3ZSGA

X-ray structure of p38alpha bound to tak-715
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
349
structure length
337
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 14
publication title X-ray structure of p38 alpha bound to TAK-715: comparison with three classic inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 116
structure length 337
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zsgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zsgA01
1IR3A 2C6KA 4I3ZA 4IZ7A 3VJOA 3MFUA 1ZYJA 2Z2WA 3QTWA 4W4WA 1CKPA 4MNEA 3AOXA 4IANA 4DITA 5FD2A 2ETRA 1DI8A 1GIHA 4KS8A 4L9IA 2J90A 2WAJA 1O6KA 2WEIA 4M68A 4WO5A 1FMKA 1XKKA 5JRQA 2QLQA 3G0EA 3NIZA 4PMPA 4OAUC 1U59A 2JKQA 1UV5A 5EKNA 5D1JA 3L9NA 2J0JA 4FIEA 4S30A 3MI9A 3UOLA 3BHYA 3KC3A 1R3CA 4JBPA 3CCNA 3LJ0A 4UWCA 3V04A 3UZPA 3VW8A 4BDHA 3OWJA 4EL9A 2YDJA 4D9TA 1YWRA 3TZMA 1T45A 1ZY5A 2QKRA 2YAAA 4WG4A 2PZ5A 1H1PA 4KBCA 3PWDA 4F7SA 3HV4A 4EKLA 3NYVA 1H00A 4FEQA 3Q4CA 1PKDA 3DA6A 2BRNA 3N9XA 1ZYDA 2EWAA 4RC4A 5GIPE 1I09A 3UNZA 1PXOA 4LFIA 3PZEA 4BL1A 3R8UA 3GP0A 2B53A 4DEAA 4Z7HA 3UIMA 4XG3A 2W1FA 3NCGA 4U40A 1U54B 4FIIA 5D11A 4AS0A 4HVIA 5IZFA 4DH1A 4FSZA 3HV5A 3EN4A 1VZOA 1H0WA 3CD3A 3PSCA 4FEUA 3A7IA 1IA8A 3COMA 3E8EA 4DFNA 1ZYCA 4S34A 3FLSA 5C8MA 3VUKA 3UPZA 1PXJA 3UG1A 4DGNA 3DK6A 3RKBA 4FV3A 2YDIA 3D7TB 3IOPA 5CAPA 5E8VA 5K5XA 3VBYA 4H36A 3HUBA 1W82A 1HOWA 5EG3A 2WGJA 4JS8A 2BROA 2PSQA 4F1TA 4ZZMA 5HU9A 2XIYA 3SA0A 3PLSA 3A62A 1JBPE 1F5QA 5HI2A 2ITPA 5LMBA 4DFBA 4C8BA 3ZO1A 4IM2A 4FOCA 5CT0A 3R9DA 2XCKA 4XUFA 5HBHA 1BLXA 2JBPA 3MFTA 3EH9A 2VWBA 3KL8A 3OW3A 2BTRA 3E63A 3QKKA 4H1MA 3OT8A 4I23A 4AP7A 5BYLA 3N51A 4EH4A 2WQEA 4O7SA 4BDKA 2HENA 1JLUE 3G51A 4D1XA 4N70A 4IX4A 1TQIA 3ORPA 3D94A 5IA2A 4EJNA 1XH5A 3ZDUA 2AC5A 2PVRA 5DLSA 5HLWA 4IVCA 5J5SA 4GFMA 4A9RA 5KMLA 5LVOA 4CG9A 3B2TA 3BLHA 2O8YA 3ZSGA 2GDOA 3ZLXA 2VTQA 5BQ0A 3TKIA 4AXAA 3LLAA 4GVAA 3VQHA 2XA4A 4HCTA 5CI6A 4F9BA 5HE3A 4FV5A 4C3FA 3G9LX 3UVPA 4JBVA 3A8XA 4FIHA 1PHKA 3CIKA 4H39A 4MVFA 3RALA 2JC6A 2ERZE 4QTEA 5BVDA 2B0QA 2NNWB 3NSZA 1OUYA 3O2MA 2GNHA 5L8KA 5KO1A 1Z5MA 5M07A 1LEWA 3SLSA 4IAAA 3LFNA 2GTNA 5HVYA 3F7WA 2WMXA 3MVJA 4ZY5A 4QOXA 4XJ0A 1H1SA 3PTGA 4F0GA 2SRCA 2VTJA 5KBQA 4RX7A 3NCZA 3QXPA 2OH0E 4U45A 2V5QA 3ALOA 2XNNA 3PZHA 5E1EA 1Q97A 2ITNA 4P90A 4WOVA 4EC9A 5CF5A 4FSYA 2YISA 5A4QA 4KBAA 2GNIA 3DBEA 3WZUA 3C0IA 4O0YA 2OG8A 4RWIA 3DU8A 4XS2A 3UMWA 4DYMA 5K5NA 3PLAE 5FRIA 4O96A 3COIA 3GU5A 2WTIA 5B2KA 4ENYA 1FGKA 1SNXA 2A1AB 4MXXA 4BZDA 3VUDA 1YHVA 5CU0A 4UX9A 4DFUA 4XG7A 3PE2A 3SXRA 4BKZA 4LGDA 2X7GA 1BMKA 4F64A 2R3IA 3D5VA 3BELA 3UPXA 4FF8A 4ZLYA 3C51A 2P2IA 3QUPA 2W1GA 4FIJA 4AW5A 3JUHA 3SDJA 4PP7A 4RIXA 5KMJA 4IDTA 4OTRA 3MFRA 3R30A 2BHEA 3D14A 4C2VA 4RJ8A 4XLIA 3BV2A 5ACKA 2CNVA 2I7QA 2B9HA 5I9VA 1L8TA 2RG6A 3LCTA 3Q9WA 3FC1X 2F7XE 1DS5A 5CZHA 4FE2A 3ZSIA 5HLPA 3ZUTA 3TNHA 4C4JA 1E1VA 4ASZA 4QP6A 4W4XA 1XH8A 4RJ5A 5H3QA 2WMVA 3VBXA 3V01A 4O84A 4AW1A 4FL3A 3DQWA 3F61A 3A7JA 3GCPA 1PYEA 5L8JA 2IN6A 5B7VA 4RVKA 4IH8A 4GU9A 2VTPA 3QXOA 3GXLA 5HGIA 4ZJIA 2OH4A 1PRYA 1Z57A 3QC9A 5J8IA 3OROA 3QRIA 3ZRMA 5CSHA 5J87A 3VNTA 3C7QA 4FVRA 3OP5A 5BVWA 4LQMA 4IEBA 3PUPA 2HCKA 2GPHA 4I4FA 3NR9A 5KZ0A 1YXXA 2UW8A 3QQFA 4PDOA 5AUVA 3H0ZA 4TWNA 1R78A 2QOCA 3PVUA 2IVUA 5H9BA 3MB6A 4ZAUA 2YM4A 4BTFA 3PP0A 3AMYA 2Q0BA 3AD6A 3OVVA 3QRUA 4OTHA 3ZXZA 2W4JA 3LXKA 4J99A 4UMTA 5E8ZA 1PXPA 1IAJA 4LV5A 5CU4A 2UZTA 2XK9A 3R7EA 3LQ8A 3T3VA 3TXOA 4EQUA 1ZLTA 5DT4A 2AC3A 2VV9A 2WMRA 3KMWA 4FK6A 3FQSA 5I9WA 2OK1A 3C4EA 4AA4A 4QQCA 4AA0A 4D55A 3R8PA 5HEZA 3P1AA 2WHBA 4I20A 4A4OA 5K3YA 1GJOA 2XUUA 1EH4A 4WIHA 3WE8A 2QU6A 4DEDA 4QMQA 3GNIB 2WQNA 1UKIA 1PF8A 3W33A 4FX3A 4I94A 2DS1A 4C7TA 4X6QC 5K4JA 4RVLA 2XYNA 3LFEA 4R1YA 3QZGA 1ZOGA 2QOKA 3F9NA 4O7LA 2YABA 3I4BA 3LFFA 2X9FA 3KFAA 3R02A 4O82A 4M67A 5GNKA 3KA0A 4AF3A 3B8QA 3CD8A 1XH7A 3VS3A 2YZLA 4QYFA 4E6AA 2VTOA 3CJFA 3FQHA 2BRGA 2QOFA 3KK8A 1OI9A 4D2RA 2VAGA 2YM5A 1OPKA 2C0IA 3MIAA 4EZ5A 4U43A 4OTQA 1GOLA 1FMOE 1OVEA 2JIUA 3QGYA 1O6YA 4GT4A 4J95A 2XRUA 5EM8A 5LCJA 1YRPA 3NNVA 3KRXA 4CYIA 4MK0A 3SVVA 3ID6C 2OI4X 3QTRA 3QZHA 1YVJA 3DY7A 3NUPA 3F3ZA 5FDXA 1W84A 3BPRA 3D15A 3FL5A 5AJQA 5HVJA 4C37A 5CAVA 4EYJA 3BX5A 1HCLA 2UZOA 3LXPA 3LXNA 1SYKA 3SC1A 5AUUA 4FNZA 5BVNA 2OZAA 2FVDA 2F57A 3EQGA 3ZXTA 4BF2A 3GUBA 2PULA 2FYSA 2PK9A 4FT7A 3MIYA 1P14A 5EYCA 5L6WL 4CFMA 3OTUA 4JDKA 5DVRA 2CHLA 4MNEB 2Z8CA 2IVVA 3L9PA 3LM0A 1LR4A 2YHVA 3PP1A 1OL2A 4AGDA 3CY2A 4FSRA 1G3NA 1OMWA 4H3BA 5I3OA 5H2UA 2HAKA 1V1KA 3F82A 4BDIA 3M2WA 4G17A 1CKIA 2CKEA 3PJ1A 3G6GA 2BFXA 3I0QA 4I5HA 3K54A 3RBWA 2ACXA 2QOOA 4C33A 3THBA 3ZHPC 4PDPA 3HZTA 4YJOA 3R73A 2W17A 4XRLA 3WZDA 4OTIA 3MVHA 4RWKA 3IGGA 3AC2A 3K3IA 2FA2A 4H05A 5IUGA 3BLRA 5G1XA 3FEGA 1OL5A 5HIBA 3EN7A 4D58A 4UV0A 1MRUA 3IW5A 3HMOA 1JKSA 4RPVA 2BAJA 4O0UA 4MX9A 4G16A 1H28A 4FZ6A 5CSVA 5HE0A 3IECA 4Z9LA 1JWHA 3NYXA 4GU6A 5CF8A 3LZBA 3NVMB 5TKDA 3EYHA 3E8CA 3MH0A 3EYGA 3OG7A 4EOIA 4FGRA 3CQWA 2RSVA 3FMHA 3V8WA 5KX8A 2WQOA 3MB7A 