3ZSGA

X-ray structure of p38alpha bound to tak-715
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
349
structure length
337
Chain Sequence
b'ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title X-ray structure of p38 alpha bound to TAK-715: comparison with three classic inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 116
structure length 337
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zsgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zsgA01
5KMMA 3SGCA 2BRMA 1WBNA 3DZOA 4J52A 3T3VA 4BIBA 5HLNA 1H07A 4IAYA 4ARKA 5BVDA 1AD5A 3QGWA 3EQPA 1KE6A 3H30A 4YU2A 4IB1A 4YUQA 5HBJA 4XP2A 1PXJA 5HE3A 4I23A 4M0YA 4O0RA 3SOAA 3KA0A 4BYJA 4BR3A 2QG7A 2GHGA 3UP7A 2RL5A 4KUJA 3FXWA 3TJCA 3FDNA 5DVRA 3P9JA 4UMQA 3E8DA 2R3MA 3F5GA 3I79A 4YTCA 3T3UA 5EKNA 5CVHA 1PYXA 1ZMVA 2PMOX 3UP2A 4YJUA 3SQQA 3MBLA 4G5JA 2PMLX 3CGFA 3NYOA 5D7VA 2A4LA 1OMWA 3BIZA 2FYSA 2OO8X 3TNHA 4DA5A 2W96B 4QTDA 3WF9A 3EH9A 4H05A 1OIUA 3FEGA 1V0PA 4S2ZA 4DTAA 5IH6A 3GGFA 3RM6A 4ZLOA 4XG7A 2ZAZA 1J1BA 3NYXA 1XH4A 3OCTA 4QYHA 3MS9A 4V0GB 1HCLA 1TKIA 3GU7A 4BKJA 4PY1A 3G0EA 4JG8A 3O17A 3Q9ZA 2BDFA 5H2UA 5J5TA 2J4ZA 1H8FA 1NA7A 4I24A 3BELA 4FBXA 5AM7A 4ACMA 3ATSA 4KS8A 3TEIA 3U9NA 4BWPA 1BL6A 2X0GA 3GI3A 4LL0A 1L3RE 4PL5A 4TWOA 4EK8A 2QVSE 3BU6A 4J8NA 5FEEA 1S9JA 4J99A 5J8IA 3ENMA 4U5JA 1OUKA 2IZSA 1Q3DA 2UW3A 3TTJA 5JFXA 4XUFA 2PHKA 2JKOA 3R04A 3HKOA 3UJGA 3V6SA 1VYWA 3ZUUA 4A4XA 3BHVA 4R1VA 5JFVA 1ZOHA 3BYSA 3BKBA 4IMYA 1E1VA 1BI7A 4NFMA 4IBMA 1YW2A 4FC0A 4OTRA 3QL8A 5J95A 2Q0BA 3EN6A 4LYNA 4BHZA 3TXOA 4FKIA 4NM5A 3AC3A 3PE1A 4DEEA 2XK4A 3H10A 3QTZA 2GQSA 2QR7A 4MWIA 4FKWA 3KULB 4JR7A 4F63A 2XNPA 4RIXA 4HNIA 4O1PA 3PXZA 3LKMA 1YI4A 2YN8A 3VQHA 3RGFA 3F2NA 4U80A 3ZC5A 4YC8A 1J91A 2UVZA 4USFA 2OJGA 1WBOA 1OKVA 2YM6A 5GZ9A 5B2KA 3KRWA 3UG1A 4Z7HA 3OP5A 5G1XA 2W4OA 4NK9A 2XNGA 2XIKA 4XV1A 5CU3A 3V5JA 2GU8A 3FMDA 3A4PA 1H28A 4JG6A 5E1SA 4ZZMA 2QOCA 4O7RA 4UXQA 3JY0A 4AZVA 1CM8A 4TWCA 4UN0C 5TF9A 5AEPA 5LMBA 1STCE 3F3ZA 4FTOA 4IFCA 4RWLA 5AP7A 3Q4CA 3C0GA 4ZSLA 1JBPE 3WI6A 2BZIB 5KBQA 3TCPA 4KD1A 4UXLA 3OG7A 5AR2A 1JOWB 3F2RA 4G1WA 4ERWA 2E2BA 3RPSA 4C36A 3EYGA 3QC4A 4X3JA 1P4FA 5AUUA 3QRKA 5C4KA 4ANNA 2G2HA 4ZZNA 2X2MA 3DU8A 5CY3A 3RI1A 3AGMA 3EQGA 3KCKA 3THBA 4D0WA 4FT7A 4PPCA 4XHKB 4C57A 3U8WA 3WYXA 3O23A 4RJ7A 3F6XA 4WA9A 4LQMA 1VEBA 3R8VA 2BAJA 4BL1A 4WOVA 4G3FA 3R1NA 4DT8A 1UNLA 2WGJA 3DQWA 4EK3A 3N4VA 3KRXA 4E4MA 4XG8A 3VC4A 5IQCA 4ACDA 4CKRA 4S33A 3HRBA 3P7CA 5EFQA 3W18A 5I9ZA 2ZMCA 1ZOEA 4FI1A 5F4NA 4F9BA 2DWBA 5J7HA 2G9XA 1KE9A 5H9BA 5CAQA 5FP6A 2PZIA 3MPMA 3AXWA 2F7EE 4IX3A 4PMMA 5AUYA 2WU7A 4F7SA 3QX4A 4E6CA 2VTMA 4GU9A 4KNBA 3UQCA 3UNZA 3OF0A 2WMBA 3K5VA 5CAOA 3OW4A 4IX6A 1ZYLA 2O64A 2VTJA 5J1VA 3EJ1A 4AXAA 1YOLA 3F7ZA 4ZSJA 3TV6A 1E1XA 4YTHA 1YKRA 2PULA 4O7TA 3JVRA 2RIOA 3FQEA 1YDRE 4X7QA 3LPBA 3GFWA 2A27A 1Q97A 4XBUA 4DH8A 5CZIA 4FTQA 2VUWA 4PP7A 5I0BA 5DH3A 2JFLA 4E26A 5HHWA 3DBFA 2XKEA 1S9IA 3LW0A 5K4IA 4JBOA 3C4ZA 4I92A 4U79A 2Y7JA 3VUDA 4RGJA 1JVPP 4EJ7A 4ZOGA 5DR9A 5FXQA 3C4EA 2W1HA 4BDIA 1W0XC 4Z55A 4H3PA 2IW6A 2C3KA 1QMZA 2XBAA 2GS2A 3LAUA 1UKIA 4YJRA 4KRCA 1WCCA 4FV9A 4WIHA 3OZ6A 4TYGA 5FG8A 3ZEPA 3PPKA 3R8PA 3TT0A 2XB7A 4ACHA 4MQ1A 4C3RA 3C4CA 3PXRA 5L2WA 4GFGA 3UNKA 2A2AA 2BFYA 4J97A 5HU9A 4IM0A 5DYJA 2WTJA 5IEVA 3HMNA 2OICA 2UW6A 3A60A 3HMIA 4H1MA 4J71A 2QONA 3MYGA 3DNEA 5A4CA 4ZTLA 4YP8A 2IVUA 4MXAA 2WO6A 3OWPA 4DINA 2REIA 2C6IA 2QO9A 3LCKA 4L53A 5AP2A 4OBQA 3F3VA 4I21A 3EQIA 4ZJIA 4D2VA 4JS8A 1SVHA 1WAKA 3Q32A 4E7WA 5I9VA 2CGWA 4JL9A 5GJDA 4IH8A 3R02A 3TIZA 4I0SA 4JR3A 3GQIA 5JSMA 3LXPA 1TQMA 3P79A 4FIGA 4PDSA 1KSWA 3I7CA 3LZBA 1CSNA 3PA4A 4ZS0A 4NL0A 5JQ8A 4YSMA 2YFXA 3NUSA 3EL8A 3P08A 5GNKA 4KRDA 1FBNA 3E92A 4OTDA 5HG8A 3IPHA 4R6VA 3IGOA 4PMSA 2A0CX 4FT5A 4BFMA 2BIYA 4QP6A 1H01A 2FA2A 4F08A 5L8LA 3QD3A 3ATTA 4QMNA 3ZC6A 5HESA 5CAPA 1ZLTA 3DK7A 4CQGA 4I41A 3C51A 5IQAA 5CALA 1PY5A 4XG9A 3VF9A 2XK8A 5B2LA 2BPMA 4F6UA 5A9UA 3QHRA 5L2SA 3VUIA 3ID6C 4OTWA 3OBGA 4B9DA 5HGIA 2QOLA 4FKVA 1OVEA 4NM3A 3UPXA 3OT8A 3OCGA 4WNMA 1UU3A 3RK7A 2VO6A 3QTRA 3PXYA 3E8CA 5B7VA 2VX1A 3PY0A 5IPJA 2H34A 5KZIA 3R8MA 3ELJA 4G9RA 4JVGA 3ZO3A 2UZEA 5EOLA 5EW8A 2J0JA 1OPLA 2ZMDA 3V51A 5IH5A 3AT3A 5EKOA 4FVQA 4XCUA 4FYOA 3NCZA 3TN8A 2JAMA 2CLXA 1U5QA 2FVDA 3DB6A 5DHJA 3PXQA 5HIDA 2WIHA 2UW5A 5F20A 3PIZA 5DT3A 4ZIMA 1Q8UA 5TE0A 1MRVA 2CNUA 4MK0A 3SRVA 3U6JA 1TQPA 4KBAA 5C8MA 3V5LA 1P5EA 3H9OA 4QTAA 2QKRA 4X2FA 5JT2A 1UU7A 1FPUA 4BCKA 3MTLA 5M56A 3OOGA 4FSZA 5IA4A 1R39A 3MW1A 2W4JA 3BWFA 3TUCA 2B9HA 1I44A 1U46A 5CSHA 4BICA 4YZMA 4DH1A 3NLBA 1V0OA 3ORIA 5D7AA 3CTQA 3VUGA 2UW4A 4ORKA 4MWHA 5L2IA 2ITWA 3WF8A 4TYHB 3FLZA 2JGZA 2R0UA 3DTCA 1UKHA 5IQIA 2UVXA 1G5SA 2UW7A 4YO6A 3Q2JA 1T46A 4EOLA 4CCUA 3PY3A 1OL5A 3R0TA 3BWJA 3MY0A 5AV1A 4L52A 4E5AX 4FV7A 5JH6A 4MYGA 3JXWA 3ZZEA 3KULA 2J90A 3FKOA 4C3FA 1YOJA 4ZTNA 2YJSA 4A4LA 4OTGA 3AQVA 2HZNA 2OU7A 5AR3A 4KIQA 2ITZA 3HMOA 4FTLA 4FTAA 3UVPA 4IE9A 4X2NA 3E63A 4XH6A 3TTIA 2WQMA 4CZTA 4K2RA 4RX9A 4IDVA 