1GZOA

Structure of protein kinase b unphosphorylated
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
296
structure length
271
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism for the Regulation of Protein Kinase B/Akt by Hydrophobic Motif Phosphorylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase
molecule keywords RAC-BETA SERINE/THREONINE PROTEIN KINASE
total genus 68
structure length 271
sequence length 296
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1gzoA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1gzoA02
3VJOA 2ETMA 3FC1X 2HW7A 4PPAA 3T9TA 5L2TA 5AP2A 2JDVA 3NYNA 1JKLA 1YRPA 2JIIA 2JKKA 3JVSA 3WZUA 1ZY4A 3UYSA 3DFAA 2F2CB 2PVMA 3KQ7A 1Z5MA 4L44A 1UV5A 4RX9A 5H3QA 3PVWA 3SXRA 4N57A 5E9EA 5ANDA 3VUTA 2O63A 4BIDA 3V04A 4F09A 1OKZA 2FYSA 1H26A 3ENHA 4KKHA 3PE1A 4CT2A 2VTHA 2W06A 1V0OA 2J4ZA 1DAWA 4BTMA 1SNXA 3QX4A 2WOUA 5IA5A 3ULIA 2HWPA 1O9UA 4X3FA 3VS1A 2ERKA 5DRBA 4J98A 3QZGA 4TYHA 2BIKB 4QMXA 4RJ4A 5I9YA 4FOCA 3NW6A 3JS2A 2FUMA 4BHNA 2R3OA 4OTHA 4ASZA 4EK6A 3G6GA 4Q5EA 4AZWA 4RZVA 3DFCB 2IVUA 2Y7JA 4FNYA 5DRDA 4ZJJA 1BLXA 2JGZA 1H0VA 3FQEA 4AW1A 4W4VA 4CTBA 4EZ5A 4CEGA 4F4PA 5AIRA 3KVWA 4UZHA 3C9WA 4P4CA 2BIYA 3TV6A 1BUHA 3AQVA 4BY9E 4B6LA 2GS6A 2Q0NA 3UPXA 1PXPA 3KF4A 3CKXA 3C51A 4F1OA 4KD1A 3TJCA 5HIEA 3PJ1A 4A4OA 2LGCA 5HBEA 4JBQA 2BAQA 3COHA 2PU8A 4FVQA 4WNKA 1FGKA 5AUZA 4LFIA 1NVSA 5CX9A 3CSVA 4A07A 3V3VA 4ANLA 4LGHA 3QKMA 5ANGA 4LM5A 4RJ8A 2Q83A 4FEXA 2HYYA 4G9CA 1B39A 1ZMVA 3OWPA 5TT7A 1LUFA 2C6IA 4JQ8A 3OCSA 3QTZA 3QQFA 3FPQA 3TIYA 4PDOA 4A9UA 3C4ZA 4UX9A 1UVRA 4XCUA 3KULA 4HOKA 5GZ9A 4J7BA 3R83A 4I3ZA 3P5KA 5L8LA 2R3NA 4I5HA 4AZTA 3EQGA 3PVGA 4BGGA 2BVAA 2ZV2A 4C59A 1SZMA 2Z02A 4D0WA 4IWDA 3LFQA 3NIEA 2XNEA 3PXFA 2P0CA 2R3QA 4I93A 4OTQA 5GJDA 5LMAA 4D28A 4F99A 4D58A 5K4IA 5KMIA 1QCFA 3MGYA 3OY1A 2X9EA 3HUCA 3EL8A 4WA9A 3DBFA 4JIKA 4GKHA 2UZWE 4GIHA 4G2FA 5EKOA 4RVKA 3S3IA 4ACMA 1RE8A 1WVWA 3V5TA 4I94A 4BBEA 4B9DA 2C4GA 3FL5A 4JBOA 4KIKB 2OXYA 4NK9A 2PUIA 1Q97A 1OL1A 5DT4A 3QC4A 5BUIA 3U6IA 3NX8A 3U6HA 4QYEA 4S30A 5J8IA 2PK9A 2RKUA 2X7FA 3BYOA 3FLZA 4HCUA 4Q9ZA 5CEMA 3PPJA 4C57A 1H1SA 3Q9YA 4WRSA 3BLRA 2XK4A 2PVFA 4GL9A 3C50A 3FMNA 2WQMA 3PIZA 5EDRA 3HMIA 3G15A 2G1TA 3HYHA 4DCEA 5HBHA 3UOJA 4JBVA 4O83A 4QO9A 5KZIA 3UOHA 4I22A 2JFLA 3GNIB 2XM8A 2B52A 3TIZA 3ZUTA 4C38A 4YLLA 5D9HA 5GNKA 5BMSA 1Q62A 4B0GA 1PXOA 3VBVA 2IZTA 5EHYA 2C5NA 5AEPA 2O8YA 3CJFA 3QLFA 4O96A 4FNWA 5ANJA 3VBYA 2XB7A 2J51A 4AP7A 3U4WA 4YTCA 3HV7A 3C0HA 4FKOA 1J91A 3OROA 3DZOA 4FV4A 3HMNA 1AQ1A 1REJA 2AYPA 3LCOA 3W8LA 4TPTA 4YJTA 3LQ3A 2PUUA 5ETFA 4O38A 4BIEA 4EZ3A 3NCZA 4JS8A 3DTCA 4L43A 5CSWA 4HCVA 5AUWA 3VF9A 5JT2A 1YOMA 5L6PA 4G31A 3F7WA 4O82A 2IVSA 4YUQA 4I4EA 3SOAA 3ZS5A 4KBAA 3LZBA 2ZJWA 4WNOA 3CEKA 1P4OA 2B4SB 4ACCA 2VTRA 1OUKA 3MPMA 4G3FA 3GC7A 5T68A 4BYIA 5AJQA 5J9ZA 3ZLWA 3ORPA 4QYYA 3NR9A 3VUHA 4PP9A 2F7EE 3PPZA 5EDQA 5EQYA 3C4EA 5K5NA 3MWUA 2QG5A 1PJKA 3KRLA 3NGAA 3I5NA 3HA6A 4LRKA 2XK6A 3OFMA 3RM7A 4C3RA 5DMZA 1GAGA 2EB2A 4IAYA 4F65A 3BYMA 4CV9A 4BDHA 4MWHA 4QP3A 3AD6A 4BZOA 5BVOA 4EEVA 4NM0A 4O7SA 2FB8A 3RVGA 4ZY5A 3C1XA 4FIGA 3D15A 3FUPA 1H1QA 1PXMA 2NO3A 4O21A 4D2TA 3F6XA 3GU8A 5D7AA 2CKOA 1P4FA 3FHRA 3GP0A 3SDJA 3EYGA 3BHTA 4IM2A 1J7UA 4BI0A 4EH3A 1A06A 4O7LA 2C6EA 3OZ6A 4W8EA 4HW7A 5HO7A 3JR1A 4GEOA 2RFSA 2PZRA 4Y72A 4WO5A 3TM0A 3UTOA 1XH4A 5IA4A 3E3BX 5HESA 1JKTA 2JC6A 3I79A 3QCXA 4IQ6A 3MV5A 4UALA 3OTVA 3RHKA 5IG1A 4II5A 3FWQA 5K9IA 4YURA 2CNUA 2GTNA 3CPBA 4U9AA 4DN5A 4WSYA 4QP4A 3TNWA 4USFA 3ROYA 3MVJA 3DJ6A 2W1CA 3P86A 1YHVA 3FMJA 2HK5A 3QCQA 1MUOA 3R1YA 2YM3A 3QD3A 4UB7A 3WZJA 5LVNA 4V01A 4K11A 4FG9A 4CMOA 3QX2A 4NIFB 3PIYA 4EK8A 1G8AA 2CNVA 4E20A 3R7IA 2WQNA 3KMMA 3QL8A 5DT3A 3IO7A 4NW5A 4IVAA 2WMUA 5EM5A 2UVZA 3LIJA 3V5LA 3CKWA 2RG6A 2ZM1A 5K0XA 2CNQA 5AR4A 3RK5A 4KWPA 3TACA 2OZOA 4PMPA 2GMXA 5EYDA 3FZRA 3EQBA 2NNWB 1T46A 1TQIA 2BILB 5BVDA 2ITYA 5AUTA 1STCE 3UP2A 4U3ZA 4QOXA 4YSJA 2YJSA 3VUDA 4JIAA 2YWVA 5CI6A 3IS5A 4S33A 5CEOA 5CF4A 1ZYSA 3OWKA 3LFBA 2YEXA 3VS4A 1OPKA 2REIA 3AMYA 3AT2A 3EZVA 4L00A 2WO6A 3UGCA 3W55A 4Z7HA 3EN9A 4M0ZA 4KA3A 3SW7A 3KCFA 2XIYA 1PMNA 4XUFA 4KNBA 4Y5QA 4A4XA 4AAAA 3C7QA 3NYXA 5LVPA 5CZHA 3Q6UA 4J53A 2V62A 3DJ5A 4C37A 3PJCA 1H00A 1B38A 3GCVA 1MP8A 5KKRB 2WMXA 4QMUA 4ASDA 1H24A 4G17A 3NNWA 3NNUA 2WMAA 5FTGA 2F49A 4FG7A 3KU2A 3Q9ZA 4ZY6A 1JVPP 3G51A 3GU5A 3KRJA 3QKLA 3F9NA 3FLWA 3UO4A 1J1CA 4C33A 4XYFA 4YHJA 4TYJA 2VWWA 4QTEA 4J52A 2Z8CA 4IWOA 4FTKA 1RDQE 3U55A 3GGFA 2PMNX 4JDKA 3WIGA 3GFWA 4XS2A 3M42A 2VTLA 4GG5A 3GU4A 5E7RA 2XCHA 3TTJA 4ZSAA 4GUEA 4HPUE 3QZFA 5IA1A 4W8DA 4CQEA 3E8NA 3B8RA 2UW9A 1CSNA 1PHKA 3W2QA 3L8VA 3OBJA 4X3JA 4YMJA 4RX5A 3EMGA 5H8EA 4V04A 3AC3A 2EWAA 2KULA 2NP8A 4HZRA 5AP6A 5HG8A 4FGRA 3GU6A 4O0VA 3B2TA 3R8MA 3QTSA 5KX8A 4DGLC 4WG5A 3HRBA 4ZLYA 2PVLA 2WKMA 2YM8A 3DKFA 2XNBA 1R78A 2V22A 3QXPA 2V7AA 4JLCA 4B8LA 2EXEA 4XRJA 5I4NA 4RFYA 5EQEA 4U44A 1OUYA 3O96A 3D9VA 4FMQA 3A7FA 3I5ZA 3OBGA 4YTFA 2C68A 5JQ8A 4ZSGA 4PL3A 3PDTA 5TO8A 1VYWA 