4UN0C 3NUSA 5DH3A 5GZ8A 1JSTA 3NPCA 4FZ7A 2QVSE 4QMWA 1QL6A 1URCA 4ZXTA 5IDPA 4Q9SA 4BYJA 4CKIA 4IAYA 4BIEA 5HX6A 3TKHA 5A9UA 3U6IA 3FLZA 4Y8DA 4KRCA 2ZMDA 1WBPA 3VS7A 2F2CB 3AQVA 4CMOA 4AE9A 4KUJA 1XH6A 5CVGA 2HWOA 3BYUA 5M09A 3PY0A 5E8TA 4XV2A 5E4HA 3FHIA 1LP4A 4TT7A 2R0UA 2WMWA 2YCRA 4IWPA 4HGEA 3V6SA 4PNKA 1RDQE 2XK7A 2J7TA 2VWVA 4O1PA 2VO0A 4BDDA 1RE8A 3KXXA 4HZSA 4F9YA 2RKUA 1E1XA 2EUFB 2QC6A 3F5PA 4MTAA 1WAKA 5EI6A 1XH4A 2Y4IB 4ITJA 3LHJA 3DXQA 3ZEWA 3H30A 4CSVA 2YAKA 4GL9A 4G6LA 4M15A 5DR6A 5HG5A 5A4EA 2OZOA 2WMQA 4NM5A 1H1RA 4X2FA 3POZA 3D5XA 3EIDA 3HDMA 4S32A 3WI6A 3QWKA 4HNFA 2OIBA 4F08A 5JFXA 1JAMA 1M7NA 5FXQA 4YBKA 4FG8A 5I5ZA 3F2RA 3KU2A 4ZSEA 1KE7A 2XM8A 4EH6A 3EQIA 4K33A 3EL8A 5L8LA 3I7BA 4Z7GA 3FZOA 1Q99A 2CMWA 2G2HA 5GZ9A 3U4WA 3NNUA 1HCKA 4UEUA 4E26A 4CTBA 2Y6OA 5L2TA 4G3CA 1YDRE 5IMEA 3DPKA 2F9GA 3OOMA 3VWAA 4ENXA 1FVTA 3R8LA 5E9EA 1ZAOA 1REKA 4IWDA 5JQ5A 4GK2A 4GMYA 4FUXA 4H1JA 4NFMA 5A46A 4IQ6A 4YTCA 1JVPP 3Q9ZA 4I1ZA 5CENA 2JBOA 4NYEA 4BBMA 3VF8A 2AUHA 4HGLA 3WIGA 1IG1A 4EOJA 5ITAA 4O7WA 3QYWA 5EK7A 4QMZA 4ZTQA 3LJ2A 5AX9A 2E9UA 3FLWA 4QPAA 3BZ3A 4HNIA 4K0YA 4O0WA 2BDFA 4RWLA 3FZTA 3W2RA 3QQGA 4OLIA 2X8DA 4BKJA 4BICA 3FI2A 4ZTLA 2P33A 4G6OA 5JQ8A 4YURA 2X6EA 2W5HA 4EH3A 4EK8A 3LE6A 5CNOA 4BGGA 2ZM4A 2E9OA 3QFVA 3P08A 4RIXB 4X2JA 3CQEA 5AP2A 4O0XA 3Q5IA 1P4FA 4EBVA 5EM5A 3O50A 4IW0A 4E73A 2WFYA 5BUIA 3TCPA 4HGTA 3QX4A 1ATPE 3CPCA 3GT8A 1WBNA 3BGQA 3N4TA 3P7AA 3QU0A 2BIYA 2FSTX 2IZRA 4IX6A 2YJRA 4L3LA 3R00A 4OTFA 1MUOA 4FTIA 5DE2A 2BDWA 4AOJA 3BI6A 2BZKB 2GNFA 5HKMA 4BKYA 4PTGA 3KF7A 1ZYSA 3K3JA 2UV2A 3EQBA 2PVHA 3OUNB 4IVAA 3C0HA 4KAOA 4CQGA 4DFYA 3HV3A 3OXIA 2E9VA 3DV3A 4F7LA 3TJDA 3I5ZA 3UIUA 5AAEA 4MF1A 4YJNA 5HG9A 4NFNA 4PQNA 5IQIA 3ZZEA 2QO2A 3QZIA 4E5AX 5BYZA 3S0OA 4FSQA 3TJCA 4CZYB 3A8WA 4J53A 3F3VA 4X6RA 1MRYA 1IRKA 1R0EA 1ZOEA 4LL5A 4NCTA 4QP2A 4YJSA 4QMUA 1G8AA 5HESA 4BFMA 3DKCA 4GSBA 5ANOA 2EU9A 3NUUA 3FZRA 3MPMA 3PVWA 5CSXA 5TR6A 4TKSA 5BUEA 5M4UA 4CFXA 4S31A 2X2LA 3DBDA 4O0SA 1ERKA 3Q60A 2Z7RA 4FTMA 3FHRA 4LGHA 4J98A 3NVKI 4L8MA 3MJ2A 3NAYA 2X4FA 4FV4A 5EDPA 1Q8TA 3AGLA 4EH8A 2ZM3A 3BE9A 3DK7A 2VUWA 2XEZA 4MF0A 4GFGA 5HE2A 3I0OA 2OXDA 2GNJA 2WIHA 2JKMA 2X8IA 4BCIA 4YPDA 3WIKA 3DAJA 4FOBA 5M08A 3C50A 4C0TA 2F49A 4BDFA 2WNTA 1KE9A 3DB6A 5AM7A 4DFLA 5KMMA 2IZUA 2OGVA 5L3AA 2WQBA 3RAKA 3VO3A 4PV0A 1UA2A 4XHKB 4BDJA 3BYOA 2BMCA 5EQPA 3W2QA 3OT3A 1YDSE 4MYGA 3ZO4A 3LVPA 1OKWA 2ZM1A 3JYAA 5TT7A 4IWQA 4M12A 3R1YA 3LW0A 4RIOA 5DWRA 4UWYA 4E8AA 4EOKA 5CWZA 4D1SA 3GU8A 4KNBA 4YR8A 1Q5KA 3VUGA 2YN8A 4DE4A 5IA0A 2HELA 3Q5ZA 4K9YA 3PPZA 4ZSLA 4L45A 3QCQA 4DH3A 4F7JA 2C6LA 3AD5A 5KMNA 1ZXEA 3WZJA 1VYWA 5BVEA 5AX3A 3FJQE 3G0FA 5DT3A 3TUDA 2JDTA 2X7FA 3QQHA 3ZFMA 4IZAA 3TTJA 5JN2A 4MD8E 2UZUE 3HECA 3SOCA 2OZAB 3LMHA 4EHZA 4F6UA 4M13A 2BZJA 1OPJA 4JNWA 2OJ9A 3U9CA 3H9OA 3DZQA 4ERWA 3VHEA 3P86A 3OMVA 4FT3A 3NW6A 4F4PA 2IW8A 4G3DA 5CTPA 2BUJA 5D12A 5DIAA 2YIXA 2W96B 5AAFA 1Q3DA 2J0KA 2W1DA 2VTAA 3EN9A 3I1AA 5HO8A 4TPTA 1PMEA 2XIRA 4O6EA 3UC3A 4EQCA 1KSWA 1NVSA 4RJ3A 3ORMA 4RX8A 3R1SA 1WVXA 4CFVA 4CLJA 2R3KA 5KCVA 1TQMA 3C5UA 2PVLA 5E91A 1Y6AA 3R7IA 5CX9A 4G5JA 3F5UA 4LUDA 1M52A 4OBOA 4AFJA 4ANLA 4RQKA 4PDYA 4H3PA 4HYSA 4E93A 3OW4A 4PMSA 1M2RA 3OWKA 2XM9A 3PWYA 3Q32A 4IZ5A 4BDAA 4YUQA 1WVWA 2FSLX 5AP4A 3P79A 4YZMA 4LOOA 4ZOGA 3C5IA 2ZV2A 4FV7A 3BKBA 4G9RA 4QMMA 3WF6A 2BPMA 2XIXA 2XNPA 4FV2A 3DFCB 3ZUVA 3EB0A 3L8SA 3AXWA 3HV7A 3C4CA 2ZYBA 4AACA 3QA0A 1RW8A 4IZYA 4M7IA 3SG8A 4QT1A 4CV9A 3GQIA 1KE5A 5EH0A 5L6PA 2P55A 4LI5A 3QHWA 4ZIMA 3KULA 3H0YA 4N57A 2ZV7A 1Y57A 4J96A 2UW5A 4G31A 3QQUA 2GTMA 3K5UA 4AWIA 4QP3A 3QL8A 4CQEA 1JSVA 2O65A 4YZDA 3ZO2A 1K3AA 4EK5A 4ZLOA 2ZDUA 2R3PA 3LFBA 1J7IA 4E4XA 4FT9A 4JX3A 3NIEA 4C35A 3OBGA 4U9AA 4AZWA 4FBXA 2C68A 2H6DA 4XG2A 3SQQA 3GC7A 3D2KA 1Q41A 2CCHA 3EOCA 5IA1A 4IWOA 5D9HA 3EFJA 4E20A 1B6CB 2XS0A 4FV8A 5L2SA 2VX1A 4TY1A 3MPAA 4ID7A 1CMKE 5IPJA 5C03A 3U51A 3UVRA 4N6YA 4PPCA 1URWA 4GIIA 4GT5A 4ZSJA 4F7NA 5CAOA 5M06A 5GHVA 4FKJA 4O0TA 4YJPA 3VS0A 2QO9A 4V05A 2UW0A 5CF6A 2GS6A 4WRSA 3KQ7A 3PG3A 4MXAA 3VUTA 4G9CA 3RCDA 2B9IA 4AX8A 4CEGA 3TIZA 3R7OA 2YITA 5GINE 3PXYA 3O0GA 4AOTA 4RZVA 3WILA 4AQCA 3PJ8A 4R3PA 3BHUA 3EL7A 4KKHA 3OY1A 4MEDA 1W7HA 1CSNA 3I81A 4L6QA 3OEZA 4QMLA 4OGRA 4S2ZA 4AGCA 3ACKA 3R22A 4F9AA 3HAMA 4USFA 4MXZA 4I6HA 3PRIA 3RTPA 3VRYA 2PE0A 2B1PA 2WTKC 3ZFXA 3CS9A 3MY0A 3AT2A 3R63A 4FG9A 4XP2A 2X9EA 3RAIA 4DG2E 4IC7A 5AP5A 3C4XA 5I0BA 2VGPA 5CEKA 4NM0A 4AZSA 1J91A 4R1VA 3N4UA 4EH9A 4QMOA 3BBTB 1PXIA 2A19B 2BAQA 2R3FA 3RHXA 3F5GA 2PVFA 3PSBA 4JX7A 5IQBA 3R9RA 3Q6WA 3UC4A 2B7AA 3LPBA 5F20A 3GQLA 3WF7A 2G9XA 4X3FC 2JGZA 2PMIA 4D2TA 4XYFA 2Z7SA 4UALA 3ZU7A 3TZ7A 2IZTA 2Z02A 2UZLA 2H8HA 2Y7JA 3VQUA 4A9TA 4FODA 4IM3A 4DH7A 3C4ZA 3R83A 1BL7A 1YHWA 3FI8A 3R0TA 1JQHA 3QD4A 3LIJA 5M51A 4GRBA 2YIYA 3WE4A 3S3IA 3NW7A 3C4FA 2QHNA 3GC0A 3VS5A 4A9UA 2V7AA 2Y8OA 3KRWA 2BRMA 1DM2A 1OITA 2J51A 1H27A 5EDQA 4JXFA 3BYSA 3GC9A 4AW0A 3F3WA 5EHYA 4B6LA 2XIKA 2X81A 3WOWA 2QOBA 3FMNA 