKA 4C61A 4YZ9A 3FPQA 4HVDA 5M4IA 1Z57A 2VV9A 4O0TA 3DV3A 4JRVA 4AP7A 2XNBA 1DS5A 3F5GA 3LFFA 4AW2A 2YDKA 3BE9A 3RAWA 4B4LA 4N4SA 1GIHA 1JQHA 4MNFA 5IA3A 4QTDA 3UZTA 1ZYJA 3Q3BA 4CMUA 4FTAA 4ITHA 2YFXA 3FQHA 1V0OA 4FV5A 2VTJA 3QFVA 4QP9A 1XJDA 4EHGA 2C47A 3MS9A 5K0XA 4XG9A 3W33A 4AZVA 3GCQA 3DBCA 2Z7QA 4BZOA 3RZBA 5GJDA 3E7OA 4RWIA 3KULA 5F94A 3UO4A 3D9VA 4AS0A 4F6UA 2W9FB 5D9HA 3F9NA 4QQJA 2YITA 5CI7A 2UZNA 1WVYA 4CZUA 3PJ3A 4MQ1A 4E20A 2LGCA 2F57A 4C4FA 5CNOA 4F99A 3SD0A 2UV2A 4IAIA 3W2OA 2X81A 3WYYA 4AOTA 3A61A 4F09A 4DEBA 2E9OA 3QU0A 3ITZA 3RPRA 3V6RA 2CN5A 3R7VA 1M14A 2JGZA 4YHFA 4OT5A 1V0PA 3VUKA 4ID7A 3HMPA 1OKVA 5AR5A 4F6SA 4FMQA 4RJ5A 3EN5A 3T9IA 4EUUA 1YDRE 2Y8OA 1FINA 4M0YA 3FJQE 2ITTA 3BWFA 4L53A 3ZM4A 3UJGA 4DITA 3ZONA 4F7SA 4KRCA 2OICA 4HVSA 4AN9A 4HVHA 3ET7A 3TKIA 2PZYA 3VUDA 3P9JA 3BYVA 4OR5A 5J9YA 4ZJJA 2H34A 3KN5A 4CCUA 2WZJA 3KMUA 3FLQA 4AN2A 2QD9A 3R8ZA 3F88A 1Q24A 1Y57A 4ACDA 3HP2A 2ZVAA 5AAEA 3UP7A 3CY3A 4WRGA 2JAVA 2IW6A 3GOPA 2ZYBA 3OY3A 4J99A 2HW7A 4G31A 5LWMA 2C3IB 2QHNA 2WMSA 4J52A 5HD4A 1YI3A 4L52A 2SRCA 3Q4ZA 4WNMA 2VTSA 5FD2A 3OW4A 3ANRA 4B99A 5HO6A 4XRLA 4CFUA 4ANQA 2VRXA 4FOCA 4E93A 5G1XA 3BGZA 2XIXA 3NIEA 4FC0A 2PHKA 4BI1A 3CXWA 3H9OA 2GCDA 4L7FA 3E62A 4K33A 4PL5A 2XKCA 3PSBA 2FGIA 4MD8E 5J79A 3OTUA 2Y4IC 2OI4X 3C13A 3A99A 4FBXA 3TNIA 2VZ6A 4RWKA 1XHAA 3PPKA 4ZSGA 3LCOA 5HBJA 2C6KA 3VQUA 2OIQA 4O21A 2HOGA 3R21A 3I1AA 3Q4TA 4QTCA 5AUZA 1XH8A 3ZEPA 3EFKA 1Q61A 4D2VA 1JKLA 2WQBA 4IE9A 2EUFB 4DGGA 4NH1A 5ICPA 1APME 4FODA 4JR7A 1UVRA 3C4ZA 3LHJA 4FKQA 1O6KA 1Q4LA 3FXXA 4UWBA 3G0EA 4WHZA 4J98A 3RPOA 4RIXB 2I0EA 4U3ZA 3OUNB 5EI6A 5E1SA 1TQPA 1DI8A 4M12A 4FT3A 4UWCA 3R63A 4BKZA 4EHVA 5KKRC 4FV8A 4H36A 4D2SA 3GU4A 3QUEA 2G2HA 3RK9A 2PVYA 3C1XA 1XH5A 5A4CA 5AM7A 2QI8A 5E8VA 4FSNA 3A60A 3PJ2A 4X2GA 3R7OA 1YWNA 4IM0A 1ZZ2A 4Y83A 3S4QA 4EQUA 4M7IA 3S3IA 5HX8A 4D4RA 4FTMA 3M11A 3KXXA 1NY3A 4FYOA 4I93A 4FKUA 2CCHA 3AMYA 3WARA 4UB7A 4FR4A 4O0VA 4X0MA 3V5PA 4D0XA 2BCJA 3KRRA 3FMLA 3ZTXA 4M84A 1UNHA 4K77A 4L3PA 5DEYA 3VUGA 3QRUA 2OJIA 2XNPA 4E1ZA 4EKLA 4QMQA 5TE0A 3V5QA 5BQ0A 3MPTA 3PZHA 5EM6A 4L46A 3VS0A 4FSTA 3R6XA 3D4QA 3E3PA 4IVDA 3UOHA 2EB3A 4BIDA 3Q96A 2QU6A 4NM5A 4PPBA 2OFVA 4OTQA 4GMYA 5CEQA 2P33A 4GT5A 5CEIA 2GFSA 3TUCA 2VWXA 3RNIA 3MB6A 3Q04A 4IMYA 4ZOGA 4CKJA 5EDPA 3QC4A 4BKJA 4FI1A 4RJ4A 4OTDA 2YA9A 4S33A 3VS7A 3KB7A 3ZDIA 4MD7E 1NVRA 5HEZA 2C5NA 4JX7A 3ZO2A 3PY0A 3NW6A 3FMNA 1VYZA 2ITXA 5HTCA 1KSWA 3MPMA 4G3CA 4G3DA 4G6NA 3L9LA 3DAKA 3ZC5A 4EH2A 3O8TA 4TWCA 4O27B 1YVJA 3V5TA 3LM5A 3DJ5A 5E8XA 5KBRA 5H3QA 2WNTA 5E8UA 5AA8A 4NWMA 2LAVA 3UOKA 3H30A 4QOXA 2I0YA 3GI3A 3ORMA 1CKIA 5IH6A 4QMMA 5G6VA 4X21A 2OF2A 3QX2A 2ZV7A 2C5XA 4MBJA 4PX6A 1QL6A 1ZLTA 4NJ3A 3LXNA 4ANMA 3A7GA 2OH0E 4QQCA 4BTMA 4G9RA 4IEBA 1PXNA 2C3LA 4FK6A 5CQUA 2G9XA 3EQFA 4K0YA 3LJ1A 