1GZOA

Structure of protein kinase b unphosphorylated
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
296
structure length
271
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Kinase
molecule keywords RAC-BETA SERINE/THREONINE PROTEIN KINASE
publication title Molecular Mechanism for the Regulation of Protein Kinase B/Akt by Hydrophobic Motif Phosphorylation
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 271
sequence length 296
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1gzoA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1gzoA02
4LQMA 4R3CA 2BIKB 3JR1A 3Q2JA 4UEUA 5IQBA 1F5QA 4BGHA 1ZOHA 1K3AA 3V5JA 4YHTA 4CSVA 3EZRA 3QUPA 4FKLA 4NZWB 4J98A 2OZOA 2VTOA 3WF7A 3UGCA 2IZRA 5TOZA 2IJMA 2WXVA 3EIDA 3QCXA 2X4ZA 2YCSA 3D2KA 4G5JA 5HBHA 3VAPA 2OZAA 3HA6A 5ETIA 3C0GA 3TKUA 5E8XA 2J5EA 3UYSA 2BROA 3LFCA 4RJ7A 2VV9A 5HVJA 4AA0A 4X6QC 3K5UA 4YTFA 4F70A 1FMOE 2C3LA 4BGQA 2ZDTA 4WBBB 4EQMA 2C6KA 3PDTA 2CGXA 4TYHA 3QX2A 3Q4TA 4UXQA 4CLIA 2XK6A 3KULA 5FTQA 3A8WA 3P5KA 1TQMA 4RMZA 4J53A 2X39A 1Q8UA 5CYIA 4FK6A 2YERA 3ZO3A 4HVDA 4M7IA 4U42A 5CF4A 4KKHA 2VNWA 1H28A 5J9YA 1YVJA 3P23A 3VJNA 1LR4A 5HNBA 5GIOE 2F4JA 4NWMA 4PTEA 4GIHA 4QMVA 3V6RA 2GS6A 2QG7A 4G3GA 4BC6A 3VJOA 1BUHA 1ZRZA 4JQ8A 3Q9XA 3QRUA 1JSUA 4O1PA 4Y5QA 4BTJA 2W17A 4ERWA 2H9VA 4Z9LA 4F6WA 4RVMA 5JFSA 4QP9A 4RVKA 2YZLA 1PMEA 3GCPA 3BE9A 4PPAA 4BDEA 3GC9A 2XH5A 4ZY4A 3QCSA 1ZWSA 4ANBA 4ANLA 1XH4A 4GU9A 3MPTA 1Z57A 4YSMA 2EXMA 3KVXA 2OF2A 5HE3A 4I41A 4BFMA 4ANQA 2UVXA 3WZKA 3JPVA 4E6QA 1U54A 2ZB1A 5DEYA 2B9FA 3RHKA 3TTIA 4Y73A 5EYCA 3EL8A 4FVQA 3DLSA 3Q5IA 3POZA 3AQVA 4GMYA 4IVDA 3R21A 5KMNA 3T9TA 3FXXA 3QZFA 2XRUA 3A99A 4FNWA 3VS4A 4DH3A 3SOAA 5C8NA 2WTKC 2YWPA 3HP5A 4FNYA 4O6EA 1MQBA 1B39A 2YEXA 3PVBA 2UZVA 1Q3WA 3R6XA 5L2IA 5DYJA 2BILB 2E9UA 2VWWA 4M68A 3JVRA 4AOTA 3LE6A 4BI1A 4J97A 2B54A 3FL5A 4G17A 3QYWA 4YZ9A 3RBWA 4AN2A 4ARKA 4OTGA 3DDPA 5DIAA 5IA2A 5ITAA 3IG7A 1YDRE 4CYIA 3VHEA 4D2RA 3NCGA 2XMYA 3WYXA 5ACKA 5J7HA 4WSYA 2EVAA 4IB3A 1B38A 5HTCA 5FUTA 4B99A 1Z9XA 2WTDA 2KULA 4CNHA 3OY1A 3BU5A 3NW7A 3NW5A 4K8AA 4DH8A 4UMRA 4NIFA 1PMUA 2ZMCA 3BGZA 1K9AA 4F7SA 5BVNA 4K1BA 1Q99A 3ENHA 4C59A 3VS1A 3WZDA 2W1CA 1YHVA 2FB8A 3DK6A 5A54A 4DE4A 4EZ3A 5FM3A 5BYLA 5C4KA 3ALNA 4FSYA 2I0HA 3L9LA 4EK8A 3TNPC 3K3JA 3DXQA 3CIKA 1JVPP 1H24A 1Y91A 4IC7A 4C0TA 4C4IA 2UVZA 3UMWA 3ITZA 4M67A 4O38A 5E8UA 3TUDA 4LRJA 4F9CA 4NM0A 4RA5A 2JIUA 2OJGA 4NEUA 1ZARA 5IUGA 4YC8A 2VX0A 3F3TA 2PZ5A 2G9XA 1Q97A 3F3VA 2QOCA 4QYHA 4QYYA 4NM5A 3LZBA 5ANDA 3UJGA 4ENXA 2QD9A 4IXPA 4TW9A 3RK9A 2PVMA 1YW2A 2O65A 4GEOA 5AM7A 4E4LA 4YTHA 2XS0A 3OEZA 3RTPA 1Q4LA 3FLWA 2JAMA 3QQFA 4FZAB 1JQHA 4DFXE 5LWMA 3S0OA 4JBPA 2XYNA 4WA9A 4FKVA 4MQ1A 4E8AA 1UU3A 2R2PA 3OY3A 1XWSA 3P08A 3PSBA 2J90A 3S4QA 5TE0A 4U0IA 3BLHA 3FWQA 4AS0A 4O7TA 1R3CA 2OIBA 5KMJA 2IVUA 4Q5EA 5FDXA 4HYIA 2JFLA 4XNEA 2CMWA 2IVSA 4Z55A 2XRWA 1UU9A 2QCSA 4JDJA 3TNQB 2UZUE 4OTRA 3U9CA 4ACGA 4GCJA 4EQCA 4KS8A 2XK8A 3DB6A 4CZYB 2X6DA 3C4CA 5FRIA 4EKKA 4P90A 4ONAA 2XEZA 2B0QA 3EFLA 3GCVA 1Z5MA 2W1HA 4MF1A 4GJ3A 3FSKA 3L9NA 4CV9A 1U5QA 5E9EA 5AV2A 5EW8A 3RCJA 4A9SA 4BB4A 3QHWA 3ZRMA 3DK3A 3RALA 5AUZA 4UZHA 3C51A 4MK0A 4P4CA 3V04A 2CLQA 4XRLA 2PVHA 1BLXA 3D83A 3MIAA 2ITXA 3PWYA 4XYFA 4ZTRA 3ZSHA 4BCJA 4BKYA 3F5GA 3RPRA 5AX3A 3UPXA 5C4LA 4EOKA 3ZLSA 2YDJA 4JDHA 4MYGA 4USEA 4DTAA 1PXNA 3NYNA 3PSDA 3D94A 3SW7A 4YPSA 2PL0A 3K5VA 4RJ5A 5F20A 5KKRC 2W5HA 4G9CA 2VTAA 4GK4A 4U3YA 2QHMA 5CZHA 2VO7A 4Q9ZA 5EKNA 3TTJA 4X21A 5M4FA 2GTNA 3QUEA 4ACCA 4W9WA 4O7SA 2OIQA 3G9NA 3PE2A 3LM0A 2H96A 4PNIA 4FG7A 2HZ4A 5B2LA 4JXFA 4BDHA 2W5AA 4G6NA 4KA3A 5HOAA 3W2RA 3CPCA 4L7FA 4RLLA 3QRJA 2XJ1A 3PYYA 3ZZEA 2W0JA 2F57A 5HTBA 5ICPA 4RJ4A 5I9VA 5M57A 5FP5A 3DY7A 4RC3A 4AGWA 3R22A 4I24A 5J7BA 4JG8A 2HZ0A 3H0ZA 5I3OA 2WGJA 2Z7SA 4Y5HA 3KREA 5AUYA 1AD5A 4CMOA 3MH3A 3IOPA 4FT7A 4U8ZA 5E1SA 4LL5A 4NCTA 3HGKA 1R1WA 3U4UA 4CVAA 3R9OA 4DG3E 3W8QA 4IC8A 4KRCA 5JK3A 4QP7A 1QPDA 1REJA 4AW2A 4APCA 4Y83A 3HV3A 5AP1A 1BI7A 2JKQA 2RFDA 3QQHA 4F65A 4KABA 5CU3A 4EJNA 4D1ZA 5AR5A 1JKLA 4YTCA 4PMTA 1Q24A 3B8QA 4GYIA 1H25A 3RWQA 2BIYA 3VS5A 5BNJA 5HTIA 4GKHA 1JKSA 1YI3A 1BMKA 4J1RA 3TI1A 2C6LA 2VX1A 2XNMA 5ANIA 2B55A 2QR7A 2WNTA 4RSSA 3TUBA 1G3NA 1E9HA 5M51A 3S3IA 1XH6A 4A4OA 2R3RA 1H08A 4IM3A 3UVPA 5F4NA 1GZ8A 3MVMA 2Z7LA 4I4EA 4UMPA 5J5SA 4BKJA 3ZFXA 2GNLA 4IEBA 2PZRA 4XBUA 4N4SA 4B8MA 2YZAA 4RWLA 3PY0A 4OTWA 5D12A 4EONA 4AA5A 2VWVA 5CQWA 1W8CA 5KHWA 4QMPA 3F7ZA 4MXYA 2GPHA 4CMUA 3Q60A 5D7VA 5AADA 5AFVA 3PP1A 4FA2A 3HMNA 2XEYA 4FV6A 4DFNA 4ID7A 3TKHA 4BRXA 3CPBA 3FLZA 4TL0A 4F1OA 1V0PA 5JEBA 4G6LA 4D58A 3R1YA 3P1AA 3FLNC 2ZMDA 3HRCA 3CXWA 3LCDA 3OWPA 3DPKA 2BDFA 2QOHA 3FHRA 1YXUA 5DR6A 3GFWA 3Q4UA 4W4XA 3VS2A 1PRYA 5EQYA 3GI3A 4BDJA 2Z02A 1WBVA 4KIPA 2XM8A 1JOWB 4KBAA 4YPDA 5DHJA 4CTBA 3IGGA 2J2IB 3D9VA 3DU8A 3NGAA 4U45A 5AP7A 5HHWA 3SXSA 4DFLA 4C36A 4IAKA 4O7NA 4BTMA 5DT3A 5DR2A 5DEWA 2CCIA 2B7AA 2JDTA 3AC4A 3HLLA 2WTCA 3EFKA 3E63A 3FYJX 5LARA 5T68A 1ZYCA 5CSPA 3FLQA 4YC6A 3W16A 4GVJA 