4FL2A 4WNKA 5DI1A 5FLFA 5CQUA 4Y5QA 4L46A 4FL1A 3AGMA 5E8UA 4F9WA 3I79A 2ZJWA 2C69A 4EOQA 4DGMA 4U41A 3KMUA 4Z3VA 1WVYA 5AMNA 4F0IA 2WOTA 5AWMA 1NVQA 2IPXA 3RHKA 3VIDA 2CNQA 3IPHA 4EWHA 4RA4A 1AQ1A 2BKZA 1QPDA 2GHMA 3DT1A 3JY9A 4UYNA 4AZTA 3SW7A 4IVBA 3UIBA 3W55A 3SW4A 1WBOA 2JLDA 2XK3A 2C5YA 4N6ZA 4FTKA 3L9LA 4S33A 5CF4A 4O83A 2VZ6A 3ZO3A 5EOBA 4L44A 4UYAA 4C59A 3FLNC 2VU3A 4WG5A 2UW7A 4JG7A 3O23A 3R6XA 4KIKA 3TZ9A 3UO5A 4Y85A 4U81A 4AN9A 1IAHA 4Q5HA 3F7ZA 4XNEA 3E88A 2C4GA 3MVLA 3ZSHA 3R2BA 4DLIA 3GENA 4JL9A 4FVQA 3KN6A 4JVGA 4BY9E 4BIDA 3MH3A 3E7OA 4NKSA 4W8EA 4ALVA 5JSMA 4YJVA 3ZM4A 1KWPA 3QD0A 4KSQA 3D5WA 3R8VA 1SVEA 3UVQA 5JFVA 4CFWA 4I5PA 4BZNA 3BYMA 3BIZA 3R7YA 4QMYA 3LFDA 3CY3A 3FSFA 4PL3A 2C5VA 2CPKE 3ZBFA 1J1BA 4L67A 5I9UA 2J4ZA 2JIIA 3LCDA 4O27B 4TN6A 3RINA 4APPA 2QODA 4FI1A 2J2IB 2I1MA 2KULA 2IWIA 4EH7A 3MGYA 1OL1A 5F94A 5EYMA 3VBQA 2C0OA 3UOHA 4AE6A 4C38A 4ZY4A 5IEVA 2JEDA 4D2PA 1JPAA 2JDRA 2OXYA 5EW8A 5A6OA 4E5BA 2ITXA 2B52A 4GG5A 1VYZA 3L9MA 4FZDB 4CMTA 3NRMA 3EQPA 5EDRA 3VF9A 5CAUA 5IH5A 1PYXA 2Y9QA 1T46A 2VWIA 3GU7A 2R4BA 3OBJA 3QTSA 2J6MA 2X4ZA 2UW4A 4QNYA 4QYHA 4TYJA 4X0MA 5AR7A 3SOAA 4DC2A 3CKWA 2CCIA 2OO8X 3R7GA 4I22A 4M14A 5AUXA 2XJ2A 2VRXA 4DCEA 5HTIA 5JKGA 3ZC5A 3OS3A 3FBVA 2BTSA 3QQJA 5TE0A 4ZS4A 2WU6A 3AC5A 4FKLA 3IK3A 3O8TA 3CTJA 2C6DA 3DOGA 4M8TA 2XCHA 5M4IA 4I24A 2H9VA 5CXHA 2XNBA 5D41A 3NGAA 2GS2A 4D28A 2QR8A 5KE0A 4XV3A 4DLJA 2XZSA 2VO3A 4Z16A 3QCXA 3KVWA 2WXVA 4JQEA 3FLYA 4E3CA 2QO7A 4B4LA 3DLZA 3MH2A 1YXTA 4ZTRA 2PHKA 2QG5A 1F0QA 3OWLA 4G5PA 3JR1A 3CLYA 4OAVB 4WT6A 5CEMA 3FWQA 4MNFA 1TQPA 2G15A 4QP1A 4E6CA 4FTRA 4WBBB 1WBTA 2UZWE 2EB2A 4B8LA 1FINA 2BAKA 4PL5A 1P5EA 3GI3A 3OY3A 2R3GA 4EKKA 5AP3A 4ALUA 2X2MA 3UZTA 3GB2A 3OEFX 4I41A 2YLEA 3U55A 4IAFA 5BVOA 5CANA 5FWKK 5GJGA 4AUAA 4DFZE 3TM0A 4RZWA 3F2AA 4O2PA 3TNWA 4RLLA 4RJ6A 5JGBA 1H08A 1V0OA 2VNYA 1R1WA 4X21A 1DAYA 2X0GA 4F6WA 4YO6A 4O38A 5AAGA 2DYLA 4FMQA 3KULB 3UNJA 5DEWA 3TNPC 4ORKA 4DH5A 4GK4A 4ITHA 4KINA 1XBBA 3LMIA 1YW2A 3A99A 4BZOA 4D9UA 3VS2A 2ESMA 4K1BA 4YTHA 3UYSA 2VWYA 5I9YA 5AIRA 3F3TA 4MWIA 3UO4A 4EBWA 2IO6A 4O7ZA 2XRWA 3WBLA 4IFCA 2PVMA 2ITUA 2ONLC 4L3PA 2W1ZA 2WTCA 3IG7A 4FC0A 3UJGA 3AC8A 4X2KA 3A61A 3W10A 3GCVA 3V5WA 4C61A 3HKOA 5C9CA 3PSDA 3IS5A 4K8AA 1Q24A 5IA5A 4F70A 4YGAA 3LCSA 5E90A 4HYIA 4M84A 1PXLA 5I3RA 4IAKA 4JG8A 3TUBA 2W1HA 2G1TA 3FI4A 3AMAA 4FEXA 1Y6BA 4IXPA 4EZ7A 1MRVA 4EOOA 1BI8A 4XMOA 2HW6A 3RPVA 2QONA 3JS2A 1M2PA 5E8YA 2YIRA 3GU4A 1Y8YA 4ANBA 4D4YA 5CS6A 4EONA 2C1BA 2WEVA 4CMUA 3MYGA 5IQGA 2OU7A 3W2CA 3EFKA 3EZVA 2YJSA 3TT0A 5HG7A 3CQUA 3BE2A 2C5OA 3VN9A 3Q52A 2UZNA 3OF0A 5AIKA 4BGHA 2UW9A 3LFCA 1F3MC 4BWXA 2GU8A 5AP7A 3OFMA 3LFQA 4F6SA 3W2PA 4LM5A 2V0DA 4Y95A 4YTFA 5LQFA 5HNIX 2NRUA 2YCQA 4TRLA 1PW2A 2YCSA 2CGVA 4U79A 2B9FA 2FB8A 4NKAA 1AD5A 2W7XA 4BCMA 5IH6A 3ORXA 5JZNA 4NT4A 1XWSA 2X7OA 3F6XA 3KXHA 3R71A 1GIIA 5LWNA 2PVYA 3ENMA 4IIRA 2WZJA 3A4OX 1OB3A 3FMLA 4RVMA 4U44A 4F1MA 5LVMA 4FNWA 3ZDIA 3I6UA 3PXFA 4GUBA 5TO8A 2E2BA 2VTTA 3RMFA 2I0EA 2YDKA 3Q53A 3PVBA 2YM8A 3FPQA 5BPYA 2UW6A 3D4QA 4TL0A 3CXWA 1ZMWA 5JFSA 5J9YA 1K2PA 5JZJA 3QX2A 3S00A 3KB7A 2W1EA 2WMUA 5CSWA 3TG1A 2VO7A 3ORKA 2WTVA 3HMPA 4DGGA 3KK9A 4FYNA 4H3QA 4D2SA 5T6KA 5DHJA 3PPKA 4LV8A 1UVRA 1ZYLA 5H8GA 3G33A 4QQJA 3FKNA 5GJDA 1H24A 4DEBA 4OUCA 1P4OA 3VJNA 4DBNA 4CRLA 1H1QA 5DN3A 5KKRB 1RQQA 5DGZA 1MQ4A 5CVFA 2JIVA 3BWJA 1R0PA 2P0CA 3GBZA 3I6WA 5AP0A 3SRVA 3NLBA 2XBJA 5BMMA 4AZFA 3D7ZA 4WSQA 4C4GA 3QC4A 4DBXA 2YM3A 3AC3A 4O91A 4UB7A 3KRJA 4FTNA 2BHHA 2B54A 1G5SA 3JPVA 1GZOA 4O0RA 4HVGA 3IQ7A 4EHGA 2VTMA 5AFVA 4P5QA 2R64A 2HXQA 4CV8A 4BBFA 4AU8A 2PZIA 4I6FA 3KRLA 5HIEA 3FZ1A 4RBLA 3PDTA 3NYOA 2XEYA 2R3MA 1H07A 2XBAA 2OFVA 5CXZA 2GQGA 2RFNA 4NJDA 4QTBA 2UUEA 4IM0A 3DLSA 4TYEA 4DFXE 2BIKB 3Q04A 5M55A 4NTTA 3QBNA 4JJRA 3UODA 3EMGA 3FMKA 4UY9A 3PFQA 3FMEA 1KUTA 5IF1A 4DEIA 2UZBA 4USDA 1YWNA 2JKOA 4P2KA 1JSUA 3ZBXA 2W9FB 3EZRA 5LJJA 2X6DA 2GQRA 4LRJA 4UMQA 4B8MA 5FEDA 3REPA 2XK8A 2R0IA 4U3YA 3QKMA 3W1FA 3KF4A 4Q5EA 5E8WA 2BKKA 3EHAA 3EQCA 4CT1A 5CYIA 4PUZA 3DQXA 4FG7A 3F88A 4DGOA 4CVAA 3ZM9A 5FM3A 3S4QA 2BVAA 2EXCX 1FQ1B 2BZHB 2C6OA 3ZRLA 4II5A 4R5YA 1E9HA 5C4LA 4GUEA 5KBRA 1QPEA 3K2LA 1YI6A 1ZY4A 1TKIA 3R2YA 3MN3A 4Y72A 3BHTA 5CZIA 5J95A 3EWHA 4EH2A 2XK6A 3MJ1A 3MPTA 5HO6A 2W5BA 4EOMA 4O86A 5IQDA 5AEPA 3RCJA 3TNIA 5HTBA 1JKTA 4OT6A 4WSYA 3KREA 5C8NA 4IB1A 4V0GA 5DRBA 5ANJA 4E4NA 4RMZA 4FTJA 2C5NA 3NW5A 3ROCA 3V5PA 2ITZA 2R3JA 4FKWA 1QPCA 3W18A 2EXMA 2JFMA 4O7TA 1XBAA 3FXZA 1H25A 3CR0A 3VS4A 5LARA 4N0SA 3VS1A 2JITA 3RPSA 4B9DA 5DRDA 5FP6A 1M2QA 4GIHA 2I6LA 4W4YA 2WTDA 1Y91A 3U6HA 2CGWA 3UIXA 4R7IA 2IVTA 4KIOA 4JBQA 4C57A 3TN8A 3PA4A 3TWJA 3GEQA 4KWPA 3QWJA 3PA5A 3MV5A 5H8EA 1W8CA 5DR9A 5ANGA 3C1XA 2P3GX 4ZEGA 1OIRA 3PIYA 3QD2B 4L3JA 2GHLA 1UU9A 2BRHA 3A2CA 3D2IA 3NUYA 4I92A 4L00A 4ACHA 5EI8A 1Q61A 2NO3A 5JGAA 4NK9A 3FUPA 5AR3A 3QUEA 3TV6A 3PPJA 4J52A 5IQFA 2RFSA 4DEGA 2PVKA 4FTOA 4RIWA 4OT5A 4A07A 4QMSA 5D7VA 3VHKA 4EWQA 4A7CA 3PXRA 3F66A 1FPUA 