5J7BA

The identification and pharmacological characterization of 6-(tert-butylsulfonyl)-n-(5-fluoro-1h-indazol-3-yl)quinolin-4-amine (gsk583), a highly potent and selective inhibitor of rip2 kinase, gsk583 complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
306
structure length
277
Chain Sequence
AICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLGTIIYMPPENYESRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Receptor-interacting serine/threonine-protein kinase 2
publication title The Identification and Pharmacological Characterization of 6-(tert-Butylsulfonyl)-N-(5-fluoro-1H-indazol-3-yl)quinolin-4-amine (GSK583), a Highly Potent and Selective Inhibitor of RIP2 Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 81
structure length 277
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5j7bA00
1LR4A 4ANNA 4HYIA 4FUYA 3EN4A 4EQUA 3K3JA 3O51A 2QNJA 1OGUA 3NUPA 5TE0A 2VTTA 4FEQA 2W17A 5M4UA 2J5FA 3HV5A 5HCZA 1F5QA 5KZ0A 1YXVA 4QMZA 4WT6A 4BCPA 1HCKA 1R0PA 2I40A 2JLDA 2VO7A 3C4XA 3PSDA 3SD0A 3R8VA 3ZFYA 4AACA 4XG3A 4BKZA 1FQ1B 3H0ZA 5A4EA 2E2BA 5E8VA 3B8QA 3SHEA 5EW9A 2YJRA 3UIBA 2J0JA 3Q60A 3C0GA 3SRVA 1OVEA 4IB1A 4BTJA 2XKFA 3O96A 4GVJA 3VC4A 2E9OA 3A99A 4QTCA 3ZSGA 4G6LA 4E4XA 2I1MA 4O2ZA 4AP7A 4U6RA 5HE1A 2Y0AA 4G9RA 4QQ5A 3U6HA 2YM5A 4P5ZA 4OTIA 2B4SB 4G3FA 2ZM1A 3R9NA 4PNIA 2UZUE 2XKCA 1LEZA 3FZSA 3D7TB 4G31A 4O0UA 2ETKA 3KQ7A 3TJDA 4FA2A 1H25A 1WBOA 3EQGA 3ENMA 3NDMA 4Y5QA 2BIYA 2RIOA 4YJTA 4C4IA 2VTPA 1H8FA 4U45A 4A9YA 3Q32A 2RGPA 4M3QA 4E4MA 2ITYA 3DBQA 3QQFA 2WIPA 3IGGA 5A46A 2P3GX 2X7OA 3F2NA 4U9AA 1OM1A 1BMKA 3BU5A 3CGOA 1XH8A 2JBPA 5TT7A 4YU2A 2WMSA 2O3PA 3FLSA 4JG7A 3AC4A 5E8UA 5HTBA 3DAJA 3FE3A 4PDOA 3LE6A 1GIJA 4MYGA 5AX3A 1OIUA 3Q3BA 3QCSA 2PVYA 2UZLA 4O22A 3VUIA 2J9MA 4J1RA 4ENXA 2R3FA 2UZEA 5ETFA 3QQUA 3QUPA 4UWCA 3WF9A 4BCQA 3OUKA 4AW0A 3H30A 4I0SA 1APME 4D4RA 3OROA 4ZTNA 3KMUA 3UDBA 5A4QA 2C6EA 4NJ3A 4F6UA 3IG7A 4AW5A 1UU9A 3E3PA 3VBXA 1CTPE 5DHJA 1PHKA 2X2KA 5KMOA 4QMVA 1Z9XA 4DFZE 2BRBA 4R5SA 2BMCA 3TL8A 5GNKA 2UW6A 3EOCA 2JKOA 4O21A 2JAVA 3TIZA 4CV8A 4FSWA 4UMTA 4ZJJA 4DINA 5AA9A 5ITAA 4RJ6A 5CX9A 5EHYA 3ZRLA 4DEGA 5LOHA 4MKCA 3QBNA 2BAKA 4DN5A 4J71A 4BL1A 4NIFB 3RCDA 3HYHA 3GC0A 4NKSA 3U9NA 2YACA 3HUCA 1S9JA 3D7ZA 2C69A 3ORXA 4FK6A 4IX4A 4XUFA 4FIFA 2YIWA 4LYNA 4V0GB 3RZBA 1R0EA 3R7OA 4C4HA 1J1CA 1AQ1A 1H26A 1U46A 3NX8A 3NSZA 5IA3A 3F66A 5AM7A 4GG7A 4YNOA 1LPUA 5I9VA 5DG5A 1PKDA 4I6FA 4QMPA 3PWYA 4FTOA 3IECA 2O8YA 2QHMA 4L8MA 3LFDA 3DPKA 2E9NA 5AV4A 2WTKC 1XH7A 2G2FA 4XS2A 5AUVA 2XEZA 5CTPA 4PPCA 2CLXA 5ETIA 4RJ5A 4TW9A 4W4XA 5KMMA 4UBAA 4ASZA 3A4PA 2J0LA 3FXWA 3PPJA 4F0FA 1UKHA 2VTHA 2XIZA 5AUXA 2C3JA 3FI4A 1FVTA 3G5DA 2YFXA 5FXQA 2C3KA 3PIXA 5HQ0A 4D5HA 4S2ZA 1IEPA 2W9FB 4U3ZA 3NUNA 3DDQA 3W16A 3RINA 3EMGA 3SW7A 4TWPA 5IISA 3BYVA 4WG5A 3PSCA 4EH6A 3A62A 2X9FA 3OUNB 4N0SA 2F4JA 3QCYA 5H3QA 3E8DA 4PRJA 4M14A 5BQ0A 2YIXA 3DNEA 4O6EA 2PVLA 3FKOA 5CEMA 3QQGA 1P14A 3TKIA 3HRCA 2B7AA 2E9PA 4CFXA 1R3CA 4UEUA 5KHWA 3U6JA 3GP0A 5E90A 3HECA 1B39A 2R9SA 3TNQB 3NR9A 5F1ZA 3UPZA 4IAKA 2FVDA 4I22A 4MX9A 4AG8A 3K5VA 1RE8A 5E1EA 4GS6A 2RFSA 4GW8A 4M12A 4FKIA 1JQHA 3L9PA 3MH2A 4FC0A 2R3HA 2BZJA 3GOPA 4N6YA 1Q8ZA 3L9LA 4EH4A 3EIDA 5H8GA 3F9NA 4FTQA 1T46A 4UXQA 1W83A 3BCEA 2C5YA 2XYNA 3FY2A 1YRPA 4XRLA 4HVGA 4R6VA 3F3ZA 5E92A 2FA2A 4LRKA 1SMHA 5HIEA 3SKCA 3HDMA 5JRQA 4QP8A 4F9YA 1VR2A 1O6YA 1YI6A 3L9NA 4FZ7A 4BI0A 1ZZLA 3CKXA 2WQNA 5ACBC 3KFAA 5D1JA 3S4QA 3ACJA 4ENYA 5IG1A 1JOWB 4QP6A 3VJOA 2GNLA 4OW8A 3DBEA 3PG1A 3CY3A 4IQ6A 3MH3A 3PXYA 3BE2A 3FI3A 4QP7A 4XV3A 2OSCA 4Y85A 3H9FA 3NNUA 3H10A 4ZZMA 3BWJA 4F0IA 5IMEA 1JKTA 1QPDA 5K4IA 4MWHA 3B8RA 4S32A 1OITA 4NJDA 1OUYA 4W8EA 4E5AX 5HLNA 4QMSA 2X4ZA 2OIBA 4S30A 2R5TA 5F9EA 3DT1A 4HNFA 4HJOA 4WRSA 4D9UA 5C8MA 5JH6A 3F7WA 5LMKA 4WRGA 5CT0A 3UOHA 2ETMA 2WMBA 4UMQA 3AC8A 5CF8A 4QPMA 4G17A 4MBLA 4U80A 3PZEA 1MQBA 2WTIA 1U59A 2QG5A 1ZZ2A 4XOZA 5CVHA 5JGBA 1GZOA 4JDJA 4CZTA 3BYOA 3FMKA 3II5A 4ACHA 5I3RA 2OFVA 4IM0A 5AP0A 2RF9A 2JDSA 3QTRA 4X6QC 3PUPA 4L3PA 5JFVA 1JKKA 1XKKA 3A60A 3DOGA 2UW3A 4HCTA 1H24A 4JG6A 4C02A 4O0XA 3GQLA 3PRFA 5M4IA 5JFSA 4JRNA 2XNBA 3AOXA 4XJ0A 4XP0A 3LJ1A 4XX9A 3LW0A 4ID7A 3SVVA 2J0IA 3P1AA 1M17A 2OO8X 3BU3A 3SX9A 2CPKE 3ZU7A 3MWUA 1B38A 1Q24A 3MFTA 2VNWA 4KSQA 4IVDA 4WSQA 5EK7A 1BL6A 4DC2A 4UZHA 4D2SA 1Y57A 4DH8A 3R21A 1ZY4A 2W99B 2YJSA 3UNZA 4BTFA 1WAKA 5CU6A 5CSVA 3KXXA 5CZIA 5KKRC 4GT4A 4XEYA 3KULB 5CU4A 5BUIA 2W4OA 2JEDA 4GUEA 1F3MC 2WTWA 2BHEA 5AX9A 2I0HA 2YLEA 4Z55A 4O0YA 5LMKC 3E62A 4WD5A 2BRGA 4X2JA 3FPQA 5ANKA 2C6IA 4OBPA 5J9ZA 3MI9A 4IWOA 2PZ5A 3V3VA 2E9UA 4YPDA 1PY5A 3QXPA 5F94A 2J7TA 2G9XA 3I0OA 3N9XA 3GU7A 4BCFA 5BYZA 4TNDA 3C51A 2W1GA 3RM6A 2A2AA 1STCE 4G6NA 4FIJA 3OXZA 3ZO2A 4W4YA 4EH7A 3KXGA 2OXYA 1GAGA 3I6WA 4OBQA 5HZNA 4CQGA 3O8PA 2JITA 4FKSA 3P23A 4FT7A 4OR5A 3VULA 1M2QA 2XJ2A 3FQEA 2QOHA 3VHEA 5LWNA 5CAOA 2WU7A 1J3HA 5EOBA 1SNUA 4FG7A 2ITTA 1UNLA 2QURA 2X39A 3FL4A 4BDGA 3OOGA 2YDKA 2IVUA 5AP6A 4QP2A 5DWRA 2CGWA 3U8WA 2C68A 2HELA 5EYDA 2QCSA 4QT1A 4JIKA 