5J7BA

The identification and pharmacological characterization of 6-(tert-butylsulfonyl)-n-(5-fluoro-1h-indazol-3-yl)quinolin-4-amine (gsk583), a highly potent and selective inhibitor of rip2 kinase, gsk583 complex
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
306
structure length
277
Chain Sequence
AICSALPTIPYHKLADLRYLSRGASGTVSSARHADWRVQVAVKHLLLDSERKDVLREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDVAWPLRFRILHEIALGVNYLHNMTPPLLHHDLKTQNILLDNEFHVKIADFGLGTIIYMPPENYESRASIKHDIYSYAVITWEVLSRKQPFEDVTNPLQIMYSVSQGHRPVINEESLPYDIPHRARMISLIESGWAQNPDERPSFLKCLIELEPVLRTFEEITFLEAVIQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Receptor-interacting serine/threonine-protein kinase 2
publication title The Identification and Pharmacological Characterization of 6-(tert-Butylsulfonyl)-N-(5-fluoro-1H-indazol-3-yl)quinolin-4-amine (GSK583), a Highly Potent and Selective Inhibitor of RIP2 Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 277
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5j7bA00
2P0CA 5GZ8A 3FE3A 4FL2A 3IOKA 4F6WA 2GHGA 3CR0A 4A9RA 4YSMA 4D4SA 2XNBA 4U9AA 3KVWA 4YHTA 4FTOA 4ACDA 3NUNA 4FTRA 1T45A 3CEKA 3PXQA 5BYYA 5J1VA 3D7ZA 2YIWA 4GYGA 4GK2A 1PXKA 2OFUA 2W4KA 4XP3A 4QMLA 5C27A 1ZYDA 2OF4A 4HZSA 4E6QA 3MPTA 5A6OA 1J1BA 3R22A 4PP7A 3PSDA 4LRKA 4MD7E 4N0SA 4QMTA 2ITVA 1IR3A 4NM3A 4OGRA 4TW9A 4XH6A 4DG3E 4TWCA 4MH7A 2C3JA 4IX3A 3VIDA 5AV4A 1JBPE 4D5KA 4EHGA 1A9UA 3PIYA 4IAZA 4W8DA 4GJ3A 3ORTA 4FI1A 2WMAA 3Q04A 1DI9A 5ETFA 3ZC5A 5HVJA 4DCEA 3JS2A 5EDRA 1WCCA 3P7BA 1JWHA 2VTMA 5AUUA 3D5XA 3I7CA 3SA0A 4FUXA 2EVAA 4DG0E 4ZTRA 3SDJA 2PE2A 4QTAA 2PMOX 4NTSA 4ANQA 4CRLA 3FMDA 4J97A 4KRCA 4MXAA 3UIMA 4XV3A 3ZO1A 3UQCA 3BHUA 2IZUA 4FTQA 4R5YA 2PVFA 4FNWA 3LQ8A 4YR8A 4RX7A 2F57A 4TN6A 5KKRB 3A7HA 1FVVA 2ETMA 2HY0A 5I3RA 5IA4A 1IG1A 3F5UA 2Y6OA 1M2RA 4ALWA 3HDNA 1JQHA 2WQOA 4L45A 1H01A 1FQ1B 3QTIA 3T3UA 4O6LA 5AEPA 4I5HA 3AT2A 4XV1A 4M84A 2OXXA 5J9LA 3NSZA 2VX1A 4YJSA 5FQDC 4AZSA 5AR2A 1H1QA 2WQNA 3S4QA 1U46A 4G9RA 3GC7A 3AC1A 4XRJA 5JFXA 1TQPA 4S32A 3O71A 3PG1A 3ALOA 3FBVA 3UQGA 4DEHA 4RZWA 2W9FB 1H26A 3C4EA 3JY0A 3PFQA 2R5TA 4L3PA 2JKOA 2GS6A 4IJPA 4H1MA 4YO6A 4LI5A 5CASA 3CJGA 4WNKA 2E9PA 4X6RA 3SX9A 5C8KA 2QOHA 3QTRA 3KEXA 3MB6A 1GZNA 3LXKA 1LEWA 4UV0A 3CJFA 4IBMA 4QYHA 4CZYB 3OWPA 1OM1A 1QPJA 5HE0A 2Z7RA 4L52A 3TNPC 5AIRA 5AV3A 4RLLA 4DFLA 1H28A 3FXZA 2CGWA 4QYGA 4R7HA 3C7QA 2ITZA 4OTGA 4QMXA 2QI8A 5HORA 4E4LA 2YA9A 4DEIA 4CEGA 1WBPA 4CYIA 1M52A 2W9ZB 3V5TA 4EONA 1GZOA 1UKHA 3R2YA 4FKVA 5DVRA 4LGDA 3HUBA 4Y5QA 2GNLA 3QHWA 5CENA 4FR4A 2B9JA 5I3OA 4DC2A 3LFSA 3PE2A 1O9UA 2BVAA 5A6NA 3PA3A 2ITOA 3GQLA 4M14A 5BNJA 2UZWE 4HPTE 3Q3BA 2BFXA 4FKUA 2YN8A 3A99A 1YW2A 3EMGA 2ITTA 1QMZA 5JGAA 4MWIA 2JDOA 3Q4ZA 3OY1A 1JNKA 3F3VA 2Y4IC 2P4IA 4N70A 1K3AA 2WQBA 4BBMA 4CFNA 2IW8A 2F2UA 2VTAA 5C01A 3PYYA 3TUBA 4WHZA 3DQXA 2BCJA 2XNOA 4QRCA 2UW3A 2GS7A 2QD9A 2WEVA 3I81A 2BAQA 5CSVA 4JS8A 2QOBA 5LCJA 2R7BA 5E92A 3L8SA 4IMYA 4ONAA 3AD5A 4ZIMA 2WIHA 4CLJA 4Y46A 4EOPA 1QCFA 3SHEA 2BZKB 4R5SA 4YLLA 3BGPA 1UWJA 4XG7A 2QO9A 5AUYA 4R7IA 4NH1A 3FLZA 4Q5HA 2WGJA 2QVSE 4IX5A 2X6EA 3OCGA 4RX9A 4KRDA 4XEYA 2YCQA 3TCPA 2FYSA 2XNNA 4XX9A 5L2SA 4UALA 3AD6A 5CEQA 5CANA 2A19B 2PVNA 1H25A 3FLWA 3QD4A 4RZVA 3DK6A 5T68A 2Z2WA 3CCNA 3CTQA 2OG8A 2YM6A 3QC4A 4MBJA 5F20A 3THBA 1JKLA 3G9NA 3GFEA 3V01A 2FSTX 4TKSA 5JZNA 4CT1A 2C4GA 4ZK5A 3FLQA 4ITJA 5F94A 2BIYA 3O8PA 3ZFMA 4U44A 3HRCA 1A06A 3HDMA 3WF5A 2ZOQA 1PF8A 2PVLA 1REKA 4D4VA 2JDVA 3SRVB 3TNWA 4C4FA 3PP1A 1FGIA 2OJFE 3QX2A 4L6QA 5BVKA 5EM7A 3EFJA 4ACMA 4L3LA 3KXMA 4FSRA 5EI2A 4AZEA 4ANBA 4F6UA 3IK3A 4W8EA 2UW8A 2VTOA 3F3TA 3NUSA 3DJ5A 3K5VA 3ORZA 3OWKA 3JY9A 4CNHA 3PJ8A 2R9SA 3UG2A 3NLBA 4JAIA 5AR8A 3P1AA 3G5DA 4G5PA 2YACA 4QTEA 3G51A 2OI4X 2YM5A 3DJ7A 3QHRA 4FV3A 2BRGA 1R3CA 3D7TA 3ENHA 2IO6A 2R3NA 3U4UA 2F49A 2VTPA 3OTUA 4NJDA 5HIBA 3ZZWA 4LM5A 4EOOA 3UMXA 2WMBA 3E8NA 3VBWA 1YDTE 4PUZA 4JIKA 3DS6A 3A2CA 3F5XA 3V5JA 1ZY4A 4FOBA 2C6TA 1XH9A 2R7IA 4F64A 4Z55A 4G2FA 3KRWA 1XKKA 3VWAA 4BI2A 5AADA 4QTBA 4AGDA 1W98A 2JDRA 2QC6A 4GU9A 3OT8A 4BGQA 2JKKA 4AA4A 4AG8A 3ZSGA 1URWA 4KIPA 3KF7A 3T9TA 2B55A 5CU2A 4EK8A 4CQGA 3SW7A 3QALE 1Q99A 4WUAA 2F2CB 2R4BA 4W4XA 1S9JA 4QMZA 4ASXA 4RQVA 3UTOA 1XR1A 5LOHA 3HGKA 1XH8A 3EQCA 5EYCA 4KKGA 4TYEA 3TG1A 3ZC6A 3EFKA 3OBJA 4AZWA 3TKHA 4O0TA 3DTCA 4BDGA 3U9CA 2YCRA 4HYSA 4JNWA 3NAYA 4L43A 4FZ6A 2PL0A 1AQ1A 5EHOA 5DT4A 4UWCA 4NW5A 1ZYCA 2X9FA 3GT8A 4S30A 4MBIA 3CD8A 3IDPA 3O2MA 5IMEA 5JFWA 3BCEA 3VS4A 4GUEA 3FQEA 4QTDA 3L9MA 4UWBA 1F0QA 3PUPA 3Q32A 4AN2A 1OIRA 4L8MA 2QOFA 5TE0A 2W1ZA 4O2ZA 4RFYA 5L3AA 4U43A 5HLNA 3R00A 5KKRC 4I41A 4KIQA 4D0XA 4NIFA 3VS2A 4GT4A 5EYMA 3SXSA 4E6AA 1BI7A 4EQUA 5LARA 3GBZA 5K4JA 3IDCA 1W7HA 4IAYA 2YAKA 5ETIA 1LPUA 5ICPA 2CGVA 4WT6A 4ALVA 4G3GA 5JH6A 2ZMCA 5AR7A 3F69A 2E9NA 5HHWA 5KHWA 4C35A 3DKGA 3HP5A 3T9IA 4TPTA 2UZEA 4GUBA 5AP7A 2ITPA 4PMTA 3V8SA 2C5XA 4BZOA 5DMZA 4G31A 3LHJA 4L9IA 2PVRA 3TNHA 3UDBA 3FI3A 3R6XA 5C03A 2C5OA 4UMRA 4BBFA 3L8XA 2EXEA 3KULB 3PSBA 4RWLA 3OWLA 4C7TA 1OECA 4QMQA 1F3MC 