1LEZA 3HP2A 3PXQA 3EQRA 3ZYAA 4XG8A 2WMAA 3O7LD 3QTIA 3VUMA 2O0UA 4LMNA 2I0VA 3LAUA 5TF9A 5AV4A 4FTLA 5EHLA 4KABA 4DEEA 5IH4A 3P7CA 1Q3WA 2Z7LA 5ACBC 4DTBA 4YZ9A 4JRVA 5ETAA 4IC8A 4Z55A 2BCJA 5BYYA 5J7BA 2FGIA 2H34A 2J5EA 4KB8A 3R01A 4MAOA 3GCSA 2QLUA 3ACJA 3HYHA 3U54A 5EM6A 2BILB 4BRXA 4QMNA 4YC6A 2CLQA 4NM3A 1U46A 5AP1A 5ETIA 5HCZA 1KOBA 4H58A 4ANMA 4FTCA 3U9NA 4CT2A 1UU7A 1R39A 5L2IA 1SM2A 3PRFA 1NY3A 4EK3A 2OJJA 1WZYA 5KZIA 3EJ1A 3M1SA 3VW6A 5IA3A 4RRVA 4RSSA 5C26A 4DTKA 2G01A 3FMMA 4JI9A 2Y4IC 4Y46A 3O8PA 1VEBA 3QRKA 2OIQA 2J50A 2HY0A 1YKRA 5TOZA 1M7QA 2O64A 4E6QA 4C4IA 1Y8GA 4TWOA 4MQ1A 2PL0A 4KD1A 3OXTA 5FG8A 5AA8A 4QYYA 3RI1A 4CKRA 3ORLA 2X8EA 5B2LA 5HZNA 1I44A 4CFNA 1DAWA 3QLFA 2YZAA 4LGGA 4NUSA 3UYTA 4YZBA 4A9SA 3AD4A 4BR3A 3GCUA 3AT4A 5F95A 3D9VA 4CKJA 3HV6A 5EFQA 5IQEA 3AT3A 4XH6A 4C36A 3E3PA 4FKUA 3LKMA 5A4LA 3OCTA 5LXMA 2ZAZA 2JDSA 4FV9A 3VBWA 2VO6A 4QP7A 4FTAA 3TACA 1V0BA 4E5WA 3MBLA 4K18A 3D5UA 3KXNA 1WBWA 3H9FA 4BCHA 4EOPA 1RJBA 5CU3A 1Q8WA 4IX5A 2NRYA 2XK4A 4L01A 4W9XA 4ZLZA 1Q8YA 3QHRA 3NMUF 2HW7A 2R9SA 3FMDA 5CT7A 4PP9A 3R04A 2ERKA 5HD7A 3A4PA 3Q96A 2W4OA 4U97A 2RGPA 4FTQA 4XCUA 2I40A 2G2IA 4TYHA 4K11A 3DGKA 2VTNA 1OL6A 4KS7A 1SVGA 2G2FA 4L43A 1W83A 3MW1A 3KMMA 3PG1A 4G3GA 4E4MA 4IACA 5A6NA 4ZZOA 4R7BA 4JLCA 1YHSA 3MS9A 2V62A 3ETAA 4KSPA 4XV9A 2V55A 4X2GA 2HY81 3RWQA 3QQKA 4D0WA 2F7ZE 4FEWA 3RK7A 5A14A 4QMVA 5HD4A 2VTLA 5L6OA 4E6DA 2W05A 2ZDTA 2BZIB 5FBOA 2PE2A 5BX0A 4DT9A 2BALA 4PX6A 1APME 3ZH8A 3UO6A 3ULZA 3ZLYA 4NL0A 2OFUA 5HG8A 5GIOE 5A54A 4QYEA 1SMHA 4ZMEA 2C0TA 1VR2A 5M44A 4MWHA 4ANOA 2V7OA 4WG3A 3NWWA 5J1WA 3D83A 5C4KA 2WU7A 2WTKB 3DDPA 4PPBA 2A2AA 2BRBA 2HZNA 3IW4A 5JK3A 3WF5A 4ACCA 3EN5A 3FY0A 4CCBA 3Q9YA 5CASA 2WPAA 2ZVAA 3W8QA 1H4LA 4AAAA 4ERKA 5HQ0A 4D4RA 4TXCA 4Y73A 3BHHA 5HX8A 2QHMA 2XIZA 1YXVA 3OCBA 4HOKA 4JIAA 4UMRA 4ZMFA 1UKHA 3KXMA 4Y83A 5LVPA 5EHOA 1B38A 4ZTHA 4O22A 1PXMA 2JFLA 4QMXA 4DN5A 3BEGA 3SRVB 3VUIA 4DAWA 1ZMUA 4P7EA 3DXPA 3FV8A 3VUHA 3FYJX 3LLTA 5LMKC 3R7VA 3PXKA 5AUWA 2DWBA 3JVRA 5I9XA 3COHA 5FM2A 1FGIA 1CKJA 4JT3A 4AFEA 4FNXA 5JFWA 2NPQA 4O21A 2YACA 4GH2A 1M17A 2DQ7X 4MQ2A 4N4SA 4V01A 4O0VA 4GVJA 4MHAA 4IFGA 2Q0NA 3T9IA 4FT5A 4FUYA 5HNGA 4HYHA 3UQGA 3WF9A 5HBJA 2FH9A 2VTHA 4GV1A 5FBNC 3PVGA 1QMZA 3S2PA 3ODZX 4FZFB 4YLKA 4B7TA 3DJ5A 2X2KA 4O7VA 4AA5A 1AGWA 2YM7A 5AR5A 4D2WA 4BHNA 2REIA 2EB3A 4MCVA 3RK9A 5HCYA 3JY0A 3QQLA 4LRMA 2O63A 2PTKA 3W2OA 4MH7A 4F63A 4MBJA 4NSTA 3R1QA 2J0MB 4CZTA 4DEHA 3G6HA 3LCOA 2I0HA 4HPTE 4IB0A 4MXCA 3DCVA 3VS6A 4DG0E 3ALNA 5JEBA 3UOKA 3W32A 1GZKA 2XKFA 4PTEA 4RFZA 2VN9A 4JDIA 3RZBA 2W4KA 2PVNA 2IZSA 2VWUA 4FKPA 3DZOA 1SNUA 1WCCA 4EZ3A 5G6VA 1OECA 4ANNA 2JAMA 2VD5A 3LJ1A 4USEA 5HBEA 4WNMA 3E8DA 2WD1A 4LMUA 4V0GB 2ETMA 3P5KA 4IB3A 4KIQA 4NW5A 3VC4A 4BDBA 3G5DA 1FOTA 4NH1A 4EC8A 3NNWA 4R6VA 3KRRA 3ZCLA 4HVHA 3OHTA 3Q2JA 2PZRA 3F3UA 2XH5A 4UBAA 5EI2A 4YLJA 4FKSA 4IX3A 5LCKA 3RWPA 3SXSA 3HGKA 4ARKA 4I0TA 4IADA 4L42A 3E3BX 4DGLC 3QTUA 3ANQA 2O5KA 4OBQA 3L8VA 2YM6A 2FO0A 2GS7A 2JDVA 4FKTA 3WYYA 5AV2A 3NZ0A 4WD5A 5EQYA 4BBEA 5A4CA 4DT8A 1PMUA 3BGPA 2GHGA 3MA3A 4KBKA 5L4QA 5EKOA 4ANSA 3OCGA 4BCPA 3QGWA 1O6LA 4NM7A 4D5KA 5GZAA 3BQCA 2VWZA 3HEGA 2WTWA 3TTIA 4YP8A 4FV0A 4J1RA 4YMJA 1OM1A 3HA6A 5JT2A 2PVJA 3OZ6A 4WHZA 2C6MA 1YQJA 5DMZA 5FQDC 4PF4A 2PU8A 5J9LA 4FV1A 3ZRKA 5M4CA 1GAGA 5E1SA 5DYJA 5D7AA 4RIWB 3C9WA 1PXKA 1GZ8A 4OBPA 4QNAA 5D10A 5CEIA 5I4NA 4W8DA 2R3RA 4QP4A 5EM7A 4C3PA 3CKXA 3JVSA 3IDBA 5ETFA 2A0CX 5LVLA 4BHZA 5B2MA 3EN6A 1G8SA 3ZMMA 3R9OA 3DBCA 3KXGA 1XQZA 4U8ZA 3AC4A 4YLLA 3HRCA 4YJUA 1FVRA 2DUVA 3ZLWA 3NX8A 1GY3A 3BGZA 4NJ3A 3W8LA 1JNKA 2X1NA 2J0LA 3G90X 4I5CA 4F9CA 5IUHA 4RJ7A 5C8KA 2CNUA 3AC1A 1BI7A 3EQDA 3BV3A 4Y5HA 3QCSA 1UU3A 4EEVA 4HW7A 1PKGA 4DCAA 3M42A 4PPAA 4FTTA 5IEXA 3RNYA 5DG5A 4KRDA 4YTIA 4C62A 4MD7E 3RP9A 4I21A 3LMGA 3OOGA 4NU1A 1UNGA 5J5TA 3EFWA 1CM8A 2ZMCA 4C3RA 5KHWA 2WKMA 3OUKA 2XKDA 4KA3A 4JAIA 3RNIA 3V6RA 4CFUA 4I6QA 5EQEA 2ITTA 2R3HA 4FIFA 5C1QB 3QRJA 2OJIA 3DJ7A 1PMVA 4JDJA 4D1ZA 1FBNA 1YI4A 5AADA 2KTYA 4RGJA 4V04A 3IGOA 4PRJA 4ZTNA 3VVHA 3NUXA 5HTCA 5LVNA 4J71A 5IISA 3LQ3A 2OBJA 4FTUA 3W2SA 4LRKA 3FLQA 4HYUA 2OICA 3GOPA 4J7BA 4D4VA 3ZFYA 3B8RA 1ND4A 3TEIA 3BLQA 2GNGA 5JMSA 3O71A 5ICPA 2ITYA 1BYGA 3ERKA 3QTZA 4XG6A 5BVKA 1OUKA 2RF9A 4LYNA 3SKCA 4CYJA 1TVOA 4X2NA 4NWMA 1BX6A 2YIWA 5AV1A 2XJ0A 4HGSA 4LL0A 4YZCA 1OIUA 4F99A 1K9AA 2XNOA 4M0YA 4E7WA 2CGXA 3UQCA 3TV4A 3R8MA 2B4SB 3OC1A 4AG8A 3UP2A 2C6IA 2HK5A 3HMIA 1XH9A 1YDTE 5A4TA 4JIKA 3MWUA 2HXLA 5H8BA 2B9JA 1S9JA 3L8XA 4EJ7A 2C6TA 3V51A 5BNJA 1XHAA 1KE6A 3O96A 4TYHB 2BDJA 4MD9E 4JR7A 3EQHA 4P4CA 5BUJA 3IO7A 4RC2A 1VJYA 1Z9XA 4GCJA 4FSWA 1PY5A 4WUAA 3GFWA 3RK5A 2AYPA 3BYVA 5HNBA 3RJCA 3DDQA 3WF8A 5IUIA 5F4NA 4YSJA 4ASDA 4C4FA 4UMUA 5CEPA 1GZNA 3P9JA 3DTWA 3EKNA 3IKAA 3QALE 4G6NA 4KKEA 2C3LA 3QF9A 4G34A 3PY3A 4M69A 1B39A 2VNWA 3ELJA 4FR4A 4QMTA 3GCQA 3IW8A 3MY1A 5HU3A 4X7QA 2QQ7A 2WQMA 2A27A 3FSKA 4I6BA 2UVZA 2I0YA 1H01A 3ATSA 1GNGA 3BCEA 5HHWA 1OBDA 4FEVA 1U5QA 3ZOSA 4EI4A 