3E5AA 5DN3A 3PIYA 4J8MA 1A06A 1M7QA 1YW2A 1CDKA 1H07A 1PMVA 3KRRA 4O38A 3P08A 5B7VA 2XNGA 3IQ7A 4RIWB 3R7IA 2C6LA 2WMWA 1WVYA 5BVEA 3JVSA 4GU6A 4C59A 4EH9A 2OICA 1TQMA 4F08A 4NFMA 1HCLA 2XRUA 3G0FA 3LJ0A 2Y6MA 5AR5A 3TZ9A 4XLIA 2XUUA 4TYIA 3TTIA 1KE7A 3Q52A 3PYYA 3RGFA 1O6LA 3OHTA 3MPMA 2W1ZA 2XM8A 4QMTA 4K18A 4CFNA 1Z57A 2W1EA 1PXJA 2RG6A 4M0YA 1MQ4A 2VTIA 3EFJA 3Q04A 5E8SA 3TNIA 2PMOX 2HWPA 4IAIA 3QWKA 4S33A 2PZPA 3QALE 4GFMA 3O7LD 4I5CA 3VS1A 4IANA 4K2RA 3ODZX 2JFLA 4WG3A 4LOQA 5M57A 3ZUTA 2XNNA 3ELJA 4QPSA 2X0GA 4IX6A 4IAZA 3W8QA 3R9HA 4ZLOA 3AD4A 1RW8A 4HGTA 3QZFA 5DLSA 3VF8A 3DDPA 2ONLA 4GFOA 2QU5A 4HZRA 2RKUA 4X7QA 2EXMA 5JK3A 5HE2A 1S9IA 5AR4A 2QOFA 3DKFA 4RGJA 4EUTA 2CGUA 2YEXA 2Y9QA 3QGWA 4DG0E 5FXSA 1YQJA 2OGVA 4ZTMA 4M68A 1K3AA 4AUAA 3LM5A 3F3VA 3FSFA 3DKGA 3Q4UA 2IO6A 3FLNC 3L8XA 4FTLA 4GH2A 2Y8OA 4ANBA 4WOVA 2Y4IB 5CU0A 5KMJA 5ANJA 1AGWA 1J1BA 1XQZA 4LV5A 1JSVA 3D5UA 4R1VA 4V04A 5ANOA 2EXCX 4A9TA 5IU2A 3UIXA 4UYNA 4U3YA 4JDIA 3V6RA 5AAGA 4HVHA 4OTGA 2R3PA 3BI6A 4FKPA 3UIMA 5FRIA 3LMGA 5IEYA 4ZZOA 3I5NA 4QTDA 4I6BA 3AGMA 4GVAA 4IZ7A 4TWOA 3WARA 2UZTA 2XK4A 3BQRA 1PXOA 4KIQA 3TJCA 4BIDA 5JEBA 2YAAA 2Z8CA 3QQJA 4DG2E 5F4NA 5GJFA 3U51A 3MFSA 4D0WA 2XIKA 4OTFA 4PWNA 3OW3A 3S3IA 1B6CB 4H36A 5A4CA 3LFBA 5HU9A 2DUVA 4EEVA 2JIUA 3OG7A 3QTQA 5IF1A 4LGHA 2BRMA 2YM6A 3RAHA 2YDJA 4A07A 4ACCA 2OU7A 4FKUA 2XCHA 3RAKA 3QD3A 2VUWA 2R3KA 3GQIA 1Y8GA 3UVQA 4XG4A 1QPEA 2IZRA 4BKJA 1U54A 4CFVA 1U5QA 4D2RA 1NXKA 4JQEA 4CRSA 3SOAA 4DH3A 4P2KA 4F70A 2X9EA 1XBBA 3NYVA 3DJ7A 4IW0A 1PXPA 1W82A 5CNOA 5AP2A 4ZTHA 3WYXA 4BDAA 4YR8A 3WI6A 2NRUA 3CD3A 3R28A 4RRVA 3QC9A 3R1QA 5EM8A 1Q3DA 3RJCA 3ULIA 5JSMA 4MXYA 5E1SA 3LPBA 5HCYA 3WIKA 2VD5A 3MY1A 3MSSA 3WF7A 5CEIA 3OY3A 4ALWA 1H1SA 4EZ7A 1L3RE 2BAJA 4ITJA 5CAQA 4DGOA 4LG4A 3L8SA 1P5EA 3QHWA 4IVAA 3PVUA 5I9YA 4ZSJA 3LCKA 2ZB0A 3E8CA 4W9XA 5D7AA 3BLHA 5FTQA 4KRDA 3BLRA 5BNJA 2C5XA 1ZYCA 3JPVA 5DR2A 1I44A 2GQGA 4QMXA 3R0TA 1OKYA 3C4EA 4F6WA 2HCKA 2H9VA 4HZSA 4JBQA 4YSMA 4D4SA 5CXZA 2JDRA 3FMHA 5LVNA 4OT6A 4MWIA 4C7TA 3KRWA 4HCUA 3CR0A 3R9OA 4YTFA 1VJYA 2IZSA 2PWLA 4WIHA 2F7EE 4I4FA 2YDIA 3MVMA 2QOLA 3KXNA 3W18A 4GU9A 3Q5IA 3QC4A 3DY7A 2XM9A 5AUYA 3ZEPA 3EN9A 4EYMA 4OLIA 3ZXTA 2PY3A 3D5VA 3O17A 4FTNA 2P33A 5HORA 4H3PA 4EK5A 3JY9A 3H4JA 4NSTA 2HXLA 2BR1A 3OT8A 3BGZA 4FODA 3EH9A 3E93A 3JXWA 4IDVA 2YCQA 2I0YA 2WFYA 3TKHA 3HX4A 3NZ0A 2C1AA 3I7CA 3F88A 4JBVA 2XNOA 3WE4A 1YXTA 1OIQA 3ANQA 3NUSA 3QD0A 3QTXA 4BDJA 5DRBA 4X3FB 3MTFA 3KK9A 3CE3A 3LFEA 4M84A 3U4UA 4NT4A 5IMXA 1J91A 3O23A 3BZ3A 2C3LA 1O9UA 2XP2A 3ODYX 4I0RA 3NIEA 2BCJA 2XIRA 4RWLA 1W84A 4D1SA 4E6AA 4Z3VA 4RX9A 2YISA 5K0XA 4GYIA 4A4XA 4FTMA 3TV6A 4RG0A 2CN5A 3GBZA 4QYFA 2O63A 3DBFA 4RPVA 3QUDA 4RVKA 3ROYA 3UC3A 4Y83A 3RPSA 3TN8A 3P4KA 5CALA 4E73A 1X8BA 1W98A 1ZMVA 3ALOA 3KVWA 4QP9A 4EC8A 1GJOA 4LM5A 4TT7A 5BVFA 4CVAA 2C0IA 5K4JA 1GNGA 1ZMWA 1ZOHA 4KBAA 1PYXA 3ZXZA 4CQEA 3BU6A 5CF5A 5JKGA 1P2AA 3Q9YA 2BAQA 4FV8A 4ANQA 4AT3A 1V0PA 1OUKA 3HA8A 5CEQA 5J9LA 3ZRMA 2F9GA 2HY81 4FYOA 4USDA 4RIXB 4MAOA 4TYHA 3FLQA 5H8BA 3QYWA 2ITQA 5EDRA 1MP8A 3KRLA 4ERWA 1ZOGA 1YOJA 4HYHA 4JNWA 4MXOA 4AU8A 2HZ4A 3EL7A 3GNIB 3PXKA 3FXZA 3FQHA 3VBYA 5CEOA 1OL5A 3G51A 5BVDA 1BYGA 1KE8A 2W5AA 4RBLA 2Y7JA 3W2RA 2B9IA 3FMMA 2VX0A 3ORTA 2CMWA 2R3JA 3NCZA 3FWQA 2YCSA 3TZMA 3Q6WA 1P4FA 2ZJWA 2HOGA 2V55A 4GV1A 4BDFA 4M15A 2VN9A 1OL1A 4QMMA 3ZO3A 5D9HA 2JAMA 3EQDA 4FR4A 1Q97A 4IVBA 3NUUA 4L7FA 4EQCA 4FKVA 4E26A 4FKQA 1Q8UA 2HW7A 3E7OA 1OIRA 4QYGA 1TKIA 2B9JA 2QODA 2W4KA 3BBTB 3UZTA 3EYHA 5C8KA 5EW8A 3GVUA 3BWFA 2E9VA 3WZUA 3QQLA 3RHKA 4F1OA 5LQFA 4TTHB 4RVTA 4FSMA 5G6VA 4ALUA 3ZSHA 3QKLA 5EFQA 3WOWA 5L6PA 3VF9A 1OPLA 3BGQA 4BZOA 4QMQA 1OPJA 1KE6A 2A0CX 3VNTA 4IE9A 4MD7E 4DH5A 3ZLXA 4J95A 1DI8A 3O50A 4HW7A 2FSMX 3QZHA 5B0XA 2QOQA 3PPZA 4UN0C 2JKKA 3ZTXA 4DCEA 4F7NA 2GHGA 2IW8A 2BFXA 4IX3A 4RA5A 2EVAA 4EOIA 1DAWA 1BLXA 2RSVA 4Y8DA 3CY2A 4O1PA 2HXQA 2X6EA 3HLLA 5FTOA 3SOCA 4IHPA 2EB2A 4BDDA 1IRKA 2XNMA 1W8CA 3T9TA 2BUJA 3Q9XA 4ZTSA 4OAUC 5A4TA 4L43A 4X2FA 1MRVA 3LXKA 4FSTA 3GC7A 3W8LA 4JS8A 3FHRA 2V5QA 4FSZA 4G16A 5AP7A 4JQ7A 4E1ZA 4EH5A 2I0EA 4RFMA 1DS5A 5EH0A 4V01A 3C7QA 3ENHA 4FTCA 2GTMA 2VTNA 3LAUA 4Q2AA 4RC2A 4C8BA 2OJIA 3KCKA 3MDYA 4DYMA 1F0QA 1YXXA 2C5NA 5EYMA 3ZLYA 5JGDA 4F99A 2JIIA 4J8NA 1KOAA 3L8PA 3NGAA 5DBXA 1IR3A 3K5UA 3PXFA 4IH8A 4FNWA 2GFCA 5DT3A 4D0XA 1Q99A 3LZBA 4FKOA 3HA6A 4RJ7A 3ZMMA 3DB6A 3D7TA 4WA9A 3E64A 2BZHB 2UW0A 4BVUA 4UWBA 4MD9E 1DAYA 4YZ9A 3DLSA 4N4SA 3VS0A 4C57A 3IW8A 4J96A 4O0SA 4YP8A 5TOZA 2HZIA 4DGNA 2OBJA 3FV8A 3LHJA 4FIEA 4YTCA 5FDPA 2YA9A 1WVWA 4R3PA 4C38A 1VEBA 5DNRA 4M13A 3WF5A 5KBRA 5J95A 1XBAA 2X7FA 2VO6A 5L4QA 3SA0A 3UOKA 3NUXA 2XYUA 3PJ2A 4Y5HA 1AD5A 5KE0A 2A27A 4YJOA 4EOSA 2C0TA 2FYSA 3LM0A 2VTLA 4UALA 2FH9A 4NCTA 4RA4A 3D14A 3PJCA 3T9IA 3JS2A 3DBCA 5H8EA 3MV5A 4QO9A 2IZUA 3P7AA 4FT5A 5CY3A 3UPXA 3S1HA 3AD5A 3ORNA 2NPQA 4NM3A 4ASDA 3I5ZA 4C37A 4DLIA 1WCCA 2R4BA 3LXPA 2QR7A 4APPA 1H1QA 5CAVA 4GRBA 2OG8A 3POOA 4KKEA 5GZAA 5IUIA 3A7JA 3DB8A 4H3QA 3SRVB 3FZTA 1FINA 3GU4A 4LRJA 