2ERKA 1DS5A 2XM8A 1WVWA 4HGEA 3MPMA 2BALA 3UE4A 2W1GA 3DLSA 4KKHA 4QMYA 3PA5A 3V51A 5KMJA 4XV9A 4OBPA 2W4OA 3LQ5A 4GH2A 4NWMA 4A4OA 2BROA 4TWNA 2V55A 4BBEA 3SV0A 3DA6A 4F99A 4CKRA 3O8TA 4UWYA 3LFCA 3QGWA 5A54A 1OKVA 2VNWA 3PPKA 4UB7A 4IJ9A 4ZXTA 5B2MA 1H1RA 3ANRA 4HVSA 2CSNA 2JITA 3PIXA 2YCSA 4G3DA 5HLPA 5LWMA 5IDPA 4ALUA 1J1CA 3JVRA 3ZRKA 3NGAA 4BKZA 4CD0A 4CQEA 4HVIA 3LAUA 1YWRA 4NJ3A 1EH4A 5ACKA 5KZIA 3BKBA 2VNYA 3QTXA 5TF9A 5EHYA 2OK1A 3KK8A 3DTWA 2P55A 4O0SA 2OKRA 3VW6A 1XO2B 3HMNA 2A2AA 3JUHA 2UW4A 2XEYA 3R7VA 4YZMA 4NM7A 5BVDA 1PXIA 3VF8A 3KGAA 3WZKA 4XOZA 5D1JA 3EHAA 4ACGA 2X0GA 4XNEA 1M2PA 5CEIA 1ZZLA 2XH5A 3GI3A 3O23A 4AX8A 4BIEA 4HGTA 2OJJA 4M66A 2R3OA 3COMA 2A0CX 2NO3A 2E9OA 3I6WA 3KU2A 3Q2MA 4AT4A 4ZAUA 2J5EA 3F7ZA 3KXNA 1YI3A 3NS9A 3OCSA 4QQJA 4FSNA 4KS7A 3OWJA 5E1EA 4CV8A 2VRXA 4F9WA 3TT0A 2HIWA 4ZSAA 4QYYA 3NUXA 4MQ1A 4DINA 3EB0A 4N4SA 4EQCA 2ONLC 2X7FA 3LJ1A 4RBLA 3W55A 3QD3A 5J8IA 4U42A 4YTHA 4E6DA 5AMNA 2VX3A 4RVMA 3W2PA 4FYNA 4F09A 2QR8A 2UVZA 2ITWA 2XNGA 2YLFA 4QNYA 4XG2A 4FKWA 4ZJJA 4J8NA 1VJYA 4IWDA 4H39A 2BR1A 2ESMA 3DAJA 3RWPA 4B6LA 2X4FA 2OFVA 4OW8A 3LFEA 5CWZA 3BWJA 3W16A 2VZ6A 5E8UA 4WD5A 4YZCA 5HO6A 4NCTC 3HRBA 4IVCA 4YNOA 5A46A 4C37A 3VQHA 1J91A 4EOIA 3QWKA 4IFCA 4A4LA 2PZYA 2WQEA 3E88A 4FKLA 4YBJA 4DHFA 5F1ZA 1JKTA 4DH7A 4YSJA 3ZYAA 2JFLA 3I7BA 4G6LA 3RVGA 4DYMA 3TKIA 4I6FA 2ZVAA 4XLVA 2IW9A 4QMMA 4LG4A 1JSVA 5AR4A 2J2IB 3EH9A 4ZOGA 2EXCX 3PY1A 4FSWA 5DEWA 5KCVA 5K0XA 3P86A 5CVFA 1H1PA 3O8UA 2Z7QA 3AOXA 4IH8A 4BDAA 3VBXA 4XG6A 4MHAA 2V62A 5EI6A 2X7GA 5EKOA 1PW2A 2VO6A 3A8XA 3UNJA 3BU3A 5IH5A 4BDIA 4YLJA 4ID7A 3OXZA 2ITYA 5CSWA 4C59A 4XYFA 5CEMA 4OT5A 4F70A 1OUYA 3FHRA 3LLTA 1KOAA 4K0YA 4X2NA 4GMYA 3R30A 4YZBA 3ELJA 2PUUA 3VUHA 3MH0A 4PNKA 2XIZA 4IB0A 3DLZA 4NK9A 3TV6A 3QRUA 4G5JA 4AU8A 2G1TA 3ZHPC 3SD0A 3ZUVA 3QTUA 4E4MA 1FVTA 3SKCA 3V8TA 1UNGA 2WHBA 4RT7A 3R8MA 4ERKA 2WTKB 1GAGA 3SC1A 3NWWA 5T3QA 3ZBFA 3ZDIA 1URCA 4I24A 4M0ZA 3B2TA 4I6HA 4BIDA 5I5ZA 3ROYA 3FZSA 3LFDA 1K2PA 4M12A 4U3ZA 5HLWA 3WF9A 2C6EA 4IEBA 3DU8A 4I1ZA 4NCTA 3VW8A 4JOAA 4F7SA 3SRVA 2OH0E 4FTJA 2RSVA 4H1JA 2BMCA 2WU6A 3PXYA 3QYWA 5CYIA 5EI8A 2OIDA 2AC3A 2QURA 4RC4A 4A06A 1S9IA 3FLSA 3GCSA 4D0WA 3D83A 3GC0A 4EBVA 4ZJVA 3PXKA 2DS1A 4KSPA 5CZIA 3ORXA 1DM2A 5HKMA 5AWMA 4PV0A 5DN3A 4ZLYA 3RI1A 3CGFA 5HOAA 5LQFA 2B4SB 3I0OA 2VO7A 1V0BA 3C0GA 3MY5A 4HVHA 3BYOA 2J0JA 4QT1A 1Q4LA 5I9XA 4F0IA 2DUVA 3L9NA 3PY0A 4B7TA 3BE9A 1MQBA 1LP4A 3QGYA 4U7ZA 3T8OA 5IUHA 4FT5A 4L3JA 5HU3A 4IVDA 4JT3A 4YC8A 3QQGA 5HGIA 3CLYA 2WMVA 2JGZA 3QRIA 3RPOA 4DTKA 3KF4A 1DAWA 2XEZA 3ANQA 5DIAA 5IZFA 3E64A 1O6LA 3LXPA 1B38A 4GS6A 2PZ5A 2WTJA 2YDJA 3HV3A 4GVAA 1GY3A 4AZTA 4KNBA 3AD4A 5KMKA 4U8ZA 4MD8E 1H1WA 3OUKA 4O2PA 5L8LA 3MIAA 2KULA 3UC4A 2C0IA 1RJBA 4D4RA 4M15A 2Q0BA 3BZ3A 4EZ3A 2CKEA 4QP4A 4C4JA 4GFGA 4YGAA 4XUFA 3NNWA 5TOZA 3VN9A 4FKGA 4BI1A 2XF0A 4CFVA 1XWSA 5DEYA 4MEDA 2IZRA 2VGPA 4K11A 4WSQA 1ERKA 3B8QA 4YHJA 4ZZMA 4WUNA 3F7WA 3UZTA 4NEUA 2CDZA 2QQ7A 2Y4PA 3CBLA 3M1SA 4PDPA 4RFZA 3R8VA 2CGUA 4FT7A 4JG7A 4RSSA 1WVXA 5HESA 5BMMA 1PYXA 3HKOA 2QO7A 3QQKA 1Z5MA 4FL3A 4JR7A 2R3FA 5D41A 5LMBA 1O6YA 3VNTA 5L2TA 4Y73A 4IM3A 4FEQA 4ZTLA 1OPKA 2H96A 4LUDA 3DKCA 4KABA 4IZAA 1TQIA 5DWRA 3UPXA 4D9TA 5A4CA 1XBBA 3K3IA 3CY2A 2GS2A 1FMOE 5CXHA 4MXXA 2NRUA 4U81A 3BYUA 4AGWA 3MYGA 4K77A 4BZDA 4HYIA 3I6UA 5DA3A 3OTVA 5AUVA 4BN1A 4OLIA 1W8CA 5AV1A 3TJCA 5K3YA 3ZO2A 1QPCA 4YNEA 4LOOA 3DZOA 4D1SA 4UMPA 3DZQA 2YZAA 2CN8A 1GNGA 2W17A 2HELA 3BELA 3BX5A 3CP9A 3FWQA 4PMMA 4QP3A 3RPSA 5DRDA 1V0PA 3MH1A 5FM3A 5HCXA 4HNFA 5ANEA 4KBCA 5HI2A 5EYKA 4AQCA 2W06A 2UZDA 2P2IA 5IDNA 3IONA 1UKIA 2BRBA 3RM6A 5HTCA 4CFMA 2XUUA 4R6VA 5CT7A 4RWIA 1YXSA 4FTUA 3QQJA 4BCGA 3N9XA 1PYEA 4DFNA 2FB8A 5GNKA 3MVMA 4JBPA 4ZLOA 4AOIA 2GPHA 4TYJA 3I79A 2R3MA 3B2WA 5TKDA 5FM2A 3Q6UA 4J7BA 3C4ZA 3RBWA 3R9NA 4FZDB 2EXMA 3DBEA 3NW5A 1BI8A 3WF6A 3NIEA 4C61A 1RDQE 4FT3A 2SRCA 2BHEA 1Q3WA 4AOTA 3WF8A 4AXAA 3NX8A 4X21A 5KUPA 5FTOA 4DAWA 2UV2A 1Y8YA 5B7VA 4FK6A 4MNEB 5HZNA 1H08A 4NSTA 1F5QA 1WBNA 3EL8A 3O7LB 2UW7A 5AA9A 3ZSIA 2W1EA 1LR4A 2BILB 4PL4A 3VULA 2ITQA 4F7NA 2ZV7A 4C02A 4FOCA 3PPJA 3OMVA 3DJ6A 4FGBA 4MF0A 3EN5A 5EG3A 5LMKA 1YOJA 5FLFA 5EW9A 3CXWA 4FVQA 2RGPA 3G2FA 4HNIA 3DGKA 3EN7A 2EB2A 3O51A 4GW8A 5IA5A 4D2VA 4L53A 4ZZOA 1PKGA 4FL1A 4Y72A 4H36A 3VUKA 5HO8A 3FI2A 3F3WA 4J53A 4DH5A 3S2PA 2WTIA 4WBOA 4FK3A 3GCPA 3OCTA 2IZSA 4HVGA 2V7OA 4B8LA 4ZTMA 3AT3A 4JR3A 3TNIA 4PMSA 4TNDA 5LCKA 3M11A 3ZMMA 4CZTA 3A60A 3HV7A 4W9XA 4ANOA 1B39A 4IDVA 1P2AA 2UZVA 2ACXA 4I94A 3QQFA 4UYNA 4ZY6A 3KK9A 2V22A 2WIPA 3PXZA 5AP3A 3ODYX 3OCBA 4IAFA 3O96A 5CVGA 4R8QA 5HE3A 4BTMA 1U59A 1ZY5A 3DNDA 3EFWA 4NW6A 4PWNA 3DNEA 5DG5A 5FGKA 2CMWA 2FSLX 3IO7A 2PVKA 2O0UA 3FAAA 5DR9A 2JC6A 3FI4A 3DFCB 4AZFA 4E5AX 3FMEA 2WTKC 3BHTA 4FTCA 4FV9A 4FNZA 1NVSA 3V5PA 1FVRA 3KL8A 4BRXA 2XM9A 5A9UA 3LCTA 4USFA 2XKCA 2C6DA 5HICA 5AP0A 3QKMA 3R8PA 3VVHA 4I0TA 1CMKE 5I9WA 3NW7A 3R28A 5CAPA 4YURA 3H9FA 5DGZA 1YQJA 2PWLA 4DFYA 5L6OA 2BDFA 2UUEA 3AQVA 3C9WA 5JGBA 3KY2A 5IA1A 1Q8ZA 1MRUA 3BE2A 3K54A 3WIKA 2BZIB 4KA3A 1H4LA 