3L1SA 2QNJA 1KE7A 2R3KA 4O22A 2B53A 3KY2A 3MYGA 4EYJA 4I92A 5IQHA 4NFNA 3R7OA 2VTJA 4NIFA 5EFQA 3IK3A 3COMA 4JAJA 4H1JA 2B9IA 4FV1A 1PXIA 4GU6A 2HZ4A 3IKAA 2XMYA 3KKVA 4KIQA 3P79A 4E4NA 3L8SA 2JIVA 5DN3A 1BX6A 3FL4A 3FZTA 1JBPE 3TNPC 2YCQA 1ZOHA 5IEVA 1XWSA 1G8SA 4EQMA 2YM5A 5KKRC 4EHVA 3U51A 2QC6A 3RPVA 3R1SA 3ZRKA 3CD3A 5KNJA 4UXQA 2XEZA 3VQHA 4HVSA 1SM2A 5CEQA 5CSHA 4RIXB 2OJFE 2ZDUA 3CJGA 2PTKA 2YM6A 4BKJA 2BRBA 3PSCA 4IHPA 2P55A 4CD0A 4ONAA 1PXJA 5IQCA 3SG9A 4U45A 4YU2A 2BMCA 4RFMA 5E8UA 4QMQA 5J7BA 1PYEA 1XBAA 4EK3A 4YR8A 3PXQA 4HYHA 1OKVA 5AX9A 3ATTA 5IQAA 4BCMA 1XR1A 2FH9A 2Y6OA 5D1JA 5G1XA 3CTQA 5FQDC 3ORKA 5BYYA 4O7WA 2E9OA 5FEEA 3TKUA 1CM8A 4IVDA 3L8PA 4WUNA 4RVLA 4UWYA 1YXTA 4O84A 2XNGA 4BR3A 3EQRA 4ZS4A 1UU8A 1IAHA 2ZV8A 4JRNA 3S95A 3WE4A 3KGAA 4BCGA 3MIYA 1OL7A 2I0HA 4PPBA 4CFWA 3FMDA 5E90A 3FYJX 3EFKA 3ZEPA 3R04A 1Y6AA 3LFSA 2ONLA 4KIPA 2VRXA 5FEDA 1NY3A 4UWCA 4YJOA 3EN4A 3DXNA 5DR2A 4UZDA 3ZDUA 1Q8ZA 1SYKA 4NKAA 4PDPA 1SNUA 3DQXA 3HECA 3ZO2A 4AW5A 3SXFA 3NMUF 4FOBA 1PXLA 2UW0A 4QQCA 4BHZA 4XG8A 5M07A 4R78A 4MD7E 5HCXA 5AFVA 5E8ZA 4O7RA 3DK6A 2DS1A 3A8WA 3PWDA 2BDFA 1FPUA 3PUPA 4L67A 4MEDA 4CKRA 3EWHA 4QMZA 3DQWA 4O0SA 5EK7A 5FUTA 2OZAB 3F5PA 5IKWA 4ERKA 3CY3A 2CN5A 3IGGA 5J5TA 1JSUA 3PJ8A 4S34A 3QZHA 2WZJA 4XH6A 1NVRA 4QP8A 2ZVAA 4FIEA 5KMLA 2R64A 3UC4A 4JDIA 1PXNA 4BYJA 3HUBA 4IM3A 3SV0A 2VX3A 2W1IA 4JDHA 2XA4A 5FRIA 2XH5A 3OG7A 4FKPA 2RFNA 4QT1A 1Y91A 1ZWSA 3FXXA 4WOVA 4GT5A 2O64A 2WMSA 4YJSA 3SX9A 5HLWA 5LJJA 2YM7A 3QD0A 4BWXA 3R73A 1YXXA 4IZ7A 3R9DA 5EI8A 1LP4A 4IWQA 4DBXA 5J95A 5EYKA 5J79A 2W17A 2OJ9A 3W2RA 2C1AA 2JFMA 2JITA 3BBWA 2YN8A 3D7ZA 1U4DA 4C4EA 5JFXA 2XK3A 2WOTA 5B2KA 3R00A 2G2IA 2IVTA 4EH8A 4KINA 2XRUA 4UMRA 5HBJA 1BI7A 5LMBA 4U8ZA 5ANOA 5AM6A 4AN9A 4EOSA 4EBVA 4FSNA 1R3CA 4GU9A 3KXHA 3K2LA 3UOLA 5ICPA 5CAQA 5K0KA 4ZS0A 2BDWA 4YNOA 5AUVA 1FINA 3DLSA 4YLJA 2YACA 1TKIA 4YTIA 1TQMA 4USEA 3IW8A 3V5JA 4PNIA 4H36A 3QRJA 3TUBA 3LJ1A 5E1EA 2F2UA 1SVHA 3OW3A 3T3VA 5CY3A 4BTJA 2OWBA 3G6HA 2GQSA 2XBJA 2OJJA 3ZH8A 1GNGA 4F08A 4ZSLA 4PDSA 4YO6A 3R9OA 4CFNA 3AT3A 3E7OA 2OG8A 4C2WA 4F7NA 2OXXA 4G3CA 4EL9A 5A4QA 3FMMA 4XP0A 4NM3A 3ODYX 4ZEGA 5JN2A 3ITZA 1VJYA 3OMVA 3M2WA 5AR8A 3O71A 2OFVA 2JBPA 2X9FA 2QO9A 4YP8A 4WG4A 3QA0A 5DYJA 5T3QA 4BZDA 3E8CA 2BR1A 4PP7A 5IDPA 4EHZA 2J9MA 4OT5A 4M3QA 5HLPA 2WEIA 1YOLA 2E9PA 3JPVA 4IB1A 4YHTA 2UZBA 3KCKA 3LVPA 4E1ZA 4XV1A 2ITZA 3FEGA 3EN7A 2QR8A 3FMHA 4V05A 3BV2A 4OT6A 4C34A 3R63A 3MPTA 4DFYA 5L2IA 1IAJA 3I7BA 5AR5A 5IU2A 4AS0A 2BKKA 5AAFA 2I6LA 2IG7A 1PRYA 1BKXA 4F70A 2R3JA 2XP2A 3V8TA 2CDZA 3R1NA 4DAWA 3LQ5A 4CLJA 3U4UA 2XJ1A 5EM8A 1Y8GA 3IDBA 3BELA 4RIYA 3NYOA 4I5PA 4GRBA 4BCKA 5HHWA 4KAOA 2UW7A 4PRJA 3FLQA 3NEWA 4KS7A 4CTCA 5AUYA 4UYNA 4RZWA 2R3IA 3H0ZA 3K54A 3QZIA 1GZKA 3IW4A 3MW1A 5HICA 4EKKA 4GIIA 4A06A 3DNDA 2VTTA 3MS9A 4P5QA 5B2LA 5C8KA 2B0QA 5BYLA 3F5XA 3QD4A 4PL5A 4EOKA 5LMKC 3AMBA 3CLYA 1JLUE 2QVSE 4RVTA 4YPDA 1XBBA 1H25A 2VAGA 4ZP5A 3SW4A 4GK3A 3E8DA 4KSQA 4QTCA 4BBMA 4FTMA 3NIZA 2YIXA 3DV3A 4TL0A 2QR7A 5M06A 4DGOA 5D11A 1R0EA 2H9VA 3DCVA 4JG8A 3UVRA 2UW5A 1JAMA 5KHWA 2VO7A 1H1WA 4KBCA 2C0OA 2RIOA 2PVNA 2HCKA 4FTOA 4IH8A 3FZOA 1YDTE 4RIXA 4EH7A 3I6UA 3ATSA 4FUXA 1WBVA 2J0KA 1H08A 1W7HA 2ZM3A 3LXNA 3MDYA 3TZ7A 3A7HA 5JGDA 4U42A 3NCGA 4Z9LA 3B2WA 4E4MA 4FEQA 5K4JA 2BTRA 2GNJA 4NTTA 4UMTA 3U8WA 2WMQA 2OJIA 4AG8A 4FSQA 2VO3A 2WTWA 4K1BA 3BGZA 4KB8A 5HE1A 4LUEA 2ITOA 1GY3A 2R4BA 4TY1A 3LCKA 4ZZMA 4CFUA 2JD5A 4RVMA 5F94A 2QODA 1WBPA 1ZYJA 4APPA 5F9EA 2QOCA 4AOJA 4YHFA 2QU5A 3F69A 5DLSA 4W4YA 5AA9A 3BWFA 1P2AA 1MRVA 1HOWA 3F61A 4V0GA 2BALA 2WELA 2HW6A 1W98A 4FL1A 1J1BA 4ITHA 4BI1A 3QTWA 4DGGA 2GDOA 1WCCA 3R9RA 1Q8YA 3VVHA 3MBLA 3C4CA 4L3LA 4UBAA 2CLXA 2WIHA 4G5JA 2J5EA 4K6ZA 4R5YA 4FTUA 3UDBA 4O7NA 4IX4A 2YZAA 3GXLA 3N51A 3AG9A 4B7TA 3LJ2A 5HD7A 4HYSA 4FSRA 4M12A 5AUXA 3R8UA 3S0OA 2OLCA 1O6YA 1M14A 2WTCA 2R3GA 4XG2A 3TI1A 5CAOA 2PZYA 3PJ3A 4O0TA 2PMOX 4TT7A 4HYIA 3MIAA 3R7EA 2GHMA 2OXDA 3HDNA 1H4LA 4OBOA 5CENA 4ALUA 4BCJA 1E1XA 5IA2A 4ID7A 1YXSA 1PF8A 1OM1A 5HOAA 5HIDA 4EK5A 4EHEA 5B7VA 4FIIA 2YDIA 2XK8A 3I7CA 4F6WA 2I0EA 5EHLA 4AZEA 3IQ7A 4WD5A 3KXZA 5EG3A 2OF2A 2XNOA 2Y6MA 5CS6A 4IZ5A 4R7HA 2YIRA 4WBBB 5M56A 4DHFA 4BZNA 5CSVA 1HCLA 4D9TA 3PY0A 3IGOA 2A1AB 4XHKB 3VW6A 4D5HA 4LYNA 3BX5A 5F20A 2PPQA 3Q4UA 4JNWA 4ZTSA 2BUJA 2E2BA 2QLQA 3WF8A 4R3RA 2HZIA 4FODA 1T45A 2WNTA 1WBTA 2YHVA 3BU5A 3C0IA 4Q5HA 5EM7A 4TZRA 2JDRA 4P2KA 1S9JA 4JQ7A 3SD0A 3RM6A 4F0GA 4FYNA 5DH3A 3EOCA 2I7QA 1Q8UA 2I40A 2OBJA 3FZ1A 3L9MA 1H1RA 2QONA 3FDNA 1OITA 3MESA 4YZBA 3ORTA 3OY3A 1QPDA 1OBGA 5M4UA 1GZNA 2BZHB 1XH6A 5D7VA 4IC8A 3HV5A 3TZ9A 4FIHA 4AACA 2GNFA 4HPTE 3ZC5A 3ZFMA 5IH5A 1R39A 5BX0A 2X1NA 3R7VA 4XG3A 1U5RA 3I0QA 1GIIA 3ETAA 3Q32A 4AWIA 1OI9A 1JWHA 4GJ3A 4ZLOA 3T8OA 3CD8A 4DCAA 4I4FA 4BCHA 4OTGA 4G9RA 4LGDA 2QLUA 2J2IB 5LQFA 4AGUA 2C6KA 3IPHA 5LVOA 1ZLTA 3LCDA 3QAME 3BWJA 3S4QA 3AD4A 3QTXA 4C02A 4BDCA 2J7TA 5DE2A 2ESMA 3ACKA 3JXWA 4PUZA 4Y85A 2V5QA 1ZY5A 4RJ3A 1ATPE 3NRMA 1KE5A 5KO1A 3W16A 