3ORZA 3B2WA 4HYUA 4L46A 4F63A 2J6MA 4H1JA 3DK3A 3GCUA 4BIEA 3LCDA 3FYJX 3SQQA 5DPVA 2VWWA 1NVQA 5HIBA 3LFNA 3B2TA 5EOLA 3OY1A 5HTCA 2A4LA 2VX3A 1OZ1A 3E92A 3TIYA 2ZV7A 4X0MA 2AC5A 4CNHA 4V0GA 3UQGA 3OTUA 3EHAA 4FOBA 3HMOA 3GFWA 4M66A 2VWUA 4MXZA 1UA2A 3SW4A 4GK3A 3VQHA 2DYLA 2V22A 3KXZA 1R78A 4YZCA 3ZO1A 2YN8A 2W0JA 3PFQA 4RIYB 1T45A 4XMOA 4A9SA 4RC3A 5C01A 3FAAA 1OB3A 2ITUA 3HV3A 3PXRA 4NCTC 3U6IA 4KS7A 4KBCA 4NTSA 3O2MA 4GIIA 3W33A 1RDQE 3I81A 1YI4A 3AT3A 2W1HA 3QU0A 4FT3A 4X2NA 3RVGA 4DFLA 4ZZNA 5CSPA 2PE1A 4U43A 4RC4A 1Q61A 2OJGA 4CV9A 4RZVA 3ANRA 5C26A 4MQ2A 3UG2A 3GCSA 4FZDB 3R7UA 1H0VA 3LFQA 1MUOA 3WZKA 3L1SA 3QQHA 5CLPA 4EBWA 2FSOX 3HP5A 2JIVA 4AW2A 2XK3A 3EJ1A 4GT5A 4L3LA 2O0UA 4K0YA 3RM7A 4AQCA 3AXWA 3VS2A 3PLSA 3DK6A 2CDZA 4F0GA 3IK3A 3FJQE 2WMXA 4KINA 3VW6A 3PJ3A 4TRLA 3UZPA 3BQCA 5EYKA 4JR7A 4H58A 4YLLA 2JKQA 5J79A 3CJGA 1PMEA 3OVVA 4MK0A 2BZIB 4D4YA 1YOMA 4DAWA 4IAFA 2ZV8A 3GFEA 3BV3A 3A2CA 4PP7A 4RX5A 4CKRA 1E1XA 2OJFE 5HO6A 3GC8A 5DEWA 3GCVA 5LVOA 3E8NA 3HV4A 5J1VA 4LUDA 2GPHA 4WKQA 4QMOA 5EHOA 3QZIA 3WZDA 5JMSA 3Q9WA 3KU2A 5IA1A 3U9CA 3RK9A 4FNXA 2SRCA 4FTAA 2VWVA 4PMTA 3D2KA 3I1AA 4DEHA 3COIA 3F3TA 5J1WA 2OIQA 2WEIA 2W7XA 3OBJA 4BCJA 1OECA 4CD0A 2FSTX 2CCIA 2B52A 5J7HA 3CQEA 2R3QA 2QLUA 5DE2A 4BZDA 5EKNA 2HW6A 2C6TA 3DA6A 4EC9A 3KCFA 3L8VA 4CLJA 3AC5A 4ZTRA 1VZOA 2JDVA 2RFDA 1V0BA 1YXUA 3BGPA 3FUPA 4EQMA 2B53A 4L52A 4PMSA 2R0IA 4ASEA 2X6DA 4PDSA 4ZSAA 3ZH8A 1REKA 5BX0A 4Q5HA 4KKHA 3POZA 4ZTQA 1JKSA 3KF7A 5A3XA 4XV1A 1OKVA 3VBVA 3MA3A 4B6LA 4QQTA 5CASA 2Z2WA 4YZDA 4ARKA 2FO0A 4GT3A 2ERZE 2OZAA 3E63A 4CT1A 4J52A 2YITA 3QLGA 3OF0A 5FLFA 4EJNA 1JAMA 1BL7A 4CYIA 3G9LX 5I9XA 3MS9A 5KMKA 5AP5A 3BHHA 5AIKA 3SXFA 2VGOA 4FZAB 4EHZA 4D58A 1H28A 1PXMA 3IW7A 2HAKA 2UW9A 2W1CA 4BRXA 4JDKA 3FL5A 3LFFA 4XP3A 3OFMA 4JDHA 3DZQA 4KRCA 5J5TA 4YPSA 4NZWB 3MGYA 2X2LA 4MF0A 4V05A 3EN5A 4EHVA 4FL3A 5CI7A 2YM7A 5E91A 1YKRA 3VS7A 3DTWA 5A14A 4LGDA 4EI4A 4OTWA 2UV2A 4Y46A 3EWHA 4ZLZA 2YZAA 2JD5A 4O0RA 3RHXA 4Y95A 4BGQA 1XHAA 2GNFA 4NK9A 3WE8A 4ACMA 2HK5A 5KUPA 3P9JA 4U40A 2C6MA 4TY1A 2WQMA 3DAKA 4E4LA 1Y6BA 3C4FA 3EL8A 3MVJA 5AWMA 5CU3A 1OMWA 2BDFA 4YC6A 4FV0A 4PTEA 2C1BA 4IC8A 3ZDIA 1JPAA 2YABA 5GJDA 2G2HA 4WSYA 3QX4A 5H9BA 3RWQA 3F7ZA 3HGKA 3D5XA 3LVPA 1CKIA 2W4JA 3AMYA 4XRJA 3MY0A 4TYEA 2R0UA 2C0OA 4FKTA 2ITNA 2UUEA 3MH0A 4E5BA 4GYGA 4EOQA 1PJKA 1UVRA 4RWIA 4W9WA 4YJVA 4F9CA 5EM7A 2W96B 3C13A 3QHRA 4FV3A 3C4WA 3ZUVA 5L8JA 3FKNA 1BX6A 5AV2A 3OWPA 3UVRA 3D4QA 1ZAOA 2FSLX 4CTCA 3MJ1A 2UZNA 4QYEA 2WQEA 5C03A 5CS6A 2ZDUA 3TTJA 4I4EA 2VZ6A 4FTJA 2BTRA 3E7VA 3R00A 4RIOA 3ZLSA 1K9AA 4ACDA 4B8MA 2VWYA 3OT3A 4G6OA 3VRZA 2BTSA 5F95A 4ZK5A 1YHSA 4I23A 5HU3A 1TVOA 5JFXA 4R5YA 4II5A 1ZWSA 1BI7A 5CWZA 3DNDA 3KN5A 3D2IA 4O0WA 5GZ9A 3VUTA 3MB6A 4O2PA 4I24A 5IEVA 3M2WA 2WMAA 4C61A 2ZDTA 1SM2A 1SYKA 1WBVA 2ITVA 4H1MA 5KX8A 3ZBFA 4BGHA 4ZS0A 4EOJA 2PTKA 2WMUA 3VRYA 4F7LA 2IWIA 1SZMA 3UNJA 4UXLA 4A4OA 3GU6A 3OEZA 4J53A 4P90A 4F09A 3ZZEA 3KRJA 3WZJA 4I5HA 2XK9A 3O7LB 1QPCA 4Z9LA 4MNEA 2QQ7A 3R04A 2VO3A 2YM8A 4L42A 3C1XA 2R2PA 4OTDA 1OL6A 3CTJA 4L44A 4EOPA 5JQ5A 2PZRA 3A8XA 2RG5A 3EKNA 2WGJA 3OWJA 3PY0A 4RIWA 5DR9A 3MFUA 3DU8A 4RMZA 3UE4A 4L9IA 3EZVA 2UW4A 4DTKA 2C3IB 3ZC6A 5DA3A 3TXOA 3VS4A 3TACA 2QO2A 4E6QA 4C35A 4CCUA 1BI8A 3A4OX 4BCMA 2WTCA 3TI1A 4BTMA 3WF6A 5EI6A 3FMEA 3PTGA 3VAPA 5CVGA 1JSUA 2BPMA 3RZFA 5CF4A 3QRJA 3D9VA 4BBFA 2YIYA 5BVKA 3CEKA 3PVWA 3QCXA 4FUXA 3NNWA 4FV9A 4JG8A 3SV0A 2C5VA 2OJ9A 2WKMA 4OUCA 4CYJA 5A6NA 1JLUE 4NW5A 1UWJA 1WBPA 1IG1A 2VTAA 3QTWA 3R02A 3I0QA 4YBJA 1GOLA 2GFSA 5L2TA 3HMMA 3EQFA 1GIIA 3NEWA 2OWBA 4IJPA 4IWQA 3DJ6A 4L53A 4R8QA 5IA4A 3GU8A 4UWYA 5CSWA 3BYUA 3CIKA 4FF8A 3TZ7A 1NY3A 2FB8A 4IB5A 3A61A 1ZMUA 4IX5A 4QTAA 5I9WA 3Q53A 4YJSA 3PVBA 4F64A 4CKIA 2QKRA 2ERKA 2OFUA 4FG8A 1LUFA 1Y8YA 4XBUA 2YERA 4AN2A 4D1XA 2O5KA 2VTSA 3IDCA 3LXLA 4IZAA 4XHKB 1WBNA 3RI1A 3V5LA 3ZONA 2OKRA 4EHEA 5D12A 5FBNC 1ZLTA 4AOJA 3EKKA 2CGVA 2YM4A 3NLBA 2XB7A 2UVYA 4PDPA 3BV2A 4BIBA 3TWJA 2J50A 2C5OA 1QCFA 1OPKA 4AGUA 4CLIA 4CZUA 4JRVA 4PF4A 3S95A 4BCKA 2Z7SA 1KOBA 2WTVA 3TUCA 4L68A 4O6LA 2EU9A 1KV2A 2F49A 3UO6A 5L2SA 3RK5A 1JBPE 5LXMA 1Q8TA 2PUUA 3VQUA 2OXXA 2UVXA 3DXNA 4B4LA 4FTIA 4DGLC 1Y91A 3KEXA 4YNEA 3R7YA 1KE5A 2Y6OA 2BVAA 3OOMA 2C4GA 2ITOA 3CQUA 2ACXA 4FT0A 4LMNA 4WNKA 3UVPA 4A7CA 2IVTA 3HP2A 3PZHA 3ET7A 2WPAA 1U5RA 5DVRA 4PQNA 2V0DA 4LI5A 2IN6A 5HNIX 3DK7A 5CU2A 1OIYA 1YDSE 5KO1A 3KA0A 3I7BA 5AM6A 5FXRA 3C0IA 4XBRA 4DLJA 3FKLA 3Q5ZA 5GHVA 2XKEA 4AN9A 1REJA 2PMLX 3T3UA 2BROA 1V0OA 4QNYA 5HLPA 2OIDA 3HEGA 4TYJA 4BCGA 5KNJA 4UMPA 2W1IA 3AC1A 2V7AA 4I3ZA 2R7BA 3KRXA 3U87A 3VUGA 3FLZA 1H1WA 2UZWE 3F3UA 5I9ZA 2WU6A 4FKWA 3ZRKA 3CPBA 4QP1A 2J90A 4X2KA 1FGKA 3BYSA 3QD2B 4OTRA 4BYIA 2GHLA 2Y4IC 3CC6A 4MTAA 4FSUA 2WHBA 2OI4X 4AE6A 4ZAUA 5CEKA 2B55A 5CQWA 4WUAA 5I5ZA 5KMLA 1UV5A 1M52A 1YWVA 4IAAA 2XIYA 2CJMA 4RVMA 4M69B 2VTMA 1ZYJA 3C50A 5EW3A 4AZFA 5IUGA 5JZNA 4DGMA 2GS2A 2W06A 5ACKA 4K1BA 4HPTE 3LFAA 3RP9A 4IADA 4BCNA 2XJ0A 5CVFA 4J98A 5FQDC 3BYMA 3VUDA 4PMMA 3COKA 1FGIA 2OJJA 