1UNHA 3V5TA 5HU3A 5J5SA 3ANQA 4U97A 2CGXA 2P0CA 2EXCX 4IAZA 4J1RA 3OBJA 2E9OA 3TV7A 4H39A 4RQVA 3D4QA 4QMXA 5ANKA 5IEXA 1H27A 4XS2A 4NWMA 2XS0A 4ZJJA 3BGPA 4APCA 4NTSA 4MD7E 4Y8DA 5JZNA 4EOOA 2YZAA 3GVUA 5KKRC 3NNWA 2R7BA 4L6QA 1XBCA 3Q3BA 1OPJA 4FNZA 5J1WA 1LR4A 5TR6A 3QZGA 3MA3A 3EFKA 5FXSA 4EHGA 3K2LA 5CNOA 4YJQA 2YJRA 4ZEGA 2VRXA 4BBEA 4ZLYA 3QTUA 2PE2A 4YSJA 4BBFA 3ERKA 2Y8OA 4GH2A 2J51A 4WNKA 4D2PA 1XJDA 4ENYA 4X2JA 3IO7A 2XEYA 1JLUE 3I5ZA 4W9WA 1M14A 3W2RA 4Q9ZA 5JZJA 4EOSA 2X4FA 4IZ7A 3L9LA 4Z16A 3G15A 4FKTA 5DT0A 4RA5A 1A06A 3LM5A 1NVSA 1PHKA 3DQXA 3R9HA 4GU6A 5CF5A 2VTAA 3AMBA 3QWKA 4EHEA 5L4QA 4M14A 2SRCA 4K1BA 2VO7A 4RIOA 5ACBC 4BZOA 3A7HA 2BR1A 3TACA 1R3CA 2YACA 4DHFA 2I0EA 4FYNA 4CG8A 2YM7A 3ZRMA 4OUCA 1KV1A 4IAFA 4H3QA 5KMNA 3NUAA 5IQEA 2XYUA 3RPYA 2DQ7X 3VJOA 3HV6A 5FUTA 2UW0A 3LMGA 2P2HA 4RPVA 4DGGA 3ORNA 5HE1A 5KBRA 4M69B 3Q53A 2ITTA 4RIWB 4AACA 1JWHA 4RBLA 1RJBA 2QOQA 3GT8A 4O86A 4R7HA 4JDHA 1KE8A 4IC8A 2ITVA 3KREA 3NRMA 2PZYA 2YCRA 3NAXA 5M08A 3O51A 2VV9A 3GQLA 4FUXA 5CSWA 2C3LA 5KMKA 4L8MA 4HVHA 4FV1A 4XP3A 3AC2A 4ZY5A 4DEDA 5E90A 2UW8A 3UO5A 3QUPA 5CQWA 3VN9A 3DKOA 2WQNA 4ENXA 3LLAA 1LPUA 2OF4A 3EQFA 5EM8A 2GPHA 3WF5A 3R8LA 5AA8A 1G8AA 4AN2A 3KEXA 3SX9A 4O0VA 2HW7A 3FI4A 4IB5A 4XV2A 3ORPA 3P1AA 3OTVA 4ANLA 4J95A 1CTPE 4KABA 4NM0A 1H0WA 1PMNA 1FMOE 3M2WA 3B2WA 4C4GA 4IANA 4BIDA 4AZEA 4FNWA 4QT1A 4U3YA 3SV0A 2VGPA 3IW5A 3ZONA 5HVYA 5HIEA 4RVTA 3QA0A 4G31A 4NUSA 3OWLA 5EW9A 5L3AA 3UQFA 4F9AA 5CSPA 4C4IA 5E8TA 4YBJA 5HBEA 4DFBA 4QP3A 4OTPA 1E9HA 1WBSA 2C6LA 2HOGA 5FTQA 4JQEA 1XWSA 4R77A 2BTRA 2YWVA 3CR0A 4YLJA 3E93A 3R83A 3FMLA 4CGAA 3MJ2A 4E20A 2PVHA 4WBBB 3WIGA 4HGSA 2Z2WA 3UIBA 1Q99A 2GNGA 4G6NA 3IGGA 4YC3A 4YJSA 4D2RA 1YHSA 2YM3A 2HY0A 4QQCA 5KHWA 5IQGA 1CKIA 3FY2A 3PY1A 5AP0A 1JKSA 4GT4A 2X9EA 4CVAA 2YDKA 4HVDA 3OROA 5AV3A 1U4DA 2XCHA 3CTJA 3EFWA 4L46A 4A9UA 2OIDA 5CT7A 5AIRA 5AADA 4XRLA 2OG8A 3DTWA 2XA4A 3PSBA 3O7LB 4X21A 3BQRA 3C0HA 2CCIA 2ZV2A 5M07A 2YAAA 3MV5A 4FV3A 3FLWA 4AOTA 3EN7A 3R8ZA 2F2UA 4FSMA 4O2PA 2F7ZE 1J7UA 3UO4A 2BHHA 2XJ2A 5D9HA 2RF9A 3K3JA 5FP5A 4BN1A 4AZTA 1NVQA 4O7ZA 4USEA 2ZJWA 4GIIA 3VS0A 3HV4A 5ETFA 3KU2A 3GP0A 3VBVA 4GCJA 4N57A 4C0TA 4DGMA 5AV4A 4FEVA 1OGUA 4I0RA 5AX3A 3ZO1A 1PYEA 3BE2A 4YHTA 4O7SA 4UWBA 4ANBA 4KSPA 3POZA 2YWPA 3HMMA 3MH3A 3QUEA 4QMUA 4GK4A 1ZXEA 4C62A 4HZSA 4YTIA 1YRPA 5EG3A 3KGAA 3VBYA 3HZTA 1DI8A 4RX7A 5IQBA 3CD8A 4DH5A 3SW7A 2IO6A 3SG9A 2YLFA 5JQ5A 1M52A 3FLNC 4MQ2A 3EN4A 4ALUA 1OBGA 4LOQA 3DBQA 3VBWA 3PDTA 4DTBA 3BCEA 3QQUA 2XRWA 3FZSA 4XJ0A 4I3ZA 5D10A 2GTMA 2B4SB 2ZV7A 3NAYA 3FKNA 4H58A 4MAOA 3BEAA 4D58A 3I4BA 3UG2A 4C2WA 2GMXA 2XKCA 3JY9A 4FTNA 5M4IA 1CKPA 1KE5A 1RQQA 2P2IA 3BLHA 3DJ6A 4BGGA 5J9YA 5AV0A 2PZ5A 2X8IA 5ANJA 3VS2A 3MFTA 5K0XA 3QRIA 3ZFXA 2Z7SA 4EQUA 3HDNA 1R0PA 2C0IA 4NFNA 5EYDA 3RKBA 4DFUA 5DOSA 3QFVA 5J87A 5A4LA 3R2BA 2BMCA 1GZOA 3KXZA 2R64A 2XIXA 4UZDA 3JS2A 5BVWA 3H3CA 3QALE 3OWKA 3VIDA 4L3PA 1ZOGA 1SNUA 2BTSA 2YEXA 3KXGA 3R7GA 3UGCA 3TZ7A 4CFWA 3COMA 4JQ8A 3VBXA 4FTRA 3OFMA 4GKHA 4DGLC 2UVYA 2X6EA 3KK9A 4JT3A 2FB8A 2VX0A 4O96A 2XK9A 1URCA 3DOGA 3GU5A 4MF1A 4DG3E 3W33A 4CYJA 2BDWA 1K9AA 3DXPA 3LXKA 4U8ZA 3DK6A 2XZSA 3FI2A 1REKA 2C30A 4B0GA 3D0EA 3FQSA 4RWIA 3EFJA 1YDTE 4BCJA 3MN3A 1ZYSA 3EIDA 3FPQA 3NDMA 4TYIA 5AUZA 5B2MA 3DKCA 2AUHA 4FZ7A 5CEMA 4BDHA 3FQHA 4QOXA 4QYEA 2WMSA 4LI5A 2B53A 2ZVAA 3QTWA 4FEWA 4V05A 2OXDA 2JDSA 1GIJA 4GJ2A 4QTEA 1MRUA 1T45A 2HY81 3A7FA 3FLQA 4BZNA 4C4HA 5IDPA 2QURA 3QWJA 5DRBA 3ZXTA 4AGCA 3COHA 4K6ZA 4E1ZA 5M06A 1P14A 2WELA 1GAGA 3HV5A 2VAGA 3DDQA 4L3LA 5DE2A 3VS3A 5GIOE 2EB3A 2YCQA 4AW5A 2NNWB 2VWVA 4CT1A 3NR9A 3R30A 3IW4A 3HUCA 3O50A 4LG4A 4EK5A 5KHXA 2W06A 5G6VA 5A4TA 4QPMA 3BU5A 4O21A 3KRRA 2EUFB 1PXPA 5IQHA 3D7TA 3UVRA 4CMOA 3TIYA 1MP8A 2OIBA 4YURA 4IAAA 5CAVA 4BIEA 1KOBA 4TTHB 4CFFA 1WVWA 4LOPA 4HVGA 3BQCA 4QTBA 3PVBA 3LFAA 4B6LA 4YZNA 3QXOA 3KF7A 5KMLA 3IW8A 3C1XA 1OL2A 2AC3A 2ETKA 4CTCA 1VZOA 4M69A 3UC4A 3OEFX 4X0MA 5CEPA 4O38A 1OI9A 2BZJA 2JC6A 4OT5A 4P5ZA 1F5QA 3L1SA 4M13A 3MVHA 4AAAA 1SYKA 3IS5A 4LM5A 5EOBA 4ZJVA 3PPJA 2ITOA 3PTGA 4UZHA 4DTKA 5M51A 2VO3A 3VF8A 2JD5A 3W2CA 3PP0A 2NP8A 4BDKA 2OZAB 5ETCA 2GTNA 3TM0A 4M84A 3O8UA 2VTIA 3DBDA 1CMKE 2BKZA 4M67A 4M3QA 4BDJA 5DI1A 2UZOA 2Y4PA 3RWPA 2OSCA 3IDPA 2W1GA 3QAME 3NW5A 5C03A 2OKRA 3OMVA 4L68A 1ND4A 1NXKA 3NYVA 3PJCA 4ITHA 4GL9A 1CKJA 1SNXA 4I5CA 5CYIA 5M4FA 3ZHPC 3QZIA 4R3PA 2X9FA 4EC9A 4MBJA 4IJ9A 4AF3A 5FWKK 3PVWA 3QD0A 3IW7A 5LWMA 4D2WA 4A07A 4JQ7A 2O0UA 4L43A 1WFCA 5DT4A 3OEZA 1M2RA 4BCGA 2WQEA 2ZV8A 3COKA 3CJFA 4BDEA 4FEXA 3KVXA 4EWQA 2EVAA 3R7UA 3ZLYA 2VTNA 4K9YA 2GFSA 2JBPA 2BAQA 4F0GA 1ZMWA 2FSLX 3OUNB 3SRVB 4FV4A 2RFEA 3FZTA 3MWUA 2GNJA 4D5KA 4K33A 5AM6A 4O7NA 1KUTA 2UZBA 4ZSAA 4I4EA 4G6OA 4MCVA 3MFUA 3ACKA 4FVRA 4QMYA 3ZRLA 2IVSA 2WMVA 3ORXA 2YAKA 4G3CA 4TNDA 5IA5A 5CXHA 5FBNC 1H1RA 4ZTRA 5BYYA 5AIKA 1ERKA 2XNNA 3O96A 4EH8A 3UQGA 2DS1A 3LQ8A 5EM7A 3ZUTA 1J3HA 5KMOA 2QOFA 3G2FA 5FEQA 1Q4LA 4WNPA 2CKEA 3ZBFA 4BDGA 1ZY5A 3DJ5A 2Y6OA 