5J7BA

The identification and pharmacological characterization of 6-(tert-butylsulfonyl)-n-(5-fluoro-1h-indazol-3-yl)quinolin-4-amine (gsk583), a highly potent and selective inhibitor of rip2 kinase, gsk583 complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
306
structure length
277
Chain Sequence
AICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLGTIIYMPPENYESRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Identification and Pharmacological Characterization of 6-(tert-Butylsulfonyl)-N-(5-fluoro-1H-indazol-3-yl)quinolin-4-amine (GSK583), a Highly Potent and Selective Inhibitor of RIP2 Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Receptor-interacting serine/threonine-protein kinase 2
total genus 81
structure length 277
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5j7bA00
4O38A 2W1ZA 3UYSA 3RP9A 5CZHA 4AT5A 4C61A 2R3GA 3QCYA 2XNOA 2XBAA 4EK4A 2W1DA 3GNIB 4FZ6A 4Y85A 1ZWSA 2WMTA 5J9ZA 3DBFA 4RC3A 5ANIA 4ZLOA 5FBNC 1FVRA 4AOIA 4YZBA 2HW7A 4A9UA 2CHLA 2UW6A 1GZOA 2B9JA 2I6LA 4ANNA 3SVVA 5TF9A 4YR8A 3ORPA 4QNYA 1KV1A 3KXMA 4XG4A 3D0EA 2UW4A 3EYGA 4LV5A 2AC5A 3TNHA 3V5QA 2R3MA 4C35A 4FIGA 4NU1A 4I20A 3BZ3A 1U54A 2GNLA 2A0CX 3ZEWA 4C8BA 4G6NA 5IA2A 3M1SA 2DWBA 4USFA 2XM8A 3FL4A 4F9YA 3IDCA 5C27A 5BYYA 4CQEA 2ZVAA 1UU3A 3IKAA 4JDJA 2OZOA 1PW2A 5B2KA 5JFWA 4PMTA 5M51A 4I3ZA 3QQKA 4YJUA 3RNIA 3KRLA 4WSQA 4Y5QA 5IA0A 1Q8WA 3QUDA 2GCDA 1YXUA 4FV9A 4G6OA 3ZEPA 4BBFA 2OF4A 3BKBA 4G2FA 3VBWA 4Y72A 4AN2A 5AV1A 3BQCA 2C5NA 4E26A 1FQ1B 2WTIA 2W0JA 4U43A 1STCE 2QU6A 3UVRA 4IFGA 3FKOA 4PP7A 5BVNA 3R1SA 2J6MA 4UMPA 5HX6A 2R3PA 4E20A 3UQGA 3G51A 4M13A 2RFNA 3O7LB 5CNNA 4N6YA 3MJ2A 3IW6A 1MQBA 1M7NA 4FTAA 3ZRKA 3TUCA 4EWQA 3NRMA 2F49A 4D0XA 1UKHA 3KKVA 5CF4A 2JITA 3FLSA 2PSQA 2X2MA 3QRKA 5AMNA 1U5QA 4A9TA 5H9BA 4N70A 4OTIA 2XIRA 4C3PA 5JN2A 4GUEA 1IG1A 2YFXA 3DAKA 1JNKA 4RJ5A 5DNRA 5HTCA 3R7YA 2ITYA 3NUUA 5EW9A 4C02A 4OT5A 5TT7A 4BCQA 2R7BA 2BAJA 1JAMA 4RIYB 4HYUA 4PP9A 2W5HA 5M55A 2J5FA 1YKRA 2F2CB 5FDPA 1QPJA 3TUDA 4QMOA 3RK9A 1XHAA 1ZMVA 4PY1A 4YZMA 3ZO1A 4GYIA 1ERKA 4NTSA 4MWIA 2CGWA 3QFVA 5CQUA 5D12A 1X8BA 4OTGA 4ZIMA 3F3UA 3E92A 3UGCA 5HE2A 4G3CA 4FTNA 4AP7A 5I3RA 2P55A 2XA4A 3E5AA 3IW5A 3PRIA 1ZMUA 4ITHA 4NCTA 5C8KA 4GT3A 3OXZA 2QOBA 4FKGA 3NUPA 4OAUC 3UTOA 3ANQA 3GC9A 2BDFA 3NCGA 4YNEA 3RPSA 4A9RA 3PVWA 5AP2A 2JDVA 2JKMA 4RIYA 4RPVA 1YXVA 3GCSA 5AAFA 3KGAA 3TT0A 5IEYA 5JGAA 3GCPA 4AN3A 4AACA 3H9FA 4U45A 2WGJA 3ZM4A 2JKQA 4HNIA 3FAAA 3IGGA 4E4LA 2BHHA 4I6HA 3ZSHA 4IWOA 4DGGA 3EKNA 3FHIA 2C0TA 3KU2A 3ZFMA 5M4CA 2QOHA 3VS7A 4AZWA 4F4PA 3PP0A 2A1AB 4NJ3A 3ZONA 4CV9A 1VYZA 3B8QA 4ZTHA 4Y5HA 2ZAZA 4R6VA 4EC9A 1WVWA 4AGDA 1OIQA 3OG7A 3KL8A 1BI7A 3NX8A 5HE3A 5D10A 5AV3A 3DFAA 3FQHA 4K8AA 4BWXA 4FKRA 1JSTA 4UX9A 2GFSA 2HENA 3EOCA 2W5BA 4AZFA 4WHZA 2YIXA 3P1AA 4MXYA 3U9NA 4CD0A 2C6IA 5I5ZA 2W7XA 4KRDA 3SC1A 4B4LA 1ZOHA 4GG5A 1S9IA 1HOWA 3R71A 2YDKA 1H1QA 1Y57A 3TN8A 3EQGA 3GUBA 2GU8A 3ZMMA 4D5HA 3L8SA 2CPKE 4DN5A 5L8LA 1OI9A 3PE1A 3UOKA 4D2VA 4J52A 2QVSE 3PSDA 3E93A 3EIDA 3AGLA 3FL5A 4S32A 5L6WL 5I4NA 3P23A 2VTLA 2VV9A 5FD2A 1FGIA 3MFRA 3BEGA 2E9NA 4AA5A 4KNBA 4BIBA 3OWJA 2HY81 4XYFA 2W1GA 4NW6A 2QHNA 3VW8A 5IUHA 5AV4A 5F4NA 4FK3A 2OW3A 4KIKB 3EHAA 4HW7A 4ERKA 2Z60A 1H27A 1OPJA 3O8PA 4CT2A 5EHLA 4E7WA 4F1TA 3HMNA 3LFSA 4BTKA 3TKUA 3TKHA 4BDJA 4HVGA 2NPQA 3QTWA 3HMIA 3MH1A 4TYIA 1S9JA 3Q32A 4FKOA 4GFMA 3C0GA 4F09A 3LXNA 3D15A 2VAGA 4FSUA 2YM4A 3IONA 4B6LA 2G9XA 4DG3E 2R3RA 4I4EA 4C3RA 2QOOA 4BB4A 3QBNA 2GS2A 1U59A 3I81A 2AUHA 3IOPA 3ACKA 5FWKK 3ORNA 3F7ZA 4FV6A 4CV8A 2I0YA 4XJ0A 3R8UA 4IZAA 3PXRA 2C68A 3OWPA 3P08A 4EH6A 2R3QA 4DTKA 1Q62A 4FKLA 4I0SA 5HCYA 4U80A 3IW4A 2ITVA 2R3JA 3ORXA 3DXNA 2BILB 1W8CA 3BYOA 4FT3A 1YDSE 2EWAA 3EL7A 2GNIA 4JBPA 3OW4A 4OTDA 5CI6A 2WMQA 5CALA 3G9NA 4FT7A 5KKRC 3QZFA 1LUFA 5BVWA 4AA4A 5FQDC 1Q8TA 1UNLA 3FMJA 4AF3A 3QCSA 3R30A 3NR9A 3OFMA 1YHWA 5KCVA 4BCKA 5HG8A 4X0MA 3U51A 2W4KA 1CKPA 3R6XA 1FMKA 3CD8A 2WOUA 2PHKA 5ICPA 3C4EA 4L3PA 5HO8A 4QOXA 2XRUA 3ZO3A 3FMMA 3G0EA 5LOHA 3FXZA 4YSMA 1OMWA 4F63A 2CSNA 3UYTA 4WA9A 4LM5A 4AW2A 2JKKA 5CVGA 4FKVA 2FSOX 2P2IA 3C13A 2FSLX 4LUDA 3HRFA 4EJNA 2OZAA 4KD1A 4IDTA 3R7IA 4JG8A 3LCSA 4WOVA 1REJA 3LQ5A 3QTXA 2JC6A 2YJSA 1DAYA 2RF9A 4S34A 2PUUA 4IM3A 5AAEA 3R1YA 2J0IA 5EG3A 5KZ0A 4DEEA 2PZPA 2R3NA 1H1RA 3QA8A 5CXHA 4OBPA 3V5PA 4AXAA 4EUUA 5AIRA 4QTBA 2BMCA 2C6TA 2I0EA 4L42A 5GZAA 4NTTA 1YRPA 4D4SA 3QD4A 5D7AA 1WZYA 4QYYA 2CCHA 2PL0A 3IDBA 4ONAA 3UG1A 5F9EA 5KKRB 2BRGA 3O50A 4EH3A 2P33A 4RQKA 3R9DA 4YTIA 3T3VA 4GJ2A 4O2PA 4L01A 4F0GA 2RKUA 5BVDA 2G1TA 5HU9A 2YM8A 2WQMA 3AT4A 2J0JA 4YU2A 3EN4A 4BWPA 3DAEA 5M53A 3KB7A 3ZFXA 5AV2A 3LLTA 2IW8A 4TKSA 4RFZA 4ZTNA 3WF7A 3HV6A 4M84A 1BMKA 3QF9A 2OG8A 3UMXA 3GC8A 4D4RA 1SMHA 4W4XA 3Q52A 5HTIA 3EKKA 3IECA 1GAGA 5I9XA 3GP0A 4EBWA 2YJRA 3DLSA 4R7HA 1RE8A 4MHAA 2YEXA 3PVUA 4TN6A 4M7IA 3HRCA 4XRLA 1XBAA 5LCJA 3QTZA 2C3JA 3OTVA 3R2YA 5T6KA 3ZLWA 3EQDA 2BKZA 4BDHA 4DCEA 4F0IA 4QQTA 4UXQA 2BZJA 4A4XA 1BI8A 4FZAB 1T45A 2DS1A 3LXKA 2WQNA 3R21A 5A54A 2VD5A 