2VU3A 4O7ZA 2OI4X 2YCSA 2VN9A 2A2AA 3P23A 4L7FA 4QMVA 4FSYA 4D2VA 3V51A 5GINE 2JKOA 4JBPA 2UZNA 2WTJA 5ETIA 3LMIA 2VTNA 1F3MC 1MRUA 2QU6A 5HVKA 5JFVA 2W9FB 4FI1A 2QOHA 2ITNA 3ENMA 4FKQA 5HORA 2GNIA 4R7BA 5CU2A 3H9OA 2ZB0A 4FT9A 2AUHA 3DNEA 3IONA 3ZZEA 1XBCA 4X2FA 3QF9A 1M2PA 2W4JA 1KV1A 2H34A 1KE9A 4E73A 1Q41A 3MJ2A 2VWXA 3C4XA 4YBKA 4ZOGA 2CSNA 4HYUA 2C3LA 3E8EA 3QYWA 4FT5A 4IIRA 4CFVA 4XV2A 2X4ZA 4D9UA 5EM6A 4YZNA 5AA8A 5C01A 3KXNA 5JSMA 3KK9A 2VV9A 3ZLSA 4L52A 5EKNA 3N4TA 3SHEA 2YITA 3OXZA 4RFZA 3ZFYA 4ZZOA 4FVPA 4ANQA 3ZSIA 3D7TA 2VNWA 2WD1A 4FR4A 4MD9E 5A6OA 4CVAA 5IDNA 4FSUA 2C3KA 4DG2E 3QHRA 3UVPA 5GZAA 3ZXZA 5HTBA 2PZ5A 4CCBA 2OH4A 3WZDA 3Q9WA 3DTWA 5FBOA 3S2PA 2BHEA 4GK2A 3EQCA 3GOPA 4ENXA 3AGMA 3DS6A 4RWJA 4XNEA 2X2KA 5EH0A 2R3FA 4Q9SA 5DFPA 4UY9A 4L3JA 4L46A 2YABA 3FLSA 4W4WA 3OT3A 2WMRA 2Y4IC 4TN6A 3OD6X 4O7VA 5AX3A 1M2RA 5LCKA 1I44A 2PSQA 4FKTA 4EQUA 3PTGA 3IW5A 2PMLX 4APCA 1F5QA 4FT3A 4OAUC 3C5IA 3D5UA 5JMSA 3BE9A 1DI9A 1W83A 2J6MA 3LPBA 3QC9A 3R8PA 3ZMMA 2B55A 3SXSA 1XO2B 2PE1A 3FQSA 3MPAA 1VZOA 4FTJA 4C36A 2VWVA 4YC6A 4RWIA 5IMXA 2X7GA 4TXCA 3RTPA 4C4FA 4M67A 2HXLA 5F4NA 2C0TA 3BYUA 3DT1A 4O0RA 5FP5A 4DH7A 4FG8A 4FV8A 3T3UA 3FC2A 3E3PA 4ENYA 4I6HA 5E8SA 2JAVA 1OB3A 3QQHA 4ZZNA 3LHJA 4DLIA 2WMVA 3KN6A 2PY3A 3PRFA 5FWKK 2XF0A 1OPLA 4QMOA 4LQMA 1GIHA 5IUHA 4PMSA 3D5XA 5M4IA 2UW6A 4FTLA 3HRCA 5I3RA 2YIWA 3TKHA 1XH7A 3OHTA 2YERA 4I0TA 4CMUA 3FHIA 4FEWA 4OR5A 1FVTA 5E8WA 3ZU7A 1ZOGA 5A3XA 4HZSA 3VS7A 4C4HA 2ETKA 4K33A 2BFXA 2X8EA 4HJOA 4IVCA 4D4YA 4EJ7A 5IQGA 3LFEA 3UNZA 4DEBA 2P3GX 3NNVA 4IW0A 5BVEA 3VWAA 2A19B 2W9ZB 3DBEA 1U54B 2XBAA 3O50A 1PKGA 3UG2A 4E6CA 2XK7A 3DPKA 4FA2A 3SRVA 3G9NA 3WARA 3DBDA 4XMOA 4D4RA 3R8ZA 3L9LA 2VUWA 3BHUA 2R2PA 3R8LA 4F7JA 5B2MA 3RGFA 4OAVB 4DH5A 5HQ0A 2XUUA 1QPEA 4CQGA 4RGJA 4O7TA 3DK7A 5L8JA 2WAJA 2VNYA 4J1RA 2CJMA 4F0FA 5IA3A 4ARKA 1VYZA 3A2CA 4MXXA 4IB3A 4WNPA 4ZJIA 1M7NA 1A48A 5H2UA 4GSBA 2JDOA 2P33A 3RKBA 5C26A 5CT7A 2R3PA 3F3ZA 5DIAA 5D10A 4ZTNA 5CNNA 3MN3A 4O1OA 4BI2A 3UO6A 2R3LA 1KE8A 5FP6A 4ORKA 4A9RA 3FBVA 3HVCA 2O0UA 3LXLA 5J87A 3CQEA 4ZY4A 3BE2A 2I0VA 3F2AA 1ERKA 4O86A 3FMLA 2BAKA 5LARA 4I21A 3UQGA 3VQUA 1O6KA 5D12A 4QP9A 2ITXA 5GJGA 3H9FA 2GHGA 1OL2A 5DI1A 5I5ZA 4EOLA 5HNBA 4PNKA 2UW3A 2Y0AA 3EZRA 1AD5A 4CRSA 1XKKA 5GZ8A 3K3IA 3LAUA 3QUPA 5HX8A 3WIKA 2ITUA 2O3PA 4X0MA 5JQ5A 5L6WL 2G01A 1JOWB 5FM3A 4CZTA 4QNYA 5KMKA 4IZYA 3UBDA 3M1SA 4RLLA 4DFZE 4NM7A 1G3NA 3E92A 4JRVA 4DGMA 3EQHA 4XLVA 5JGAA 2WTDA 3LFAA 5CVFA 4N6YA 1WVYA 2WEVA 4GCJA 2Z7QA 4I6QA 4IJPA 3R2YA 5E8XA 4O2ZA 5C8NA 5KBRA 3CQUA 3PXRA 3EKNA 2VTSA 4LUDA 5IQIA 3HL7A 3G33A 2VX0A 3AC2A 5HCZA 3EQFA 2BFYA 4QMYA 1F0QA 4MXOA 1WBOA 3RNIA 4E5AX 3KK8A 4N0SA 3QRKA 4HGLA 3Q9XA 3REPA 4YC8A 1ZZLA 4YGAA 1G5SA 2C47A 3CE3A 2EU9A 4FZ7A 4ZTHA 2PUPA 1WFCA 1Q8TA 4PPCA 3KC3A 4AT3A 4OUCA 1UNGA 3BHVA 4LL0A 1REKA 1URCA 3OVVA 3MVHA 2C3JA 5CU3A 2PUNA 1OKYA 4MVFA 3DU8A 4HVDA 5KBQA 1H0WA 3NUUA 2RGPA 5AAGA 4A9SA 3DDPA 4AA4A 3UMWA 3P0MA 5I9UA 4U5JA 4DFUA 4FT0A 3ZO1A 4NM5A 5FXQA 1SVEA 2P2IA 1URWA 3ZBXA 5C8MA 2PE0A 2BPMA 2X39A 3O23A 4QP1A 3CXWA 4XJ0A 4OGRA 3RZBA 3BEAA 4I5MA 2WPAA 5JFWA 4NL0A 3N4UA 4GFOA 1EH4A 2YDKA 4RSSA 5FM2A 3R8VA 3TNHA 2QKWB 1WAKA 5KHXA 2XIKA 3O8PA 4RA4A 3IDCA 3W8QA 4MX9A 2Z7SA 5CTPA 3RCJA 4D2SA 3DAEA 1P14A 3G9LX 4KRCA 3R7YA 3LCSA 4IACA 4BF2A 3CGOA 4D4VA 5C4KA 2YWPA 1V1KA 3OUKA 5HLNA 3VUMA 5FXRA 4ZMEA 4DTKA 5C4LA 2QOKA 1AGWA 5KMJA 4GKIA 5HO6A 1J3HA 4IM0A 2X8DA 5CAUA 4W9XA 3D14A 2XK9A 4G5PA 5F95A 5K3YA 3JVRA 4ZIMA 3ZUVA 3GC0A 4BWKA 2YAKA 3NS9A 4A4LA 5HU9A 1QPCA 3O7LB 5GIOE 1VR2A 1WBSA 3F3WA 5HGIA 3Q3BA 4MNEB 2OZAA 3FV8A 3VBTA 4C8BA 3TDVA 3DKCA 3TKIA 4EWHA 2CKPA 3D5VA 4CG9A 2BAJA 5KMMA 1YHSA 4I41A 3HZTA 5AR7A 3VN9A 4AGCA 4I5CA 4RBLA 3MI9A 4WHZA 4AOTA 4ANOA 2B7AA 3SLSA 2CPKE 2WB8A 3FKLA 4FF8A 4I0SA 4AN2A 3E88A 4EYMA 5AP3A 5M4CA 2FA2A 4JT3A 4W4XA 5AV3A 3H4JA 1NA7A 4QPAA 4FKGA 2HWOA 3Q60A 3PSDA 3MFRA 4BCFA 5IH6A 4K0YA 2ZMDA 3QQLA 5AP0A 5IQBA 4Z3VA 3EQPA 2R7BA 3VBWA 4FV7A 2XYUA 2W4OA 3GFEA 2UW8A 3Q53A 4GFGA 1IRKA 5DT0A 3NW7A 4LV8A 3U9CA 4DC2A 3R0TA 3RJCA 4WIHA 4X3FC 1WVXA 3SVVA 5IQDA 4GG7A 1ZYLA 3F3TA 3A7GA 3KEXA 2IO6A 3WILA 2YFXA 3LM0A 2BRGA 3R1QA 1P5EA 4HCTA 4XBUA 1ZAOA 3FAAA 4D1SA 3W2PA 2NPQA 1H1PA 4NUSA 2QCSA 4Z55A 2X8IA 3Q4TA 4E6AA 3S00A 3BV3A 3FYKX 3GI3A 3NPCA 3RPOA 4DEAA 4EORA 3E5AA 4N6ZA 3BI6A 4MWIA 5KMNA 5CF5A 3QCYA 5DR6A 4C4IA 3NUPA 2QHNA 2BCJA 3W1FA 1K2PA 2W5HA 3EFJA 2R0IA 5EOLA 3PG3A 3RAHA 3Q52A 4HNIA 4AFEA 1APME 3R21A 3KFAA 5F1ZA 4CG8A 2BDJA 4MXYA 3VAPA 2XS0A 3TJDA 3L9NA 5FBNC 1CMKE 3GCUA 3MH0A 4J99A 4AZFA 4C7TA 1QPJA 2A0CX 5EW3A 4NWMA 5LMKA 4PV0A 4NT4A 4MBLA 2WXVA 3KXGA 3QFVA 2BROA 2GQGA 3V5QA 2VGOA 3EFWA 3H0YA 3LOKA 2UV2A 2WMBA 3R71A 4MQ2A 5CWZA 4DH1A 4M84A 3HKOA 1GZ8A 4J97A 4XLIA 1OIRA 2FVDA 2XJ2A 3ORNA 5HD4A 3GCQA 3Q04A 4NJDA 3EB0A 4FSTA 3ET7A 3H30A 2Q0BA 4ANBA 5L6OA 4FTRA 2ITVA 1Y8YA 4EUUA 3ZO4A 2UVYA 2UZLA 4N4SA 3BYSA 3GQLA 1NT2A 4DTAA 3OCGA 5J9YA 5IUIA 5HE2A 4RA5A 2J5FA 4TWPA 3C0GA 4LG4A 4DEEA 2VGPA 1Q61A 4O0XA 4RIYB 