2QOCA 3P7CA 5HCXA 4F1TA 2XNPA 5HE0A 4NM0A 5E8YA 2CHLA 2XK6A 3CP9A 5LARA 4DITA 4K11A 3U4WA 4R3RA 4Y73A 5CSHA 5L2WA 1PXLA 2CGXA 4J97A 3PA5A 4CFUA 1BKXA 3BE9A 3KVXA 2P4IA 4BDHA 1KV1A 5AV1A 4RX7A 4HNIA 4QP3A 3QRTA 5AR3A 5HICA 4BDIA 3IO7A 3HNGA 2ZOQA 3E8EA 4GMYA 4JAJA 2ZM4A 3V8SA 4FX3A 2ZAZA 4A9RA 4AE9A 1CKJA 2WELA 3GENA 3WBLA 5LVPA 3MA6A 4D28A 1YDRE 3VO3A 1UWHA 4KIKA 4YGAA 4QPAA 1H27A 1OL7A 3E87A 5HVKA 4XYFA 3F5XA 4HVIA 3D0EA 2BIKB 2GDOA 2R3GA 3CGFA 5E8XA 4DFNA 4QMNA 4M8TA 3PA3A 3KB7A 1CKPA 4AN3A 4BDCA 4F7SA 3OWLA 4HYSA 2VAGA 3ZSIA 3OMVA 3G9NA 3QUEA 3QD4A 3Q6UA 4IIRA 5C27A 5J87A 5EM5A 3EQCA 2W5HA 4YJNA 5JGAA 3NWWA 4BCIA 1WBSA 4ANOA 3V5TA 3EQPA 5FG8A 3BBWA 3W2SA 3RBWA 4FBXA 4AZVA 3QCQA 2UZBA 2ESMA 2PL0A 4FT9A 3V8TA 5HBJA 5D7VA 4Z7GA 4EK3A 4CMOA 2VX1A 3HRFA 3IW4A 3PWDA 3ZFXA 3MVLA 2NO3A 3AQVA 3EQHA 3UTOA 4G1WA 4KIOA 4EYJA 5CAPA 4YO6A 4C3PA 5HLWA 5ANGA 4ERKA 5JT2A 3AT2A 4AT5A 4FIGA 4IJ9A 4KAOA 4YHFA 1WVXA 4B9DA 3MVHA 4D2PA 4WO5A 4FKGA 3SC1A 3VBQA 5E7RA 2PMNX 4WG4A 4AA0A 3NW6A 4O0TA 3G0EA 3PXZA 2AC3A 5J8IA 5DOSA 1M2RA 4BI2A 2YIRA 5HKMA 3WIGA 2VTOA 2C6OA 4ACGA 4YZNA 4WBOA 1PW2A 4AF3A 3FMNA 5LVMA 1YVJA 2J2IB 4C3RA 2UVZA 2YHVA 4JLCA 4BB4A 5M4FA 4QTBA 2QI8A 5D11A 3TUDA 4GUBA 4RSSA 4IEBA 5E8ZA 4W4WA 3LXNA 5HG7A 3TNPC 1E9HA 1KSWA 4FZFB 3CKWA 3O71A 2OK1A 3R6XA 4JXFA 3IONA 3DCVA 3KXMA 5BVWA 2XH5A 4ZIMA 5CENA 3H9RA 4EHGA 2O64A 4AZWA 4ZSLA 3R7EA 2H6DA 4DEAA 2PHKA 2ITPA 4NH1A 3BPRA 4IWPA 3PP1A 4TPTA 5DT4A 2GU8A 4GSBA 4XG2A 1ZYLA 2J0KA 3Q4ZA 3R73A 3O8TA 4HGSA 4NKAA 5EI8A 4ZOGA 4YSJA 4PV0A 4PMPA 5HTIA 5I4NA 4GK2A 1LEWA 4TL0A 4FSRA 1XH6A 4AT4A 2QOKA 5TR6A 4U7ZA 2JDOA 1FPUA 2YM3A 2WO6A 4YUQA 1LP4A 2GHMA 4EOMA 1UNHA 4TYHB 5L6WL 3UO5A 3UP7A 2ETRA 5AMNA 3HKOA 4EOLA 4KD1A 3M11A 3QA0A 3FLWA 5DGZA 2VU3A 3MJ2A 1UU7A 3H9OA 4XV2A 1K2PA 4O1OA 3RTPA 3NUYA 2XF0A 4NEUA 3PG3A 2PVNA 5HNBA 2WNTA 4KB8A 4A4LA 2G15A 3F3WA 4LRMA 4E93A 2WQOA 2BKZA 1RQQA 2C30A 2UW7A 4FI1A 3NIZA 3C9WA 3BX5A 4YC8A 2XBJA 3BHUA 4RVLA 3DFAA 4Q5EA 4AAAA 5AADA 4EOOA 4C36A 2WOUA 4USEA 5K3YA 4IFGA 3W32A 2V7OA 2X2MA 3NYXA 4UV0A 4G3GA 2A19B 3IS5A 5EI2A 3OTVA 4D2WA 2BILB 1XR1A 2F57A 3PSBA 4EWQA 3FY0A 4CSVA 3SXRA 4QMYA 3ACKA 1XJDA 5HNGA 4I6HA 2R3NA 4I92A 5B2MA 3AC3A 3MTLA 3RPRA 4CFMA 5B2KA 1GY3A 3GU5A 2QHNA 5A6OA 4AOTA 4D1ZA 5HBHA 2XCKA 4AOIA 3NW7A 3H3CA 3KY2A 4I0TA 5IA2A 4GJ2A 5L2QA 3VUMA 4UMUA 3ZC5A 4YZMA 3BHVA 1H0WA 3T8OA 4B7TA 3UC4A 3DJ5A 2W5BA 3TT0A 4E4NA 3K54A 3PY3A 4QYHA 3QTIA 3TNHA 3VUHA 2ZMDA 3I6UA 3OCBA 4MXXA 3WILA 4ITIA 4HGEA 4BGGA 2Z60A 3DGKA 2XZSA 3QA8A 3GI3A 1ZRZA 2P2IA 3EQRA 2C6DA 4IACA 4GG5A 1IA8A 5HVYA 3AMBA 2X8IA 2W1DA 3P0MA 4FVRA 2XA4A 2PVJA 3GB2A 3P7BA 4CFWA 3JY0A 5FM2A 3EQIA 4FKRA 1SVEA 4IZYA 4PPBA 3UO4A 4DGGA 3DFCB 3PRIA 3DQWA 4C4EA 3R63A 1Z5MA 5FP6A 4KA3A 2WXVA 5BVNA 3LQ5A 4JBPA 4OTHA 5FBOA 4BI1A 2PVMA 2R3LA 4FTUA 1H4LA 5KZIA 3FMLA 3UMXA 5GJGA 3R83A 3V01A 3F6XA 3LIJA 4PX6A 3UIUA 5HESA 4YURA 4NW6A 5EYCA 3HV6A 3A7FA 3DV3A 4FTKA 2XK7A 5AV3A 3TZ8A 3SDJA 4PUZA 4X3JA 4PTCA 2CSNA 3UQCA 4DG3E 5M56A 1GIHA 1YDTE 4MQ1A 1Q4LA 3WZEA 1ATPE 3KXHA 2X4FA 4NWMA 4RFYA 1TQPA 4BICA 5C1QB 1PKGA 1YWRA 4FL1A 3A7IA 3F61A 3QRUA 2OZOA 4WBBB 3SLSA 3R1YA 3CTHA 3MPTA 3HZTA 4FV7A 4NM7A 4TNBA 4UB7A 4UY9A 4J7BA 2GNIA 5ANIA 3ZEWA 4E3CA 5B2LA 1DI9A 1TQIA 2P55A 4WNOA 4XH6A 4NIFA 1JVPP 1UU8A 3ORIA 4L6QA 2F2CB 4RIYA 4GFGA 3ULZA 5CAUA 5KBQA 2GSFA 4BWXA 2GMXA 4ZTLA 3V5QA 4QD6A 4IB0A 4M97A 2A1AB 4U5JA 2Q0NA 2YIQA 3NCGA 1Q62A 4KIPA 3GCPA 3T3VA 1ERKA 3A7GA 3PJ1A 4YLKA 5CI6A 3G90X 3DAEA 4WHZA 4HVDA 3VVHA 3PIZA 2OH0E 3RAWA 5HG5A 3V5JA 5EDPA 4XOYA 4AA4A 1O6KA 2WZJA 3PE1A 3MH1A 3RKBA 3QF9A 4TWCA 1KWPA 5HX8A 2W9ZB 1JSTA 4FV6A 5TF9A 4ZJIA 5A4LA 4OGRA 4JX3A 3MW1A 2WTKB 3NNXA 2QD9A 3EFWA 4YC3A 1G5SA 4OTPA 5EKOA 5CYIA 1YWNA 5BUEA 2G1TA 2HYYA 4QNAA 1XBCA 4M7IA 2OXDA 4FNZA 3MN3A 2WIHA 3CXWA 5AR2A 4FVPA 2OH4A 2R64A 3O8UA 3ZZWA 4XLVA 4AGWA 5DMZA 3G6GA 3VBTA 1URWA 3QTSA 2WB8A 3KF4A 4AGDA 3UOLA 4XCUA 5FM3A 5M4CA 2W1FA 3MYGA 2PVFA 4BF2A 5IUHA 5D10A 2R3MA 1ZOEA 2HZNA 4JX7A 3FZRA 4Q9ZA 3GEQA 2XNEA 4G9CA 3R8ZA 3RCJA 5CF6A 3JUHA 3EN6A 3NRMA 2EWAA 4K77A 4I5MA 2X1NA 5L6OA 3M1SA 2ZYBA 1WZYA 4UYAA 5IA5A 2G01A 1VYWA 2QOOA 3LCTA 5FEDA 5IEXA 4YO4A 3AGLA 4GIHA 1H08A 5HE3A 3P86A 1FVRA 4ZLYA 5AIRA 3W2PA 4O91A 4RJ8A 4QQCA 4L00A 4ALVA 4GL9A 4NU1A 2BRNA 4KS8A 3LCSA 4UMRA 5AUUA 1V1KA 3D5WA 5HEZA 3VJNA 3M42A 4BDBA 3CLYA 2Z7QA 2PZYA 5T68A 4AZSA 5CT7A 3Q4TA 3NYNA 4HOKA 4LL0A 4EH3A 3A8WA 3GCQA 5AUTA 4ASXA 4IFCA 4W4VA 3W55A 5C8NA 4NFNA 3CPCA 3HV7A 4EH8A 1QL6A 2LGCA 3RMFA 4MHAA 3COHA 3AC2A 2QC6A 2QU6A 4BN1A 4A06A 2DWBA 5AP1A 5IZFA 3QKKA 4C33A 1FOTA 2YCFA 3UBDA 3ZBXA 3ORLA 4AFEA 3R1NA 1GZ8A 2UW8A 2X8DA 5T3QA 4MXAA 4YJQA 2REIA 3IGOA 2ITWA 1FMOE 5DH3A 1Q3WA 5I0BA 3DZOA 3FZPA 1UNGA 3BEAA 5LWMA 3I79A 3OS3A 4R3CA 4KBKA 4BWPA 3QQKA 1PMUA 3PXQA 4D2VA 4O27B 4AFJA 3RALA 4RX8A 3NNVA 2IW9A 3RPVA 1HOWA 3V04A 4F9BA 2WTJA 4HPUE 3W2CA 2QO9A 3AD6A 1URCA 1MRUA 3L9MA 2YWPA 2JBOA 4FSNA 3MBLA 1R39A 5CNNA 4PL4A 2H8HA 4PNKA 1W7HA 3OW4A 2QONA 2V62A 3ZM4A 3NYOA 3QAME 2C6KA 1XO2B 3QRKA 4PL5A 4FL2A 2UW5A 4Z7HA 5KMNA 5M51A 