4WNPA 4AA5A 3CCNA 3HX4A 3TJCA 4AT3A 4G9CA 2JFLA 4DGNA 5ANDA 5L6PA 3O2MA 5DIAA 5CASA 1YOLA 3NCGA 5K9IA 4RG0A 4L45A 5IH4A 1XR1A 4HYSA 2WO6A 3AC5A 3TNQB 3NCZA 1JNKA 5KMMA 3LCTA 1H07A 2C5YA 3AG9A 3GCPA 3JVRA 4GW8A 5FQDC 2HWPA 2UW9A 5HIDA 4BCOA 4ERWA 2OZAB 4CCBA 5LMKC 2UVXA 3P7CA 3REPA 2IVUA 3T3VA 3VWAA 5IUIA 4BDJA 5BVFA 3IGOA 4WUAA 1JBPE 1VEBA 4AZTA 1KOAA 4OTIA 4AX8A 2X8IA 2Y7JA 3HUCA 4HYHA 4DGOA 2JKQA 2IZRA 2OGVA 3D83A 4FICA 4G16A 1PY5A 4BWPA 3MJ2A 3ULZA 2OZOA 2C4GA 2YJSA 3NUYA 3QKKA 3SRVA 2ESMA 4D2PA 2Y4IB 2UZVA 3KEXA 3DJ6A 1ZMWA 3POOA 3EN7A 5F4NA 3ZO3A 2EXCX 4ITJA 4QTEA 2JLDA 3FSFA 3PVBA 3C4XA 1PKDA 3QXPA 1OPKA 4YJTA 2IVVA 3H0ZA 4JDJA 4MWIA 3DZQA 3OCGA 4QNAA 4ZJVA 5B2KA 5IMXA 4I0RA 3ZRLA 3HDMA 4BDIA 4KIKB 4EK3A 3FDNA 5JGDA 5L3AA 2VX1A 1G3NA 3ZLSA 2GPHA 5KKRB 1ZZLA 2O64A 3UC4A 3L8VA 3OZ6A 3G9NA 4KSPA 4XG3A 1ERKA 1FVTA 3BYUA 5D11A 3UVPA 3VUMA 3E8CA 4L67A 3GU7A 4DCEA 1Q3WA 1HOWA 2CCIA 2BZHB 2C6EA 5DOSA 3GOKA 2X8DA 3ANQA 2C5OA 4FZDB 4RC3A 3GC8A 1FGKA 4L01A 2ITNA 2ITYA 3S95A 2E9PA 3FMJA 3TG1A 5HE0A 3TT0A 1ZMVA 3COHA 4ZAUA 2P4IA 3U87A 4Q5HA 4UEUA 5ITAA 5A4TA 3H10A 3VRYA 2XKDA 3E5AA 2PMOX 3GBZA 4ZY4A 4U5JA 4RFMA 3O71A 3PSCA 2OZAA 4H3PA 4UMRA 1JVPP 3VF9A 4DG2E 5J9LA 4ITIA 3U9CA 2UW3A 3BV2A 3R02A 3DS6A 2A27A 4FNXA 4M67A 5HICA 4DHFA 3QKMA 4GS6A 2XNMA 3QQKA 4HJOA 2QOHA 4APCA 3RINA 3BBWA 4FKVA 4DH1A 4OW8A 4DGLC 2XEYA 2BKZA 2HAKA 5D7VA 5M56A 4YNOA 4CZYB 3DKCA 2B9IA 3CC6A 3V5LA 3LJ0A 4JOAA 3SXSA 4YPSA 3HDNA 5ANKA 1YQJA 5LVPA 3DZOA 3P7AA 4E5WA 5HG9A 3PUPA 2A4LA 2I0HA 2JITA 4UN0C 4PPAA 5CALA 3L8PA 2XBJA 4RIOA 4RQVA 4XV1A 5AEPA 4GV1A 2ZV8A 1YHVA 2DUVA 2ZMDA 2JDVA 3NEWA 2E2BA 4FEQA 4Z7HA 3ZLXA 4FUXA 3U4WA 2Y4PA 2ERKA 3IDPA 3KXMA 3NAYA 3ORTA 3ALOA 1H0VA 3MJ1A 3UDBA 2JD5A 2X7FA 1FVRA 3D2IA 4FV4A 1QCFA 5CSHA 1SYKA 4MEDA 3C4EA 3PVGA 1GIJA 5ETAA 4DEHA 2VWUA 5AUVA 1IR3A 3QQLA 1W84A 2GMXA 1ZYCA 4D1XA 5DR2A 5KBQA 2X4FA 3LQ8A 2X1NA 3LFCA 3R73A 5KO1A 3QGYA 3E92A 4RQKA 5ANJA 3VBYA 3RHXA 3LIJA 1B39A 4ZSAA 4I6HA 5FDPA 2JIUA 3VAPA 5ANIA 4GK3A 3KC3A 1JSTA 3EHAA 3EKKA 3BGQA 3HMNA 3JXWA 3TKUA 3BE2A 3G6GA 4FZ6A 4NZWB 5HE1A 4C2VA 4C4GA 4CV9A 4USFA 2F2CB 5J5TA 5JZJA 4OAUC 1YHSA 4EOJA 4MKCA 4X2FA 2X6EA 2YIRA 3BHHA 4C7TA 4O0UA 4U8ZA 2JDTA 3C5UA 5ETIA 3ZXZA 5B2LA 3W2RA 2PVHA 3UQFA 1NXKA 3PJ8A 2JDOA 4O2ZA 3GC7A 4TY1A 4ZTRA 3D7TA 4G2FA 4FZ7A 4JBPA 2XF0A 3EN9A 3ZXTA 4AW1A 2JBPA 4L6QA 5C01A 3LOKA 3MDYA 3WE8A 3EQCA 3WF9A 2B54A 4PV0A 4FGBA 2PVLA 4LOOA 3QWKA 3E87A 5DFPA 4IB1A 5K0KA 3VS1A 5F9EA 3CTJA 3OWLA 1WBVA 1FQ1B 4XOZA 1W7HA 3ORXA 1BL6A 4MQ2A 2W1FA 3OP5A 2QOIA 5CU2A 3RWQA 5DMZA 3KXZA 3V51A 4FV3A 3OG7A 3FMKA 5KMLA 3FBVA 4IAZA 3D14A 1GNGA 4FSQA 5CU6A 3OXIA 3QRKA 2Z7RA 1WMKA 4E6CA 5I9WA 2PWLA 4ASZA 1VJYA 4LGGA 4EOSA 4D9UA 3WIKA 3FL5A 3R83A 1IEPA 1QPJA 1VZOA 2WMRA 4ZJIA 3MA3A 4FTUA 1QPCA 4EZ5A 2GDOA 3FMHA 4KNBA 4JQ7A 4MXXA 