2FSMX 4ACGA 5J79A 2XP2A 3HMNA 4NW6A 3QTXA 2XB7A 3FKLA 4GS6A 5AP6A 3NUAA 4TWPA 5HVKA 3CTQA 4F09A 4QO9A 3DB8A 2OW3A 5AUTA 4YSMA 2CKPA 3FMJA 4O7YA 4NTSA 3UZRA 3EFLA 3OTVA 3KN5A 4I5MA 3Q9XA 3TV7A 2C47A 1W98A 4FICA 3R8ZA 1OGUA 3HLLA 5DNRA 3E87A 4D4SA 4XRJA 3DBFA 4J8NA 5AUZA 4QYGA 3NNXA 2YWPA 3SHEA 1PJKA 3ROYA 4NCTC 3IOKA 5C27A 4RWJA 5KMIA 3PJCA 2CSNA 3IONA 1U4DA 2C30A 4YNEA 4BTJA 4OW8A 2PUPA 3FXWA 3PE1A 2R3OA 3O7LB 4FKGA 2ZB1A 3Q6UA 4FT0A 3HX4A 3ODYX 1PMNA 4FKOA 4ITIA 3PY1A 4EOLA 4G2FA 5AV3A 1ZRZA 4FSMA 4C02A 2Q83A 2UZVA 5K0KA 4JG6A 4WA9A 5ETCA 4JQ8A 3LFAA 2FSOX 2R3NA 4LUEA 3NAXA 5CEOA 4E1ZA 4ASEA 5KMKA 2ZV8A 4GW8A 1MP8A 1OPLA 4PWNA 5LMKA 2VTIA 4U3ZA 4YBJA 1J7UA 3RPYA 2OSCA 1MQBA 3UMXA 2OXXA 4OR5A 3E62A 3NYNA 3ULIA 4PMTA 2QOQA 2WTJA 3R28A 3U8WA 3V5LA 3HNGA 5IA4A 2F2UA 3PJ3A 1QPJA 3E64A 3V3VA 4K77A 3FL4A 4FIGA 2ITQA 3TNQB 4L68A 4YHFA 3UDBA 5M4FA 4L7FA 2HOGA 2UZDA 4HVDA 4APCA 4EHVA 5IKWA 4CTCA 5JGDA 3RPOA 4BWKA 3UGCA 3OD6X 3PIXA 2OLCA 2YEXA 4WNPA 2O2UA 3QUDA 1LUFA 5AR8A 1SVHA 5CEQA 4TYGA 4XP0A 3MDYA 2R5TA 4NIFA 3ZUUA 3DAEA 4GEOA 2BFYA 3DNDA 4KIPA 3H10A 4OTDA 5CAQA 4ACMA 3ATTA 2O3PA 2OKRA 5HOAA 5FTGA 3SV0A 4O1OA 2JAVA 4YNOA 3TKUA 5IMXA 3O51A 4TYIA 5IDNA 3VBTA 5IU2A 1BUHA 4M0ZA 4FKRA 3AMBA 4ZSAA 5IG1A 2Y4PA 4MKCA 2Z7QA 3SX9A 3OXZA 4YHJA 4DH8A 4WNOA 2J9MA 2JD5A 3K5VA 3MTFA 3Q4TA 4JR3A 4L7SA 4MBIA 3BBWA 4WKQA 4U80A 3MESA 1L3RE 1UU8A 4XP3A 1YWVA 4TZRA 3CSVA 2QOLA 2XKEA 3FI3A 4QP8A 2H96A 4ACDA 3NEWA 5ANEA 4ANQA 3SGCA 2WIPA 5IQCA 4HJOA 4DTAA 3F5XA 2VX3A 4YC8A 4F65A 4WBOA 1IEPA 4AT4A 2XYUA 3QAME 2R2PA 2W06A 2WELA 1Q8ZA 3CE3A 2UZEA 4RT7A 5CU2A 4XV1A 4ZJVA 4PTCA 1DI9A 5B0XA 2XNMA 3KEXA 1ZARA 5AR4A 5CNNA 3EQFA 5CU6A 4BYIA 3BU5A 4HZRA 1WBSA 3S95A 3TI1A 2XMYA 3QKLA 4XBRA 2GMXA 3DKFA 4BWPA 5EW3A 5EOLA 4X3FA 3PYYA 1H26A 1NA7A 5L2QA 2ZB0A 4FVPA 2W0JA 4BI0A 4O2ZA 1LPUA 3MVMA 5HO7A 2R3LA 3O17A 1YXSA 5E8SA 2PUIA 4EK6A 4DG3E 1M14A 4O6LA 5E7RA 4BCFA 4FV6A 4R5SA 1BKXA 1NT2A 5CLPA 4ZK5A 5J9ZA 5LWMA 2HZ4A 1ZZ2A 3WYXA 2C5XA 2OF2A 4RFMA 2NP8A 5ANDA 3T9TA 1Q8UA 3LFSA 1XJDA 5K9IA 4U0IA 4R3CA 2X39A 4QQ5A 4RIYA 5HE1A 2CKQA 2GFCA 5M56A 2HZ0A 1J3HA 1IASA 5AV0A 3ZEPA 1A48A 2RL5A 4LOQA 4MBLA 2C3KA 4ZJJA 2PZYA 1H0VA 2GFSA 2UW3A 1XO2B 3FKOA 3W16A 4R77A 4ZS0A 4IDVA 5CALA 4GK3A 3CPBA 3PXZA 4BCQA 4HPUE 4BCNA 1ZWSA 2WMBA 5FTQA 4BCKA 1GIJA 2R3QA 2WMTA 3LXLA 4BVUA 1UWHA 2GCDA 2XF0A 4O81A 4I0RA 4KIKB 5KNJA 3Q2MA 5T3QA 3LQ5A 3H3CA 5EYKA 3MTLA 3IDPA 4UXLA 4EOSA 3KGAA 2JDOA 5L2WA 2QURA 4PL4A 4QMPA 4RFYA 4ZP5A 4ZTSA 2VWWA 4AN3A 4RA5A 4R7HA 4IHPA 3CEKA 2IW9A 4YU2A 1KOAA 3RAHA 4GG7A 4ALWA 4DF3A 4A06A 4XOZA 2Y6MA 3PA3A 4UWBA 3ZONA 3UQFA 4JQ7A 3WZEA 3P78A 3HAVA 2WMSA 3A7FA 4AZVA 1KE8A 4IE9A 5AA9A 3CTHA 2FUMA 4FSNA 1KV1A 1OKVA 4YC3A 4XG4A 3C4WA 3KCKA 4CCUA 1O9UA 3C13A 4RQVA 1SZMA 3BWFA 3COKA 1OL7A 4FKVA 4Q9ZA 3UNKA 4G3FA 3TZ8A 5JH6A 3E7VA 5HORA 4XBUA 4M3QA 2V22A 3QD3A 5FTOA 3HP5A 4GJ3A 4TW9A 3R9HA 4M97A 4BTKA 4BGQA 2P4IA 1XBCA 3WZKA 4BN1A 2XNGA 4RVTA 1YOMA 3E8NA 5C01A 1NVRA 4XOYA 3A7GA 4EORA 2F4JA 3CJGA 4OTWA 4BDGA 2RIOA 1YOJA 4IJ9A 4GFOA 4RX9A 4XLVA 1QCFA 3QA8A 5DBXA 3RGFA 4NZWB 4F1OA 2PE1A 3NDMA 2CKOA 4L53A 3Q4UA 4JBOA 4YJRA 4AW2A 4C58A 3FXXA 2GNLA 2JKKA 4U5JA 5DA3A 3MSSA 4UZHA 5CY3A 2YFXA 1OZ1A 1WMKA 3T8OA 1ZZLA 3FAAA 3RPRA 3L1SA 4R3RA 3RAWA 4CNHA 4BTMA 5DEYA 4EUUA 3GFEA 3QTQA 1STCE 5KKRC 4EQMA 3R21A 4MXOA 3V5QA 4ZTMA 2Z60A 2ITVA 4GT3A 2HWPA 3VBVA 4FA2A 4YO4A 2QNJA 5LOHA 3RM6A 4M69B 1U54A 1NXKA 5M53A 4A4LA 4AGWA 4C34A 3OCSA 2W1IA 4FK3A 2A4LA 4PDSA 4B99A 4QTAA 4TNDA 4BB4A 1X8BA 4ZZNA 3F2NA 4DINA 2CJMA 4TWCA 3E92A 3ITZA 1JKKA 2QKWB 4QPMA 3FE3A 3D7TA 4BDCA 5DOSA 2CN5A 5T68A 2RFDA 5CSPA 2HIWA 3II5A 4AN2A 4A4XA 1J7LA 4OTPA 3RVGA 3ZLSA 4PY1A 2R7BA 3PIZA 2LAVA 2WO6A 1OKYA 5DFPA 3HUCA 2XKCA 1A9UA 3M11A 3POOA 4X3JA 1CTPE 5CQWA 4IMYA 5FGKA 3TUCA 5E8XA 3DS6A 5BMSA 4DA5A 1PXNA 4FNYA 1REJA 5CVHA 4IBMA 3UTOA 5JRSA 4PNIA 4EK4A 4EYMA 3I60A 1YXUA 5E92A 3ZZWA 5BVFA 4XEYA 3DAKA 3DBQA 5AR2A 3GU6A 4BCJA 4C4HA 4CGAA 1OIQA 4XX9A 3GVUA 4D0XA 4YJTA 3P4KA 1OIYA 4XG9A 5K0XA 3KKVA 3OWPA 5HLNA 3UBDA 3CP9A 2E9NA 2YIQA 3FC2A 4WRGA 1IA9A 5IEYA 5DPVA 3ORNA 3F69A 2HZIA 1WFCA 2UVXA 4HCVA 4U7ZA 3T3UA 5FEEA 2W9ZB 4CG8A 1ZOHA 1CDKA 2C1AA 5EYDA 5IQHA 3CGOA 2IVSA 3N4VA 3QRTA 3ZS5A 4LG4A 2YLFA 4QD6A 4R78A 4C2WA 2VWXA 3BHVA 4RJ4A 3SD0A 3P0MA 3LCKA 4BI1A 4GJ2A 4FKIA 3BEAA 2ETKA 2ONLA 3I7CA 3U87A 4GKIA 4YJQA 5FEQA 3ENHA 1A06A 4I0SA 3B2WA 2PPQA 3UG2A 4JDHA 2HYYA 4YPSA 2PYWA 4YZNA 3UP7A 4CLIA 5K4IA 3E5AA 4BIBA 1Q62A 2E9PA 1W0XC 5HICA 2WB8A 3CGFA 3MH1A 5ANIA 4EH5A 3GC8A 4ZSGA 3H4JA 3ORZA 1XR1A 4AOIA 4R8QA 4AZEA 4NIFB 4C4EA 4CRSA 4NEUA 2ZV9A 2W1CA 2QOIA 4WUNA 3DJ6A 3TDWA 4GYGA 2VX0A 2YA9A 4K2RA 2WOUA 4QQTA 4L52A 4F0FA 4IAZA 3BU6A 4P5ZA 2R7IA 3V5JA 3HRFA 2OJGA 3D0EA 4IB5A 4Q2AA 3VAPA 4CZUA 3V8SA 2F7EE 2PWLA 4JAJA 3ZC6A 4QTDA 5LMAA 3GOKA 4D5HA 4QPSA 3V8TA 3MFSA 4U6RA 3PJ2A 3G2FA 2PUUA 2YERA 5F9EA 4QRCA 4AT3A 3HDNA 3S1HA 5AM6A 4AT5A 2PMOX 5GJFA 3KVXA 3C0GA 2W5AA 3KY2A 4D2VA 4CXAA 4OTGA 4BCGA 3NS9A 3TIYA 4U42A 4FKQA 1S9IA 