1QPJA 3R7GA 2DS1A 3IW5A 4RJ3A 3UODA 3R8UA 5G1XA 3ZYAA 4EKLA 4EONA 1PYEA 3FXXA 3NPCA 4ZSGA 2KTYA 4O96A 4EOKA 4FOCA 1YHVA 3G6HA 1MRYA 4H39A 2PK9A 1SVGA 2IVSA 3SXSA 2IVVA 2EB3A 3R2YA 1PXIA 4IM2A 2OZAB 3TKUA 4C4GA 3KKVA 3OP5A 4G3DA 4IZ5A 3TCPA 5EHLA 4QRCA 3K2LA 3EZRA 4B99A 3ZFMA 4JI9A 4F4PA 2Q0BA 4OBOA 3BRBA 4U44A 1JKLA 3F2AA 3EYGA 5E8TA 1OL2A 2YCRA 5K9IA 4D55A 4NUSA 2EXEA 2JC6A 4MVFA 4AXAA 4GCJA 2X81A 5LVLA 2O2UA 4E7WA 3GXLA 3RNIA 4MXCA 3LFSA 4FSQA 1ZY5A 5A9UA 4AW1A 3UQFA 4MBJA 4I5PA 3WYYA 1WFCA 3ORPA 4IB3A 3RWPA 5IDNA 3KULA 3OXIA 3QLFA 2W05A 5HGIA 2GNJA 2VTJA 2XS0A 3QL8A 4M0ZA 3S0OA 3AG9A 4KKGA 3LJ2A 5DEYA 4DH1A 5KKRB 4X21A 1XH4A 2R3IA 4U0IA 4OAVB 4XG6A 4EUUA 2VTRA 2I0VA 3ETAA 1QMZA 3BKBA 3CBLA 5DIAA 3E88A 4EK8A 1I09A 3BEGA 4FNYA 2R3RA 4RJ4A 3F69A 3MY5A 4BCOA 5GZ8A 4GJ3A 2J0MB 5LCKA 3VIDA 5I3OA 2WMRA 4E5WA 5J7BA 5L8LA 3ALNA 3LCOA 5LJJA 4ZEGA 3S00A 4LMUA 4R7IA 1PF8A 1FMKA 2B1PA 3NAXA 2QOIA 3KL8A 3E3BX 2CN8A 4MCVA 5FWKK 4J99A 1NVSA 1H1PA 4WNMA 5HD4A 2PVRA 4YLJA 1GZKA 3BHYA 4X6RA 3FQSA 4U79A 5HI2A 4BBEA 2HY0A 4RT7A 5IKWA 1M7NA 3VS6A 5L8KA 5AP3A 4HGLA 5DFPA 3FMDA 4C4FA 1Y6AA 4MD8E 4XG8A 2HZ0A 3OXTA 4U81A 5FP5A 5M55A 3PJ8A 4G3EA 4BYJA 4TXCA 5BMMA 3GGFA 5TO8A 4LUEA 3TG1A 3R9DA 1KE9A 4IXPA 1ZARA 2DQ7X 2PE0A 4XNEA 4YJRA 4G5JA 3ERKA 3FZ1A 4ITHA 4D4VA 3EFKA 2VTQA 4D2TA 2WAJA 4C2VA 5CXHA 1ZYDA 3CCNA 2PVHA 4DEDA 3LFCA 4LFIA 4I21A 4K9YA 5HHWA 2Y4PA 3QRIA 3W2QA 1WBWA 5CEPA 3TV4A 3GT8A 3R30A 2XK8A 2R3OA 5AJQA 5L3AA 3I60A 3RPOA 5IH4A 5JZJA 1ZXEA 3ITZA 3PY1A 3R22A 4IMYA 4D9TA 4PTGA 4RZWA 2UZVA 4KNBA 4U42A 1PXKA 3KN6A 3KMWA 2JDTA 4CMTA 3DQXA 4PP9A 5EG3A 3ORKA 3CD8A 2P0CA 4I41A 1SVHA 2WEVA 5K5XA 5KCVA 3BIZA 1WMKA 4KWPA 4BHZA 5AV0A 3P5KA 4ZP5A 1Q5KA 4E20A 3CQWA 1CSNA 2FUMA 2G2IA 3PPKA 4FIIA 3VN9A 2H96A 3MFRA 3D15A 1PXNA 3JVRA 5M44A 5BPYA 2ZVAA 1M14A 4WUNA 4QMUA 4FZ6A 1YI3A 4MNEB 3W10A 5BVOA 2X7GA 3BHTA 1PMNA 2ZV9A 2BFYA 2GCDA 2BHHA 3OD6X 5DR6A 3V5WA 5BMSA 2J4ZA 4TWNA 3R8PA 5CANA 2CKEA 2F7XE 3LOKA 1OKZA 2BZKB 4FKJA 5BUJA 5LCJA 3GOKA 2PMIA 4FVQA 4L3JA 3UOJA 3P79A 4IBMA 5HO8A 3EFLA 3D83A 3BELA 4BFMA 2QKWB 3TV7A 3QTUA 5IDPA 1YXSA 4ZXTA 3ZHPC 2GS6A 3VS5A 3OBGA 4CFFA 5HG9A 3QYZA 3NAYA 1JNKA 1OKWA 1SNXA 4ONAA 3R8LA 1W0XC 3COMA 2WQBA 3QKMA 4A9UA 3FC1X 3QWJA 4M67A 4APCA 4CCBA 4EK6A 4CXAA 4AGCA 1DM2A 5F20A 5M53A 3CTQA 5I9UA 3V51A 3UP2A 3Q96A 2JFMA 4EWHA 4UX9A 4XG7A 4WNPA 4EZ3A 2NRYA 3W2OA 3K3IA 4S31A 4FTRA 2HIWA 3A7HA 4LGGA 4JJRA 3R71A 4IM3A 3JYAA 2XEYA 4BBMA 3NW5A 4FV2A 4EZ5A 4LOOA 2H34A 4C0TA 4U41A 3FHIA 2F7ZE 4FV1A 4ANLA 5HX6A 3ROCA 3R01A 5HOAA 1G3NA 4I1ZA 5J5SA 4F6SA 5HO7A 2ITXA 3NS9A 3ZS5A 4MNFA 3HMIA 4AZEA 1H1RA 2I6LA 3DS6A 4L45A 1FVVA 5AUZA 3FC2A 3THBA 4F7JA 4YJUA 3UYSA 4M69A 4ZY6A 3TNWA 3ZCLA 5CQUA 5KHXA 4CKJA 4LV8A 4QYYA 3VUKA 1BUHA 4OT5A 4U8ZA 5ETCA 2ZM3A 3SAYA 4DH7A 1R1WA 4QQJA 2QVSE 4QMLA 4N70A 4DEIA 3HMPA 2CCHA 4UZDA 4S34A 4C34A 5ICPA 2VGPA 4C2WA 5JFWA 4P4CA 5DRDA 3PE2A 5FD2A 3C4CA 3UYTA 2VV9A 2WTDA 3FYKX 4EBVA 4XG9A 1CMKE 2XBAA 4IVCA 5HG8A 3Q4CA 2OW3A 5J9YA 4ZY4A 4GK4A 2VWBA 2ONLC 1UKIA 4MH7A 4FV5A 5T6KA 3VHKA 4QOXA 4I6QA 4X2GA 5IH6A 3F5UA 5IPJA 5AA8A 4O0VA 4RWKA 3KMMA 3OCGA 1ZYSA 4C62A 2QOBA 4FIHA 3G2FA 3AT4A 3OZ6A 3N51A 4FTTA 4TN6A 4LOPA 3FZOA 3IDPA 5JRSA 3MIAA 4USFA 4I20A 5AR7A 1JWHA 4N6ZA 4C58A 3PVGA 1U54B 2BDWA 3H0YA 4F9AA 5AEPA 4JT3A 4Q9SA 5CZHA 4H3BA 4FKLA 1UU3A 2P2HA 3DLZA 2JKMA 1EH4A 2QLQA 1WBTA 5ETAA 2FGIA 3EB0A 2LAVA 1A9UA 1IASA 4FGBA 4YBKA 2UZOA 5AAEA 4X3FA 5HD7A 3KK8A 3S2PA 3MPAA 2IJMA 4JAIA 2BRHA 2EUFB 4FICA 4BHNA 4G2FA 4TKSA 4E8AA 4G5PA 5LMBA 3PA4A 2BDJA 3PP0A 5FGKA 3CS9A 4YHTA 3TUBA 1CM8A 1RJBA 2WMVA 4RQKA 4W8DA 4AX8A 4JR3A 5E8WA 2ZV2A 4RLKA 4I93A 3V8WA 3Q9ZA 2PE2A 3C0HA 2J5EA 4Y72A 3IDBA 5ANEA 4BKYA 2UZDA 4JL9A 4KSPA 3O0GA 3HRBA 3ZO4A 5LMAA 1Q41A 5ANDA 3R7VA 1H00A 2WOTA 3DBDA 5DI1A 3DKCA 4XP2A 4MEDA 2C47A 4JVGA 4F1MA 1YOLA 4D5KA 4HCVA 4C3FA 3QX2A 2XMYA 4BDKA 4U97A 4EK4A 2QR8A 5HVJA 5FEEA 2HWOA 3EN7A 3RAIA 2XIXA 2WMQA 4F65A 2AUHA 4RIXA 4LL5A 3ZDUA 3FMJA 4C4JA 2RFEA 3MIYA 4FYNA 4KIKB 3OCSA 5C9CA 3FPMA 2OF4A 3R8MA 4AWIA 4IDTA 3QTZA 3FBVA 3KGAA 3AMAA 4RLLA 2ZB1A 4Z16A 5TKDA 4NTTA 4EL9A 4KABA 3UNKA 1XWSA 2RFNA 4X3FC 3C4ZA 2HENA 3BLQA 3W1FA 4DBNA 4IC7A 4CTBA 4DFXE 4CEGA 3FSKA 4QP4A 4TYGA 5EM6A 4EKKA 3UMWA 2JGZA 2F2UA 2B9HA 3DTCA 4B0GA 3QXOA 4K8AA 2VRXA 1NA7A 3FI2A 2ITZA 2R7IA 4FSYA 1YHWA 3VBWA 4MBIA 4ZY5A 3OEFX 4TZRA 2X8EA 4P7EA 4L01A 4F9WA 4NM5A 4FG9A 3TEIA 4R7HA 3REPA 4AZTA 2BALA 3EQBA 3HL7A 2GNGA 3CJFA 5KMIA 3IKAA 1M2PA 3HMNA 3HUBA 4PY1A 4K6ZA 4E6CA 3VWAA 4BZNA 4RFZA 2B54A 4IWDA 1Q8WA 3UGCA 4DFYA 3R2BA 2WD1A 2B9FA 4JOAA 2GS7A 5HIDA 2PZIA 4ZJVA 3IOKA 5AAFA 2VO0A 3DKOA 3LQ8A 3OCTA 2VNYA 2J51A 1GZNA 3C5UA 3QZGA 3VW8A 4FMQA 4FK3A 3ZLWA 5HBEA 3WF8A 4YJPA 5D41A 4JQ8A 2XJ1A 3IOPA 4LQMA 3F5GA 4BC6A 2ZMCA 1NVRA 3ZOSA 3QFVA 5K5NA 2VWZA 3GC9A 4PL3A 3RK7A 2VWXA 5IA0A 3IW6A 4QTEA 2WMTA 1OI9A 3FLYA 4YZBA 5AR8A 4YTIA 4BWKA 2IZTA 2XKDA 2XRWA 1P4OA 4R1YA 3UJGA 1E1VA 1U4DA 3F5PA 3RPYA 5CSXA 4DEEA 4HVSA 5BYYA 3F82A 4ANSA 2IW6A 4QMWA 4EH2A 3GUBA 3QGYA 3ORMA 2VWIA 3HVCA 5L2IA 4CMUA 4GEOA 3D94A 3G33A 2RL5A 3VS3A 4L67A 4AS0A 4CT2A 4YTHA 3KC3A 1H01A 3V6SA 2Z7LA 4OTQA 3R1SA 4PPAA 2PVKA 4YHJA 4DEBA 3V5PA 1XH5A 3MB7A 4CZYB 2GTNA 2NP8A 3ZUUA 3OC1A 4MF1A 3Q2MA 5A54A 5EDQA 5K0KA 3P78A 4AA5A 5AP4A 4BCHA 4L7SA 4I94A 2GNHA 4IAYA 4EORA 5AUWA 4ZSEA 4RQVA 5H2UA 2YLFA 4K33A 5JQ8A 3HDNA 4BDEA 4JBOA 4YMJA 2CLQA 5FEQA 3LLTA 2Z7RA 5JN2A 3IPHA 3FDNA 4P5QA 4G3CA 4BTKA 5IH5A 4RWJA 2PSQA 4FV4A 3I4BA 3OWKA 5DT0A 4CRLA 4E6DA 4ANMA 4G34A 4B8LA 2XVDA 1VYZA 4JIAA 1XH9A 2YAKA 4XV9A 2O65A 2QO7A 2OF2A 4DHFA 3RNYA 2AYPA 3UG1A 1Q8YA 5FDXA 2KULA