2E9VA 2QONA 5FM2A 3HP2A 3WOWA 2B4SB 3MSSA 4OR5A 4V01A 4Z16A 1UWJA 2BVAA 4L53A 4CQGA 3QRIA 3KA0A 1W84A 3B2WA 2HY0A 5CSWA 5CEKA 1XBAA 5CU0A 1H1PA 5AUXA 2VD5A 4FV7A 3ORIA 2QVSE 4MKCA 1YHWA 4O0RA 2BFXA 4IACA 4WHZA 5AJQA 4EZ7A 2GHMA 4F9WA 5BX0A 5JQ8A 3DBFA 4C34A 2BTSA 4FTAA 4RJ8A 3OTUA 5HE0A 2EUFB 4G1WA 2XNNA 4FTRA 3EN6A 1Y6AA 5KZIA 5C26A 1J3HA 5A4EA 5EOLA 4ASXA 4BVUA 3A7IA 3NLBA 4Z3VA 1KE9A 4FKPA 3KMWA 3MH2A 4JDIA 1JNKA 2JAVA 4YJQA 1UU8A 4E4NA 5J9LA 3DV3A 3NVKI 5BMSA 3R7VA 2OH4A 3C9WA 3FMMA 4QMTA 2G1TA 4QPAA 3DXNA 2B1PA 2CJMA 2BKKA 4DGGA 3NUYA 2HK5A 4H58A 4ZJIA 3NRMA 3O8TA 3ZBFA 4ZMFA 3ORKA 3Q96A 4RVLA 4HVGA 3P79A 3A7JA 3PPKA 4JQ7A 3NYVA 4YZCA 4YJRA 5D1JA 2GHLA 4I21A 4TNBA 5HCYA 3ZLXA 3DOGA 4CFNA 4EH7A 3QQGA 4KIKA 3COMA 4PMMA 4D2TA 2R9SA 3QRKA 4E6AA 4KSPA 2XIYA 2ZAZA 3KFAA 5FD2A 5ANKA 4BL1A 3UQFA 3KN5A 1P4FA 4HZRA 1PXLA 4O7LA 3VS6A 2XK4A 5TT7A 4F6SA 3JY9A 4G3DA 3RZFA 4FSMA 1XKKA 5HCZA 5A3XA 4A9TA 4F9YA 1ZZ2A 2VWYA 4FZ6A 5LJJA 2BRGA 3PJ3A 4M15A 3GC8A 2GNGA 4JBVA 3UBDA 1GIHA 2QU5A 3V5TA 3O17A 4D4SA 4PQNA 2FSTX 2ZVAA 3SX9A 2C5OA 2NO3A 3L8SA 4D2VA 2QO2A 3BYVA 3QTWA 2VTTA 4FZ7A 1R78A 4FOCA 4MXOA 3UP2A 1NVSA 4RIWA 3C7QA 4BDIA 3FMLA 4CCUA 4DH7A 4IJ9A 4EOSA 3TV6A 1OIUA 2R3MA 2UW9A 2HELA 2R3KA 5CVFA 1IA9A 4QQCA 2HWPA 4HNFA 4FTUA 1O6YA 4LMNA 2VTSA 5KMMA 3TJDA 3FYKX 4JNWA 3ZC6A 4B6LA 4DAWA 5IMXA 3HMPA 1OIYA 4EH3A 3O7LB 1IA8A 4LOOA 5J87A 1DM2A 4C58A 3AGMA 4B7TA 4S30A 1OL7A 3SC1A 3MVJA 2PK9A 4W9XA 2Y4PA 4NTTA 4MNFA 2ITZA 3V5PA 1FGKA 2WIHA 4XH6A 1OKWA 4GYGA 4QP2A 1YI6A 1SVGA 3ET7A 4YBKA 5M53A 4S31A 3DBCA 4YJNA 5JFVA 4IWDA 4FKQA 3VF9A 2WU7A 5TF9A 1WVWA 2P0CA 3UO4A 2CNUA 1UVRA 3AMYA 2IZSA 2QNJA 4IX5A 5L6OA 3NMUF 2VTRA 2XIRA 3PA5A 1Q61A 3L9MA 3UPZA 5L3AA 1H00A 4PL3A 5CNNA 2XCHA 4XJ0A 1ZMWA 3LFDA 3PLAE 3NEWA 3VUIA 3KRXA 4IWPA 4LOPA 2CPKE 2JC6A 3SG8A 3LCKA 1E1VA 2VZ6A 3FZSA 4UN0C 3QU0A 5JN2A 5H3QA 3WIKA 5CAPA 1APME 1UKHA 3CC6A 3IW6A 3D7ZA 3PTGA 3GFEA 5GZ9A 3CTHA 3S1HA 4DA5A 4C02A 4E4XA 3KXNA 3ZM4A 4Y8DA 4IM0A 2XA4A 4HGTA 3MY5A 3FMHA 4DGLC 3AT4A 2X2KA 3NUNA 3QQJA 1CM8A 5K4JA 4GS6A 4CFMA 2HCKA 2W4OA 2VTLA 4FV9A 5HIDA 5DOSA 3I1AA 3QGWA 3UOHA 2CSNA 2PMLX 5HE1A 3IS5A 5EM6A 3O8UA 4PRJA 3CY2A 4GKIA 3DZQA 3R63A 2UZEA 2UZLA 4H1MA 2O3PA 2YIRA 4FKWA 4Z7GA 1A9UA 4MVFA 5ANOA 2W96B 3TXOA 4MX9A 3ODYX 4ZSAA 3IPHA 4M14A 4FEVA 3KRJA 2Y7JA 4IWQA 5KZ0A 1Y57A 4V04A 2WMWA 3F3WA 4X3FC 4R3PA 2RG5A 4TWCA 4XOZA 3FXZA 3HRBA 3RAIA 5JGAA 4DEHA 4QMYA 1ZY5A 4UB7A 4F7NA 3LFNA 3HECA 5EG3A 5IQDA 2GS7A 4TTHB 2W9ZB 2YACA 3IDPA 3UNJA 3VUDA 1SYKA 4GU6A 5CNOA 4B0GA 4L68A 4EHVA 3R9RA 5M4CA 4C3RA 3EFWA 3LQ8A 2ETKA 4UBAA 4MWIA 1XBBA 5M44A 5I9WA 2ITPA 4AX8A 1OPJA 3KXZA 3O7LD 3QZIA 2J0KA 4LFIA 2JLDA 3H9OA 4TT7A 3DAJA 4XG9A 1B6CB 1KOBA 3D5WA 5C8KA 4L52A 5B2KA 2ONLC 2ZV2A 5HU3A 1MP8A 3PRIA 4E6CA 3AC5A 3DKGA 4MQ2A 3GU5A 2O2UA 4QPMA 3VQHA 3OOGA 3ORXA 5J5TA 1DAWA 3VUHA 4D55A 3EQBA 2PVFA 3U4WA 1H26A 4KRDA 5AP2A 3Q4CA 2UZDA 3GU4A 3Q5ZA 4H39A 5F95A 4AE9A 2H8HA 5LMKC 2HAKA 4CXAA 1PKDA 2QR8A 3F3UA 3FAAA 4J7BA 4X2GA 5LVPA 3PXQA 4N0SA 5IDPA 1VJYA 2I1MA 2YA9A 3HRFA 5D11A 3R8PA 5E8SA 1T45A 3N51A 4WO5A 4O27B 1KE8A 4XEYA 5HNGA 3ZEWA 3SXRA 3LCTA 5CXZA 3LFAA 2WEIA 2WIPA 1H4LA 4GV1A 4OT5A 3BRBA 4PDOA 4FSRA 2W7XA 2GMXA 4O7RA 2BPMA 2C6MA 2HXLA 3BV2A 3NUXA 3OS3A 3R8LA 3RMFA 4C7TA 2VWIA 3L8PA 3R7YA 4DEAA 2XK9A 3UOKA 2ZM4A 4ASEA 4DGOA 5IQIA 5A14A 3Q4ZA 3CGFA 3QA8A 3D7TB 3PA4A 5K5NA 3OWJA 2YDKA 5EI6A 3BQRA 2ITTA 2JITA 3BYSA 3OBJA 4L42A 1HCKA 2O64A 3BQCA 4QMXA 4RA4A 5CX9A 1WBPA 5AV1A 3W2PA 5ANGA 3UNKA 3HMMA 4OW8A 4JBQA 2GFCA 4F7JA 4C4EA 1IRKA 4DG0E 5A4TA 2C47A 4JRVA 5E7RA 4FIJA 3TNWA 3Q9WA 3OCTA 3BGQA 4A9YA 4EOPA 4IX4A 3GEQA 2X4FA 2QURA 2IZUA 2X8DA 3KRRA 4GG5A 2WQEA 2CGVA 4L7SA 4MD9E 5E8WA 4ZXTA 5K5XA 4L8MA 4IAIA 3IW7A 4IZAA 3UODA 1PXPA 2FA2A 1KWPA 3GC7A 3E93A 5A4CA 2R4BA 1J1CA 2BALA 3AC2A 4FIHA 5EYKA 1KOAA 4KBKA 2C3IB 3AC3A 3DCVA 2HXQA 3Q2MA 4GUEA 1KSWA 2IPXA 1H01A 1WVXA 1OB3A 1URCA 3G5DA 2UUEA 3RAKA 2BAKA 4FL2A 5CTPA 2HWOA 5EK7A 1WCCA 3MI9A 3KVWA 4R7BA 4FKIA 5AP6A 5CU6A 4YURA 1JPAA 3ACKA 4QMZA 5CEPA 4F1TA 4F9BA 3I6UA 2C6DA 4IDVA 2F2UA 3ETAA 3QKMA 2ITYA 1R0EA 4NFMA 2UZBA 2C30A 4BZDA 3H30A 4DLIA 3HX4A 4E5AX 1PY5A 3TEIA 5M56A 5HG8A 4GT5A 1OKZA 3BE2A 2QOKA 3NSZA 2H34A 1IAHA 2W9FB 4OBOA 1YDSE 1AQ1A 5I9XA 3KXMA 1YWVA 4H36A 1JLUE 4O0WA 4OT6A 5H8BA 4RX7A 3VRZA 3FEGA 4K2RA 2UW6A 4KIQA 5GIPE 3AC8A 3ORTA 4QMQA 4CG8A 3FSFA 3L8VA 1Q8TA 3TM0A 3CSVA 1PHKA 3R7EA 1ZYSA 4IE9A 5GINE 3GCUA 3MGYA 5IA1A 4M69A 3MVHA 2QU6A 3VVHA 1VR2A 4ANMA 1RE8A 3AD5A 5HG9A 4AT4A 3PXZA 2OZAB 4L6QA 4EBWA 2YCFA 4FTTA 3HL7A 3F5PA 5DH3A 2WZJA 4NUSA 4NW6A 3N4VA 4DF3A 4FBXA 5EOBA 4C4HA 2ERKA 2O5KA 3G33A 3NAXA 4PWNA 1VEBA 2A19B 3QA0A 2ZV7A 3BHUA 3BGPA 2WB8A 3R00A 1XO2B 3R8VA 3E87A 4EWHA 2W06A 4M0YA 4TYHB 3LMGA 1OI9A 3LFBA 5ANEA 3KULB 2OJJA 4WNOA 3V5QA 2JKMA 2IO6A 4AE6A 4FSTA 2WMSA 4C2WA 4QTDA 3TIZA 2EU9A 2X7FA 3ORMA 4X2JA 3DJ5A 1JWHA 3EL7A 3IK3A 3WARA 4CLJA 2RG6A 5GNKA 5IA3A 3BBTB 4A4LA 5E8YA 4FSQA 4AA4A 5AR8A 4BDGA 2C6EA 3Q6UA 3SA0A 1NT2A 1J91A 3QCYA 4O7ZA 3ENMA 