1GZOA

Structure of protein kinase b unphosphorylated
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
296
structure length
271
Chain Sequence
KVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAMKILRKEVIVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFHLSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-BETA SERINE/THREONINE PROTEIN KINASE
publication title Molecular Mechanism for the Regulation of Protein Kinase B/Akt by Hydrophobic Motif Phosphorylation
pubmed doi rcsb
source organism Homo sapiens
molecule tags Kinase
total genus 68
structure length 271
sequence length 296
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1gzoA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1gzoA02
5EG3A 1H1WA 3TNQB 1OPKA 3BPRA 4RFYA 3BHHA 4FKJA 5CU4A 4CTCA 2RFEA 3NDMA 1PMNA 4UXLA 4CKJA 3KY2A 3KRJA 4O1OA 5M4IA 5DFPA 5BYLA 3A2CA 3BGQA 3IW6A 5CNOA 4ZOGA 4O7ZA 3C51A 4RX5A 1J3HA 3FPQA 1NVSA 2BILB 3ROYA 3UO6A 4OR5A 2WMWA 4AQCA 3DXQA 2JKQA 5IEYA 2VTAA 3S95A 4CMUA 1M2RA 2FGIA 4K8AA 2XJ0A 3GCQA 2JDSA 2BPMA 4EH4A 3QC9A 1UNHA 4TL0A 5CF8A 1FMOE 1KE9A 5A3XA 4RJ7A 4K33A 4ENXA 3U4WA 5AUUA 2YCSA 4LMUA 2B52A 4DF3A 3BI6A 4L67A 2BAJA 4GSBA 3SAYA 3ULZA 5CU3A 2PL0A 3LFFA 3LMGA 3LQ3A 1JKLA 2OZOA 3S2PA 4ZTHA 4RFZA 3VS7A 2YN8A 3VVHA 3ZBXA 2HZ0A 4D55A 4EBWA 2J5EA 3NUNA 4K1BA 5A6OA 3CKWA 3SG9A 3DKOA 5FEEA 3WF6A 4O7RA 2XZSA 4O7WA 2XYNA 4MNEA 3UQGA 4MX9A 5IF1A 4EHZA 2YIQA 3LFEA 3CGFA 4IB0A 4Y72A 3RINA 4D4VA 3ACKA 4D4YA 4BCNA 3FLSA 2HW7A 4WRSA 3AOXA 4QMLA 3F3TA 3R1NA 5J8IA 2OXXA 3UDBA 4AGWA 4ERKA 4QQJA 4G17A 5KCVA 1J7IA 4ACMA 3HP2A 3NEWA 5I9XA 4N57A 3G9LX 3HNGA 2C6OA 1Q8UA 3ORXA 2R9SA 4L7FA 3DBFA 3G6HA 2A1AB 2UZNA 3JPVA 5J95A 2V7AA 3KK9A 5DBXA 1XJDA 3BU5A 2PUNA 4EOMA 2W17A 1B6CB 3H3CA 3NYOA 3V5JA 4ERWA 2HY81 2PYWA 3FXZA 2BAQA 2VN9A 5EYCA 2R0IA 3OD6X 3CY3A 5AR3A 4PY1A 2YM6A 5EOLA 2QG5A 2HAKA 3FZTA 3W8LA 1FINA 2UW7A 3NPCA 4PL4A 4YJNA 4JQ7A 4FVRA 2R5TA 2W05A 5FP6A 4DINA 2VGPA 3AC1A 4EH2A 4FKSA 3OOGA 4FIHA 2UVZA 5KE0A 4JBPA 4ONAA 5CI7A 4ID7A 3GFWA 4YTFA 2EWAA 4R5SA 3BLHA 3UNZA 5DEYA 4XBRA 3S4QA 1WBPA 2RKUA 4AW2A 3OW4A 5TR6A 5GZAA 2W1ZA 2R7BA 5K5XA 3R73A 3MY5A 4FL3A 3D0EA 2ZB0A 2ITUA 4HZSA 4P7EA 5CNNA 5KZ0A 1DAWA 3PVGA 4CVAA 2J6MA 1Q8TA 1GZKA 4OW8A 3DBQA 4D0XA 3AQVA 3IECA 3ZTXA 2YERA 2CGUA 4GL9A 5A4EA 3U6JA 4EONA 3F9NA 2VTHA 2QD9A 3RZFA 2XVDA 1K2PA 3OT8A 5FWKK 3R21A 3VF9A 4QMWA 3VBWA 5IQCA 3DLSA 2WTKB 2C47A 2YDIA 5EYDA 5LQFA 2VTQA 2R3PA 4PTGA 3KN5A 4I93A 2VUWA 1FMKA 4YC3A 2I7QA 3KRRA 2NRYA 3FPMA 3BV2A 3CQWA 4PL5A 5T6KA 3C5IA 5FQDC 3L8SA 2JKKA 3A60A 4BB4A 5DI1A 1SZMA 2J5FA 3LFDA 4TRLA 1YQJA 4DFZE 3IQ7A 1JWHA 5CI6A 3CKXA 5HQ0A 3MVMA 4L3LA 2BZHB 5E8ZA 2XK4A 4RT7A 1JNKA 3C7QA 3EOCA 4ZMFA 4U79A 2OGVA 4DEIA 5M4UA 4F0IA 3EZRA 2DQ7X 4DEGA 1MQ4A 2HOGA 5HEZA 2YIXA 4QQ5A 5KMLA 4DCEA 2OI4X 4X3FB 3GFEA 3F3VA 3GGFA 2JDTA 4OTWA 1R1WA 4KIKB 2OF2A 4FV1A 3DAJA 5AP2A 5BUJA 4WUAA 4FUXA 2F4JA 5IQEA 4JS8A 2OW3A 2A19B 4KRDA 4FNXA 5DNRA 5DA3A 5DT3A 2B9HA 3HMIA 3P79A 5F9EA 5IQDA 4XG6A 5BVNA 4CLJA 3MDYA 5DRBA 5EW9A 1RE8A 2QODA 3OY1A 1Z9XA 4DFUA 4YHJA 2OICA 3PIZA 5HE0A 5D41A 4AOTA 5HIEA 4EI4A 3RTPA 3NUXA 5CU2A 3FEGA 1PKDA 2WXVA 4D0WA 3SKCA 3GC0A 3O8UA 3SXRA 3OG7A 3ZRMA 3GQLA 4KBKA 3RHKA 4TNBA 4XLVA 3IKAA 2FSMX 3EQDA 4B99A 3LFAA 4RG0A 3AC4A 3ZHPC 3I60A 2VD5A 4OTFA 4E3CA 3UIMA 3R7EA 2AUHA 3U9CA 4FSMA 5L3AA 1ZLTA 1OL2A 4GK2A 3AD6A 4BDKA 4EORA 3KL8A 2CMWA 4OUCA 4I94A 2OF4A 1ZMUA 4JR3A 4S31A 5HORA 3HA6A 2J0MB 3BYSA 4BHZA 4C58A 4ZTNA 4IB1A 4M7IA 2Y4IC 4WA9A 2J0JA 2IW8A 4ENYA 3QUDA 4IWPA 3ZCLA 3GCUA 5AMNA 4IDVA 2B7AA 4XBUA 5H8BA 5IEXA 2C6TA 4QP9A 4DGMA 4MD9E 3Q53A 1Y8YA 3QZFA 2VTTA 3DDQA 4DLIA 3Q9WA 4BTMA 4IX4A 5HNGA 3M1SA 3CP9A 3UP2A 4QMXA 4MXYA 3E88A 5LOHA 4HVHA 4DLJA 2AC5A 4BVUA 3D5VA 2YHVA 4WO5A 4BL1A 2WTJA 3P4KA 4DGGA 5CAUA 3P1AA 4EJNA 4YPSA 3EN6A 3QQUA 3I7BA 4WRGA 5LVLA 3MTFA 2DUVA 4N70A 2O5KA 3C4XA 2F49A 2C3IB 4IC8A 2ZM1A 3UE4A 3VQUA 4MF0A 4FSUA 2VZ6A 2XKEA 4HVDA 4Y83A 5HIBA 4NJDA 3MFSA 