chains in the Genus database with same CATH superfamily
1LR4A 4ANNA 4HYIA 4FUYA 3EN4A 4EQUA 3K3JA 3O51A 2QNJA 1OGUA 3NUPA 5TE0A 2VTTA 4FEQA 2W17A 5M4UA 2J5FA 3HV5A 5HCZA 1F5QA 5KZ0A 1YXVA 4QMZA 4WT6A 4BCPA 1HCKA 1R0PA 2I40A 2JLDA 2VO7A 3C4XA 3PSDA 3SD0A 3R8VA 3ZFYA 4AACA 4XG3A 4BKZA 1FQ1B 3H0ZA 5A4EA 2E2BA 5E8VA 3B8QA 3SHEA 5EW9A 2YJRA 3UIBA 2J0JA 3Q60A 3C0GA 3SRVA 1OVEA 4IB1A 4BTJA 2XKFA 3O96A 4GVJA 3VC4A 2E9OA 3A99A 4QTCA 3ZSGA 4G6LA 4E4XA 2I1MA 4O2ZA 4AP7A 4U6RA 5HE1A 2Y0AA 4G9RA 4QQ5A 3U6HA 2YM5A 4P5ZA 4OTIA 2B4SB 4G3FA 2ZM1A 3R9NA 4PNIA 2UZUE 2XKCA 1LEZA 3FZSA 3D7TB 4G31A 4O0UA 2ETKA 3KQ7A 3TJDA 4FA2A 1H25A 1WBOA 3EQGA 3ENMA 3NDMA 4Y5QA 2BIYA 2RIOA 4YJTA 4C4IA 2VTPA 1H8FA 4U45A 4A9YA 3Q32A 2RGPA 4M3QA 4E4MA 2ITYA 3DBQA 3QQFA 2WIPA 3IGGA 5A46A 2P3GX 2X7OA 3F2NA 4U9AA 1OM1A 1BMKA 3BU5A 3CGOA 1XH8A 2JBPA 5TT7A 4YU2A 2WMSA 2O3PA 3FLSA 4JG7A 3AC4A 5E8UA 5HTBA 3DAJA 3FE3A 4PDOA 3LE6A 1GIJA 4MYGA 5AX3A 1OIUA 3Q3BA 3QCSA 2PVYA 2UZLA 4O22A 3VUIA 2J9MA 4J1RA 4ENXA 2R3FA 2UZEA 5ETFA 3QQUA 3QUPA 4UWCA 3WF9A 4BCQA 3OUKA 4AW0A 3H30A 4I0SA 1APME 4D4RA 3OROA 4ZTNA 3KMUA 3UDBA 5A4QA 2C6EA 4NJ3A 4F6UA 3IG7A 4AW5A 1UU9A 3E3PA 3VBXA 1CTPE 5DHJA 1PHKA 2X2KA 5KMOA 4QMVA 1Z9XA 4DFZE 2BRBA 4R5SA 2BMCA 3TL8A 5GNKA 2UW6A 3EOCA 2JKOA 4O21A 2JAVA 3TIZA 4CV8A 4FSWA 4UMTA 4ZJJA 4DINA 5AA9A 5ITAA 4RJ6A 5CX9A 5EHYA 3ZRLA 4DEGA 5LOHA 4MKCA 3QBNA 2BAKA 4DN5A 4J71A 4BL1A 4NIFB 3RCDA 3HYHA 3GC0A 4NKSA 3U9NA 2YACA 3HUCA 1S9JA 3D7ZA 2C69A 3ORXA 4FK6A 4IX4A 4XUFA 4FIFA 2YIWA 4LYNA 4V0GB 3RZBA 1R0EA 3R7OA 4C4HA 1J1CA 1AQ1A 1H26A 1U46A 3NX8A 3NSZA 5IA3A 3F66A 5AM7A 4GG7A 4YNOA 1LPUA 5I9VA 5DG5A 1PKDA 4I6FA 4QMPA 3PWYA 4FTOA 3IECA 2O8YA 2QHMA 4L8MA 3LFDA 3DPKA 2E9NA 5AV4A 2WTKC 1XH7A 2G2FA 4XS2A 5AUVA 2XEZA 5CTPA 4PPCA 2CLXA 5ETIA 4RJ5A 4TW9A 4W4XA 5KMMA 4UBAA 4ASZA 3A4PA 2J0LA 3FXWA 3PPJA 4F0FA 1UKHA 2VTHA 2XIZA 5AUXA 2C3JA 3FI4A 1FVTA 3G5DA 2YFXA 5FXQA 2C3KA 3PIXA 5HQ0A 4D5HA 4S2ZA 1IEPA 2W9FB 4U3ZA 3NUNA 3DDQA 3W16A 3RINA 3EMGA 3SW7A 4TWPA 5IISA 3BYVA 4WG5A 3PSCA 4EH6A 3A62A 2X9FA 3OUNB 4N0SA 2F4JA 3QCYA 5H3QA 3E8DA 4PRJA 4M14A 5BQ0A 2YIXA 3DNEA 4O6EA 2PVLA 3FKOA 5CEMA 3QQGA 1P14A 3TKIA 3HRCA 2B7AA 2E9PA 4CFXA 1R3CA 4UEUA 5KHWA 3U6JA 3GP0A 5E90A 3HECA 1B39A 2R9SA 3TNQB 3NR9A 5F1ZA 3UPZA 4IAKA 2FVDA 4I22A 4MX9A 4AG8A 3K5VA 1RE8A 5E1EA 4GS6A 2RFSA 4GW8A 4M12A 4FKIA 1JQHA 3L9PA 3MH2A 4FC0A 2R3HA 2BZJA 3GOPA 4N6YA 1Q8ZA 3L9LA 4EH4A 3EIDA 5H8GA 3F9NA 4FTQA 1T46A 4UXQA 1W83A 3BCEA 2C5YA 2XYNA 3FY2A 1YRPA 4XRLA 4HVGA 4R6VA 3F3ZA 5E92A 2FA2A 4LRKA 1SMHA 5HIEA 3SKCA 3HDMA 5JRQA 4QP8A 4F9YA 1VR2A 1O6YA 1YI6A 3L9NA 4FZ7A 4BI0A 1ZZLA 3CKXA 2WQNA 5ACBC 3KFAA 5D1JA 3S4QA 3ACJA 4ENYA 5IG1A 1JOWB 4QP6A 3VJOA 2GNLA 4OW8A 3DBEA 1W2CA 3PG1A 3CY3A 4IQ6A 3MH3A 3PXYA 3BE2A 3FI3A 4QP7A 4XV3A 2OSCA 4Y85A 3H9FA 3NNUA 3H10A 4ZZMA 3BWJA 4F0IA 5IMEA 1JKTA 1QPDA 5K4IA 4MWHA 3B8RA 4S32A 1OITA 4NJDA 1OUYA 4W8EA 4E5AX 5HLNA 4QMSA 2X4ZA 2OIBA 4S30A 2R5TA 5F9EA 3DT1A 4HNFA 4HJOA 4WRSA 4D9UA 5C8MA 5JH6A 3F7WA 5LMKA 4WRGA 5CT0A 3UOHA 2ETMA 2WMBA 4UMQA 3AC8A 5CF8A 4QPMA 4G17A 4MBLA 2AQXA 4U80A 3PZEA 1MQBA 2WTIA 4O4DA 1U59A 2QG5A 1ZZ2A 4XOZA 5CVHA 5JGBA 1GZOA 4JDJA 4CZTA 3BYOA 3FMKA 3II5A 4ACHA 5I3RA 2OFVA 4IM0A 5AP0A 2RF9A 2JDSA 3QTRA 4X6QC 3PUPA 4L3PA 5JFVA 1JKKA 1XKKA 3A60A 3DOGA 2UW3A 4HCTA 1H24A 4JG6A 4C02A 4O0XA 3GQLA 3PRFA 5M4IA 5JFSA 4JRNA 2XNBA 3AOXA 4XJ0A 4XP0A 3LJ1A 4XX9A 3LW0A 4ID7A 3SVVA 2J0IA 3P1AA 1M17A 2OO8X 3BU3A 3SX9A 2CPKE 3ZU7A 3MWUA 1B38A 1Q24A 3MFTA 2VNWA 4KSQA 4IVDA 4WSQA 5EK7A 1BL6A 4DC2A 4UZHA 4D2SA 1Y57A 4DH8A 3R21A 1ZY4A 2W99B 2YJSA 3UNZA 4BTFA 1WAKA 5CU6A 5CSVA 3KXXA 4O4CA 5CZIA 5KKRC 4GT4A 4XEYA 3KULB 5CU4A 5BUIA 2W4OA 2JEDA 4GUEA 1F3MC 2WTWA 2BHEA 5AX9A 2I0HA 2YLEA 4Z55A 4O0YA 5LMKC 3E62A 4WD5A 2BRGA 4X2JA 3FPQA 5ANKA 2C6IA 4OBPA 5J9ZA 3MI9A 4IWOA 2PZ5A 3V3VA 2E9UA 4YPDA 1PY5A 3QXPA 5F94A 2J7TA 2G9XA 3I0OA 3N9XA 3GU7A 4BCFA 5BYZA 4TNDA 3C51A 2W1GA 3RM6A 2A2AA 1STCE 4G6NA 4FIJA 3OXZA 3ZO2A 4W4YA 4EH7A 3KXGA 2OXYA 1GAGA 3I6WA 4OBQA 5HZNA 4CQGA 3O8PA 2JITA 4FKSA 3P23A 4FT7A 4OR5A 3VULA 1M2QA 2XJ2A 3FQEA 2QOHA 3VHEA 5LWNA 5CAOA 2WU7A 1J3HA 5EOBA 1SNUA 4FG7A 2ITTA 1UNLA 2QURA 2X39A 3FL4A 4BDGA 3OOGA 2YDKA 2IVUA 5AP6A 4QP2A 5DWRA 2CGWA 3U8WA 2C68A 2HELA 5EYDA 2QCSA 4QT1A 4JIKA 3E5AA 5DN3A 3PIYA 4J8MA 1A06A 1M7QA 1YW2A 1CDKA 1H07A 1PMVA 3KRRA 4O38A 3P08A 5B7VA 2XNGA 3IQ7A 4RIWB 3R7IA 2C6LA 2WMWA 1WVYA 5BVEA 3JVSA 4GU6A 4C59A 4EH9A 2OICA 1TQMA 4F08A 4NFMA 1HCLA 2XRUA 3G0FA 3LJ0A 