4ZTRA 3W33A 4TYGA 5FGKA 3TL8A 3VBQA 4FE2A 4I0RA 1PMVA 2WU7A 3G0EA 3QTRA 4GVAA 4LOQA 5ANKA 5HE3A 3GCSA 3TUCA 1PMUA 2XEYA 3DKGA 5AADA 3QU0A 3WZEA 3V8SA 2ONLC 4D5KA 4QMPA 5L8KA 4BDGA 3ZM4A 3F5UA 3DZQA 3FMKA 4DH8A 3V8WA 5ACKA 5HI2A 2OO8X 3PXYA 4U80A 1OECA 3DBQA 4FL2A 4XG9A 4DBNA 4FNZA 3BYVA 4OTPA 4BWPA 2IJMA 3TDWA 2ZB1A 2EXCX 5L2QA 4ZXTA 3SKCA 5DPVA 3HMPA 4UEUA 4LV5A 5LCJA 4RRVA 3VHKA 4EZ7A 1YHWA 4FV3A 5FTQA 3LQ8A 1Q8WA 2J90A 4Z7GA 3IG7A 2PHKA 4FK6A 4U81A 2XKFA 3WF7A 4P5ZA 3D83A 3A99A 4IAFA 3LCTA 3UIMA 1DI8A 2O65A 3MB6A 2CKEA 4KABA 3RINA 2IPXA 4GH2A 2W1HA 1S9IA 2C0IA 3ZC6A 2DUVA 5J1WA 3TV4A 4TNDA 4X6QC 4RIWB 3LJ0A 1IEPA 1KSWA 3ROCA 3TNIA 2BRNA 1IR3A 1QL6A 4CFFA 1A9UA 1IA8A 5CZIA 5M51A 2UZUE 3A4PA 3IOKA 3WF6A 5HU3A 4CNHA 4L01A 5FLFA 5AUUA 4LMUA 3V5PA 4U43A 4IJ9A 3GU7A 5HNGA 3GOKA 4GS6A 2GFCA 2GHLA 3ZZWA 3A60A 4QD6A 4W9WA 4FTCA 4MXAA 1HCKA 1GJOA 4AT5A 4EC9A 1QMZA 1YKRA 3HMOA 4YZDA 1RQQA 4RJ7A 4EHGA 2BTSA 2W1FA 5KZ0A 3ZLXA 2CKQA 1H27A 4YPSA 3P4KA 4MNFA 4D0XA 4M7IA 2RL5A 3QGWA 3QQUA 3HDMA 4JJRA 4L9IA 4MNEA 3PZHA 4I1ZA 5EW8A 4EJNA 5JRQA 2F4JA 4CKIA 2B9FA 4YSMA 5JZNA 3QUEA 3AC8A 1JKKA 1YWNA 1Y57A 2YM4A 4O1PA 5AV0A 4DTBA 4ZK5A 2Z7RA 3UE4A 3RBWA 5CLPA 5JK3A 3HAMA 1OIQA 2UW4A 4F6UA 2XZSA 4PTCA 4U0IA 3OWLA 2OIDA 3PXKA 4H05A 4UMPA 1XH5A 2B54A 3ALNA 3R28A 3PIXA 3IW6A 3R9HA 3VW8A 4IDTA 3GEQA 5JEBA 5DBXA 5EYMA 3THBA 3FSKA 3VJNA 2HZ0A 3TCPA 4ZMFA 3A61A 5CYIA 4XOYA 3O51A 3V6SA 5LVMA 4EKLA 4RX7A 2Y9QA 3P7CA 4MBIA 2H96A 3GC9A 3KMWA 3FQHA 2B9JA 4FKUA 3TG1A 3I1AA 4DEGA 5A6NA 5CNOA 3VS0A 4CSVA 3GQIA 1DAYA 3AT4A 3KB7A 3WYXA 3GCPA 4IB0A 2J0MB 4MD8E 4X2NA 4D2PA 1UU7A 4J96A 1FMKA 4MK0A 5CANA 1PY5A 4EBWA 2HENA 4AA5A 5DGZA 3U6JA 2CCHA 1CKIA 5DHJA 2SRCA 1FMOE 1I09A 2OU7A 2W99B 2AC3A 3OP5A 4WG3A 5E8VA 2QD9A 3W10A 3P1AA 2CGWA 4OBQA 2BZKB 3COKA 5LVLA 4K18A 2EUFB 3HNGA 1X8BA 3VUIA 1YI4A 1IG1A 2X7OA 4RQVA 4UV0A 4IE9A 3HV3A 4M14A 2YIYA 4FEVA 3BBTB 5A4EA 5BPYA 2FGIA 3RMFA 4FYOA 4A7CA 3QGYA 3H3CA 1MRYA 4AOIA 3UNKA 2R5TA 4I6FA 2DYLA 3PRIA 1XH9A 2I1MA 3BLHA 3E64A 3EJ1A 3ORIA 4NTSA 5B0XA 2YZLA 3MY5A 5J1VA 4GVJA 3ACJA 3CY2A 3DXQA 4E4XA 5ACBC 4S2ZA 2OIQA 3Q5ZA 4D2WA 3C5UA 3TEIA 3HAVA 3ZBFA 1KOBA 3UYTA 1OL6A 5BVNA 2QKRA 3LMGA 5EOBA 3ZUUA 3MA6A 4J8MA 3FJQE 4EK4A 3LW0A 4GUBA 4LRJA 5TKDA 3KRXA 5BUEA 1ZYDA 3S1HA 2YDJA 3O17A 3SOCA 1PW2A 3HX4A 2FO0A 4XRLA 4Y73A 5AP1A 2YCFA 2GS2A 4U3YA 2BRMA 4XOZA 3OT8A 3FI8A 4YC3A 2QOIA 4BICA 2X6EA 4RJ5A 3U54A 2G9XA 2QURA 5CASA 3ZSHA 4QYGA 4NKSA 2LAVA 5HVJA 3PY3A 2J50A 3PP1A 4JQEA 4L6QA 2PULA 3GC8A 4IFGA 3CC6A 5DG5A 4BCQA 5IEXA 3UPZA 3FLYA 2DQ7X 4CV8A 2V0DA 4ANMA 2HZNA 2VTMA 3L8XA 3LLAA 4KKGA 4CXAA 4PMMA 2EVAA 2UVXA 3BGPA 4E8AA 3UZPA 4CZYB 3HEGA 2PZPA 4ALWA 2HOGA 4XV3A 4R1YA 2RFDA 3R2BA 4PTEA 4NCTA 2ZV9A 4MXCA 2W1EA 3UIUA 2PMIA 4GV1A 3QALE 1ZMUA 1YDRE 3EYHA 3NYVA 5CT0A 2XCKA 4AQCA 5AWMA 4BIBA 4FL3A 5M55A 3L9PA 2C5OA 4MKCA 2PVYA 5H8BA 4KKEA 1W82A 2ITQA 3BU3A 4FIJA 4YO4A 3QXOA 2NRYA 2PZIA 1Q5KA 4FK3A 3TZ8A 2X0GA 3LKMA 2P4IA 4OLIA 1PYXA 4G34A 4BB4A 3FZPA 3ZDIA 4AXAA 4F7SA 2X2MA 3OCBA 4BDKA 3MVLA 1FVRA 2QO2A 2YLEA 3MFSA 4EONA 5CU6A 4X21A 3RK9A 3FKOA 4K77A 3UMXA 5LWNA 3LMHA 3P9JA 3VULA 2PYWA 2C6LA 1OVEA 4FICA 1UU9A 3UOKA 3RP9A 4DG3E 4WT6A 5CEIA 3NUNA 2WMWA 3MFUA 1J7LA 2R0UA 4FGBA 2UUEA 3VRZA 5M57A 1V0BA 4AW0A 5FTOA 4EH5A 2VTIA 2RSVA 5IA0A 1OIYA 3F2RA 2WQBA 3PE2A 3PYYA 2XIRA 3LE6A 4FBXA 3I4BA 3V5WA 2JEDA 3HV6A 2OJGA 1L8TA 4BGHA 3VS5A 5FG8A 3SG8A 2HIWA 5HEZA 4ERWA 4G6LA 4QMLA 4NJ3A 4FZDB 4M69A 3WI6A 4TKSA 4O7YA 4X2JA 2F57A 4NFMA 5JFSA 5DOSA 4ACGA 3MY0A 3QBNA 3QLGA 4ZSJA 5BMMA 1BI8A 3GT8A 2VTAA 3SC1A 4PQNA 1OMWA 3CCNA 2JAMA 3B8QA 3PFQA 3V01A 4DITA 3ORZA 3RWPA 1OKWA 2JDTA 3BGQA 2EB3A 4HVGA 3E63A 4TYEA 5L3AA 3KN5A 4KBKA 2WQOA 3CBLA 4FKSA 1JNKA 4ZSEA 3C4FA 3DKOA 5EW9A 2FSMX 3WZKA 4ZTLA 3ERKA 4Z16A 5KUPA 4Q2AA 1WMKA 2CGXA 2W96B 3V6RA 2OF4A 4IZAA 2E9NA 3KF7A 4XP2A 4ANNA 2CLQA 1UKIA 1YDSE 2F7ZE 3BZ3A 3D2KA 4P90A 4QQ5A 5TE0A 3GENA 5E8TA 3SRVB 4D2RA 4QTAA 4JAIA 2OGVA 5EHOA 3KVXA 3HA8A 3DB6A 5DWRA 5M53A 1Z9XA 4FTQA 2PE2A 4QQJA 2Y4PA 4QMMA 3ZRLA 3VF8A 1YWVA 2R3HA 2WTKB 2ZYBA 2PVHA 5JKGA 1YQJA 3D2IA 4B99A 4BN1A 4DG0E 4H58A 3ORXA 1PMEA 4R6VA 5CAPA 2FSOX 4U6RA 4BKYA 3D7TB 4MAOA 2Y8OA 4DLJA 4MF0A 4H3PA 1U46A 3Q4CA 3CQWA 4RWKA 4UMQA 5CXZA 2F7XE 1JPAA 3AOXA 4RC3A 4U7ZA 3ZOSA 3NAYA 4GFMA 3G90X 4Y5HA 1JSTA 1ZOEA 2J0IA 3GUBA 3GVUA 3DAJA 3MY1A 4R1VA 1KV2A 5AV1A 3IW7A 3Q2MA 2ZM4A 4KRDA 4DFXE 4X7QA 3QQGA 4D55A 3M11A 3NZ0A 4S32A 4K8AA 5BVKA 1UU3A 5C27A 4F9WA 4IB5A 4ZLZA 1R1WA 3DK3A 3BRBA 4RJ6A 4X3FB 3ZXTA 5A9UA 4FTAA 1KWPA 2C6TA 3MSSA 4E93A 4CGAA 2ZMCA 1ZARA 3CIKA 4IANA 3BQRA 2XNPA 5BVWA 1RW8A 2ERZE 4TWNA 4KIKA 4BCNA 3DJ7A 2FSLX 1YI6A 1UWJA 1DS5A 2UZTA 2W0JA 3SAYA 3DBCA 4AX8A 3UNJA 3FY2A 3RK7A 5CQUA 3UO5A 3MJ1A 3O8TA 4DF3A 1J7IA 3F3UA 3E87A 4JX7A 4Y46A 5IQEA 4QMWA 3VS3A 2W5AA 4BGQA 4BTFA 4DFBA 3PA4A 4L45A 4WNMA 2YA9A 4NCTC 5ANEA 4RWLA 2OKRA 1FQ1B 4JR3A 4ASEA 4HVIA 4BTKA 2GFSA 5ANIA 4WRGA 3QTUA 2IN6A 5JGBA 4FZFB 4FZAB 4PWNA 2G2HA 2BZJA 4G6OA 5C03A 1IA9A 3PP0A 3A62A 2GCDA 4U41A 