1V0BA 3QD0A 4NYEA 3MVJA 3AC5A 3QALE 4R8QA 3QTSA 4E6DA 1Q8WA 3MB6A 5AX9A 3UTOA 4FV7A 2J4ZA 3QYZA 3MGYA 4RVKA 3KMWA 2XK9A 3KFAA 4I6QA 4XYFA 4EZ7A 3PWYA 3BEGA 1O6LA 4II5A 3PA3A 3AC8A 2C0IA 4MXZA 3RWQA 2CKQA 4A9UA 3MA3A 4L9IA 3DJ5A 5HICA 2OU7A 2WIPA 1NT2A 3WF9A 2OSCA 5B2MA 3VUDA 3R0TA 5HG8A 3ZZEA 3LE6A 1PY5A 3HEGA 3R02A 4BWPA 3D7ZA 2RGPA 4IX6A 3UMWA 2LAVA 1G8AA 2ZV2A 1LR4A 3MWUA 4O2PA 4K6ZA 4XG4A 3ZONA 4IEBA 5AUTA 3NS9A 3UQCA 5LVPA 1TKIA 4P2KA 3RAIA 4TN6A 5IEVA 3KXNA 5L8KA 1JVPP 3PUPA 2UZOA 4NKSA 3TV7A 1FOTA 5I4NA 3ZLXA 3O7LB 4A4OA 3JXWA 3OHTA 4L6QA 4EHEA 4U0IA 2VWVA 4MKCA 1MRVA 3RHXA 4F99A 3RCJA 1Q3DA 2W9ZB 5J9ZA 4ANMA 3V6RA 4F08A 3F7WA 3V6SA 3ZBFA 2FYSA 2Y6MA 2ZM4A 4OTRA 2P4IA 4U80A 3DB6A 5HE3A 2PUPA 2Y8OA 5L8JA 3TT0A 4E26A 5IMXA 1OECA 3DDPA 5C4LA 2YAKA 3OEFX 4PF4A 4I5HA 4AT3A 4RC2A 1ND4A 1OKZA 3OUKA 2W9FB 3TV6A 3LJ0A 2BDFA 3QQFA 4FSRA 5CEKA 3DS6A 2IO6A 2LGCA 1APME 1PJKA 5EHLA 2YITA 3EKNA 5CS6A 1T46A 1WVXA 2XBJA 5F20A 5HCZA 3W1FA 3IDCA 4GMYA 3W2OA 5M4FA 3HUBA 3VS4A 3S0OA 2EU9A 3C0IA 2ITOA 1UU8A 4W4YA 2WMBA 4FEXA 2QURA 3DFCB 2CLQA 4IZ5A 4ITJA 4L01A 4V04A 3Q5ZA 3GU6A 5JZNA 2IVTA 1VYZA 4ACDA 3KRWA 4EK5A 5EI8A 3N51A 2X6EA 4FOBA 1L3RE 3HZTA 3PRIA 4NFMA 3VS5A 5CF4A 5J7HA 3Q4ZA 4FIFA 3ZLWA 3G0FA 5M44A 2R4BA 4R1VA 3UIBA 5FXRA 1YI6A 1FVTA 3Q9ZA 3DAEA 3QTWA 4F7SA 1JPAA 2UW9A 3MY0A 4BCHA 3CPBA 3CTJA 3RAKA 1K3AA 5GIOE 3R8UA 2GQSA 2XBAA 3GP0A 2QR8A 4KNBA 1UU3A 4UBAA 4FTLA 4QT1A 2XNOA 3VRZA 4BZNA 3VULA 1CSNA 4R3CA 4UMUA 4P90A 2H96A 3QFVA 3RZBA 1Y57A 4V05A 2UZBA 4G31A 4UMRA 4ANQA 4AZVA 4C33A 3ZO3A 5I3RA 5FTOA 4PQNA 4RJ6A 2O63A 2JLDA 5FEDA 4ZSJA 2R3FA 4B7TA 4NIFB 5E92A 3C50A 1OUYA 1TQIA 3KMMA 3C13A 4IHPA 3NWWA 4YJTA 3TKIA 3UG1A 3IW8A 4UALA 4JG8A 3C0HA 3SLSA 3UPXA 4R77A 4O0YA 4H1JA 4DH1A 4H3PA 4EOLA 4EQUA 4F6SA 4B8LA 2CDZA 1SVGA 4D9TA 4RWJA 2OZAB 3D7TB 3A4OX 3OWJA 4LL5A 2GNFA 3F88A 3MIAA 4ZY4A 4KIQA 3VQHA 2QC6A 5AEPA 2FSOX 4FGBA 5A14A 4ZS0A 4J98A 3HMMA 1JSUA 1ZOHA 2YLFA 2R7IA 5KHXA 3THBA 4A9TA 3UODA 4F1TA 1U46A 4MQ1A 2YDJA 3AT2A 4YJRA 3L8XA 3TIZA 4D58A 3TM0A 4DEDA 2HZ4A 3JS2A 4FTJA 2W1DA 2YCQA 2QHMA 3GI3A 1A06A 3DQXA 3IONA 4QP6A 3SDJA 4G9CA 4S34A 1OL6A 2CSNA 4NSTA 4YJSA 3H0YA 5AP3A 1KV1A 3KXGA 4FKLA 3RGFA 1WBOA 4F9AA 4DH3A 4XG7A 4L3JA 4QMOA 2PMOX 2PE0A 1RW8A 5IG1A 5C01A 2IPXA 2VWXA 3COHA 2DS1A 4JQEA 1TVOA 4UY9A 1Q3WA 3I5ZA 4QYGA 5K3YA 1BI7A 2NNWB 1SM2A 2J0LA 3MPAA 3ZOSA 3OP5A 1LP4A 4D5HA 2XK8A 2YIWA 3DOGA 5A46A 3SW4A 4MBJA 3OW3A 1Q41A 4RC3A 2UW0A 5J1VA 4C4EA 3CE3A 2WMVA 5B7VA 3RM7A 1B38A 5IA3A 2E9VA 3QZIA 1JKKA 1YI3A 4XEYA 2UVYA 1WBSA 3QYWA 5IMEA 2ESMA 5KZIA 4F1MA 3BEAA 3ZFMA 3R2BA 1BMKA 3QTIA 4G3FA 2PPQA 3COIA 5CT0A 3SRVA 2VTPA 4L00A 3HMOA 4UEUA 4CZUA 4XRJA 5AAFA 3NR9A 2FH9A 3MB7A 4N6YA 3COKA 2R3QA 3AC3A 2CCHA 2IVVA 2FA2A 3HDMA 5EHYA 1XH7A 3UJGA 2XK3A 1YOMA 3BZ3A 3CR0A 5JRSA 4FODA 4EL9A 3OUNB 3MN3A 1URWA 3EQIA 4ZAUA 2X1NA 3HLLA 4DCAA 4USDA 3ORZA 4IFGA 5AR8A 4EKLA 4CQEA 3T3VA 4N6ZA 3PA5A 1GOLA 2YWVA 4BKJA 3BHVA 3QXPA 5FRIA 4P5QA 1XH5A 2BCJA 5E8SA 5J1WA 3JYAA 3GC8A 1S9IA 4PUZA 3NLBA 4B8MA 5GIPE 4FIIA 3MJ1A 3FZOA 3FQHA 3GU8A 3DXNA 5HE1A 5CU0A 3BGZA 3R30A 2W1HA 2J0IA 5CSPA 3UO5A 1VJYA 4U5JA 1VEBA 4HPUE 4YO4A 3FXWA 4RJ5A 2IZSA 3KXMA 3LVPA 1HOWA 2AC3A 2X7FA 4AOIA 2HWOA 4TZRA 4WG5A 5D10A 4EBVA 4UN0C 4BR3A 4OTIA 3TZ9A 4U3YA 3R8ZA 4R5YA 1RDQE 5DRDA 4TYJA 4D2SA 4EH5A 5G1XA 4QPSA 2H34A 1IAJA 3MS9A 2EXEA 5E1SA 2R0UA 5LMAA 4AG8A 4AE6A 3VIDA 4NM7A 3RMFA 4ZLYA 3G33A 4XX9A 3FZSA 5LARA 3JUHA 4OTGA 4E4XA 3A99A 4RGJA 4IX3A 5CXHA 5CEPA 3FUPA 3DGKA 3LXNA 4I5PA 4IM3A 1PYEA 2VV9A 5L6WL 2OJGA 3PLSA 5KMJA 1ZAOA 2YIYA 4IDTA 4A07A 4AGUA 3TTJA 5M57A 4M0ZA 2WMXA 3KCFA 5GZ8A 3ATSA 3W2CA 3PJ3A 3Q5IA 4G6NA 3LFBA 3QWJA 5CXZA 3LJ2A 3QGWA 3LAUA 2QO9A 1W98A 4ALUA 4LOOA 5ETCA 3E3BX 4ASDA 3K3IA 5HG5A 4F7JA 1SVEA 4TWOA 3QLFA 4FV5A 4LRKA 5AJQA 4YTCA 2O64A 4AP7A 3R00A 2P0CA 5CY3A 5EM8A 4BDBA 5FXSA 5K5NA 4DH5A 3ZDUA 2X0GA 3KU2A 1J7UA 1U5RA 2F2UA 3S3IA 2VAGA 3VN9A 1M17A 5ETIA 1TQMA 4QYHA 5M08A 3Q9XA 