1PXNA 2R7IA 5HBHA 4TYJA 2C0OA 5AP6A 2QI8A 3G6HA 2PVMA 5BNJA 1OUYA 5DGZA 3BBWA 4RG0A 3EYHA 3NIEA 3W32A 1GNGA 3SXRA 2DUVA 4GT3A 4YZBA 4XG3A 4FR4A 5M57A 3R1QA 1YWVA 3FV8A 2ZDUA 2OIQA 3R7IA 2HELA 4USDA 5DR2A 2ONLA 2QQ7A 4X3FB 1OL6A 2CN8A 4RVMA 4BDBA 5E91A 4Y95A 2PTKA 3ZXZA 5AP5A 2BRBA 3FLSA 3MVLA 3ZH8A 4QPAA 4B8LA 3G9LX 3OC1A 3DBCA 4IWOA 3FXXA 1PRYA 4YHJA 4ANOA 1YHVA 2YITA 4QMVA 5JEBA 4QP4A 3KXXA 4X2KA 2WIPA 2VTSA 3HA8A 4CMUA 3D94A 4FE2A 2WEVA 3HLLA 3R6XA 4Q5HA 1OKYA 3QUDA 2C47A 3BV3A 4YJTA 4DEGA 3L8VA 3OOMA 3F69A 2YDIA 2BIKB 4FKLA 4HPUE 3TZ9A 3H0ZA 1G3NA 1X8BA 3PSDA 4TW9A 3AC1A 5JGDA 3F5XA 5HD4A 5TKDA 1YHWA 4IJPA 1YXXA 2BCJA 3UIXA 3D5VA 3R01A 4NSTA 2JFMA 4IEBA 4AZSA 4E5WA 1IA9A 4FV6A 4D28A 2QR8A 4K0YA 4GV1A 5HX6A 1OL7A 5CTPA 4K77A 3GFEA 4EOQA 3IDCA 3FJQE 4MVFA 4C59A 2F2CB 2E9PA 4M97A 4CNHA 3LQ5A 4EBWA 2GQRA 3RAKA 2WMTA 4OAVB 4OBOA 3IDBA 4QP8A 3KMUA 4BKYA 2GQGA 5CNNA 2Q83A 3HECA 4EOIA 5I3RA 3U4UA 4I22A 2JDOA 2R4BA 1W98A 3Q2MA 3OW3A 4I6QA 4IZAA 4TN6A 4EH6A 4TPTA 1NT2A 4F1MA 3HDMA 2OI4X 1PF8A 3CD3A 5E92A 4PDYA 3LJ1A 4FL3A 3Q6WA 3QYWA 4L01A 4U42A 5HTIA 5H8GA 3TL8A 3ZLXA 1DAYA 3NCGA 4FG9A 4FSRA 2R3JA 4J8MA 3Q5IA 1FVVA 4M7IA 3E3BX 3HX4A 3C4XA 4DEHA 3NPCA 3GENA 2R3LA 3QCXA 2HK5A 4E73A 3D5UA 4Q2AA 3VS5A 1G8SA 2HWPA 3VHKA 4GRBA 3FMEA 3ALNA 2R3RA 4LOOA 5LMKA 3DNDA 2G2IA 5DN3A 2YERA 2OFVA 5GJGA 5CSVA 4QMLA 4RX8A 4RLKA 4XYFA 5DG5A 3UYSA 3VW6A 5E7RA 5ETAA 4AZFA 5IF1A 3ZUVA 5AP4A 2VWZA 5JGBA 2C1BA 4IB0A 1FVTA 2HXQA 2GHMA 3GCSA 4O7VA 4GYIA 4FV2A 1U54B 2R0IA 3CPBA 5FRIA 2WMWA 3Q9WA 4FTUA 5FQDC 5BVEA 3TNQB 2WNTA 4CEGA 4DH7A 1APME 1QPJA 5CF8A 2ITNA 1P4OA 5LVLA 4GEOA 3TUDA 2C5VA 4BCHA 2P33A 2R3PA 4MTAA 4U81A 1Z57A 4EOMA 5C4LA 1GZKA 3PVUA 3ORLA 3R1SA 2JIUA 3R7YA 5CEOA 4JJRA 1R78A 3SG8A 4H3BA 3RVGA 4IX5A 3LE6A 4XBRA 3ZRKA 2YISA 4YPSA 1DS5A 2XJ0A 4FF8A 3T8OA 5IA1A 3IW6A 3ZLSA 3L8PA 2WTDA 5L6OA 4ZS4A 3RPOA 2HWOA 3GB2A 4ZMFA 3CKXA 5LWNA 2IW9A 5L8JA 2ITUA 3FY0A 3GC9A 4FIIA 1NY3A 3ULZA 2VTPA 3DKFA 2WTWA 1Y8YA 3TKIA 1LUFA 2FO0A 2HIWA 3CY3A 5EYMA 2WFYA 4FG7A 5F1ZA 5LVOA 1OKWA 4CRLA 3QKLA 3FSKA 4U43A 3FMJA 4QYYA 2XNMA 5HVKA 2JDTA 3LFDA 1Y91A 3DJ7A 4C7TA 4D2TA 4O6LA 4O0XA 4LGGA 3LHJA 5FLFA 1YWNA 1IA8A 5DLSA 4YR8A 3D2KA 4YBKA 3MB6A 2HYYA 5LCKA 4AP7A 5TOZA 3AC8A 4UYAA 2XK6A 3OXIA 2C6OA 3QC9A 3TI1A 2C4GA 4A7CA 3I0OA 4FSNA 3R9RA 3BPRA 4O0YA 2X2LA 2WZJA 4AOIA 1QL6A 2E9NA 3AC5A 4FTKA 4OW8A 5EI2A 4PNKA 3T9TA 4Z7GA 5E1EA 5KE0A 3ROYA 3ZLWA 2OZAA 3GBZA 1DAWA 3KMMA 4YJNA 2H9VA 3IK3A 2PMNX 4KBCA 3V8WA 4D1ZA 2CSNA 3CJGA 3CQEA 5DA3A 1QPDA 2ERKA 3Q4UA 4F70A 1M2QA 1UWJA 2A1AB 3GCVA 4WG4A 5EDPA 3KF4A 2XKDA 3VBQA 5AV2A 2V0DA 4JNWA 2PUUA 1H08A 4Z3VA 2GS7A 4MXCA 4O2ZA 4EH4A 5FBOA 4JBQA 3C50A 4WHZA 3ZSIA 5JRQA 4EH2A 3VVHA 2GNFA 1CDKA 2IVTA 1ZRZA 3QGYA 3VQUA 4EZ3A 4QNYA 4A9SA 2YM4A 4JBPA 2DYLA 4XG2A 2W1ZA 4D5HA 3TNWA 1L8TA 4IC7A 2WOUA 2YLEA 2VZ6A 3LFSA 3UIMA 2WTKB 4F0IA 5GHVA 2BFXA 2J50A 3TUBA 3KRJA 2QOIA 4IVCA 4DGNA 2JITA 4QQ5A 1YXSA 4QP2A 4D2SA 5HO6A 3K5UA 3BLRA 1O6YA 4WNOA 4MHAA 4BRXA 2PUPA 2KTYA 3NW6A 4HCVA 4RC3A 2PVJA 3PFQA 3R63A 3GU4A 4C4FA 4KS7A 5A6NA 4E93A 5BQ0A 4EKLA 4IZYA 3E62A 2W5BA 4M12A 2PZRA 4F0FA 3L9MA 3OXZA 2QOOA 4F6WA 2CNVA 4WD5A 4RVLA 5EH0A 5HLWA 3LM0A 5CANA 5HCXA 4QO9A 4HGTA 1GZNA 4GKIA 3VUKA 4UB7A 2C5XA 3RCJA 4Y5QA 5HTBA 5LVNA 3MB7A 2ZM3A 3C7QA 4D0XA 3ZM4A 3PPZA 4XV3A 2QCSA 3Q4TA 4ZK5A 1U59A 3CBLA 4YJPA 4EC8A 2XNOA 3MIAA 4P7EA 5CU4A 4IIRA 1UU9A 3E8NA 5A4EA 3EHAA 3R8UA 1Z9XA 4FUYA 2Y4IB 4TZRA 4NEUA 2Z7RA 4X3FA 2YDJA 2RG6A 4EOPA 1IRKA 2FSMX 2WTVA 3NIZA 3P0MA 1BUHA 1M17A 3ORKA 3G9NA 1V1KA 2XUUA 4P90A 4EBVA 4RT7A 3DBEA 4N4SA 4XX9A 4RQKA 5M09A 4IVDA 3V01A 4FNXA 3VBTA 3W10A 1XHAA 3V3VA 5HTCA 2V62A 5IZFA 1YDSE 2Z7QA 4PP9A 5EDQA 1IAJA 4DFZE 2VN9A 3EB0A 1GY3A 3RZBA 3WE8A 3EQDA 3L9PA 1YXTA 3R28A 4OTQA 3BHHA 5IQFA 5IEYA 2H96A 4FV8A 4QMOA 5CU2A 3HP2A 4FNYA 5BVFA 2I40A 3NYNA 3NUPA 4W9XA 4WT6A 3R21A 4EH9A 4CFNA 1ZAOA 1ZZ2A 4AUAA 2XH5A 1ATPE 1UU8A 2C3IB 4AQCA 4JXFA 4ZSGA 3A99A 4W4VA 4WRGA 3QHWA 2PVKA 3U4WA 2BRHA 3IQ7A 4ZAUA 2F57A 2R2PA 3Q04A 4MBIA 5AUTA 2R3FA 1IAHA 4ZTSA 4BHNA 2E9UA 4WKQA 3HA6A 2R3OA 4CLIA 3I60A 3R9NA 4R3CA 2BZKB 2F4JA 3DK3A 4BVUA 2WMQA 2XIRA 2YM5A 3G0FA 3SD0A 3WIKA 1W84A 4YLKA 3RCDA 3W2PA 2NPQA 1QPCA 3GU8A 3OY3A 1YXVA 4GFOA 3D7TB 2YIXA 3LFNA 5AR8A 4AZWA 4PQNA 4I6FA 3V8TA 2O2UA 2F7XE 3ZCLA 5I5ZA 2IPXA 4D4SA 4FX3A 5ICPA 2C5NA 3OVVA 4F1TA 1FGIA 2C6KA 5FEDA 3TZ8A 4OT6A 4EONA 5IDNA 4BCNA 4ZSEA 5F94A 2V5QA 5LQFA 4RJ4A 2HAKA 4XP0A 3VRYA 5EHYA 1BL7A 3QRUA 3DLSA 1A9UA 2WMAA 3SXFA 2QHMA 2CJMA 4LRMA 3KVWA 3HNGA 4FTMA 4GG5A 3QRJA 2R5TA 4WUNA 4FKRA 4RIYB 3RHXA 3SW4A 3WZUA 3ZSGA 2WMXA 5HLPA 3KN5A 1H0VA 4JDJA 2CPKE 1U54A 4I0TA 1WBVA 3MA6A 5HG5A 4Q5EA 3Q60A 2QU6A 4KA3A 4IX4A 4JDKA 5DWRA 2GFCA 2J2IB 3QQKA 4HYIA 5HIBA 3FI3A 4FODA 2XRUA 1I09A 3RAWA 3SC1A 2RFDA 4EKKA 3BGQA 4QTCA 4F7NA 3DB8A 3P4KA 4KAOA 2W1EA 4UWYA 3MESA 4GK2A 2ACXA 3BU3A 1WMKA 3P7BA 3RPRA 4DEIA 4QD6A 1H24A 2OBJA 4NIFA 4F9WA 2HXLA 3FL4A 4CLJA 2C6DA 2BROA 4EHZA 2PU8A 3U55A 1Y8GA 4F65A 2GSFA 4WRSA 5CLPA 