3MTLA 4DFNA 5J5SA 5GHVA 3K3JA 4EOQA 3G0FA 2R9SA 3BEGA 2VO0A 3K5VA 4G6NA 4IAIA 4O0UA 4EWQA 4L3PA 3CTHA 1U54A 4H39A 2QQ7A 4LL5A 5L2SA 1Q3DA 3TWJA 2GTMA 3PSBA 4F9CA 4EOIA 3ZEWA 3KULB 3MFTA 2C3IB 5HG5A 1XJDA 5C9CA 4UXLA 5CF8A 1H28A 4M68A 2WGJA 5AM7A 3MH1A 4NW6A 4UYAA 3IDPA 1R0PA 4HVHA 4BDDA 4EI4A 2VTPA 3MH2A 4QP6A 3U87A 4ZAUA 1SMHA 3RI1A 4BDFA 4FIFA 3K5UA 3ZTXA 4HGEA 3D0EA 5KMOA 2YISA 3W2CA 5DR9A 2GQRA 3P08A 2O2UA 3NVMB 4YZCA 3RWQA 3PJ2A 5KE0A 3ELJA 4AGDA 5K5XA 5DEWA 4AN3A 3JYAA 4HGSA 4BDEA 2P2HA 3PPKA 4NYEA 4P7EA 4WBOA 5I3OA 2HXQA 5E92A 5CU0A 4LRMA 3E62A 2BZIB 3RAIA 3QWJA 1B6CB 2RFEA 4JDJA 3PVBA 2IVVA 2B9HA 3UJGA 2PVKA 3EQIA 1OZ1A 4FC0A 1ZZ2A 3R22A 4I20A 2J0JA 2J0LA 3EN5A 4ACDA 2X4FA 4FV0A 4R7IA 2WTIA 4N70A 3GBZA 4J71A 2IW8A 4M13A 5M08A 3RZFA 2G15A 2PWLA 3A4OX 3PA5A 1CTPE 5AAEA 4UWBA 4FZ6A 2X6DA 4K2RA 4FX3A 5TOZA 4F9YA 1W0XC 2XRWA 4EOPA 3G2FA 5ETCA 4JXFA 5I0BA 3RNYA 3ULZA 2QOFA 4O81A 4IAZA 3TZMA 5LWMA 2C5YA 2VZ6A 2C1BA 4RQKA 3FI4A 3FZSA 5CAVA 3W32A 3KL8A 4IMYA 3MTFA 1OL5A 4FTTA 4GW8A 1Y6BA 4MQ1A 2UZOA 5FXSA 4RMZA 1TVOA 3PVUA 4O6EA 4A9YA 3FPMA 2G2FA 2JLDA 3DB8A 4D4SA 2VWBA 3KXMA 3BIZA 3LFFA 3CPCA 4V0GB 2CGVA 4EUTA 4H1MA 3JY0A 4HGTA 3N4VA 4JG6A 4G3GA 4C3PA 2UZDA 1CKJA 3QA8A 5TF9A 1XHAA 2OICA 3DAKA 4M69B 4DEHA 3OF0A 3CTJA 1WBWA 4IAAA 4L53A 4FKJA 4R3PA 3PXZA 4EOOA 2ITPA 3OXTA 4GT4A 5HIBA 4EH4A 4CT1A 1LEZA 4M15A 2E9VA 4BC6A 1ZRZA 5E4HA 1Q24A 3OWJA 5BQ0A 3QTQA 3A8XA 3NVKI 3AXWA 3FE3A 5CVHA 2IZRA 1Q4LA 3LFDA 5AP7A 4BDIA 3FLNC 4O2PA 2VWYA 4TRLA 2W4KA 2VWUA 4PY1A 3FSFA 4BDJA 5M4FA 2IZSA 3VUGA 5CF6A 4PL4A 4EH9A 3DOGA 3SA0A 4G16A 3R30A 4EC8A 3W18A 3I0OA 3CGFA 1U59A 2GSFA 1ZXEA 4FNXA 1E1VA 3F3VA 5JZJA 4IDVA 3ZYAA 2ZV7A 3U9NA 4JI9A 4RC4A 3WF9A 3D94A 3O8UA 4CYIA 1WZYA 3F88A 3RHXA 3ZRMA 3FXWA 2C6OA 4TW9A 3VIDA 1LR4A 1U5QA 5CU4A 3GB2A 4BDBA 2QO7A 2PVRA 5HG9A 3TN8A 5CEKA 4DEDA 4E5WA 3OTUA 2VX1A 3OEZA 3ZO3A 4C4JA 4D1ZA 3A7IA 3OEFX 5EI6A 2ZDTA 4OTWA 4CMTA 4E6DA 3F2NA 3PZEA 5A14A 4E5BA 3KRWA 1M7QA 2A4LA 1OIUA 2GPHA 3UQCA 4LGGA 3LXPA 4ITJA 1IASA 4IADA 2BKZA 4U79A 4L7SA 3RCDA 4MTAA 2YAAA 4RX8A 4CLIA 5LXMA 3RPSA 3I81A 5FEQA 3HP5A 2V55A 1LEWA 5CXHA 4E26A 5HTCA 2RG5A 2W5BA 1UNHA 3MH3A 4F9AA 5A4LA 3UODA 4F7LA 5CQWA 3QHWA 5DA3A 4I6BA 4QNAA 4B4LA 5EQPA 3NAXA 2FSTX 3OXIA 2HY81 2W1ZA 3POZA 4IAKA 3BKBA 5DNRA 2HELA 4C62A 4NSTA 4I24A 3LM5A 4XV9A 4G1WA 3R9NA 2OFUA 2H6DA 3NDMA 3WF5A 2XNNA 5FDXA 4XP3A 2QOLA 2WMTA 4R3CA 4QMSA 3O2MA 5DEYA 3NWWA 4BL1A 3C4WA 5IISA 3TTIA 2F9GA 3BHYA 4PTGA 1H8FA 1NW1A 4QMNA 5KCVA 4QP2A 3OUNB 3RAWA 4FKIA 2BHHA 3ID6C 2PVJA 4IX6A 4ANSA 1XQZA 5AMNA 4F6SA 2E9UA 4TYIA 4E7WA 2H8HA 2AC5A 1ZYCA 2VTQA 3ORLA 4FT7A 4XG4A 4PF4A 4U40A 5IF1A 3I6WA 3JY9A 4KS8A 5GJFA 3VC4A 3QD2B 3UIXA 4MBJA 1JKSA 3TXOA 2GNLA 5IEYA 4QYHA 4RG0A 4EQCA 3FI3A 4F64A 2OH0E 3R01A 2IW9A 2WFYA 3BCEA 4JG7A 1YWRA 4OTFA 1O6LA 2Z7LA 4QTBA 4AE6A 2Y4IB 4QTDA 1L3RE 4M8TA 4F1MA 2XKCA 4R8QA 2QOOA 2ZOQA 2QG7A 4IX3A 3AC4A 5CSPA 3ZLYA 4X6RA 4JL9A 1UNLA 5CALA 4YBJA 2X2LA 1KE6A 3EL7A 1UWHA 3QRTA 4RLKA 3R7UA 3ALOA 4CFMA 5A4CA 4XBRA 1K3AA 1BL6A 3WYYA 1YXUA 3PA3A 4AW2A 3EQDA 3VHEA 4F9BA 4QPMA 5C1QB 3UQFA 3FI2A 2XIZA 5AV2A 4FV9A 5AIKA 1ZMWA 4FVRA 2C6DA 3CP9A 4E6QA 3KRRA 4O6LA 4S31A 3F66A 3PWYA 3R7GA 5BYZA 2CGUA 1CKPA 4FV6A 5HTIA 1YW2A 4MXZA 4H3QA 5IZFA 4TTHB 2C5XA 3MA3A 4FKRA 5HVYA 3WOWA 2EXMA 4LOOA 4YJVA 4MH7A 1RJBA 1K9AA 4MHAA 3P7BA 4EOMA 3VS2A 2GNGA 1Z57A 4FTNA 2O5KA 2A27A 4OTDA 3PLAE 3TUDA 2HY0A 5BVFA 4NZWB 4MYGA 4XX9A 3AD5A 1FVVA 3HP2A 3OC1A 4YJQA 4JOAA 4CZUA 4FEUA 1KOAA 2DWBA 4EH2A 3BHHA 2NRUA 3AC5A 4RT7A 1OBDA 4QYFA 3R02A 2WTVA 2VO6A 4PX6A 2IWIA 4QMTA 2VTOA 4HNFA 4AGWA 1YXVA 4ASXA 2VWZA 3ZM9A 3O0GA 4FSZA 2WHBA 4UN0C 4OW8A 5LOHA 4NU1A 4F63A 4DA5A 1JSVA 4KSPA 1LPUA 4O0YA 4Y83A 4E3CA 3AGLA 4U97A 5J7HA 3QRIA 4BBFA 1MQ4A 4DH3A 4I23A 5ITAA 3FXZA 4ALVA 2QI8A 3QUDA 4M0YA 3E93A 3UC3A 4XEYA 4JR7A 2ITTA 3NUYA 5CI7A 1GZOA 1W84A 4FKVA 4H3BA 1DM2A 4AT4A 2YCRA 3BPRA 1FBNA 4AUAA 3ODZX 4EH6A 1JQHA 4FKWA 4JVGA 4B8MA 5D41A 3HMMA 5EYCA 1MQBA 4PDYA 4OTRA 2CMWA 4RIWA 5E91A 4GYGA 3QTIA 4AZSA 5JH6A 5A4TA 3II5A 3VRYA 3ZFXA 2VD5A 4AZVA 1NVQA 1FGIA 4TNBA 5EI2A 4XG7A 2W7XA 3Q5IA 5T6KA 4BRXA 3KREA 4GJ2A 3W2OA 3BQCA 3F5GA 4BDAA 3UZRA 1BMKA 1W8CA 5E1SA 5IQFA 1SVGA 3HLLA 2W05A 4C3FA 3DXPA 3PG1A 2R3RA 3DA6A 5G6VA 2OW3A 4L68A 3WBLA 4BCPA 5FDPA 3F82A 3DLZA 4ZTMA 2WQEA 5HX6A 4R77A 4IC7A 4M66A 3HRFA 3KXXA 4GK4A 4NH1A 3UP7A 5A46A 5AV4A 1WBNA 2V7OA 2JDSA 2XIXA 3RALA 3ZCLA 3H10A 3ANRA 5JRSA 5E8YA 2WTKC 3KMUA 4IEBA 4IBMA 1M2QA 5IH4A 4TYHB 4UMUA 3I60A 4RC2A 3IECA 3Q96A 4IWPA 4DFLA 3H9RA 3Q6WA 4FV5A 4X2KA 2XJ0A 3QRUA 1YOJA 4QQTA 4AU8A 3NUAA 3R6XA 4FKLA 4IXPA 4YJRA 4D1XA 5IMEA 2ETRA 3TNQB 4J95A 3WE8A 1E9HA 2YIQA 2OIBA 3CR0A 2W1DA 4CRLA 2C69A 3NLBA 4CKJA 5J9LA 1KUTA 4Y8DA 3UG1A 2C5VA 2C6MA 4F1TA 5IUGA 4BFMA 3DGKA 4DYMA 2CN8A 2JKQA 3SGCA 3KA0A 5M09A 3CS9A 2I0YA 3E7VA 3UVQA 3UZTA 3AC1A 1H01A 5HO8A 2VWIA 3LFCA 3VO3A 1BL7A 4GYIA 4O27B 5AP4A 4C35A 5CEPA 1OGUA 3ZSGA 4AFJA 1H07A 4CFXA 3BU6A 3D4QA 2PL0A 3OS3A 3QYZA 4L8MA 4AF3A 4C0TA 4YJUA 4KUJA 