3DFCB 1BL7A 2P2HA 2A27A 3L8VA 5FDXA 2W9FB 5HKMA 1JKSA 4TPTA 4NIFB 3ZO2A 3SLSA 4GFGA 3L9NA 1NVQA 2VN9A 3DDQA 4F1MA 4DINA 4CYIA 4QP7A 2GFCA 1J3HA 2BRNA 1U46A 4H36A 5G6VA 3ZH8A 4EK3A 1QCFA 4F64A 3A60A 4TNBA 4HVDA 4EKKA 3FWQA 4NSTA 5EI2A 4BCFA 3D2IA 3DU8A 2XK4A 1YWRA 5ETCA 4AN9A 4U41A 3UC3A 5HLNA 3BBWA 2GPHA 3OS3A 4MNEB 4OBQA 5BMMA 3MIYA 1PF8A 3KF4A 3O51A 4ZK5A 4R3RA 3TNWA 3W32A 5KBRA 2CCIA 3P7CA 3MH0A 4QO9A 3WIKA 4ASXA 5ETFA 4E4MA 3QTUA 2PE1A 3PTGA 2XK9A 5HNGA 4G9CA 3FYKX 3ORIA 4JI9A 3SD0A 4BCPA 4ZZOA 1FINA 3OCSA 3MS9A 4DLIA 4C4GA 3GCQA 3R7OA 2XH5A 5H8GA 4QMQA 4HGLA 3F2NA 3QD0A 2AYPA 4B8MA 3UO4A 4BF2A 2UZDA 3RHXA 1JPAA 2F2UA 2Z7LA 2ITZA 4G5JA 5JMSA 3A7IA 4MXZA 1TVOA 3LW0A 3VIDA 4QMPA 5JH6A 1OPLA 3MWUA 4RVMA 5IKWA 4EK8A 4ZTMA 3IO7A 4E3CA 3TKIA 3ETAA 3EFLA 3VUTA 3OT3A 4AE6A 5JRQA 4AWIA 4RVTA 3LAUA 3NUYA 3UVPA 3O8UA 5AEPA 3QYWA 3C50A 1H28A 3FY2A 2YWPA 5C01A 1J91A 2NO3A 3LCDA 3Q9WA 3DPKA 3S0OA 3F69A 1B39A 2PVNA 4EKLA 1PYXA 3KXZA 5HEZA 2XF0A 4FYNA 3MB7A 4PPAA 4P5QA 3I7BA 4RZWA 1UU7A 4GIIA 2JLDA 5IPJA 3HLLA 4EOKA 1OGUA 2VZ6A 1VZOA 4IX5A 1ZYSA 3RM6A 4ARKA 3W2RA 2EB3A 3F5PA 3BIZA 5AM7A 4ANSA 4X3JA 4C34A 2WQEA 2HXQA 2PVHA 3TZMA 3KXNA 3UPXA 4EHGA 2XYNA 4TYEA 4CQGA 5KNJA 2XIXA 4WG5A 3QKMA 4HJOA 4M12A 1MUOA 4EYJA 3G6GA 1WBSA 3MVMA 5AP0A 3H0YA 4FNWA 1URWA 3C9WA 3HMOA 3KA0A 4R1YA 3SW7A 3MY5A 2FO0A 1RQQA 4L52A 1PMNA 3WZEA 3QXPA 4IWDA 5HLPA 3E7VA 4FODA 3WF9A 3H9OA 1AQ1A 2OK1A 4LUEA 4FOBA 3VS5A 1P14A 4JDIA 3QCXA 2DQ7X 4EOOA 3E88A 4E6AA 1ZYDA 4QMTA 4F9WA 3GOPA 3NW7A 4KIKA 4YMJA 5EKOA 3VBQA 3KCKA 4TNDA 5F95A 1GY3A 5I0BA 2XNEA 2BDWA 4B7TA 1Q3WA 4EOLA 5CVFA 1Q24A 1OPKA 4IB5A 4F9CA 1OL7A 3A7FA 4NFNA 2KULA 3MVHA 5A6NA 2FB8A 2J0LA 2R5TA 4U79A 1YVJA 1F5QA 4Y95A 5AWMA 3QXOA 2WZJA 3OROA 3UNKA 2GS7A 4IB1A 4RIOA 4X3FA 3S95A 3VVHA 5ANKA 1SVEA 4DFNA 3CBLA 5TR6A 2WIHA 5LMBA 4IX4A 4IM0A 4GIHA 5FP6A 4CFNA 4QP2A 4X3FB 3QZHA 2RIOA 4KABA 3EFWA 4N0SA 2X7GA 3ODYX 2WTCA 4QPMA 2OI4X 3AC5A 5JSMA 1ZZ2A 4BDKA 1Q8UA 1TQIA 2YITA 2CKEA 3GBZA 2WEVA 3FKNA 4FKQA 4JXFA 2G01A 4U0IA 4PL4A 2WHBA 3MY0A 4E1ZA 1MRUA 3IGOA 4I41A 3QA0A 2FSMX 3P4KA 3QRTA 5CENA 2O64A 3DBQA 5ANEA 4Q9SA 5HZNA 2SRCA 3D7TB 4IC7A 4DH1A 2YM6A 3DKGA 4JQEA 4U44A 3LFBA 4O6EA 4QMZA 4BWKA 5D41A 3DKCA 5D11A 4G3EA 4DG0E 2HELA 5C26A 1JOWB 4MTAA 4MNFA 1RDQE 3RPVA 2R3KA 5DHJA 4ITIA 3RZBA 3PZHA 3TV7A 5LVNA 3THBA 4NJDA 1M2QA 3CQWA 4HPTE 3GOKA 3I1AA 4BGHA 3Q6UA 1V0OA 3SHEA 1R0PA 3R28A 2Z7SA 3QUPA 5KO1A 3R73A 5BVOA 4EYMA 5K9IA 1ZYLA 2B52A 1MRVA 1Y91A 4O1PA 2R3LA 1REKA 1PKDA 4V0GA 4BCNA 4FTUA 4CZTA 4RVLA 3U8WA 1SZMA 4YLKA 3VRZA 1Y8GA 3PY3A 4F7SA 5CEMA 3FSFA 5FXQA 3QWKA 3ZDUA 4CLJA 5EM8A 5FLFA 1UNHA 3KCFA 2OH4A 1W7HA 3SRVA 4BI1A 1TQPA 3PWDA 1KE9A 4FTTA 3JY9A 4MD8E 4JIKA 4IHPA 4KIOA 4WT6A 2QODA 2X4ZA 3AG9A 2WXVA 5DR2A 5EW3A 2EXMA 3WE4A 3FZRA 3E8CA 3DDPA 3PY0A 4APCA 2W1FA 4YNOA 2QCSA 2VTRA 4F6UA 2OJJA 3CY3A 2OXDA 2RL5A 4IFCA 4L6QA 4C4JA 4I5PA 5E90A 3R9NA 3GC0A 1SNUA 3C51A 1W84A 3FYJX 4CVAA 4W9XA 4XH6A 2E9PA 4RG0A 3LFNA 5AP6A 4ZZMA 1OM1A 3RTPA 1WVXA 3QTIA 3S3IA 3AXWA 4ACMA 3NW6A 4C4EA 2C1AA 5HNIX 4CTBA 1CSNA 2X7OA 3BWJA 4QTAA 3RMFA 4J96A 1H08A 3CE3A 4M3QA 5KHWA 4ENYA 3C7QA 2W1EA 1DAWA 4RA4A 2C6LA 2J9MA 3FLYA 5E8TA 3RKBA 3RZFA 3FJQE 2H34A 3CCNA 4EOQA 5DT0A 5K5XA 2X6EA 3B8RA 4O0WA 4DITA 1ATPE 2W4JA 4JJRA 5EYKA 4E93A 2OXYA 3W2PA 3P79A 2FH9A 3QTSA 4YBJA 1ZY4A 3U6HA 2BROA 3NWWA 4KSQA 4ZY6A 3F6XA 2W05A 3FSKA 4UN0C 4FL2A 5CU2A 3UOJA 3QCQA 4L7FA 2R2PA 1J1CA 3MTFA 4FC0A 5HBEA 2XNGA 5HE1A 4AGCA 4ZJVA 1M17A 2UVZA 3TZ7A 1VJYA 1YQJA 3LFCA 4FV8A 1IRKA 4PMSA 3FI2A 3S2PA 4ZXTA 4I94A 3QD2B 3NAXA 2JIVA 4JR3A 5FTOA 4KBKA 3RAHA 3BV3A 3PXQA 4WIHA 2J90A 3EZRA 3IW7A 1MP8A 4YZCA 5LVOA 1CDKA 5L4QA 1PY5A 5B2MA 2EB2A 1JKKA 3A61A 3R0TA 4IACA 4DEHA 5EYDA 2VX3A 2UW9A 4BDGA 4M14A 4PL5A 3SKCA 4GU6A 3NDMA 3A62A 4IVBA 3CTJA 1AGWA 4WNKA 5AR5A 3MYGA 4D2WA 3OT8A 4KINA 4H58A 3E3PA 4D55A 3EWHA 1BUHA 4FX3A 2VWXA 4DEDA 5E8YA 3A2CA 1KE7A 4QRCA 4ASDA 3UE4A 2CN5A 4KAOA 1Q8ZA 4RFYA 4QYGA 3LZBA 3VS6A 5AUZA 2W5AA 1Y6AA 2WKMA 3WZKA 1Q8YA 4C2VA 4EHVA 3FMLA 3LCOA 3QC4A 3JXWA 4C62A 3ZC5A 3OOGA 3PY1A 3QL8A 4TYJA 5FEQA 4LRJA 3CS9A 3NNUA 5B7VA 4CEGA 3CQUA 5ANGA 5L8JA 3DK3A 5HU3A 3COHA 5BVEA 4CFVA 1B6CB 3NNXA 4IB0A 5DOSA 4TYHA 2V0DA 4NT4A 4DFYA 1KOAA 4FIFA 1WVYA 3MV5A 2F9GA 3Q4TA 3ZO4A 4ITJA 3MA6A 4GW8A 4JDHA 3T8OA 1XH8A 2IN6A 3MGYA 5EFQA 1ZAOA 2UW8A 5JQ5A 4W9WA 4BI0A 5CXZA 2XYUA 4HCVA 3G5DA 3R8VA 3VS2A 3Q53A 5KHXA 4X3FC 3TTJA 3UP7A 5K5NA 4GU9A 4BKZA 3FMKA 3K54A 4PDOA 2FSTX 1YI4A 1E1XA 4AW1A 4FSNA 2FUMA 2UZLA 3PZEA 2UVXA 4W4VA 4A7CA 2VGPA 5K0KA 4JR7A 5LMKC 4AFJA 3UNZA 2F7XE 3LJ1A 2CLQA 5ANDA 3PXZA 4RJ7A 5EM7A 4ALUA 4BZDA 4RLKA 2V55A 2YDJA 4FTRA 4RWKA 2OJIA 4TW9A 2HZIA 4FNZA 3BGPA 4BGGA 4KBCA 4CFXA 4ZTSA 3DNDA 4E73A 1P5EA 2YN8A 4G17A 4OLIA 3QZGA 2BVAA 2ITNA 2Z7QA 3RWPA 3RAIA 4ZY4A 3UBDA 3E87A 4KS8A 2B55A 5AR3A 3RGFA 5I9YA 2OJGA 2IVUA 2C6MA 1GZNA 3BV2A 3G6HA 3H4JA 5AR2A 3QLFA 5K3YA 3FC1X 4JOAA 3NSZA 1GZKA 3VQHA 2VGOA 4FT5A 5L2WA 4MXOA 3ZZWA 3I4BA 3FHRA 4BI2A 3BEAA 3TI1A 4BYIA 2GQGA 4EQUA 4P5ZA 1ZRZA 2XNNA 1LPUA 4NW5A 