4DYMA 2WAJA 2CN5A 4GG7A 3VAPA 2OLCA 2YZLA 1JKKA 3ET7A 3ZFMA 3KXMA 3D2IA 2CKQA 1BKXA 2HZ0A 4F6SA 5JGAA 4XMOA 2O63A 3PVGA 4UMRA 4AFJA 2X8DA 3BX5A 3WZEA 4E6AA 4R78A 3EMGA 1JQHA 2E9VA 5GZ8A 1QCFA 4MX9A 3RHKA 4E4NA 3MSSA 2OJIA 3UVQA 5H3QA 3EQBA 3UZPA 5HE2A 3NNVA 4NCTA 4E3CA 3ETAA 2J0MB 3ENHA 4N0SA 4WG5A 2VU3A 2ETMA 3ZFYA 4DG2E 2I7QA 1H1WA 3NS9A 2I6LA 2VWUA 3QLGA 3QD2B 3IECA 1OPKA 3CP9A 1URWA 3DXNA 4R5SA 4RJ8A 5FXRA 3OCBA 3QYZA 4PPAA 3QQHA 3R7VA 4OBPA 4JLCA 3UIUA 4QYGA 2UZDA 4D9TA 4RJ6A 3HV7A 4MF0A 2EXMA 5K4JA 3DY7A 1TVOA 3SHEA 4ANSA 3FHIA 3IKAA 4TXCA 2RSVA 3SOCA 4QMZA 4DBNA 2QHNA 4S34A 2H8HA 5BMSA 2BZHB 2W7XA 3FZOA 3R9DA 3RWQA 3CKWA 3QCSA 1LEZA 4QP7A 4QQJA 4O7YA 3BYMA 5IMEA 3G5DA 3WF6A 2QD9A 3LOKA 4IADA 2W05A 3SA0A 1W83A 4W4XA 3KXNA 3ORTA 2RFSA 4ASDA 5AAGA 3JVSA 1YQJA 2W5HA 4C58A 2YA9A 1K3AA 3QTQA 3V6RA 3BHTA 1AGWA 3PE2A 1IG1A 4WUAA 4GVJA 3ZO4A 4DGOA 4EOKA 4DF3A 4CYIA 3TDVA 2W5AA 3QQFA 2RFNA 4PDPA 4NH1A 2I0YA 2JAVA 4WG3A 3ZBXA 4PF4A 4IAKA 4KKEA 3KQ7A 5DIAA 3NWWA 4GSBA 3GU6A 5IKWA 2QOBA 4AG8A 3Q4ZA 4PV0A 4A9TA 3UZRA 1H25A 3F82A 3HGKA 4ACCA 5HG7A 2IVVA 3A8XA 5L8KA 1GOLA 4AA4A 5IU2A 2AC5A 4EK6A 3MTFA 4UWCA 3P23A 5EHOA 5FM2A 3U9CA 3UMWA 3ZYAA 5DEWA 4NM7A 4EOJA 1OL1A 5M53A 4ZXTA 1SZMA 1YVJA 4CG9A 2IWIA 4E8AA 1B39A 4YC6A 3BZ3A 4B99A 3MFSA 4A9YA 4MXOA 4FKGA 4CSVA 5TT7A 1A48A 3PLAE 1LEWA 4Y73A 4XLIA 3CC6A 4HGLA 2C0TA 5CU0A 3C4WA 4R7IA 2ZB1A 4I5PA 4D1SA 3WZKA 4CV8A 5JKGA 4FG8A 4UX9A 3FC1X 5I9XA 5CVGA 4PMTA 4O7LA 1Q8ZA 4RFMA 2ZDTA 4JG7A 5E8SA 4BF2A 3EZRA 3KL8A 3E87A 3OWJA 2UZVA 4JI9A 4B7TA 5HI2A 4B8MA 1Q3WA 5LXMA 4C4JA 3DDPA 4FSWA 3ZZWA 1Y6BA 4Q9SA 3ROCA 3ODZX 4TWPA 4W8EA 3RBWA 3FL5A 3F61A 4FK3A 4QQTA 2F9GA 4E6QA 3I6WA 4X6RA 3HUBA 4NJDA 2C1AA 5K3YA 1ZZLA 4DLJA 4MBLA 3V5PA 3G33A 4FL1A 5FM3A 4IB3A 3IG7A 5IUIA 4CFMA 4EI4A 5JMSA 4PL4A 2WKMA 1Z5MA 4O6EA 1O6LA 4R7BA 4WBOA 3OT3A 1H1PA 4HZRA 4CKJA 3PXFA 3Q9XA 1JKLA 2PK9A 3QTXA 3QXPA 5ITAA 4LRKA 1ZYDA 4RLLA 2OWBA 4U3ZA 2O5KA 2W17A 1Q61A 4MNEA 5EYKA 4F64A 2W0JA 3DT1A 2XMYA 3GCUA 2VWBA 5C26A 4PL3A 5M44A 1GIIA 2OH0E 1WBPA 2OXXA 4ID7A 1J1CA 3Q5ZA 2IZRA 2BILB 3D7ZA 2ZOQA 5FTGA 3AD5A 2OH4A 2VNWA 4L45A 3DKGA 3L9NA 2G15A 2XKFA 3BBTB 4YO4A 2QNJA 1FINA 4DT9A 3OUKA 4FKJA 5BX0A 2GNHA 2OGVA 2Y9QA 1REJA 2B1PA 4I1ZA 4NTTA 1VR2A 5DFPA 3VS1A 4CFUA 5HNGA 5IUGA 2C5YA 3R00A 5AUWA 3F88A 2OJFE 3KB7A 3CQUA 1NW1A 4G16A 4ERKA 2CGVA 5A14A 4MXXA 4FKOA 4L7SA 2JKMA 4HVSA 5C1QB 2FSOX 3AMAA 1YI6A 5ANOA 2G1TA 4UMPA 4R1YA 2XK3A 3NEWA 3POOA 3MI9A 1F0QA 4BI2A 1PMUA 4YZ9A 3R22A 4EL9A 3M11A 3LFFA 3K54A 4GIHA 3VW8A 4CTBA 2VX3A 2O65A 4QMPA 3ITZA 3PIYA 2VTLA 4BC6A 2XM9A 3HAVA 1HCKA 4BDAA 4O27B 4LUEA 4KKHA 3DFCB 5LVMA 5KNJA 3C5UA 4U44A 3U6IA 1OIYA 5KO1A 5LOHA 1SM2A 4GS6A 4RIYA 3NMUF 5L2QA 5B0XA 2V22A 5DNRA 3W8QA 2PMIA 3PZEA 4YLLA 4O82A 5D12A 4FZAB 3W1FA 3OS3A 4CQEA 5E8ZA 4E5BA 1TQIA 5AWMA 5H8BA 1FQ1B 3DAEA 3PG1A 4AE9A 1QPEA 2BALA 2I0VA 4FT3A 4S31A 4L9IA 1OBDA 2I1MA 5E8UA 3MH0A 1Q24A 3FXZA 4MXZA 2WPAA 2XNEA 5IMXA 2VO0A 3OHTA 4YGAA 4C33A 5CF6A 2R3GA 4AN9A 2I0HA 4G3GA 4GVAA 4ALVA 4F9YA 4O22A 4W4YA 2OFUA 4DFYA 2QU5A 3DFAA 3LFCA 3QF9A 4FOBA 2OZOA 3VUTA 5DMZA 3UE4A 4F7JA 1OIRA 4FEUA 4DFNA 4LFIA 3PWYA 4WSYA 5HX8A 5J9ZA 2ITXA 3MJ1A 4F99A 2XYNA 5IA0A 5BMMA 5LJJA 5CI6A 1KOAA 2XF0A 4QRCA 2IZTA 2OJJA 5T68A 5D11A 3CLYA 4EYJA 3LCSA 3TNPC 1YOMA 4A06A 3LXNA 3VUMA 4PMPA 4EH3A 3C0IA 2PE1A 2LGCA 3PA3A 4O0TA 3PZHA 3ZO2A 1SVGA 3DGKA 3F66A 3FMHA 3PJ3A 4GUEA 4O91A 4YNOA 2VWWA 4G2FA 5ETIA 3N9XA 2C6EA 4EQCA 3S95A 2PUIA 4ONAA 4JIAA 3LIJA 3TKUA 1YXUA 5ANGA 4WSQA 2YHVA 4IAIA 3S3IA 3O0GA 3W2SA 3AC4A 2BRNA 3F9NA 2CLQA 4E4XA 4XNEA 4DITA 4FTCA 4IVAA 4O0UA 4DG0E 4EH7A 4BTKA 4HJOA 3VULA 3FI8A 5I4NA 4DBXA 3AT2A 4AOJA 2NRYA 3G51A 2CNQA 2WMUA 2OXYA 2IN6A 3M1SA 4ASEA 5IISA 4YHFA 3V5QA 2WHBA 3S1HA 3P7AA 4IZ5A 4MH7A 4PTGA 4F1OA 2YCSA 2W1FA 2VWXA 2PZPA 4MD8E 4NW5A 3WF7A 4IHPA 2B0QA 2GS6A 4V01A 3JYAA 3FE3A 3C5IA 3FHRA 2VTQA 3HL7A 4XRJA 5EDRA 5CXZA 5AUVA 5KMIA 2B54A 2PVYA 3WE4A 3N4TA 4FVPA 4ZZOA 4DLIA 3FZPA 4P4CA 2YIQA 2LAVA 4BTFA 5IA2A 4AWIA 2J9MA 3R73A 4KWPA 5KKRB 4AA0A 4CCBA 1XBBA 3DZQA 4UY9A 5HKMA 2ZM1A 3QQJA 2BUJA 3C4FA 1EH4A 3GEQA 4L3JA 4FICA 5I9UA 4NZWB 4F09A 4L44A 5CT0A 2Z02A 5I9YA 3P5KA 3QZFA 1VJYA 3HEGA 4APPA 1JSUA 2YABA 1XH5A 3D5XA 2V7AA 1XQZA 4MEDA 3F3TA 3RMFA 5EM6A 4RSSA 3AG9A 4IW0A 2XK7A 3BHUA 4XOYA 3V5WA 3ZOSA 4DFLA 2BDJA 1XH8A 1ZARA 2ONLC 3S2PA 1JPAA 1DI9A 1OECA 4I5MA 1ZYJA 4CZUA 4BCPA 1KWPA 2P3GX 5CASA 2B52A 3OXTA 4CRSA 4IACA 3R71A 3OY1A 1BLXA 5T3QA 3VHEA 1GJOA 4X2GA 3UOJA 4L00A 3TDWA 1W8CA 3DLZA 3HP5A 4LGHA 3GC0A 5F9EA 4O0WA 3NVMB 3MPAA 3R2YA 3SLSA 3L8SA 3NGAA 4LV8A 3FLYA 4E4LA 4GT5A 2FGIA 5AJQA 5GIPE 2Y6MA 2W1IA 4R8QA 4HNFA 4U9AA 2X8EA 5IA3A 2W1DA 4G6LA 4M68A 5HZNA 5ANIA 4HYSA 2XIZA 4EUTA 3MIYA 4H36A 5LMAA 5JN2A 1PKGA 1PKDA 4BCOA 3FSFA 2CMWA 4S30A 5EQYA 2ZB0A 4BZDA 2GCDA 3FMKA 3F7WA 1OM1A 3G6GA 4UYNA 4FKUA 1XH9A 4C35A 3REPA 2EB2A 2X39A 4FV0A 3LFQA 5C27A 4BDFA 3VNTA 1PMEA 2JDVA 4ALWA 2RGPA 4AX8A 4PRJA 2ZM4A 2XNBA 3I81A 4RWKA 5AA9A 3MH2A 4LV5A 5HCYA 4N70A 