4EORA 4F4PA 5IEYA 1APME 4V04A 4PTCA 4O27B 4ZSLA 3FKOA 3GU4A 3RWQA 3HZTA 5L6WL 3HECA 3FSKA 4EKLA 2R64A 1KSWA 2OGVA 1YRPA 4F1TA 4I5PA 2BAKA 4APPA 1UNHA 3NYXA 3GNIB 3EQDA 3ZO4A 3JPVA 4RX8A 4XP2A 5HNGA 3GOKA 2VTQA 5C8MA 4EWHA 4BHZA 3HLLA 2LAVA 3UP2A 4IZ5A 4XBRA 2DQ7X 4EEVA 3KC3A 1Y6AA 4OR5A 1U5QA 5HEZA 3K5UA 3BGQA 1IA8A 5KMIA 1SVEA 4KB8A 4LGGA 3SXRA 1ATPE 4JRNA 4FVPA 5H2UA 4FKRA 5IEVA 1Q8YA 3QZGA 4A7CA 5FBOA 3FQSA 2WNTA 3GENA 3RK5A 2W0JA 2PSQA 2RG5A 2X39A 2BTSA 3MVHA 4IXPA 4O0RA 1KE6A 3W1FA 5DI1A 3R7EA 1YXUA 4XG9A 4FIHA 3FSFA 4ENYA 4NFMA 5CT0A 3ZUUA 4D2WA 1WBOA 3FY2A 5K5NA 2VTTA 2GSFA 4F1OA 4GCJA 5ACBC 1M7NA 1Q8WA 5C26A 3BHHA 5H3QA 3R04A 3TZ9A 4L46A 3KXGA 4V05A 5BUIA 2VV9A 4C4HA 4EZ5A 4KINA 3W33A 3BQCA 4F9CA 2BDWA 2Z60A 4LGHA 1XHAA 3ZM4A 4IW0A 2AYPA 2X2MA 1UU3A 3W32A 3TACA 3A7IA 5I9UA 4LRJA 5I9VA 3KB7A 4LOQA 3EIDA 4MXCA 3MTLA 2R3GA 3MW1A 3PXRA 4FKSA 4QPSA 4FTNA 5EM6A 5CNNA 4E20A 4F65A 3DAEA 4ASDA 4O1OA 1MUOA 3H9RA 3DBFA 4FMQA 2YM4A 4JDKA 3N51A 3RAIA 2CHLA 2JLDA 4FZ7A 4LV8A 3EWHA 3VS3A 4TWPA 2J0MB 3ZLSA 3UNZA 2CLXA 4F0FA 5BVOA 5GJGA 4HPUE 4W9WA 2GNGA 3NUYA 1PXPA 3UNKA 1UU8A 2OW3A 2UZLA 2X1NA 2ZJWA 3CQUA 4IVAA 5G1XA 3DBDA 2ETKA 5HX8A 4WOVA 3MJ2A 3T3VA 3QKKA 3LPBA 1R0EA 4EOLA 1O6KA 3ZEWA 2I0YA 4GYIA 3QXOA 3VS7A 2G2IA 4IHPA 2F9GA 5CSHA 3UPZA 5BVEA 5KBQA 2LGCA 3LFQA 4OTPA 4AFJA 1GOLA 2RIOA 4OUCA 3VBVA 4UEUA 2C3IB 3O50A 3Q9WA 2VTRA 4GV1A 5A3XA 3KFAA 4WRSA 4KD1A 2XMYA 5HNIX 2PY3A 2UZBA 5HTBA 3S00A 5D9HA 3QQUA 3TEIA 5CLPA 3WE8A 4P7EA 2H9VA 1OL1A 1PMEA 4BCQA 4RGJA 2YITA 3KMWA 3BEAA 5JQ5A 3ZEPA 2J0LA 4D1XA 1H8FA 3DB8A 5AAGA 3ZCLA 4C2WA 5AX9A 3FMNA 2BRNA 2UZUE 3FMLA 2ZAZA 4FBXA 4BTJA 3W2OA 4AF3A 5BMSA 4DH8A 4TYHA 4R3PA 3RPRA 3NR9A 5CEPA 4L68A 4YTFA 2P33A 4GT3A 4XOYA 1Q61A 3PRIA 2Z7SA 4QMUA 5HG7A 4RA4A 3NZ0A 2VWUA 5HG5A 3R7YA 4BDJA 4Y83A 4LV5A 1ZMWA 3ENMA 1SVGA 4HZRA 4PNIA 3IW4A 4FV8A 1P4OA 3UOHA 2PMLX 3TI1A 3FQHA 5L4QA 3E62A 4L67A 4M0YA 2VO0A 4P5ZA 3I60A 3OW4A 2VWWA 3PLSA 3D14A 4A07A 4PQNA 3LCOA 4M7IA 4CMTA 3OEFX 3A7GA 2IWIA 4JQ7A 1ZYSA 3MS9A 3EQFA 3RZBA 1R78A 3QZHA 4Y85A 2QG5A 4TWOA 4FTKA 2A4LA 2ITNA 1OMWA 3S3IA 3HV5A 2C6MA 3BBTB 4AGCA 4U6RA 4EOKA 5A4EA 3KULA 5CVHA 4DITA 4BGGA 4KSQA 5BVWA 5JEBA 5CI6A 1JSUA 3FMJA 3ZRMA 4WG4A 4K6ZA 4BFMA 4FSMA 4EH8A 3RJCA 3ETAA 5EOBA 3V5WA 2JEDA 4M69B 2QOOA 4DLIA 3Q6WA 5BVNA 3ODZX 4C4EA 3POZA 4DLJA 4IADA 1I09A 4NTTA 2UZTA 3CS9A 5KMNA 3GVUA 2W5HA 3FL4A 3MB7A 3NCZA 3ALNA 4C3RA 3OXTA 3OUNB 2QOKA 4YJUA 2I1MA 2QU5A 4BKJA 3OG7A 4YMJA 4R1YA 2B9HA 3W2QA 2B9IA 3UOJA 4CFFA 3MJ1A 3PJ2A 4ENXA 2FGIA 2OZAB 2RG6A 4EQMA 1WBTA 1ZLTA 2FSOX 2Y6MA 3KMUA 4O0WA 4YTCA 2HK5A 3FHIA 5FXSA 3RMFA 3ULZA 1Q8TA 1OB3A 4RIWA 4XRLA 5B0XA 4AA5A 4PPAA 5FXQA 3WF7A 1H24A 3OW3A 5M55A 2XIRA 4MNEA 4FF8A 3QQHA 4FSYA 4QO9A 5TO8A 1GIJA 4FV7A 2PVJA 3RZFA 3Q5ZA 2O64A 3ZFXA 3C4WA 1XH7A 4JLCA 3FPQA 2X8EA 3C51A 1FGKA 3EQIA 3OVVA 4NKAA 1XQZA 3OT3A 3VQUA 1KE9A 3VJOA 2OH4A 5JN2A 1Y57A 4F9YA 3P9JA 3ZOSA 1J3HA 3GP0A 5KO1A 3IGOA 5C8NA 2XYNA 1GJOA 3QTSA 4JG6A 2XK6A 3WE4A 1OKZA 3FKLA 3R21A 2XNPA 4FV4A 1P5EA 3NCGA 4BICA 1YKRA 2J0IA 4CRSA 2YM3A 4FKPA 2RFSA 3ACKA 5AP4A 4EOQA 3WARA 5EOLA 1JPAA 4DEAA 5FWKK 4FG9A 4C58A 4O0YA 3DXNA 4MNFA 4RFMA 5BX0A 4QNAA 3PJ3A 4YZDA 4JG8A 1W0XC 1BX6A 3SVVA 2PTKA 3P7CA 2CCIA 5E90A 3W18A 4HW7A 2G2HA 2O8YA 4FV2A 4EOMA 3ZUTA 4A9UA 2HW7A 5HBJA 1U54B 4JDJA 4FTMA 3R1SA 3A61A 4TY1A 4PDOA 3LFNA 3LMGA 4CTCA 1RE8A 4EH5A 3C4CA 5H9BA 5DE2A 2XRUA 3CIKA 2YJRA 4C2VA 3QTWA 2QO2A 3BLQA 5BUJA 4O0UA 3DK3A 4XCUA 3BV3A 3VBYA 3R1NA 2RFEA 4U40A 3BYVA 3ERKA 3W8QA 3PVUA 4EUTA 3R1YA 4NKSA 3FXXA 4AP7A 4QQTA 4GK4A 1BYGA 5HIEA 3Q52A 5D12A 5FRIA 3FJQE 1SVHA 1OITA 2YIXA 3SQQA 4O96A 2GNFA 1P4FA 4RJ5A 4FODA 2X81A 3MTFA 3BEGA 1W84A 5I9ZA 4D2TA 2QOCA 5IISA 5FEQA 4KIOA 4WNOA 4JX7A 3RNYA 4WRGA 5FP6A 3FZ1A 5A4LA 2R2PA 3RK7A 4C57A 2OBJA 3HV4A 4YJRA 1KE8A 3FL5A 4V0GB 3AXWA 1BL7A 3HNGA 3G0FA 1H00A 3UGCA 2C68A 4JAJA 3KRJA 4U80A 2IVUA 2J51A 2R3IA 4XLIA 5GHVA 3RAHA 2QCSA 3ZXZA 4C34A 3FLNC 3LFAA 1YXTA 2UZOA 2V7AA 4PDSA 2RKUA 3OOMA 2WTVA 3F6XA 4I93A 4RJ7A 2GFCA 4FZAB 4IANA 3W8LA 3G90X 5HTIA 4GT5A 4BWKA 2Z7LA 1LEZA 3Q9XA 4CZUA 4CCBA 2HENA 4UZDA 4D55A 2RFDA 3E5AA 3RPVA 5JSMA 4RLKA 4C0TA 3W10A 2H34A 3CPBA 3QUEA 4XV2A 1PMNA 4EWQA 3H0YA 5E8XA 4YU2A 2I0EA 1Q62A 2BTRA 5LMAA 3Q4UA 4MAOA 3FMHA 3PA4A 5IA3A 5EFQA 3ZLWA 2HOGA 1G5SA 5H8GA 2WMQA 5CQWA 2ZDTA 4XG4A 3E87A 3E8EA 5EDPA 3WZDA 2ITXA 3KXHA 5F9EA 4JL9A 2QODA 3W2CA 5AAEA 5M44A 5GZ9A 3HA8A 1BMKA 5GJDA 3PZEA 3BYMA 2YIRA 4RRVA 4MCVA 5FDXA 4FICA 3RALA 3PTGA 4GG5A 1UA2A 4MYGA 4JDIA 5HE1A 1JSTA 2FH9A 4D9UA 4EJNA 3U6JA 4R3RA 2YEXA 3V5LA 4EHVA 2C3KA 3QTZA 4QQ5A 3TL8A 4IACA 2FUMA 4FIEA 3TN8A 4QMPA 4I21A 3TJDA 3QRJA 3HP2A 4EZ7A 3MIYA 1VZOA 2O3PA 3LOKA 3EN6A 3QFVA 4DGNA 4FV1A 1E9HA 2V0DA 2UVYA 3BGZA 3KQ7A 3R71A 4RVTA 2C47A 3RTPA 4BDEA 4BVUA 2B7AA 3KXXA 4BCJA 2UW5A 2YAAA 3AGMA 3A62A 1OVEA 2JKMA 3FMKA 3IW5A 3KMMA 2ZM4A 3OF0A 2HZNA 2XYUA 4Z3VA 3LCSA 4JQEA 5K4IA 4MX9A 5AUTA 5KZ0A 1AGWA 4DFXE 4EUUA 3RK9A 2QR7A 2EUFB 2QKRA 2ZDUA 3CTJA 3LE6A 5T6KA 4OTFA 4F1MA 5LVMA 2R3PA 2P3GX 5ETCA 4ZSEA 4DN5A 4BCMA 3F2AA 1WFCA 