2XKEA 1XH8A 3O7LD 5HKMA 1YVJA 5EDPA 3OOGA 4ACHA 3TT0A 3VUKA 5H9BA 3PLSA 3W2SA 3NSZA 4FUYA 1M17A 2C30A 4RIOA 2JBOA 3AMAA 3RPYA 4E4LA 1UA2A 5TR6A 4DT8A 4MF1A 4QP7A 5L2WA 4DGNA 1CDKA 5CVGA 3POOA 4FSMA 2YJRA 4GT3A 4J8NA 4A9TA 4X2GA 2QOBA 4XG6A 2UZEA 4BCIA 4KIOA 3LLTA 3LXKA 3A7JA 4YTHA 1YI3A 3EFLA 2XM9A 5AP5A 4F0IA 5BUJA 3NUXA 5HG7A 2QOQA 2OSCA 3C13A 2B1PA 1GOLA 4OBPA 4QPSA 4ZJVA 4YZMA 4YJNA 4FSWA 5HNIX 4YZ9A 2JKMA 1VEBA 4K9YA 3LFNA 4G3DA 4WKQA 3T9IA 3PY1A 2WIPA 4LMNA 2CCIA 3ZHPC 3N9XA 4MCVA 5HCYA 2Z60A 4GMYA 4BKZA 3NUSA 1UKHA 2UZVA 5I9WA 2RF9A 4C4GA 2GS7A 3FKNA 3VNTA 3NW5A 4LOPA 4G3EA 4M97A 3Q2JA 4Y95A 4ZTQA 4CYJA 5IPJA 2IW6A 3EH9A 2KTYA 3BLQA 2YLFA 3JUHA 5HZNA 3IOPA 2R7IA 1TQPA 2ACXA 4O91A 4EOJA 4ITIA 3COIA 2OK1A 2JIUA 3P78A 4DINA 3EKKA 4OTIA 3OOMA 1PKDA 1PXKA 1GIJA 4JX3A 4FV2A 5I9ZA 3F7ZA 3SQQA 3DDQA 4BCOA 4WUAA 4AE9A 3QKKA 2XYNA 4BVUA 3MVMA 4FTIA 5GIPE 3VS6A 2ZAZA 3FMEA 1M52A 4TWCA 4DT9A 2WU6A 5ETAA 3TV7A 4NEUA 1BYGA 5L4QA 5AR3A 4YLKA 2GNHA 3ANQA 3OCTA 3RAKA 5FD2A 2XKDA 5I9VA 1ND4A 2XNMA 3ORMA 5A54A 4DE4A 3HV4A 4C58A 4IX5A 4R5SA 5M44A 2CHLA 3D5WA 4YJPA 3P7AA 2ITWA 4DEIA 3EIDA 4CCUA 4QRCA 4AA0A 4L42A 3EN6A 3FY0A 1Q3WA 3NNXA 3ZONA 4IFCA 4WSQA 4O0WA 3HGKA 4IVBA 2IZUA 5I9XA 3QWKA 2X81A 4LI5A 5H8GA 3UIBA 3VBXA 1FOTA 1Q99A 4RPVA 4C61A 2W1GA 4PMTA 4YNEA 3MB7A 3QCSA 3Q4ZA 1V0PA 1NXKA 3EHAA 5DVRA 2BRHA 5AR2A 5HE0A 4C2VA 5BNJA 2XVDA 4USDA 3OW4A 5CSXA 3DY7A 2GU8A 2Z2WA 2QHMA 3QQKA 1OPJA 3QQJA 3G5DA 2HAKA 2R3MA 4TWOA 3RPRA
chains in the Genus database with same CATH superfamily
3VJOA 2ETMA 3FC1X 2HW7A 4PPAA 3T9TA 5L2TA 5AP2A 2JDVA 3NYNA 1JKLA 1YRPA 2JIIA 2JKKA 3JVSA 3WZUA 1ZY4A 3UYSA 3DFAA 2F2CB 2PVMA 3KQ7A 1Z5MA 4L44A 1UV5A 4RX9A 5H3QA 3PVWA 3SXRA 4N57A 5E9EA 5ANDA 3VUTA 2O63A 4BIDA 3V04A 4F09A 1OKZA 2FYSA 1H26A 3ENHA 4KKHA 3PE1A 4CT2A 2VTHA 2W06A 1V0OA 2J4ZA 1DAWA 4BTMA 1SNXA 3QX4A 2WOUA 4AQKA 5IA5A 3ULIA 2HWPA 1O9UA 4X3FA 3VS1A 2ERKA 5DRBA 4J98A 3QZGA 4TYHA 2BIKB 4QMXA 4RJ4A 5I9YA 4FOCA 3NW6A 3JS2A 2FUMA 4BHNA 2R3OA 4OTHA 4ASZA 4EK6A 3G6GA 4Q5EA 4AZWA 4RZVA 3DFCB 2IVUA 2Y7JA 4FNYA 5DRDA 4ZJJA 1BLXA 2JGZA 1H0VA 3FQEA 4AW1A 4W4VA 4CTBA 4EZ5A 4CEGA 4F4PA 5AIRA 3KVWA 4UZHA 3C9WA 4P4CA 2BIYA 3TV6A 1BUHA 3AQVA 4BY9E 4B6LA 2GS6A 2Q0NA 3UPXA 1PXPA 3KF4A 3CKXA 3C51A 4F1OA 4KD1A 3TJCA 5HIEA 3PJ1A 4A4OA 2LGCA 5HBEA 4JBQA 2BAQA 3COHA 2PU8A 4FVQA 4WNKA 1FGKA 5AUZA 4LFIA 1NVSA 5CX9A 3CSVA 4A07A 3V3VA 4ANLA 4LGHA 3QKMA 5ANGA 4LM5A 4RJ8A 2Q83A 4FEXA 2HYYA 4G9CA 2ZFYA 1B39A 1ZMVA 3OWPA 5TT7A 1LUFA 2C6IA 4JQ8A 3OCSA 3QTZA 3QQFA 3FPQA 3TIYA 4PDOA 4A9UA 3C4ZA 4UX9A 1UVRA 4XCUA 3KULA 4HOKA 5GZ9A 4J7BA 3R83A 4I3ZA 3P5KA 5L8LA 2R3NA 4I5HA 4AZTA 3EQGA 3PVGA 4BGGA 2BVAA 2ZV2A 4C59A 1SZMA 2Z02A 4D0WA 4IWDA 3LFQA 3NIEA 2XNEA 3PXFA 2P0CA 2R3QA 4I93A 4OTQA 5GJDA 5LMAA 4D28A 4F99A 4D58A 5K4IA 5KMIA 1QCFA 3MGYA 3OY1A 2X9EA 3HUCA 3W0PA 3EL8A 4WA9A 3DBFA 4JIKA 4GKHA 2UZWE 4GIHA 4G2FA 5EKOA 4RVKA 3S3IA 4ACMA 1RE8A 1WVWA 3V5TA 4I94A 4BBEA 4B9DA 2C4GA 3FL5A 4JBOA 4KIKB 2OXYA 4NK9A 2PUIA 1Q97A 1OL1A 5DT4A 3QC4A 5BUIA 3U6IA 3NX8A 3U6HA 4QYEA 4S30A 5J8IA 2PK9A 2RKUA 2X7FA 3BYOA 3FLZA 4HCUA 4Q9ZA 5CEMA 3PPJA 4C57A 1H1SA 3Q9YA 4WRSA 3BLRA 2XK4A 1TZDA 2PVFA 3C50A 3FMNA 4GL9A 2WQMA 3PIZA 5EDRA 3HMIA 3G15A 2G1TA 3HYHA 4DCEA 5HBHA 3UOJA 4JBVA 4O83A 4QO9A 5KZIA 3UOHA 4I22A 2JFLA 3GNIB 2XM8A 2B52A 3TIZA 3ZUTA 4C38A 4YLLA 5D9HA 5GNKA 3W0MA 5BMSA 1Q62A 4B0GA 1PXOA 3VBVA 2IZTA 4O4FA 5EHYA 2C5NA 5AEPA 2O8YA 3CJFA 3QLFA 4O96A 4FNWA 5ANJA 3VBYA 2XB7A 2J51A 4AP7A 3U4WA 4YTCA 3HV7A 3C0HA 4FKOA 1J91A 3OROA 3DZOA 4FV4A 3HMNA 1AQ1A 1REJA 2AYPA 3LCOA 3W8LA 4TPTA 4YJTA 3LQ3A 2PUUA 5ETFA 4O38A 4BIEA 4EZ3A 3NCZA 4JS8A 3DTCA 4L43A 5CSWA 4HCVA 5AUWA 3VF9A 5JT2A 1YOMA 5L6PA 4G31A 3F7WA 4O82A 2IVSA 4YUQA 4I4EA 3SOAA 3ZS5A 4KBAA 3LZBA 2ZJWA 4WNOA 3CEKA 1P4OA 2B4SB 4ACCA 2VTRA 1OUKA 3MPMA 4G3FA 3GC7A 5T68A 4BYIA 5AJQA 5J9ZA 3ZLWA 3ORPA 4QYYA 3NR9A 1OGYA 3VUHA 4PP9A 2F7EE 3PPZA 5EDQA 5EQYA 3C4EA 5K5NA 3MWUA 2QG5A 1PJKA 3KRLA 3NGAA 3I5NA 3HA6A 4LRKA 2XK6A 3OFMA 3RM7A 4C3RA 5DMZA 1GAGA 2EB2A 4IAYA 4F65A 3BYMA 4CV9A 4BDHA 4MWHA 4QP3A 3AD6A 4BZOA 5BVOA 4EEVA 4NM0A 4O7SA 2FB8A 3RVGA 4ZY5A 3C1XA 4FIGA 4QDEA 3D15A 3FUPA 1H1QA 1PXMA 2NO3A 4O21A 4D2TA 3F6XA 3GU8A 5D7AA 2CKOA 1P4FA 3FHRA 3GP0A 3SDJA 3EYGA 3BHTA 4IM2A 1J7UA 4BI0A 4EH3A 1A06A 4O7LA 2C6EA 3OZ6A 4W8EA 4HW7A 5HO7A 3JR1A 4GEOA 2RFSA 2PZRA 4Y72A 4WO5A 3TM0A 3UTOA 1XH4A 5IA4A 3E3BX 5HESA 1JKTA 2JC6A 3I79A 3QCXA 4IQ6A 3MV5A 4UALA 3OTVA 3RHKA 5IG1A 4II5A 3FWQA 5K9IA 4YURA 2CNUA 2GTNA 3CPBA 4U9AA 4DN5A 4WSYA 4QP4A 3TNWA 4USFA 3ROYA 1ST4A 3MVJA 3DJ6A 2W1CA 3P86A 1YHVA 3FMJA 2HK5A 3QCQA 1MUOA 3R1YA 2YM3A 3QD3A 4UB7A 3WZJA 5LVNA 4V01A 4K11A 4FG9A 4CMOA 3QX2A 4NIFB 3PIYA 4EK8A 1G8AA 2CNVA 4E20A 3R7IA 2WQNA 3KMMA 3QL8A 5DT3A 3IO7A 4NW5A 4IVAA 2WMUA 5EM5A 2UVZA 3LIJA 3V5LA 3CKWA 2RG6A 2ZM1A 5K0XA 2CNQA 5AR4A 3RK5A 4KWPA 3TACA 2OZOA 4PMPA 2GMXA 5EYDA 3FZRA 3EQBA 2NNWB 1T46A 1TQIA 2BILB 5BVDA 2ITYA 5AUTA 1STCE 3UP2A 4U3ZA 4QOXA 4YSJA 2YJSA 3VUDA 4JIAA 2YWVA 5CI6A 