1FMKA 2ITYA 4CFVA 4JX3A 2BVAA 4TL0A 3A7GA 3LJ2A 3CCNA 3BEGA 4KIKB 5DBXA 2VTRA 2UW9A 4QPSA 1IR3A 3WARA 2NRUA 4NIFB 2OF2A 2X1NA 2XBJA 3H9FA 3QA8A 5AR4A 3LCOA 1KE7A 5CVFA 4CKIA 4EQMA 1XH6A 3K3IA 2IG7A 4FZDB 5CEKA 3R1YA 5HD7A 3TG1A 3FPMA 2QC6A 3A2CA 5IH4A 3B8QA 3Q96A 4J53A 4ASXA 3U6HA 3A61A 3QKKA 2Z60A 1XBAA 4IM2A 4FTTA 2WMRA 5K0KA 4I20A 2G01A 4RZWA 4OAUC 4FOCA 2VTOA 2PY3A 2R3HA 3GC7A 4FTJA 4U7ZA 3UNJA 3FUPA 4O81A 1FVRA 2QLQA 3NX8A 4DEBA 3WOWA 1WBWA 5BYZA 4RRVA 3UYTA 4G3DA 3ZM9A 4JIKA 4U41A 1M7QA 4V04A 4ANQA 4CFXA 4PWNA 1SVEA 5GJFA 3II5A 3HMPA 3SXSA 2B9FA 3GUBA 4Y46A 5TO8A 1W82A 2HZIA 4UV0A 3LJ0A 3WYYA 1RW8A 3MPTA 2VNYA 1XH7A 3CS9A 4HYUA 1VYZA 4OTIA 3OCSA 4RFYA 2VD5A 4NT4A 3AD4A 3UOLA 4BB4A 4YJOA 5BYLA 3GOKA 5CEQA 4TWNA 4X6QC 2Z7LA 4AA5A 2QOKA 3F3UA 4PTCA 4B4LA 1UWHA 2BAKA 1KV2A 2J7TA 4LUDA 4TNBA 4FSUA 4KIPA 3E3PA 3RTPA 3DV3A 2XCKA 3V04A 5I9WA 2R9SA 5JFWA 3FYKX 2X81A 3DA6A 3OD6X 3KN6A 5E4HA 3VS6A 4ZTMA 5HCZA 4C8BA 3RALA 4CD0A 2UV2A 2EU9A 3O7LD 3AT4A 3NNUA 5AFVA 2C5OA 4BDCA 4EJNA 4EUUA 5AX9A 2YIYA 2V7OA 3RPVA 1O9UA 3W16A 4RWJA 3A7JA 5K5XA 1MQBA 4UMTA 5HVJA 4F9CA 5HG9A 4GYGA 3GC8A 4F7LA 2UZLA 5IQDA 2XJ1A 2ITQA 3W2QA 4EYMA 4R5YA 5KMJA 4CXAA 3QTSA 3E5AA 3LQ3A 4FK6A 5A46A 2XP2A 1IEPA 5AR7A 3NUYA 4IQ6A 1R0EA 4CT2A 2PSQA 5CEIA 4C3PA 1H1SA 1H4LA 3EN9A 2JBOA 3FYJX 4FEQA 4UMUA 5BUEA 3KY2A 4BTMA 3ORZA 3I0QA 4AGWA 4FGRA 1WBTA 3PWDA 3UZTA 1GIHA 2Q0NA 4OGRA 5DRDA 2X2KA 1PMVA 2EXEA 2WTIA 3NW7A 4FZ6A 2X7OA 2WOTA 4L67A 4LMNA 4NKSA 5DEYA 5L6PA 2QLUA 2HW6A 2JLDA 2YIRA 4DAWA 4FA2A 3QCQA 5KX8A 3PA5A 5E8YA 4AE6A 1H26A 4IVBA 1Q62A 5A6OA 3AOXA 4HYHA 3CTHA 1ZYCA 3ZSHA 3RAIA 4V0GA 4EZ5A 4TT7A 1XR1A 3QRTA 1MRYA 3EL7A 5EQPA 3O8TA 5BUIA 3B2TA 3E7OA 3LVPA 4LL5A 3NUUA 2PL0A 3AGLA 3MDYA 3TJDA 4JRNA 2YM8A 4FT9A 4IFGA 3GOPA 3I7BA 4N6YA 3ZEWA 4BGHA 4R3RA 5JK3A 2NO3A 4QMTA 3IONA 1PW2A 3DPKA 3PXKA 3R9OA 4RA4A 1JNKA 3GNIB 3FC2A 3RINA 4YNEA 4BCMA 3BYVA 1FGKA 2GHLA 2Y0AA 3TV4A 3FZ1A 3QTIA 3C13A 1OKZA 5M4UA 3LMHA 3RAHA 2QO2A 2PWLA 5CX9A 2ITPA 5T6KA 3GCPA 2VWIA 4YMJA 1PXLA 2O8YA 4M8TA 3HAMA 2VTHA 3O2MA 3I5NA 5K5NA 4OTFA 2JKKA 3AD6A 2X7FA 4JAJA 3LLTA 3A62A 5C8KA 4BWXA 1ZMUA 3RNYA 3KC3A 4FIJA 4EHVA 1LP4A 3E8EA 1RDQE 3FKLA 3QZHA 5E9EA 5EQEA 2J5FA 4J98A 4FMQA 4I93A 2QOHA 3H4JA 2ETRA 3M42A 5EI6A 4U6RA 4RFZA 4U45A 2XVDA 3UODA 4AT4A 4C37A 5IG1A 3V8SA 4OLIA 4XOZA 4YTFA 3PP1A 4ZTHA 3ZS5A 3RJCA 2RKUA 3EZVA 4BI0A 1Q8YA 3ALOA 4XG4A 1BMKA 4MNEB 1OIQA 4LRJA 4Y5HA 5DR6A 5M55A 1O6KA 1JAMA 3EKKA 2IZUA 3IOPA 4JAIA 4U40A 5E8VA 3RK9A 3D14A 4P2KA 4XV9A 2GNIA 3PJ8A 2YIWA 4GUBA 5FD2A 3TWJA 4FSQA 4X3FC 2WU6A 3CSVA 3HYHA 5BVKA 3PJ1A 5CU6A 5IUHA 4FIHA 2H6DA 2J6MA 3FZRA 3HV3A 4PX6A 4KIOA 4G34A 1ZWSA 2ZYBA 1PJKA 1RE8A 5E8XA 3CGOA 3PJ2A 4JX7A 4RVKA 2FUMA 1F3MC 3SKCA 4AS0A 5LCJA 4O7WA 3EKNA 3S00A 2XIYA 4UEUA 5CSXA 2JIIA 4BGQA 4FZFB 1J7IA 4XG6A 5EYCA 1H00A 3KK8A 1HOWA 4ANMA 3R7OA 5CWZA 4CV9A 4J96A 4DCAA 4FKSA 4QMWA 2XM8A 4P5QA 2JIVA 4IDTA 4H1JA 4RX5A 3BRBA 4O83A 5ANEA 2W99B 2VWYA 4D4RA 4FL2A 2A19B 3BHYA 4FKPA 4AT3A 4ZLZA 1Q41A 3UMXA 2UZTA 3WBLA 3QQLA 1XKKA 2IW8A 3ZTXA 4EEVA 3TNIA 5EK7A 2PVRA 2VGOA 3ACJA 4BDDA 4AU8A 4JBVA 5CZHA 5CENA 5FDPA 2QODA 3KFAA 4BYIA 4HCUA 2UUEA 2UZWE 4FIFA 3FWQA 3SAYA 4BTJA 1K2PA 1MUOA 1V0BA 2UZUE 2ZV9A 3BV2A 4QMMA 4RC2A 3ZDUA 4IM3A 5HO7A 3KXHA 5LVPA 4FIEA 3BE9A 3FAAA 3Q9YA 4RJ3A 3N51A 3JUHA 1OITA 5H8EA 3ANRA 4FT0A 4OR5A 3NNXA 2X7GA 3EQCA 3GXLA 2QKWB 4KIKA 2V55A 4IWPA 2VTTA 3SDJA 2J0KA 4I5HA 4FSTA 1UA2A 1M2PA 1PXMA 1M7NA 3KCFA 5ACKA 4HCTA 4HW7A 4CMTA 4D4VA 4AW2A 4EK4A 4O0SA 2ESMA 3DAJA 3VO3A 3WZJA 5L2TA 4KKGA 4M66A 5LMKC 2W1CA 3PLSA 3ULIA 3NZ0A 4I94A 4DN5A 1IASA 3FBVA 1UVRA 2WEIA 4TKSA 5AAEA 4HPTE 4UALA 5FDXA 4BBMA 5LARA 4J7BA 5AR5A 3UDBA 5BUJA 4PDOA 5C9CA 2OK1A 4L42A 3O8PA 3E88A 1Q8WA 3F5PA 4M0ZA 3A4OX 4MXYA 2P55A 4ITJA 4FSYA 4KBKA 5HNBA 3UOKA 1OB3A 3IOKA 4DEAA 4D9UA 4PPBA 2EWAA 3B8RA 1MQ4A 1YI3A 5F95A 4O84A 4IXPA 2R3IA 3DCVA 4ASZA 3F2AA 3NSZA 3QX2A 5HO8A 3BYOA 3U51A 1Q8TA 1WVYA 4ITIA 3QU0A 2W4KA 2BHEA 3D83A 4DFXE 1UV5A 3JPVA 3PYYA 2WQBA 5J9LA 3HRCA 3N4UA 4OTHA 3MY5A 4TY1A 5ANDA 3LCDA 4HVIA 5HNIX 1J7LA 4XLVA 4YZDA 4AFEA 4K18A 3CPCA 5A3XA 4RMZA 3QQGA 2CDZA 2FH9A 4HOKA 4NCTC 4D55A 4GK3A 2OW3A 4YJVA 4DCEA 1YWRA 2J0LA 1P2AA 1ZY4A 4NU1A 2WD1A 3CY2A 3TKHA 3ORMA 2WQOA 3EQRA 3QKMA 1WZYA 3NUXA 4G5PA 3G90X 1B6CB 4XEYA 5AUXA 3WZDA 4A4OA 4C38A 2GDOA 3MGYA 5HORA 4NYEA 4DC2A 5CS6A 4RJ5A 1NVRA 3Q6UA 4C34A 1Y6AA 4U0IA 3UTOA 3DXQA 3DAKA 3A7IA 4RIXB 4FV5A 3LFBA 5AP1A 3ZDIA 5GINE 4FGBA 2F49A 4G9CA 1XO2B 3LFEA 3MVMA 3PIXA 5D41A 4YZCA 5DPVA 4ACGA 5M4CA 2PUNA 3ZU7A 2CGUA 4MD9E 5C01A 3MVJA 4EWHA 2C6MA 3D9VA 4TRLA 2O3PA 3ZMMA 3P78A 3JR1A 4C2VA 5EI8A 2JEDA 2KULA 4A9RA 4JDIA 5K9IA 3RNIA 3FMMA 4BCIA 5C8NA 5D1JA 3EFLA 4UBAA 2IJMA 5HICA 1DM2A 4BWKA 2W9FB 5JFSA 5AAFA 3VJNA 5JRSA 3PRFA 4MKCA 4Z9LA 4M15A 4AT5A 2XEZA 2W9ZB 2X4ZA 2WXVA 2FSTX 1W7HA 5KCVA 1UNGA 2R3QA 5FGKA 3H9RA 4QMQA 4II5A 2B7AA 3QBNA 3OTUA 4JRVA 3U54A 4RC4A 5CF4A 3C9WA 1SMHA 3CE3A 4EH5A 3SVVA 5EM5A 4E6DA 5AP3A 4ZY6A 2CHLA 5BVOA 1U5RA 4D1XA 