2BIKB 4B8MA 3NYOA 4E93A 1W83A 3HRFA 1NVQA 2OF2A 2XNEA 4IZ7A 5AAFA 1QL6A 4D2PA 4DBNA 4OAUC 2ONLA 3LW0A 1KOBA 3FZPA 4YJQA 3TUDA 4BYJA 2C69A 3TTIA 3GC9A 4XP0A 5CU0A 2VGOA 4B4LA 3BU5A 4C62A 4BDBA 2YERA 3QKLA 3NIZA 2JIIA 5DBXA 3VUDA 2XK4A 4KIKB 2JBOA 4F9BA 4U5JA 4BCIA 4BIBA 4DH3A 4IAIA 4OBOA 3QCXA 4E4XA 3QAME 3GU6A 3I0QA 4FKJA 3R1QA 4QD6A 3GC8A 4BB4A 5CNOA 4FZFB 3F9NA 4ZTHA 2WMSA 1OL7A 4JBQA 4JXFA 2G15A 2F7EE 4JX3A 1STCE 4K33A 4FVRA 5D10A 5A14A 4D2RA 4PL3A 4PX6A 5I4NA 3DCVA 2QU6A 3A8WA 5HBHA 2CCHA 1BLXA 4QOXA 2P2HA 4U3YA 1YWVA 5AV2A 5AP5A 5F4NA 4YTIA 2HWOA 4JBOA 4IB1A 3BLHA 5LVLA 5CSPA 3LFFA 1Z57A 2VU3A 3EQRA 2E2BA 2XJ2A 4G6NA 2OJGA 4I0RA 4AAAA 4EOJA 5IKWA 4ZTNA 3TZ8A 2XK3A 1OPLA 4M69A 5M51A 5AP1A 4LUEA 3UVRA 2X6DA 4FUYA 4GIIA 2GQGA 4S33A 1UV5A 2YWPA 4YJPA 4DH1A 3AMBA 4J52A 4EK4A 4DGGA 2BUJA 1PJKA 4TTHB 1HCKA 1NVRA 2JDTA 4U41A 1JAMA 4TZRA 3GB2A 3IPHA 2XB7A 3EKNA 3GU8A 3R7UA 5ANOA 3P7AA 3MFTA 3HV6A 4TL0A 5CS6A 1XH4A 2FSMX 2IN6A 3R01A 3QD2B 3BRBA 3QXPA 3MVJA 3D2KA 2QKWB 2GU8A 3QCQA 2ZYBA 5HU9A 4B99A 2FA2A 2OZAA 5ITAA 1Q8UA 5J7BA 3I1AA 4TXCA 2QOIA 4E7WA 3IG7A 2IVVA 5EK7A 2XBAA 4DGMA 5BVFA 1SZMA 3POOA 1ZAOA 3VHEA 5K9IA 1CSNA 3NRMA 4HYHA 5L2WA 1PXJA 4NM5A 2ZM1A 4PRJA 3VS5A 2VTHA 4YPDA 4X7QA 2PVYA 4FIGA 1VYZA 4B9DA 2PVHA 2YIQA 4I6BA 2YM7A 3UO5A 1BUHA 2PVMA 4FSQA 5TT7A 5E8VA 5M4CA 3QCSA 3DV3A 3ORLA 2IVTA 3MPAA 4IX4A 2WXVA 3TZ7A 3RHXA 5BPYA 3QX4A 5DR6A 2W5BA 4MXYA 3VAPA 3F88A 1YDSE 2EB3A 1KV2A 5E7RA 1H0VA 4JBVA 4FTLA 3UG1A 3LXLA 5C9CA 2IVSA 3UVQA 3OFMA 4EK5A 3K3JA 3MFSA 3QL8A 3VJNA 3CKWA 5L8KA 4HCVA 4RJ3A 5DOSA 3DPKA 5DPVA 2VTNA 4BC6A 5CAOA 3DDPA 5HCZA 1NY3A 1VR2A 1ZYLA 2VWBA 3FZTA 5AIKA 1JKSA 1XBCA 3F3UA 2XKFA 1SMHA 3PRFA 5H8BA 4HOKA 3VUMA 1WBVA 3LJ2A 4A9TA 5CF6A 2ZMDA 3P0MA 4OTHA 3COKA 4GRBA 4O0XA 2VWYA 3VS6A 3CKXA 5A4QA 2XNMA 4IFGA 2C5NA 1PMUA 1UU9A 1U54A 3M2WA 5CEOA 3QBNA 4NZWB 3VHKA 5CI7A 2XK8A 4BKYA 4E1ZA 3EQGA 5J95A 3UIBA 3WZJA 3UQFA 3OY3A 2VWXA 2XKDA 4AZVA 4KBAA 3Q9YA 1E1VA 3WIGA 2XKEA 3DBQA 3G9LX 3OXIA 3V3VA 4ZJIA 4C38A 2WU7A 5IEXA 4CFXA 2NRYA 2ZM3A 3HEGA 3U51A 4ASZA 4BTFA 3CC6A 4PPCA 5IU2A 2DYLA 3IECA 3QTQA 4ZP5A 4O38A 1PXOA 4XMOA 3ROCA 3UIUA 4FTAA 3MWUA 4WG3A 4DEBA 1K9AA 4FIIA 3HYHA 3BYSA 1YDRE 4USDA 5DT3A 3OHTA 4FIFA 4FSTA 3C4XA 4EYMA 3R0TA 4MF1A 3MY1A 4Z9LA 3REPA 5CAVA 4L7SA 2W99B 3SOAA 1FOTA 3BHYA 3DT1A 3NYVA 4E4NA 3ZRLA 2YIYA 4C4IA 2OIBA 4I0SA 3WYYA 5HVKA 3FY0A 4E5WA 4V0GA 4FKIA 3Q4CA 4PTEA 5HVYA 1CDKA 2W1IA 4ANMA 4IQ6A 2PZIA 3VUTA 3DFAA 2C6LA 3EJ1A 3ORNA 5HQ0A 1UVRA 3FC1X 4HCTA 3ZO3A 3SXFA 3G6GA 2W5AA 5CF8A 2WMTA 2VX0A 3QZIA 4IAKA 2RL5A 1R1WA 4XG8A 3KN5A 4NFNA 4NIFB 3F2NA 4W4WA 3LVPA 1H27A 5EW8A 3BHVA 1I44A 1OIUA 4M13A 4OTWA 4RVKA 4X2KA 4YUQA 1ZARA 3FKNA 3QWJA 3SW4A 4K8AA 2WB8A 3HX4A 5AX3A 1WBWA 2C30A 5AM7A 3RCDA 3K2LA 3SOCA 1GZKA 3C50A 3FC2A 3H9OA 5JT2A 3CD3A 5AP6A 3UOLA 5E8SA 4I5MA 4APCA 1OIYA 1QPDA 4FX3A 4QMOA 3L8PA 3U8WA 3U87A 4EHZA 1ZOGA 3CQWA 4FSUA 2C5VA 4P90A 2YDIA 4J95A 5JFSA 2WFYA 5ANDA 3NUPA 1Y8GA 3IOPA 3SAYA 1ZRZA 4CFWA 5J5SA 5LVNA 1SNUA 1OKYA 4RQKA 4B0GA 4I3ZA 4MQ2A 4EH2A 4HVDA 3ITZA 5AR5A 2YCFA 1HCLA 3R9HA 3RPYA 1U5RA 4FSZA 4GVJA 5J87A 3VBTA 4E26A 4IX6A 3AT4A 3NNUA 2J50A 3OBGA 3MH3A 4IB5A 1TKIA 4IWPA 3DDQA 2VWZA 2I0VA 3UP7A 2C0OA 2PZPA 3MH2A 3NEWA 4G3EA 5E91A 4TNBA 3DOGA 3QLGA 4RIXB 2GNIA 3U6IA 4Q5EA 4EYJA 3F66A 1OZ1A 1WBSA 4FIJA 4HGLA 4U0IA 3UIXA 1NA7A 2GCDA 1MRVA 3D5WA 4H58A 2VO3A 1YVJA 5K5XA 2Q0NA 3WOWA 1W82A 1OKWA 3KRRA 3UC3A 3R7GA 4I22A 4QP1A 3ZLYA 5FD2A 3GCQA 4IC7A 3RP9A 4KS8A 2W96B 4H3PA 1VEBA 5CTPA 3S1HA 1KV1A 3I5NA 3BBWA 2JKQA 2WPAA 2PHKA 5DFPA 4G17A 4GU6A 5AM6A 3LXNA 2WEIA 1SM2A 4CFUA 2XIYA 4AW1A 3UO6A 2REIA 4N6ZA 2HCKA 4BCHA 3TIZA 1PKDA 3E7OA 3QUDA 1JVPP 5EW3A 2VTLA 4UXLA 2Y7JA 2OO8X 4QMNA 4BI0A 1ZZ2A 3A7FA 4X3JA 4ZSJA 3PVWA 5EKNA 3Q9ZA 3A4PA 4KIKA 1GIIA 1OL2A 1VYWA 4WNPA 5EDQA 4EH6A 1REJA 1V1KA 4J1RA 2C6IA 2OSCA 5FG8A 3R9DA 5E8WA 2XS0A 2O63A 3HA6A 3OOGA 4WBBB 3BI6A 1CKJA 2W1HA 4R3CA 4O21A 4MWHA 4EKKA 5FXRA 2R3QA 4ZS0A 2WTDA 2V5QA 2GHLA 1FMKA 4UBAA 3FMMA 3EFLA 5JQ8A 1ZOEA 2UZNA 5AV0A 1DI8A 4ZY5A 3L9PA 4RIOA 4CLIA 4RC3A 2NP8A 4EH4A 3P79A 2JIVA 2G2FA 4GFOA 3D94A 5EM8A 3V5QA 3L8VA 5LXMA 3BQRA 3EKKA 1WMKA 3NW6A 4G3FA 5HG9A 4S31A 4GSBA 5JGDA 4PF4A 5CU6A 4GFMA 2WTWA 1KE5A 3KKVA 4I23A 1Q24A 5BQ0A 3IW8A 4IB3A 4UMQA 4AS0A 4GK3A 5CX9A 2JBPA 3PXFA 1HOWA 3H4JA 3G0EA 3F5PA 3LFBA 3FDNA 5FTQA 1UNLA 3A7JA 4IZYA 4JI9A 5HD7A 3E8CA 5HX6A 2AC5A 3TV7A 3RAKA 2VTSA 2ZB1A 4Y5HA 4OT6A 5ANGA 1OL6A 4TT7A 2JDSA 3TTJA 3ZDUA 4FT0A 4FNXA 3LCKA 4G3CA 4DGLC 3Q53A 4CMUA 1WVYA 2XVDA 2YABA 4RMZA 2XZSA 3VUIA 4EH3A 2BZHB 3PJCA 1PMVA 3GCUA 2WZJA 3DY7A 4IVBA 2A27A 3AMYA 2Y9QA 4JRVA 4MXOA 3R8ZA 4ZLZA 1G3NA 1PY5A 4CT2A 1OPJA 3E92A 2CN5A 4QQCA 3EZVA 1JLUE 4G6OA 5HCYA 2I6LA 1LUFA 3GFWA 3AG9A 4YLKA 5K0KA 3TNQB 3G33A 4J71A 3DQWA 4H3BA 4BCNA 2C6OA 3PP0A 4O1PA 3V8WA 4BCPA 5JRSA 5E8TA 4M68A 3LCDA 4WG5A 4K1BA 4I4EA 5KX8A 5LJJA 3PWYA 1WZYA 2JD5A 2KTYA 2Y8OA 2CGXA 2VD5A 3MGYA 3RAWA 3I4BA 5L8JA 4RA5A 4LYNA 3DKFA 4KAOA 4Q2AA 4U45A 5G6VA 3UJGA 4AOJA 2VWVA 2XRWA 3AGLA 4MKCA 3ZSHA 3MI9A 3PJ1A 1X8BA 4UMTA 2HZ0A 