4PMTA 5CNNA 5EOBA 3U6JA 4YGAA 2UW5A 1ZRZA 3QYZA 3CJGA 3ORZA 4LOQA 4MWHA 4CNHA 3FZ1A 5JFXA 4OBQA 5C8KA 4O0XA 3O7LD 3KA0A 4I5PA 1MUOA 3PE2A 2I6LA 4J53A 5B2MA 3Q9WA 2R0UA 2GS2A 2BRMA 4DINA 4EK4A 4FV6A 1MRVA 5AUTA 1K9AA 2PUUA 4HGSA 4QPSA 2YM8A 4MH7A 3V8SA 4E3CA 3NLBA 1Y8GA 1PXLA 3CKXA 3PXFA 2QO2A 4FV2A 3LPBA 3FV8A 5AUYA 4JG7A 3DDQA 4PP9A 4XEYA 4C4IA 2FVDA 2XIYA 3AC3A 2BALA 1XBAA 3HYHA 1FMKA 3P7BA 3ZFXA 2ITWA 4MNEB 3QZGA 1H27A 1H26A 2PE0A 2Z7LA 3HV5A 2Z60A 3FQSA 4C8BA 5HHWA 1GZ8A 2PTKA 3LFNA 5HNGA 5AUWA 4E4LA 3PJ1A 3Q32A 4KB8A 5HG8A 3VW8A 1OI9A 1OIYA 4TYEA 5AIKA 5AM6A 1OL2A 4OTFA 2FYSA 1FPUA 4V04A 5KMJA 5FM3A 2KTYA 5AUXA 3ZLWA 4I0SA 4Y95A 2J0MB 3GC9A 4XLVA 2QKRA 4XG6A 2PVRA 2X7GA 3R30A 1WBTA 2OJ9A 2VTIA 5HX6A 3OD6X 1PMEA 3F61A 4AF3A 4V01A 3A8XA 3ALNA 3UOJA 4A4XA 2UZEA 4Y73A 3FHIA 3DA6A 1OGUA 3DLSA 4QYYA 5AADA 2XP2A 3MIYA 3PJCA 5EI2A 3A7JA 4NCTA 4DFXE 5I3OA 2XK3A 5AP6A 3K2LA 2F4JA 3PG1A 4QNYA 3MVJA 3PA3A 5GJFA 3MVMA 3SDJA 3VJOA 4EYMA 5JK3A 3HA8A 4FV0A 2GHMA 1KOBA 4EH9A 2ITVA 3NZ0A 2Y0AA 3PRFA 4DN5A 5BVNA 2W4JA 3N9XA 5LVNA 3F7ZA 2UZUE 2JDSA 3RK5A 4HYUA 4XG2A 4HNIA 3MY5A 1IA8A 3HMIA 5AP7A 1L3RE 3RALA 2HIWA 3ZC6A 4IANA 4PL3A 5HLWA 3K3IA 3UNJA 4RPVA 2JAMA 3FL4A 2ONLC 3L8XA 3GUBA 2PZRA 4TYGA 3SXFA 2OW3A 1OVEA 5FXQA 4D5KA 4KRDA 2IN6A 2PVNA 3N51A 5BX0A 4F4PA 2WHBA 3GXLA 4QMXA 5IA2A 1AQ1A 5HO8A 3PP1A 1PXKA 2XCHA 2YDJA 4CEGA 4XP2A 2W99B 4M69B 4UXLA 3ZMMA 3HMMA 4B8LA 4E6AA 5IF1A 4P7EA 5AMNA 4I6QA 2IZSA 4YC3A 3S2PA 4M15A 4IWDA 2VO7A 3TEIA 4I24A 5ACBC 3VJNA 3OS3A 2VGPA 2X4ZA 2PE1A 4RVMA 4TN6A 4C3FA 3FKLA 4F64A 5CF4A 1WBNA 2RL5A 3E8EA 1OKZA 2YJRA 4BDBA 3JY0A 3CGOA 5HOAA 2J50A 5E92A 3JS2A 4WSQA 3PP0A 4YP8A 4B6LA 3EOCA 5CEMA 2FH9A 4A9YA 3MFRA 3PY3A 1PMUA 2J0LA 5E7RA 1O6LA 4J71A 4AGUA 2G2IA 3GFWA 3A7IA 4I21A 2RF9A 3M42A 5DNRA 3KRJA 2C3JA 3C51A 4C3RA 4YU2A 3HV3A 3ZYAA 1H4LA 2XB7A 4D58A 3VS6A 4TYJA 2VTPA 3CBLA 1LP4A 4QP3A 5H8GA 4FKJA 3JYAA 4ZLOA 4CV8A 3AT3A 2EXMA 4NKAA 5GJGA 5J9ZA 4EWHA 2H8HA 2W1IA 4S31A 4C35A 3MH1A 1YI4A 5CSVA 2C6LA 4CD0A 5DT4A 4YO4A 1UWHA 4BCMA 4LL5A 1VR2A 4LI5A 5BPYA 3SC1A 4DEDA 4B9DA 2QC6A 4PPCA 4Z7GA 3G0FA 3VQHA 4A7CA 5L8JA 4JDHA 1PYXA 4QP6A 2IW8A 5M57A 2XK9A 3NR9A 4ZLYA 4UALA 2YM7A 3GQLA 2X2LA 3BYOA 4RLLA 1DI9A 1PMVA 5C27A 4QP8A 5JSMA 4W4WA 4X2KA 3RAIA 5IPJA 5E1EA 5D41A 3JPVA 4TT7A 4DH7A 4AZFA 3NDMA 4YMJA 5ANGA 5DVRA 4AFJA 5HQ0A 1H8FA 2BTSA 5EW9A 1SNXA 4I6FA 2PZPA 3EFJA 2GHGA 2OJFE
chains in the Genus database with same CATH superfamily