4KSQA 4DH3A 4PNIA 5J79A 3WILA 2UZNA 4QYFA 3NUNA 5FTOA 3EN5A 3UPZA 3VWAA 4L7FA 2CKOA 2WTKC 3MH1A 1B38A 2BRGA 4PUZA 4AW1A 2C69A 2BKKA 3W55A 4D4YA 3PRIA 3I6UA 3W8LA 3CEKA 4NKAA 3VS4A 2AYPA 4C02A 3E7VA 4W4WA 1PXOA 4TYHA 5L6WL 2B9IA 1BI8A 3BLQA 3COIA 4KINA 2G2FA 4IWDA 4AN3A 2HZ4A 4GMYA 2HENA 2R3KA 5EHLA 3UOHA 4GW8A 4QP1A 4LMUA 5A4QA 5HQ0A 5CAUA 4I6BA 3PG3A 4ZP5A 5HOAA 5AMNA 3DS6A 2C3JA 4BCQA 5I3OA 1JSTA 3A8WA 4BKZA 1BYGA 3CQWA 4S32A 3FMNA 3T9IA 4AGDA 3CXWA 4F4PA 2R3NA 5J7BA 1FOTA 1OZ1A 3GCQA 4KB8A 4ZMEA 3RZFA 3VUHA 4O1OA 4G17A 5E8WA 3QD4A 5BPYA 2GNLA 3UBDA 2P4IA 1R1WA 2JDRA 3D5WA 3EOCA 2PE0A 4ZTQA 4Y83A 4C61A 2CKPA 4K8AA 5HE0A 4HGEA 4BY9E 2QO7A 1PXIA 2Y4IC 3E64A 2PVFA 3TZMA 2JKQA 3D15A 2RG5A 4I4FA 4AW0A 3F3WA 5GZAA 1GZ8A 3S4QA 3EQHA 4K11A 3I1AA 2Z8CA 3EWHA 1JKTA 3HVCA 3VRZA 4IWQA 3RP9A 3VS7A 5A54A 3NVKI 3RM7A 4FTIA 3O71A 3UO6A 3F5UA 3U87A 3CIKA 2J0IA 3KRLA 3Q52A 4EORA 4TYEA 3QCYA 4Y72A 5EW3A 2B9JA 4LGDA 2YCFA 3BGZA 3W2OA 4C4EA 4AGUA 3LMIA 4JOAA 4G3EA 2WTCA 4NJ3A 4EZ7A 4MNFA 5KUPA 1AQ1A 4BI1A 4PTEA 3LCTA 3QLFA 1PXKA 2B55A 1BX6A 1Q5KA 3UC3A 3LXLA 4QMSA 2HCKA 3KKVA 3PSCA 4WO5A 1WVXA 3MY1A 2X6DA 4DE4A 4CZYB 3BI6A 2WB8A 3AMYA 1JSVA 5BVNA 2ERZE 2J5EA 5HEZA 2C6TA 4QP9A 3P86A 5CQUA 4YPDA 4BCFA 2PPQA 2PYWA 2CCHA 3HRFA 2PVNA 4QNAA 4GFMA 4NW6A 3ODYX 2OJ9A 3MFRA 3R7EA 3S0OA 4RZVA 4N6ZA 2PVLA 4I6HA 5CI7A 4ZY4A 3RK5A 1Y57A 4FKQA 3L8XA 2C68A 3PUPA 4GJ3A 5KZ0A 1H1QA 2QG5A 3KMWA 3H0YA 3BYUA 4W8DA 4Y85A 4RIWA
chains in the Genus database with same CATH superfamily
5KMMA 3SGCA 2BRMA 1WBNA 3DZOA 4J52A 3T3VA 4BIBA 5HLNA 1H07A 4IAYA 4ARKA 5BVDA 1AD5A 3QGWA 3EQPA 1KE6A 3H30A 4YU2A 4IB1A 4YUQA 5HBJA 4XP2A 1PXJA 5HE3A 4I23A 4M0YA 4O0RA 3SOAA 3KA0A 4BYJA 3VONA 4BR3A 2QG7A 2GHGA 3UP7A 2RL5A 4KUJA 3FXWA 3TJCA 3FDNA 5DVRA 3P9JA 3PUFC 4UMQA 3E8DA 2R3MA 3F5GA 3I79A 4YTCA 3T3UA 5EKNA 5CVHA 1PYXA 1ZMVA 2PMOX 3UP2A 4YJUA 3SQQA 3MBLA 4G5JA 2PMLX 3CGFA 3NYOA 5D7VA 2A4LA 1OMWA 3BIZA 2FYSA 2OO8X 3TNHA 4DA5A 2W96B 4QTDA 3WF9A 3EH9A 4H05A 1OIUA 3FEGA 1V0PA 4S2ZA 4DTAA 5IH6A 3GGFA 3RM6A 4ZLOA 4XG7A 2ZAZA 1J1BA 3NYXA 1XH4A 3OCTA 4QYHA 3MS9A 4V0GB 1HCLA 1TKIA 3GU7A 4BKJA 4PY1A 3G0EA 4JG8A 3O17A 3Q9ZA 2BDFA 5H2UA 5J5TA 2J4ZA 1H8FA 1NA7A 4I24A 3BELA 4FBXA 5AM7A 4ACMA 3ATSA 4KS8A 3TEIA 3U9NA 4BWPA 4FJVA 1BL6A 2X0GA 3GI3A 4LL0A 1L3RE 4PL5A 4TWOA 4EK8A 2QVSE 3BU6A 4J8NA 5FEEA 1S9JA 4J99A 5J8IA 3ENMA 4U5JA 1OUKA 2IZSA 1Q3DA 2UW3A 3TTJA 5JFXA 4XUFA 2PHKA 2JKOA 3R04A 3HKOA 3UJGA 3V6SA 1VYWA 3ZUUA 4A4XA 3BHVA 4R1VA 5JFVA 1ZOHA 3BYSA 3BKBA 4IMYA 1E1VA 1BI7A 4NFMA 4IBMA 1YW2A 4FC0A 4OTRA 3QL8A 5J95A 2Q0BA 3EN6A 4LYNA 4BHZA 1TFFA 3TXOA 4FKIA 4NM5A 3AC3A 3PE1A 4DEEA 2XK4A 3H10A 3QTZA 2GQSA 2QR7A 2IF8A 4MWIA 4FKWA 3KULB 4JR7A 4F63A 2XNPA 4RIXA 4HNIA 4O1PA 3PXZA 3LKMA 1YI4A 2YN8A 3VQHA 3RGFA 3F2NA 4U80A 3ZC5A 4YC8A 1J91A 2UVZA 4USFA 2OJGA 1WBOA 1OKVA 2YM6A 5GZ9A 5B2KA 3KRWA 3UG1A 4Z7HA 3OP5A 5G1XA 2W4OA 4NK9A 2XNGA 2XIKA 4XV1A 5CU3A 3V5JA 2GU8A 3FMDA 3A4PA 1H28A 4JG6A 5E1SA 4ZZMA 2QOCA 4O7RA 4UXQA 3JY0A 4AZVA 1CM8A 4TWCA 4UN0C 5TF9A 5AEPA 5LMBA 1STCE 3F3ZA 4FTOA 4IFCA 4RWLA 5AP7A 3Q4CA 3C0GA 4ZSLA 1JBPE 3WI6A 2BZIB 5KBQA 3TCPA 4KD1A 4UXLA 3OG7A 5AR2A 2XAMA 1JOWB 3F2RA 4G1WA 4O4BB 4ERWA 2E2BA 3RPSA 4C36A 3EYGA 3QC4A 4X3JA 1P4FA 5AUUA 3QRKA 5C4KA 4ANNA 2G2HA 4ZZNA 2X2MA 3DU8A 5CY3A 3RI1A 3AGMA 3EQGA 3KCKA 3THBA 4D0WA 4FT7A 4PPCA 4XHKB 4C57A 3U8WA 3WYXA 3O23A 4RJ7A 2XAOA 3F6XA 4WA9A 4LQMA 1VEBA 3R8VA 2BAJA 4BL1A 4WOVA 4G3FA 3R1NA 4DT8A 1UNLA 2WGJA 3DQWA 4EK3A 3N4VA 3KRXA 4E4MA 4XG8A 3VC4A 3O5AA 5IQCA 4ACDA 4CKRA 4S33A 3HRBA 3P7CA 5EFQA 3W18A 5I9ZA 2ZMCA 1ZOEA 4FI1A 5F4NA 4F9BA 2DWBA 5J7HA 2G9XA 1KE9A 5H9BA 5CAQA 5FP6A 2PZIA 3MPMA 3AXWA 2F7EE 4IX3A 4PMMA 5AUYA 2WU7A 4F7SA 3QX4A 4E6CA 2VTMA 4GU9A 4KNBA 3UQCA 3UNZA 3OF0A 2WMBA 3K5VA 5CAOA 3OW4A 4IX6A 3W0MA 1ZYLA 2O64A 2VTJA 5J1VA 3EJ1A 4AXAA 3UDTA 1YOLA 3F7ZA 4ZSJA 3TV6A 1E1XA 4YTHA 1YKRA 2PULA 4O7TA 3JVRA 2RIOA 3FQEA 1YDRE 4X7QA 3LPBA 3GFWA 2A27A 1Q97A 4XBUA 4DH8A 5CZIA 4FTQA 2VUWA 4PP7A 5I0BA 5DH3A 2JFLA 4E26A 5HHWA 3DBFA 2XKEA 1S9IA 3LW0A 5K4IA 4JBOA 3C4ZA 4I92A 4U79A 2Y7JA 3VUDA 4RGJA 1JVPP 4EJ7A 4ZOGA 5DR9A 5FXQA 3C4EA 2W1HA 4BDIA 1W0XC 4Z55A 4H3PA 2IW6A 2C3KA 1QMZA 2XBAA 2GS2A 3LAUA 1UKIA 4YJRA 4KRCA 1WCCA 4FV9A 4WIHA 3OZ6A 4TYGA 1G8JA 5FG8A 3ZEPA 3PPKA 3R8PA 3TT0A 2XB7A 4ACHA 4MQ1A 4C3RA 3C4CA 3PXRA 5L2WA 4GFGA 3UNKA 2A2AA 2BFYA 4J97A 5HU9A 4IM0A 5DYJA 2WTJA 5IEVA 3HMNA 2OICA 2UW6A 3A60A 3HMIA 4H1MA 4J71A 2QONA 3MYGA 3DNEA 5A4CA 4ZTLA 4YP8A 2IVUA 4MXAA 2WO6A 3OWPA 4DINA 2REIA 2C6IA 2QO9A 3LCKA 4L53A 5AP2A 4OBQA 3F3VA 4I21A 3EQIA 4ZJIA 4D2VA 4JS8A 1SVHA 1WAKA 3Q32A 2X0QA 4E7WA 5I9VA 2CGWA 4JL9A 5GJDA 4IH8A 3R02A 3TIZA 4I0SA 4JR3A 3GQIA 5JSMA 3LXPA 1TQMA 3P79A 4FIGA 4PDSA 1KSWA 1G8KA 3I7CA 3LZBA 1CSNA 3PA4A 4ZS0A 4NL0A 5JQ8A 4YSMA 2YFXA 3NUSA 3EL8A 3P08A 5GNKA 4KRDA 1FBNA 3E92A 4OTDA 5HG8A 3IPHA 4R6VA 3IGOA 4PMSA 2A0CX 4FT5A 4BFMA 2BIYA 4QP6A 1H01A 2FA2A 4F08A 5L8LA 3QD3A 3ATTA 4QMNA 3ZC6A 5HESA 5CAPA 1ZLTA 3DK7A 4CQGA 4I41A 