5FQDC 3OZ6A 2OKRA 3D0EA 1NY3A 4ZSLA 5CF6A 3T3VA 3ZONA 1PYXA 1P5EA 3PG3A 2VRXA 4RBLA 3OVVA 4R1VA 1XH9A 2CN8A 5AP5A 2XK7A 3G2FA 1M2RA 4BCMA 2PZYA 4GK3A 4RPVA 4BWKA 2DWBA 4TYIA 4FSNA 2HOGA 4C8BA 3W33A 1WAKA 3MB6A 4XV9A 5AWMA 4QNAA 5BVDA 3EQHA 3VUMA 1M17A 2CLXA 3TACA 5IH5A 3A7FA 2R0IA 4O0XA 2GNIA 5GHVA 4XG2A 1U54B 4ALWA 4BCGA 4DH5A 4AZVA 4X0MA 1XH8A 4MBLA 5CAOA 4EHGA 3FKLA 2RIOA 3I7CA 5CF5A 5CSHA 4I20A 2ZV8A 3G0FA 4R1YA 4DLJA 3KEXA 4QO9A 2J6MA 3WILA 2EXEA 2FSLX 5BUJA 3I60A 5LMBA 4AT5A 2JFMA 5JRQA 4EC9A 4D9UA 4JDKA 4FIEA 2F9GA 4KUJA 3KF4A 4O7VA 3T8OA 5HQ0A 2Z7RA 5CI7A 2J9MA 3GXLA 3S95A 4C61A 5K0XA 1QCFA 5JMSA 5A9UA 4YHJA 3ATSA 2JDRA 2OICA 2Q0BA 1X8BA 5IQHA 4H3PA 4JI9A 2WMXA 3EQDA 3FDNA 1FVTA 2KTYA 4AZFA 3WZEA 4E5BA 1SZMA 4RFMA 5KBQA 4XUFA 3EN7A 3SV0A 3FQEA 4NIFB 3MS9A 1WBOA 2R7IA 3G6GA 2YLFA 3R1SA 4GJ2A 4I92A 3QCQA 4KINA 4UWCA 4XX9A 5CT0A 1YOMA 5C9CA 5FXQA 2VWXA 3ULIA 3WF5A 4CYJA 2Y6OA 3OC1A 4OAVB 4RLKA 4RZVA 4YJUA 5AV4A 2GTMA 3PPJA 5HLWA 5CZIA 1IASA 3F5UA 2YCRA 3H4JA 3PVGA 4AGCA 1SVHA 5F94A 2BZKB 1IAJA 4ANOA 3C4EA 5ANJA 3VBYA 1XH7A 3P7CA 3I7BA 2ITUA 3RPVA 3SOCA 4ZZOA 2X2LA 4WOVA 1ZXEA 4E7WA 3IKAA 4WKQA 3AC1A 5HO8A 1L8TA 5AAEA 5IEYA 2RFSA 4F0FA 4EOOA 2ZJWA 1OUKA 4ZY6A 3TIYA 4I5PA 4AZWA 5J9ZA 5IQCA 3UZTA 4MD8E 4FV3A 2XP2A 3C4XA 3MTLA 4RX9A 4TZRA 2UW3A 3AGLA 5I0BA 1LEWA 3UIMA 4B8LA 3EWHA 4DBXA 3CGOA 4XOYA 3SDJA 2V7OA 2JIIA 2WTVA 1CDKA 3PJ1A 4KB8A 4AQCA 2XIXA 3F3ZA 3TZ9A 2C6OA 4YSJA 4CQEA 4FT3A 2R3HA 3QTSA 3NX8A 5H9BA 5H8EA 5ETFA 4B4LA 1RJBA 4QMOA 5IZFA 4QT1A 2XBAA 3TZ7A 5EYMA 3BWJA 1WBTA 2P4IA 3IDCA 3WE8A 3R83A 4FKOA 4PMPA 3DGKA 4YLKA 3QC9A 3IW8A 2NP8A 4I0TA 3NW6A 2OJ9A 3VUKA 4QP4A 3PY3A 4S33A 5IA0A 3E8NA 4BDCA 4F63A 5AEPA 4G3CA 3GNIB 3I4BA 2FVDA 1JAMA 4GW8A 4WUNA 3ZUVA 4M8TA 4BWPA 2UW4A 3OXTA 2VWUA 4ITJA 1H1QA 4B9DA 2W1IA 5IQAA 2R0UA 2W1EA 3LFEA 4YZBA 5J95A 4AZEA 3QD0A 3R9DA 5G1XA 4S32A 2WFYA 3R73A 2UZOA 2PUUA 4I6QA 5FWKK 4OLIA 3EH9A 2ACXA 3CQEA 2C0TA 4ZS0A 5KMLA 1UKIA 3RVGA 3FZOA 5HLNA 3UC4A 4RG0A 4C2VA 1YXTA 4D1SA 3PVUA 2BRBA 4YNOA 4L3PA 3UIBA 2X1NA 1S9JA 4I0SA 3FQSA 5CVHA 4C38A 3DBEA 4EOLA 4O7YA 3COIA 4PL4A 4F08A 4JX7A 5EQPA 1KE7A 2QOBA 4FZDB 3CTJA 4BI2A 2WMAA 2WEVA 3Q53A 3I0OA 2IW9A 3RK7A 2XM9A 4Q5HA 3CCNA 4U97A 2WQBA 3WYYA 5AM6A 5IA4A 4WG4A 4XP0A 4ASZA 5FXRA 5IDNA 5GJFA 1TQPA 5EHLA 2OI4X 3HV5A 4EHEA 4ORKA 3PJ8A 4LUDA 3AG9A 3VHKA 5E4HA 3CY3A 4WBOA 2C0OA 2XIKA 4MHAA 4YJPA 3JUHA 2Y4IB 4RJ6A 3PIYA 4CZTA 3I81A 1BX6A 3VBVA 3ZOSA 4KAOA 1Q8ZA 3L1SA 3FUPA 3MA3A 4E6DA 3C4ZA 2PMNX 4ZTSA 1V0BA 1GJOA 3VBTA 5IUHA 3DXPA 4E5WA 2DYLA 4D4RA 4XP2A 4MTAA 5K0KA 5JT2A 4I6HA 2R64A 4IFCA 3QL8A 4JT3A 3V01A 3ZSGA 5EI2A 1H1WA 4ZZMA 3TZ8A 3QD3A 2W5BA 4BYIA 3FMDA 1YI4A 2FO0A 3JY0A 2GFSA 2I6LA 2BHEA 4S34A 4YJSA 3ZYAA 3FKOA 4IVCA 3LQ5A 3EKKA 5CQUA 1FMKA 4LGHA 4A9RA 1J7LA 1KUTA 4E20A 1R39A 3THBA 4EL9A 5DNRA 2EXCX 3C1XA 2HYYA 2X0GA 3MJ1A 3OROA 4FUYA 4USDA 5FBNC 4TWNA 4X6RA 3RI1A 3RPYA 2C5VA 3EB0A 3ROCA 2GDOA 5DR9A 3OMVA 4WIHA 2QKRA 5HIBA 4ERKA 4M97A 4DFUA 4GRBA 4G31A 4X2NA 4HPUE 4EK4A 4QP3A 3R2BA 3LOKA 3KKVA 2PE2A 1P14A 3DA6A 4C4FA 2JKOA 3RKBA 4L43A 4U3ZA 4O81A 4KD1A 1GAGA 2XKEA 5D41A 5LCKA 3BCEA 5HNIX 3SAYA 4BWXA 5HX8A 5AR7A 4GVAA 4DGMA 3WF9A 1EH4A 2VTNA 3PVWA 3HV4A 4WNPA 3MBLA 4Y46A 3VUTA 3UYTA 5DVRA 2CCHA 4YZDA 3ZDUA 2GHGA 4CZUA 4I93A 4R5YA 3C4FA 4FKSA 3R9HA 2CHLA 4ASDA 3GENA 4BHZA 3IW5A 4MXZA 5L8KA 3O0GA 3CD8A 3AT3A 3MFTA 2PVJA 3VS3A 5HCXA 3LXLA 3OCSA 2YDIA 4JR3A 4IM2A 3QHRA 3F6XA 1FOTA 3MIYA 1JKKA 4JIAA 4G5PA 3QD4A 5CT7A 3UZRA 3ZFMA 1W98A 4D5HA 1PXJA 2OFVA 3JYAA 3LJ0A 1SNXA 3FY0A 4QNYA 4FV5A 2YN8A 3I0QA 1GIIA 2C0IA 4IZ5A 2OH0E 1YRPA 4V0GA 4K9YA 3PJ2A 1PW2A 3LXPA 4BN1A 4F6UA 1Y6BA 5LQFA 2HW7A 5CWZA 5M4UA 3BHYA 3O51A 3PFQA 5B2MA 4FVRA 3GU6A 4AOJA 4DINA 3O71A 5CSXA 2QHNA 3NAYA 4FKJA 4FT5A 5H8GA 4D1XA 5DWRA 3FZPA 4GT3A 3ZUTA 3UIUA 1YOJA 2V7AA 2W05A 3UZPA 4CKRA 1OBGA 1Q5KA 1P4OA 2XVDA 3R02A 4IQ6A 5CLPA 4FTIA 4N6YA 3U6JA 4YBJA 4ZAUA 3F2AA 3BIZA 3KMUA 3UNZA 4FV4A 4QP1A 2WMVA 4PDYA 1V1KA 4YJOA 4DHFA 5HX6A 5AP0A 5FEEA 4BDBA 1W82A 2WO6A 2XIZA 4YMJA 3CJGA 1YWNA 3KY2A 4FSWA 2CNQA 3UP7A 4O2ZA 2O8YA 5CEIA 2PU8A 3R8ZA 1FGIA 2ETRA 3L9PA 5BUIA 2Y6MA 3FXWA 5IMEA 1OGUA 3CBLA 3HV6A 5G6VA 3BLQA 2I40A 3AD4A 1DI8A 2RGPA 4EHZA 5A6NA 2ESMA 4QQ5A 4AG8A 4DEEA 4R5SA 3ZC5A 2NNWB 4O6LA 3QXOA 5HICA 3PLSA 3PZEA 3AT2A 4OTQA 3HKOA 3E3PA 4AGUA 5DMZA 2YISA 3ACJA 2RL5A 4KIKB 2YLEA 4QMUA 4OTIA 3MFUA 4UWYA 4EH2A 4LI5A 5E8ZA 4HVIA 5HVKA 2GS2A 3E7OA 3DB8A 4U7ZA 5KHXA 3OD6X 2OK1A 3PE1A 2PY3A 3GUBA 4HCUA 4HCVA 2B9IA 2HW6A 4RWIA 4I22A 5DPVA 2WQNA 4W8EA 5CAVA 4EOMA 5HZNA 3BEGA 4ZIMA 3MB7A 3QBNA 5CS6A 1ZZLA 5E8VA 3VUGA 5AAFA 5LVNA 5M06A 2QOOA 3P4KA 5ACBC 1UNLA 4YU2A 4Q9SA 3VW8A 4AUAA 2A27A 3LFQA 4X2KA 4ZTQA 2YM8A 2WMRA 3MH1A 2GCDA 5F9EA 3NYOA 4F0GA 5AR4A 1CMKE 4LOQA 4O0SA 3SHEA 5E90A 4AT3A 4E26A 3UVQA 5HORA 2XB7A 3LAUA 4RIWB 4NYEA 4YZNA 2JDSA 2CGUA 3D14A 3G0EA 5CU4A 5JFXA 4H1JA 5IG1A 5CAQA 4O83A 2BKZA 3R71A 5JZNA 3FMNA 3RAHA 3D5XA 4JS8A 3UTOA 4ALUA 4EKLA 4F9AA 5IU2A 3FE3A 5EDQA 3UE4A 5HBEA 3CTQA 4PTCA 