5DGZA 3H3CA 1KOBA 3U9CA 2XEYA 4YZ9A 5EHYA 4D5KA 4C59A 2WFYA 4RX7A 1PMUA 5BYZA 3GU5A 4EH9A 5A4LA 2PE2A 5FGKA 3DJ7A 1Q5KA 3NYXA 3S4QA 5LVLA 2XCHA 1W82A 2J50A 2Z7RA 3LJ2A 3PA3A 4UWCA 1IEPA 4KA3A 3D7ZA 1H07A 4UY9A 2REIA 2W99B 4KBAA 4ANQA 4ZJIA 5HQ0A 2WTVA 2QOCA 3EQIA 2PVKA 4GK4A 3KRXA 3PJCA 4DEIA 2YLEA 4LYNA 5IDPA 2OWBA 3RPYA 4EL9A 2OH0E 5AV0A 3CC6A 3KY2A 4W8EA 3AD6A 4LGHA 4UZHA 5HI2A 5EW8A 1ZYJA 3ZXTA 4C57A 2E9VA 4YJVA 4ZJJA 4ZSGA 4JBQA 4M0YA 5CU4A 1JKTA 5CTPA 5DWRA 5CEQA 4QP3A 2XK3A 5M56A 1NVRA 1CM8A 2XNMA 4AW5A 2BRBA 4FTLA 4RC4A 4O0RA 2VUWA 4NM3A 4I92A 5E1EA 2JIIA 3A8WA 1WBOA 2OKRA 2B4SB 3JS2A 3JY0A 4BYJA 4BDAA 3LFDA 2WTKB 3GCVA 4FKJA 2PVRA 4RIWA 4HVIA 4G3FA 3FZTA 2GNGA 4IXPA 4PPCA 3MVLA 2W1CA 2J0KA 3I0OA 4KWPA 2PK9A 4GK2A 3O17A 3EN5A 2HZ0A 4TYHB 4IBMA 4YC6A 1VR2A 4FTCA 4D4YA 5CAQA 5HO7A 5A4TA 4A06A 2BAKA 3NGAA 4PMMA 3ZUVA 2GNJA 3DJ5A 2QOFA 4MF1A 3SDJA 1O6KA 1GOLA 3WBLA 3DKFA 2QNJA 1YXXA 3VS0A 4UMQA 4ZZNA 1OKWA 4OR5A 3H10A 3Q96A 5KMMA 3HX4A 1XH6A 3Q9ZA 1WBNA 1ZOEA 3GQLA 5DBXA 3R8MA 3OMVA 2HYYA 3D14A 2YCSA 4QQ5A 3WYXA 4CRLA 4EC8A 1LR4A 4AGUA 2B9IA 3W2CA 2XS0A 3CTHA 5C9CA 4CKRA 4IWQA 1PHKA 1OECA 4O0YA 5CSPA 2QR7A 3TUBA 3PIYA 4XLIA 1JKLA 2WNTA 3O7LD 2IJMA 4J8NA 4XG7A 5HNBA 4FKTA 4K9YA 2JDOA 4FIJA 2VTHA 4FSZA 4CFFA 3L9PA 3R04A 4FKIA 3WYYA 3C0HA 2XBJA 4RA5A 4HPUE 2YIWA 2IVTA 2UW5A 4HCUA 4XRJA 3ZUTA 4CCBA 4E6CA 2X8DA 3KN6A 2GHGA 3SA0A 1M7QA 2ZM4A 2PMLX 3BYVA 3SXRA 1WBWA 4ZOGA 1UWHA 5A4EA 3BPRA 4IVCA 4FIEA 2Y6MA 5T3QA 2OJ9A 3EQPA 4LMNA 1PXJA 1RJBA 5CQWA 2V7AA 5IU2A 5HOAA 2PVMA 1YI6A 2W06A 2ZV9A 3RBWA 4KS7A 4KSPA 4OTFA 4CYJA 3V6SA 4EQCA 5BMSA 4IZ5A 4KKHA 1LP4A 4MF0A 1TKIA 3PE2A 3QRIA 3VBXA 4L46A 4I1ZA 5HBHA 3SQQA 3DBCA 4BHNA 3NAYA 1NY3A 1DS5A 4RC2A 1CMKE 3OP5A 4JS8A 1QPDA 2RSVA 3FDNA 3IDPA 4BBEA 4OTQA 2JDSA 5GJDA 4TRLA 2WOTA 4EK5A 4WG4A 2ITOA 3E63A 4IB3A 5IZFA 4J71A 4JIAA 3FZOA 4QMVA 5EI8A 4XBUA 2ERKA 5I3OA 4IH8A 3L1SA 2UZNA 2PZ5A 4JAIA 2WMAA 5AR4A 1PXIA 2C5YA 4CMTA 4O91A 3CGOA 3F66A 4YHTA 4L3LA 2G2HA 4XG3A 4Y83A 2Z8CA 4LGGA 4BGQA 4DG2E 2QC6A 3VUIA 5DR6A 4R8QA 5BNJA 4LOPA 2VX1A 5GHVA 5E8UA 4ZAUA 5GJGA 5AA8A 4R7IA 4U8ZA 3FZSA 4YJPA 4O0VA 4APPA 5I9UA 5HICA 4FV2A 4IAIA 4D28A 3HZTA 4BCOA 4BTFA 2RFDA 1YXTA 3V04A 4G1WA 1L3RE 5CEPA 4IVAA 4EH8A 1YWNA 2PMNX 2W4OA 3AC4A 4Z7GA 3AD5A 5HCZA 4B0GA 1M14A 2C6KA 4GMYA 4O6LA 1OVEA 3AMYA 3Q9YA 3H30A 3HYHA 1IA8A 3KMMA 4YUQA 4FBXA 4XUFA 4HCTA 1E1VA 5ACBC 3VJOA 5E91A 5ACKA 3F5GA 4I24A 4ZLZA 2UZVA 2XIYA 4L44A 2CLXA 3KRJA 4DAWA 2UW0A 1SVGA 2O63A 3UMWA 1PXKA 1ZY5A 4QP1A 3ZFYA 4X7QA 2BTRA 4YHFA 3PPJA 2AC3A 3CLYA 4NWMA 5ANJA 5F20A 3SOCA 4Q2AA 4M0ZA 4V05A 5HX8A 2DUVA 4H3QA 1WBTA 3PWYA 4TZRA 2H96A 4XV3A 3EYHA 4K11A 1Q3DA 5AR7A 4Z55A 3BU5A 1XJDA 3FE3A 3HMPA 3U4UA 3GGFA 3EQRA 3CD3A 3JPVA 2IVSA 4XG2A 4EZ3A 4EUTA 4FIIA 3UQCA 3VHEA 2FGIA 4CSVA 3SV0A 3FLQA 4GFOA 3I79A 4F6WA 2YCFA 5HG9A 4X2JA 2O8YA 3HV4A 3OY3A 4YGAA 2X8EA 4PF4A 4NFMA 2QO2A 3UZPA 3PYYA 3ZZEA 2CN8A 1M2PA 5DT4A 2VWVA 2OFUA 4IAZA 4LRMA 4RX8A 3MFSA 3RHKA 4TYGA 3L8XA 3UZTA 2QO9A 4BKYA 1P4OA 3QTQA 4QT1A 4XX9A 3WOWA 3NNVA 4BKJA 2WTWA 4ANBA 4NM0A 4IX6A 2PVJA 4UEUA 1MQ4A 2VNYA 3ZRMA 5JFXA 4BZOA 2PWLA 3NUNA 4QTCA 2VO0A 2JIUA 2OBJA 2ZMCA 3BHYA 4I5HA 3R8LA 2XNBA 4YJRA 5TE0A 4WRSA 3AC2A 3A4PA 3FLNC 2C5VA 3LM0A 3P0MA 3AT3A 1Y8YA 1WCCA 2ZV8A 3HECA 4FNYA 2JFMA 4YTHA 3TCPA 3BQRA 1V0BA 2R3IA 4L7SA 3RVGA 3PIXA 3BLQA 2WELA 2XJ0A 2R64A 5CSXA 4JT3A 2XCKA 5JK3A 5HCXA 1H4LA 3ZBXA 4N6ZA 3WZDA 5LMKA 3TZ8A 3QKKA 2P3GX 3I5NA 4ZSAA 3KMUA 2IO6A 2PVLA 3N51A 4IDVA 3TACA 2KTYA 2ZB0A 4A07A 3W18A 4DBNA 4EONA 2QLUA 2VWZA 4QMMA 4S33A 5LVMA 3K3IA 1XQZA 4FICA 2VWWA 3DJ6A 3ULZA 3PSBA 5EHOA 3WARA 3R63A 1VEBA 2BPMA 4PV0A 5HVYA 4AA0A 5CEOA 4NKAA 4FZFB 3ERKA 4FVRA 4YPDA 4E5BA 2OSCA 3ACJA 3FKLA 3LVPA 3Q04A 3AQVA 5KMJA 5CU3A 2YCRA 3TTIA 3MH3A 4K0YA 4QYFA 5H2UA 2QURA 3OUNB 4R3CA 3QLGA 5DT3A 1YHVA 2OXXA 2UZUE 1P4FA 4M66A 3ZBFA 3TZ9A 3BHUA 5LCKA 3B2TA 4QMUA 2VWBA 4O96A 3VUHA 5K4JA 4I93A 3VS1A 5CSVA 2XJ2A 4RVKA 2WEIA 2VTSA 3BU3A 2WQOA 4CZYB 3BHHA 3OC1A 4V0GB 3DBEA 5BVKA 5D1JA 3BLRA 4FV1A 2BFXA 3FI3A 4ACHA 4QPSA 4RZVA 4GVAA 2UZEA 2IW9A 1PXOA 4CXAA 5CU6A 3OOMA 4YLJA 5L2SA 4RIWB 4ANMA 3FMEA 4Q9ZA 2V5QA 4X2NA 4RWJA 5CVHA 1WBPA 4UB7A 4AG8A 1K3AA 2HAKA 2H9VA 2IWIA 2RFEA 2WTKC 3F3VA 4NM7A 2I40A 1PXNA 2X39A 5EH0A 3IQ7A 4A9SA 3FXXA 4FTOA 1W83A 5L2TA 1YOMA 3COMA 2FYSA 3F61A 4AZEA 3ZYAA 2Q0NA 3EH9A 4O0XA 4X2GA 4H3BA 4FG7A 4D9UA 4TL0A 1NA7A 1OKVA 3I5ZA 4PMPA 4FOCA 3Q60A 3QRJA 4D1SA 4MNEA 4UMTA 4YZDA 2YM5A 2CGVA 4HZSA 5DRBA 5JEBA 4FSTA 5LXMA 4K6ZA 4YLLA 3ET7A 4IAYA 1VYWA 1WAKA 5CWZA 1PMVA 3UODA 4D4VA 3FMHA 2GTMA 5J8IA 3RI1A 3WZJA 3VUKA 5GZ9A 3ODZX 3R00A 3R22A 2P0CA 3R2BA 5IMXA 1ZYCA 3E62A 3PUPA 4OTHA 3FV8A 3TIYA 2UZTA 3D9VA 3OUKA 5FEEA 4CZUA 4G31A 5CT0A 3ZHPC 2P4IA 2ITQA 1YI3A 4AUAA 1YHSA 2YIYA 4ZTQA 2BIKB 2R0UA 5DMZA 2VTQA 3UQFA 2ITPA 2X4FA 4WG3A 4KB8A 2QOIA 3LCKA 3R01A 4BICA 4I0TA 3V3VA 4P7EA 3FBVA 4L45A 3R8ZA 3UO6A 5AUUA 3CPCA 1R1WA 5A4QA 5E1SA 4WSYA 4BC6A 2ETMA 4U81A 3N9XA 3P9JA 2RG5A 4QMLA 4O2ZA 1UVRA 5JZNA 4XS2A 1OIUA 4UV0A 5AX9A 5AX3A 3W2OA 