3U4UA 3UE4A 5I9ZA 3DXNA 3ANRA 4GYIA 1UNHA 4HVSA 1J1CA 3FZPA 2C3IB 3KCFA 4ONAA 3A60A 4FGBA 2QG7A 4G1WA 5EW9A 2PY3A 3SXFA 1UWJA 2ZOQA 3UOJA 3L8PA 2J5FA 3AG9A 3LM5A 3ORTA 5IQAA 3LOKA 3TDVA 4QP9A 1BL6A 5J1VA 5HIDA 3IW6A 3JXWA 5FXRA 4UXQA 4O7RA 3FZSA 4HCUA 2P2HA 5FDPA 3ORIA 3ZTXA 2CDZA 4X3FB 4M66A 4QTCA 1YOLA 3HL7A 4UMPA 2ITWA 1P2AA 4GKHA 4O7NA 2XJ1A 2OJFE 2XVDA 3IW7A 2QD9A 4IJPA 4A9YA 2QU5A 2QCSA 3KXZA 4BC6A 4RLKA 4G3EA 5F1ZA 1Q4LA 4CD0A 4FYOA 4MXYA 1V0PA 3A7HA 3DKGA 3R9NA 1JKLA 5KUPA 1UNLA 5DR2A 3BU3A 2YWVA 3SAYA 2RG5A 5FP5A 4KKGA 4E4LA 2XNEA 3DNEA 2YCFA 3G9NA 3R1NA 2QR7A 5AUYA 3QLGA 4RIYB 3FDNA 2LGCA 2J0IA 3FPMA 1H8FA 5KHXA 2IJMA 4LOPA 4BI2A 4YHTA 5FXSA 4I4EA 2IW6A 2CGUA 2IG7A 2GQSA 2OWBA 2PMNX 3NUNA 3HMMA 3QYZA 3MY5A 5J7HA 5M57A 3VRZA 2OF4A 3TL8A 2VTRA 3MA6A 2B55A 2VTSA 3WARA 5KMOA 4J8MA 4FSUA 3ET7A 4ASXA 1FVVA 3CBLA 1YI3A 3QCYA 4BCOA 4PMMA 3I5NA 1JOWB 3CC6A 3BQRA 2PZPA 3DK3A 4CFFA 5CI7A 3H9RA 3O8UA 3V5TA 3QZFA 4RX5A 4AGUA 4IAIA 3E93A 2BR1A 4FSTA 2W99B 3DKOA 3SG9A 2C3JA 4RG0A 5A3XA 2ITOA 3RZFA 4I93A 4JOAA 4JRNA 2GSFA 2RFEA 3R7UA 2CLXA 3DFAA 1U5RA 4EUTA 4W4VA 4TNBA 2EXEA 3IDCA 3BRBA 4K6ZA 2EVAA 4ZY6A 1KV2A 3HVCA 4IVDA 3GGFA 3HA8A 4W9WA 2UVYA 3Q3BA 3HRBA 2CN8A 5DT0A 1WBVA 2OIDA 4J97A 3U6JA 3P7BA 4B0GA 5ANKA 4TTHB 1H1WA 3P23A 3FY2A 3G15A 2QOHA 3VULA 1ZMVA 3FQEA 4DHFA 2QI8A 2C6EA 5FUTA 2VGOA 3Q4ZA 4BDEA 1OKZA 5HCXA 3RM7A 2Y0AA 2PMLX 4FZAB 3EKKA 2PUNA 3FYKX 4UZDA 4EHEA 1OBGA 1NW1A 4RC3A 3DTCA
chains in the Genus database with same CATH superfamily
1IR3A 2C6KA 4I3ZA 4IZ7A 3VJOA 3MFUA 1ZYJA 2Z2WA 3QTWA 4W4WA 1CKPA 4MNEA 3AOXA 4IANA 4DITA 5FD2A 2ETRA 1DI8A 1GIHA 4KS8A 4L9IA 2J90A 2WAJA 1O6KA 2WEIA 4M68A 4WO5A 1FMKA 1XKKA 5JRQA 2QLQA 3G0EA 3NIZA 4PMPA 4OAUC 1U59A 3BL7A 2JKQA 1UV5A 5EKNA 5D1JA 3L9NA 2J0JA 4FIEA 4S30A 3MI9A 3UOLA 3BHYA 3KC3A 1R3CA 4JBPA 3CCNA 3LJ0A 4UWCA 3V04A 3UZPA 3VW8A 4BDHA 3OWJA 4EL9A 2YDJA 4D9TA 1YWRA 3TZMA 1T45A 1ZY5A 2QKRA 2YAAA 4WG4A 2PZ5A 1H1PA 4KBCA 3PWDA 4F7SA 3HV4A 4EKLA 3NYVA 1H00A 4FEQA 3Q4CA 1PKDA 3DA6A 2BRNA 3N9XA 1ZYDA 2EWAA 4RC4A 5GIPE 1I09A 3UNZA 2X0QA 1PXOA 4LFIA 3PZEA 4BL1A 3NFGB 3R8UA 3GP0A 2B53A 4DEAA 4Z7HA 3UIMA 4XG3A 2W1FA 3NCGA 4U40A 1U54B 4FIIA 5D11A 4AS0A 4HVIA 5IZFA 4DH1A 4FSZA 3HV5A 3EN4A 1VZOA 1H0WA 3CD3A 3PSCA 4FEUA 3A7IA 1IA8A 3COMA 3E8EA 4DFNA 1ZYCA 4S34A 3FLSA 5C8MA 3VUKA 3UPZA 1PXJA 3UG1A 4DGNA 3DK6A 3RKBA 4FV3A 2YDIA 3D7TB 3IOPA 5CAPA 5E8VA 5K5XA 3VBYA 4H36A 3HUBA 1W82A 1HOWA 5EG3A 2WGJA 4JS8A 2BROA 2PSQA 4F1TA 4ZZMA 5HU9A 2XIYA 3SA0A 3PLSA 3A62A 1JBPE 1F5QA 5HI2A 2ITPA 5LMBA 4DFBA 4C8BA 3ZO1A 4IM2A 4FOCA 5CT0A 3R9DA 2XCKA 4XUFA 5HBHA 1BLXA 2JBPA 3MFTA 3EH9A 2VWBA 3KL8A 3OW3A 2BTRA 3E63A 3QKKA 4H1MA 3OT8A 4I23A 4AP7A 5BYLA 3N51A 4EH4A 2WQEA 4O7SA 4BDKA 2HENA 1JLUE 3G51A 4D1XA 4N70A 4IX4A 1TQIA 3ORPA 3D94A 5IA2A 4EJNA 1XH5A 3ZDUA 2AC5A 2PVRA 5DLSA 5HLWA 4IVCA 5J5SA 4GFMA 4A9RA 5KMLA 5LVOA 4CG9A 3B2TA 3BLHA 4O4EA 2O8YA 3ZSGA 2GDOA 3ZLXA 2VTQA 5BQ0A 3TKIA 4AXAA 3LLAA 2IEWA 4GVAA 3VQHA 2XA4A 4HCTA 3W0RA 5CI6A 4F9BA 5HE3A 4FV5A 4C3FA 3G9LX 3UVPA 4JBVA 3A8XA 4FIHA 1PHKA 3CIKA 4H39A 4MVFA 3RALA 2JC6A 2ERZE 4QTEA 5BVDA 2B0QA 2NNWB 3NSZA 1OUYA 3O2MA 2GNHA 5L8KA 5KO1A 1Z5MA 5M07A 1LEWA 3SLSA 4IAAA 3LFNA 2GTNA 5HVYA 3F7WA 2WMXA 3MVJA 4BJJA 4ZY5A 4QOXA 4XJ0A 1H1SA 3PTGA 4F0GA 2SRCA 2VTJA 5KBQA 4RX7A 3NCZA 3QXPA 2OH0E 4U45A 2V5QA 3ALOA 2XNNA 3PZHA 5E1EA 1Q97A 2ITNA 4P90A 4WOVA 4EC9A 5CF5A 4FSYA 2YISA 5A4QA 4KBAA 2GNIA 3DBEA 3WZUA 3C0IA 4O0YA 2OG8A 4RWIA 3DU8A 4XS2A 3UMWA 4DYMA 5K5NA 3PLAE 5FRIA 4O96A 3COIA 3GU5A 2WTIA 5B2KA 4ENYA 1FGKA 1SNXA 2A1AB 4MXXA 4BZDA 3VUDA 1YHVA 5CU0A 4UX9A 4DFUA 4XG7A 3PE2A 3SXRA 4BKZA 4LGDA 2X7GA 1BMKA 4F64A 4O4DA 2R3IA 3D5VA 3BELA 3UPXA 4FF8A 4ZLYA 3C51A 2P2IA 3QUPA 2W1GA 4FIJA 4AW5A 3JUHA 3SDJA 4PP7A 4RIXA 5KMJA 4IDTA 4OTRA 3MFRA 3R30A 2BHEA 3D14A 4C2VA 4RJ8A 4XLIA 3BV2A 5ACKA 2CNVA 2I7QA 2B9HA 5I9VA 1L8TA 2RG6A 3LCTA 3Q9WA 3FC1X 2F7XE 1DS5A 5CZHA 4FE2A 3ZSIA 5HLPA 3ZUTA 3TNHA 4C4JA 1E1VA 4ASZA 4QP6A 4W4XA 1XH8A 4RJ5A 4AXCA 5H3QA 2WMVA 3VBXA 3V01A 4O84A 4AW1A 4FL3A 3DQWA 3F61A 3A7JA 3GCPA 1PYEA 5L8JA 2IN6A 5B7VA 4RVKA 4IH8A 4GU9A 2VTPA 3QXOA 3GXLA 5HGIA 4ZJIA 2OH4A 1PRYA 1Z57A 3QC9A 5J8IA 3OROA 3QRIA 3ZRMA 5CSHA 5J87A 3VNTA 3C7QA 4FVRA 3OP5A 5BVWA 4LQMA 4IEBA 3PUPA 2HCKA 2GPHA 4I4FA 3NR9A 5KZ0A 1YXXA 2UW8A 3QQFA 4PDOA 5AUVA 3H0ZA 4TWNA 1R78A 2QOCA 3PVUA 2IVUA 5H9BA 3MB6A 4ZAUA 2YM4A 4BTFA 3PP0A 4DHIB 3AMYA 2Q0BA 3AD6A 3OVVA 3QRUA 4OTHA 3ZXZA 2W4JA 3LXKA 4J99A 4UMTA 5E8ZA 1PXPA 1IAJA 4LV5A 5CU4A 2UZTA 2XK9A 3R7EA 3LQ8A 3T3VA 3TXOA 4EQUA 1ZLTA 5DT4A 2AC3A 2VV9A 2WMRA 3KMWA 3KIOC 4FK6A 3FQSA 5I9WA 2OK1A 3C4EA 4AA4A 4QQCA 4AA0A 4D55A 3R8PA 5HEZA 3P1AA 2WHBA 4I20A 4A4OA 5K3YA 1GJOA 2XUUA 1EH4A 4WIHA 3WE8A 3TYKA 2QU6A 4DEDA 4QMQA 3GNIB 2WQNA 1UKIA 1PF8A 3W33A 4FX3A 4I94A 2DS1A 4C7TA 4X6QC 5K4JA 4RVLA 2XYNA 3LFEA 4R1YA 3QZGA 1ZOGA 2QOKA 3F9NA 4O7LA 2YABA 3I4BA 3LFFA 2X9FA 3KFAA 3R02A 4O82A 4M67A 5GNKA 3KA0A 4AF3A 3B8QA 3CD8A 1XH7A 3VS3A 2YZLA 4QYFA 4E6AA 2VTOA 3CJFA 