3COMA 4AT4A 5EHYA 1Q8YA 4D9TA 2UW4A 4DLJA 2BRHA 2BUJA 3Q4CA 3S0OA 4L43A 1WAKA 3LCDA 2IF8A 5A46A 5AV2A 4OLIA 5FLFA 4H58A 3WF5A 2R64A 3UG2A 3F3WA 4EWQA 1UU3A 4BYIA 4C02A 3HMOA 4R5SA 4I3ZA 2V7AA 5LXMA 3MFSA 4O1OA 3WBLA 2OU7A 4WA9A 3K5UA 1JWHA 4PMMA 4JAIA 2R3FA 2XNNA 3EQBA 2WTJA 3AGMA 3VS2A 2X6DA 4RJ3A 4R7IA 1KE6A 2VN9A 2W1EA 4FTNA 5LCKA 4X2JA 3VULA 3HL7A 4BBMA 3GB2A 3AMBA 3VBXA 4F1TA 4PL4A 5AX9A 4FNYA 5HCXA 5HE3A 1H1SA 5BVOA 4YBJA 1WBWA 3BYSA 3BU3A 5I4NA 4RIWA 2ZMCA 1H1RA 5BYZA 4HW7A 3C50A 2Z7SA 2WKMA 5HGIA 5C26A 2C0IA 4ZK5A 5KNJA 2IVTA 1B38A 4F9AA 4HPUE 4GFMA 2Y6OA 1EH4A 2W96B 3DCVA 2WMWA 4FL1A 5IUHA 2X39A 2GNGA 4EL9A 5DHJA 3EIDA 3L8SA 5FXSA 4U41A 2ZOQA 3P1AA 5JQ5A 3A4OX 4OT6A 1ZOGA 4E5AX 3UO5A 2WELA 3OEZA 4O4CA 2PZIA 4U44A 4FKLA 4MXAA 5IZFA 3PA5A 4QTBA 3P79A 4EBWA 5CY3A 5I0BA 4S30A 5F95A 5EHLA 4K8AA 5BMMA 5CAUA 3IW4A 4JVGA 3GVUA 2AC5A 4XCUA 4UMTA 4JIKA 3FI2A 4YLLA 3VRZA 4LL0A 5HZNA 1S9IA 1UKIA 5DT3A 5FXRA 3RTPA 3JVSA 4YC8A 2W5AA 5M4CA 4JQEA 1ZYLA 3ZBXA 4E4MA 3IW7A 2WTDA 3KCKA 2GS7A 3KU2A 2WMXA 4F63A 4C59A 3Q53A 4QMVA 4YZNA 3C0HA 2G2FA 1BUHA 4GYGA 5CU4A 4Y72A 5DT0A 4DLIA 5HD7A 2GSFA 1MRUA 1RE8A 3ZLYA 3GCSA 2WQMA 4IVCA 4IHPA 3NIZA 4EBVA 4GU6A 4E26A 1MQ4A 3BKBA 2BZKB 4IACA 3QCXA 2NRYA 2WTCA 4YLKA 4EHEA 4C34A 3O7LB 3WZJA 4V05A 4EH6A 5I9ZA 3NW7A 3DY7A 4HCVA 4YHTA 5FBNC 3WF7A 1ZARA 2ZDUA 4M68A 4U7ZA 4H39A 4L68A 5AV4A 1V0BA 3EYGA 3TKHA 4FVPA 4PF4A 4RZWA 1STCE 3CE3A 4ZS0A 3W10A 1OB3A 2PY3A 4K1BA 2Z8CA 4GT4A 3W1FA 4FKTA 4F1MA 2QR8A 2VAGA 5AA9A 3TZMA 5J5SA 3CGFA 3R8VA 1YXTA 4GVAA 4JAJA 5A4LA 4IH8A 5CWZA 4YC6A 3D94A 5B7VA 1JKTA 4E6DA 3F69A 2JIVA 5AV0A 2WMTA 3CR0A 3POZA 2QCSA 4X3FB 4GJ2A 4FIGA 5A14A 5L2IA 2YWPA 4RA5A 4C58A 1OITA 4R3RA 2QU5A 3QZHA 5A3XA 1YOMA 4U45A 4BGGA 4E5BA 4PWNA 5EM7A 4DFNA 2VU3A 5LCJA 4LV5A 4R1VA 5GNKA 3QHWA 1M2RA 5FRIA 1OIRA 1CM8A 4BWKA 1JKKA 3LCKA 4CKRA 5J7BA 3NUUA 4UMQA 2WGJA 3NAXA 4FK3A 4FKGA 4IDVA 1H1PA 4TNBA 3SLSA 3ZS5A 2BIYA 5LVLA 4BIBA 2W1DA 5CX9A 2XYUA 2QOOA 4II5A 2WIHA 4F0GA 2H9VA 3AC2A 3B2TA 2WQOA 1XBBA 1SVGA 3RPYA 4AA4A 4U42A 2CJMA 5DEWA 2GTNA 3Q6UA 2FO0A 3CQEA 5HBHA 3P86A 5CVGA 2R3IA 2J7TA 3I6WA 2JEDA 2XEZA 2WXVA 3RWPA 2VWZA 3TL8A 2C3KA 4IWQA 1KE9A 1Q5KA 2RFDA 3EKNA 3F3UA 3ORLA 4P4CA 4HVIA 4MD9E 4H3QA 4I4EA 4QYFA 5JRSA 5CU0A 3KMMA 3CD8A 1UV5A 3KFAA 4EC8A 3NNUA 2OIBA 3UMXA 3VBVA 2VTLA 2BIKB 4IC8A 1OUKA 4CVAA 4O4DA 5I3RA 3O8UA 4NIFB 3RGFA 3DQWA 4EH8A 4Y8DA 3OXZA 3H9FA 4BCJA 3FKNA 2R7BA 1ATPE 2YM4A 3DJ7A 4W4VA 5FG8A 3BIZA 2A2AA 1U5QA 5A6OA 5JT2A 3THBA 2PMIA 2BVAA 3I0OA 2XRUA 3BQRA 5AP0A 5EYMA 4OGRA 3MH0A 4LQMA 5IA0A 3EFWA 5I9UA 3VHKA 2FUMA 2B9FA 2VTMA 2ZM4A 4ALUA 5FEQA 1P2AA 3SW7A 4PDOA 2BHEA 3FXWA 1MQBA 4PP7A 4X7QA 5AR3A 4F65A 3AC8A 3IOKA 4W9WA 3VBQA 4RIXA 4CYJA 5K3YA 2OIDA 3DAJA 4FTOA 3QL8A 2YDIA 1WBSA 1AD5A 3QC9A 4RWLA 4HOKA 2CMWA 2BDJA 5HCZA 3A7HA 2XK4A 4C57A 3KCFA 4IVBA 4EI4A 5C1QB 2ZM1A 4J8MA 5FDXA 3NYOA 3BX5A 4YHJA 3W8QA 3CPBA 5JRQA 2BHHA 4FV1A 4ONAA 4XMOA 4G3GA 4W8EA 2AQXA 3LFQA 3DT1A 2RFSA 4M8TA 1Q8ZA 3ZU7A 4NU1A 4XP3A 2F7XE 4ZTLA 5CENA 5EDQA 4LUDA 5CSWA 2WMVA 5BUEA 4G3FA 5FP6A 4KBAA 4IC7A 5J1WA 3BHVA 3DTCA 1WFCA 3QTZA 3WYXA 2XCKA 1ZOHA 4JDKA 3RM6A 5IDPA 3LMGA 2QLUA 4F7JA 3G9LX 3UBDA 