2JDRA 3VBVA 4AQCA 3PVBA 2XKEA 3F7WA 3REPA 3ORLA 3QZIA 4IQ6A 4GL9A 3TV4A 3UNJA 3GVUA 3KC3A 3ORKA 4RLLA 4GYGA 3VHKA 3ZRLA 2R3FA 1FPUA 4M8TA 4QTDA 4BDBA 3PXKA 1KSWA 3POZA 5GZ8A 3DAJA 5L2IA 2XIKA 4FTMA 1QL6A 3DB6A 4EH5A 3CP9A 5FM3A 3OW3A 2C5OA 2Y6OA 3B2WA 3P5KA 1JSVA 3C0IA 3V5LA 3FY0A 4DFLA 3DT1A 2BHEA 3LQ8A 4FKWA 4RGJA 4G9RA 2HY0A 2JAVA 3W2SA 4D2RA 3W10A 4C37A 2YIRA 2JAMA 5HGIA 3KULA 4IC8A 4L67A 1KE6A 5CT7A 4AAAA 4BTMA 3AGMA 2J7TA 4FKSA 3IW8A 2A2AA 5EDPA 4NK9A 3DGKA 3UC4A 4DGLC 1QPEA 3D94A 3LXLA 2RFSA 5DI1A 3R7EA 4MBJA 3MFUA 5AUXA 3FPMA 2OU7A 4HOKA 4NH1A 4ENXA 3HKOA 2E2BA 4J97A 2X6DA 3DK6A 3ENMA 1OB3A 2WTJA 4ZEGA 2JGZA 3A99A 3OVVA 3C1XA 3TNIA 4FUYA 5J1VA 5M57A 2B7AA 2PZRA 2R9SA 3CJGA 3GFWA 4UWBA 2LAVA 3DTWA 2UZBA 3K5UA 2YISA 3COKA 1I44A 3LOKA 4D9TA 2YM3A 5FXRA 1FOTA 4WRGA 4C33A 2FA2A 3G33A 4GSBA 5AAGA 2G15A 3RPOA 4FTJA 1YXSA 4QYEA 1XH9A 3HV7A 4EORA 5DN3A 3C4ZA 1U54B 4S30A 2UW3A 5K4IA 3QYZA 1H26A 3OWLA 2WD1A 4F65A 4TY1A 3BELA 3H0ZA 3P78A 3BYSA 4NIFA 3RCDA 4KKGA 4AZSA 5J1WA 5HHWA 4ACCA 1IR3A 3ELJA 4CKJA 3Q4CA 2OFVA 3F3ZA 3GFEA 2XK7A 4RMZA 4PTGA 2JEDA 3OBJA 4U6RA 2W9ZB 2PZYA 5AADA 3D5XA 3MB6A 3DCVA 5IEVA 2C3KA 3QWJA 3KULB 4I5MA 2XMYA 3Q4ZA 2UW7A 4Z7HA 5IA4A 1XKKA 4MBIA 5IDNA 4E5AX 2E9UA 4CFMA 4I6QA 2JKOA 2W17A 1H0WA 4OT6A 4GRBA 3VN9A 3CJFA 1FVTA 5JGBA 2YACA 3K5VA 4IX3A 5J5TA 3QU0A 5AP7A 2IVVA 4D0WA 5HBJA 3H9RA 3QALE 2GTNA 3AT2A 5AJQA 5EDQA 3VF9A 4C0TA 3MIAA 4EEVA 5HD4A 5DH3A 4OW8A 4M68A 5H8EA 1QMZA 4A4OA 5T68A 4IWPA 1Z9XA 1H24A 3HDNA 1APME 1ZXEA 4II5A 5HORA 2WTDA 3JUHA 3SW4A 3AMBA 4FTKA 4AOJA 3V01A 5J79A 3GU4A 1Q4LA 4YJOA 4CLIA 3CGFA 3LMGA 3TJDA 3ZOSA 4JL9A 5AM6A 1HCLA 5E8WA 4KKEA 3VBTA 3PXFA 4QP6A 5FBOA 2VTNA 3V8WA 2VO7A 3F88A 3HP2A 4XP3A 4ZTRA 4IJ9A 3T9IA 5J5SA 2C3LA 3MPTA 4E4XA 5M4IA 5IEXA 3WIGA 4O27B 4EOJA 3LFFA 3FLWA 5J95A 4QD6A 2XKDA 4BFMA 1G5SA 1Q41A 2EXCX 2IZSA 4I22A 4MVFA 4M69A 4O21A 1GNGA 4FK6A 4HGTA 4JLCA 5FP5A 3D4QA 1SM2A 5EKNA 5JKGA 3DKOA 4FZ7A 4W4YA 2C4GA 5IH5A 4X6RA 4RRVA 3OWKA 2XEZA 3D5UA 3Q5ZA 4GV1A 4E8AA 2WU6A 2XKFA 3MTLA 3PPZA 3R1NA 3W1FA 4EK6A 3C4WA 4ID7A 4R1VA 5BUEA 4C4IA 2Q0BA 4DLJA 4EOSA 4UMRA 3PJ8A 3WILA 1SYKA 2OJFE 4UZDA 1H01A 2YLFA 4ZY5A 5DRDA 2B9HA 4DEBA 5CSWA 1URCA 3MDYA 4TXCA 2O2UA 4A4LA 4F7NA 2ETKA 2YZAA 1BKXA 4J8MA 4AU8A 1W0XC 3NZ0A 3QHRA 4I0RA 4E6DA 5JFVA 3W8LA 3MVJA 4F7JA 2C6DA 3NEWA 2J4ZA 4LOQA 4RT7A 4WNMA 4YJSA 4AX8A 3EN7A 4JDKA 5J9YA 1H1WA 3CTQA 4XBRA 3HDMA 3MW1A 2R3OA 2QLQA 4Q5EA 3DLZA 4BDCA 1FVVA 3MI9A 3ZTXA 5BPYA 2BUJA 2C5XA 2BZKB 3ITZA 1A06A 5CSHA 5C1QB 2HZ4A 4XOZA 2VTJA 3QQLA 4IADA 3DOGA 3D5WA 1A9UA 4QMWA 4EHZA 4BCJA 3GENA 4FA2A 2EXEA 4GJ3A 1GIHA 2Y4IB 3OCBA 2HK5A 3GEQA 5DLSA 4HYSA 5JQ8A 1CKJA 1ZZLA 3K2LA 3R8PA 3KK9A 5CF8A 4F9BA 3T9TA 3PP1A 2XRWA 5CEIA 5TKDA 4YURA 3QQUA 4L8MA 3KEXA 4UXLA 4BIDA 2R7IA 1WFCA 2ACXA 4JX3A 3I0QA 3AC1A 4IANA 3WZUA 1SVHA 2OO8X 2XZSA 3Q2MA 4U3ZA 3GQIA 4ASZA 3A7HA 5KE0A 4X2KA 3RWQA 1I09A 4EBVA 5KMIA 4JQ8A 2B9FA 3R7VA 5GJFA 2X81A 3W33A 3QD3A 3F3TA 2CJMA 1BYGA 4Z3VA 2CDZA 3ORTA 5EDRA 4Q5HA 3KMWA 4W4WA 3ULIA 4QPAA 4YJQA 1JWHA 5EK7A 4A9YA 3CPBA 3LM5A 3TV6A 4YTFA 4ZS0A 2C6OA 1MRYA 2OIBA 3BU6A 3VS3A 3O71A 3KVWA 4M97A 4BTJA 2DYLA 4FV3A 3VF8A 5M44A 4NUSA 4HGEA 2I0VA 3IPHA 3DS6A 4EH2A 3FI4A 4R5SA 3VUDA 3NYOA 5IISA 1B38A 4L9IA 4Z16A 5BX0A 4DHFA 1OL6A 2EU9A 3V8SA 1F0QA 3MN3A 3FUPA 4YSJA 3PA4A 5EOLA 4EZ7A 3PJ1A 4BCMA 3PIZA 4S31A 2B1PA 4CRSA 2ZM3A 4I23A 4BDFA 4LFIA 2YM7A 2I1MA 2OGVA 3DTCA 3F5XA 3L9LA 2ITXA 4S2ZA 4C2WA 3S00A 3ZCLA 3TXOA 5IF1A 3HEGA 1WMKA 4R5YA 3QHWA 4M67A 3OEZA 3PA5A 4J7BA 4IAFA 3ROCA 3SRVB 4BCIA 1CTPE 2PY3A 4WUNA 2QI8A 3QGWA 5DE2A 3OCGA 5IA3A 3MFTA 3ORZA 3R02A 2A4LA 2F7EE 2JDTA 3FZPA 3NPCA 4JBOA 3SXSA 3VJNA 4WD5A 4UMUA 2WMWA 4LV8A 4RIXA 4WKQA 1K9AA 3O2MA 4JQ7A 5IH4A 3JVSA 3FZ1A 4XMOA 2CMWA 2ETRA 5KMOA 4IZYA 3KRWA 5AP1A 4C3FA 2WAJA 2JD5A 4O0SA 2H6DA 4OAVB 1Q61A 4MX9A 3ANRA 3BGQA 2ZYBA 3VUMA 4EHEA 4N4SA 3V5TA 1PKGA 4OTWA 3HA6A 1OUYA 3QQFA 1M2RA 4KIPA 3OTUA 1UKIA 3C5UA 2J0MB 5L6PA 4FV0A 4PUZA 2OICA 3EB0A 4H1JA 4PDSA 3D7TA 4I6BA 2VRXA 2F4JA 4FSRA 3R7UA 5KMLA 4C36A 4LGDA 5EYCA 4IJPA 4LRKA 3EJ1A 3C4XA 3QTRA 2BAQA 2OIQA 4FV7A 4FVPA 1DM2A 1OL5A 3Q9XA 3DV3A 3GCUA 1WBVA 1K2PA 1YDRE 2WPAA 4FKPA 3KQ7A 3V6RA 3VAPA 3MPAA 4FTQA 3W16A 1HCKA 4I4FA 4IAKA 4OGRA 3D2KA 5M4FA 2IZTA 3UO5A 1YW2A 2XP2A 2JBOA 2WMSA 5ETAA 2QKRA 4CTCA 3MSSA 4DFXE 3G0FA 1JQHA 3P86A 5EYMA 1YDTE 2OZAB 2QQ7A 4FV4A 4B8LA 2YHVA 3DB8A 2J2IB 5DVRA 4BL1A 5HIEA 2B53A 2F57A 1PJKA 5C03A 3RM7A 3ROYA 1RW8A 1XH5A 2NP8A 4HGSA 3CY2A 1W98A 5E7RA 4XV1A 4BZNA 5A14A 5I9ZA 5I9WA 4J95A 4QP8A 2X0GA 4F70A 4LG4A 3DQXA 3UVQA 3C4FA 2Y8OA 4PL3A 1YOJA 3ALNA 4F9AA 1OKZA 1SNXA 2C69A 3FQSA 4TWNA 4PTEA 1UA2A 4WNOA 4LI5A 3L9MA 4LMUA 2WB8A 4EH4A 2VWIA 2YCQA 3PVGA 4QQCA 2YERA 3VUGA 1O6YA 3QKLA 4GH2A 4DFZE 1OITA 4Y73A 1JBPE 4Z9LA 3W2QA 1P2AA 2YABA 4BVUA 3VULA 4OBOA 3EZVA 4FKUA 4QMNA 3I60A 4D1XA 2Y4IC 4U5JA 1Q99A 3EMGA 3GI3A 3TEIA 2HWPA 2R3HA 4QMXA 3R9HA 3V51A 4UBAA 3MJ1A 3CEKA 5IMEA 4RQVA 3BHVA 5DA3A 3IG7A 2YAAA 2BTSA 4JRNA 1Y6BA 3W55A 4B99A 3ZLYA 2O3PA 4LL0A 3BE9A 2HOGA 3GU8A 3HP5A 