4D0WA 2FSOX 4DFZE 4FC0A 5J1VA 3NZ0A 4FI1A 4X3FA 2CDZA 2XBJA 3EYHA 2G2FA 3GP0A 5EI8A 4NKAA 4PP7A 5KX8A 1M2PA 4I5MA 3TL8A 4IB0A 5L4QA 5AUUA 2QODA 3V8WA 2BHHA 4AAAA 3NNUA 2IVTA 2PUPA 4N57A 3DQWA 2P2IA 3H0YA 4UYAA 3ELJA 3QZGA 5DBXA 2YM7A 2Q83A 4FGRA 4G16A 5F1ZA 5HI2A 1WBNA 1TVOA 3MFSA 3U8WA 3UOLA 3LXKA 3ZO4A 2GQGA 3UO5A 5M09A 4QTAA 4BBFA 4EWQA 2XUUA 3V5LA 1M7QA 4UMUA 4WT6A 2HZIA 2WU6A 3UOJA 2W4KA 3TDVA 1UNGA 5A4LA 3AMAA 3M42A 3EKNA 3TT0A 5IQGA 3JXWA 1VYWA 3ZCLA 4FTLA 4WRGA 3CJFA 4XRJA 2ITOA 4ZJJA 1SMHA 4HYHA 2OXYA 3SLSA 1I44A 3ZO2A 4ZY5A 4IB1A 1ZMUA 3KU2A 5IQFA 3I5NA 4JLCA 3RZBA 4IWOA 2PHKA 3FC2A 5FBOA 4ZEGA 4ACMA 4FEWA 3GC0A 3KCFA 5DT0A 2IW6A 3LPBA 5ETCA 5TKDA 1CTPE 5CEMA 3OW4A 3EMGA 1BL7A 3EHAA 2GU8A 2JD5A 3DAKA 3ORNA 4OTFA 4IAZA 5JRSA 5I9YA 3ZEPA 4HGLA 4BCPA 4RWKA 5CVGA 2I0EA 4BBEA 5IEVA 2W99B 5C03A 4ZTHA 1YWRA 3GOPA 1XQZA 3OCBA 3CS9A 5I9ZA 4CT1A 4XG7A 3R7UA 4QQTA 4V05A 2AYPA 3D2IA 4AW1A 4RIOA 4EJ7A 3R7OA 5BPYA 3MESA 4EUUA 3P0MA 4TY1A 3VQUA 4QTEA 4PUZA 4PMSA 5L2SA 5IPJA 2C3KA 5HG7A 5L8JA 3HNGA 5BVEA 3SD0A 3CKXA 1H0VA 2X81A 4BHNA 4KNBA 2R3LA 2XKDA 4F99A 3ID6C 4YZMA 3G9LX 1OMWA 4H3BA 2DQ7X 2YITA 3W2OA 5AA8A 4FIFA 3BZ3A 1OITA 4O21A 3W2SA 3R1NA 4J99A 4EYMA 4EYJA 4I1ZA 5GZAA 5JSMA 3VULA 1ZAOA 4R77A 4QRCA 3CLYA 4NFNA 2C5XA 4RIYB 5T6KA 3PRFA 2C68A 3HAMA 4W8DA 4FT9A 3NIEA 3TCPA 3A60A 3JVSA 3VN9A 1MUOA 2FGIA 4FKGA 2WTJA 3U9NA 1UV5A 3PP0A 2IG7A 4FE2A 3A8XA 1U4DA 4USFA 4R78A 2OXDA 3R0TA 4D0XA 2WOTA 3MFRA 3FI2A 4FMQA 1LUFA 2BRHA 4ZK5A 4CFWA 3PA3A 5EM7A 4QMSA 2B9HA 4NH1A 2C6TA 3DKFA 4GSBA 2Q0NA 2OJIA 1PMVA 3W18A 3D5VA 5AR3A 2WMQA 3OTVA 4BCQA 3NUPA 2OJFE 3R8MA 1Q41A 1JBPE 4XMOA 5D9HA 3V51A 3LLTA 1H07A 4I94A 3V3VA 1YXSA 4XCUA 4CG9A 3F82A 3R04A 4II5A 4O0TA 3NUUA 5DLSA 2X8EA 2JBOA 4WSQA 5C01A 2QKWB 4G3EA 5AUTA 4EOIA 3LQ3A 5LCJA 4AFEA 1CKPA 5JGDA 1TQIA 3PXRA 2VO3A 1OKYA 3GT8A 4HGSA 4JVGA 3R7IA 4AZSA 2OIDA 4FTOA 2XNBA 5M55A 2UZTA 2X6EA 4ITHA 4KKEA 4ZLOA 1QL6A 4ALVA 1OL5A 3PXYA 2AUHA 3QZHA 5IKWA 4U81A 3FPQA 3DJ6A 5EDPA 3RM7A 4AWIA 4RIXA 2CKQA 4AF3A 3TNHA 1Q62A 2W1GA 3TV7A 4J8MA 2BZIB 4W4WA 1REKA 3A4PA 3BHHA 3BLRA 3UC3A 4FOBA 2BDJA 2PE0A 2VO6A 3IW4A 4JRNA 2J0LA 4L44A 4YO6A 4BTFA 4FV8A 2BRNA 3BX5A 2ITQA 4FG8A 3BYMA 5HIEA 4BY9E 1YKRA 5FDPA 2R3FA 4DG2E 3A61A 1OL1A 1OPLA 1WBWA 2C1AA 4L3LA 4PNKA 3W32A 3RP9A 1OZ1A 5GZ8A 2PUNA 2BDWA 2QC6A 3IO7A 5AIRA 4EEVA 5AR2A 4L46A 1FPUA 4AN9A 4RX5A 4L45A 3C0HA 5AV3A 2DS1A 3ZM9A 2F2CB 3RNIA 5D10A 5L2QA 4A9UA 4I5HA 4QYFA 4Z7HA 2W1ZA 1ZMVA 4QP8A 4I6FA 1OL6A 1S9IA 3E8CA 1BI8A 3UDBA 4O2PA 3MA6A 4BIEA 2G15A 5BUEA 1ZYJA 4RQVA 2EWAA 5FGKA 2E2BA 4PX6A 3ZZWA 3ORZA 2R3PA 4ZSGA 5AUWA 3M2WA 4FTJA 2VAGA 4PP9A 2X7OA 3U87A 1UWHA 5M08A 4J8NA 5FLFA 5KO1A 1ZLTA 3W1FA 4A06A 4C37A 1OBDA 2J50A 2G2HA 2ZB0A 1IG1A 2WOUA 4M69B 3ZRLA 3S00A 4W4YA 2JKKA 2WTKB 1TKIA 1QPJA 3NPCA 1LPUA 4MEDA 3QLFA 3NDMA 5HESA 3VS7A 1PF8A 3L8XA 5I9UA 2YJSA 3NVMB 3E64A 4MNEA 3KB7A 4JR7A 3W2CA 1O6KA 3A7HA 3FZ1A 2HY81 4DFYA 4F64A 4H05A 4BR3A 3NCZA 1KE5A 3A62A 4DBNA 4DH1A 4PPCA 3ZFYA 1F3MC 4BDKA 3F7WA 4IZYA 3CEKA 3ZH8A 4AU8A 4I3ZA 4DYMA 2JGZA 4WUAA 3KK8A 4O22A 2J0JA 3RGFA 4UALA 3B8RA 3OWKA 3PIZA 4K11A 3DNEA 2Z8CA 1OVEA 2J0IA 3VBXA 1L3RE 4M3QA 4MXCA 4O96A 3W2QA 4QMNA 4ZTMA 2CKPA 1CKIA 3OBGA 3BEAA 4FX3A 4X7QA 4C35A 4HW7A 4M84A 1ND4A 4LRKA 4BCOA 3IECA 1QPEA 3COHA 2YIXA 4GFMA 4JX3A 4BIBA 4C3PA 3G6HA 2Z7QA 4N70A 4WNMA 2WQOA 3V8SA 3H9RA 4HOKA 3BBWA 2UW0A 4QTBA 4RFYA 2B9JA 5CAUA 4PDSA 3NNWA 3TUCA 1OUYA 5CXHA 1WMKA 2UZWE 1UU7A 3EZVA 1M14A 4Q2AA 3V5WA 4AXAA 4C33A 4FKRA 1NVQA 5BYYA 3C13A 4FTCA 2PZIA 2R3JA 3VC4A 2WMBA 4AW5A 5JGBA 5JFWA 2LGCA 4P7EA 1SM2A 3E8EA 3PPZA 3RHXA 3SRVA 3EQFA 4IADA 5DE2A 3R28A 5HEZA 5HD4A 1Y8GA 5EM8A 4LM5A 3HVCA 3TZMA 4U41A 4JAIA 4AOIA 1GZOA 2XCKA 2B52A 4HYSA 1G8SA 3FZTA 3DS6A 3W10A 5HBJA 5ETAA 3TN8A 1PKGA 5IH4A 5J1WA 3BI6A 4BYJA 3F2RA 3K54A 3UIXA 4O86A 5IH6A 4C4JA 3AMBA 1BL6A 4P5QA 5IUIA 3FMJA 5JH6A 2PVLA 2QG5A 2RSVA 2O0UA 1OPKA 2OW3A 2P55A 2V22A 3IOKA 5AUVA 4OBQA 4KKGA 2VN9A 2XNOA 4PV0A 3GVUA 3NIZA 4EH9A 4YUQA 4G3FA 3FPMA 3ODZX 1MRVA 2GNFA 4L00A 3KL8A 4IX6A 4R7HA 4JL9A 4M12A 4FIGA 3KK9A 3HMIA 2X9EA 3EQGA 3EFJA 1Y8YA 3DTCA 3H3CA 2PUIA 4LV5A 4XS2A 4XV2A 4WG5A 3DTWA 5HD7A 3U6IA 4ZZNA 1J7IA 3DKCA 4GL9A 4JOAA 4KSQA 4DEIA 4IHPA 4I23A 3ULZA 5E91A 5A46A 5LWNA 3C5IA 2BFYA 3KC3A 3QLGA 1FINA 2F7XE 1OECA 4FTQA 2PWLA 1GIJA 3LW0A 2QOLA 1NVRA 2YIWA 4NM7A 3PJCA 4U6RA 5HG5A 5BMMA 4FR4A 4MCVA 2RKUA 2X9FA 3II5A 4LGGA 4QP6A 3VBWA 2XKFA 3P7BA 3T3UA 4L3JA 2AC5A 3R2YA 2BTRA 3LKMA 4WNKA 4GT4A 2R3GA 4XBRA 4U79A 4TYGA 4RC2A 4OTPA 1UA2A 2C5NA 3M1SA 3VWAA 4UXLA 4FL3A 4ZSJA 3QTUA 4IB5A 5CALA 3C5UA 5KCVA 5I5ZA 2YJRA 3IGOA 2OO8X 3H9FA 4TN6A 3QXPA 2LAVA 2OXXA 4NU1A 2PMOX 4WD5A 5KKRB 4IIRA 1H27A 2YM5A 3R30A 4XHKB 3ROYA 1R0PA 3LCOA 2ZDUA 3D4QA 3HUCA 1JSTA 1E1XA 1YOLA 1Q8WA 2W1FA 4CT2A 2P33A 4XG4A 3EOCA 4PL5A 4CRSA 5KE0A 3LMHA 3RAWA 5HE2A 4TWPA 2YAAA 2WTIA 3CD3A 4BBMA 4DEDA 4HGEA 4K18A 2G2IA 2XF0A 5HO6A 1GOLA 3E92A 4PF4A 3R8UA 4MAOA 3I6WA 5L6WL 4O0VA 2XNPA 3Q04A 3E8DA 4FSUA 1ZYDA 2YIQA 4FGBA 