2CKPA 4GIHA 2UZTA 4AN3A 5BPYA 4W8EA 5ITAA 4KSPA 3L9MA 3R7VA 5CEIA 1H1RA 5EM7A 4ORKA 2ZMDA 4CZYB 3KF7A 4GW8A 4E73A 4NU1A 3QGYA 5HTIA 1VR2A 4YJOA 5JQ8A 3ENMA 2PTKA 4DFNA 1YWVA 1AD5A 4PNIA 2VTOA 3UVQA 5CALA 2ZM3A 3CXWA 2BZIB 3JY0A 1WBNA 3OBGA 3R9DA 2Y7JA 3MW1A 2RFDA 4J53A 5I9ZA 3FWQA 1RQQA 5AM7A 1T45A 3DBDA 3RPRA 1H8FA 2ITVA 5AWMA 4XG3A 4PV0A 2J90A 3ZU7A 4GT3A 2RF9A 3FI8A 2GS6A 2YIRA 5K0KA 4GS6A 4OTQA 4DTBA 1CM8A 2R3LA 3UZTA 3MH2A 1ZYSA 1P5EA 2F9GA 4FL2A 5AR4A 3T9IA 3UQFA 3V8TA 3SGCA 3NSZA 4JR7A 4UWYA 3UIXA 3ALOA 4KS8A 5H2UA 3CTHA 1R78A 2X2KA 5C26A 1H27A 4NCTC 4AA4A 3FMMA 1DAYA 3A7IA 5HI2A 3WOWA 4GUEA 3VS1A 4OBPA 4YJVA 3G2FA 3K2LA 3C4ZA 3I0QA 4JJRA 4O1PA 3KRLA 3LCKA 3QRKA 4K0YA 4G5PA 3P9JA 1I09A 2WTWA 3CIKA 2R3NA 4U8ZA 5CU6A 2AYPA 2WMTA 4ZTLA 3WARA 4BDIA 4YBJA 2GU8A 4ZJJA 3UOLA 2Y9QA 4HCTA 1YRPA 3K5VA 3KQ7A 3QRIA 4IAFA 2QOCA 4FV6A 4E6CA 1OBDA 3DKGA 3HKOA 3FYKX 2A2AA 4JIKA 2VU3A 2Z2WA 4TY1A 3GUBA 4DC2A 4GG7A 4YU2A 2XRUA 4IADA 5JMSA 4YP8A 2W4OA 1UU9A 2GDOA 3ODYX 5IZFA 4RWIA 4EHGA 3NUAA 3R01A 3NYXA 4TTHB 1CKJA 4NEUA 4FIJA 3UIUA 3KXHA 3EFWA 4GRBA 3C1XA 5IUIA 3WF7A 2PZPA 3LXKA 2JGZA 2CNQA 3PG3A 3GEQA 3ZRKA 2PVNA 2X2MA 3OS3A 5I9VA 3GVUA 1PXPA 4O0SA 4C61A 4BBEA 3EKKA 4KINA 4QP1A 3F6XA 4L45A 4QPAA 4D2WA 3PDTA 5E8XA 3FZPA 1YWNA 4K11A 2XKDA 1SNXA 4XV9A 4LI5A 3FY0A 3PY3A 3ORTA 2XKCA 2ZJWA 4LGHA 2BHEA 2VNWA 3UC3A 5EQPA 2DWBA 2YM7A 1ZRZA 5AAEA 4IZYA 3F61A 4ZS4A 5DT0A 1SVHA 1YDRE 2OWBA 4NWMA 1UWHA 1Z57A 1VYWA 5BVEA 3UC4A 3WF5A 2V5QA 2GTNA 4ZXTA 4EK4A 3CC6A 1UWJA 2JBOA 3VS2A 2RIOA 4KBCA 5KHWA 4DBXA 1KE8A 2QOHA 5M53A 1JSTA 3C4WA 3RALA 3V8WA 3C4EA 4GK4A 2C0OA 4DGLC 2PY3A 1U4DA 2GTMA 4M66A 1HCLA 3FJQE 1LUFA 2E9UA 3NNXA 4DHFA 1BUHA 4TT7A 5LMKC 5LVMA 2ZV7A 3C4FA 5CQWA 1ERKA 4E4LA 3EJ1A 2I1MA 4HJOA 2X2LA 2UVXA 3EL8A 4H58A 3PP0A 1HCKA 4O0XA 3QCSA 4IAIA 4RIWB 2PE1A 4LM5A 2QOFA 3VBVA 3FZRA 4E1ZA 1MRUA 4JLCA 3VBTA 3VC4A 5D12A 3N4TA 4GUBA 2VWZA 3H10A 3W10A 5DHJA 3Q2MA 3UYTA 4EZ3A 5HNIX 1H1PA 4F09A 1XQZA 3E62A 4LUEA 2OIDA 5BYZA 4EZ5A 4I0SA 5HU9A 2E9PA 1QCFA 1ZZLA 2BRGA 4GFGA 4GVJA 2VNYA 4IFCA 4IB5A 4NW6A 1Y6BA 2G1TA 3U9NA 4EUUA 2HELA 5KMIA 3EB0A 3QCQA 4M15A 4FSQA 4NCTA 2B54A 2C5XA 4CEGA 2IVUA 5HX8A 4RJ3A 2VWYA 3ID6C 5CVGA 5HBHA 3ZM9A 4BF2A 3CCNA 4D1ZA 5HNBA 3Q04A 4HNIA 4CRSA 5BX0A 5IQHA 3FY2A 3I5NA 2XIRA 3LQ5A 5D7VA 4D1XA 1NXKA 4FKOA 4ANBA 4CFUA 1CTPE 2XKFA 3H4JA 5F95A 3V5QA 3RVGA 4M13A 4YZNA 4CT2A 2V7OA 3ATTA 4HYHA 4O84A 5E8YA 1A48A 3SX9A 4DT9A 2XJ1A 1NA7A 4NK9A 3L8PA 4J71A 5TKDA 2OJIA 4IB3A 3ZYAA 4O0TA 2BZJA 3QKMA 3CLYA 4FTUA 1YHWA 4YZMA 5BUEA 3QX4A 5ANEA 4UYNA 5ANIA 4OAUC 4O7LA 4I3ZA 4XLIA 2QQ7A 3W16A 3OCBA 4M14A 4BGHA 3L9PA 2ACXA 3POOA 4LYNA 5ANGA 3TG1A 4RWKA 2XUUA 4XP0A 4G3EA 3OOMA 3RAHA 3Q96A 3IOKA 4I22A 1PXIA 2BFXA 1KOAA 2G2IA 3BRBA 3E8DA 2JC6A 4RX9A 5ETFA 1UA2A 3G90X 4X21A 3Q9YA 1KUTA 4L52A 4F7NA 3KK8A 3SVVA 1BL7A 4QO9A 3DXPA 1H26A 5BNJA 1REJA 1V0OA 1G8SA 2WGJA 3NUUA 3EQGA 4PMMA 5EQEA 4FEWA 2JIIA 3G51A 4O6EA 4C57A 4DAWA 4ZP5A 4LRJA 1BX6A 3VBXA 1SMHA 2GMXA 4IAZA 4XUFA 1S9JA 4M69A 3WZKA 4RLLA 5CF5A 3V5TA 3RI1A 3L8VA 3GU4A 3TKHA 2Y0AA 5JRQA 3VBYA 4X6QC 4ZTQA 5AR7A 3R04A 5AFVA 4AW5A 3QCXA 4RJ4A 5FM2A 2EB3A 3MY1A 3UOKA 1PRYA 4QP7A 4FC0A 3HX4A 5LMKA 3TWJA 4FT9A 4XOYA 4MXOA 5AR2A 4DYMA 5D11A 4FKWA 4G16A 5IU2A 2EXMA 3QA0A 4PNKA 2B53A 3T3UA 3U8WA 4HGSA 4HGLA 3HV3A 3WIKA 1O6YA 3FBVA 4YSMA 4IANA 4YR8A 3LKMA 3BYMA 4I4EA 3QKLA 5CASA 5CTPA 1H0VA 4IJ9A 5C8KA 2VRXA 2CGVA 4PPBA 4NZWB 3GT8A 2OJJA 4FX3A 2UZDA 2X7GA 2EXCX 4ASEA 2HYYA 3DCVA 4EWQA 2JFLA 3QX2A 5J79A 3ORNA 2W1IA 3FI3A 3SXSA 4U9AA 4ANNA 3P86A 2O8YA 2OKRA 3B8RA 1G3NA 3FDNA 3O8PA 1U54B 3DY7A 4M8TA 4P5ZA 2PUIA 4L8MA 3BHTA 2EB2A 3F3WA 4LV5A 4DE4A 4RX8A 4NFNA 4EK3A 4RSSA 2HZNA 2QNJA 5AIKA 1ZYJA 4L7SA 4S30A 5BQ0A 3R7YA 3JVSA 4BY9E 1G5SA 1J7LA 2WTKC 5A4TA 4BDFA 3D5WA 3QHRA 4I24A 2BRBA 2XM8A 3QZHA 3O23A 3PPKA 2BIYA 3CGOA 2YJRA 4J95A 4BFMA 4HW7A 2ZVAA 5DG5A 1MP8A 1Q5KA 4EH8A 2VTNA 2FB8A 5LMBA 4GCJA 3B2WA 4I5MA 4BCOA 5IQFA 