4D1ZA 4F7LA 3QQGA 1XO2B 4MYGA 4BCHA 4GEOA 2V7OA 4QP4A 4D2TA 4IZ7A 4WUAA 4O0TA 5HG5A 5F94A 1H25A 4O0UA 3BI6A 5FTQA 5AUTA 3RALA 1U5RA 4U3YA 3FC2A 2VNWA 4YHJA 3C4CA 3KF7A 4FG9A 4MH7A 4FZDB 4C4FA 5HTBA 5AP5A 5B0XA 5HVJA 4ZLYA 4FMQA 3WI6A 4FSWA 2ESMA 1Q97A 4C38A 3LIJA 1KV2A 2ZJWA 4L68A 4QYHA 4ZSEA 3UOLA 4AZTA 4DGNA 1ZLTA 5CAUA 3LFQA 2C6EA 4USEA 3AC3A 4AFEA 4XLVA 4EI4A 2QOKA 4IIRA 2QD9A 3U87A 1AD5A 5LVPA 3KN5A 5AR8A 2BRMA 2XK8A 4L3JA 4TWCA 4JRVA 4B9DA 5AP4A 2WU7A 5HIBA 3FXWA 2YIQA 5C8MA 4DEGA 5M4UA 3OCTA 4AGWA 3WF8A 4P4CA 4FT9A 4MK0A 5HLWA 5CANA 5LQFA 3PRFA 4YJTA 4RIXB 3UIXA 4YZNA 2Y7JA 4C4HA 3U6IA 3O96A 4XP2A 4FYOA 2GHLA 3CKWA 3I6UA 5FXSA 1GIIA 2GS6A 5HD7A 5IA5A 3GC7A 3CR0A 1OIYA 4G3GA 4K33A 1V1KA 3UIMA 2C0OA 4YO6A 4G34A 3DK7A 5AUVA 3JYAA 1FGKA 2JBPA 3OHTA 5E8SA 1H00A 4K77A 1R0EA 3RPRA 4MXXA 3BRBA 3LE6A 2C3IB 4XEYA 4MEDA 3UDBA 4FI1A 3TNPC 3VC4A 5LWMA 5BUIA 4FT0A 5KMNA 5FEDA 3DQWA 3QX4A 4XV2A 3MBLA 3RK7A 4FR4A 2QKWB 4F99A 5AUWA 1BX6A 3LHJA 3NNWA 4W8DA 4AOTA 5FG8A 3V5WA 5L6OA 4CT1A 2H8HA 2ITTA 5H3QA 3UG2A 2X7FA 2HWOA 4EWHA 1JLUE 3EQBA 3Q4UA 4HVSA 2VWUA 2WQBA 3ZDIA 4AT3A 3KXXA 5A4CA 3SOAA 3LFEA 2VTOA 4DH3A 2QOLA 2XNPA 2LGCA 5L3AA 1KWPA 3FLZA 2O5KA 1O9UA 3FQEA 1YOLA 1BL6A 1XBBA 3V5JA 1E9HA 2WMVA 2W96B 2XM9A 3F82A 4QP9A 5EI6A 2VX0A 3ZXZA 3NYNA 4XG6A 4NKSA 1PXLA 2G2IA 4JAJA 3POOA 4PQNA 3F5UA 5J9LA 1R78A 4BDEA 3M11A 4EH7A 3M42A 5KX8A 3AD4A 3NW5A 3HRBA 3RINA 4QTEA 4AE9A 5JFSA 4K18A 3VO3A 5CF5A 1M52A 3UJGA 3ZLXA 5CAPA 3IOKA 2BALA 3KRRA 4G6LA 4ALWA 2F7ZE 2ZB1A 2R4BA 1H1PA 4I6FA 4MXCA 4PRJA 5AIKA 4ZSJA 1V0PA 4ERWA 3P7BA 3R7GA 5B2LA 1UV5A 2GNHA 2BIYA 2VO3A 5JGDA 1PXPA 3KFAA 3BHTA 2PVFA 3I6WA 4BBMA 4M69B 1UU9A 4TWOA 1Z5MA 3NIEA 4FG8A 1PXMA 4I5CA 4USDA 2HIWA 2W1HA 3HL7A 3E8EA 4F0FA 1F3MC 3VW6A 2X1NA 1ZARA 3LPBA 3T3UA 4YPSA 3BYMA 5DG5A 5HO6A 2X2KA 4KIQA 4CCUA 3RK5A 4JVGA 3Q3BA 2ZDUA 3EFJA 4X21A 3VQUA 3RCJA 3OEFX 4J98A 1O6LA 4F1OA 4YC3A 4J53A 2RGPA 5HESA 4X6QC 4HVHA 4H39A 3K3JA 5L8KA 5HG7A 5C8NA 3VRYA 5KMKA 4DEAA 3ALOA 4V04A 5JZJA 3QC9A 2GMXA 3IS5A 5ITAA 1XBCA 4EQMA 3F3WA 3V8TA 3LXPA 2V62A 4QQJA 4ANOA 4D2PA 4KRCA 3UOHA 4YP8A 4FL3A 2GHMA 2G2FA 2JFLA 2UUEA 3CIKA 3HGKA 2IZUA 4TT7A 2HZNA 2ONLA 4ZP5A 4YC8A 3GXLA 2C47A 4FGBA 1TQMA 3EQFA 3HA8A 4ANLA 4PPBA 4D58A 3QRUA 5IH6A 5JRSA 4AZVA 2OIDA 5AUYA 1GZ8A 2X9FA 4AS0A 3W8QA 4E6QA 2O65A 3D5VA 3DZOA 4MD7E 5BVFA 3BCEA 4WNPA 2NRUA 4HZRA 5HE0A 2HW6A 4MQ1A 3O8TA 4XNEA 5HVKA 4CFWA 4RJ3A 1DI9A 3QGYA 4OTPA 4YBKA 3R83A 5EOBA 3ZLSA 3G2FA 5E8ZA 3OY1A 3TWJA 2QOQA 3AOXA 4EOPA 1UNGA 2PTKA 2X2LA 3AC8A 4R3PA 4IAAA 2E9OA 4BRXA 2B54A 3NLBA 5EM5A 4IW0A 3VWAA 3LFAA 3GU6A 3MY1A 5J7HA 4OTRA 3LCTA 4HNFA 2WMRA 2X8IA 2ZOQA 2NRYA 1JSUA 5FM2A 4MXAA 5IG1A 5IUGA 2PVYA 3HVCA 5I9VA 1YWVA 4F08A 1UWJA 4CMOA 4CNHA 1XWSA 1R3CA 2EVAA 2PMIA 1IASA 3DNEA 4LL5A 4PTCA 4YO4A 3F9NA 4IM2A 4MWHA 3TG1A 3U4WA 3RAWA 3PG1A 4H1MA 4XG8A 3U6JA 4V01A 2IZRA 5E8XA 2ZM1A 4K1BA 3M2WA 5CX9A 4BN1A 4RJ8A 2IW6A 4XG9A 4GK3A 5CEKA 2QONA 5J7BA 1GJOA 1PMEA 2ZDTA 3GT8A 1OIRA 3BE2A 4U40A 4U9AA 5FRIA 3ZSGA 2XB7A 4AT4A 5K0XA 3MA3A 4NZWB 1ZMWA 3WF5A 2V22A 2BZHB 1OL2A 3MH2A 3KXHA 5F1ZA 2UVYA 4JX7A 4EZ5A 5LMAA 3NUXA 4RSSA 1PYEA 1OZ1A 4DH5A 4L53A 1UU8A 3NYVA 3EN9A 2XKCA 3HV3A 4RFMA 1G3NA 4BDIA 2PE0A 4NEUA 3BWFA 4OUCA 2A19B 2PMOX 5AP3A 4O22A 3QUEA 2XUUA 4PX6A 4FL1A 3RJCA 3LJ0A 4MCVA 4ACDA 5EM6A 4L00A 2YA9A 1CKIA 1KE8A 5DPVA 2WMUA 4EOIA 3PXYA 4PNKA 4FUXA 5TO8A 2QG5A 4MD9E 5IUIA 5LWNA 4HYIA 2VTIA 3ZSIA 4Y46A 3CQEA 4RJ6A 1GIJA 3EQHA 2I0HA 3OXTA 4FSYA 1ZOGA 5JT2A 5CI7A 1J1BA 3G90X 3DBDA 4FIHA 4PDPA 4DC2A 1EH4A 2XK6A 4RJ4A 4YJNA 4ALVA 3EFKA 4GVJA 2BRHA 4TWPA 5H8BA 4DH8A 3VNTA 2R0IA 3PJ3A 3PSCA 5J87A 4XP0A 3GB2A 3WE8A 2WIPA 1OKYA 3E3BX 4MKCA 4XOYA 5ETIA 4J1RA 3ZC6A 3PJ2A 3BBTB 4TTHB 1OUKA 4PWNA 1LEZA 4GT4A 4RWLA 5CNOA 3II5A 4P2KA 4E5WA 4RX5A 4JBVA 3E8NA 3ZUUA 3QX2A 4CFUA 2XIZA 2PZIA 3PLSA 3E8DA 2X9EA 2UZOA 3COIA 4U97A 4GCJA 5DR9A 5GNKA 2O0UA 5G1XA 3ZS5A 1NXKA 3A4OX 3AMAA 2HXLA 2HCKA 2VTMA 5DIAA 3EQCA 5CYIA 1H1SA 4LOOA 4FV5A 5TOZA 4JG6A 3CKXA 3FMNA 5DEWA 1LEWA 3RNYA 2VO6A 4FNXA 3FPQA 3ZU7A 4GUBA 4X2FA 2RG6A 2VU3A 2W1IA 3ORMA 4ACGA 3HNGA 3MPMA 5A3XA 1Z57A 3CXWA 3NIZA 3NS9A 4NCTC 2QU5A 5ANOA 3UIUA 4CKIA 2UZWE 4XHKB 2Z2WA 2GDOA 4QMYA 2QR8A 2XVDA 2VWYA 3NUSA 2VTAA 4E4NA 4IMYA 3DZQA 3JVRA 4DYMA 2CGXA 5BQ0A 3EL8A 5DEYA 3E7OA 1XH7A 4K2RA 2ZV2A 4XV9A 4IEBA 1JVPP 5CLPA 3VS4A 4FSMA 2J51A 2WMBA 5AA9A 4M15A 4ASEA 5E92A 4IE9A 3O0GA 3UIBA 1QPCA 3TJCA 3PPKA 2ERZE 2BFYA 3SAYA 1FMOE 4RBLA 4UYAA 3BGZA 4JG7A 4DGMA 4FEQA 4ZSLA 3DA6A 3EN6A 4G3DA 5CU0A 2YDIA 3R1QA 4LQMA 3UP2A 3A7GA 5A46A 3ENHA 4DGOA 4U7ZA 3WF6A 3PG3A 5CAVA 1OL1A 4RWIA 3F2AA 1H0VA 3KK8A 3BLHA 1H8FA 4WBOA 1NVSA 3Q6WA 4WO5A 2C0IA 4BDDA 4P90A 4QNAA 4G5PA 4CMUA 4JNWA 3D83A 4ZTLA 4GS6A 3TIZA 4AW0A 3OD6X 4MAOA 4FVQA 4BCGA 4I21A 2BDJA 2Y0AA 2BR1A 4FF8A 1U4DA 3HUBA 3A8XA 4GT5A 3Q5IA 3DY7A 3L8PA 3S1HA 2VTTA 2WMXA 3IK3A 3BX5A 1DI8A 2ITWA 5CZIA 3E64A 3QQJA 4J99A 5LARA 2UV2A 3G9LX 4NM5A 1KE5A 4C7TA 2J5EA 3UPZA 2GNFA 2VTPA 3HUCA 5D9HA 3R9OA 2CGUA 3SX9A 3RAKA 4D2SA 4U42A 4C58A 3BYUA 4F6SA 3TNQB 4MBLA 3NCZA 5CF6A 5CY3A 2WO6A 4L43A 3O23A 4H3PA 4BHZA 4PNIA 3QAME 2C1BA 4EOMA 4WBBB 2EUFB 5E8VA 2ONLC 3PFQA 5HIDA 3QQHA 3P7AA 1XH4A 5D7VA 3SXFA 5A6OA 4O1OA 5LJJA 3HMMA 1BLXA 5IA1A 2GSFA 3TL8A 4UYNA 5KZIA 5A9UA 3I7CA 1XR1A 2QO7A 5CASA 2FVDA 2ZMDA 2XJ1A 3OF0A 4QMSA 5KBQA 1T46A 3OXIA 4GG7A 4IVDA 2OF2A 4FSQA 3A7JA 4G16A 5CS6A 2BZIB 3OBGA 4Y8DA 2Y9QA 4UWYA 4DH7A 3FMDA 4MQ2A 4XCUA 5BUJA 4FTIA 4HYHA 3OZ6A 3KVXA 3GU7A 1R39A 2C30A 2ITUA 4YTCA 2YAKA 4RX9A 5CAOA 2Y4PA 5DFPA 3KXGA 4UALA 3VBYA 2BCJA 5L2QA 4BIEA 2ZV7A 3HV5A 2QHMA 5KUPA