4L42A 3II5A 3QA8A 1M7QA 1OI9A 3AC8A 4EC8A 4YBKA 1ZOHA 4Q9ZA 4UYAA 1MP8A 5KMMA 3E3PA 4BDHA 4TRLA 2W1DA 3TXOA 2WAJA 2CPKE 2VWIA 3COHA 4L00A 5M53A 2OICA 1FINA 3WYXA 4WNMA 4CYJA 3S0OA 2R3JA 4USEA 4L01A 4RWJA 3RM7A 3Q5IA 5JFVA 4BTKA 3QQLA 3R2BA 3D15A 2PE0A 2F4JA 2HZ4A 1YOLA 3C5UA 3O0GA 5ANKA 5J79A 3LIJA 4MVFA 5HE2A 5H8EA 2C1BA 4RIYB 5M57A 2CJMA 2PK9A 2BPMA 2X8IA 4FT9A 3TV4A 5JZJA 1L3RE 4I4FA 1T46A 2HYYA 3W2SA 4AE6A 4QP2A 4BYIA 5J5TA 5L6PA 2C0TA 3P5KA 3GGFA 5LVOA 5AJQA 3FV8A 2CLQA 2WOUA 2XCHA 3E3BX 2HXLA 1YI6A 4S2ZA 1AD5A 2B53A 3CQEA 2ITUA 3D4QA 3KN6A 4Y8DA 3QRKA 3GCVA 4BCOA 4YJNA 4E8AA 5IG1A 5J9YA 3MVLA 4G34A 3ZH8A 2WMRA 3H30A 4IM0A 5DT0A 4PMPA 3O7LD 1YXXA 4DEGA 4HCUA 1R0PA 2XP2A 4HGSA 4E73A 2YHVA 3EZRA 3CY3A 3PZHA 3CPCA 4FG7A 3FZOA 1YHSA 5CQUA 4ANNA 1YXVA 4EK3A 3BPRA 3C0IA 3EN4A 4AW0A 3MY0A 4ZSGA 3ORMA 4MBLA 1OL5A 1BKXA 4ZZNA 5IH6A 2BHHA 3AC4A 3KVXA 5CEKA 2B54A 2UW6A 3DK7A 3JVSA 3UMWA 5JMSA 3RNIA 3LM0A 3FYKX 3SLSA 4QMWA 4AN9A 4C3PA 2XIXA 3QRTA 1XJDA 4X0MA 4YJVA 5IF1A 1M2QA 4BZNA 4ITHA 3EQHA 5D7AA 2J9MA 4PTGA 3OC1A 3L1SA 2JIUA 1IASA 5EH0A 3TUCA 1CM8A 2E9VA 4QTCA 3UBDA 3D5VA 4ZTSA 1Q3DA 2IZTA 5KNJA 3F3ZA 5BUEA 5M56A 1CTPE 1Z9XA 5LWNA 4M97A 3L9LA 4NU1A 5D11A 2OIQA 2WELA 2W4JA 3U6HA 3MDYA 3VF9A 3RKBA 4QPAA 3M42A 2XIKA 2OWBA 5IUIA 4BF2A 4EOSA 1YWNA 1Q97A 1RW8A 4OTRA 3V6SA 4AW2A 3ORPA 3QF9A 3EQPA 3FLYA 4W4VA 4XJ0A 1H1SA 5KMLA 4LOPA 3CE3A 2WQMA 3LM5A 3PSCA 4ACHA 3H10A 1PHKA 4J99A 5M4FA 4P4CA 1JKKA 3LJ0A 4RWKA 4X6QC 2YISA 4AW5A 4BDDA 4E5BA 2FO0A 4F0GA 4J96A 2W7XA 5DR2A 4OAVB 4OBQA 3PVBA 3D5UA 4IWOA 4X2JA 1PXMA 1GIHA 3V04A 4RJ8A 1UWHA 3WZUA 5KE0A 4J8MA 1FPUA 2B52A 3GXLA 3ULIA 4IM2A 3PG3A 4RPVA 5CY3A 2R0UA 3ZZEA 3PY3A 4C8BA 5D7VA 1RQQA 2X2LA 2XK9A 5F95A 4MXZA 3QCYA 4IWQA 4QMVA 1P14A 2ETRA 2JFMA 2AUHA 1DAYA 4PL5A 5DNRA 3UYSA 4RIXA 4X2GA 2J6MA 3OD6X 4M67A 4KKEA 1ZXEA 4I92A 5ANIA 3VS0A 3BLRA 3Q4TA 4OTDA 2O65A 3UVPA 5IA0A 5CF4A 4X3FB 2WTCA 4LMUA 2C6KA 2QOQA 4FA2A 5DLSA 2GNJA 4P2KA 3S95A 2XJ1A 5DHJA 4FKOA 4UMUA 2I0HA 4IIRA 2XBJA 3DKOA 2W1FA 4BCFA 1Y6BA 3NPCA 4ERWA 2YFXA 4JIAA 4AFEA 2UW0A 4BWXA 2JAMA 4RJ6A 4WIHA 4BL1A 4RJ4A 4M3QA 3VRYA 4ACCA 2G01A 2HZIA 4KBKA 1SNXA 3R8UA 1YI4A 2HY81 3U4WA 4ANLA 4CTBA 4L44A 4E6CA 4W4YA 1Y91A 3IW6A 4MK0A 3VO3A 4K9YA 4JDHA 3DBCA 2H6DA 2X2KA 5AUXA 3UOKA 3C0HA 4C36A 2QNJA 3GQIA 3G6HA 4UX9A 2WOTA 4FV5A 3TKUA 4PP9A 2Z8CA 3PWDA 3HVCA 3NNXA 2O2UA 4J98A 5M4IA 3BU6A 4CXAA 2IJMA 2J90A 4MD9E 2Y0AA 3H3CA 4P5QA 2BZJA 3VC4A 3FUPA 5EYDA 1NXKA 3JYAA 4EL9A 4ASEA 3IQ7A 5EM5A 3COIA 4YJTA 2YJSA 5E1SA 3AC3A 2G9XA 4UN0C 5JK3A 5LVPA 3W2RA 1KWPA 3DB6A 3JXWA 3WI6A 4ARKA 5JKGA 1E1XA 5IMXA 3NDMA 4H3QA 1OIQA 2FVDA 5DH3A 5ANJA 2IW6A 2WD1A 2QONA 4II5A 4CKIA 2R3LA 3AC5A 3D0EA 4BDFA 4DEEA 1BL6A 4BWPA 3MSSA 4S34A 4CKJA 4A9SA 3UZPA 2F7XE 3C1XA 5I0BA 4EI4A 4D1ZA 4Z7HA 1XH6A 1B6CB 2BFYA 1R39A 3UODA 3NNVA 3ZBXA 4F9AA 4LL5A 3ZFYA 3QLFA 2UW9A 2W1CA 3KRXA 2A1AB 2XK7A 2YDKA 4G9CA 4D4YA 4FKQA 3RGFA 5E8YA 3OP5A 4KWPA 3R9OA 1CKIA 3RCJA 4BDCA 5C1QB 3R63A 4U97A 3PVGA 4K18A 5L2IA 4QYFA 3DAKA 5J7HA 4DG2E 3IGGA 1XBAA 4WSYA 4IDTA 2J5FA 5IH4A 5HBEA 4YJOA 4RC2A 5AUWA 5CXZA 3F82A 4CV9A 1PXLA 3P08A 3ZS5A 2JAVA 5E8ZA 5KBRA 4BHNA 4EBWA 4HYUA 1ZWSA 4F63A 4UXQA 5EHLA 5CAQA 1ZMUA 3O17A 2GTNA 4EH7A 2R3KA 4LFIA 1TQMA 4FKTA 3MFRA 5A4TA 3E8DA 4O91A 5CF5A 5J1WA 4I6QA 3Q96A 3R73A 5HNBA 5JRQA 3NYNA 5KHXA 2OXDA 3ZONA 4GG7A 1JOWB 3EN9A 2J0KA 3WILA 3BV2A 2VTIA 2GMXA 2OJ9A 5AP2A 4AT3A 4FC0A 4O6EA 3EOCA 4MTAA 4GEOA 3BWFA 3HMIA 3ZU7A 5IUGA 2OJIA 4NM0A 3LZBA 3OROA 4C33A 3GUBA 4UY9A 4XBUA 4QP7A 2XCKA 4HJOA 1OGUA 5M4UA 2ZB0A 3ACJA 2QLUA 2GTMA 2I40A 2XA4A 2BRHA 4PPBA 2C3LA 3PIZA 2EU9A 3OZ6A 4GL9A 2BAJA 4RG0A 4EC9A 1XH5A 3E63A 4IAAA 1Q5KA 3EYGA 4DEDA 3Q60A 2GFSA 1MRYA 2PE1A 2RF9A 2OU7A 2VTJA 3QD0A 4XG3A 2OXYA 3H0ZA 2ZV9A 2VUWA 3HMMA 3IW7A 4XHKB 4FTIA 3VBQA 3KXZA 3OEZA 2HW6A 3ORKA 2R3HA 3IKAA 1Q41A 3ZLXA 4X2FA 3ZXTA 4EK6A 4D28A 2UVXA 3QC9A 5FP5A 5TR6A 5AUZA 4WKQA 4RIYA 3FZRA 4ITIA 4WO5A 5CSXA 3QYZA 3R7OA 4CSVA 3ORIA 4LL0A 4YP8A 2YM8A 2B9FA 2W05A 4QP8A 3HMOA 4FV6A 3KRLA 3AC2A 4FYOA 4AUAA 3VRZA 4YC6A 4F7LA 4Z7GA 1M14A 2OZOA 4E3CA 4YPSA 4WA9A 4BDKA 5HIDA 5IA2A 3NAXA 3QA0A 4YHFA 4D58A 2X7OA 4ZTQA 2WMUA 5CAUA 1H0WA 3OS3A 1OUKA 2BDJA 3TWJA 3BIZA 2QHNA 4Q9SA 4AE9A 1PXNA 4CVAA 2HAKA 4TYHB 4FNYA 3E93A 4N6YA 3EYHA 4XS2A 2F7ZE 2BRMA 3EQBA 4DFZE 3MA3A 5FEEA 3MBLA 3MFUA 4TYIA 2QHMA 3GU5A 3UO4A 3C13A 3HL7A 3HUCA 5AR3A 1QPEA 3R02A 4A9YA 2HXQA 1ZYJA 2NPQA 4X3FC 4OTIA 2ZV2A 3IS5A 3CTHA 3R7IA 4AGUA 2WMXA 1CKPA 1H07A 3U9NA 4CMOA 1GZ8A 3P23A 4U79A 4GJ2A 5FBNC 4BGHA 2YLEA 2ZV8A 5CU4A 3KCFA 3MA6A 5LMKC 3PE1A 4ANSA 2QOLA 4DGOA 4CCUA 3D2IA 5IPJA 2VAGA 5BYZA 5KMOA 4NUSA 3I5ZA 4G1WA 4F08A 4ZEGA 2EWAA 4R1VA 3HMPA 3TZMA 3MV5A 3D7TB 4C4GA 4FG8A 2WO6A 4YZ9A 1YHWA 3R83A 3ZTXA 2Y4IB 4UZHA 4D2SA 1KE7A 2X4ZA 4G16A 3QZFA 4PY1A 4AACA 5CZHA 3FPMA 3TIYA 3VS1A 3PPZA 2H8HA 4L7FA 1MQ4A 4IC8A 4GIHA 3WBLA 2WMWA 1ZMVA 3MN3A 2X8DA 4YO4A 1U4DA 2VN9A 3QUPA 2PMNX 2WKMA 5ETAA 3ET7A 5FEDA 3P78A 5L2QA 3GU7A 4JQ8A 4TYGA 3RINA 5B2LA 3F5GA 4EHEA 2XJ0A 2O5KA 4V01A 5GJFA 5CALA 3FXWA 4YC3A 5I9YA 5GZAA 4QP9A 4YZNA 5FDPA 2PZRA 2HWPA 1UU7A 3KA0A 3A4OX 4I5CA 5AA8A 3NUUA 3EL7A 4BCKA 3QU0A 2J4ZA 1YOMA 4O22A 4QYEA 4JVGA 4C3FA 3AMAA 4Z16A 1TVOA 4RIWB 4OTQA 4I20A 4LMNA 1M17A 2GHMA 2C1AA 4AWIA 3E7VA 1IEPA 1IRKA 2QLQA 3GEQA 2R0IA 2GDOA 4O0VA 4AN3A 2R3RA 3C4FA 5DRBA 3D9VA 3WZEA 5HG8A 4X3FA 1V0OA 5J9ZA 5CU3A 3B8RA 4LRMA 4AA0A 4EH9A 3R8LA 2B1PA 2X9EA 4Y95A 3F61A 3UYTA 2DWBA 4JJRA 1WAKA 4LQMA 4QP6A 5HD4A 5HO7A 2C5YA 2E9UA 4K2RA 3FYJX 3V6RA 3GOPA 3P4KA 4QMSA 4D5HA 4FV0A 4QPMA 3CGOA 4IE9A 4M8TA 2J7TA 4FTTA 1SYKA 4RVLA 2BKZA 4A4XA 4AT5A 3KCKA 4F7JA 2RFNA 3RHKA 4F6SA 4ZY4A 2PMIA 2ERZE 2GNHA 4NT4A 5B2KA 3IDBA 1YHVA 3VUGA 4RX5A