4R3PA 4C37A 5JGDA 4RQKA 4XV1A 3SV0A 4DFLA 1FBNA 5J7BA 2YAAA 4C36A 2GNHA 3O51A 5I9UA 4D2TA 2RG6A 4U43A 4BCPA 4ITIA 5T3QA 3V51A 5F1ZA 3R9NA 3PY1A 4QPMA 2QONA 4FV4A 2ZB1A 3PTGA 4JNWA 4FT7A 3NNWA 4QP2A 5F4NA 4LOPA 4X3FC 5TOZA 5CAPA 5FP5A 2OXDA 3NW7A 1GZNA 3ETAA 2QOOA 1KE5A 2PMIA 4J8NA 4QNYA 4AE9A 2GHMA 5GJDA 3RPSA 2XNNA 2IW9A 4S2ZA 1QPEA 1B39A 3ROCA 2UZEA 2BIKB 4LG4A 2OH4A 1YOJA 3FLYA 4XS2A 4BTKA 3BCEA 5DE2A 3ZMMA 2HY0A 4FTMA 2CCIA 4QYFA 4PMPA 3DV3A 2WTCA 3QZGA 4OT6A 4OTPA 3NCZA 3FKLA 4KS7A 4Z9LA 5BMMA 3ZRLA 2WEVA 3SHEA 4FICA 4JDIA 3VW8A 1V1KA 5IKWA 4JAJA 4DG0E 4EOPA 4OT5A 3EQRA 3LOKA 4PRJA 2NRUA 4G6LA 4F65A 4BHNA 4D5KA 2UV2A 4EK6A 1XWSA 3ZFYA 2WEIA 3O2MA 4G5JA 3E8NA 1V0PA 4WBBB 4Q5EA 4MK0A 4CG9A 4NM5A 3TACA 4YMJA 4YUQA 3CBLA 4FNYA 4O38A 1DI9A 1F5QA 2ITNA 2W4JA 3I1AA 5ACBC 3DTCA 4OAVB 1LPUA 4AN9A 3ANQA 2YLEA 4O6LA 1Y6AA 2X8IA 2GNJA 2PUUA 3D2IA 4I20A 4IVCA 5CEOA 5DR6A 5FM3A 5LCKA 1YVJA 2PE2A 2PVRA 4ZJVA 4NM0A 2WPAA 4XV3A 4ASXA 2C6KA 2O3PA 1OB3A 5I5ZA 4MVFA 2CGXA 2F57A 4JDHA 4F4PA 3E7VA 4I1ZA 3NVMB 5A9UA 1DM2A 4JRNA 1IG1A 4ZTSA 4AZTA 2QI8A 5AV2A 4EOSA 4EH7A 5E8VA 2JAMA 2W99B 4U42A 3PJ1A 3VS0A 3W2SA 1GY3A 4HYIA 2WQOA 3Q4UA 4TYHB 4C2VA 4GU9A 2JBPA 4PWNA 2VWWA 3MH3A 4QD6A 5TE0A 4DEAA 1GNGA 4I6BA 1PMVA 2UW5A 4GT5A 4O22A 4WBOA 3PPZA 4O0RA 3RNYA 2BRNA 5CSXA 4DG3E 5A4QA 3EQCA 3AD5A 3LQ8A 2WD1A 4EK8A 4FV8A 1E1XA 1F3MC 2YACA 4GEOA 2C5VA 3FI4A 4Y8DA 3MYGA 3TUBA 4Z16A 2XIXA 4RIXB 1WAKA 5GNKA 2J2IB 1P4FA 4HCVA 1WBTA 4FTOA 3ZSHA 4YLLA 5EW3A 1W84A 4YNEA 3OEZA 3QLGA 5C8NA 1H08A 3MV5A 4GKHA 1KV2A 3BYVA 3KA0A 4CGAA 4AT5A 3ZLYA 4F6WA 2BVAA 5CAQA 5K0XA 3IG7A 4D4RA 2YJSA 5AX3A 1MRYA 2IZRA 2BTRA 4G6OA 2X39A 5AUZA 4I6HA 1KWPA 3E92A 4FG7A 4PX6A 5CZIA 4CD0A 3G5DA 3F69A 3OC1A 3TJDA 2QO7A 4IWQA 4CFFA 3Q6WA 3U87A 3K5UA 4F0FA 2F7EE 2OJFE 4FA2A 2E2BA 4EOKA 3NNVA 4X3FA 1YWRA 4CCUA 3RWPA 4BDHA 2C1BA 2IW6A 2VWBA 3AGMA 4FZAB 4KIKA 2XJ2A 5HG9A 3R9RA 3UVPA 3LFQA 5FDPA 2A4LA 3PG1A 5JKGA 4Z3VA 5DGZA 1FGKA 3PIYA 1IA8A 1IASA 4JXFA 3QUPA 1YHSA 3FI2A 2I40A 5AUWA 5K4IA 3R8LA 4BN1A 4E5BA 1U54A 4LQMA 1ZYCA 3BHUA 1YXXA 4FSYA 4BDAA 4ZZOA 3EYGA 4CMTA 4PDSA 2SRCA 4Q9ZA 2V55A 2RG5A 1YXTA 5CVFA 4NH1A 3PJ8A 3HMPA 1Q24A 4RA5A 3RP9A 2Z7RA 1ZYLA 2QG7A 4EYJA 5L6OA 2JKOA 1J1BA 3O71A 4FV2A 2X4FA 4C0TA 4C3PA 4Q5HA 3V8SA 3TDVA 2XK6A 3DAKA 3FE3A 3CS9A 3Q32A 2Z7QA 4ACCA 4BWKA 3QBNA 3W33A 2YABA 3LCTA 5JK3A 3LJ1A 3VUMA 3QRUA 3M11A 3GBZA 4O2ZA 5FBOA 1YXUA 4EH6A 4AA5A 2VTJA 4R78A 5FD2A 3QQKA 1XBBA 1H01A 3PSBA 4AUAA 4WG4A 4W8DA 4QP8A 5LCJA 5AAGA 4F9CA 1W83A 4ZMEA 3F3UA 4FT0A 3R8MA 5CF6A 1OL5A 4TKSA 3P08A 3P7BA 3OTVA 2VGOA 2C3KA 4D2VA 4O0VA 3OBJA 1ZMVA 2NPQA 3DNEA 3JR1A 4QMZA 1SYKA 4L43A 2XMYA 5DVRA 2ETMA 4FR4A 2OIBA 2QKWB 4XV2A 4RX7A 3EIDA 5HG7A 3ZLSA 1YI4A 4H3BA 4D2PA 5LXMA 1XBCA 4HOKA 1YHVA 1ZWSA 1Z5MA 3BBWA 4Z55A 4YHTA 3FQEA 4JT3A 3AG9A 4K2RA 3FLQA 4HGTA 2ERKA 2ZAZA 4GU6A 4RVMA 4D4SA 4DG2E 2ITTA 2WELA 3TXOA 2YZAA 4EHVA 3ZFXA 5AP7A 4OTDA 4Z7GA 4NW5A 3HRFA 3F2AA 1Q8YA 2WTIA 2CN5A 3R6XA 4G1WA 1GIHA 4F7LA 5HZNA 2OIQA 5HBJA 5ANKA 3OCSA 4AAAA 3EHAA 4J52A 4JI9A 4L42A 4QTAA 2WU6A 3UNJA 3HMNA 1H07A 2B9IA 2UW6A 3E8EA 3G9NA 4JX7A 5EH0A 3VRYA 2VX1A 2W96B 3LXLA 3QQLA 5EDPA 2BRHA 4IVBA 3QC4A 3WZUA 2J0KA 4BICA 4APPA 4F64A 1NY3A 2R64A 2ITYA 1XR1A 4UXQA 4LMNA 4ZSAA 5E8WA 3RPYA 3I4BA 5CSWA 5FDXA 3N4UA 3KXXA 2PZIA 2BALA 3RK9A 2JIVA 3JY9A 2V0DA 3BE9A 5EHOA 3VAPA 3TNIA 4BBMA 4AGCA 5M51A 3GU5A 4TWNA 3MVHA 4O7YA 4NJ3A 1EH4A 2C6MA 5FXQA 4BDJA 5GHVA 4QMPA 4B6LA 4FKGA 3QA8A 2G15A 1IEPA 4FTRA 4NM3A 3VS6A 4ANOA 3PY0A 5HO6A 5CLPA 5A4CA 4JIAA 4U45A 3V5WA 4PDYA 4O96A 2BDWA 3E63A 3QAME 5F94A 3WILA 2F2CB 3EQBA 3SXFA 5I3OA 4CV8A 5AM6A 1F0QA 3QQGA 4ZEGA 5J9YA 2WTDA 3TEIA 2A27A 5AP0A 2C6LA 4U97A 4BCQA 4UYAA 2BROA 3MBLA 2BKKA 2XCHA 2WU7A 3QD3A 4BIBA 4BTFA 4N0SA 5AR5A 4KABA 1ZOGA 3W55A 3RPVA 4XNEA 2Z8CA 3LFCA 3QTXA 4BIEA 3ZO2A 4CKIA 5AADA 3W32A 3R7OA 4QQTA 3R63A 3G6GA 2RSVA 4I5CA 3VNTA 3ZH8A 3HV6A 3KGAA 5J5TA 3HVCA 4RQVA 3IDPA 4AU8A 5FGKA 3UVRA 