chains in the Genus database with same CATH superfamily
4O38A 2W1ZA 3UYSA 3RP9A 5CZHA 4AT5A 4C61A 2R3GA 3QCYA 2XNOA 2XBAA 4EK4A 2W1DA 3GNIB 4FZ6A 4Y85A 1ZWSA 2WMTA 5J9ZA 3DBFA 4RC3A 5ANIA 4ZLOA 5FBNC 1FVRA 4AOIA 4YZBA 1W2FA 2HW7A 4A9UA 2CHLA 2UW6A 1GZOA 2B9JA 2I6LA 4ANNA 3SVVA 5TF9A 4YR8A 3ORPA 4QNYA 1KV1A 3KXMA 4XG4A 3D0EA 2UW4A 3EYGA 4LV5A 2AC5A 2X0PA 3TNHA 2R3MA 3V5QA 4FIGA 4NU1A 4I20A 3BZ3A 1U54A 2GNLA 4C35A 2A0CX 3ZEWA 4C8BA 4G6NA 5IA2A 3M1SA 2DWBA 4USFA 2XM8A 3FL4A 4F9YA 3IDCA 5C27A 5BYYA 4CQEA 2ZVAA 2X0OA 1UU3A 3IKAA 4JDJA 2OZOA 1PW2A 5B2KA 5JFWA 4PMTA 5M51A 4I3ZA 3QQKA 4YJUA 3RNIA 3KRLA 4WSQA 4Y5QA 5IA0A 1Q8WA 3QUDA 2GCDA 1YXUA 4FV9A 4G6OA 3ZEPA 4BBFA 2OF4A 3BKBA 4G2FA 3VBWA 4Y72A 4AN2A 5AV1A 3BQCA 2C5NA 4E26A 1FQ1B 2WTIA 2W0JA 4U43A 1STCE 2QU6A 3UVRA 4IFGA 3FKOA 4PP7A 5BVNA 3R1SA 2J6MA 4UMPA 5HX6A 2R3PA 4E20A 3UQGA 3G51A 4M13A 2RFNA 3O7LB 5CNNA 4N6YA 3MJ2A 4FRFA 3IW6A 1MQBA 1M7NA 4FTAA 3ZRKA 3TUCA 4EWQA 3NRMA 2F49A 4D0XA 1UKHA 3KKVA 5CF4A 2JITA 3FLSA 2PSQA 2X2MA 3QRKA 5AMNA 1U5QA 4A9TA 5H9BA 4N70A 4OTIA 2XIRA 4C3PA 5JN2A 4GUEA 1IG1A 2YFXA 3DAKA 1JNKA 4RJ5A 5DNRA 5HTCA 3R7YA 2ITYA 3NUUA 5EW9A 4C02A 4OT5A 5TT7A 4BCQA 2R7BA 2BAJA 1JAMA 4RIYB 4HYUA 4PP9A 2W5HA 5M55A 2J5FA 1YKRA 2F2CB 5FDPA 1QPJA 3TUDA 4QMOA 3RK9A 1XHAA 1ZMVA 4PY1A 4YZMA 3ZO1A 4GYIA 1ERKA 4NTSA 4MWIA 2CGWA 3QFVA 5CQUA 5D12A 1X8BA 4OTGA 4ZIMA 3F3UA 3E92A 3UGCA 5HE2A 4G3CA 4FTNA 4AP7A 5I3RA 2P55A 2XA4A 3E5AA 3IW5A 3PRIA 1ZMUA 4ITHA 4NCTA 5C8KA 4GT3A 3OXZA 2QOBA 4FKGA 3NUPA 4OAUC 3UTOA 3ANQA 3GC9A 2BDFA 3NCGA 4YNEA 3RPSA 4A9RA 3PVWA 5AP2A 2JDVA 2JKMA 4RIYA 4RPVA 1YXVA 3GCSA 5AAFA 3KGAA 3TT0A 5IEYA 5JGAA 3GCPA 4AN3A 4AACA 3H9FA 4U45A 2WGJA 3ZM4A 2JKQA 4HNIA 3FAAA 3IGGA 4E4LA 2BHHA 4I6HA 3ZSHA 4IWOA 4DGGA 3EKNA 3FHIA 2C0TA 3KU2A 3ZFMA 5M4CA 2QOHA 3VS7A 4AZWA 4F4PA 3PP0A 2A1AB 4NJ3A 3ZONA 4CV9A 1VYZA 3B8QA 4ZTHA 4Y5HA 2ZAZA 4R6VA 4EC9A 1WVWA 4AGDA 1OIQA 3OG7A 3KL8A 1BI7A 3NX8A 5HE3A 5D10A 5AV3A 3DFAA 3FQHA 4K8AA 4BWXA 4FKRA 1JSTA 4UX9A 2GFSA 2HENA 3EOCA 2W5BA 4AZFA 4WHZA 2YIXA 3P1AA 4MXYA 3U9NA 4CD0A 2C6IA 5I5ZA 2W7XA 4KRDA 3SC1A 4B4LA 1ZOHA 4GG5A 1S9IA 1HOWA 3R71A 2YDKA 1H1QA 1Y57A 3TN8A 3EQGA 3GUBA 2GU8A 3ZMMA 4D5HA 3L8SA 2CPKE 4DN5A 5L8LA 1OI9A 3PE1A 3UOKA 4D2VA 4J52A 2QVSE 3PSDA 3E93A 3EIDA 3AGLA 3FL5A 4S32A 5L6WL 5I4NA 3P23A 2VTLA 2VV9A 5FD2A 1FGIA 3MFRA 3BEGA 2E9NA 4AA5A 4KNBA 4BIBA 3OWJA 2HY81 4XYFA 2W1GA 4NW6A 2QHNA 3VW8A 5IUHA 5AV4A 5F4NA 4FK3A 2OW3A 4KIKB 3EHAA 4HW7A 4ERKA 2Z60A 1H27A 1OPJA 3O8PA 4CT2A 5EHLA 4E7WA 4F1TA 3HMNA 3LFSA 4BTKA 3TKUA 3TKHA 4BDJA 4HVGA 2NPQA 3QTWA 3HMIA 3MH1A 4TYIA 1S9JA 3Q32A 4O4BB 4FKOA 4GFMA 3C0GA 4F09A 3LXNA 3D15A 2VAGA 4FSUA 2YM4A 3IONA 4B6LA 2G9XA 4DG3E 2R3RA 4I4EA 4C3RA 2QOOA 4BB4A 3QBNA 2GS2A 1U59A 3I81A 2AUHA 3IOPA 3ACKA 5FWKK 3ORNA 3F7ZA 4FV6A 4CV8A 2I0YA 4XJ0A 3R8UA 4IZAA 3PXRA 2C68A 3OWPA 3P08A 4EH6A 2R3QA 4DTKA 1Q62A 4FKLA 4I0SA 5HCYA 4U80A 3IW4A 2ITVA 2R3JA 3ORXA 3DXNA 2BILB 1W8CA 3BYOA 4FT3A 1YDSE 2EWAA 3EL7A 2GNIA 4JBPA 3OW4A 4OTDA 5CI6A 2WMQA 5CALA 3G9NA 4FT7A 5KKRC 3QZFA 1LUFA 5BVWA 4AA4A 5FQDC 1Q8TA 1UNLA 3FMJA 4AF3A 3QCSA 3R30A 3NR9A 3OFMA 1YHWA 5KCVA 4BCKA 5HG8A 4X0MA 3U51A 2W4KA 1CKPA 3R6XA 1FMKA 3CD8A 2WOUA 2PHKA 5ICPA 3C4EA 4L3PA 5HO8A 4QOXA 2XRUA 3ZO3A 3FMMA 3G0EA 5LOHA 3FXZA 4YSMA 1OMWA 4F63A 2CSNA 3UYTA 4WA9A 4LM5A 4AW2A 2JKKA 5CVGA 4FKVA 2FSOX 2P2IA 3C13A 2FSLX 4LUDA 3HRFA 4EJNA 2OZAA 4KD1A 4IDTA 3R7IA 4JG8A 3LCSA 4WOVA 1REJA 3LQ5A 3QTXA 2JC6A 2YJSA 4APCA 1DAYA 2RF9A 4S34A 2PUUA 4IM3A 5AAEA 3R1YA 2J0IA 5EG3A 5KZ0A 4DEEA 2PZPA 2X0QA 2R3NA 1H1RA 3QA8A 5CXHA 4OBPA 3V5PA 4AXAA 4EUUA 5AIRA 4QTBA 2BMCA 2C6TA 2I0EA 4L42A 5GZAA 4NTTA 1YRPA 4D4SA 3QD4A 5D7AA 1WZYA 4QYYA 2CCHA 2PL0A 3IDBA 4ONAA 3UG1A 5F9EA 5KKRB 2BRGA 3O50A 4EH3A 2P33A 4RQKA 3R9DA 4YTIA 3T3VA 4GJ2A 4O2PA 4L01A 4F0GA 2RKUA 5BVDA 2G1TA 5HU9A 2YM8A 2WQMA 3AT4A 2J0JA 4YU2A 3EN4A 4BWPA 3DAEA 5M53A 3KB7A 3ZFXA 5AV2A 3LLTA 2IW8A 4TKSA 4RFZA 4ZTNA 3WF7A 3HV6A 4M84A 1BMKA 3QF9A 2OG8A 3UMXA 3GC8A 4D4RA 1SMHA 4W4XA 3Q52A 5HTIA 3EKKA 3IECA 1GAGA 5I9XA 3GP0A 4EBWA 2YJRA 3DLSA 4R7HA 1RE8A 4MHAA 2YEXA 3PVUA 4TN6A 4M7IA 3HRCA 4XRLA 1XBAA 5LCJA 3QTZA 2C3JA 3OTVA 3R2YA 5T6KA 3ZLWA 3EQDA 2BKZA 4BDHA 4DCEA 4F0IA 4QQTA 4UXQA 2BZJA 4A4XA 1BI8A 4FZAB 1T45A 2DS1A 3LXKA 2WQNA 3R21A 5A54A 2VD5A 3DFCB 1BL7A 2P2HA 2A27A 3L8VA 5FDXA 2W9FB 5HKMA 1JKSA 4TPTA 4NIFB 3ZO2A 3SLSA 4GFGA 3L9NA 1NVQA 2VN9A 3DDQA 4F1MA 4DINA 4CYIA 4QP7A 2GFCA 1J3HA 2BRNA 1U46A 4H36A 5G6VA 3ZH8A 4EK3A 1QCFA 