3IS5A 4S33A 5CEOA 5CF4A 1ZYSA 3OWKA 3LFBA 2YEXA 3VS4A 1OPKA 2REIA 3AMYA 3AT2A 3EZVA 4L00A 2WO6A 3UGCA 3W55A 4Z7HA 3EN9A 4M0ZA 4KA3A 3SW7A 3KCFA 2XIYA 1PMNA 4XUFA 4KNBA 4Y5QA 4A4XA 4AAAA 3C7QA 3NYXA 5LVPA 5CZHA 3Q6UA 4J53A 2V62A 3DJ5A 4C37A 3PJCA 1H00A 1B38A 3GCVA 1MP8A 5KKRB 2WMXA 4QMUA 4ASDA 1H24A 4G17A 3NNWA 3NNUA 2WMAA 5FTGA 2F49A 4FG7A 3KU2A 3Q9ZA 4ZY6A 1JVPP 3G51A 3GU5A 3KRJA 3QKLA 3F9NA 3FLWA 3UO4A 1J1CA 4C33A 4XYFA 4YHJA 4TYJA 2VWWA 4QTEA 4J52A 2Z8CA 4IWOA 4FTKA 1RDQE 3U55A 3GGFA 2PMNX 4JDKA 3WIGA 3GFWA 4XS2A 3M42A 2VTLA 4GG5A 3GU4A 5E7RA 2XCHA 3TTJA 4ZSAA 4GUEA 4HPUE 3QZFA 5IA1A 4W8DA 4CQEA 3E8NA 3B8RA 2UW9A 1CSNA 1PHKA 3W2QA 3L8VA 3OBJA 4X3JA 4YMJA 4RX5A 3EMGA 5H8EA 4V04A 3AC3A 2EWAA 2KULA 2NP8A 4HZRA 5AP6A 5HG8A 4FGRA 3UDSA 3GU6A 4O0VA 3B2TA 3W0QA 3R8MA 3QTSA 5KX8A 4DGLC 4WG5A 3HRBA 4ZLYA 2PVLA 2WKMA 2YM8A 3DKFA 2XNBA 1R78A 2V22A 3QXPA 2V7AA 4JLCA 4B8LA 2EXEA 4XRJA 5I4NA 4RFYA 5EQEA 4U44A 3UDTA 1OUYA 3O96A 3D9VA 4FMQA 3A7FA 3I5ZA 3OBGA 4YTFA 2C68A 5JQ8A 4ZSGA 4PL3A 3PDTA 5TO8A 1VYWA 3L1SA 2QNJA 3UDZA 1KE7A 2R3KA 4O22A 2B53A 3KY2A 3MYGA 4EYJA 4I92A 5IQHA 4NFNA 3R7OA 2VTJA 4NIFA 5EFQA 3IK3A 3COMA 4JAJA 4H1JA 3O5AA 2B9IA 4FV1A 1PXIA 4GU6A 2HZ4A 3IKAA 2XMYA 3KKVA 4KIQA 3P79A 4E4NA 2XANA 3L8SA 2JIVA 5DN3A 1BX6A 3FL4A 3FZTA 1JBPE 3TNPC 2YCQA 1ZOHA 5IEVA 1XWSA 1G8SA 4EQMA 2YM5A 5KKRC 4EHVA 3U51A 2QC6A 3RPVA 3R1SA 3ZRKA 3CD3A 5KNJA 4UXQA 2XEZA 3VQHA 4HVSA 1SM2A 5CEQA 5CSHA 4RIXB 2OJFE 2ZDUA 3CJGA 2PTKA 2YM6A 4BKJA 2BRBA 3PSCA 4IHPA 2P55A 4CD0A 4ONAA 1PXJA 1W2FA 3SG9A 5IQCA 4U45A 4YU2A 2BMCA 4RFMA 5E8UA 4QMQA 5J7BA 1PYEA 1XBAA 4EK3A 4YR8A 3PXQA 4HYHA 1OKVA 5AX9A 3ATTA 3NFGB 5IQAA 4BCMA 1XR1A 2FH9A 2Y6OA 5D1JA 5G1XA 3CTQA 5FQDC 3ORKA 5BYYA 4O7WA 2E9OA 5FEEA 3TKUA 1CM8A 4IVDA 3L8PA 4WUNA 4RVLA 4UWYA 1YXTA 4O84A 2XNGA 4BR3A 3EQRA 4ZS4A 1UU8A 1IAHA 2ZV8A 4JRNA 3S95A 3WE4A 4O4DA 3KGAA 4BCGA 3MIYA 1OL7A 2I0HA 4PPBA 4CFWA 3FMDA 5E90A 3FYJX 3EFKA 3ZEPA 3R04A 1Y6AA 3LFSA 2ONLA 4KIPA 2VRXA 5FEDA 1NY3A 4UWCA 4YJOA 3EN4A 3DXNA 5DR2A 4UZDA 3ZDUA 1Q8ZA 1SYKA 4NKAA 4PDPA 1SNUA 3DQXA 3HECA 3ZO2A 4AW5A 3SXFA 3NMUF 4FOBA 1PXLA 2UW0A 4QQCA 4BHZA 4XG8A 5M07A 4R78A 4MD7E 5HCXA 5AFVA 5E8ZA 4O7RA 3DK6A 2DS1A 3A8WA 3PWDA 4DHZA 2BDFA 1FPUA 3PUPA 4L67A 4MEDA 4CKRA 3EWHA 4QMZA 3DQWA 4O0SA 5EK7A 5FUTA 2OZAB 3F5PA 5IKWA 4ERKA 3CY3A 2CN5A 3IGGA 5J5TA 1JSUA 3PJ8A 4S34A 3QZHA 2WZJA 4XH6A 1NVRA 4QP8A 2ZVAA 4FIEA 5KMLA 2R64A 3UC4A 4JDIA 1PXNA 4BYJA 3HUBA 4IM3A 3SV0A 2VX3A 2W1IA 4JDHA 2XA4A 5FRIA 2XH5A 3OG7A 4FKPA 2RFNA 4QT1A 1Y91A 1ZWSA 3FXXA 4WOVA 4GT5A 2O64A 2WMSA 4YJSA 3SX9A 5HLWA 5LJJA 2YM7A 3QD0A 4BWXA 3R73A 1YXXA 4IZ7A 3R9DA 5EI8A 1LP4A 4IWQA 4DBXA 5J95A 5EYKA 5J79A 2W17A 2OJ9A 3W2RA 2C1AA 2JFMA 2JITA 3BBWA 2YN8A 3D7ZA 1U4DA 4C4EA 5JFXA 2XK3A 2WOTA 5B2KA 3R00A 2G2IA 2IVTA 4EH8A 4KINA 2XRUA 4UMRA 5HBJA 1BI7A 5LMBA 4U8ZA 5ANOA 5AM6A 4AN9A 4EOSA 4EBVA 4FSNA 1R3CA 4GU9A 3KXHA 3K2LA 3UOLA 5ICPA 5CAQA 5K0KA 4ZS0A 2BDWA 4YNOA 5AUVA 1FINA 3DLSA 4YLJA 2YACA 1TKIA 4YTIA 1TQMA 4USEA 3IW8A 3V5JA 4PNIA 4QDVA 4H36A 3QRJA 3TUBA 3LJ1A 5E1EA 2F2UA 1SVHA 3OW3A 3T3VA 5CY3A 4BTJA 2OWBA 3G6HA 2GQSA 2XBJA 2OJJA 3ZH8A 1GNGA 4F08A 4ZSLA 4PDSA 4YO6A 3R9OA 4CFNA 4F78A 3AT3A 3E7OA 2OG8A 4C2WA 4F7NA 2OXXA 4G3CA 4EL9A 5A4QA 3FMMA 4XP0A 4NM3A 3ODYX 4ZEGA 5JN2A 3ITZA 1VLRA 1VJYA 3OMVA 3M2WA 5AR8A 3O71A 2OFVA 2JBPA 2X9FA 2QO9A 4YP8A 4WG4A 3QA0A 5DYJA 5T3QA 4BZDA 3E8CA 4AXDA 2BR1A 4PP7A 5IDPA 4EHZA 2J9MA 4OT5A 4M3QA 5HLPA 2WEIA 1YOLA 2E9PA 3JPVA 4IB1A 4YHTA 2UZBA 3KCKA 3LVPA 4E1ZA 4XV1A 2ITZA 3FEGA 3EN7A 2QR8A 3FMHA 4V05A 3BV2A 4OT6A 4C34A 3R63A 3MPTA 4DFYA 5L2IA 1IAJA 3I7BA 5AR5A 5IU2A 4AS0A 2BKKA 5AAFA 2I6LA 2IG7A 1PRYA 1BKXA 4F70A 2R3JA 2XP2A 3V8TA 2CDZA 3R1NA 4DAWA 3LQ5A 4CLJA 3U4UA 2XJ1A 5EM8A 1Y8GA 3IDBA 3BELA 4RIYA 3NYOA 4I5PA 4GRBA 4BCKA 5HHWA 4KAOA 2UW7A 4PRJA 3FLQA 3NEWA 4KS7A 4CTCA 5AUYA 4UYNA 4RZWA 2R3IA 3H0ZA 3K54A 3QZIA 1GZKA 3IW4A 3MW1A 5HICA 4EKKA 4GIIA 4A06A 3DNDA 2VTTA 3MS9A 4P5QA 5B2LA 5C8KA 2B0QA 5BYLA 3F5XA 3QD4A 4PL5A 4EOKA 5LMKC 3AMBA 3CLYA 1JLUE 2QVSE 4RVTA 4YPDA 1XBBA 1H25A 2VAGA 4ZP5A 3SW4A 4GK3A 3E8DA 4KSQA 4QTCA 4BBMA 4FTMA 3NIZA 2YIXA 3DV3A 4TL0A 2QR7A 5M06A 4DGOA 5D11A 1R0EA 2H9VA 3DCVA 4JG8A 3UVRA 2UW5A 1JAMA 5KHWA 2VO7A 1H1WA 4KBCA 2C0OA 2RIOA 2PVNA 2HCKA 4FTOA 4IH8A 3FZOA 1YDTE 4RIXA 4EH7A 3I6UA 3ATSA 4FUXA 1WBVA 2J0KA 1H08A 1W7HA 2ZM3A 3LXNA 3MDYA 3TZ7A 3A7HA 5JGDA 4U42A 3NCGA 4Z9LA 3B2WA 4E4MA 4FEQA 5K4JA 2BTRA 2GNJA 4NTTA 4UMTA 3U8WA 2WMQA 2OJIA 4AG8A 4FSQA 2VO3A 2WTWA 4K1BA 3BGZA 4KB8A 5HE1A 4LUEA 2ITOA 1GY3A 2R4BA 4TY1A 3LCKA 4ZZMA 4CFUA 2JD5A 4RVMA 5F94A 2QODA 1WBPA 1ZYJA 4APPA 5F9EA 2QOCA 4AOJA 4YHFA 2QU5A 3F69A 5DLSA 4W4YA 5AA9A 3BWFA 1P2AA 1MRVA 1HOWA 3F61A 4V0GA 2BALA 2WELA 2HW6A 1W98A 4FL1A 1J1BA 4ITHA 4BI1A 3QTWA 1ST0A 4DGGA 2GDOA 1WCCA 3R9RA 1Q8YA 3VVHA 3MBLA 3C4CA 4L3LA 4UBAA 2CLXA 2WIHA 4G5JA 2J5EA 4K6ZA 4R5YA 4FTUA 3UDBA 4O7NA 4IX4A 2YZAA 3GXLA 3N51A 3AG9A 4B7TA 3LJ2A 5HD7A 4HYSA 4FSRA 4M12A 5AUXA 3R8UA 3S0OA 2OLCA 1O6YA 1M14A 4JMQA 2WTCA 