5IU2A 5EYDA 2ITQA 3QQHA 2QOQA 4LYNA 4YZCA 4EQCA 4MXOA 3LCSA 2NRUA 4YUQA 1GIIA 1CDKA 2WTIA 2YM5A 3R28A 3RP9A 1U46A 5DPVA 3HP5A 2OH4A 4EOIA 3ZZWA 2B52A 4OTHA 4XS2A 3LW0A 4IX3A 4BI0A 3LFEA 3MB7A 3PA4A 3ETAA 4WG4A 5LVMA 2A0CX 1OL1A 3ENHA 3ZSIA 3RCDA 3IGGA 4BGHA 3ODZX 3NUNA 5HG5A 2F49A 4X6RA 5KHXA 3FLYA 4ZSLA 3R01A 4KIQA 3UIXA 4UMUA 2VTOA 2Q0BA 2O3PA 2ITZA 3S1HA 2NPQA 2PL0A 4IB3A 4A9UA 1RDQE 4S32A 4BDCA 3DB8A 4LGDA 2UW8A 4B0GA 3OT8A 4OTRA 5L8LA 3QA8A 4IM3A 4UYNA 2QOKA 3OWPA 4U6RA 4FSRA 4EEVA 4XH6A 3SAYA 3V3VA 2CLXA 4Z16A 3KKVA 2JBOA 3BQCA 5EHOA 3KQ7A 4DH3A 4PRJA 5CZIA 1CKPA 3DTWA 4YURA 4HCUA 4XG8A 3EQIA 5EG3A 3KVXA 4Q2AA 2W5BA 3FY2A 3ZEWA 3MW1A 3UC3A 1X8BA 2ZV2A 3AT4A 2F7ZE 2UW7A 3EN4A 2HY0A 3P0MA 2XS0A 4EOMA 3IPHA 2XZSA 2B1PA 4AQCA 5AX3A 2QLQA 2R4BA 1T46A 3BEGA 4AZSA 3IW8A 4EH7A 2BFYA 4HZRA 4CTBA 2VO0A 2V5QA 3FUPA 4XX9A 4YZMA 4WO5A 5FM2A 2R2PA 3E63A 4FT5A 5IEYA 4XBRA 4XHKB 3AMAA 4XV9A 4M0ZA 4RBLA 1GJOA 3ULIA 3QALE 4FVRA 2IWIA 3RMFA 4GEOA 3CKWA 2OXYA 5GZ8A 4LGHA 1Q97A 2J0KA 1H1WA 4RVLA 4AGDA 4PNIA 2WU6A 3TIYA 3I7BA 1B6CB 3AD5A 4U0IA 4X6QC 4BGQA 3OF0A 3G51A 4FSMA 4M14A 4ACMA 3NRMA 1OL5A 1WBPA 4WBBB 1YRPA 5HKMA 4DBNA 5IEVA 3KVWA 3VS4A 5K4IA 3GT8A 2BAQA 3TCPA 4FNZA 5E90A 1UU7A 4NKSA 3O51A 1WZYA 1YXXA 5FWKK 3HZTA 2YCFA 1WCCA 4ZSEA 3EN6A 5KZIA 4EK8A 1UNLA 4GCJA 2YISA 2RG5A 5E8YA 3UQCA 3R8PA 2XRWA 4YZDA 3SKCA 5CEKA 4I5MA 1UU9A 3AQVA 4L42A 2HENA 3GU5A 5E8SA 5FBOA 4KIKA 4GVJA 2O2UA 3UQGA 2OK1A 5AV1A 2VD5A 5J87A 1NVSA 2R3OA 5CSXA 3VBTA 2X2MA 2BTRA 4AE6A 5BMSA 4RFYA 3ZUUA 4MCVA 5CANA 2WPAA 3GNIB 3NUXA 4R3PA 4C0TA 4F08A 2RFNA 5CI6A 1H1QA 4G5JA 4O91A 4QO9A 4CRSA 4EKKA 4UX9A 2GTMA 3LFDA 3PVUA 4IDTA 3NS9A 2OXXA 3FY0A 5H9BA 4JX3A 4YJUA 3OC1A 4R3CA 5BUIA 5BNJA 1E9HA 3QRJA 2O63A 4IZ7A 3BHTA 2O65A 2YIQA 4EH5A 4FTIA 2I1MA 4DG3E 5C8NA 2VX3A 4D5HA 4UV0A 4CFFA 3QF9A 2X9FA 3KF7A 4FZFB 1GZNA 4J95A 4C38A 2HK5A 3PFQA 3OVVA 2WMQA 1PXOA 1R39A 2CLQA 5CQWA 3W8LA 1NA7A 2HY81 3QLFA 4MXYA 2PMNX 4QMLA 5EOLA 3KY2A 5CTPA 4D1ZA 5HIBA 3CD3A 4MYGA 4FTRA 3COKA 4XRJA 5BVEA 1SVEA 4GK2A 2QG5A 2W1CA 1REJA 3LFBA 3UVRA 5HLNA 3SA0A 3D7ZA 4KS7A 2VUWA 4QYHA 5C03A 1RQQA 2F2UA 3Q2MA 2JKOA 5BVDA 3D15A 2OFUA 3MA6A 4O0RA 1ZOEA 4I5CA 5H8EA 4D0WA 1XQZA 4DTKA 2CGVA 3R22A 1M7NA 5AP5A 3TV4A 3NYXA 3FZSA 1RW8A 3U51A 2UVZA 4MBLA 4RIYB 2RKUA 2V7OA 4H1MA 3NPCA 1G5SA 3K54A 3EH9A 4QMUA 4AU8A 3EJ1A 5HNIX 3O8PA 3DGKA 5IISA 3Q60A 4MHAA 4ASEA 1LEZA 4YJRA 3F6XA 4RSSA 1SVHA 3NX8A 3WZUA 4BCNA 5HORA 3LLTA 4GJ3A 1PXIA 1LUFA 2UZTA 4FV9A 3TNHA 1U59A 4IXPA 4D2TA 2QO9A 4ZIMA 4K11A 4YJOA 2BZJA 4IFGA 2W1ZA 3AC4A 3M2WA 3UPXA 5EYKA 1W8CA 4GU9A 1PJKA 3F5PA 1ZMUA 4XG7A 5HBEA 4ERKA 2WOUA 4S2ZA 4O0SA 4DFYA 4EOQA 1UA2A 2R3MA 5CAPA 3ELJA 3Q9XA 5IG1A 3TUDA 5HE2A 1OM1A 5KE0A 4LRKA 3QQGA 2ZM3A 4Z9LA 4ZZMA 3ZCLA 3DK7A 2J2IB 4RFZA 5M4FA 4WBOA 4KD1A 3RNYA 1KE7A 1R3CA 