1ZOEA 3RNYA 2JBPA 2JIVA 3BELA 4Y95A 5H2UA 3FBVA 5HVYA 3RM6A 2ERZE 3W8LA 2R3NA 4IAAA 4DFBA 4X2FA 3BKBA 2YM3A 3ZHPC 4FODA 1YQJA 3RPSA 3FI3A 4TKSA 2AC3A 2R3OA 2PSQA 1PJKA 2R3QA 4IVAA 4L67A 3R9NA 5AIKA 4DTBA 3GBZA 1H1RA 1W83A 5BVOA 2A4LA 4FKUA 2UW7A 2VO0A 3MH0A 3F69A 1NW1A 3MDYA 5CY3A 1FVVA 3SKCA 3ORPA 2WTWA 4ACDA 4BCHA 4U80A 4NTSA 1WVYA 2WAJA 4UMQA 3QAME 1HCLA 4R8QA 4RFZA 3UQGA 2X2MA 1SNUA 3QTIA 4I0RA 5K3YA 2VUWA 4FTNA 4PPBA 3T9IA 1QMZA 2XNGA 3DKOA 3DFAA 2E9OA 3PZHA 2A1AB 3IDBA 4FYOA 4DEGA 5KUPA 3VIDA 5AV0A 2H6DA 5CEOA 4FTKA 5LMAA 3ZBXA 3CKWA 4JG6A 2QOQA 3PIXA 1F0QA 4FZFB 4NW5A 4YLLA 5AX9A 5E8TA 4BKZA 4MD7E 4R7IA 4BZNA 3GU7A 4BCIA 5L2WA 1LEZA 2RF9A 4O84A 4I4FA 3FMEA 4NK9A 2CKOA 1KE6A 4J52A 2VTMA 2OWBA 4XV1A 4FV1A 2GNHA 3PY1A 3W55A 3QWJA 4ZJVA 3KXHA 3SG9A 2A0CX 3QX4A 2NRYA 3G15A 3SW4A 4X3JA 1Q8YA 4QOXA 5DFPA 3KRWA 3ANRA 4EBVA 3OF0A 4ANSA 1VZOA 2PVKA 4YHFA 3DT1A 3ZMMA 1KV2A 4DC2A 4ZLYA 1CSNA 3OUNB 4AN3A 3TJCA 3EQIA 4EK3A 4YO4A 3ALOA 5LVLA 3VS0A 2ZOQA 4RC4A 3QTZA 4FSZA 5CU2A 4IJPA 3TG1A 5J79A 4PY1A 4XLVA 4DT9A 3NNXA 2PTKA 4F7LA 3E3BX 3RINA 2VGOA 4RGJA 2JDOA 4LRMA 2SRCA 3BU3A 1STCE 3K2LA 5T3QA 5KMIA 2OU7A 1H1SA 2QI8A 5FEQA 4A4XA 2OSCA 2I0YA 3POOA 3FQHA 5FTGA 4DT8A 4M0ZA 3GGFA 3D5UA 1ZOGA 2BCJA 2V0DA 3O2MA 4BDFA 4F1MA 3UQCA 2Z60A 3KQ7A 3NR9A 2F7EE 3ZS5A 4O0UA 2YABA 1DI9A 1OKVA 4TPTA 4CEGA 4YJVA 5I3RA 5CEQA 1HOWA 4FV0A 4QPSA 3TV4A 1PXMA 4E4MA 1IEPA 1CKJA 4QMWA 1BYGA 2X8IA 3OXIA 1A48A 1AGWA 3WIGA 4MH7A 2JDVA 1OIQA 4HJOA 2PPQA 3LIJA 2GQRA 1XH5A 3FZRA 4FUXA 5KMKA 5CENA 3VF8A 3REPA 3QUDA 3MTFA 4LGDA 2PZPA 2F49A 2VNYA 3HA8A 2GNJA 5D7AA 3LFFA 4BGGA 5BQ0A 2QLQA 5L8LA 3G90X 4K33A 4O91A 2X7GA 4QQJA 3R1QA 3OFMA 4FV2A 4V0GB 4ANNA 3DBDA 3ZXTA 3SRVB 2P3GX 2B53A 2W1DA 3WZUA 2ITVA 3FHIA 1NA7A 3EYGA 5E1EA 5TO8A 4UZDA 3RCDA 2C1BA 2DUVA 2R7BA 3COKA 3EQRA 4ZP5A 4AZTA 4NJDA 5M4IA 4G34A 2XJ0A 4GUBA 2RFEA 2BUJA 2XJ2A 1YXVA 2I0VA 2YAKA 3KGAA 1NXKA 2VGPA 3P78A 4GK2A 4NKSA 4O82A 4NSTA 4QTCA 5EFQA 3ATTA 3CP9A 1WFCA 3MY1A 3DK7A 4G2FA 4BDAA 3TDWA 2UVYA 3NWWA 4ACHA 2ITNA 2VTPA 2BRMA 3MPMA 5LOHA 3NUSA 5GJDA 2EB3A 3DAEA 4BCFA 4CFVA 4D2SA 4TXCA 3RWPA 3FJQE 2J5FA 4KIOA 4A07A 2E9NA 2R5TA 2CGWA 5DI1A 3C4WA 3QTRA 4HVHA 4FG9A 3E88A 4AW0A 3Q32A 4XG6A 4QMLA 2QOIA 4MBJA 4D2WA 4BDDA 5IQEA 4XG3A 3MW1A 4AGDA 3PUPA 2UW8A 3O50A 4RZWA 1M2QA 3B2TA 3DJ7A 3OUKA 4NL0A 1RQQA 2Y4IC 4EK5A 1BKXA 3I79A 4YTIA 3TWJA 3UG2A 4D4YA 1MRUA 4ZTLA 1VYZA 2YHVA 3EN5A 3QRTA 2WPAA 3V8TA 2Y8OA 2CKEA 4FTMA 4EQUA 4EZ5A 2NPQA 3FI8A 3LXNA 3O8PA 4IANA 3QKKA 2XNEA 2BAJA 4RX8A 4Y72A 4DN5A 4IFGA 4ITIA 2BMCA 4CD0A 3PXKA 4IH8A 2IZTA 3P7AA 4IW0A 3U6HA 4DITA 3E5AA 3BV3A 1W7HA 3UO6A 3GU8A 2FUMA 3KRLA 3QWKA 4NCTC 2C6IA 3HMOA 5EW3A 5HKMA 4NM3A 3P9JA 2YM4A 4ZMEA 4DGNA 2NRUA 3SVVA 5B7VA 1UNHA 4FICA 3OWLA 1WBSA 1OL2A 3O23A 4FIIA 5EW9A 4TWOA 4JJRA 5K9IA 3FI4A 3H10A 4PTGA 3LHJA 4HCTA 4IZ7A 5DA3A 4LG4A 1XHAA 5EYDA 3CE3A 4HYUA 4TRLA 3QFVA 3QC4A 4QMMA 3MPAA 4UY9A 3RK5A 4MXXA 3DNDA 2CNVA 5EKOA 3ERKA 3U54A 3WZJA 4G6OA 4M66A 4F4PA 4M13A 5CANA 3ZLYA 4BCNA 4FEXA 3VBQA 5TR6A 4AFJA 4L01A 3A7GA 3QYZA 3C0IA 3BHVA 3LLAA 4K0YA 1O9UA 1PYEA 3QKLA 5CI6A 2XKCA 5JKGA 5EQEA 5LXMA 2VTQA 2OLCA 2PYWA 4GFOA 4ZS4A 2IVVA 4J96A 3OCGA 2J0MB 2W4JA 3LMIA 4OTHA 4D28A 5AA9A 1XBCA 4UYNA 3UG1A 4RWJA 4X3FB 3EN9A 1GZKA 2C3JA 4CCBA 3ANQA 2ETMA 4IAFA 3HAVA 4IVBA 4EH8A 3GCQA 3GOKA 3MVLA 4XP3A 4HPTE 2FSMX 1ERKA 4RT7A 3SQQA 3IQ7A 1RW8A 4OUCA 4OAUC 3HZTA 4IX3A 2BZHB 1K2PA 3QTXA 5K4IA 5AP3A 1U5RA 3F9NA 4WG3A 1W0XC 5BVWA 3BWFA 2QO7A 2VX3A 1M52A 4A7CA 2OF4A 2V5QA 4S2ZA 5EDRA 3DZOA 3FMKA 3QQLA 1V0OA 5JZJA 1J7UA 3ORLA 3E7VA 2VU3A 3O96A 4EOJA 2PVYA 5IISA 1MQ4A 2ZM3A 3UVRA 4OBPA 1JKTA 4TNDA 4FVPA 3ZRKA 3JS2A 4EH5A 4CKIA 5AMNA 4QYGA 2HZNA 2Z2WA 4RJ3A 2YCQA 2ONLA 3EQPA 4U9AA 4C62A 5KNJA 4BZOA 4L9IA 4RRVA 3ZLWA 3IONA 3ZDIA 4E73A 2R3IA 5IA5A 4DEBA 3F88A 4U43A 5LMKA 3GB2A 5C1QB 2VTJA 1H8FA 3Q9YA 4JG7A 2E9PA 1DS5A 3ZTXA 4FNXA 3RJCA 4F09A 3EJ1A 1XR1A 2GSFA 3U51A 4JAJA 1WZYA 1T46A 3GQLA 3OW3A 4D9TA 2WQMA 3MN3A 1OM1A 4I5CA 3OG7A 1OIRA 2QQ7A 2YIYA 3A4OX 3LFSA 4I6BA 2QOFA 3LVPA 4EH6A 4JIKA 4BCKA 5EH0A 4DCEA 3LJ2A 4AACA 1FBNA 2XYUA 4K77A 3FL4A 4YJTA 3R7GA 5HLPA 3P86A 5JQ5A 1LP4A 4ZTNA 5DRDA 4GIIA 4IMYA 4CFUA 5DN3A 4EH4A 3FKNA 4ENYA 1PXKA 3F5XA 1G8AA 3DQXA 3GQIA 3HEGA 5CASA 5C8MA 3OOMA 4JQEA 2OG8A 5DRBA 3S2PA 3MJ2A 2IWIA 3D15A 3PXFA 5DG5A 4EI4A 2JEDA 2WKMA 4CV8A 2WD1A 4R3RA 4MWHA 4E1ZA 3I5ZA 4CTCA 3HDMA 4O7WA 3QALE 4IDTA 2P2HA 5C27A 3KCKA 4ZLZA 3VO3A 2I7QA 2QO9A 2PVNA 1DAYA 2ZV9A 1PXIA 5BVFA 4WRSA 5FXSA 1IR3A 2J51A 2PVRA 4OTDA 3KF7A 3SXFA 2ITWA 4MF0A 4MXAA 2RFNA 5HGIA 3SGCA 4APPA 3AD6A 5AAGA 5CSVA 4QD6A 2REIA 4EC8A 4LL0A 3MYGA 4BF2A 4EUTA 5L6PA 3VW6A 3N4TA 5J8IA 4LUEA 3WI6A 3FY2A 3AXWA 2A2AA 3OP5A 4KWPA 1SVEA 4K6ZA 3M11A 3VNTA 2BAQA 5HO7A 1PMNA 4J95A 5LVMA 4ZOGA 4P5ZA 4BIDA 4W4VA 1FVRA 3EQCA 5FG8A 5BYZA 5CF8A 5B0XA 4YP8A 3PWDA 4J71A 4JBOA 3ZSIA 2HIWA 4D5KA 1JSVA 2WMTA 3FV8A 2Y0AA 3NUAA 3Q9ZA 3QQUA 4E93A 5IEXA 5A6OA 1ZYLA 3BPRA 4G9RA 4N6ZA 4C3FA 3WE4A 1U59A 3F66A 3OHTA 2XZSA 2HENA 1KV1A 