2R3GA 4XG2A 3TI1A 5CAOA 2PZYA 3PJ3A 4O0TA 2PMOX 4TT7A 4HYIA 3MIAA 3R7EA 2GHMA 2OXDA 3HDNA 1H4LA 4OBOA 5CENA 4ALUA 4BCJA 1E1XA 5IA2A 4ID7A 1YXSA 1PF8A 1OM1A 5HOAA 5HIDA 4EK5A 4EHEA 5B7VA 4FIIA 2YDIA 2XK8A 3I7CA 4F6WA 2I0EA 5EHLA 4AZEA 3IQ7A 4WD5A 3KXZA 4FJVA 5EG3A 2OF2A 2XNOA 2Y6MA 5CS6A 4IZ5A 4R7HA 4BJJA 2YIRA 4WBBB 5M56A 4DHFA 4BZNA 5CSVA 1HCLA 4D9TA 3PY0A 3IGOA 2A1AB 4XHKB 2A98A 3VW6A 4DHIB 4D5HA 4LYNA 3BX5A 5F20A 2PPQA 3Q4UA 4JNWA 4ZTSA 2BUJA 2E2BA 2QLQA 3WF8A 4R3RA 2HZIA 4FODA 1T45A 2WNTA 1WBTA 2YHVA 3BU5A 3C0IA 4Q5HA 5EM7A 4TZRA 2JDRA 4P2KA 1S9JA 4JQ7A 3SD0A 3RM6A 4F0GA 4FYNA 5DH3A 3EOCA 4QEBA 2I7QA 1Q8UA 2I40A 2OBJA 3FZ1A 3L9MA 1H1RA 2QONA 3FDNA 1OITA 3MESA 4YZBA 3ORTA 3OY3A 1QPDA 1OBGA 5M4UA 1GZNA 2BZHB 1XH6A 5D7VA 4IC8A 3HV5A 3TZ9A 4FIHA 4AACA 2GNFA 4HPTE 3ZC5A 3ZFMA 5IH5A 1R39A 5BX0A 2X1NA 3R7VA 4XG3A 1U5RA 3I0QA 1GIIA 3ETAA 3Q32A 4AWIA 1OI9A 1JWHA 4GJ3A 4ZLOA 3T8OA 3CD8A 4DCAA 4I4FA 4BCHA 4OTGA 4G9RA 4LGDA 2QLUA 2J2IB 5LQFA 4AGUA 2C6KA 3IPHA 5LVOA 1ZLTA 3LCDA 3QAME 3BWJA 3S4QA 3AD4A 3QTXA 4C02A 4BDCA 2J7TA 5DE2A 2ESMA 3ACKA 3JXWA 4PUZA 4Y85A 2V5QA 1ZY5A 4RJ3A 1ATPE 3NRMA 1KE5A 5KO1A 3W16A 2VU3A 4O7ZA 2OI4X 2YCSA 2VN9A 2A2AA 3P23A 4L7FA 4QMVA 4FSYA 4DDGA 4D2VA 3V51A 5GINE 2JKOA 4JBPA 2UZNA 2WTJA 5ETIA 3LMIA 2VTNA 1F3MC 1MRUA 2QU6A 5HVKA 5JFVA 2W9FB 4FI1A 2QOHA 2ITNA 3ENMA 4FKQA 5HORA 2GNIA 4R7BA 5CU2A 3H9OA 2ZB0A 4FT9A 2AUHA 3DNEA 3IONA 3ZZEA 1XBCA 4X2FA 3QF9A 1M2PA 2W4JA 1KV1A 2H34A 1KE9A 4E73A 1Q41A 3MJ2A 2VWXA 3C4XA 4YBKA 4ZOGA 2CSNA 4HYUA 2C3LA 3E8EA 3QYWA 4FT5A 4IIRA 4CFVA 4XV2A 2X4ZA 4D9UA 5EM6A 4YZNA 5AA8A 5C01A 3KXNA 5JSMA 3KK9A 2VV9A 3ZLSA 4L52A 5EKNA 3N4TA 3SHEA 3P5JC 2YITA 3OXZA 4RFZA 3ZFYA 4ZZOA 4FVPA 4ANQA 3ZSIA 3D7TA 2VNWA 2WD1A 4FR4A 4MD9E 5A6OA 4CVAA 5IDNA 4FSUA 2C3KA 4DG2E 3QHRA 3UVPA 5GZAA 3ZXZA 5HTBA 2XAOA 2PZ5A 4CCBA 2OH4A 3WZDA 3Q9WA 3DTWA 5FBOA 3S2PA 2BHEA 4GK2A 3EQCA 3GOPA 4ENXA 3AGMA 3DS6A 4RWJA 4XNEA 2X2KA 5EH0A 2R3FA 4Q9SA 5DFPA 4UY9A 4L3JA 4L46A 2YABA 3FLSA 4W4WA 3OT3A 2WMRA 2Y4IC 4TN6A 3OD6X 4O7VA 5AX3A 1M2RA 5LCKA 1I44A 2PSQA 4FKTA 4EQUA 3PTGA 3IW5A 2PMLX 4APCA 1F5QA 4FT3A 4OAUC 3C5IA 3D5UA 5JMSA 3BE9A 1DI9A 1W83A 2J6MA 3LPBA 3QC9A 3R8PA 3ZMMA 2B55A 3SXSA 1XO2B 2PE1A 3FQSA 3MPAA 1VZOA 4FTJA 4C36A 2VWVA 4YC6A 4RWIA 5IMXA 2X7GA 4TXCA 3RTPA 4C4FA 4M67A 2HXLA 5F4NA 2C0TA 3BYUA 3DT1A 4O0RA 5FP5A 4DH7A 4FG8A 4FV8A 3T3UA 3FC2A 3E3PA 4ENYA 4I6HA 5E8SA 2JAVA 1OB3A 3QQHA 4ZZNA 3LHJA 4DLIA 2WMVA 3KN6A 2PY3A 3PRFA 5FWKK 2XF0A 1OPLA 4QMOA 4LQMA 3AKKA 1GIHA 5IUHA 4PMSA 3D5XA 5M4IA 2UW6A 4FTLA 3HRCA 5I3RA 2YIWA 3TKHA 1XH7A 3OHTA 2YERA 4I0TA 4CMUA 3FHIA 4FEWA 4OR5A 1FVTA 5E8WA 3ZU7A 1ZOGA 5A3XA 4HZSA 3VS7A 4C4HA 2ETKA 4K33A 2BFXA 2X8EA 4HJOA 4IVCA 4D4YA 4EJ7A 5IQGA 3LFEA 3UNZA 4DEBA 4BJJB 2P3GX 3NNVA 4IW0A 5BVEA 3VWAA 2A19B 2W9ZB 3DBEA 1U54B 2XBAA 3O50A 1PKGA 3UG2A 4E6CA 2XK7A 3DPKA 4FA2A 3SRVA 3G9NA 3WARA 3DBDA 4XMOA 4D4RA 3ML1A 3R8ZA 3L9LA 2VUWA 3BHUA 2R2PA 3R8LA 4F7JA 5B2MA 3RGFA 4OAVB 4DH5A 5HQ0A 2XUUA 1QPEA 4CQGA 4RGJA 4O7TA 3DK7A 5L8JA 2WAJA 2VNYA 4J1RA 2CJMA 4F0FA 5IA3A 4ARKA 1VYZA 3A2CA 4MXXA 4IB3A 4WNPA 4ZJIA 1M7NA 1A48A 5H2UA 4GSBA 2JDOA 2P33A 3RKBA 5C26A 5CT7A 2R3PA 3F3ZA 5DIAA 5D10A 4ZTNA 5CNNA 3MN3A 4O1OA 4BI2A 3UO6A 2R3LA 1KE8A 5FP6A 4ORKA 4A9RA 3FBVA 3HVCA 2O0UA 3LXLA 5J87A 3CQEA 4ZY4A 3BE2A 2I0VA 3F2AA 1ERKA 4O86A 3FMLA 2BAKA 5LARA 4I21A 3UQGA 3VQUA 1O6KA 5D12A 4QP9A 2ITXA 5GJGA 3H9FA 2GHGA 1OL2A 5DI1A 5I5ZA 4EOLA 5HNBA 4PNKA 2UW3A 2Y0AA 3EZRA 1AD5A 4CRSA 1XKKA 5GZ8A 3K3IA 3LAUA 3QUPA 5HX8A 3WIKA 2ITUA 2O3PA 4X0MA 5JQ5A 5L6WL 2G01A 1JOWB 5FM3A 4CZTA 4QNYA 5KMKA 4IZYA 3UBDA 3M1SA 4RLLA 4DFZE 4NM7A 1G3NA 3E92A 4JRVA 4DGMA 3EQHA 4XLVA 5JGAA 2WTDA 3LFAA 5CVFA 4N6YA 1WVYA 2WEVA 4GCJA 2Z7QA 4I6QA 4IJPA 3R2YA 5E8XA 4O2ZA 5C8NA 5KBRA 3CQUA 3PXRA 3EKNA 2VTSA 4LUDA 5IQIA 3HL7A 3G33A 2VX0A 3AC2A 5HCZA 3EQFA 2BFYA 4QMYA 1F0QA 4MXOA 1WBOA 3RNIA 4E5AX 3KK8A 4N0SA 3QRKA 4HGLA 3Q9XA 3REPA 4YC8A 1ZZLA 4YGAA 1G5SA 2C47A 3CE3A 2EU9A 4FZ7A 4ZTHA 2PUPA 1WFCA 1Q8TA 4PPCA 3KC3A 4AT3A 4OUCA 1UNGA 3BHVA 4LL0A 1REKA 1URCA 3OVVA 3MVHA 2C3JA 5CU3A 2PUNA 1OKYA 4MVFA 3DU8A 4HVDA 5KBQA 1H0WA 3NUUA 2RGPA 5AAGA 4A9SA 3DDPA 4AA4A 2XARA 3UMWA 3P0MA 5I9UA 4U5JA 4DFUA 4FT0A 3ZO1A 4NM5A 5FXQA 1SVEA 2P2IA 1URWA 3ZBXA 5C8MA 2PE0A 2BPMA 2X39A 3O23A 4QP1A 3CXWA 4XJ0A 4OGRA 3RZBA 3BEAA 4I5MA 2WPAA 5JFWA 4NL0A 3N4UA 4GFOA 1EH4A 2YDKA 4RSSA 5FM2A 3R8VA 3TNHA 2QKWB 1WAKA 5KHXA 2XIKA 3O8PA 4RA4A 3IDCA 3W8QA 4MX9A 2Z7SA 5CTPA 3RCJA 4D2SA 4LDTA 3DAEA 1P14A 3G9LX 4KRCA 3R7YA 3LCSA 4IACA 4BF2A 3CGOA 4D4VA 5C4KA 2YWPA 1V1KA 3OUKA 5HLNA 3VUMA 5FXRA 4ZMEA 4DTKA 5C4LA 2QOKA 1AGWA 5KMJA 4GKIA 5HO6A 1J3HA 4IM0A 2X8DA 5CAUA 4W9XA 3D14A 2XK9A 4G5PA 5F95A 5K3YA 3JVRA 4ZIMA 3ZUVA 3GC0A 4BWKA 2YAKA 3NS9A 4A4LA 5HU9A 1QPCA 3O7LB 5GIOE 2NYAA 1VR2A 1WBSA 3F3WA 5HGIA 3Q3BA 4MNEB 2OZAA 3FV8A 3VBTA 4C8BA 3TDVA 3DKCA 3TKIA 4EWHA 2CKPA 3D5VA 4CG9A 2BAJA 5KMMA 1YHSA 4I41A 3HZTA 5AR7A 3VN9A 4AGCA 4I5CA 4RBLA 3MI9A 4WHZA 4AOTA 4ANOA 2B7AA 3SLSA 2CPKE 2WB8A 3FKLA