3W2RA 4CSVA 4QMNA 2B0QA 4FTCA 3HAVA 3FHRA 4YJPA 5CSVA 2JDRA 3HP5A 5BVKA 3FMKA 1NVQA 2WOTA 3FMNA 3FLNC 5EK7A 4BTJA 1XO2B 4FZ6A 4UWBA 3CPCA 4O7SA 2KULA 1PYXA 4ZTMA 1JOWB 2VTMA 4C3FA 2O2UA 4O27B 2WNTA 5GINE 3OWPA 4BKYA 4BYIA 2GFCA 2IVSA 3BLRA 5C8MA 3SOCA 3TN8A 4CLIA 2OFUA 5HU3A 5KNJA 3FL5A 2WOUA 3OXZA 5IQAA 1XH9A 2WFYA 3DKFA 2W5HA 3PXZA 4F63A 5E90A 5AA9A 3E3PA 4MEDA 2C30A 1H1QA 5DWRA 5AP5A 2XRWA 5BUIA 5J87A 4P4CA 5BMSA 5HHWA 4B0GA 5HIDA 1OVEA 5AUVA 3KRXA 4AACA 2GHLA 5IH6A 2R3GA 2BRMA 4DGNA 3DZOA 1FGIA 2WQEA 2C6EA 2GS2A 3LLTA 4E5WA 4GYGA 4I4FA 1PMEA 4JDJA 4GJ2A 4TYGA 4E93A 4IX5A 3PYYA 4GG5A 3QUEA 1UKHA 2IWIA 4M12A 4FKRA 4BZDA 1W7HA 4RFMA 4U41A 4EOJA 3O7LD 4ZY6A 1UNLA 5H3QA 5G6VA 4JRVA 4R7IA 4Z7HA 2R3IA 4MD7E 1UKIA 2OK1A 2R3RA 4MNEB 1M14A 2XCKA 4AT4A 1ZOEA 4CMOA 4CZTA 2RFSA 2Z60A 3CD3A 2NO3A 1QMZA 3E5AA 2I6LA 4IJPA 3WE4A 4CFWA 2CNUA 3F3ZA 1L8TA 3ZEPA 5L6PA 3OCTA 3LCDA 4XHKB 4YTHA 3BLQA 3GENA 4IAAA 4D1SA 3TNWA 4FSZA 3R9OA 4UZHA 4PMTA 4V01A 3UO4A 3CY2A 1GZOA 2ITXA 5B2KA 2R2PA 1PXLA 1YW2A 3CTQA 3QF9A 5DN3A 5BYYA 4NIFA 3AMYA 4FTNA 4DA5A 1PF8A 3EYHA 1NVRA 1TQPA 1W82A 4QYEA 5IUHA 2PVFA 5J5SA 3QQJA 2UZVA 4NTTA 2QKRA 1BKXA 5KMMA 2PVLA 4F0GA 4W9XA 4B9DA 4MNFA 3IO7A 1AQ1A 4C4JA 1OIQA 1H24A 1CDKA 2I0EA 4JAIA 5DR9A 4UB7A 1OITA 2GCDA 4FEQA 2OZAA 4RLKA 3D7TA 3OXIA 2FUMA 4J8MA 4UMQA 5EI6A 4ANLA 3D15A 3S00A 4QMVA 4DT8A 1JKTA 2HW6A 3BU3A 4FTAA 4MBLA 5JFSA 5EQYA 2C6IA 3E93A 4FVPA 3C9WA 4AX8A 2QVSE 1YXVA 2JDOA 4QYYA 4DEEA 1FPUA 2XIYA 4O0UA 3PXQA 3U6IA 1WVYA 4GV1A 4JBQA 5LVNA 4X3JA 2VWIA 3IW5A 4ZSEA 3P7AA 3S1HA 4U40A 3DZQA 3Q60A 3TNPC 5HVJA 3PA4A 4DEHA 1ZMWA 5GJGA 4FOCA 4AA0A 4M3QA 3H30A 4IZ7A 5JEBA 3FLWA 3A7FA 1JSVA 3MFTA 3MI9A 4TNDA 1R0PA 2C69A 4Y85A 3VHKA 4CXAA 3Q2JA 3T8OA 3VUTA 4D9UA 4WSYA 4N4SA 2JDVA 4XCUA 4X2KA 4FI1A 5A4LA 5JGAA 5CEQA 5TO8A 4C4IA 2W0JA 3QCYA 4WNPA 3FC2A 5EKOA 5CENA 5EYKA 2PSQA 1KSWA 3CSVA 3T9TA 4X2JA 4O21A 2ZV9A 4NT4A 5JT2A 4CG8A 4ZSLA 4IIRA 4RIOA 3BYOA 4RIYB 3AMAA 5DPVA 5CANA 4R1YA 2OXYA 4UX9A 3NW5A 2W1CA 2W1FA 5FG8A 1OUKA 1WBWA 1QL6A 4GFMA 3R1QA 5E91A 4YLKA 4EC8A 3EQHA 4TYEA 3EQFA 4QTBA 2C3JA 1JLUE 3MJ2A 4QP4A 4U7ZA 3OROA 4YBKA 3G15A 2PHKA 4I21A 5DR2A 2XNGA 3B2TA 5AV0A 1P2AA 5AV4A 3ENHA 5GZ9A 3DFAA 4JOAA 1ZARA 4S33A 4E4NA 2YFXA 3RPOA 1RJBA 3QTQA 5HLWA 3PE1A 2IJMA 2PVMA 5KX8A 5DYJA 2ZYBA 4HGEA 5ETAA 3A7JA 4WNMA 3VUIA 5ICPA 1R39A 2BUJA 2P33A 3F82A 3FMEA 2XNPA 3NIEA 5GJFA 2XA4A 1OIUA 5IISA 4BC6A 3EMGA 4O83A 2OH0E 3F5GA 3M42A 1H00A 5HE2A 3ZO4A 5E1EA 5HOAA 1CMKE 2O65A 4CNHA 1JKSA 2B55A 3DBCA 4GYIA 4G34A 4H36A 3FYJX 5IA1A 3NW6A 3NAYA 2XP2A 4WG3A 4AZFA 4BKZA 4FEUA 1YOLA 1AGWA 5AV1A 4HZRA 3MFUA 3GCSA 2XS0A 4YZCA 4XRLA 4BDEA 3UYSA 2XIKA 5C03A 3A62A 3P0MA 4FK3A 4J99A 4EWHA 4J1RA 4I0RA 2BFYA 3RK5A 4JDKA 1VZOA 4ZTRA 4S32A 5KUPA 3LM0A 5IDNA 3QQHA 2W1GA 5L8LA 2Q0NA 3O17A 4X7QA 4PDOA 4LRMA 4X0MA 3VBQA 3UBDA 1STCE 3EH9A 3BIZA 3VW6A 3GCVA 2GNIA 5DMZA 2CPKE 2HIWA 4PTCA 4LUDA 3UGCA 3A61A 4BI1A 4TXCA 4EEVA 3QRTA 4QMQA 4U44A 5CAOA 1OGUA 3CQUA 5LJJA 2W7XA 4FZDB 2OO8X 4OLIA 4TWPA 4C62A 4H3QA 5BVWA 5AUYA 5HO7A 4FKUA 3A8XA 3IW4A 2PVHA 3PVWA 1PMUA 3BV3A 2WTVA 2R3MA 4C59A 3WZDA 2WO6A 3DBEA 4ZJIA 2F7XE 3VWAA 3TKUA 2XK7A 2JAVA 4XG8A 4XH6A 1E1VA 3G0EA 4GIIA 4B4LA 4E6QA 3OWKA 4HVSA 2RL5A 4BDCA 5JGBA 2WHBA 3POZA 3HGKA 5IUGA 4X6RA 3DA6A 1PXNA 3R2YA 3EFLA 2XNEA 4XG2A 3NYNA 2JEDA 2JFMA 3UOHA 2P55A 5CAVA 4M68A 4FBXA 4L46A 5DH3A 2ETKA 5HLPA 3VUKA 5IA2A 2IZTA 2WZJA 5DEWA 4NL0A 1Q62A 1O6KA 2PVJA 1GIIA 4FUYA 4HYUA 1JAMA 3IW7A 3MSSA 3Q3BA 1H1SA 1H25A 2QOIA 5TT7A 4M97A 4JQ8A 2YM8A 4I6FA 4QP3A 2CLXA 4RWLA 2FO0A 2YZLA 2VO0A 3VUHA 5HX6A 3F66A 3TDWA 1OKVA 4FNZA 3FMLA 4WOVA 1OBGA 3GCPA 3W18A 3LIJA 4LGGA 3E7OA 3GOPA 5CX9A 5HCYA 5LWMA 4X2NA 3DT1A 1XHAA 3SQQA 4FVQA 4R6VA 2C5YA 2BMCA 4FG8A 5M07A 4AZSA 3H9OA 2W1EA 1U59A 3V5LA 3KMUA 2A0CX 4DH8A 4TW9A 2ITQA 3E87A 2QOQA 3EFKA 5HVYA 2ZDUA 3TNHA 4H05A 2WQBA 2YM3A 4APCA 3QTRA 5A54A 4KKGA 2BDJA 3JVRA 5E8TA 1BYGA 4MXCA 3U51A 3KXZA 4AF3A 4KRCA 3DK6A 