2Y6MA 5AR5A 3TZ9A 4XLIA 2XUUA 4TYIA 3TTIA 1KE7A 3Q52A 3PYYA 3RGFA 1O6LA 3OHTA 3MPMA 2W1ZA 2XM8A 4QMTA 4K18A 4CFNA 1Z57A 2W1EA 1PXJA 2RG6A 4M0YA 1MQ4A 2VTIA 3EFJA 3Q04A 5E8SA 3TNIA 2PMOX 2HWPA 4IAIA 3QWKA 4S33A 2PZPA 3QALE 4GFMA 3O7LD 4I5CA 3VS1A 4IANA 4K2RA 3ODZX 2JFLA 4WG3A 4LOQA 5M57A 3ZUTA 2XNNA 3ELJA 4QPSA 2X0GA 4IX6A 4FRFA 4IAZA 3W8QA 3R9HA 4ZLOA 3AD4A 1RW8A 4HGTA 3QZFA 5DLSA 3VF8A 3DDPA 2ONLA 4GFOA 2QU5A 4HZRA 2RKUA 4X7QA 2EXMA 5JK3A 5HE2A 1S9IA 5AR4A 2QOFA 4O4BB 3DKFA 4RGJA 4EUTA 2CGUA 2YEXA 2Y9QA 3QGWA 4DG0E 5FXSA 1YQJA 2OGVA 4ZTMA 4M68A 1K3AA 4AUAA 3LM5A 3F3VA 3FSFA 3DKGA 3Q4UA 2IO6A 3FLNC 3L8XA 4FTLA 4GH2A 2Y8OA 4ANBA 4WOVA 2Y4IB 5CU0A 5KMJA 5ANJA 1AGWA 1J1BA 1XQZA 4LV5A 1JSVA 3D5UA 4R1VA 4V04A 5ANOA 2EXCX 4A9TA 5IU2A 3UIXA 4UYNA 4U3YA 4JDIA 3V6RA 5AAGA 4HVHA 4OTGA 2R3PA 3BI6A 4FKPA 3UIMA 5FRIA 3LMGA 5IEYA 4ZZOA 3I5NA 4QTDA 4I6BA 3AGMA 4GVAA 4IZ7A 4TWOA 3WARA 2UZTA 2XK4A 3BQRA 1PXOA 4KIQA 3TJCA 4BIDA 5JEBA 2YAAA 2Z8CA 3QQJA 4DG2E 5F4NA 5GJFA 3U51A 3MFSA 4D0WA 2XIKA 4OTFA 4PWNA 3OW3A 3S3IA 1B6CB 4H36A 5A4CA 3LFBA 5HU9A 2DUVA 4EEVA 2X0PA 2JIUA 3OG7A 3QTQA 5IF1A 4LGHA 2BRMA 2YM6A 3RAHA 2YDJA 4A07A 4ACCA 2OU7A 4FKUA 2XCHA 3RAKA 3QD3A 2VUWA 2R3KA 3GQIA 1Y8GA 3UVQA 4XG4A 1QPEA 2IZRA 4BKJA 1U54A 4CFVA 1U5QA 4D2RA 1NXKA 4JQEA 4CRSA 3SOAA 4DH3A 4P2KA 4F70A 2X9EA 1XBBA 3NYVA 3DJ7A 4IW0A 1PXPA 1W82A 5CNOA 5AP2A 4ZTHA 3WYXA 4BDAA 4YR8A 3WI6A 2NRUA 3CD3A 3R28A 4RRVA 3QC9A 3R1QA 5EM8A 1Q3DA 3RJCA 3ULIA 5JSMA 4MXYA 5E1SA 3LPBA 5HCYA 3WIKA 2VD5A 3MY1A 3MSSA 3WF7A 5CEIA 3OY3A 4ALWA 1H1SA 4EZ7A 1L3RE 2BAJA 4ITJA 5CAQA 4DGOA 4LG4A 3L8SA 1P5EA 3QHWA 4IVAA 3PVUA 5I9YA 4ZSJA 3LCKA 2ZB0A 3E8CA 4W9XA 5D7AA 3BLHA 5FTQA 4KRDA 3BLRA 5BNJA 2C5XA 1ZYCA 3JPVA 5DR2A 1I44A 2GQGA 4QMXA 3R0TA 1OKYA 3C4EA 4F6WA 2HCKA 2H9VA 4HZSA 4JBQA 4YSMA 4D4SA 5CXZA 2JDRA 3FMHA 5LVNA 4OT6A 4MWIA 4C7TA 3KRWA 4HCUA 3CR0A 3R9OA 4YTFA 1VJYA 2IZSA 2PWLA 4WIHA 2F7EE 4I4FA 2YDIA 3MVMA 2QOLA 3KXNA 3W18A 4GU9A 3Q5IA 3QC4A 3DY7A 2XM9A 5AUYA 3ZEPA 3EN9A 4EYMA 4OLIA 3ZXTA 2PY3A 3D5VA 3O17A 4FTNA 2P33A 5HORA 4H3PA 4EK5A 3JY9A 3H4JA 4NSTA 2HXLA 2BR1A 3OT8A 3BGZA 4FODA 3EH9A 3E93A 3JXWA 4IDVA 2YCQA 2I0YA 2WFYA 3TKHA 3HX4A 3NZ0A 2C1AA 3I7CA 3F88A 4JBVA 2XNOA 3WE4A 1YXTA 1OIQA 3ANQA 3NUSA 3QD0A 3QTXA 4BDJA 5DRBA 4X3FB 3MTFA 3KK9A 3CE3A 3LFEA 4M84A 3U4UA 4NT4A 5IMXA 1J91A 3O23A 3BZ3A 2C3LA 1O9UA 2XP2A 3ODYX 4I0RA 3NIEA 2BCJA 2XIRA 4RWLA 1W84A 4D1SA 4E6AA 4Z3VA 4RX9A 2YISA 5K0XA 4GYIA 4A4XA 4FTMA 3TV6A 4RG0A 2CN5A 3GBZA 4QYFA 2O63A 3DBFA 4RPVA 3QUDA 4RVKA 3ROYA 3UC3A 4Y83A 3RPSA 3TN8A 3P4KA 5CALA 4E73A 1X8BA 1W98A 1ZMVA 3ALOA 3KVWA 4QP9A 4EC8A 1GJOA 4LM5A 4TT7A 5BVFA 4CVAA 2C0IA 5K4JA 1GNGA 1ZMWA 1ZOHA 4KBAA 1PYXA 3ZXZA 4CQEA 3BU6A 5CF5A 5JKGA 1P2AA 3Q9YA 2BAQA 4FV8A 4ANQA 4AT3A 1V0PA 1OUKA 3HA8A 5CEQA 5J9LA 3ZRMA 2F9GA 2HY81 4FYOA 4USDA 4RIXB 4MAOA 4TYHA 3FLQA 5H8BA 3QYWA 2ITQA 5EDRA 1MP8A 3KRLA 4ERWA 1ZOGA 1YOJA 4HYHA 4JNWA 4MXOA 4AU8A 2HZ4A 3EL7A 3GNIB 3PXKA 3FXZA 3FQHA 3VBYA 5CEOA 1OL5A 3G51A 5BVDA 1BYGA 1KE8A 2W5AA 4RBLA 2Y7JA 3W2RA 2B9IA 3FMMA 2VX0A 3ORTA 2CMWA 2R3JA 3NCZA 3FWQA 2YCSA 3TZMA 3Q6WA 1P4FA 2ZJWA 2HOGA 2V55A 4GV1A 4BDFA 4M15A 2VN9A 1OL1A 4QMMA 3ZO3A 5D9HA 2JAMA 3EQDA 4FR4A 1Q97A 4IVBA 3NUUA 4L7FA 4EQCA 4FKVA 4E26A 4FKQA 1Q8UA 2HW7A 3E7OA 1OIRA 2X0QA 4QYGA 1TKIA 2B9JA 2QODA 2W4KA 3BBTB 3UZTA 3EYHA 5C8KA 5EW8A 3GVUA 3BWFA 2E9VA 3WZUA 3QQLA 3RHKA 4F1OA 5LQFA 4TTHB 4RVTA 4FSMA 5G6VA 4ALUA 3ZSHA 3QKLA 2A98A 5EFQA 3WOWA 5L6PA 3VF9A 1OPLA 3BGQA 4BZOA 4QMQA 1OPJA 1KE6A 2A0CX 3VNTA 4IE9A 4MD7E 4DH5A 3ZLXA 4J95A 1DI8A 3O50A 4HW7A 2FSMX 3QZHA 5B0XA 2QOQA 3PPZA 4UN0C 2JKKA 3ZTXA 4DCEA 4F7NA 2GHGA 2IW8A 2BFXA 4IX3A 4RA5A 2EVAA 4EOIA 1DAWA 1BLXA 2RSVA 4Y8DA 3CY2A 4O1PA 2HXQA 2X6EA 3HLLA 5FTOA 3SOCA 4IHPA 2EB2A 4BDDA 1IRKA 2XNMA 1W8CA 3T9TA 2BUJA 3Q9XA 4ZTSA 4OAUC 5A4TA 4L43A 4X2FA 1MRVA 3LXKA 4FSTA 4A7CA 3GC7A 3W8LA 4JS8A 3FHRA 2V5QA 4FSZA 4G16A 5AP7A 4JQ7A 4E1ZA 4EH5A 2I0EA 4RFMA 1DS5A 5EH0A 4V01A 3C7QA 3ENHA 4FTCA 2GTMA 2VTNA 3LAUA 4Q2AA 4RC2A 4C8BA 2OJIA 3KCKA 3MDYA 4DYMA 1F0QA 1YXXA 2C5NA 5EYMA 3ZLYA 5JGDA 4F99A 2JIIA 4J8NA 1KOAA 3L8PA 3NGAA 5DBXA 1IR3A 3K5UA 3PXFA 4IH8A 4FNWA 2GFCA 5DT3A 1TZDA 4D0XA 1Q99A 3LZBA 4FKOA 3HA6A 4RJ7A 3ZMMA 3DB6A 3D7TA 4WA9A 3E64A 2BZHB 2UW0A 4BVUA 4UWBA 4MD9E 1DAYA 4YZ9A 3DLSA 4N4SA 3VS0A 4C57A 3IW8A 4J96A 4O0SA 4YP8A 5TOZA 2HZIA 4DGNA 2OBJA 3FV8A 3LHJA 4FIEA 4YTCA 5FDPA 2YA9A 1WVWA 4R3PA 4C38A 1VEBA 5DNRA 4M13A 3WF5A 5KBRA 5J95A 1XBAA 2X7FA 2VO6A 5L4QA 3SA0A 3UOKA 3NUXA 2XYUA 3PJ2A 4Y5HA 1AD5A 5KE0A 2A27A 4YJOA 4EOSA 2C0TA 2FYSA 3LM0A 2VTLA 4UALA 2FH9A 4NCTA 4RA4A 3D14A 3PJCA 3T9IA 3JS2A 3DBCA 5H8EA 3MV5A 4QO9A 2IZUA 3P7AA 4FT5A 5CY3A 3UPXA 3S1HA 3AD5A 3ORNA 2NPQA 4NM3A 4ASDA 3I5ZA 4C37A 4DLIA 1WCCA 2R4BA 3LXPA 2QR7A 4APPA 1H1QA 5CAVA 4GRBA 2OG8A 3POOA 4KKEA 5GZAA 5IUIA 3A7JA 3DB8A 4H3QA 3SRVB 3FZTA 1FINA 3GU4A 4LRJA 3ORZA 3B2WA 4HYUA 4L46A 4F63A 2J6MA 4H1JA 3DK3A 3GCUA 4BIEA 3LCDA 3FYJX 3SQQA 5DPVA 2VWWA 1NVQA 5HIBA 3LFNA 3B2TA 5EOLA 3OY1A 5HTCA 2A4LA 2VX3A 1OZ1A 3E92A 3TIYA 