3FQHA 2BRGA 2QOFA 3KK8A 1OI9A 4D2RA 2VAGA 2YM5A 1OPKA 2C0IA 3MIAA 4EZ5A 4U43A 4OTQA 2XAMA 1GOLA 1FMOE 1OVEA 2JIUA 3QGYA 1O6YA 4GT4A 4J95A 2XRUA 5EM8A 5LCJA 1YRPA 3NNVA 3KRXA 4CYIA 4MK0A 3SVVA 3ID6C 2OI4X 3QTRA 4LV7A 3QZHA 1YVJA 3DY7A 3NUPA 3F3ZA 5FDXA 1W84A 3BPRA 3D15A 3FL5A 5AJQA 5HVJA 4C37A 5CAVA 4EYJA 3BX5A 1HCLA 2UZOA 3LXPA 3LXNA 1SYKA 3SC1A 5AUUA 4FNZA 5BVNA 2OZAA 2FVDA 2F57A 3EQGA 3ZXTA 4BF2A 1G8KA 3GUBA 2PULA 2FYSA 2PK9A 4FT7A 3MIYA 1P14A 5EYCA 5L6WL 4CFMA 3OTUA 4JDKA 5DVRA 2CHLA 4MNEB 2Z8CA 2IVVA 3L9PA 3LM0A 1LR4A 2YHVA 3PP1A 1OL2A 4AGDA 3CY2A 4FSRA 1G3NA 1OMWA 4JMQA 4H3BA 5I3OA 5H2UA 2HAKA 1V1KA 3F82A 4BDIA 3M2WA 4G17A 1CKIA 2CKEA 3PJ1A 3G6GA 2BFXA 3I0QA 4I5HA 3K54A 3RBWA 2ACXA 2QOOA 4C33A 3W0MA 3THBA 3ZHPC 4PDPA 3HZTA 4YJOA 3R73A 2W17A 4XRLA 3WZDA 4OTIA 3MVHA 4RWKA 3IGGA 3AC2A 3K3IA 2FA2A 2NYAA 5IUGA 4H05A 3BLRA 5G1XA 3FEGA 1OL5A 5HIBA 3EN7A 4D58A 4UV0A 1MRUA 3IW5A 3HMOA 1JKSA 4RPVA 2BAJA 4O0UA 4MX9A 4G16A 1H28A 4FZ6A 5CSVA 5HE0A 3IECA 4Z9LA 1JWHA 3NYXA 4GU6A 5CF8A 3LZBA 3NVMB 5TKDA 2AEGA 3EYHA 3E8CA 3MH0A 3EYGA 3OG7A 4EOIA 4FGRA 3CQWA 2RSVA 3FMHA 3V8WA 5KX8A 2WQOA 3MB7A 4UN0C 3NUSA 3NFFB 5DH3A 5GZ8A 1JSTA 3NPCA 4FZ7A 2QVSE 4QMWA 1QL6A 1URCA 4ZXTA 5IDPA 4Q9SA 4BYJA 4CKIA 4IAYA 4BIEA 5HX6A 3TKHA 5A9UA 3U6IA 3FLZA 4Y8DA 4KRCA 2ZMDA 1WBPA 3VS7A 2F2CB 3AQVA 4CMOA 4AE9A 2XALA 1XH6A 5CVGA 2HWOA 3BYUA 4KUJA 5M09A 3PY0A 5E8TA 4XV2A 5E4HA 3FHIA 1LP4A 4TT7A 2R0UA 2WMWA 2YCRA 4IWPA 4HGEA 3V6SA 4PNKA 3UDSA 3W0QA 1RDQE 2XAOA 2XK7A 2J7TA 2VWVA 4O1PA 2VO0A 4BDDA 1RE8A 3KXXA 4HZSA 4F9YA 2RKUA 1E1XA 2EUFB 2QC6A 3F5PA 4MTAA 1WAKA 5EI6A 1XH4A 2Y4IB 4ITJA 3LHJA 3DXQA 3ZEWA 3H30A 4CSVA 2YAKA 4GL9A 4G6LA 4M15A 5DR6A 5HG5A 5A4EA 2OZOA 2WMQA 4NM5A 1H1RA 4X2FA 3POZA 3D5XA 3EIDA 3HDMA 4S32A 3WI6A 3QWKA 4HNFA 2OIBA 4F08A 5JFXA 1JAMA 1M7NA 5FXQA 4YBKA 4FG8A 5I5ZA 3F2RA 3KU2A 4ZSEA 1KE7A 2XM8A 4EH6A 3EQIA 4K33A 3EL8A 5L8LA 3I7BA 4Z7GA 3FZOA 1Q99A 2CMWA 2G2HA 5GZ9A 3U4WA 3NNUA 1HCKA 4UEUA 4E26A 4CTBA 2Y6OA 5L2TA 4G3CA 1YDRE 4BJJB 5IMEA 3DPKA 2F9GA 3OOMA 3VWAA 4ENXA 1FVTA 3R8LA 5E9EA 1ZAOA 1REKA 4IWDA 5JQ5A 4GK2A 4GMYA 4FUXA 4H1JA 4NFMA 5A46A 4IQ6A 4YTCA 1JVPP 3Q9ZA 4I1ZA 5CENA 2JBOA 4NYEA 4BBMA 3VF8A 2AUHA 4HGLA 3WIGA 1IG1A 4EOJA 5ITAA 4O7WA 3QYWA 5EK7A 4QMZA 4ZTQA 3LJ2A 5AX9A 2E9UA 3FLWA 4QPAA 3BZ3A 4HNIA 4K0YA 4O0WA 2BDFA 4RWLA 3FZTA 3W2RA 3QQGA 4OLIA 2X8DA 4BKJA 4BICA 3FI2A 4ZTLA 2P33A 4G6OA 5JQ8A 4YURA 2X6EA 2W5HA 4EH3A 4EK8A 3LE6A 5CNOA 4BGGA 2ZM4A 2E9OA 3QFVA 3P08A 4RIXB 4X2JA 3CQEA 5AP2A 4O0XA 3Q5IA 1P4FA 4EBVA 5EM5A 3O50A 4IW0A 4E73A 2WFYA 5BUIA 3TCPA 4HGTA 3QX4A 1G8JA 4DHZA 1ATPE 3CPCA 3GT8A 1WBNA 3BGQA 3N4TA 3P7AA 3QU0A 2BIYA 2FSTX 2IZRA 4IX6A 2YJRA 4L3LA 3R00A 4OTFA 1MUOA 4FTIA 5DE2A 2BDWA 4AOJA 3BI6A 2BZKB 2GNFA 5HKMA 4BKYA 4PTGA 3KF7A 1ZYSA 3K3JA 2UV2A 3EQBA 2PVHA 3OUNB 4IVAA 3C0HA 4KAOA 4CQGA 4DFYA 3HV3A 3OXIA 2E9VA 3DV3A 4F7LA 3TJDA 3I5ZA 3UIUA 5AAEA 4MF1A 4YJNA 5HG9A 4NFNA 4PQNA 5IQIA 3ZZEA 2QO2A 3QZIA 4E5AX 5BYZA 3S0OA 4FSQA 3TJCA 4CZYB 3A8WA 4J53A 3F3VA 4X6RA 1MRYA 1IRKA 1R0EA 1ZOEA 4LL5A 4NCTA 4QP2A 4YJSA 4QMUA 1G8AA 5HESA 4BFMA 3DKCA 4GSBA 5ANOA 2EU9A 3NUUA 3FZRA 3MPMA 3PVWA 5CSXA 5TR6A 4TKSA 5BUEA 5M4UA 4CFXA 4S31A 1VLRA 2X2LA 3DBDA 4O0SA 1ERKA 3Q60A 4DDIA 2Z7RA 4FTMA 3FHRA 4LGHA 4J98A 3NVKI 4L8MA 3MJ2A 3NAYA 2X4FA 4FV4A 5EDPA 1Q8TA 3AGLA 4EH8A 2ZM3A 3BE9A 3DK7A 2VUWA 2XEZA 4MF0A 4GFGA 5HE2A 3I0OA 2OXDA 2GNJA 2WIHA 2JKMA 2X8IA 4BCIA 4YPDA 3WIKA 3DAJA 4FOBA 5M08A 3C50A 4C0TA 2F49A 4BDFA 2WNTA 1KE9A 3DB6A 5AM7A 2XARA 4DFLA 5KMMA 2IZUA 2OGVA 5L3AA 2WQBA 3RAKA 3VO3A 4PV0A 1UA2A 4XHKB 4BDJA 3BYOA 2BMCA 5EQPA 3W2QA 3OT3A 1YDSE 4MYGA 3ZO4A 3LVPA 1OKWA 2ZM1A 3JYAA 5TT7A 4IWQA 4M12A 4AXFA 3R1YA 3LW0A 4RIOA 5DWRA 4UWYA 4E8AA 4EOKA 5CWZA 4D1SA 3GU8A 4KNBA 4YR8A 1Q5KA 3VUGA 2YN8A 4DE4A 5IA0A 2HELA 3Q5ZA 4K9YA 3PPZA 4ZSLA 4L45A 3QCQA 4DH3A 4F7JA 2C6LA 3AD5A 5KMNA 1ZXEA 3WZJA 1VYWA 5BVEA 5AX3A 3FJQE 3G0FA 5DT3A 3TUDA 2JDTA 2X7FA 3QQHA 3ZFMA 4IZAA 3TTJA 5JN2A 4MD8E 2UZUE 3HECA 3SOCA 2OZAB 3LMHA 4EHZA 4F6UA 4M13A 2BZJA 1TFFA 1OPJA 4JNWA 2OJ9A 3U9CA 3H9OA 3DZQA 4ERWA 3VHEA 3P86A 3OMVA 4FT3A 3NW6A 4D4YA 4F4PA 2IW8A 4G3DA 5CTPA 2BUJA 5D12A 5DIAA 2YIXA 2W96B 5AAFA 1Q3DA 2J0KA 2W1DA 2VTAA 3EN9A 3I1AA 5HO8A 4TPTA 1PMEA 2XIRA 4O6EA 3UC3A 4EQCA 1KSWA 1NVSA 4RJ3A 3ORMA 4RX8A 3R1SA 1WVXA 4CFVA 4CLJA 2R3KA 5KCVA 1TQMA 3C5UA 2PVLA 5E91A 1Y6AA 3R7IA 5CX9A 4G5JA 3F5UA 3AKKA 4LUDA 1M52A 4OBOA 4AFJA 4ANLA 4RQKA 4PDYA 4H3PA 4HYSA 4E93A 3OW4A 4PMSA 1M2RA 3OWKA 2XM9A 3PWYA 3Q32A 4IZ5A 4BDAA 4YUQA 1WVWA 2FSLX 5AP4A 3P79A 4YZMA 4LOOA 4ZOGA 3C5IA 2ZV2A 4FV7A 3BKBA 4G9RA 4QMMA 3WF6A 2BPMA 2XIXA 2XNPA 4FV2A 3DFCB 3ZUVA 3EB0A 3L8SA 3AXWA 3HV7A 3C4CA 2ZYBA 4AACA 3QA0A 1RW8A 4IZYA 4M7IA 3SG8A 4QT1A 4CV9A 3GQIA 1KE5A 5EH0A 5L6PA 2P55A 4LI5A 3QHWA 4ZIMA 3KULA 3H0YA 4N57A 2ZV7A 1Y57A 4J96A 2UW5A 3BL9A 4G31A 3QQUA 2GTMA 3K5UA 4AWIA 4QP3A 3QL8A 4CQEA 1JSVA 2O65A 4YZDA 3ZO2A 1K3AA 4EK5A 4ZLOA 2ZDUA 2R3PA 3LFBA 1J7IA 4E4XA 4FT9A 4JX3A 3NIEA 4C35A 3OBGA 4U9AA 4AZWA 