3O8TA 2WIHA 3UMXA 1QPJA 3O96A 3B8QA 3D9VA 4IVAA 3TCPA 2GS7A 4YSJA 3IOPA 3F2RA 4KKEA 1OMWA 5K4JA 1XBAA 1UV5A 5IA5A 1XH6A 5CQUA 2PVKA 2YM4A 4MWIA 3AT3A 4MTAA 5HD4A 2HXLA 4FYNA 3D4QA 4D2RA 4BCIA 3PJCA 3SG8A 4FKQA 3LLAA 1ZZ2A 4RVLA 4A06A 1H0WA 2PZRA 1PXOA 2QU6A 4TPTA 2V22A 3CEKA 2DYLA 2ONLC 5LVOA 1OPLA 3ZUVA 4EKKA 5JFXA 1R0EA 2Q0BA 3TZ8A 4ZIMA 4FGRA 2ITWA 4RIYA 5B0XA 3EFJA 3HV5A 4AW1A 4GFOA 4JG6A 3UNKA 1R3CA 3GNIB 3HV7A 2PULA 2UUEA 3NUSA 4TYIA 3UOJA 3OXTA 4FMQA 3D5XA 5D9HA 4MXXA 3ZC5A 3NMUF 2Y4IB 4M67A 4MCVA 4AGDA 5AA8A 4YNOA 4FV3A 4IWDA 3SOAA 5CYIA 2NP8A 2C4GA 3F5XA 3I79A 3I81A 4A9SA 4BCJA 5JN2A 3ODZX 3PVBA 2QOBA 3A7HA 3DTWA 2B1PA 3PIXA 4CV9A 2BKZA 2C5NA 3EQPA 3LZBA 4E20A 3QRJA 4CCBA 1H4LA 1Q4LA 4IACA 4C35A 3HDNA 3PZHA 3LFNA 2HCKA 3QTUA 4C3RA 3FXXA 3PP1A 4G3GA 5L2SA 2WMRA 4L3PA 1X8BA 2WB8A 4X2GA 3CJFA 3ORLA 5KMKA 4QNAA 1YDSE 2WAJA 4FT5A 3PPJA 4UWCA 4J97A 4DN5A 4EC9A 1LEWA 4MXAA 2GSFA 4C7TA 4XG9A 2VWUA 5FTGA 3FAAA 3R83A 1PXJA 5M4CA 1DI8A 3RJCA 4DTKA 3REPA 2WMSA 3HAMA 3ZEWA 3LMHA 4RIWA 1A9UA 4WIHA 1OL7A 2XEZA 5L2TA 2YWPA 5I9YA 2I0HA 4WHZA 4YC6A 3KF4A 5KMNA 2VTIA 1PXMA 1K9AA 2BR1A 1KOBA 1M52A 4FTTA 5AV3A 2ITPA 3VF8A 4U3ZA 4CFMA 4RPVA 2IG7A 1P4OA 4FIEA 3MPTA 3W8QA 4BDGA 4ZZMA 2VX0A 3DB8A 2X8DA 4HPTE 4RC4A 3NX8A 4Y73A 4BRXA 4CTBA 5KBQA 3NCGA 4FKIA 3KN6A 5HVKA 2X81A 5DT4A 2PMNX 3ZC6A 3E8CA 3LFSA 3WZJA 4FSTA 4ALWA 4DH7A 1E9HA 1QPCA 3PZEA 3PWDA 4FKPA 4BCFA 4QMUA 4BI0A 4TWCA 4ZLZA 2F7ZE 5JFVA 1ZXEA 1IR3A 4G3DA 5KKRB 2XF0A 4JG7A 3DNDA 4Q9SA 2VTSA 4GK3A 4O7VA 5EYMA 4DEBA 4F9YA 4ZZNA 2C68A 2CHLA 2GNLA 2XM9A 4WT6A 3DKCA 4IM2A 4QTDA 4C4HA 4W9WA 1OM1A 4BI2A 4YGAA 4KWPA 3F2NA 3SD0A 3OZ6A 5EM6A 2XIZA 2YCFA 4RMZA 2RFNA 2ZDTA 4IWOA 4IE9A 3ULIA 4UV0A 2XYUA 4IXPA 2E9NA 3C4CA 4UMTA 4ITHA 3V01A 5K9IA 2R3HA 3QHWA 3FMHA 4AFEA 3VS3A 3KULB 3ZUUA 4Y95A 2B4SB 4JX3A 2OLCA 4A9YA 5CZHA 2VO3A 5IA4A 1UU7A 2ONLA 4NTSA 2QR7A 3TJCA 2J9MA 2WQNA 3ET7A 3R28A 2IZUA 3OY3A 3R7IA 4LL0A 4HNFA 4AW0A 4HCUA 5KO1A 1W0XC 3TV4A 2QHNA 4L68A 4A4XA 2Z7SA 3NZ0A 1XH8A 1Y8GA 3PXYA 4GJ3A 4MF1A 4PP7A 4ALVA 3DPKA 2YA9A 4H39A 2BAKA 2OJ9A 2UW8A 2V62A 3R7GA 5IH4A 5ACKA 4ZY5A 3PLAE 2E9OA 3FL4A 4BYJA 1BI8A 5EOBA 3PRFA 4MAOA 1YXSA 2QCSA 1Q97A 2CKEA 3DJ6A 3EZVA 4I92A 3K3JA 3MIYA 2CKOA 1WFCA 4QQCA 2XNMA 2I0YA 3SRVB 1JQHA 4QRCA 2HWPA 4YPDA 2P3GX 5KKRC 4LV8A 1WVWA 1PKGA 4KSQA 1XH4A 1PXKA 4OBOA 1OL1A 1FVVA 3P5KA 3H9FA 4YJUA 3GU7A 4BCGA 3GC7A 4WUNA 1PHKA 4DBNA 5AP1A 2I0VA 3ALNA 4YURA 4V0GB 3II5A 2FVDA 4FF8A 5HO8A 5FUTA 2GNGA 5JQ5A 4XJ0A 4WSQA 3NAXA 4E7WA 3L9NA 3DLZA 3ZDIA 3R9HA 4CFXA 3D14A 4DFYA 5LWNA 2W06A 3ZM4A 5I9WA 5ANDA 4D28A 3F5PA 3U4UA 5L4QA 2P2HA 2UZUE 3UPZA 5C27A 3D5UA 2X6DA 5M06A 3O0GA 3E64A 4CYJA 5M56A 3KVWA 2X9EA 2B9JA 1KE7A 3BX5A 4EQCA 4XP3A 3TL8A 3C0GA 4MYGA 4PL3A 2HXQA 5HESA 3PXKA 1IA9A 4KBAA 2QOKA 3F7ZA 4IC7A 3FSFA 2BTSA 2XNBA 1M2QA 5FEQA 5H8EA 4ARKA 4DITA 2P2IA 4KA3A 3ERKA 3UP7A 3I7CA 4M0YA 3WYXA 1ZYDA 4UMPA 3FMDA 2QOLA 2H6DA 3BQCA 3RM6A 2YDKA 4E5AX 1NW1A 4CRLA 3TTIA 3CD8A 4C38A 2X4ZA 1WZYA 3WYYA 3MH0A 4ZSGA 3QXOA 3WZEA 2B9FA 3KVXA 3QD2B 4F9WA 2VTRA 4A9RA 4ASZA 3R1SA 4FG9A 3RCDA 4GH2A 4YHFA 2UW3A 3KEXA 1OKYA 3V04A 1KE6A 4EOQA 5EDRA 5HBEA 3RNIA 4XOZA 4IAYA 5CEMA 3OT3A 4WKQA 4AOJA 1BL6A 3KC3A 3WF8A 1Q99A 3D83A 3DK7A 3PJ2A 4IMYA 4XP2A 4EQMA 4ANSA 5C1QB 4AWIA 1IRKA 5JH6A 1Y91A 3AC2A 4BGQA 3A7GA 4FSNA 3AXWA 5E4HA 4R7HA 2ETRA 3FZ1A 4K9YA 1ATPE 4HVIA 4Y46A 4FV9A 4C8BA 4G2FA 4YZBA 4BZOA 4WNOA 3IPHA 4OGRA 4O82A 3BELA 4IAKA 2X7OA 4WNKA 2EVAA 3I6UA 2PK9A 3LXPA 5AIRA 4EH9A 4H1MA 5IQGA 3C5UA 3LW0A 2R3OA 3MVLA 4FYOA 3GB2A 1GZ8A 2CN8A 3MESA 4ACGA 4MQ2A 5M55A 2PZ5A 3D94A 4MWHA 2VTLA 2Z7LA 3BWJA 4RBLA 3WBLA 3CJGA 4R3RA 4BBFA 3HRCA 3LPBA 1QPDA 3EN5A 5JFWA 3FLZA 5H9BA 4ZLOA 3LMIA 4M84A 5L2QA 3CQEA 3LHJA 2W4KA 3DJ7A 4FT3A 3ZZWA 4I23A 2OBJA 3FKOA 3I0OA 3O50A 4O7TA 1M2PA 4LGDA 3ORKA 4AZWA 2HK5A 4IBMA 1MQBA 2WMAA 3NVKI 4W4VA 5A6NA 5EKNA 3P23A 5E8UA 2ZMCA 3FV8A 3OF0A 5IPJA 5E9EA 2J51A 5EM5A 3R8PA 2GQGA 3GXLA 4U81A 3VJOA 