3C51A 5IQAA 5CALA 1PY5A 4XG9A 3VF9A 2XK8A 5B2LA 2BPMA 4F6UA 5A9UA 3QHRA 5L2SA 3VUIA 3ID6C 4OTWA 3OBGA 4B9DA 5HGIA 2QOLA 4FKVA 1OVEA 4NM3A 3UPXA 3OT8A 3OCGA 4WNMA 1UU3A 3RK7A 2VO6A 3UDSA 3QTRA 3W0PA 3PXYA 3E8CA 5B7VA 2VX1A 3PY0A 5IPJA 2H34A 5KZIA 3R8MA 3ELJA 4G9RA 4JVGA 3ZO3A 2UZEA 5EOLA 5EW8A 2J0JA 1OPLA 2ZMDA 3V51A 5IH5A 3AT3A 5EKOA 4FVQA 4XCUA 4FYOA 3NCZA 3TN8A 5BV3A 3W0QA 2JAMA 2CLXA 1U5QA 2FVDA 3DB6A 5DHJA 3PXQA 5HIDA 2WIHA 2UW5A 5F20A 3PIZA 5DT3A 4ZIMA 1Q8UA 5TE0A 1MRVA 2CNUA 4MK0A 3SRVA 3U6JA 1TQPA 4KBAA 5C8MA 3V5LA 1P5EA 3H9OA 4QTAA 2QKRA 4X2FA 5JT2A 1UU7A 4MUQA 1FPUA 4BCKA 3MTLA 5M56A 3OOGA 4FSZA 5IA4A 1R39A 3MW1A 2W4JA 3BWFA 3TUCA 2B9HA 1I44A 1U46A 2X0OA 5CSHA 4BICA 4YZMA 4DH1A 3AKJA 3NLBA 1V0OA 3ORIA 5D7AA 3CTQA 3VUGA 2UW4A 4ORKA 4MWHA 5L2IA 2ITWA 3WF8A 4TYHB 3FLZA 2JGZA 2R0UA 3DTCA 1UKHA 5IQIA 2UVXA 1G5SA 2UW7A 4YO6A 3Q2JA 1T46A 4EOLA 4CCUA 3PY3A 1OL5A 3R0TA 3BWJA 3MY0A 5AV1A 4L52A 4E5AX 4FV7A 5JH6A 4MYGA 3JXWA 3ZZEA 3KULA 2J90A 3FKOA 4C3FA 1YOJA 4ZTNA 2YJSA 4A4LA 4OTGA 3AQVA 2HZNA 2OU7A 5AR3A 4KIQA 2ITZA 3HMOA 4FTLA 4FTAA 3UVPA 4IE9A 4X2NA 3E63A 4XH6A 3TTIA 2WQMA 4CZTA 4K2RA 4RX9A 4IDVA 1UNHA 3V5TA 5HU3A 5J5SA 3ANQA 4U97A 2CGXA 2P0CA 2EXCX 4IAZA 4J1RA 3OBJA 2E9OA 3TV7A 4H39A 4RQVA 3D4QA 4QMXA 5ANKA 5IEXA 3W0SA 1H27A 4XS2A 4NWMA 2XS0A 4ZJJA 3BGPA 4APCA 4NTSA 4MD7E 4Y8DA 5JZNA 4EOOA 2YZAA 3GVUA 5KKRC 3NNWA 2R7BA 4L6QA 1XBCA 3Q3BA 1OPJA 4FNZA 5J1WA 1LR4A 5TR6A 3QZGA 3MA3A 3EFKA 4O4DA 5FXSA 4EHGA 3K2LA 5CNOA 4YJQA 2YJRA 4ZEGA 2VRXA 4BBEA 4ZLYA 3QTUA 2PE2A 1W2CA 4BBFA 3ERKA 2Y8OA 4GH2A 4YSJA 2J51A 4WNKA 4D2PA 1XJDA 4ENYA 4X2JA 3IO7A 2XEYA 1JLUE 3I5ZA 4W9WA 1M14A 3W2RA 4Q9ZA 5JZJA 4EOSA 2X4FA 4IZ7A 3L9LA 4Z16A 3G15A 4FKTA 5DT0A 4RA5A 1A06A 3LM5A 1NVSA 1PHKA 3DQXA 3R9HA 4GU6A 5CF5A 2VTAA 3AMBA 3QWKA 4EHEA 5L4QA 4M14A 2SRCA 4K1BA 2VO7A 4RIOA 5ACBC 4BZOA 3A7HA 2BR1A 3TACA 1R3CA 2YACA 4DHFA 2I0EA 4FYNA 4CG8A 2YM7A 3ZRMA 4OUCA 1KV1A 4IAFA 4H3QA 5KMNA 3NUAA 5IQEA 3W0NA 2XYUA 3RPYA 2DQ7X 3VJOA 3HV6A 4O4EA 5FUTA 2UW0A 3LMGA 2P2HA 4RPVA 4DGGA 3ORNA 5HE1A 5KBRA 4M69B 3Q53A 2ITTA 4RIWB 4AACA 1JWHA 4RBLA 1RJBA 2QOQA 3GT8A 4O86A 4R7HA 4JDHA 1KE8A 4IC8A 2ITVA 3KREA 3NRMA 2PZYA 2YCRA 3NAXA 5M08A 3O51A 2VV9A 3GQLA 4FUXA 5CSWA 2C3LA 5KMKA 4L8MA 4HVHA 4FV1A 4XP3A 3AC2A 4ZY5A 4DEDA 5E90A 2UW8A 3UO5A 3QUPA 5CQWA 3VN9A 3DKOA 2WQNA 4ENXA 3LLAA 1LPUA 2OF4A 3EQFA 5EM8A 2GPHA 3WF5A 3R8LA 5AA8A 1G8AA 4AN2A 3KEXA 3SX9A 4O0VA 2HW7A 3FI4A 4IB5A 4XV2A 3ORPA 3P1AA 3OTVA 4ANLA 4J95A 1CTPE 4KABA 4NM0A 1H0WA 1PMNA 1FMOE 3M2WA 3B2WA 4C4GA 3TYKA 4IANA 4BIDA 4AZEA 4FNWA 4QT1A 4U3YA 3SV0A 2VGPA 3IW5A 3ZONA 5HVYA 5HIEA 4RVTA 3QA0A 4G31A 4NUSA 3OWLA 5EW9A 5L3AA 3UQFA 4F9AA 5CSPA 4C4IA 5E8TA 4YBJA 5HBEA 4DFBA 4QP3A 4OTPA 1E9HA 1WBSA 2C6LA 2HOGA 5FTQA 4JQEA 1XWSA 4R77A 2BTRA 2YWVA 3CR0A 4YLJA 3E93A 3R83A 3FMLA 4CGAA 3MJ2A 4E20A 2PVHA 4WBBB 3WIGA 4HGSA 2Z2WA 3UIBA 1Q99A 2GNGA 4G6NA 3IGGA 4YC3A 4YJSA 4D2RA 1YHSA 2YM3A 2HY0A 4QQCA 5KHWA 5IQGA 1CKIA 3FY2A 3PY1A 5AP0A 1JKSA 4GT4A 2X9EA 4CVAA 2YDKA 4HVDA 3OROA 5AV3A 1U4DA 2XCHA 3CTJA 3EFWA 4L46A 4A9UA 2OIDA 5CT7A 5AIRA 5AADA 4XRLA 2OG8A 3DTWA 2XA4A 3PSBA 3O7LB 4X21A 3BQRA 3C0HA 2CCIA 2ZV2A 5M07A 2YAAA 3MV5A 1W2FA 4FV3A 3FLWA 4AOTA 3EN7A 3R8ZA 2F2UA 4FSMA 4O2PA 2F7ZE 1J7UA 3UO4A 2BHHA 2XJ2A 5D9HA 2RF9A 3K3JA 5FP5A 4BN1A 4AZTA 2X0PA 1NVQA 4O7ZA 4USEA 2ZJWA 4GIIA 3VS0A 3HV4A 5ETFA 3KU2A 3GP0A 3VBVA 4GCJA 4N57A 4C0TA 4DGMA 5AV4A 4FEVA 1OGUA 4I0RA 5AX3A 3ZO1A 1PYEA 3BE2A 4YHTA 4O7SA 4UWBA 4ANBA 4KSPA 3POZA 2YWPA 3HMMA 3MH3A 3QUEA 4QMUA 4GK4A 1ZXEA 4C62A 4HZSA 4YTIA 1YRPA 5EG3A 3KGAA 3VBYA 3HZTA 2AEGA 1DI8A 4RX7A 5IQBA 3CD8A 4DH5A 3SW7A 2IO6A 3SG9A 2YLFA 5JQ5A 1M52A 3FLNC 4MQ2A 3EN4A 4ALUA 1OBGA 4LOQA 3DBQA 3VBWA 3PDTA 4DTBA 3BCEA 3QQUA 2XRWA 3FZSA 4XJ0A 4I3ZA 5D10A 2GTMA 2B4SB 2ZV7A 3NAYA 3FKNA 4H58A 4MAOA 3BEAA 4D58A 3I4BA 3UG2A 4C2WA 2GMXA 2XKCA 3JY9A 4FTNA 5M4IA 1CKPA 1KE5A 1RQQA 2P2IA 3BLHA 3DJ6A 4BGGA 5J9YA 5AV0A 2PZ5A 2X8IA 5ANJA 3VS2A 3MFTA 5K0XA 3PFYA 3QRIA 3ZFXA 2Z7SA 4EQUA 3HDNA 1R0PA 2C0IA 4NFNA 5EYDA 3RKBA 4DFUA 5DOSA 3QFVA 5J87A 5A4LA 3R2BA 2BMCA 1GZOA 3KXZA 2R64A 2XIXA 4UZDA 3JS2A 5BVWA 3H3CA 3QALE 3OWKA 3VIDA 4L3PA 1ZOGA 1SNUA 2BTSA 2YEXA 3KXGA 3R7GA 3UGCA 3TZ7A 4CFWA 3COMA 4JQ8A 3VBXA 4FTRA 3OFMA 4GKHA 4DGLC 2UVYA 2X6EA 3KK9A 4JT3A 2FB8A 2VX0A 4O96A 2XK9A 1URCA 3DOGA 3GU5A 4MF1A 4DG3E 3W33A 4CYJA 2BDWA 1K9AA 3DXPA 3LXKA 4U8ZA 3DK6A 2XZSA 3FI2A 1REKA 2C30A 4B0GA 3D0EA 3FQSA 4RWIA 3EFJA 1YDTE 4BCJA 3MN3A 1ZYSA 3EIDA 3FPQA 3NDMA 4TYIA 5AUZA 5B2MA 3DKCA 2AUHA 4FZ7A 5CEMA 4BDHA 3FQHA 4QOXA 4QYEA 2WMSA 4LI5A 2B53A 4QDVA 2ZVAA 3QTWA 4FEWA 4V05A 4DHZA 2OXDA 2JDSA 1GIJA 4GJ2A 4QTEA 1MRUA 1T45A 2HY81 3A7FA 3FLQA 4BZNA 4C4HA 5IDPA 2QURA 3QWJA 5DRBA 3ZXTA 4AGCA 3COHA 4K6ZA 4E1ZA 5M06A 1P14A 2WELA 1GAGA 3HV5A 2VAGA 3DDQA 4L3LA 5DE2A 3VS3A 5GIOE 2EB3A 2YCQA 4AW5A 2NNWB 2VWVA 4CT1A 3NR9A 3R30A 3IW4A 3HUCA 3O50A 4LG4A 4EK5A 5KHXA 2W06A 5G6VA 5A4TA 4QPMA 3BU5A 4O21A 3KRRA 2EUFB 1PXPA 5IQHA 3D7TA 3UVRA 4CMOA 3TIYA 1MP8A 