chains in the Genus database with same CATH superfamily
2P0CA 5GZ8A 3FE3A 4FL2A 3IOKA 4F6WA 2GHGA 3CR0A 4A9RA 4YSMA 4D4SA 2XNBA 4U9AA 3KVWA 4YHTA 4FTOA 4ACDA 3NUNA 4FTRA 1T45A 3CEKA 3PXQA 5BYYA 5J1VA 3D7ZA 2YIWA 4GYGA 4GK2A 1PXKA 2OFUA 2W4KA 4XP3A 4QMLA 5C27A 1ZYDA 2OF4A 4HZSA 4E6QA 3MPTA 5A6OA 1J1BA 3R22A 4PP7A 3PSDA 4LRKA 4MD7E 4N0SA 4QMTA 2ITVA 1IR3A 4NM3A 4OGRA 4TW9A 4XH6A 4DG3E 4TWCA 4MH7A 2C3JA 4IX3A 3VIDA 5AV4A 1JBPE 4D5KA 4EHGA 1A9UA 3PIYA 4IAZA 4W8DA 4GJ3A 3ORTA 4FI1A 2WMAA 3Q04A 1DI9A 5ETFA 3ZC5A 5HVJA 4DCEA 3JS2A 5EDRA 1WCCA 3P7BA 1JWHA 2VTMA 5AUUA 3D5XA 3I7CA 3SA0A 4FUXA 2EVAA 4DG0E 4ZTRA 3SDJA 2PE2A 4QTAA 2PMOX 4NTSA 4ANQA 4CRLA 3FMDA 4J97A 4KRCA 4MXAA 3UIMA 4XV3A 3ZO1A 3UQCA 3BHUA 2IZUA 4FTQA 4R5YA 2PVFA 4FNWA 3LQ8A 4YR8A 4RX7A 2F57A 4TN6A 5KKRB 3A7HA 1FVVA 2ETMA 2HY0A 5I3RA 5IA4A 1IG1A 3F5UA 2Y6OA 1M2RA 4ALWA 3HDNA 1JQHA 2WQOA 4L45A 1H01A 1FQ1B 3QTIA 3T3UA 4O6LA 5AEPA 4I5HA 3AT2A 4XV1A 4M84A 2OXXA 5J9LA 3NSZA 2VX1A 4YJSA 5FQDC 4AZSA 5AR2A 1H1QA 2WQNA 3S4QA 1U46A 4G9RA 3GC7A 3AC1A 4XRJA 5JFXA 1TQPA 4S32A 3O71A 3PG1A 3ALOA 3FBVA 3UQGA 4DEHA 4RZWA 2W9FB 1H26A 3C4EA 3JY0A 3PFQA 2R5TA 4L3PA 2JKOA 2GS6A 4IJPA 4H1MA 4YO6A 4LI5A 5CASA 3CJGA 4WNKA 2E9PA 4X6RA 3SX9A 5C8KA 2QOHA 3QTRA 3KEXA 3MB6A 1GZNA 3LXKA 1LEWA 4UV0A 3CJFA 4IBMA 4QYHA 4CZYB 3OWPA 1OM1A 1QPJA 5HE0A 2Z7RA 4L52A 3TNPC 5AIRA 5AV3A 4RLLA 4DFLA 1H28A 3FXZA 2CGWA 4QYGA 4R7HA 3C7QA 2ITZA 4OTGA 4QMXA 2QI8A 5HORA 4E4LA 2YA9A 4DEIA 4CEGA 1WBPA 4CYIA 1M52A 2W9ZB 3V5TA 4EONA 1GZOA 1UKHA 3R2YA 4FKVA 5DVRA 4LGDA 3HUBA 4Y5QA 2GNLA 3QHWA 5CENA 4FR4A 2B9JA 5I3OA 4DC2A 3LFSA 3PE2A 1O9UA 2BVAA 5A6NA 3PA3A 2ITOA 3GQLA 4M14A 5BNJA 2UZWE 4HPTE 3Q3BA 2BFXA 4FKUA 2YN8A 3A99A 1YW2A 3EMGA 2ITTA 1QMZA 5JGAA 4MWIA 2JDOA 3Q4ZA 3OY1A 1JNKA 3F3VA 2Y4IC 2P4IA 4N70A 1K3AA 2WQBA 4BBMA 4CFNA 2IW8A 2F2UA 2VTAA 5C01A 3PYYA 3TUBA 4WHZA 3DQXA 2BCJA 2XNOA 4QRCA 2UW3A 2GS7A 2QD9A 2WEVA 3I81A 2BAQA 5CSVA 4JS8A 2QOBA 5LCJA 2R7BA 5E92A 3L8SA 4IMYA 4ONAA 3AD5A 4ZIMA 2WIHA 4CLJA 4Y46A 4EOPA 1QCFA 3SHEA 2BZKB 4R5SA 4YLLA 3BGPA 1UWJA 4XG7A 2QO9A 5AUYA 4R7IA 4NH1A 3FLZA 4Q5HA 2WGJA 2QVSE 4IX5A 2X6EA 3OCGA 4RX9A 4KRDA 4XEYA 2YCQA 3TCPA 2FYSA 2XNNA 4XX9A 5L2SA 4UALA 3AD6A 5CEQA 5CANA 2A19B 2PVNA 1H25A 3FLWA 3QD4A 4RZVA 3DK6A 5T68A 2Z2WA 3CCNA 3CTQA 2OG8A 2YM6A 3QC4A 4MBJA 5F20A 3THBA 1JKLA 3G9NA 3GFEA 3V01A 2FSTX 4TKSA 5JZNA 4CT1A 2C4GA 4ZK5A 3FLQA 4ITJA 5F94A 2BIYA 3O8PA 3ZFMA 4U44A 3HRCA 1A06A 3HDMA 3WF5A 2ZOQA 1PF8A 2PVLA 1REKA 4D4VA 2JDVA 3SRVB 3TNWA 4C4FA 3PP1A 1FGIA 2OJFE 3QX2A 4L6QA 5BVKA 5EM7A 3EFJA 4ACMA 4L3LA 3KXMA 4FSRA 5EI2A 4AZEA 4ANBA 4F6UA 3IK3A 4W8EA 2UW8A 2VTOA 3F3TA 3NUSA 3DJ5A 3K5VA 3ORZA 3OWKA 3JY9A 4CNHA 3PJ8A 2R9SA 3UG2A 3NLBA 4JAIA 5AR8A 3P1AA 3G5DA 4G5PA 2YACA 4QTEA 3G51A 2OI4X 2YM5A 3DJ7A 3QHRA 4FV3A 2BRGA 1R3CA 3D7TA 3ENHA 2IO6A 2R3NA 3U4UA 2F49A 2VTPA 3OTUA 4NJDA 5HIBA 3ZZWA 4LM5A 4EOOA 3UMXA 2WMBA 3E8NA 3VBWA 1YDTE 4PUZA 4JIKA 3DS6A 3A2CA 3F5XA 3V5JA 1ZY4A 4FOBA 2C6TA 1XH9A 2R7IA 4F64A 4Z55A 4G2FA 3KRWA 1XKKA 3VWAA 4BI2A 5AADA 4QTBA 4AGDA 1W98A 2JDRA 2QC6A 4GU9A 3OT8A 4BGQA 2JKKA 4AA4A 4AG8A 3ZSGA 1URWA 4KIPA 3KF7A 3T9TA 2B55A 5CU2A 4EK8A 4CQGA 3SW7A 3QALE 1Q99A 4WUAA 2F2CB 2R4BA 4W4XA 1S9JA 4QMZA 4ASXA 4RQVA 3UTOA 1XR1A 5LOHA 3HGKA 1XH8A 3EQCA 5EYCA 4KKGA 4TYEA 3TG1A 3ZC6A 3EFKA 3OBJA 4AZWA 3TKHA 4O0TA 3DTCA 4BDGA 3U9CA 2YCRA 4HYSA 4JNWA 3NAYA 4L43A 4FZ6A 2PL0A 1AQ1A 5EHOA 5DT4A 4UWCA 4NW5A 1ZYCA 2X9FA 3GT8A 4S30A 4MBIA 3CD8A 3IDPA 3O2MA 5IMEA 5JFWA 3BCEA 3VS4A 4GUEA 3FQEA 4QTDA 3L9MA 4UWBA 1F0QA 3PUPA 3Q32A 4AN2A 1OIRA 4L8MA 2QOFA 5TE0A 2W1ZA 4O2ZA 4RFYA 5L3AA 4U43A 5HLNA 3R00A 5KKRC 4I41A 4KIQA 4D0XA 4NIFA 3VS2A 4GT4A 5EYMA 3SXSA 4E6AA 1BI7A 4EQUA 5LARA 3GBZA 5K4JA 3IDCA 1W7HA 4IAYA 2YAKA 5ETIA 1LPUA 5ICPA 2CGVA 4WT6A 4ALVA 4G3GA 5JH6A 2ZMCA 5AR7A 3F69A 2E9NA 5HHWA 5KHWA 4C35A 3DKGA 3HP5A 3T9IA 4TPTA 2UZEA 4GUBA 5AP7A 2ITPA 4PMTA 3V8SA 2C5XA 4BZOA 5DMZA 4G31A 3LHJA 4L9IA 2PVRA 3TNHA 3UDBA 3FI3A 3R6XA 5C03A 2C5OA 4UMRA 4BBFA 3L8XA 2EXEA 3KULB 3PSBA 4RWLA 3OWLA 4C7TA 1OECA 4QMQA 1F3MC 2ERKA 1DS5A 2XM8A 1WVWA 4HGEA 3MPMA 2BALA 3UE4A 2W1GA 3DLSA 4KKHA 4QMYA 3PA5A 3V51A 5KMJA 4XV9A 4OBPA 2W4OA 3LQ5A 4GH2A 4NWMA 4A4OA 2BROA 4TWNA 2V55A 4BBEA 3SV0A 3DA6A 4F99A 4CKRA 3O8TA 4UWYA 3LFCA 3QGWA 5A54A 1OKVA 2VNWA 3PPKA 4UB7A 4IJ9A 4ZXTA 5B2MA 1H1RA 3ANRA 4HVSA 2CSNA 2JITA 3PIXA 2YCSA 4G3DA 5HLPA 5LWMA 5IDPA 4ALUA 1J1CA 3JVRA 3ZRKA 3NGAA 