2ZV7A 4X0MA 2AC5A 4CNHA 4V0GA 3UQGA 3OTUA 3EHAA 4FOBA 3HMOA 3GFWA 4M66A 2VWUA 4MXZA 1UA2A 3SW4A 4GK3A 3VQHA 2DYLA 2V22A 3KXZA 1R78A 4YZCA 3ZO1A 2YN8A 2W0JA 3PFQA 4RIYB 1T45A 4XMOA 4A9SA 4RC3A 5C01A 3FAAA 1OB3A 2ITUA 3HV3A 3PXRA 4NCTC 3U6IA 4KS7A 4KBCA 4NTSA 3O2MA 4GIIA 3W33A 1RDQE 3I81A 1YI4A 3AT3A 2W1HA 3QU0A 4FT3A 4X2NA 3RVGA 4DFLA 4ZZNA 5CSPA 2PE1A 4U43A 4RC4A 1Q61A 2OJGA 4CV9A 4RZVA 3ANRA 5C26A 4MQ2A 3UG2A 3GCSA 4FZDB 3R7UA 1H0VA 3LFQA 1MUOA 3WZKA 3L1SA 3QQHA 5CLPA 4EBWA 2FSOX 3HP5A 2JIVA 4AW2A 2XK3A 3EJ1A 4GT5A 4L3LA 2O0UA 4K0YA 3RM7A 4AQCA 3AXWA 3VS2A 3PLSA 3DK6A 2CDZA 4F0GA 3IK3A 3FJQE 2WMXA 4KINA 3VW6A 3PJ3A 4TRLA 3UZPA 3BQCA 5EYKA 4JR7A 4H58A 4YLLA 2JKQA 5J79A 3CJGA 1PMEA 3OVVA 4MK0A 2BZIB 4D4YA 1YOMA 4DAWA 4IAFA 2ZV8A 3GFEA 3BV3A 3A2CA 4PP7A 4RX5A 4CKRA 1E1XA 2OJFE 5HO6A 3GC8A 5DEWA 3GCVA 5LVOA 3E8NA 3HV4A 5J1VA 4LUDA 2GPHA 4WKQA 4QMOA 5EHOA 3QZIA 3WZDA 5JMSA 3Q9WA 3KU2A 5IA1A 3U9CA 3RK9A 4FNXA 2SRCA 4FTAA 2VWVA 4PMTA 3D2KA 3I1AA 4DEHA 3COIA 3F3TA 5J1WA 2OIQA 2WEIA 2W7XA 3OBJA 4BCJA 1OECA 4CD0A 2FSTX 2CCIA 2B52A 5J7HA 3CQEA 2R3QA 2QLUA 5DE2A 4BZDA 5EKNA 2HW6A 2C6TA 3DA6A 4EC9A 3KCFA 3L8VA 4CLJA 3AC5A 4ZTRA 1VZOA 2JDVA 2RFDA 1V0BA 1YXUA 3BGPA 3FUPA 4EQMA 2B53A 4L52A 4PMSA 2R0IA 4ASEA 2X6DA 4PDSA 4ZSAA 3ZH8A 1REKA 5BX0A 4Q5HA 4KKHA 3POZA 4ZTQA 1JKSA 3KF7A 5A3XA 4XV1A 1OKVA 3VBVA 3MA3A 4B6LA 4QQTA 5CASA 2Z2WA 4YZDA 4ARKA 2FO0A 4GT3A 2ERZE 2OZAA 3E63A 4CT1A 4J52A 2YITA 3QLGA 3OF0A 5FLFA 4EJNA 1JAMA 1BL7A 4CYIA 3G9LX 5I9XA 3MS9A 5KMKA 5AP5A 3BHHA 5AIKA 3SXFA 2VGOA 4FZAB 4EHZA 4D58A 1H28A 1PXMA 3IW7A 2HAKA 2UW9A 2W1CA 4BRXA 4JDKA 3FL5A 3LFFA 4XP3A 3OFMA 4JDHA 3DZQA 4KRCA 2IF8A 5J5TA 4YPSA 4NZWB 3MGYA 2X2LA 4MF0A 4V05A 3EN5A 4EHVA 4FL3A 5CI7A 2YM7A 5E91A 1YKRA 3VS7A 3DTWA 5A14A 4LGDA 4EI4A 4OTWA 2UV2A 4Y46A 3EWHA 4ZLZA 2YZAA 2JD5A 4O0RA 3RHXA 4Y95A 4BGQA 1XHAA 2GNFA 4NK9A 3WE8A 4ACMA 2HK5A 5KUPA 3P9JA 4U40A 2C6MA 4TY1A 2WQMA 3DAKA 4E4LA 1Y6BA 3C4FA 3EL8A 3MVJA 5AWMA 5CU3A 1OMWA 2BDFA 4YC6A 4FV0A 4PTEA 2C1BA 4IC8A 3ZDIA 1JPAA 2YABA 5GJDA 2G2HA 4WSYA 3QX4A 5H9BA 3RWQA 3F7ZA 3HGKA 3D5XA 3LVPA 1CKIA 2W4JA 3AMYA 4XRJA 3MY0A 4TYEA 2R0UA 2C0OA 4FKTA 2ITNA 2UUEA 3MH0A 4E5BA 4GYGA 4EOQA 1PJKA 1UVRA 4RWIA 4W9WA 4YJVA 4F9CA 5EM7A 2W96B 3C13A 3QHRA 4FV3A 3C4WA 3ZUVA 5L8JA 3FKNA 1BX6A 5AV2A 3OWPA 3UVRA 3D4QA 1ZAOA 2FSLX 4CTCA 3MJ1A 2UZNA 4QYEA 2WQEA 5C03A 5CS6A 2ZDUA 3TTJA 4I4EA 2VZ6A 4FTJA 2BTRA 3E7VA 3R00A 4RIOA 3ZLSA 1K9AA 4ACDA 4B8MA 2VWYA 3OT3A 4G6OA 3VRZA 2BTSA 5F95A 4ZK5A 1YHSA 4I23A 5HU3A 1TVOA 5JFXA 4R5YA 4II5A 1ZWSA 1BI7A 5CWZA 3DNDA 3KN5A 3D2IA 4O0WA 5GZ9A 3VUTA 3MB6A 4O2PA 4I24A 5IEVA 3M2WA 2WMAA 4C61A 2ZDTA 1SM2A 1SYKA 1WBVA 2ITVA 4H1MA 5KX8A 3ZBFA 4BGHA 4ZS0A 4EOJA 2PTKA 2WMUA 3VRYA 4F7LA 2IWIA 1SZMA 3UNJA 4UXLA 4A4OA 3GU6A 3OEZA 4J53A 4P90A 4F09A 3ZZEA 3KRJA 3WZJA 4I5HA 2XK9A 3O7LB 1QPCA 4Z9LA 4MNEA 2QQ7A 3R04A 2VO3A 2YM8A 4L42A 3C1XA 2R2PA 4OTDA 1OL6A 3CTJA 4L44A 4EOPA 5JQ5A 2PZRA 3A8XA 2RG5A 3EKNA 2WGJA 3OWJA 3PY0A 4RIWA 5DR9A 3MFUA 3DU8A 4RMZA 3UE4A 4L9IA 3EZVA 2UW4A 4DTKA 2C3IB 3ZC6A 5DA3A 3TXOA 3VS4A 3TACA 2QO2A 4E6QA 4C35A 4CCUA 1BI8A 3A4OX 4BCMA 2WTCA 3TI1A 4BTMA 3WF6A 5EI6A 3FMEA 3PTGA 3VAPA 5CVGA 1JSUA 2BPMA 3RZFA 5CF4A 3QRJA 3D9VA 4BBFA 2YIYA 5BVKA 3CEKA 3PVWA 3QCXA 4FUXA 3NNWA 4FV9A 4JG8A 3SV0A 2C5VA 2OJ9A 2WKMA 4OUCA 4CYJA 5A6NA 1JLUE 4NW5A 1UWJA 1WBPA 1IG1A 2VTAA 3QTWA 3R02A 3I0QA 4YBJA 1GOLA 2GFSA 5L2TA 3HMMA 3EQFA 1GIIA 3NEWA 2OWBA 4IJPA 4IWQA 3DJ6A 4L53A 4R8QA 5IA4A 3GU8A 4UWYA 5CSWA 3BYUA 3CIKA 4FF8A 3TZ7A 1NY3A 2FB8A 4IB5A 3A61A 1ZMUA 4IX5A 4QTAA 5I9WA 3Q53A 4YJSA 3PVBA 4F64A 4CKIA 2QKRA 2ERKA 2OFUA 4FG8A 1LUFA 1Y8YA 4XBUA 2YERA 4AN2A 4D1XA 2O5KA 2VTSA 3IDCA 3LXLA 4IZAA 4XHKB 1WBNA 3RI1A 3V5LA 3ZONA 2OKRA 4EHEA 5D12A 5FBNC 1ZLTA 4AOJA 3EKKA 2CGVA 2YM4A 3NLBA 2XB7A 2UVYA 4PDPA 3BV2A 4BIBA 3TWJA 2J50A 2C5OA 1QCFA 1OPKA 4AGUA 4CLIA 4CZUA 4JRVA 4PF4A 3S95A 4BCKA 2Z7SA 1KOBA 2WTVA 3TUCA 4L68A 4O6LA 2EU9A 1KV2A 2F49A 3UO6A 5L2SA 3RK5A 1JBPE 5LXMA 1Q8TA 2PUUA 3VQUA 2OXXA 2UVXA 3DXNA 4B4LA 4FTIA 4DGLC 1Y91A 3KEXA 4YNEA 3R7YA 1KE5A 2Y6OA 2BVAA 3OOMA 2C4GA 2ITOA 3CQUA 2ACXA 4FT0A 4LMNA 4O4FA 4WNKA 3UVPA 2IVTA 3HP2A 3PZHA 3ET7A 2WPAA 1U5RA 5DVRA 4PQNA 2V0DA 4LI5A 2IN6A 5HNIX 3DK7A 5CU2A 1OIYA 1YDSE 5KO1A 3KA0A 3I7BA 5AM6A 5FXRA 3C0IA 4XBRA 4DLJA 3FKLA 3Q5ZA 5GHVA 2XKEA 4AN9A 1REJA 2PMLX 3T3UA 2BROA 1V0OA 4QNYA 5HLPA 2OIDA 3HEGA 4TYJA 4BCGA 5KNJA 4UMPA 2W1IA 3AC1A 2V7AA 4I3ZA 2R7BA 3KRXA 3U87A 3VUGA 3FLZA 1H1WA 2UZWE 3F3UA 5I9ZA 2WU6A 4FKWA 3ZRKA 3CPBA 4QP1A 2J90A 4X2KA 1FGKA 3BYSA 3QD2B 4OTRA 4BYIA 2GHLA 2Y4IC 3CC6A 4MTAA 4FSUA 2WHBA 2OI4X 4AE6A 4ZAUA 1W2FA 5CEKA 2B55A 2X0OA 5CQWA 4WUAA 5I5ZA 5KMLA 1UV5A 1M52A 1YWVA 4IAAA 2XIYA 2CJMA 4RVMA 4M69B 2VTMA 1ZYJA 3C50A 5EW3A 4AZFA 5IUGA 5JZNA 4DGMA 2GS2A 2W06A 5ACKA 4K1BA 4HPTE 3LFAA 3RP9A 4IADA 4BCNA 2XJ0A 5CVFA 4J98A 5FQDC 3BYMA 3VUDA 4PMMA 3COKA 1FGIA 2OJJA 2QOCA 3P7CA 5HCXA 4F1TA 2XNPA 5HE0A 4NM0A 5E8YA 2CHLA 2XK6A 3CP9A 5LARA 4DITA 4K11A 3U4WA 4R3RA 4Y73A 5CSHA 5L2WA 1PXLA 2CGXA 4J97A 3PA5A 4CFUA 1BKXA