2WELA 3QD2B 4LV8A 4EK6A 1FQ1B 1QPCA 1RDQE 2V55A 4FNZA 4AP7A 3KN6A 1MRYA 4YGAA 3ZU7A 4CFXA 4RIXB 3BYUA 3LM5A 3N9XA 5A4QA 4BICA 3Q52A 4D4VA 2IN6A 3WBLA 3G51A 4FK3A 4XV3A 5GJGA 2UW5A 2ZYBA 3BHTA 4YLJA 3DFCB 2XK3A 2VWBA 3KXGA 4FL1A 4RQKA 4YC3A 4UMTA 3MWUA 4DCAA 4O0YA 3FLSA 2PMIA 4MBIA 5DT4A 4E3CA 1I09A 3HV7A 4P2KA 4H3QA 5EHOA 2UZNA 3F2NA 5KMOA 3N4UA 2EB2A 3LJ1A 3NS9A 4GFGA 3DLZA 5M07A 2C5YA 4YR8A 3GCSA 5E92A 4U5JA 1A06A 3QQKA 3PSCA 3Q6WA 2IW8A 1P2AA 3C50A 4QYEA 4RVTA 4BTKA 3DDQA 4OGRA 3QTQA 3ZUUA 5LVOA 4FEQA 3ZO1A 2YM6A 3BYOA 2PE1A 1ZY4A 2C4GA 3CR0A 5IF1A 3EN4A 5BVKA 3OT8A 3TKIA 4GG7A 4FEUA 4UX9A 3QGYA 4LMUA 5I4NA 1GY3A 5EHYA 3MV5A 3FLYA 3NYXA 3D7TA 3HUBA 3K3IA 3WF6A 5FP6A 2F7ZE 4HZSA 3OXZA 4HVSA 2VTIA 4LYNA 2OFUA 3FC1X 2J4ZA 3V6SA 4CMTA 4C4GA 1GNGA 3KMMA 4TYEA 1XJDA 1PXOA 3F61A 2YWVA 1Q3DA 4IAYA 3CQWA 3MY0A 4U44A 3NNVA 5AP4A 3Q3BA 4YNEA 3ZXZA 3U55A 4CKJA 5KBRA 1GZNA 4RIYA 3RPOA 2OBJA 4MNEB 4KBCA 4R6VA 4U40A 1ATPE 2J7TA 3E62A 4F0IA 4EOQA 1H0WA 4FT0A 2CN5A 1M7NA 4CFFA 4O1OA 1YHSA 3BU6A 3HYHA 4D2PA 4UWBA 5EM5A 3QF9A 4DTKA 4KS7A 3R01A 2Y9QA 4CGAA 2BR1A 4HNIA 4NT4A 4XLIA 2VTHA 4ZSEA 2O63A 1G5SA 4FF8A 2GQSA 2PULA 2C69A 4Y85A 1U46A 4IBMA 4BI0A 3LCSA 4CRLA 2VWZA 2ZM1A 3KXXA 2WMUA 3VRYA 5FEDA 1J1BA 2V62A 3PG1A 3A2CA 3AOXA 3DBQA 3OT3A 4GH2A 3CQUA 1YDTE 3HDNA 3TNIA 1URWA 3UMXA 5L2TA 4PDPA 2FYSA 4NJ3A 4XG8A 2FH9A 4EORA 2OGVA 2BZJA 2YFXA 2WHBA 2G01A 4FKTA 3WF8A 5HU9A 1O6LA 2QLUA 2UV2A 4UV0A 5FTOA 4TYJA 4FYNA 4C57A 5DGZA 1YXXA 3OEFX
chains in the Genus database with same CATH superfamily
4LQMA 4R3CA 2BIKB 3JR1A 3Q2JA 4UEUA 5IQBA 1F5QA 4BGHA 1ZOHA 1K3AA 3V5JA 4YHTA 4CSVA 3EZRA 3QUPA 4FKLA 4NZWB 4J98A 2OZOA 2VTOA 3WF7A 3UGCA 2IZRA 5TOZA 2IJMA 2WXVA 3EIDA 3QCXA 2X4ZA 2YCSA 3D2KA 4G5JA 4O4BB 5HBHA 2OZAA 3HA6A 5ETIA 3VAPA 3C0GA 3TKUA 5E8XA 2J5EA 3UYSA 2BROA 3LFCA 4RJ7A 2VV9A 5HVJA 4AA0A 4X6QC 3K5UA 4YTFA 4F70A 1FMOE 2C3LA 4BGQA 2ZDTA 4WBBB 4EQMA 2C6KA 3PDTA 2CGXA 4TYHA 3QX2A 3Q4TA 4UXQA 4CLIA 2XK6A 3KULA 5FTQA 3A8WA 3P5KA 1TQMA 4RMZA 4J53A 2X39A 4QDEA 1Q8UA 5CYIA 4FK6A 2YERA 3ZO3A 4HVDA 4M7IA 4U42A 5CF4A 4KKHA 2VNWA 1H28A 5J9YA 1YVJA 3P23A 3VJNA 1LR4A 5HNBA 5GIOE 2F4JA 4NWMA 4PTEA 4GIHA 4QMVA 3V6RA 2GS6A 2QG7A 4G3GA 4BC6A 3VJOA 1BUHA 1ZRZA 4JQ8A 3Q9XA 3QRUA 1JSUA 4O1PA 4Y5QA 4BTJA 2W17A 4ERWA 2H9VA 4Z9LA 4F6WA 3W0SA 4RVMA 5JFSA 4QP9A 4RVKA 2YZLA 1PMEA 3GCPA 3BE9A 4PPAA 4BDEA 3GC9A 2XH5A 4ZY4A 3QCSA 2XAOA 1ZWSA 4ANBA 4ANLA 1XH4A 4GU9A 3MPTA 1Z57A 4YSMA 3PFYA 2EXMA 3KVXA 2OF2A 5HE3A 4I41A 4BFMA 4ANQA 1G8KA 2UVXA 3WZKA 3JPVA 4E6QA 1U54A 2ZB1A 5DEYA 2B9FA 3RHKA 3TTIA 4Y73A 5EYCA 3EL8A 4FVQA 3DLSA 3Q5IA 3POZA 3AQVA 4GMYA 4IVDA 3R21A 5KMNA 3T9TA 3FXXA 3QZFA 2XRUA 3A99A 4FNWA 3VS4A 4DH3A 3SOAA 5C8NA 2WTKC 2YWPA 3HP5A 4FNYA 4O6EA 1MQBA 1B39A 2YEXA 3PVBA 2UZVA 1Q3WA 3R6XA 5L2IA 5DYJA 3VONA 2BILB 2E9UA 2VWWA 4M68A 4MUQA 3JVRA 4AOTA 3LE6A 4BI1A 4J97A 2B54A 3FL5A 4G17A 3QYWA 4YZ9A 3RBWA 4AN2A 4ARKA 4OTGA 3NFFB 3DDPA 5DIAA 5IA2A 5ITAA 3IG7A 1YDRE 4CYIA 3VHEA 4D2RA 3NCGA 2XMYA 3WYXA 5ACKA 5J7HA 4WSYA 2EVAA 4IB3A 1B38A 5HTCA 5FUTA 2CKPA 4B99A 1Z9XA 2WTDA 2KULA 4CNHA 3OY1A 2XARA 3BU5A 3NW7A 3NW5A 4K8AA 4DH8A 4UMRA 4NIFA 1PMUA 2ZMCA 3BGZA 1K9AA 4F7SA 5BVNA 4K1BA 1Q99A 3ENHA 4C59A 3VS1A 3WZDA 2W1CA 3BLAA 1YHVA 2FB8A 3DK6A 5A54A 4DE4A 4EZ3A 5FM3A 5BYLA 5C4KA 3ALNA 4FSYA 2I0HA 3L9LA 4EK8A 3TNPC 3K3JA 3DXQA 3CIKA 1JVPP 1H24A 1Y91A 4IC7A 4C0TA 4C4IA 2UVZA 3UMWA 3ITZA 4M67A 4O38A 5E8UA 3TUDA 4LRJA 1XMLA 4FJVA 4F9CA 4NM0A 4RA5A 2JIUA 2OJGA 4NEUA 1ZARA 5IUGA 4YC8A 2VX0A 3F3TA 2PZ5A 2G9XA 1Q97A 3F3VA 2QOCA 4QYHA 4QYYA 4NM5A 3LZBA 5ANDA 3AKLA 3UJGA 4ENXA 2QD9A 4IXPA 4TW9A 3RK9A 2PVMA 1YW2A 2O65A 4GEOA 5AM7A 4E4LA 4YTHA 2XS0A 3OEZA 3RTPA 1Q4LA 3FLWA 2JAMA 3QQFA 4FZAB 1JQHA 4DFXE 5LWMA 3S0OA 4JBPA 2XYNA 4WA9A 4FKVA 4MQ1A 4E8AA 1UU3A 2R2PA 3OY3A 1XWSA 3P08A 3PSBA 2J90A 3S4QA 5TE0A 4U0IA 3BLHA 3FWQA 4AS0A 4O7TA 1R3CA 2OIBA 5KMJA 2IVUA 4Q5EA 5FDXA 4HYIA 2JFLA 4XNEA 2CMWA 2IVSA 4Z55A 2XRWA 1UU9A 2QCSA 4JDJA 3TNQB 2UZUE 4OTRA 3U9CA 4ACGA 4GCJA 4EQCA 4KS8A 2XK8A 3DB6A 4CZYB 2X6DA 3C4CA 5FRIA 4EKKA 4P90A 4ONAA 2XEZA 2B0QA 3EFLA 3GCVA 1Z5MA 2W1HA 4MF1A 4GJ3A 3FSKA 3L9NA 4CV9A 1U5QA 5E9EA 5AV2A 5EW8A 3RCJA 4A9SA 4BB4A 3QHWA 3ZRMA 3DK3A 3RALA 5AUZA 4UZHA 3C51A 4MK0A 4P4CA 3V04A 2CLQA 4XRLA 2PVHA 1BLXA 3D83A 3MIAA 2ITXA 3PWYA 4XYFA 4ZTRA 3ZSHA 4BCJA 4BKYA 3F5GA 3RPRA 5AX3A 3UPXA 5C4LA 4EOKA 3ZLSA 2YDJA 4JDHA 4MYGA 4USEA 4DTAA 1PXNA 3NYNA 3PSDA 3D94A 3SW7A 4YPSA 2PL0A 3K5VA 4RJ5A 5F20A 5KKRC 2W5HA 4G9CA 2VTAA 4GK4A 4U3YA 2QHMA 5CZHA 2VO7A 4Q9ZA 5EKNA 3TTJA 4X21A 5M4FA 2GTNA 3QUEA 4ACCA 4W9WA 4O7SA 2OIQA 3G9NA 3PE2A 3LM0A 2H96A 4PNIA 4FG7A 2HZ4A 5B2LA 4JXFA 4BDHA 2W5AA 4G6NA 4KA3A 5HOAA 3W2RA 5BV3A 3CPCA 4L7FA 4RLLA 3QRJA 2XJ1A 3PYYA 3ZZEA 2W0JA 2F57A 5HTBA 5ICPA 4RJ4A 5I9VA 5M57A 5FP5A 3DY7A 4RC3A 4AGWA 3R22A 4I24A 5J7BA 4JG8A 2HZ0A 3H0ZA 5I3OA 2WGJA 2Z7SA 4Y5HA 3KREA 5AUYA 1AD5A 4CMOA 3MH3A 3IOPA 4FT7A 3TYKA 4U8ZA 5E1SA 4LL5A 4NCTA 3HGKA 1R1WA 3U4UA 4CVAA 3R9OA 4DG3E 3W8QA 4IC8A 4KRCA 5JK3A 