2OIBA 4YURA 4IAAA 5CAVA 4BIEA 1KOBA 4TTHB 4CFFA 1WVWA 4LOPA 4HVGA 3BQCA 4QTBA 3PVBA 3LFAA 4B6LA 4YZNA 3QXOA 3KF7A 5KMLA 3IW8A 3C1XA 1OL2A 2AC3A 2ETKA 4CTCA 1VZOA 4M69A 3UC4A 3OEFX 4X0MA 5CEPA 4O38A 1OI9A 2BZJA 2JC6A 4OT5A 4P5ZA 1F5QA 3L1SA 4M13A 3MVHA 4QDEA 4AAAA 1SYKA 3IS5A 4LM5A 5EOBA 4ZJVA 3PPJA 2ITOA 3PTGA 4UZHA 4DTKA 5M51A 2VO3A 3VF8A 2JD5A 3W2CA 3ML1A 3PP0A 2NP8A 4BDKA 2OZAB 5ETCA 2GTNA 3TM0A 4M84A 3O8UA 2VTIA 3DBDA 1CMKE 2BKZA 4M67A 4M3QA 4BDJA 5DI1A 2UZOA 2Y4PA 3RWPA 2OSCA 3IDPA 2W1GA 4QEBA 3QAME 3NW5A 5C03A 2OKRA 3OMVA 4L68A 1ND4A 1NXKA 3NYVA 3PJCA 4ITHA 4GL9A 1CKJA 1SNXA 4I5CA 5CYIA 5M4FA 3ZHPC 3QZIA 4R3PA 2X9FA 4EC9A 4MBJA 3AKLA 4IJ9A 4AF3A 5FWKK 3PVWA 3QD0A 3IW7A 5LWMA 4D2WA 4A07A 4JQ7A 2O0UA 4L43A 1WFCA 5DT4A 3OEZA 1M2RA 4BCGA 2WQEA 2ZV8A 3COKA 3CJFA 4BDEA 4FEXA 3KVXA 4EWQA 2EVAA 3R7UA 3ZLYA 2VTNA 4K9YA 2GFSA 2JBPA 2BAQA 4F0GA 1ZMWA 2FSLX 3OUNB 3SRVB 4FV4A 2RFEA 3FZTA 3MWUA 2GNJA 4D5KA 4K33A 5AM6A 4O7NA 1KUTA 2UZBA 4ZSAA 4I4EA 4G6OA 4MCVA 3MFUA 3ACKA 4FVRA 4QMYA 3ZRLA 2IVSA 2WMVA 3ORXA 2YAKA 4G3CA 3TMOA 4TNDA 5IA5A 5CXHA 5FBNC 1H1RA 4ZTRA 5BYYA 5AIKA 1ERKA 2XNNA 3O96A 4EH8A 3UQGA 2DS1A 3LQ8A 5EM7A 3ZUTA 1J3HA 5KMOA 2QOFA 3G2FA 5FEQA 1Q4LA 4WNPA 2CKEA 3ZBFA 4BDGA 1ZY5A 3DJ5A 2Y6OA 1PXNA 2R7IA 5HBHA 4TYJA 2C0OA 5AP6A 2QI8A 3G6HA 2PVMA 5BNJA 1OUYA 5DGZA 3BBWA 4RG0A 3EYHA 3NIEA 3W32A 1GNGA 3SXRA 2DUVA 4GT3A 4YZBA 4XG3A 4FR4A 5M57A 3R1QA 1YWVA 3FV8A 2ZDUA 2OIQA 3R7IA 2HELA 4USDA 5DR2A 2ONLA 2QQ7A 4X3FB 1OL6A 2CN8A 4RVMA 4BDBA 5E91A 4Y95A 2PTKA 3ZXZA 5AP5A 2BRBA 3FLSA 3MVLA 3ZH8A 4QPAA 4B8LA 3G9LX 3OC1A 3DBCA 4IWOA 3FXXA 1PRYA 4YHJA 4ANOA 1YHVA 2YITA 4QMVA 5JEBA 4QP4A 3KXXA 4X2KA 2WIPA 2VTSA 3HA8A 4CMUA 3D94A 4FE2A 2WEVA 3HLLA 3R6XA 4Q5HA 1OKYA 3QUDA 2C47A 3BV3A 4YJTA 4DEGA 3L8VA 3OOMA 3F69A 2YDIA 2BIKB 4FKLA 4HPUE 3TZ9A 3H0ZA 1G3NA 1X8BA 3PSDA 4TW9A 3AC1A 5JGDA 3F5XA 5HD4A 5TKDA 1YHWA 4IJPA 1YXXA 2BCJA 3UIXA 3D5VA 3R01A 4NSTA 2JFMA 4IEBA 4AZSA 4E5WA 1IA9A 4FV6A 4D28A 2QR8A 4K0YA 4GV1A 5HX6A 1OL7A 5CTPA 4K77A 3GFEA 4EOQA 3IDCA 3FJQE 4MVFA 4C59A 2F2CB 2E9PA 4M97A 4CNHA 3LQ5A 4EBWA 2GQRA 3RAKA 2WMTA 4OAVB 4OBOA 3IDBA 4QP8A 3KMUA 4BKYA 2GQGA 5CNNA 1XMMA 2Q83A 3HECA 4EOIA 5I3RA 3U4UA 4I22A 2JDOA 2R4BA 1W98A 3Q2MA 3OW3A 4I6QA 4IZAA 4TN6A 4EH6A 4TPTA 1NT2A 4F1MA 3HDMA 2OI4X 1PF8A 3CD3A 5E92A 4PDYA 3LJ1A 4FL3A 3Q6WA 3QYWA 4L01A 4U42A 5HTIA 5H8GA 3TL8A 3ZLXA 1DAYA 3NCGA 4FG9A 4FSRA 2R3JA 4J8MA 3Q5IA 1FVVA 4M7IA 3E3BX 3HX4A 3C4XA 4DEHA 3NPCA 3GENA 2R3LA 3QCXA 2HK5A 4E73A 3D5UA 4O4CA 4Q2AA 3VS5A 1G8SA 2HWPA 3VHKA 4GRBA 3FMEA 3ALNA 2R3RA 4LOOA 5LMKA 3DNDA 2G2IA 5DN3A 2YERA 2OFVA 5GJGA 5CSVA 4QMLA 4RX8A 4RLKA 4XYFA 5DG5A 3UYSA 3VW6A 5E7RA 5ETAA 4AZFA 5IF1A 3ZUVA 5AP4A 2VWZA 5JGBA 2C1BA 4IB0A 1FVTA 2HXQA 2GHMA 3GCSA 4O4FA 4O7VA 4GYIA 4FV2A 1U54B 2R0IA 3CPBA 5FRIA 2WMWA 3Q9WA 4FTUA 5FQDC 5BVEA 3TNQB 2WNTA 4CEGA 4DH7A 1APME 1QPJA 5CF8A 2ITNA 1P4OA 5LVLA 4GEOA 3TUDA 2C5VA 4BCHA 2P33A 2R3PA 4MTAA 4U81A 1Z57A 4EOMA 5C4LA 1GZKA 3PVUA 3ORLA 3R1SA 2JIUA 3R7YA 5CEOA 4JJRA 1R78A 3SG8A 4H3BA 3RVGA 4IX5A 3LE6A 4XBRA 3ZRKA 2YISA 4YPSA 1DS5A 2XJ0A 4FF8A 3T8OA 5IA1A 3IW6A 3ZLSA 3L8PA 2WTDA 5L6OA 4ZS4A 3RPOA 2HWOA 3GB2A 4ZMFA 3CKXA 5LWNA 2IW9A 5L8JA 2ITUA 3FY0A 3GC9A 4FIIA 1NY3A 3ULZA 2VTPA 3DKFA 2WTWA 1Y8YA 3TKIA 1LUFA 2FO0A 2HIWA 3CY3A 2XARA 5EYMA 2WFYA 4FG7A 5F1ZA 5LVOA 1OKWA 4CRLA 3QKLA 3FSKA 4U43A 3FMJA 4QYYA 2XNMA 5HVKA 2JDTA 3LFDA 1Y91A 3DJ7A 4C7TA 4D2TA 4O6LA 4O0XA 4LGGA 3LHJA 5FLFA 2A98A 1YWNA 1IA8A 5DLSA 4YR8A 3D2KA 4YBKA 3MB6A 2HYYA 5LCKA 4AP7A 5TOZA 3AC8A 4UYAA 3NFFB 2XK6A 3OXIA 2C6OA 3QC9A 3TI1A 2C4GA 4A7CA 3I0OA 4FSNA 3R9RA 3BPRA 4O0YA 2X2LA 2WZJA 4AOIA 1QL6A 2E9NA 3AC5A 4FTKA 4OW8A 5EI2A 4PNKA 3T9TA 4Z7GA 5E1EA 5KE0A 3ROYA 3ZLWA 2OZAA 3GBZA 1DAWA 3KMMA 4YJNA 2H9VA 3IK3A 2PMNX 4KBCA 3V8WA 4D1ZA 2CSNA 3CJGA 3CQEA 5DA3A 1QPDA 2ERKA 3Q4UA 4F70A 1M2QA 1UWJA 2A1AB 3GCVA 4WG4A 5EDPA 3KF4A 2XKDA 3VBQA 5AV2A 2V0DA 4JNWA 2PUUA 1H08A 4Z3VA 2GS7A 4MXCA 4O2ZA 4EH4A 5FBOA 4JBQA 3C50A 4WHZA 3ZSIA 5JRQA 4EH2A 3VVHA 2GNFA 1CDKA 2IVTA 1ZRZA 3QGYA 3VQUA 4EZ3A 4QNYA 4A9SA 2YM4A 4JBPA 2DYLA 4XG2A 2W1ZA 4D5HA 3TNWA 1L8TA 4IC7A 2WOUA 2YLEA 2VZ6A 3LFSA 3UIMA 2WTKB 4F0IA 5GHVA 2BFXA 2J50A 3TUBA 3KRJA 2QOIA 4IVCA 4DGNA 2JITA 4QQ5A 1YXSA 4QP2A 4D2SA 5HO6A 3K5UA 3BLRA 1O6YA 4WNOA 4MHAA 4BRXA 2PUPA 2KTYA 3NW6A 4HCVA 4RC3A 2PVJA 3PFQA 3R63A 3GU4A 4C4FA 4KS7A 5A6NA 4E93A 5BQ0A 4EKLA 4IZYA 3E62A 2W5BA 4M12A 1TZDA 2PZRA 4F0FA 3L9MA 3OXZA 2QOOA 4F6WA 2CNVA 4WD5A 4RVLA 5EH0A 5HLWA 3LM0A 5CANA 5HCXA 4QO9A 4HGTA 1GZNA 4GKIA 3VUKA 4UB7A 2C5XA 3RCJA 4Y5QA 5HTBA 5LVNA 3MB7A 2ZM3A 3C7QA 4D0XA 3ZM4A 3PPZA 4XV3A 2QCSA 3Q4TA 4ZK5A 1U59A 3CBLA 4YJPA 4EC8A 2XNOA 3MIAA 4P7EA 5CU4A 4IIRA 1UU9A 3E8NA 5A4EA 3EHAA 3R8UA 1Z9XA 4FUYA 2Y4IB 4TZRA 4NEUA 2Z7RA 4X3FA 2YDJA 2RG6A 4EOPA 1IRKA 2FSMX 2WTVA 3NIZA 3P0MA 1BUHA 1M17A 3ORKA 3G9NA 1V1KA 2XUUA 4P90A 4EBVA 4RT7A 3DBEA 4N4SA 4XX9A 4RQKA 5M09A 4IVDA 3V01A 4FNXA 3VBTA 3W10A 1XHAA 3V3VA 5HTCA 2V62A 5IZFA 1YDSE 1VLRA 2Z7QA 4PP9A