4F64A 3A60A 4TNBA 4HVDA 4EKKA 3FWQA 4NSTA 5EI2A 4BCFA 3D2IA 3DU8A 2XK4A 1YWRA 5ETCA 4AN9A 4U41A 3UC3A 5HLNA 3BBWA 2GPHA 3OS3A 4MNEB 4OBQA 5BMMA 3MIYA 4O4EA 1PF8A 3KF4A 3O51A 4ZK5A 4R3RA 3TNWA 3W32A 5KBRA 2CCIA 3P7CA 3MH0A 4QO9A 3WIKA 4ASXA 5ETFA 4E4MA 3QTUA 2PE1A 3PTGA 2XK9A 5HNGA 4G9CA 3FYKX 3ORIA 4JI9A 3SD0A 4BCPA 4ZZOA 1FINA 3OCSA 3MS9A 4DLIA 4C4GA 3GCQA 3R7OA 2XH5A 5H8GA 4QMQA 4HGLA 3F2NA 3QD0A 2AYPA 4B8MA 3UO4A 4BF2A 2UZDA 3RHXA 1JPAA 2F2UA 2Z7LA 2ITZA 4G5JA 5JMSA 3A7IA 4MXZA 1TVOA 3LW0A 3VIDA 4QMPA 5JH6A 1OPLA 3MWUA 4RVMA 5IKWA 4EK8A 4ZTMA 3IO7A 4E3CA 3TKIA 3ETAA 3EFLA 3VUTA 3OT3A 4AE6A 5JRQA 4AWIA 4RVTA 3LAUA 3NUYA 3UVPA 3O8UA 5AEPA 3QYWA 3C50A 1H28A 2IEWA 3FY2A 2YWPA 5C01A 1J91A 2NO3A 3LCDA 3Q9WA 3DPKA 3S0OA 3F69A 1B39A 2PVNA 4EKLA 1PYXA 3KXZA 5HEZA 2XF0A 4FYNA 3MB7A 4PPAA 4P5QA 3I7BA 4RZWA 1UU7A 4GIIA 2JLDA 5IPJA 3HLLA 4EOKA 1OGUA 2VZ6A 1VZOA 4IX5A 1ZYSA 3RM6A 4ARKA 3W2RA 2EB3A 3F5PA 3BIZA 5AM7A 4ANSA 4X3JA 4C34A 2WQEA 2HXQA 2PVHA 3TZMA 3KXNA 3UPXA 4EHGA 2XYNA 4TYEA 4CQGA 5KNJA 2XIXA 4WG5A 3QKMA 4HJOA 4M12A 1MUOA 4EYJA 3G6GA 1WBSA 3MVMA 5AP0A 3H0YA 4FNWA 1URWA 3C9WA 3HMOA 3KA0A 4R1YA 3SW7A 3MY5A 2FO0A 1RQQA 4L52A 1PMNA 3WZEA 3QXPA 4IWDA 5HLPA 3E7VA 4FODA 3WF9A 3H9OA 1AQ1A 2OK1A 4LUEA 4FOBA 3VS5A 1P14A 4JDIA 3QCXA 2DQ7X 4EOOA 3E88A 4E6AA 1ZYDA 4QMTA 4F9WA 3GOPA 3NW7A 4KIKA 4YMJA 5EKOA 3VBQA 3KCKA 4TNDA 5F95A 1GY3A 5I0BA 2XNEA 2BDWA 4B7TA 2A98A 1Q3WA 4EOLA 5CVFA 1Q24A 1OPKA 4IB5A 4F9CA 1OL7A 3A7FA 4NFNA 2KULA 3MVHA 5A6NA 2FB8A 2J0LA 2R5TA 4U79A 1YVJA 1F5QA 4Y95A 5AWMA 3QXOA 2WZJA 3OROA 3UNKA 2GS7A 4IB1A 4RIOA 4X3FA 3S95A 3VVHA 5ANKA 1SVEA 4DFNA 3CBLA 5TR6A 2WIHA 5LMBA 4IX4A 4IM0A 4GIHA 5FP6A 4CFNA 4QP2A 4X3FB 3QZHA 2RIOA 4KABA 3EFWA 4N0SA 2X7GA 3ODYX 2WTCA 4QPMA 2OI4X 3AC5A 5JSMA 1ZZ2A 4BDKA 1Q8UA 1TQIA 2YITA 2CKEA 3GBZA 2WEVA 3FKNA 4FKQA 4JXFA 2G01A 4U0IA 4PL4A 2WHBA 3MY0A 4E1ZA 1MRUA 3IGOA 4I41A 3QA0A 2FSMX 3P4KA 3QRTA 5CENA 2O64A 3DBQA 5ANEA 4Q9SA 5HZNA 2SRCA 3D7TB 4IC7A 4DH1A 2YM6A 3DKGA 4JQEA 4U44A 3LFBA 4O6EA 4QMZA 4BWKA 5D41A 3DKCA 5D11A 4G3EA 4DG0E 2HELA 5C26A 1JOWB 4MTAA 4MNFA 1RDQE 3RPVA 2R3KA 5DHJA 4ITIA 3RZBA 3PZHA 3TV7A 5LVNA 3THBA 4NJDA 1M2QA 3CQWA 4HPTE 3GOKA 3I1AA 4BGHA 3Q6UA 1V0OA 3SHEA 1R0PA 3R28A 2Z7SA 3QUPA 5KO1A 3R73A 5BVOA 4EYMA 5K9IA 1ZYLA 2B52A 1MRVA 1Y91A 4O1PA 2R3LA 1REKA 1PKDA 4V0GA 4BCNA 4FTUA 4CZTA 4RVLA 3U8WA 1SZMA 4YLKA 3VRZA 1Y8GA 3PY3A 4F7SA 5CEMA 3FSFA 5FXQA 3QWKA 3ZDUA 4CLJA 5EM8A 5FLFA 1UNHA 3KCFA 2OH4A 1W7HA 3SRVA 4BI1A 1TQPA 3PWDA 1KE9A 4FTTA 3JY9A 4MD8E 4JIKA 4IHPA 4KIOA 4WT6A 2QODA 1W2CA 2X4ZA 2WXVA 3AG9A 5DR2A 2EXMA 5EW3A 3FZRA 3E8CA 3DDPA 3PY0A 3WE4A 2W1FA 4YNOA 2QCSA 2VTRA 4F6UA 2OJJA 3CY3A 2OXDA 2RL5A 4IFCA 4L6QA 4C4JA 4I5PA 5E90A 3R9NA 3GC0A 1SNUA 3C51A 1W84A 3FYJX 4CVAA 4W9XA 4O4FA 4XH6A 2E9PA 4RG0A 3LFNA 5AP6A 4ZZMA 1OM1A 3RTPA 1WVXA 3QTIA 3S3IA 3AXWA 4ACMA 3NW6A 4C4EA 2C1AA 5HNIX 4CTBA 1CSNA 2X7OA 3BWJA 4QTAA 3RMFA 4J96A 1H08A 3CE3A 4M3QA 5KHWA 4ENYA 3C7QA 2W1EA 1DAWA 4RA4A 2C6LA 2J9MA 3FLYA 5E8TA 3RKBA 3RZFA 3FJQE 2H34A 3CCNA 4EOQA 5DT0A 5K5XA 2X6EA 3B8RA 4O0WA 4DITA 1ATPE 2W4JA 4JJRA 5EYKA 4E93A 2OXYA 3W2PA 3P79A 2FH9A 3QTSA 4YBJA 1ZY4A 3U6HA 2BROA 3NWWA 4KSQA 4ZY6A 3F6XA 2W05A 3FSKA 4UN0C 4FL2A 5CU2A 3UOJA 3QCQA 4L7FA 2R2PA 1J1CA 3MTFA 4FC0A 5HBEA 2XNGA 5HE1A 4AGCA 4ZJVA 1M17A 2UVZA 3TZ7A 1VJYA 1YQJA 3LFCA 4FV8A 1IRKA 4PMSA 3FI2A 3S2PA 4ZXTA 4I94A 3QD2B 3NAXA 2JIVA 4JR3A 5FTOA 4KBKA 3RAHA 3BV3A 3PXQA 4WIHA 2J90A 3EZRA 3IW7A 1MP8A 4YZCA 5LVOA 1CDKA 5L4QA 1PY5A 5B2MA 2EB2A 1JKKA 3A61A 3R0TA 4IACA 4DEHA 5EYDA 2VX3A 2UW9A 4BDGA 4M14A 4PL5A 3SKCA 4GU6A 3NDMA 3A62A 4IVBA 3CTJA 1AGWA 4WNKA 5AR5A 3MYGA 4D2WA 3OT8A 4KINA 4H58A 3E3PA 4D55A 3EWHA 1BUHA 4FX3A 2VWXA 4DEDA 5E8YA 3A2CA 1KE7A 4QRCA 4ASDA 3UE4A 2CN5A 4KAOA 1Q8ZA 4RFYA 4QYGA 3LZBA 3VS6A 5AUZA 2W5AA 1Y6AA 2WKMA 3WZKA 1Q8YA 4C2VA 4EHVA 3FMLA 3LCOA 3QC4A 3JXWA 4C62A 3ZC5A 3OOGA 3PY1A 3QL8A 4TYJA 5FEQA 4LRJA 3CS9A 3NNUA 5B7VA 4CEGA 3CQUA 5ANGA 5L8JA 3DK3A 5HU3A 3COHA 5BVEA 4CFVA 1B6CB 3NNXA 4IB0A 5DOSA 4TYHA 2V0DA 4NT4A 4DFYA 1KOAA 4FIFA 1WVYA 3MV5A 2F9GA 3Q4TA 3ZO4A 4ITJA 3MA6A 4GW8A 4JDHA 3T8OA 1XH8A 2IN6A 3MGYA 5EFQA 1ZAOA 2UW8A 5JQ5A 4W9WA 4BI0A 5CXZA 2XYUA 4HCVA 3G5DA 3R8VA 3VS2A 3Q53A 5KHXA 4X3FC 3TTJA 3UP7A 5K5NA 4GU9A 4BKZA 3FMKA 3K54A 4PDOA 2FSTX 1YI4A 1E1XA 4AW1A 4FSNA 2FUMA 2UZLA 3PZEA 2UVXA 4W4VA 4A7CA 2VGPA 5K0KA 4JR7A 5LMKC 4AFJA 3UNZA 2F7XE 3LJ1A 2CLQA 5ANDA 3PXZA 4RJ7A 5EM7A 4ALUA 4BZDA 4RLKA 2V55A 2YDJA 4FTRA 4RWKA 2OJIA 4TW9A 2HZIA 4FNZA 3BGPA 4BGGA 4KBCA 4CFXA 4ZTSA 3DNDA 4E73A 1P5EA 2YN8A 4G17A 4OLIA 3QZGA 2BVAA 2ITNA 2Z7QA 3RWPA 3RAIA 4ZY4A 3UBDA 3E87A 4KS8A 2B55A 5AR3A 3RGFA 5I9YA 2OJGA 2IVUA 2C6MA 1GZNA 3BV2A 3G6HA 3H4JA 5AR2A 3QLFA 5K3YA 3FC1X 4JOAA 3NSZA 1GZKA 3VQHA 2VGOA 4FT5A 5L2WA 4MXOA 3ZZWA 3I4BA 3FHRA 4BI2A 3BEAA 3TI1A 4BYIA 2GQGA 4EQUA 4P5ZA 1ZRZA 2XNNA 1LPUA 4NW5A 5DGZA 3H3CA 1KOBA 3U9CA 2XEYA 4YZ9A 5EHYA 4D5KA 4C59A 2WFYA 4RX7A 1PMUA 5BYZA 3GU5A 4EH9A 5A4LA 2PE2A 5FGKA 3DJ7A 1Q5KA 3NYXA 3S4QA 5LVLA 2XCHA 1W82A 2J50A 2Z7RA 