4KIPA 2ERZE 2ZOQA 4A7CA 3PSDA 3UZRA 4FEVA 3FQSA 3BE2A 4W4WA 3ZS5A 5HD7A 2REIA 3W2PA 4JBVA 2X9FA 4I41A 1XKKA 5HTBA 3TUDA 2WQMA 3ZSIA 2C1AA 3VJNA 4CQGA 4CFVA 3KULA 3FHIA 1DS5A 3Q6UA 4KD1A 5IA0A 3KREA 4R7BA 4IH8A 5C4KA 3BYUA 4YC8A 4YTIA 4DFXE 3UZPA 5ANJA 4C4GA 1W8CA 2GQRA 1GIJA 5CWZA 4BIDA 3AGLA 3R1YA 4RJ8A 3N9XA 3FC1X 4NUSA 4RRVA 4BWXA 3BKBA 3MPMA 3RKBA 2BZKB 4IQ6A 5E7RA 4AZEA 2VO6A 3QWKA 4JL9A 3BHYA 1OIYA 5CSHA 3R71A 4TYHA 3RK7A 3Q4CA 4BCKA 5BVOA 3SA0A 3K54A 1FQ1B 4FTIA 4HVGA 4C4FA 2QU5A 2FSTX 3QD4A 3RBWA 4EYMA 4Y5HA 2GFSA 2UZLA 3QL8A 4BDDA 3GC9A 3AMBA 3PXFA 3QTZA 1UVRA 4W4XA 5AP4A 1FVRA 3L9LA 2C3LA 1Q8ZA 4RIXA 4F9BA 5JSMA 3F5UA 4QTCA 2XB7A 4E4MA 3WE8A 4FZFB 4J7BA 4G3CA 4OTHA 4DFBA 4C02A 1I44A 2YCRA 5IQIA 2WKMA 5I0BA 3EN4A 3OTUA 3H0ZA 2YEXA 3R22A 4NKAA 5EDQA 3TZMA 4EUTA 4IW0A 2Q83A 4F1OA 5L2WA 3UG2A 4V0GA 3GOKA 2YM5A 3NYVA 4FNWA 4PDPA 4MBIA 2CGWA 3R7UA 3P78A 3V5PA 4QOXA 4LFIA 3WIGA 4EJ7A 3IGOA 1SNUA 1REKA 3DK3A 5IH5A 5HCXA 4CFNA 3MA6A 4C34A 1URCA 2UZWE 3PXRA 2JKMA 4YO6A 3U6HA 4K77A 3BBTB 3VHEA 1J91A 4PTEA 3RAWA 2JD5A 1CKPA 2GHGA 2PMLX 3NUPA 4E8AA 2H8HA 2HENA 4MH7A 4IVDA 3ZXZA 5J9LA 4FK6A 2C5OA 4RA4A 3WI6A 4QTEA 1MUOA 2C0TA 3ITZA 2O0UA 3HV4A 4FZ7A 3BWFA 2ITZA 2OFVA 5KMOA 1ZY4A 3ANRA 4RVTA 3P7CA 3TI1A 3ACJA 4AXAA 3U54A 4WD5A 1WCCA 3IS5A 3QKKA 1P14A 3LM5A 3HL7A 4OBQA 5ANOA 2ZV8A 3I6WA 3ZXTA 4CT1A 1BLXA 5HLNA 5AUXA 4PPCA 1J1CA 5EI2A 3W2QA 3IDBA 3TUCA 3BQRA 3N4VA 1GJOA 2Y6OA 2XEYA 2UW4A 1WMKA 3KKVA 5HGIA 3NIZA 3Q4TA 3HA8A 4YZ9A 4PMSA 3SW7A 3HRBA 2XH5A 3AT4A 1WBVA 3H9RA 4YJQA 3HYHA 5T68A 2W5BA 3OCGA 4DGOA 4FIGA 2H9VA 4FE2A 3HECA 1OPJA 3ZSGA 4J96A 2G01A 4GT4A 3FKNA 4O91A 4EH3A 3VO3A 3TIYA 3IK3A 4O7NA 1OKWA 2WMUA 1OZ1A 3OVVA 3ZUTA 3PSCA 4XMOA 4O0WA 2BHHA 2G2HA 1U5QA 4QMYA 5EFQA 3DU8A 2J50A 4L44A 4F6UA 3OMVA 2R3KA 3PVUA 5B2LA 2G9XA 3DQWA 3U55A 3R8VA 3KB7A 4FL1A 3ORIA 3TZ7A 4C2WA 5FLFA 2VX3A 3OFMA 4O81A 1M7QA 4BGGA 2CNVA 2QLQA 1GAGA 5CT7A 4AFJA 4FKTA 2IN6A 2JITA 5HTCA 3ORPA 2OG8A 3MTLA 5AP6A 1OI9A 4FSWA 3M2WA 4CYIA 4PP9A 5D7AA 5DLSA 2J7TA 4EOOA 4CKRA 3ORMA 4AN2A 5FBNC 4ZK5A 5BVFA 2PU8A 2HZIA 3COMA 4MD8E 4KUJA 3BGPA 4I0TA 4BCMA 3FSKA 4HYSA 3QU0A 2PWLA 3VUGA 4KB8A 3NNUA 5JZJA 4RZVA 5C9CA 5IDPA 2GPHA 2YISA 3AD4A 4L53A 1H28A 5D1JA 2JIUA 4LOQA 2R3JA 3LCSA 2WMQA 2PVYA 4U6RA 3MFRA 4F70A 4GKIA 4GVAA 2X8EA 4UZDA 1CKIA 4FKVA 4KAOA 4ACHA 2Z02A 2VO7A 4RZWA 3PFQA 3Q52A 3IGGA 1ZY5A 4E6AA 4M69B 4YLJA 4YZDA 1M7NA 4QMTA 3GQIA 3BU6A 5M09A 5IQBA 5FTQA 2W5AA 4JVGA 3OWLA 1PW2A 2KTYA 3HUCA 3ZO1A 4AS0A 1YDTE 3D2KA 3MH1A 4MHAA 4X2FA 3ELJA 4Q2AA 4IM0A 3EN9A 4A4LA 4FV0A 4K18A 2CJMA 5TF9A 1JBPE 4USEA 3A8WA 3NRMA 1UNGA 3FMJA 3LCOA 4KIOA 4PPAA 4FTQA 4G9RA 3V3VA 5KBRA 4JBOA 4EOIA 3EWHA 4QMMA 3L1SA 1OIRA 1YKRA 5CVHA 5DIAA 5DOSA 3SC1A 2QLUA 5EW8A 5L2IA 5BVDA 4Y5QA 3NUYA 4KKHA 4USFA 2EUFB 2FSLX 3NGAA 1IAHA 4DTAA 1Q61A 2C6DA 3A4PA 2Y4PA 1LEZA 5HKMA 2PZYA 3EN7A 4QMSA 4FTKA 3EL7A 1O9UA 2G2FA 3KCKA 4IZAA 5H8GA 4O86A 2QO2A 3PE2A
chains in the Genus database with same CATH superfamily
5EG3A 1H1WA 3TNQB 1OPKA 3BPRA 4RFYA 3BHHA 4FKJA 5CU4A 4CTCA 2RFEA 3NDMA 1PMNA 4UXLA 4CKJA 3KY2A 3KRJA 4O1OA 5M4IA 5DFPA 5BYLA 3A2CA 3BGQA 3IW6A 5CNOA 4ZOGA 4O7ZA 3C51A 4RX5A 1J3HA 3FPQA 1NVSA 2BILB 3ROYA 3UO6A 4OR5A 2WMWA 4AQCA 3DXQA 2JKQA 5IEYA 2VTAA 3S95A 4CMUA 1M2RA 2FGIA 4K8AA 2XJ0A 3GCQA 2JDSA 2BPMA 4EH4A 3AKKA 3QC9A 1UNHA 4TL0A 5CF8A 1FMOE 1KE9A 5A3XA 4RJ7A 4K33A 4ENXA 3U4WA 5AUUA 2YCSA 4LMUA 2B52A 4DF3A 3BI6A 4L67A 2BAJA 4GSBA 3SAYA 3ULZA 5CU3A 2PL0A 3LFFA 3LMGA 3LQ3A 1JKLA 2OZOA 3S2PA 4ZTHA 4RFZA 3VS7A 2YN8A 3VVHA 3ZBXA 2HZ0A 4D55A 4EBWA 2J5EA 3NUNA 4K1BA 5A6OA 4AXCA 3CKWA 3SG9A 3DKOA 5FEEA 3WF6A 4O7RA 2XZSA 4O7WA 2XYNA 4MNEA 3UQGA 2X0QA 4MX9A 5IF1A 4EHZA 2YIQA 3LFEA 3CGFA 4IB0A 4Y72A 3RINA 4D4VA 3ACKA 4D4YA 4BCNA 3FLSA 2HW7A 4WRSA 3AOXA 4QMLA 3F3TA 3R1NA 5J8IA 2OXXA 3UDBA 4AGWA 4ERKA 4QQJA 4G17A 5KCVA 1J7IA 4ACMA 3HP2A 3NEWA 5I9XA 4N57A 3G9LX 3HNGA 2C6OA 1Q8UA 3ORXA 2R9SA 3W0SA 4L7FA 3DBFA 3G6HA 