4QP7A 1QPDA 1REJA 4AW2A 4APCA 4Y83A 3HV3A 5AP1A 1BI7A 2JKQA 2RFDA 3QQHA 4F65A 4KABA 5CU3A 4EJNA 4D1ZA 5AR5A 1JKLA 1VLRA 4YTCA 4PMTA 1Q24A 3B8QA 4GYIA 1H25A 3RWQA 2BIYA 3VS5A 5BNJA 5HTIA 4GKHA 1JKSA 1YI3A 1BMKA 4J1RA 3TI1A 2C6LA 2VX1A 2XNMA 5ANIA 2B55A 2QR7A 2WNTA 4RSSA 3TUBA 1G3NA 1E9HA 5M51A 3S3IA 1XH6A 4A4OA 2R3RA 1H08A 4IM3A 3UVPA 5F4NA 1GZ8A 3MVMA 2Z7LA 4I4EA 4UMPA 5J5SA 4BKJA 3ZFXA 2GNLA 4IEBA 2PZRA 4XBUA 4N4SA 4B8MA 2YZAA 4RWLA 3PY0A 4OTWA 5D12A 4EONA 4AA5A 2VWVA 5CQWA 1W8CA 5KHWA 4QMPA 3F7ZA 4MXYA 2GPHA 4CMUA 3Q60A 5D7VA 5AADA 5AFVA 3PP1A 4FA2A 3HMNA 2XEYA 4FV6A 4DFNA 4ID7A 3TKHA 4BRXA 3CPBA 3FLZA 4TL0A 4F1OA 1V0PA 5JEBA 4G6LA 4D58A 3R1YA 3P1AA 3FLNC 2ZMDA 3HRCA 3CXWA 3LCDA 3OWPA 3DPKA 2BDFA 2QOHA 3FHRA 1YXUA 5DR6A 3GFWA 3Q4UA 4W4XA 3VS2A 1PRYA 5EQYA 3GI3A 4BDJA 2Z02A 1WBVA 4KIPA 2XM8A 1JOWB 4KBAA 4YPDA 5DHJA 4CTBA 3IGGA 2J2IB 3D9VA 3DU8A 3NGAA 4U45A 5AP7A 5HHWA 3SXSA 4DFLA 4C36A 4IAKA 4O7NA 4BTMA 5DT3A 5DR2A 5DEWA 2CCIA 2B7AA 2JDTA 3AC4A 3HLLA 2WTCA 3EFKA 3E63A 3FYJX 5LARA 5T68A 1ZYCA 5CSPA 3FLQA 4YC6A 3W16A 4GVJA 2E9VA 2QONA 5FM2A 3HP2A 3WOWA 2B4SB 3MSSA 4OR5A 4V01A 4Z16A 1UWJA 2BVAA 4L53A 4CQGA 3QRIA 3KA0A 1W84A 3B2WA 2HY0A 5CSWA 5CEKA 1XBAA 5CU0A 1H1PA 5AUXA 2VD5A 1W2DA 3ORIA 2QVSE 4FV7A 1YHWA 4MKCA 2BFXA 4IACA 4O0RA 5AJQA 4EZ7A 2GHMA 4F9WA 5BX0A 5JQ8A 3DBFA 4C34A 2BTSA 4FTAA 4RJ8A 3OTUA 5HE0A 2EUFB 4G1WA 2XNNA 4FTRA 3EN6A 1Y6AA 5KZIA 5C26A 1J3HA 5A4EA 5EOLA 4ASXA 4BVUA 3A7IA 3NLBA 4Z3VA 1KE9A 4FKPA 3KMWA 3MH2A 4JDIA 1JNKA 2JAVA 4YJQA 1UU8A 4E4NA 5J9LA 3DV3A 3NVKI 5BMSA 3R7VA 2OH4A 3C9WA 3FMMA 4QMTA 2G1TA 4QPAA 3DXNA 2B1PA 2CJMA 2A98A 4DGGA 2BKKA 3NUYA 2HK5A 4H58A 4ZJIA 3NRMA 3O8TA 3ZBFA 4ZMFA 3ORKA 3Q96A 4RVLA 4HVGA 3P79A 3A7JA 3PPKA 4JQ7A 3NYVA 4YZCA 4YJRA 5D1JA 2GHLA 4I21A 4TNBA 5HCYA 3ZLXA 3DOGA 4CFNA 4EH7A 3QQGA 4KIKA 3COMA 4PMMA 4D2TA 2R9SA 3QRKA 4E6AA 4KSPA 2XIYA 2ZAZA 3KFAA 5FD2A 5ANKA 4BL1A 3UQFA 3BL7A 3KN5A 1P4FA 4HZRA 1PXLA 4O7LA 3VS6A 2XK4A 5TT7A 4F6SA 3JY9A 4G3DA 3RZFA 4FSMA 1XKKA 5HCZA 5A3XA 4A9TA 4F9YA 1ZZ2A 2VWYA 4FZ6A 5LJJA 2BRGA 3PJ3A 4M15A 3GC8A 2GNGA 4JBVA 3UBDA 1GIHA 2QU5A 4O4FA 3V5TA 4LV7A 3O17A 4D4SA 4PQNA 2FSTX 2ZVAA 3SX9A 2C5OA 2NO3A 3L8SA 4D2VA 2QO2A 4AXEA 3BYVA 3QTWA 2VTTA 4FZ7A 1R78A 4FOCA 4MXOA 3UP2A 1NVSA 4RIWA 3C7QA 4BDIA 3FMLA 4CCUA 4DH7A 4IJ9A 4EOSA 3TV6A 1OIUA 2R3MA 2UW9A 2HELA 2R3KA 5CVFA 1IA9A 4QQCA 2HWPA 4HNFA 4FTUA 1O6YA 4LMNA 2VTSA 5KMMA 3TJDA 3FYKX 4JNWA 3ZC6A 4B6LA 4DAWA 5IMXA 3HMPA 1OIYA 4EH3A 3O7LB 1IA8A 4LOOA 5J87A 1DM2A 4C58A 3AGMA 4B7TA 4S30A 1OL7A 3SC1A 3MVJA 2PK9A 4W9XA 2Y4PA 4NTTA 4MNFA 2ITZA 3V5PA 1FGKA 2WIHA 4XH6A 1OKWA 4GYGA 4QP2A 1YI6A 1SVGA 3ET7A 4YBKA 5M53A 4S31A 3DBCA 4YJNA 5JFVA 4IWDA 4FKQA 3VF9A 2WU7A 5TF9A 1WVWA 2P0CA 3UO4A 2CNUA 1UVRA 3AMYA 2IZSA 2QNJA 4IX5A 5L6OA 3NMUF 2VTRA 2XIRA 3PA5A 1Q61A 3L9MA 3UPZA 5L3AA 1H00A 4PL3A 5CNNA 2XCHA 4XJ0A 1ZMWA 3LFDA 3PLAE 3NEWA 3VUIA 3KRXA 4IWPA 4LOPA 2CPKE 2JC6A 3SG8A 3LCKA 1E1VA 2VZ6A 3FZSA 4UN0C 3QU0A 5JN2A 5H3QA 3WIKA 5CAPA 1APME 1UKHA 3CC6A 3IW6A 3D7ZA 3PTGA 3GFEA 5GZ9A 3CTHA 3S1HA 4DA5A 4C02A 4E4XA 3KXNA 3ZM4A 4Y8DA 4IM0A 2XA4A 4HGTA 3MY5A 3FMHA 4DGLC 3AT4A 2X2KA 3NUNA 3QQJA 1CM8A 5K4JA 4GS6A 4CFMA 2HCKA 2W4OA 2VTLA 4FV9A 5HIDA 5DOSA 3I1AA 3QGWA 3UOHA 2CSNA 2PMLX 5HE1A 3IS5A 5EM6A 3O8UA 4PRJA 3CY2A 4GKIA 3DZQA 3R63A 2UZEA 2UZLA 4H1MA 2O3PA 2YIRA 4FKWA 4Z7GA 1A9UA 4MVFA 5ANOA 2W96B 3TXOA 4MX9A 3ODYX 4ZSAA 3IPHA 4M14A 4FEVA 4DDIA 3KRJA 2Y7JA 4IWQA 5KZ0A 1Y57A 4V04A 2WMWA 3F3WA 4X3FC 4R3PA 2RG5A 4TWCA 4XOZA 3FXZA 3HRBA 3RAIA 5JGAA 4DEHA 4QMYA 1ZY5A 4UB7A 4F7NA 3LFNA 3HECA 5EG3A 5IQDA 2GS7A 4TTHB 2W9ZB 2YACA 3IDPA 3UNJA 3VUDA 1SYKA 4GU6A 5CNOA 4B0GA 4L68A 4EHVA 3R9RA 5M4CA 4C3RA 3EFWA 3LQ8A 2ETKA 4UBAA 4MWIA 1XBBA 5M44A 5I9WA 2ITPA 4AX8A 1OPJA 3KXZA 3O7LD 3QZIA 2J0KA 4LFIA 2JLDA 3H9OA 4TT7A 3DAJA 4XG9A 1B6CB 1KOBA 3D5WA 5C8KA 4L52A 5B2KA 2ONLC 2ZV2A 5HU3A 1MP8A 3PRIA 4E6CA 3AC5A 3DKGA 4MQ2A 3GU5A 2O2UA 4QPMA 3VQHA 3OOGA 3ORXA 5J5TA 1DAWA 3VUHA 4D55A 3EQBA 2PVFA 3U4WA 1H26A 4KRDA 5AP2A 3Q4CA 2UZDA 3GU4A 3Q5ZA 4H39A 5F95A 4AE9A 2H8HA 5LMKC 2HAKA 4CXAA 1PKDA 2QR8A 3F3UA 3FAAA 4J7BA 4X2GA 5LVPA 3PXQA 4N0SA 5IDPA 1VJYA 2I1MA 2YA9A 3HRFA 5D11A 3R8PA 5E8SA 1T45A 3N51A 4WO5A 4O27B 1KE8A 4XEYA 5HNGA 3ZEWA 3SXRA 3LCTA 5CXZA 3LFAA 2WEIA 2WIPA 1H4LA 4GV1A 4OT5A 3BRBA 4PDOA 4FSRA 2W7XA 2GMXA 4O7RA 2BPMA 2C6MA 2HXLA 3BV2A 3NUXA 3OS3A 3R8LA 3RMFA 4C7TA 2VWIA 3L8PA 3R7YA 4DEAA 2XK9A 3UOKA 2ZM4A 4ASEA 4DGOA 5IQIA 5A14A 3Q4ZA 3CGFA 3QA8A 3D7TB 3PA4A 5K5NA 3OWJA 2YDKA 5EI6A 3BQRA 2ITTA 2JITA 3BYSA 3OBJA 4L42A 1HCKA 2O64A 3BQCA 4QMXA 4RA4A 5CX9A 1WBPA 5AV1A 3W2PA 5ANGA 3UNKA 3HMMA 4OW8A 4JBQA 2GFCA 4F7JA 4C4EA 1IRKA 4DG0E 5A4TA 2C47A 4JRVA 5E7RA 4FIJA 3TNWA 3Q9WA 3OCTA 3BGQA 4A9YA 4EOPA 4IX4A 3GEQA 2X4FA 2QURA 2IZUA 2X8DA 3KRRA 4GG5A 2WQEA 1TZDA 2CGVA 4L7SA 4MD9E 5E8WA 4ZXTA 5K5XA 4L8MA 4IAIA 3IW7A 4IZAA 3UODA 1PXPA 2FA2A 1KWPA 3GC7A 3E93A 5A4CA 2R4BA 1J1CA 2BALA 3AC2A 4FIHA 5EYKA 1KOAA 4KBKA 2C3IB 3AC3A 3DCVA 2HXQA 3Q2MA 4GUEA 1KSWA 2IPXA 