4BKZA 4CD0A 4CQEA 4HVIA 3LAUA 1YWRA 4NJ3A 1EH4A 5ACKA 5KZIA 3BKBA 2VNYA 3QTXA 5TF9A 5EHYA 2OK1A 3KK8A 3DTWA 2P55A 4O0SA 2OKRA 3VW6A 1XO2B 3HMNA 2A2AA 3JUHA 2UW4A 2XEYA 3R7VA 4YZMA 4NM7A 5BVDA 1PXIA 3VF8A 3KGAA 3WZKA 4XOZA 5D1JA 3EHAA 4ACGA 2X0GA 4XNEA 1M2PA 5CEIA 1ZZLA 2XH5A 3GI3A 3O23A 4AX8A 4BIEA 4HGTA 2OJJA 4M66A 2R3OA 3COMA 2A0CX 2NO3A 2E9OA 3I6WA 3KU2A 3Q2MA 4AT4A 4ZAUA 2J5EA 3F7ZA 3KXNA 1YI3A 3NS9A 3OCSA 4QQJA 4FSNA 4KS7A 3OWJA 5E1EA 4CV8A 2VRXA 4F9WA 3TT0A 2HIWA 4ZSAA 4QYYA 3NUXA 4MQ1A 4DINA 3EB0A 4N4SA 4EQCA 2ONLC 2X7FA 3LJ1A 4RBLA 3W55A 3QD3A 5J8IA 4U42A 4YTHA 4E6DA 5AMNA 2VX3A 4RVMA 3W2PA 4FYNA 4F09A 2QR8A 2UVZA 2ITWA 2XNGA 2YLFA 4QNYA 4XG2A 4FKWA 4ZJJA 4J8NA 1VJYA 4IWDA 4H39A 2BR1A 2ESMA 3DAJA 3RWPA 4B6LA 2X4FA 2OFVA 4OW8A 3LFEA 5CWZA 3BWJA 3W16A 2VZ6A 5E8UA 4WD5A 4YZCA 5HO6A 4NCTC 3HRBA 4IVCA 4YNOA 5A46A 4C37A 3VQHA 1J91A 4EOIA 3QWKA 4IFCA 4A4LA 2PZYA 2WQEA 3E88A 4FKLA 4YBJA 4DHFA 5F1ZA 1JKTA 4DH7A 4YSJA 3ZYAA 2JFLA 3I7BA 4G6LA 3RVGA 4DYMA 3TKIA 4I6FA 2ZVAA 4XLVA 2IW9A 4QMMA 4LG4A 1JSVA 5AR4A 2J2IB 3EH9A 4ZOGA 2EXCX 3PY1A 4FSWA 5DEWA 5KCVA 5K0XA 3P86A 5CVFA 1H1PA 3O8UA 2Z7QA 3AOXA 4IH8A 4BDAA 3VBXA 4XG6A 4MHAA 2V62A 5EI6A 2X7GA 5EKOA 1PW2A 2VO6A 3A8XA 3UNJA 3BU3A 5IH5A 4BDIA 4YLJA 4ID7A 3OXZA 2ITYA 5CSWA 4C59A 4XYFA 5CEMA 4OT5A 4F70A 1OUYA 3FHRA 3LLTA 1KOAA 4K0YA 4X2NA 4GMYA 3R30A 4YZBA 3ELJA 2PUUA 3VUHA 3MH0A 4PNKA 2XIZA 4IB0A 3DLZA 4NK9A 3TV6A 3QRUA 4G5JA 4AU8A 2G1TA 3ZHPC 3SD0A 3ZUVA 3QTUA 4E4MA 1FVTA 3SKCA 3V8TA 1UNGA 2WHBA 4RT7A 3R8MA 4ERKA 2WTKB 1GAGA 3SC1A 3NWWA 5T3QA 3ZBFA 3ZDIA 1URCA 4I24A 4M0ZA 3B2TA 4I6HA 4BIDA 5I5ZA 3ROYA 3FZSA 3LFDA 1K2PA 4M12A 4U3ZA 5HLWA 3WF9A 2C6EA 4IEBA 3DU8A 4I1ZA 4NCTA 3VW8A 4JOAA 4F7SA 3SRVA 2OH0E 4FTJA 2RSVA 4H1JA 2BMCA 2WU6A 3PXYA 3QYWA 5CYIA 5EI8A 2OIDA 2AC3A 2QURA 4RC4A 4A06A 1S9IA 3FLSA 3GCSA 4D0WA 3D83A 4O4FA 3GC0A 4EBVA 4ZJVA 3PXKA 2DS1A 4KSPA 5CZIA 3ORXA 1DM2A 5HKMA 5AWMA 4PV0A 5DN3A 4ZLYA 3RI1A 3CGFA 5HOAA 5LQFA 2B4SB 3I0OA 2VO7A 1V0BA 3C0GA 3MY5A 4HVHA 3BYOA 2J0JA 4QT1A 1Q4LA 5I9XA 4F0IA 2DUVA 3L9NA 3PY0A 4B7TA 3BE9A 1MQBA 1LP4A 3QGYA 4U7ZA 3T8OA 5IUHA 4FT5A 4L3JA 5HU3A 4IVDA 4JT3A 4YC8A 3QQGA 5HGIA 3CLYA 2WMVA 2JGZA 3QRIA 3RPOA 4DTKA 3KF4A 1DAWA 2XEZA 3ANQA 5DIAA 5IZFA 3E64A 1O6LA 3LXPA 1B38A 4GS6A 2PZ5A 2WTJA 2YDJA 3HV3A 4GVAA 1GY3A 4AZTA 4KNBA 3AD4A 5KMKA 4U8ZA 4MD8E 1H1WA 3OUKA 4O2PA 5L8LA 3MIAA 2KULA 3UC4A 2C0IA 1RJBA 4D4RA 4M15A 2Q0BA 3BZ3A 4EZ3A 2CKEA 4QP4A 4C4JA 4GFGA 4YGAA 4XUFA 3NNWA 5TOZA 3VN9A 4FKGA 4BI1A 2XF0A 4CFVA 1XWSA 5DEYA 4MEDA 2IZRA 2VGPA 4K11A 4WSQA 1ERKA 3B8QA 4YHJA 4ZZMA 4WUNA 3F7WA 3UZTA 4NEUA 2CDZA 2QQ7A 2Y4PA 3CBLA 3M1SA 4PDPA 4RFZA 3R8VA 2CGUA 4FT7A 4JG7A 4RSSA 1WVXA 5HESA 5BMMA 1PYXA 3HKOA 2QO7A 3QQKA 1Z5MA 4FL3A 4JR7A 2R3FA 5D41A 5LMBA 1O6YA 3VNTA 5L2TA 4Y73A 4IM3A 4FEQA 4ZTLA 1OPKA 2H96A 4LUDA 3DKCA 4KABA 4IZAA 1TQIA 5DWRA 3UPXA 4D9TA 5A4CA 1XBBA 3K3IA 3CY2A 2GS2A 1FMOE 5CXHA 4MXXA 2NRUA 4U81A 3BYUA 4AGWA 3MYGA 4K77A 4BZDA 4HYIA 3I6UA 5DA3A 3OTVA 5AUVA 4BN1A 4OLIA 1W8CA 5AV1A 3TJCA 5K3YA 3ZO2A 1QPCA 4YNEA 4LOOA 3DZOA 4D1SA 4UMPA 3DZQA 2YZAA 2CN8A 1GNGA 2W17A 2HELA 3BELA 3BX5A 3CP9A 3FWQA 4PMMA 4QP3A 3RPSA 5DRDA 1V0PA 3MH1A 5FM3A 5HCXA 4HNFA 5ANEA 4KBCA 5HI2A 5EYKA 4AQCA 2W06A 2UZDA 2P2IA 5IDNA 3IONA 1UKIA 2BRBA 3RM6A 5HTCA 4CFMA 2XUUA 4R6VA 5CT7A 4RWIA 1YXSA 4FTUA 3QQJA 4BCGA 3N9XA 1PYEA 4DFNA 2FB8A 5GNKA 3MVMA 4JBPA 4ZLOA 4AOIA 2GPHA 4TYJA 3I79A 2R3MA 3B2WA 5TKDA 5FM2A 3Q6UA 4J7BA 3C4ZA 3RBWA 3R9NA 4FZDB 2EXMA 3DBEA 3NW5A 1BI8A 3WF6A 3NIEA 4C61A 1RDQE 4FT3A 2SRCA 2BHEA 1Q3WA 4AOTA 3WF8A 4AXAA 3NX8A 4X21A 5KUPA 5FTOA 4DAWA 2UV2A 1Y8YA 5B7VA 4FK6A 4MNEB 5HZNA 1H08A 4NSTA 1F5QA 1WBNA 3EL8A 3O7LB 2UW7A 5AA9A 3ZSIA 2W1EA 1LR4A 2BILB 4PL4A 3VULA 2ITQA 4F7NA 2ZV7A 4C02A 4FOCA 3PPJA 3OMVA 3DJ6A 4FGBA 4MF0A 3EN5A 5EG3A 5LMKA 1YOJA 5FLFA 5EW9A 3CXWA 4FVQA 2RGPA 3G2FA 4HNIA 3DGKA 3EN7A 2EB2A 3O51A 4GW8A 5IA5A 4D2VA 4L53A 4ZZOA 1PKGA 4FL1A 4Y72A 4H36A 3VUKA 5HO8A 3FI2A 3F3WA 4J53A 4DH5A 3S2PA 2WTIA 4WBOA 4FK3A 3GCPA 3OCTA 2IZSA 4FRFA 4HVGA 2V7OA 4B8LA 4ZTMA 3AT3A 4JR3A 3TNIA 4PMSA 4TNDA 5LCKA 3M11A 3ZMMA 4CZTA 3A60A 3HV7A 4W9XA 4ANOA 1B39A 4IDVA 1P2AA 2UZVA 2ACXA 4I94A 3QQFA 4UYNA 4ZY6A 3KK9A 2V22A 2WIPA 3PXZA 5AP3A 3ODYX 3OCBA 4IAFA 3O96A 5CVGA 4R8QA 5HE3A 4BTMA 1U59A 1ZY5A 3DNDA 3EFWA 4NW6A 4PWNA 3DNEA 5DG5A 5FGKA 2CMWA 2FSLX 3IO7A 2PVKA 2O0UA 3FAAA 5DR9A 2JC6A 1W2FA 3FI4A 3DFCB 4AZFA 4E5AX 3FMEA 2WTKC 3BHTA 4FTCA 4FV9A 4FNZA 1NVSA 3V5PA 1FVRA 3KL8A 4BRXA 2XM9A 5A9UA 3LCTA 4USFA 2XKCA 2C6DA 5HICA 5AP0A 3QKMA 3R8PA 3VVHA 4I0TA 1CMKE 5I9WA 3NW7A 3R28A 5CAPA 4YURA 3H9FA 5DGZA 1YQJA 2PWLA 4DFYA 5L6OA 2BDFA 2UUEA 3AQVA 3C9WA 5JGBA 3KY2A 5IA1A 1Q8ZA 1MRUA 3BE2A 3K54A 3WIKA 2BZIB 4KA3A 1H4LA 4EORA 4F4PA 5IEYA 1APME 4V04A 4PTCA 4O27B 4ZSLA 3FKOA 3GU4A 3RWQA 3HZTA 5L6WL 3HECA 3FSKA 4EKLA 2R64A 1KSWA 2OGVA 1YRPA 4F1TA 4I5PA 2BAKA 4APPA 1UNHA 3NYXA 3GNIB 3EQDA 3ZO4A 3JPVA 4RX8A 4XP2A 5HNGA 3GOKA 2VTQA 5C8MA 4EWHA 4BHZA 3HLLA 2LAVA 3UP2A 4IZ5A 4XBRA 2DQ7X 4EEVA 3KC3A 1Y6AA 4OR5A 1U5QA 5HEZA 3K5UA 3BGQA 1IA8A 5KMIA 1SVEA 