4FBXA 2C68A 2H6DA 4XG2A 3SQQA 3GC7A 3D2KA 1Q41A 2CCHA 3EOCA 5IA1A 4IWOA 5D9HA 3EFJA 4E20A 1B6CB 2XS0A 4FV8A 5L2SA 2VX1A 4TY1A 3MPAA 4ID7A 1CMKE 5IPJA 5C03A 3U51A 3UVRA 4N6YA 4PPCA 1URWA 4GIIA 4GT5A 4ZSJA 4F7NA 5CAOA 5M06A 5GHVA 4FKJA 4O0TA 4YJPA 3VS0A 2QO9A 4V05A 2UW0A 5CF6A 2GS6A 4WRSA 3KQ7A 3PG3A 4MXAA 3VUTA 4G9CA 3RCDA 2B9IA 4AX8A 4CEGA 3TIZA 3R7OA 2YITA 5GINE 3PXYA 3O0GA 4AOTA 4RZVA 3WILA 4AQCA 3PJ8A 4R3PA 3BHUA 3EL7A 4KKHA 3OY1A 4MEDA 1W7HA 1CSNA 3I81A 4L6QA 3OEZA 4QMLA 4OGRA 4S2ZA 4AGCA 3ACKA 3R22A 4F9AA 3HAMA 4USFA 4MXZA 4I6HA 3PRIA 3RTPA 3VRYA 2PE0A 2B1PA 2WTKC 3ZFXA 3CS9A 3MY0A 3AT2A 3R63A 4FG9A 4XP2A 2X9EA 3RAIA 4DG2E 4IC7A 5AP5A 4FJVA 3C4XA 5I0BA 2VGPA 5CEKA 4NM0A 4AZSA 1J91A 4R1VA 3N4UA 4EH9A 4QMOA 3BBTB 1PXIA 2A19B 2BAQA 2R3FA 3RHXA 3F5GA 2PVFA 3PSBA 4JX7A 5IQBA 3R9RA 3Q6WA 3UC4A 2B7AA 3LPBA 5F20A 3GQLA 3WF7A 2G9XA 4X3FC 2JGZA 2PMIA 4D2TA 1ST4A 4XYFA 2Z7SA 4UALA 3ZU7A 3TZ7A 2IZTA 2Z02A 2UZLA 2H8HA 2Y7JA 3VQUA 4A9TA 4FODA 4IM3A 4DH7A 3C4ZA 3R83A 1BL7A 1YHWA 3FI8A 3R0TA 1JQHA 3QD4A 3LIJA 5M51A 4GRBA 2YIYA 3WE4A 4MUQA 3S3IA 3NW7A 3C4FA 2QHNA 3GC0A 3VS5A 4A9UA 2V7AA 2Y8OA 3KRWA 2BRMA 1DM2A 1OITA 2J51A 1H27A 5EDQA 4JXFA 3BYSA 3GC9A 4AW0A 3F3WA 5EHYA 4B6LA 2XIKA 2X81A 3WOWA 2QOBA 3FMNA 4FL2A 4WNKA 5DI1A 5FLFA 5CQUA 4Y5QA 4L46A 4FL1A 3AGMA 5E8UA 4F9WA 3I79A 2ZJWA 2C69A 4EOQA 4DGMA 4U41A 3KMUA 4Z3VA 1WVYA 5AMNA 4F0IA 2WOTA 5AWMA 1NVQA 2IPXA 3RHKA 3VIDA 2CNQA 3IPHA 4EWHA 4RA4A 1AQ1A 2BKZA 1QPDA 2GHMA 3DT1A 3JY9A 4UYNA 4AZTA 3SW7A 4IVBA 3UIBA 3W55A 3SW4A 1WBOA 2JLDA 2XK3A 2C5YA 4N6ZA 4FTKA 3L9LA 4S33A 5CF4A 4O83A 2VZ6A 3ZO3A 5EOBA 4L44A 4UYAA 4C59A 3FLNC 2VU3A 4WG5A 2UW7A 4JG7A 3O23A 3R6XA 4KIKA 3TZ9A 3UO5A 4Y85A 4U81A 4AN9A 1IAHA 4Q5HA 3F7ZA 4XNEA 3E88A 2C4GA 3MVLA 3ZSHA 3R2BA 4DLIA 3GENA 4JL9A 4FVQA 3KN6A 4JVGA 4BY9E 4BIDA 3MH3A 3E7OA 4NKSA 4W8EA 4ALVA 5JSMA 4YJVA 3ZM4A 1KWPA 3QD0A 4KSQA 3D5WA 3AKLA 3R8VA 2ZFYA 1SVEA 3UVQA 5JFVA 4CFWA 4I5PA 4BZNA 3BYMA 3BIZA 3R7YA 4QMYA 3LFDA 3CY3A 3FSFA 4PL3A 2C5VA 2CPKE 3ZBFA 1J1BA 4L67A 5I9UA 2J4ZA 2JIIA 3LCDA 4O27B 4TN6A 3RINA 4APPA 2QODA 4FI1A 2J2IB 2I1MA 2KULA 2IWIA 4EH7A 3MGYA 1OL1A 5F94A 5EYMA 3VBQA 2C0OA 3UOHA 4AE6A 4C38A 4ZY4A 5IEVA 2JEDA 4D2PA 1JPAA 2JDRA 2OXYA 5EW8A 5A6OA 4AQKA 4E5BA 2ITXA 2B52A 4GG5A 1VYZA 3L9MA 4FZDB 4CMTA 3NRMA 3EQPA 5EDRA 3VF9A 5CAUA 5IH5A 1PYXA 2Y9QA 1T46A 2VWIA 3GU7A 2R4BA 3OBJA 3QTSA 2J6MA 2X4ZA 2UW4A 4QNYA 4QYHA 4TYJA 4X0MA 5AR7A 3SOAA 4DC2A 3CKWA 2CCIA 2OO8X 3R7GA 4I22A 4M14A 5AUXA 2XJ2A 2VRXA 4DCEA 5HTIA 5JKGA 3ZC5A 3OS3A 3FBVA 2BTSA 3QQJA 3TMOA 5TE0A 4ZS4A 2WU6A 3AC5A 4FKLA 3IK3A 3O8TA 3CTJA 2C6DA 3DOGA 4M8TA 2XCHA 5M4IA 4I24A 2H9VA 5CXHA 2XNBA 5D41A 3NGAA 2GS2A 4D28A 2QR8A 5KE0A 4XV3A 4DLJA 2XZSA 2VO3A 4Z16A 3QCXA 3KVWA 2WXVA 4JQEA 3FLYA 4E3CA 2QO7A 4B4LA 3DLZA 3MH2A 1YXTA 4ZTRA 2PHKA 2QG5A 1F0QA 3OWLA 4G5PA 3JR1A 3CLYA 4OAVB 4WT6A 5CEMA 3FWQA 4MNFA 1TQPA 2G15A 4QP1A 4E6CA 1ST0A 4FTRA 4WBBB 1WBTA 2UZWE 2EB2A 4B8LA 1FINA 2BAKA 4PL5A 1P5EA 3GI3A 3OY3A 2R3GA 4EKKA 5AP3A 4ALUA 2X2MA 3UZTA 3GB2A 3OEFX 4I41A 2YLEA 3U55A 4IAFA 5BVOA 5CANA 5FWKK 5GJGA 4AUAA 4DFZE 3TM0A 4RZWA 3F2AA 4O2PA 3TNWA 4RLLA 4RJ6A 5JGBA 1H08A 1V0OA 2VNYA 1R1WA 4X21A 1DAYA 2X0GA 4F6WA 4YO6A 4O38A 5AAGA 1W2FA 2DYLA 4BYIA 4FMQA 3KULB 3UNJA 5DEWA 3TNPC 4ORKA 4DH5A 4GK4A 4ITHA 4KINA 1XBBA 3LMIA 1YW2A 3A99A 4BZOA 4D9UA 3VS2A 2ESMA 4K1BA 4YTHA 3UYSA 2VWYA 5I9YA 5AIRA 3F3TA 4MWIA 3UO4A 4EBWA 2IO6A 4O7ZA 2XRWA 3WBLA 4IFCA 2PVMA 2ITUA 2ONLC 4L3PA 2W1ZA 2WTCA 3IG7A 4FC0A 3UJGA 3AC8A 4X2KA 3A61A 3W10A 3GCVA 3V5WA 4C61A 3HKOA 5C9CA 3PSDA 3IS5A 4K8AA 1Q24A 5IA5A 4F70A 4YGAA 3LCSA 5E90A 4HYIA 4M84A 1PXLA 5I3RA 4IAKA 4JG8A 3TUBA 2W1HA 2G1TA 3FI4A 3AMAA 4FEXA 1Y6BA 4IXPA 4EZ7A 1MRVA 4EOOA 1BI8A 4XMOA 2HW6A 3RPVA 2QONA 3JS2A 1M2PA 2AQXA 2YIRA 3GU4A 1Y8YA 5E8YA 4ANBA 5CS6A 4EONA 2C1BA 2WEVA 4CMUA 3MYGA 5IQGA 2OU7A 3W2CA 3EFKA 3EZVA 2YJSA 3TT0A 5HG7A 3BE2A 3CQUA 2C5OA 3VN9A 3Q52A 2UZNA 3OF0A 5AIKA 4BGHA 2UW9A 3LFCA 1F3MC 4BWXA 2GU8A 5AP7A 3OFMA 3LFQA 4F6SA 3W2PA 4LM5A 2V0DA 4Y95A 4YTFA 5LQFA 5HNIX 2NRUA 3PFYA 2YCQA 4TRLA 1PW2A 2YCSA 4O4FA 2CGVA 4U79A 2B9FA 2FB8A 4NKAA 1AD5A 2W7XA 4BCMA 5IH6A 3ORXA 5JZNA 4NT4A 1XWSA 2X7OA 3F6XA 3KXHA 3R71A 1GIIA 5LWNA 2PVYA 3ENMA 4IIRA 2WZJA 3A4OX 1OB3A 3FMLA 4RVMA 4U44A 4F1MA 5LVMA 4FNWA 3ZDIA 3I6UA 3PXFA 4GUBA 5TO8A 2E2BA 2VTTA 3RMFA 2I0EA 2YDKA 3Q53A 3PVBA 2YM8A 3FPQA 5BPYA 2UW6A 3D4QA 4TL0A 3CXWA 1ZMWA 5JFSA 5J9YA 1K2PA 5JZJA 3QX2A 3S00A 3KB7A 2W1EA 2WMUA 5CSWA 3TG1A 2VO7A 3ORKA 2WTVA 3HMPA 4DGGA 3KK9A 4FYNA 4H3QA 4D2SA 5T6KA 5DHJA 3PPKA 4LV8A 1UVRA 1ZYLA 5H8GA 3G33A 4QQJA 3FKNA 5GJDA 1H24A 4DEBA 4OUCA 1P4OA 3VJNA 4DBNA 1W2CA 4CRLA 1H1QA 5DN3A 5KKRB 1RQQA 5DGZA 1MQ4A 5CVFA 2JIVA 3BWJA 1R0PA 2P0CA 3GBZA 3I6WA 5AP0A 3SRVA 3NLBA 2XBJA 5BMMA 4AZFA 3D7ZA 4WSQA 4C4GA 3QC4A 4DBXA 2YM3A 3AC3A 4O91A 4UB7A 3KRJA 4FTNA 2BHHA 2B54A 1G5SA 3JPVA 1GZOA 4O0RA 4HVGA 3IQ7A 4EHGA 2VTMA 5AFVA 4P5QA 2R64A 2HXQA 4CV8A 4BBFA 4AU8A 2PZIA 4AAYA 4I6FA 3KRLA 5HIEA 3FZ1A 4RBLA 3PDTA