1H01A 1WVXA 1OB3A 1URCA 3G5DA 2UUEA 3RAKA 2BAKA 4FL2A 5CTPA 2HWOA 5EK7A 1WCCA 3MI9A 3KVWA 4R7BA 4FKIA 5AP6A 5CU6A 4YURA 1JPAA 3AKJA 3ACKA 4QMZA 5CEPA 4F1TA 4F9BA 3I6UA 2C6DA 4IDVA 2F2UA 3ETAA 3QKMA 2ITYA 1R0EA 4NFMA 2UZBA 2C30A 4BZDA 3H30A 4DLIA 3HX4A 4E5AX 1PY5A 3TEIA 5M56A 5HG8A 4GT5A 1OKZA 3BE2A 2QOKA 3NSZA 2H34A 1IAHA 2W9FB 4OBOA 1YDSE 1AQ1A 5I9XA 3KXMA 1YWVA 4H36A 1JLUE 4O0WA 4OT6A 5H8BA 4RX7A 3VRZA 3FEGA 4K2RA 2UW6A 4KIQA 5GIPE 3AC8A 3ORTA 4QMQA 4CG8A 3FSFA 3L8VA 1Q8TA 3TM0A 3CSVA 1PHKA 3R7EA 1ZYSA 4IE9A 5GINE 3GCUA 3MGYA 5IA1A 4M69A 3MVHA 2QU6A 3VVHA 1VR2A 4ANMA 1RE8A 3AD5A 5HG9A 4AT4A 3PXZA 2OZAB 4L6QA 4EBWA 2YCFA 4FTTA 3HL7A 3F5PA 5DH3A 2WZJA 4NUSA 4NW6A 3N4VA 4DF3A 4FBXA 5EOBA 4C4HA 3PUFC 2ERKA 2O5KA 3G33A 3NAXA 4PWNA 1VEBA 2A19B 3QA0A 2ZV7A 4QEBA 3BHUA 3BGPA 2WB8A 3R00A 1XO2B 3R8VA 3E87A 4EWHA 2W06A 4M0YA 4TYHB 3LMGA 1OI9A 3LFBA 5ANEA 3KULB 2OJJA 4WNOA 3V5QA 2JKMA 2IO6A 4AE6A 4FSTA 2WMSA 3W0RA 4C2WA 4QTDA 3TIZA 3BL9A 2EU9A 2X7FA 3ORMA 4X2JA 3DJ5A 1JWHA 3EL7A 3IK3A 3WARA 4CLJA 2RG6A 1W2CA 5GNKA 5IA3A 3BBTB 4A4LA 5E8YA 4FSQA 4AA4A 5AR8A 4BDGA 2C6EA 3Q6UA 3SA0A 1NT2A 1J91A 3QCYA 4O7ZA 3ENMA 5FQDC 3OZ6A 2OKRA 3D0EA 1NY3A 4ZSLA 5CF6A 3T3VA 3ZONA 1PYXA 1P5EA 3PG3A 2VRXA 4RBLA 3OVVA 4R1VA 1XH9A 2CN8A 5AP5A 2XK7A 3G2FA 1M2RA 4BCMA 2PZYA 4GK3A 4RPVA 4BWKA 2DWBA 4TYIA 4FSNA 2HOGA 4C8BA 3W33A 1WAKA 3MB6A 4XV9A 5AWMA 4QNAA 5BVDA 3EQHA 3VUMA 1M17A 2CLXA 3TACA 5IH5A 3A7FA 2R0IA 4O0XA 2GNIA 5GHVA 4XG2A 1U54B 4ALWA 4BCGA 4DH5A 4AZVA 4X0MA 1XH8A 4MBLA 5CAOA 4EHGA 3FKLA 2RIOA 3I7CA 5CF5A 5CSHA 4I20A 2ZV8A 3G0FA 4R1YA 4DLJA 3KEXA 4QO9A 2J6MA 3WILA 2EXEA 2FSLX 5BUJA 3I60A 5LMBA 4AT5A 2JFMA 5JRQA 4EC9A 4D9UA 4JDKA 4FIEA 2F9GA 4KUJA 3KF4A 4O7VA 3T8OA 5HQ0A 2Z7RA 5CI7A 2J9MA 3GXLA 3S95A 4C61A 5K0XA 1QCFA 5JMSA 5A9UA 4YHJA 3ATSA 2JDRA 2OICA 2Q0BA 1X8BA 5IQHA 4H3PA 4JI9A 2WMXA 3EQDA 3FDNA 1FVTA 2KTYA 4AZFA 3WZEA 4E5BA 1SZMA 4RFMA 5KBQA 4XUFA 3EN7A 3SV0A 3FQEA 4NIFB 3MS9A 1WBOA 2R7IA 3G6GA 2YLFA 3R1SA 4GJ2A 4I92A 3QCQA 4KINA 4UWCA 4XX9A 5CT0A 1YOMA 5C9CA 5FXQA 2VWXA 3ULIA 3WF5A 4CYJA 2Y6OA 3OC1A 4OAVB 4RLKA 4RZVA 4YJUA 5AV4A 2GTMA 3PPJA 5HLWA 5CZIA 1IASA 3F5UA 2YCRA 3H4JA 3PVGA 4AGCA 1SVHA 5F94A 2BZKB 1IAJA 4ANOA 3C4EA 5ANJA 3VBYA 1XH7A 3P7CA 3I7BA 2ITUA 3RPVA 3SOCA 4ZZOA 2X2LA 4WOVA 2AEGA 1ZXEA 4E7WA 3IKAA 4WKQA 3AC1A 5HO8A 1L8TA 5AAEA 5IEYA 2RFSA 4F0FA 4EOOA 2ZJWA 1OUKA 4ZY6A 3TIYA 4I5PA 4AZWA 5J9ZA 5IQCA 3UZTA 4MD8E 4FV3A 2XP2A 3C4XA 3MTLA 4RX9A 4TZRA 2UW3A 3AGLA 5I0BA 1LEWA 3UIMA 4B8LA 3EWHA 4DBXA 3CGOA 4XOYA 3SDJA 2V7OA 2JIIA 2WTVA 1CDKA 3PJ1A 4KB8A 2NYAA 4AQCA 2XIXA 3F3ZA 3TZ9A 2C6OA 4YSJA 4CQEA 4FT3A 2R3HA 3QTSA 3NX8A 5H9BA 5H8EA 5ETFA 4B4LA 1RJBA 4QMOA 5IZFA 4QT1A 2XBAA 3TZ7A 5EYMA 3BWJA 1WBTA 2P4IA 3IDCA 3WE8A 3R83A 4FKOA 4PMPA 3DGKA 4YLKA 3QC9A 3IW8A 2NP8A 4I0TA 3NW6A 2OJ9A 3VUKA 4QP4A 3PY3A 4S33A 5IA0A 3E8NA 4BDCA 4F63A 5AEPA 4G3CA 3GNIB 3I4BA 2FVDA 1JAMA 4GW8A 4WUNA 3ZUVA 4M8TA 4BWPA 2UW4A 3OXTA 2VWUA 4ITJA 4AAYA 1H1QA 4B9DA 2W1IA 5IQAA 2R0UA 2W1EA 3LFEA 4YZBA 5J95A 4AZEA 3QD0A 3R9DA 5G1XA 4S32A 2WFYA 3R73A 2UZOA 2PUUA 4I6QA 5FWKK 4OLIA 3EH9A 2ACXA 3CQEA 2C0TA 4ZS0A 5KMLA 1UKIA 3RVGA 3FZOA 5HLNA 3UC4A 4RG0A 4C2VA 1YXTA 4D1SA 3PVUA 2BRBA 1TFFA 4YNOA 4L3PA 3UIBA 2X1NA 1S9JA 4I0SA 3FQSA 5CVHA 4C38A 3DBEA 4EOLA 4O7YA 3COIA 4PL4A 4F08A 4JX7A 5EQPA 1KE7A 2QOBA 4FZDB 3CTJA 4BI2A 2WMAA 2WEVA 3Q53A 3I0OA 2IW9A 3RK7A 2XM9A 4Q5HA 3CCNA 4U97A 2WQBA 3WYYA 5AM6A 5IA4A 4WG4A 4XP0A 4ASZA 5FXRA 5IDNA 5GJFA 1TQPA 5EHLA 2OI4X 3HV5A 4EHEA 4ORKA 3PJ8A 4LUDA 3AG9A 3VHKA 5E4HA 3CY3A 4WBOA 2C0OA 2XIKA 4MHAA 4YJPA 3JUHA 2Y4IB 4RJ6A 3PIYA 4CZTA 3I81A 1BX6A 3VBVA 3ZOSA 4KAOA 1Q8ZA 3L1SA 3FUPA 3MA3A 1W2FA 4E6DA 3C4ZA 2PMNX 4ZTSA 1V0BA 1GJOA 3VBTA 5IUHA 3DXPA 4E5WA 2DYLA 4D4RA 4XP2A 4MTAA 5K0KA 5JT2A 4I6HA 2R64A 4IFCA 3QL8A 4JT3A 3V01A 3ZSGA 5EI2A 1H1WA 4ZZMA 3TZ8A 3QD3A 2W5BA 4BYIA 3FMDA 1YI4A 2FO0A 3JY0A 2GFSA 2I6LA 2BHEA 4S34A 4YJSA 3ZYAA 3FKOA 4IVCA 3LQ5A 3EKKA 5CQUA 1FMKA 4LGHA 4A9RA 1J7LA 1KUTA 4E20A 1R39A 3THBA 4EL9A 5DNRA 2EXCX 3C1XA 2HYYA 2X0GA 3MJ1A 3OROA 4FUYA 4USDA 5FBNC 4TWNA 4X6RA 3RI1A 3RPYA 2C5VA 3EB0A 3ROCA 2GDOA 5DR9A 3OMVA 4WIHA 2QKRA 5HIBA 4ERKA 4M97A 4DFUA 4GRBA 4G31A 4X2NA 4HPUE 4EK4A 4QP3A 3R2BA 3LOKA 3KKVA 2PE2A 1P14A 3DA6A 4C4FA 2JKOA 3RKBA 4L43A 4U3ZA 4O81A 4KD1A 1GAGA 2XKEA 5D41A 5LCKA 3BCEA 5HNIX 3SAYA 4BWXA 5HX8A 5AR7A 4GVAA 4DGMA 3WF9A 1EH4A 2VTNA 3PVWA 3HV4A 4WNPA 3MBLA 4Y46A 3VUTA 3UYTA 5DVRA 2CCHA 4YZDA 3ZDUA 2GHGA 4CZUA 4I93A 4R5YA 3C4FA 4FKSA 3R9HA 2CHLA 4ASDA 3GENA 4BHZA 3IW5A 4MXZA 5L8KA 3O0GA 3CD8A 3AT3A 3MFTA 2PVJA 3VS3A 5HCXA 3LXLA 3OCSA 2YDIA 4JR3A 4IM2A 3QHRA 3F6XA 1FOTA 3MIYA 1JKKA 4JIAA 4G5PA 3QD4A 5CT7A 3UZRA 3ZFMA 1W98A 4D5HA 1PXJA 2OFVA 3JYAA 3LJ0A 1SNXA 3FY0A 4QNYA 4FV5A 2YN8A 3I0QA 1GIIA 2C0IA 4IZ5A 2OH0E 1YRPA 4V0GA 4K9YA 3PJ2A 1PW2A 3LXPA 4BN1A 4F6UA 1Y6BA 5LQFA 2HW7A 5CWZA 5M4UA 2XALA 3BHYA 3O51A 3PFQA 5B2MA 4FVRA 3GU6A 4AOJA 4DINA 3O71A 5CSXA 2QHNA 3NAYA 4FKJA 4FT5A 5H8GA 4D1XA 5DWRA 3FZPA 4GT3A 3ZUTA 3UIUA