4KB8A 4LGGA 3SXRA 1ATPE 4JRNA 4FVPA 5H2UA 4FKRA 5IEVA 1Q8YA 3QZGA 4A7CA 5FBOA 3FQSA 2WNTA 3GENA 3RK5A 2W0JA 2PSQA 2RG5A 2X39A 2BTSA 3MVHA 4IXPA 4O0RA 1KE6A 3W1FA 5DI1A 3R7EA 1YXUA 4XG9A 4FIHA 3FSFA 4ENYA 4NFMA 5CT0A 3ZUUA 4D2WA 1WBOA 3FY2A 5K5NA 2VTTA 2GSFA 4F1OA 4GCJA 5ACBC 1M7NA 1Q8WA 5C26A 3BHHA 5H3QA 3R04A 3TZ9A 4L46A 3KXGA 4V05A 5BUIA 2VV9A 4C4HA 4EZ5A 4KINA 3W33A 3BQCA 4F9CA 2BDWA 2Z60A 4LGHA 1XHAA 3ZM4A 4IW0A 2AYPA 2X2MA 1UU3A 3W32A 3TACA 3A7IA 5I9UA 4LRJA 5I9VA 3KB7A 4LOQA 3EIDA 4MXCA 3MTLA 2R3GA 3MW1A 3PXRA 4FKSA 4QPSA 4FTNA 5EM6A 5CNNA 4E20A 4F65A 3DAEA 4ASDA 4O1OA 1MUOA 3H9RA 3DBFA 4FMQA 2YM4A 4JDKA 3N51A 3RAIA 2CHLA 2JLDA 4FZ7A 4LV8A 3EWHA 3VS3A 4TWPA 2X0OA 2J0MB 3ZLSA 3UNZA 2CLXA 4F0FA 5BVOA 5GJGA 4HPUE 4W9WA 2GNGA 3NUYA 1PXPA 3UNKA 1UU8A 2OW3A 2UZLA 2X1NA 2ZJWA 3CQUA 4IVAA 5G1XA 3DBDA 2ETKA 5HX8A 4WOVA 3MJ2A 3T3VA 3QKKA 3LPBA 1R0EA 4EOLA 1O6KA 3ZEWA 2I0YA 4GYIA 3QXOA 3VS7A 2G2IA 4IHPA 2F9GA 5CSHA 3UPZA 5BVEA 5KBQA 2LGCA 3LFQA 4OTPA 4AFJA 1GOLA 2RIOA 4OUCA 3VBVA 4UEUA 2C3IB 3O50A 3Q9WA 2VTRA 4GV1A 5A3XA 3KFAA 4WRSA 4KD1A 2XMYA 5HNIX 2PY3A 2UZBA 5HTBA 3S00A 5D9HA 3QQUA 3TEIA 5CLPA 3WE8A 4P7EA 2H9VA 1OL1A 1PMEA 4BCQA 4RGJA 2YITA 3KMWA 3BEAA 5JQ5A 3ZEPA 2J0LA 4D1XA 1H8FA 3DB8A 5AAGA 3ZCLA 4C2WA 5AX9A 3FMNA 2BRNA 2UZUE 3FMLA 2ZAZA 4FBXA 4BTJA 3W2OA 4AF3A 5BMSA 4DH8A 4TYHA 4R3PA 3RPRA 3NR9A 5CEPA 4L68A 4YTFA 2P33A 4GT3A 4XOYA 1Q61A 3PRIA 2Z7SA 4QMUA 5HG7A 4RA4A 3NZ0A 2VWUA 5HG5A 3R7YA 4BDJA 4Y83A 4LV5A 1ZMWA 3ENMA 1SVGA 4HZRA 4PNIA 3IW4A 4FV8A 1P4OA 3UOHA 2PMLX 3TI1A 3FQHA 5L4QA 3E62A 4L67A 4M0YA 2VO0A 4P5ZA 3I60A 3OW4A 2VWWA 3PLSA 3D14A 4A07A 4PQNA 3LCOA 4M7IA 4CMTA 3OEFX 3A7GA 2IWIA 4JQ7A 1ZYSA 3MS9A 3EQFA 3RZBA 1R78A 3QZHA 4Y85A 2QG5A 4TWOA 4FTKA 2A4LA 2ITNA 1OMWA 3S3IA 3HV5A 2C6MA 3BBTB 4AGCA 4U6RA 4EOKA 5A4EA 3KULA 5CVHA 4DITA 4BGGA 4KSQA 5BVWA 5JEBA 5CI6A 1JSUA 3FMJA 3ZRMA 4WG4A 4K6ZA 4BFMA 4FSMA 4EH8A 3RJCA 3ETAA 5EOBA 3V5WA 2JEDA 4M69B 2QOOA 4DLIA 3Q6WA 5BVNA 3ODZX 4C4EA 3POZA 4DLJA 4IADA 1I09A 4NTTA 2UZTA 3CS9A 5KMNA 3GVUA 2W5HA 3FL4A 3MB7A 3NCZA 3ALNA 4C3RA 3OXTA 3OUNB 2QOKA 4YJUA 2I1MA 2QU5A 4BKJA 3OG7A 4YMJA 4R1YA 2B9HA 3W2QA 2B9IA 3UOJA 4CFFA 3MJ1A 3PJ2A 4ENXA 2FGIA 2OZAB 2RG6A 4EQMA 1WBTA 1ZLTA 2FSOX 2Y6MA 3KMUA 4O0WA 4YTCA 2HK5A 3FHIA 5FXSA 3RMFA 3ULZA 1Q8TA 1OB3A 4RIWA 4XRLA 5B0XA 4AA5A 4PPAA 5FXQA 3WF7A 1H24A 3OW3A 5M55A 2XIRA 4MNEA 4FF8A 3QQHA 4FSYA 4QO9A 5TO8A 1GIJA 4FV7A 2PVJA 3RZFA 3Q5ZA 2O64A 3ZFXA 3C4WA 1XH7A 4JLCA 3FPQA 2X8EA 3C51A 1FGKA 3EQIA 3OVVA 4NKAA 1XQZA 3OT3A 3VQUA 1KE9A 3VJOA 2OH4A 5JN2A 1Y57A 4F9YA 3P9JA 3ZOSA 1J3HA 3GP0A 5KO1A 3IGOA 5C8NA 2XYNA 1GJOA 3QTSA 4JG6A 2XK6A 3WE4A 1OKZA 3FKLA 3R21A 2XNPA 4FV4A 1P5EA 3NCGA 4BICA 1YKRA 2J0IA 4CRSA 2YM3A 4FKPA 2RFSA 3ACKA 5AP4A 4EOQA 3WARA 5EOLA 1JPAA 4DEAA 5FWKK 4FG9A 4C58A 4O0YA 3DXNA 4MNFA 4RFMA 5BX0A 4QNAA 3PJ3A 4YZDA 4JG8A 1W0XC 1BX6A 3SVVA 2PTKA 3P7CA 2CCIA 5E90A 3W18A 4HW7A 2G2HA 2O8YA 4FV2A 4EOMA 3ZUTA 4A9UA 2HW7A 5HBJA 1U54B 4JDJA 4FTMA 3R1SA 3A61A 4TY1A 4PDOA 3LFNA 3LMGA 4CTCA 1RE8A 4EH5A 3C4CA 5H9BA 5DE2A 2XRUA 3CIKA 2YJRA 4C2VA 3QTWA 2QO2A 3BLQA 5BUJA 4O0UA 3DK3A 4XCUA 3BV3A 3VBYA 3R1NA 2RFEA 4U40A 4O4DA 3BYVA 3ERKA 3W8QA 3PVUA 4EUTA 3R1YA 4NKSA 3FXXA 4AP7A 4QQTA 4GK4A 1BYGA 5HIEA 3Q52A 5D12A 5FRIA 3FJQE 1SVHA 1OITA 2YIXA 3SQQA 4O96A 2GNFA 1P4FA 4RJ5A 4FODA 2X81A 3MTFA 1W2CA 3BEGA 1W84A 5I9ZA 4D2TA 2QOCA 5IISA 5FEQA 4KIOA 4WNOA 4JX7A 3RNYA 4WRGA 5FP6A 3FZ1A 5A4LA 2R2PA 3RK7A 4C57A 2OBJA 3HV4A 4YJRA 1KE8A 3FL5A 4V0GB 3AXWA 1BL7A 3HNGA 3G0FA 1H00A 3UGCA 2C68A 4JAJA 3KRJA 4U80A 2IVUA 2J51A 2R3IA 4XLIA 5GHVA 3RAHA 2QCSA 3ZXZA 4C34A 3FLNC 3LFAA 1YXTA 2UZOA 2V7AA 4PDSA 2RKUA 3OOMA 2WTVA 3F6XA 4I93A 4RJ7A 2GFCA 4FZAB 4IANA 3W8LA 3G90X 5HTIA 4GT5A 4BWKA 2Z7LA 1LEZA 3Q9XA 4CZUA 4CCBA 2HENA 4UZDA 4D55A 2RFDA 3E5AA 3RPVA 5JSMA 4RLKA 4C0TA 3W10A 2H34A 3CPBA 3QUEA 4XV2A 1PMNA 4EWQA 3H0YA 5E8XA 4YU2A 2I0EA 1Q62A 2BTRA 5LMAA 3Q4UA 4MAOA 3FMHA 3PA4A 5IA3A 5EFQA 3ZLWA 2HOGA 1G5SA 5H8GA 2WMQA 5CQWA 2ZDTA 4XG4A 3E87A 3E8EA 5EDPA 3WZDA 2ITXA 3KXHA 5F9EA 4JL9A 2QODA 3W2CA 5AAEA 5M44A 5GZ9A 3HA8A 1BMKA 5GJDA 3PZEA 3BYMA 2YIRA 4RRVA 4MCVA 5FDXA 4FICA 3RALA 3PTGA 4GG5A 1UA2A 4MYGA 4JDIA 5HE1A 1JSTA 2FH9A 4D9UA 4EJNA 3U6JA 4R3RA 2YEXA 3V5LA 4EHVA 2C3KA 3QTZA 4QQ5A 3TL8A 4IACA 2FUMA 4FIEA 3TN8A 4QMPA 4I21A 3TJDA 3QRJA 3HP2A 4EZ7A 3MIYA 1VZOA 2O3PA 3LOKA 3EN6A 3QFVA 4DGNA 4FV1A 1E9HA 2V0DA 2UVYA 3BGZA 3KQ7A 3R71A 4RVTA 2C47A 3RTPA 4BDEA 4BVUA 2B7AA 3KXXA 4BCJA 2UW5A 2YAAA 3AGMA 3A62A 1OVEA 2JKMA 3FMKA 3IW5A 3KMMA 2ZM4A 3OF0A 2HZNA 2XYUA 4Z3VA 3LCSA 4JQEA 5K4IA 4MX9A 5AUTA 5KZ0A 1AGWA 4DFXE 4EUUA 3RK9A 2QR7A 2EUFB 2QKRA 2ZDUA 3CTJA 3LE6A 5T6KA 4OTFA 4F1MA 5LVMA 2R3PA 2P3GX 5ETCA 4ZSEA 4DN5A 4BCMA 3F2AA 1WFCA 2BIKB 4B8MA 3NYOA 4E93A 1W83A 3HRFA 1NVQA 2OF2A 2XNEA 4IZ7A 5AAFA 1QL6A 4D2PA 4DBNA 4OAUC 2ONLA 3LW0A 1KOBA 3FZPA 4YJQA 3TUDA 4BYJA 2C69A 3TTIA 3GC9A 4XP0A 5CU0A 2VGOA 4B4LA 3BU5A 4C62A 4BDBA 2YERA 3QKLA 3NIZA 2JIIA 5DBXA 3VUDA 2XK4A 4KIKB 2JBOA 4F9BA 4U5JA 4BCIA 4BIBA 4DH3A 4IAIA 4OBOA 3QCXA 4E4XA 3QAME 3GU6A