3I5NA 2JKKA 2QNJA 2YHVA 4MAOA 5DGZA 4D2RA 5IH5A 2XVDA 3BLRA 5D10A 4Z3VA 3F3ZA 4DEIA 4A9RA 3BRBA 3OUKA 4FKIA 3TUBA 2FSMX 4FRFA 2XK7A 2VNWA 3H0YA 1Z5MA 4C4JA 5TOZA 1PMNA 3PG3A 5IUGA 4YSMA 2JKMA 1Q62A 2UUEA 4H1JA 3NSZA 1YXUA 2X8EA 5HO7A 3MN3A 4TKSA 3BWJA 4R1YA 3ROYA 5LMKA 3HKOA 4WG5A 5EI8A 1JAMA 3II5A 2VO6A 5EH0A 2V62A 2PSQA 3C0GA 3ZSGA 4BBFA 4AGCA 4BBEA 4E73A 4NT4A 4EC9A 3WZDA 2IZUA 1H25A 3EWHA 3WZKA 2JIIA 1Y6AA 5DLSA 5HG7A 5CF6A 2B4SB 4CFXA 5I9XA 4YTHA 2NO3A 2UZDA 5LARA 3Q5ZA 3QWJA 2BAKA 3KK8A 4KINA 4D2WA 4DGMA 4RJ6A 4DEEA 1E1VA 2HXQA 3V5WA 3WE4A 3PTGA 5AAFA 3G33A 2Q0NA 2WOTA 1CSNA 4OTWA 4FT9A 4PDSA 3RK7A 5AP1A 4CFNA 5LMBA 4E8AA 3D0EA 4ZSJA 3I5ZA 3TNPC 3KRXA 2R7IA 3E88A 3BELA 2B9HA 1P5EA 4TPTA 5JN2A 2R3HA 5AP2A 4FIJA 4LUEA 2G01A 3GEQA 2ITOA 4IADA 3FSKA 4JRNA 4O6EA 5ETCA 4UYAA 2RG6A 3VS3A 3NYVA 2GQGA 2QOFA 2XJ0A 4IX5A 5JQ8A 4C36A 3OCBA 3Q9ZA 3BEAA 3MH2A 2GNHA 5CSPA 1SNUA 4FYNA 3R7GA 4BHNA 4YR8A 4F6WA 1U54B 3OCTA 4X2NA 4MNEA 4QP7A 2PE2A 4D28A 1V1KA 3L9PA 4D55A 3WI6A 5K5NA 4QMOA 1M2PA 4F1OA 3IW6A 4DFZE 2BROA 4FV7A 2BZIB 5HCYA 4XJ0A 5L4QA 3HUBA 1OKYA 1LPUA 3QD3A 3GFEA 4QMSA 2OO8X 4GYIA 3P08A 2Y9QA 4F9BA 1CKJA 4D4YA 4FKWA 3IDBA 4BI2A 4JJRA 2EB2A 4X3JA 4RJ8A 3H3CA 3TZ9A 4U43A 3HLLA 1MP8A 3O96A 2J4ZA 5A54A 3ZFMA 4RVKA 4FSWA 2X0GA 4QMTA 4DEAA 3V04A 3LAUA 2VTRA 2Z2WA 4ZEGA 2WD1A 4BC6A 5M55A 4FKPA 2VX0A 4E6QA 3P78A 4EJNA 2OKRA 4ANLA 3RM7A 3F3VA 5KMKA 1QPDA 3C0IA 2YIWA 2I0VA 4XV2A 1W82A 2YM3A 3M1SA 4EOOA 1OL7A 4IJPA 4KA3A 3QAME 4GFGA 2YCRA 5LQFA 2R9SA 3FXZA 4BDGA 3UO6A 3UZPA 4IW0A 3W2SA 4YJPA 2UZLA 5FEEA 4AAAA 4C2WA 3F2AA 3KN6A 1OIQA 2VGOA 3R9OA 4PUZA 5E8WA 1U5RA 3O17A 3P5KA 2H96A 3V5JA 5A4QA 4BL1A 1IG1A 2C0OA 2R3PA 3QTIA 5I9YA 3FWQA 4MX9A 1UWJA 2YLFA 3I4BA 4DH5A 3KL8A 3UYSA 3ZUTA 3FYJX 3HA6A 4O2PA 4QT1A 4M66A 3WZEA 4MVFA 3FI3A 2XNEA 4JIAA 3QD2B 2R3NA 4X3FC 3IKAA 1ZYDA 3LXLA 3CIKA 3ZHPC 4A06A 1E1XA 5DI1A 5HU9A 1OMWA 4BCPA 4JG8A 5CT0A 4EOLA 1OIUA 3MTLA 4ASDA 2YEXA 3QTSA 3H9RA 4M69A 5F1ZA 5M53A 2W0JA 3NGAA 3CTHA 4QRCA 3HRFA 4FX3A 2QR7A 1TKIA 1YDTE 4HGEA 4QQ5A 3DKGA 3P4KA 3FMDA 1BYGA 4QP1A 1JPAA 5H8BA 5IEXA 5JH6A 3ZSHA 4G6OA 5KMIA 3DAEA 3TZ7A 3VC4A 3DBEA 3TJDA 4PMPA 4GG7A 3CLYA 4O4BB 4RRVA 5ANEA 1DAYA 1URCA 1Y8YA 2HZ0A 2ITUA 3EL8A 3EQDA 3PXRA 4LRJA 5EDRA 4F70A 5HTIA 5DA3A 3DK3A 3R9DA 2E9VA 5L6OA 2QKWB 2OF4A 3T3UA 4KAOA 2AUHA 4KSQA 3LFSA 3QTRA 1K2PA 3BU6A 3L1SA 3QA0A 4ACGA 4N0SA 4MK0A 4QQTA 1H08A 2C6OA 5AR8A 3FAAA 4YJVA 4YJNA 4EHZA 2YIYA 3VUHA 4BDDA 3AOXA 4IAAA 3QBNA 3IW5A 4BCQA 3ACJA 1R1WA 4P5ZA 3BLQA 3OT3A 3VF8A 3ZOSA 4O22A 3W2QA 3SQQA 4F7NA 2VTNA 4BTJA 1PW2A 2AYPA 1YWVA 3NWWA 2W1HA 4QYGA 2W4OA 4EQMA 4RJ7A 1BLXA 1PKGA 5D12A 3FLZA 3TV7A 5CLPA 3V8WA 4BICA 4PNKA 5HVKA 4U81A 3R04A 4A9TA 2DYLA 3C9WA 4N6YA 3QUDA 1ZXEA 4I20A 4AOIA 3PE1A 2BFXA 4RWJA 3WF6A 3BPRA 3NNVA 3FC2A 3OBGA 3AT2A 4RA4A 1HCKA 