3LJ2A 3PA3A 4UWCA 1IEPA 4KA3A 3D7ZA 1H07A 4UY9A 2REIA 2W99B 4KBAA 4ANQA 4ZJIA 5HQ0A 2WTVA 2QOCA 3EQIA 2PVKA 4GK4A 3KRXA 3PJCA 4DEIA 2YLEA 4LYNA 5IDPA 2OWBA 3RPYA 4EL9A 2OH0E 5AV0A 3CC6A 3KY2A 4W8EA 3AD6A 4LGHA 4UZHA 5HI2A 5EW8A 1ZYJA 3ZXTA 4C57A 2E9VA 4YJVA 4ZJJA 4ZSGA 4JBQA 4M0YA 5CU4A 1JKTA 5CTPA 5DWRA 5CEQA 4QP3A 2XK3A 5M56A 1NVRA 1CM8A 2XNMA 4AW5A 2BRBA 4FTLA 4RC4A 4O0RA 2VUWA 4NM3A 4I92A 5E1EA 2JIIA 3A8WA 1WBOA 2OKRA 2B4SB 3JS2A 3JY0A 4BYJA 4BDAA 3LFDA 2WTKB 3GCVA 4FKJA 2PVRA 4RIWA 4HVIA 4G3FA 3FZTA 2GNGA 4IXPA 4PPCA 3MVLA 2W1CA 2J0KA 3I0OA 4KWPA 2PK9A 4GK2A 3O17A 3EN5A 2HZ0A 4TYHB 4IBMA 4YC6A 1VR2A 4FTCA 4D4YA 5CAQA 5HO7A 5A4TA 4A06A 2BAKA 3NGAA 4PMMA 3ZUVA 2GNJA 3DJ5A 2QOFA 4MF1A 3SDJA 1O6KA 1GOLA 3WBLA 3DKFA 2QNJA 1YXXA 3VS0A 4UMQA 4ZZNA 1OKWA 4OR5A 3H10A 3Q96A 5KMMA 3HX4A 1XH6A 3Q9ZA 1WBNA 1ZOEA 3GQLA 5DBXA 3R8MA 3OMVA 2HYYA 3D14A 2YCSA 4QQ5A 3WYXA 4CRLA 4EC8A 1LR4A 4AGUA 2B9IA 3W2CA 2XS0A 3CTHA 5C9CA 4CKRA 4IWQA 1PHKA 1OECA 4O0YA 5CSPA 2QR7A 3TUBA 3PIYA 4XLIA 1JKLA 2WNTA 3O7LD 2IJMA 4J8NA 4XG7A 5HNBA 4FKTA 4K9YA 2JDOA 4FIJA 2VTHA 4FSZA 4CFFA 3L9PA 3R04A 4FKIA 3WYYA 3C0HA 2XBJA 4RA5A 4HPUE 2YIWA 2IVTA 2UW5A 4HCUA 4XRJA 3ZUTA 4CCBA 4E6CA 2X8DA 3KN6A 2GHGA 3SA0A 1M7QA 2ZM4A 2PMLX 3BYVA 3SXRA 1WBWA 4ZOGA 1UWHA 5A4EA 3BPRA 4IVCA 4FIEA 2Y6MA 5T3QA 2OJ9A 3EQPA 4LMNA 1PXJA 1RJBA 5CQWA 2V7AA 5IU2A 5HOAA 2PVMA 1YI6A 2W06A 2ZV9A 3RBWA 4KS7A 4KSPA 4OTFA 4CYJA 3V6SA 4EQCA 5BMSA 4IZ5A 4KKHA 1LP4A 4MF0A 1TKIA 3PE2A 3QRIA 3VBXA 4L46A 4I1ZA 5HBHA 3SQQA 3DBCA 4BHNA 3NAYA 1NY3A 1DS5A 4RC2A 1CMKE 3OP5A 4JS8A 1QPDA 2RSVA 3FDNA 3IDPA 4BBEA 4OTQA 2JDSA 5GJDA 4TRLA 2WOTA 4EK5A 4WG4A 2ITOA 3E63A 4IB3A 5IZFA 4J71A 4JIAA 3FZOA 4QMVA 5EI8A 4XBUA 2ERKA 5I3OA 4IH8A 3L1SA 2UZNA 2PZ5A 4JAIA 2WMAA 5AR4A 1PXIA 2C5YA 4CMTA 4O91A 3CGOA 3F66A 4YHTA 4L3LA 2G2HA 4XG3A 4Y83A 2Z8CA 4LGGA 4BGQA 4DG2E 2QC6A 3VUIA 5DR6A 4R8QA 5BNJA 4LOPA 2VX1A 5GHVA 5E8UA 4ZAUA 5GJGA 5AA8A 4R7IA 4U8ZA 3FZSA 4YJPA 4O0VA 4APPA 5I9UA 5HICA 4FV2A 4IAIA 4D28A 3HZTA 4BCOA 4BTFA 2RFDA 1YXTA 3V04A 4G1WA 1L3RE 5CEPA 4IVAA 4EH8A 1YWNA 2PMNX 2W4OA 3AC4A 4Z7GA 3AD5A 5HCZA 4B0GA 1M14A 2C6KA 4GMYA 4O6LA 1OVEA 3AMYA 3Q9YA 3H30A 3HYHA 1IA8A 3KMMA 4YUQA 4FBXA 4XUFA 4HCTA 1E1VA 5ACBC 3VJOA 5E91A 5ACKA 3F5GA 4I24A 4ZLZA 2UZVA 2XIYA 4L44A 2CLXA 3KRJA 4DAWA 2UW0A 1SVGA 2O63A 3UMWA 1PXKA 1ZY5A 4QP1A 3ZFYA 4X7QA 2BTRA 4YHFA 3PPJA 2AC3A 3CLYA 4NWMA 5ANJA 5F20A 3SOCA 4Q2AA 4M0ZA 4V05A 5HX8A 2DUVA 4H3QA 1WBTA 3PWYA 4TZRA 2H96A 4XV3A 3EYHA 4K11A 1Q3DA 5AR7A 4Z55A 3BU5A 1XJDA 3FE3A 3HMPA 3U4UA 3GGFA 3EQRA 3CD3A 3JPVA 2IVSA 4XG2A 4EZ3A 4EUTA 4FIIA 3UQCA 3VHEA 2FGIA 4CSVA 3SV0A 3FLQA 4GFOA 3I79A 4F6WA 2YCFA 5HG9A 4X2JA 2O8YA 3HV4A 3OY3A 4YGAA 2X8EA 4PF4A 4NFMA 2QO2A 3UZPA 3PYYA 3ZZEA 2CN8A 1M2PA 5DT4A 2VWVA 2OFUA 4IAZA 4LRMA 4RX8A 3MFSA 3RHKA 4TYGA 3L8XA 3UZTA 2QO9A 4BKYA 1P4OA 3QTQA 4QT1A 4XX9A 3WOWA 3NNVA 4BKJA 2WTWA 4ANBA 4NM0A 4IX6A 2PVJA 4UEUA 1MQ4A 2VNYA 3ZRMA 5JFXA 4BZOA 2PWLA 3NUNA 4QTCA 2VO0A 2JIUA 2OBJA 2ZMCA 3BHYA 4I5HA 3R8LA 2XNBA 4YJRA 5TE0A 4WRSA 3AC2A 3A4PA 3FLNC 2C5VA 3LM0A 3P0MA 3AT3A 1Y8YA 1WCCA 2ZV8A 3HECA 4FNYA 2JFMA 4YTHA 3TCPA 3BQRA 1V0BA 2R3IA 4L7SA 3RVGA 3PIXA 3BLQA 2WELA 2XJ0A 2R64A 5CSXA 4JT3A 2XCKA 5JK3A 5HCXA 1H4LA 3ZBXA 4N6ZA 3WZDA 5LMKA 3TZ8A 3QKKA 2P3GX 3I5NA 4ZSAA 3KMUA 2IO6A 2PVLA 3N51A 4IDVA 3TACA 2KTYA 2ZB0A 4A07A 3W18A 4DBNA 4EONA 2QLUA 2VWZA 4QMMA 4S33A 5LVMA 3K3IA 1XQZA 4FICA 2VWWA 3DJ6A 3ULZA 3PSBA 5EHOA 3WARA 3R63A 1VEBA 2BPMA 4PV0A 5HVYA 4AA0A 5CEOA 4NKAA 4FZFB 3ERKA 4FVRA 4YPDA 4E5BA 2OSCA 3ACJA 3FKLA 3LVPA 3Q04A 3AQVA 5KMJA 5CU3A 2YCRA 3TTIA 3MH3A 4K0YA 4QYFA 5H2UA 2QURA 3OUNB 4R3CA 3QLGA 5DT3A 1YHVA 2OXXA 2UZUE 1P4FA 4M66A 3ZBFA 3TZ9A 3BHUA 5LCKA 3B2TA 4QMUA 2VWBA 4O96A 3VUHA 5K4JA 4I93A 3VS1A 5CSVA 2XJ2A 4RVKA 2WEIA 2VTSA 3BU3A 2WQOA 4CZYB 3BHHA 3OC1A 4V0GB 3DBEA 5BVKA 5D1JA 3BLRA 4FV1A 2BFXA 3FI3A 4ACHA 4QPSA 4RZVA 4GVAA 2UZEA 2IW9A 1PXOA 4CXAA 5CU6A 3OOMA 4YLJA 5L2SA 4RIWB 4ANMA 3FMEA 4Q9ZA 2V5QA 4X2NA 4RWJA 5CVHA 1WBPA 4UB7A 4AG8A 1K3AA 2HAKA 2H9VA 2IWIA 2RFEA 2WTKC 3F3VA 4NM7A 2I40A 1PXNA 2X39A 5EH0A 3IQ7A 4A9SA 3FXXA 4FTOA 1W83A 5L2TA 1YOMA 3COMA 2FYSA 3F61A 4AZEA 3ZYAA 2Q0NA 3EH9A 4O0XA 4X2GA 4H3BA 4FG7A 4D9UA 4TL0A 1NA7A 1OKVA 3I5ZA 4PMPA 4FOCA 3Q60A 3QRJA 4D1SA 4MNEA 4UMTA 4YZDA 2YM5A 2CGVA 4HZSA 5DRBA 5JEBA 4FSTA 5LXMA 4K6ZA 4YLLA 3ET7A 4IAYA 1VYWA 1WAKA 5CWZA 1PMVA 3UODA 4D4VA 3FMHA 2GTMA 5J8IA 3RI1A 3WZJA 3VUKA 5GZ9A 3ODZX 3R00A 3R22A 2P0CA 3R2BA 5IMXA 1ZYCA 3E62A 3PUPA 4OTHA 3FV8A 3TIYA 2UZTA 3D9VA 3OUKA 5FEEA 4CZUA 4G31A 5CT0A 3ZHPC 2P4IA 2ITQA 1YI3A 4AUAA 1YHSA 2YIYA 4ZTQA 2BIKB 2R0UA 5DMZA 2VTQA 3UQFA 2ITPA 2X4FA 4WG3A 4KB8A 2QOIA 3LCKA 3R01A 4BICA 4I0TA 3V3VA 4P7EA 3FBVA 4L45A 3R8ZA 3UO6A 5AUUA 3CPCA 1R1WA 5A4QA 5E1SA 4WSYA 4BC6A 2ETMA 4U81A 3N9XA 3P9JA 2RG5A 4QMLA 4O2ZA 1UVRA 5JZNA 4XS2A 1OIUA 4UV0A 5AX9A 5AX3A 3W2OA 2JDRA 3VBVA 4AQCA 3PVBA 2XKEA 3F7WA 3REPA 3ORLA 3QZIA 4IQ6A 4GL9A 3TV4A 3UNJA 3GVUA 3KC3A 3ORKA 4RLLA 4GYGA 3VHKA 3ZRLA 2R3FA 1FPUA 4M8TA 4QTDA 4BDBA 3PXKA 1KSWA