5ANOA 3SXRA 4GSBA 2ITPA 2W4KA 1HCLA 3IECA 4IAFA 2W05A 2ETRA 2JDRA 2X0PA 4FIFA 4JLCA 5H2UA 2ETMA 3LXKA 5FP5A 3PSDA 4GK4A 3BGPA 4XG4A 4A07A 5AJQA 4NM7A 5JFSA 5L2WA 4AFEA 1H0WA 2QOCA 4I92A 2C69A 4K6ZA 3OOMA 4RC4A 3VW6A 3ZDUA 1Q8UA 4F0FA 5A4EA 5DG5A 3F82A 4K9YA 5EW8A 3VUIA 4G6LA 3HV7A 2XK6A 3EYHA 4IQ6A 4M3QA 2BRNA 3MVLA 4K18A 5C8MA 4FSZA 4FVQA 4BCHA 2CHLA 3MWUA 4GUEA 4AA0A 2YCQA 4FG7A 3GU6A 4WOVA 3BV3A 5EKNA 1OPJA 3WIGA 3BI6A 2IVSA 3VIDA 3LM0A 4I23A 2QOLA 3LE6A 3VO3A 5K5XA 3ZUVA 3UOLA 3VN9A 3MYGA 3OXTA 3ORNA 3I0QA 3F66A 5HIEA 4TWOA 3I60A 4GFOA 4Q5EA 3FLNC 3OCSA 4Y46A 4A4OA 4BDAA 2YCSA 4LRMA 2PVJA 5TR6A 1P4FA 4QD6A 5TF9A 4U40A 4NFMA 2WB8A 2WTVA 1MRYA 4IZ5A 4BWXA 3FLWA 4QMZA 5ACKA 1BMKA 1P4OA 1W2DA 3OY1A 4O6LA 5CEPA 4FT7A 3A8WA 3R2YA 4BZNA 4TW9A 3V8TA 5B0XA 3HNGA 4PTGA 4DYMA 5E91A 1JKSA 1GY3A 3GP0A 4AG8A 2BDFA 5EFQA 2FB8A 4IB5A 1BI7A 3HRBA 3EQGA 2KULA 2HWOA 2GNFA 4J96A 4UWYA 5FGKA 1P14A 2J5EA 3E93A 1Q8TA 3OEFX 1FVVA 2HZ4A 3QD4A 4AXAA 4BVUA 4IM2A 3TNWA 4C4EA 3ODYX 4ZLZA 4FTTA 2QOBA 3UE4A 4BCKA 3PXYA 2ONLA 2QODA 3G6HA 1SM2A 4JI9A 3AD6A 4I0TA 5CXHA 5AWMA 3SX9A 4G3EA 4CMTA 2EWAA 2CSNA 5DH3A 3LFAA 4Q9SA 5BVKA 4W4YA 3RPSA 4HCTA 1PHKA 3Q5IA 4QP2A 4AW0A 3R7YA 3AGLA 3PWDA 3R2BA 1CMKE 5CYIA 2R3KA 3UVQA 2C30A 4KKGA 2E9UA 3EQRA 4BTFA 1A06A 3HECA 5T68A 4ZXTA 2ZAZA 4ZTHA 5AIRA 3UNKA 4CQGA 3QQUA 4CRLA 5KCVA 2OJGA 5J8IA 1XWSA 1XKKA 3PPZA 1Z9XA 3KK9A 4FL3A 4R7HA 2W1GA 4GUBA 4L8MA 4U80A 3RI1A 4KABA 5CVFA 5DRBA 4FT0A 4ZP5A 1W98A 4U9AA 4YBKA 3CJFA 4FKSA 4GL9A 2XYNA 3W2PA 4BTKA 1YHWA 2I40A 3NUPA 3ROCA 5CAQA 1XBCA 2R3JA 3A62A 1XH7A 3DBFA 4HZSA 3B2WA 5E8TA 5TO8A 4UMPA 3QHRA 4I22A 1BI8A 4O4FA 2BR1A 4NEUA 4LOPA 4D4SA 3G90X 1CTPE 2VTAA 3Q9YA 3RCJA 3R1QA 4O0WA 2B7AA 2W06A 3OTVA 3MGYA 1QMZA 2WAJA 2G15A 2WEIA 4WNOA 3UIBA 2C1BA 4KBKA 4E4XA 5EM8A 4IX6A 2C6TA 2XNGA 5AP3A 4QMYA 2CKEA 4XLIA 2XM8A 1URWA 4R8QA 5CVHA 3CEKA 4FSUA 4TWNA 1M2QA 1U4DA 4LMNA 1YKRA 2PVFA 4TRLA 3T9TA 4EK5A 3K3JA 2P3GX 4X3FA 2VTTA 3ZZEA 3TTJA 4R6VA 3QZIA 5J95A 4EZ3A 4F7LA 2CGUA 3R71A 5CT7A 4PTEA 3R0TA 2GNIA 2ZV9A 2CGXA 4JNWA 1A9UA 3R7IA 1SZMA 4E4NA 2XJ1A 4FIHA 1BKXA 4ANSA 5JMSA 2YN8A 1GOLA 3RKBA 5TKDA 1ZYSA 3HEGA 3IOPA 3DNEA 3R00A 5KZ0A 4BDKA 3G5DA 4OTGA 5IDNA 4HGTA 4DFLA 2BPMA 4BFMA 3A7FA 2FSOX 1YOJA 3ERKA 3DPKA 2P0CA 2GHLA 3CQWA 4CFWA 2WMBA 4ZTMA 3SRVB 4I4FA 1F0QA 1K3AA 4PY1A 4YTFA 3OWJA 4L7SA 2FA2A 4EUTA 2R3LA 2R3GA 4UBAA 3U6IA 2BILB 2J9MA 3FE3A 4NIFA 2FSTX 3PLSA 2HYYA 4FKOA 4GT3A 3W16A 2X7OA 2C6IA 4CXAA 1F3MC 4LFIA 3PYYA 2GU8A 2XJ2A 5K4JA 3MH3A 4MTAA 5IKWA 1YDSE 2C0TA 1KE8A 4USEA 1YWRA 3MVHA 4FTKA 1OUYA 3QRIA 3QXOA 4FIIA 4EORA 3R1SA 4XYFA 5HI2A 5A9UA 2XIKA 1M7QA 3BLHA 3P23A 1GZOA 2VWYA 3EMGA 4FA2A 2UVYA 4EH4A 3LZBA 3NNWA 1PXMA 2XMYA 4G1WA 4DC2A 4EH3A 4HGLA 3PXQA 4AZEA 4FZAB 4G34A 5E8ZA 3UIUA 2WIPA 4CYIA 3ZO1A 4IZAA 3T8OA 2CPKE 2WFYA 3RVGA 2HELA 3E8NA 3FLSA 4IB0A 4PMSA 2XK8A 4BRXA 1ZAOA 4TL0A 1R78A 4RX7A 4NJDA 5LMAA 4D1SA 1OZ1A 2OG8A 5KHWA 3FZTA 1JSUA 3DBDA 1F5QA 3VVHA 3E8DA 5TT7A 2BRBA 3BBTB 3WF8A 2YM6A 1H28A 1JOWB 1ZY5A 3GU8A 3TZ8A 3D5XA 4N70A 3GQIA 4ZTSA 1UU8A 1O9UA 3F7WA 2HW6A 4UY9A 4XV3A 1AGWA 4FF8A 4J97A 2VO3A 3DB6A 4P2KA 4F9WA 4ZZOA 5D7AA 3IO7A 4L44A 1REKA 2C5VA 2OXDA 4DEGA 2WMAA 4CTCA 4AW5A 4TYIA 3IK3A 3SOAA 4FL2A 3QTQA 3IQ7A 5JEBA 4HVGA 4NCTC 2V22A 5LOHA 3E64A 3R7EA 5M44A 4IWOA 3KXNA 3DNDA 5CEOA 4JG6A 4JL9A 4BIEA 3UP2A 3KXHA 4KS8A 1H01A 1OL6A 5CF5A 3E7VA 2ACXA 1M17A 1OKWA 1YI6A 2VTQA 2B55A 3PXKA 1OPLA 4V0GB 4FSYA 4C3PA 4CQEA 4Q9ZA 2ZB1A 4Y85A 4OAVB 4W4XA 1JLUE 5M4UA 5T6KA 5AR7A 1XO2B 4JBQA 1KWPA 1QPEA 4FG9A 3R8LA 3RAKA 3ZRMA 2QVSE 3MSSA 2VWVA 1SMHA 4KWPA 3R9HA 3JY9A 4QPMA 3D2KA 3QUPA 1RJBA 2BDWA 2BMCA 3EZVA 3VNTA 1O6YA 4XBUA 2F9GA 5HVJA 1DM2A 1Y6BA 5JFVA 3AC1A 5A6NA 5DR9A 5DWRA 3F5UA 3CS9A 4CKIA 2WTKC 2REIA 5JGAA 4MXCA 2OWBA 3ZH8A 3MPAA 2PZ5A 3FZRA 1GZKA 4ASXA 5D1JA 4YO6A 3SW4A 4QMWA 4U3YA 3D5VA 4IX4A 2CGWA 1R0PA 2HZIA 2YZAA 3DU8A 3JUHA 3ORIA 3O23A 4BDHA 1W0XC 1FOTA 3E3BX 1TQIA 3HV4A 2DS1A 3OBJA 3LXPA 3HV6A 4TZRA 4BDFA 5AUUA 2HXLA 4LG4A 4CSVA 2IEWA 3D7TB 2VNYA 3LQ5A 4TWPA 4EOKA 3UMWA 5GHVA 4J1RA 4BYJA 4FG8A 4PQNA 1WVWA 3QTXA 1PF8A 4ANOA 2R3QA 3RJCA 4BZDA 2ETKA 4OBPA 3OW3A 4P5QA 4C4HA 2QQ7A 4MF0A 4K2RA 2J90A 3QCQA 4FTQA 3EFLA 3FZOA 3IG7A 3QRTA 2V0DA 4EONA 4O0YA 3GGFA 2P2IA 4MBIA 3FMEA 2XA4A 3LVPA 3ORPA 4PTCA 3TXOA 5L2SA 4V0GA 5CS6A 4WG3A 3Q4UA 4USDA 5FEDA 5HTBA 4NUSA 3KRWA 4OBOA 3BU5A 3O50A 5CZHA 4J7BA 4I94A 3CQUA 3FPMA 3HRCA 3UODA 3NW5A 2DWBA 3QCSA 4ANNA 2P55A 1Q41A 2IW9A 1PYEA 1KE5A 2PK9A 2EU9A 5AAGA 2W5HA 4AZWA 1IASA 3UNZA 3NYNA 5DR6A 4NFNA 3GCUA 1UNGA 2PMLX 3AD4A 3G2FA 3DBQA 3FHRA 3KGAA 4W9XA 2A19B 4KIPA 3DKFA 1XH6A 5LJJA 3FYKX 2W17A 2XH5A 4WSYA 4JXFA 5T3QA 4QMNA 3DXNA 4IJ9A 5JFWA 4CFMA 5CF8A 3PWYA 4APPA 1XH9A 3EQHA 3PZEA 4JBVA 2GNJA 3QTUA 5KX8A 4BCGA 4O1PA 4FIEA 4IAKA 5I5ZA 5BYYA 4I1ZA 4FTJA 3R1NA 3RBWA 1M52A 3I6UA 1S9JA 3OROA 5L2QA 3ZO4A 3IONA 4AGWA 2XNOA 1W83A 4CMOA 4CT1A 4IAYA 3L9MA 3MFTA 2NP8A 1YXSA 3RZFA 5GZ9A 2XIZA 2C6MA 5L6WL 5CAOA 4NK9A 2RFEA 4BCFA 4E7WA 3FKOA 3H4JA 4QYEA 1PXPA 3TIZA 2RGPA 1H00A 1OECA 5DE2A 4ZTNA 4CT2A 3S00A 1H24A 2W7XA 3BYMA 4HPTE 3V01A 2BAJA 3FQEA 2B53A 3MTFA 4L3LA 5DBXA 4G5PA 4XOYA 2AC3A 3NUSA 4L9IA 3U4UA 2WEVA 3QCYA 5DRDA 3F2NA 4BF2A 5KMNA 3EQPA 3ZBFA 2VWIA 2VTHA 4OTPA 3A4PA 4KKHA 5AR2A 2C6DA 4IWPA 4XNEA 3WOWA 3UIMA 3UGCA 3SOCA 3QZFA 2ERZE 3GENA 4LMUA 4S34A 4U97A 1BL7A 2XKFA 4UXQA 2IJMA 3COIA 3KMWA 5AP4A 4O38A 4A4LA 3A2CA 4F9YA 3CTQA 3CPCA 4ZY5A 3MFUA 5EK7A 1LR4A 4NM0A 3F5XA 4NTTA 5IMEA 2OSCA 4BDEA 4YNEA 4RVTA 5KMOA 1KV1A 2IZTA 4I5HA 4RIYA 4TXCA 3FZPA 1KV2A 2RIOA 3I7CA 4FOBA 3EB0A 4QMPA 5EW3A 2XUUA 1NVQA 3PPJA 3MIAA 3L9NA 1TZDA 5FTOA 4QPAA 3W2CA 4JQ8A 2PVMA 3K5VA 1