2A1AB 2UZNA 3JPVA 5J95A 2V7AA 3KK9A 5DBXA 1XJDA 3BU5A 2PUNA 4EOMA 2W17A 1B6CB 3H3CA 3NYOA 3V5JA 4ERWA 2HY81 2PYWA 3FXZA 2BAQA 2VN9A 5EYCA 2R0IA 3OD6X 3CY3A 5AR3A 4PY1A 2YM6A 5EOLA 2QG5A 2HAKA 3FZTA 3W8LA 1FINA 2UW7A 3NPCA 4PL4A 4YJNA 4JQ7A 4FVRA 2R5TA 2W05A 5FP6A 4DINA 2VGPA 3AC1A 4EH2A 4FKSA 3OOGA 4FIHA 2UVZA 5KE0A 4JBPA 4ONAA 5CI7A 4ID7A 3GFWA 4YTFA 2EWAA 4R5SA 3BLHA 3UNZA 5DEYA 4XBRA 3S4QA 1WBPA 2RKUA 4AW2A 1G8JA 3OW4A 5TR6A 5GZAA 2W1ZA 2R7BA 5K5XA 3R73A 3MY5A 4FL3A 3D0EA 2ZB0A 2ITUA 4HZSA 4P7EA 5CNNA 5KZ0A 1DAWA 3PVGA 4CVAA 2J6MA 1Q8TA 1GZKA 4OW8A 3DBQA 4D0XA 3AQVA 3IECA 3ZTXA 2YERA 2CGUA 4GL9A 5A4EA 3U6JA 4EONA 3F9NA 2VTHA 2QD9A 3RZFA 2XVDA 1K2PA 3OT8A 5FWKK 3R21A 3VF9A 4QMWA 3VBWA 5IQCA 3DLSA 2WTKB 2C47A 2YDIA 5EYDA 5LQFA 2VTQA 2R3PA 4PTGA 3KN5A 4I93A 2VUWA 1FMKA 4YC3A 2I7QA 3KRRA 2NRYA 3FPMA 3BV2A 3CQWA 4PL5A 5T6KA 3C5IA 5FQDC 3L8SA 2JKKA 3A60A 4BB4A 5DI1A 1SZMA 2J5FA 3LFDA 4TRLA 1YQJA 4DFZE 3IQ7A 4FRFA 1JWHA 5CI6A 3CKXA 5HQ0A 3MVMA 4L3LA 2BZHB 5E8ZA 2XK4A 4RT7A 1JNKA 3C7QA 3EOCA 4ZMFA 4U79A 2OGVA 4DEIA 5M4UA 4F0IA 3EZRA 2DQ7X 4DEGA 1MQ4A 2HOGA 5HEZA 2YIXA 4QQ5A 5KMLA 4DCEA 2OI4X 4X3FB 3GFEA 3F3VA 3GGFA 2JDTA 4OTWA 1R1WA 4KIKB 2OF2A 4FV1A 3DAJA 5AP2A 5BUJA 4WUAA 4FUXA 2F4JA 5IQEA 4JS8A 2OW3A 2A19B 4KRDA 4FNXA 5DNRA 5DA3A 5DT3A 2B9HA 3HMIA 3P79A 5F9EA 5IQDA 4XG6A 5BVNA 4CLJA 3MDYA 5DRBA 5EW9A 1RE8A 2QODA 3OY1A 1Z9XA 4DFUA 4YHJA 2OICA 3PIZA 5HE0A 5D41A 4AOTA 5HIEA 4LDTA 4EI4A 3RTPA 3NUXA 5CU2A 3FEGA 1PKDA 2WXVA 4D0WA 3SKCA 3GC0A 3O8UA 3SXRA 3OG7A 3ZRMA 3GQLA 4KBKA 3RHKA 4TNBA 4XLVA 3IKAA 2FSMX 3EQDA 4B99A 3LFAA 4RG0A 3AC4A 3ZHPC 3I60A 2VD5A 4OTFA 4E3CA 3UIMA 3R7EA 2AUHA 3U9CA 4FSMA 5L3AA 1ZLTA 1OL2A 4GK2A 3AD6A 4BDKA 4EORA 3KL8A 2CMWA 4OUCA 4I94A 2OF4A 3PUFC 1ZMUA 4JR3A 4S31A 5HORA 3HA6A 2J0MB 3BYSA 4BHZA 4C58A 4ZTNA 4IB1A 4M7IA 2Y4IC 4WA9A 2J0JA 2IW8A 4ENYA 3QUDA 4IWPA 3ZCLA 3GCUA 5AMNA 4IDVA 2B7AA 4XBUA 5H8BA 5IEXA 2C6TA 4QP9A 4DGMA 4MD9E 3Q53A 1Y8YA 3QZFA 2VTTA 3DDQA 4O4CA 4DLIA 3Q9WA 4BTMA 4IX4A 5HNGA 3M1SA 3CP9A 3UP2A 4QMXA 4MXYA 3E88A 5LOHA 4HVHA 4DLJA 2AC5A 4BVUA 3D5VA 2YHVA 4WO5A 4BL1A 2WTJA 3P4KA 4DGGA 5CAUA 3P1AA 4EJNA 4YPSA 3EN6A 3QQUA 3I7BA 4WRGA 5LVLA 3MTFA 2DUVA 4N70A 2O5KA 3C4XA 2F49A 2C3IB 4IC8A 2ZM1A 3UE4A 3VQUA 4MF0A 4FSUA 2VZ6A 2XKEA 4HVDA 4Y83A 5HIBA 4NJDA 3MFSA 1V0BA 3QD0A 4NYEA 3MVJA 3AC5A 3QALE 4R8QA 3QTSA 4E6DA 1Q8WA 3MB6A 5AX9A 3UTOA 4FV7A 3KIOC 2J4ZA 3QYZA 3MGYA 4RVKA 3KMWA 2XK9A 3KFAA 4I6QA 4XYFA 4EZ7A 3PWYA 3BEGA 1O6LA 4II5A 3PA3A 3AC8A 2C0IA 4MXZA 3RWQA 2CKQA 4A9UA 3MA3A 4L9IA 3DJ5A 5HICA 2OU7A 2WIPA 1NT2A 3WF9A 2OSCA 5B2MA 3VUDA 3R0TA 5HG8A 3ZZEA 3LE6A 1PY5A 3HEGA 3R02A 4BWPA 3D7ZA 2RGPA 4IX6A 3UMWA 2LAVA 1G8AA 2ZV2A 1LR4A 3MWUA 4O2PA 4K6ZA 4XG4A 3ZONA 4IEBA 5AUTA 3NS9A 3UQCA 5LVPA 1TKIA 4P2KA 3RAIA 4TN6A 5IEVA 3KXNA 5L8KA 1JVPP 3PUPA 3W0OA 2UZOA 4NKSA 3TV7A 1FOTA 5I4NA 3ZLXA 3O7LB 4A4OA 3JXWA 3OHTA 4L6QA 4EHEA 4U0IA 2VWVA 4MKCA 1MRVA 3RHXA 4F99A 3RCJA 1Q3DA 3NFGB 2W9ZB 5J9ZA 4ANMA 3V6RA 4F08A 3F7WA 3V6SA 3ZBFA 2FYSA 2Y6MA 2ZM4A 4OTRA 2P4IA 4U80A 3DB6A 5HE3A 2PUPA 2Y8OA 5L8JA 3TT0A 4E26A 5IMXA 1OECA 3DDPA 5C4LA 2YAKA 4I6LA 3OEFX 4PF4A 4I5HA 4AT3A 4RC2A 1ND4A 1OKZA 3OUKA 2W9FB 3TV6A 3LJ0A 2BDFA 3QQFA 4FSRA 5CEKA 3DS6A 2IO6A 2LGCA 1APME 1PJKA 5EHLA 2YITA 3EKNA 5CS6A 1T46A 1WVXA 2XBJA 5F20A 5HCZA 3W1FA 3IDCA 4GMYA 3W2OA 5M4FA 3HUBA 3VS4A 3S0OA 2EU9A 3C0IA 2ITOA 1UU8A 4W4YA 2WMBA 4FEXA 2QURA 3DFCB 4AQKA 2CLQA 4IZ5A 4ITJA 4L01A 4V04A 3Q5ZA 3GU6A 5JZNA 2IVTA 1VYZA 4ACDA 3KRWA 4EK5A 5EI8A 3N51A 2X6EA 4FOBA 1L3RE 3HZTA 3PRIA 4NFMA 3VS5A 5CF4A 5J7HA 3Q4ZA 4FIFA 3ZLWA 3G0FA 5M44A 2R4BA 4R1VA 3UIBA 5FXRA 1YI6A 1FVTA 3Q9ZA 3DAEA 3QTWA 4F7SA 1JPAA 2UW9A 5DMZA 3MY0A 4BCHA 3CPBA 3CTJA 3RAKA 1K3AA 5GIOE 3R8UA 2GQSA 2XBAA 3GP0A 2QR8A 4KNBA 1UU3A 4UBAA 4FTLA 4QT1A 2XNOA 3VRZA 4BZNA 4QDVA 3VULA 1CSNA 4R3CA 4UMUA 4P90A 2H96A 3QFVA 3RZBA 1Y57A 4V05A 2UZBA 4G31A 4UMRA 4ANQA 4AZVA 4C33A 3ZO3A 5I3RA 5FTOA 4PQNA 4RJ6A 2O63A 2JLDA 5FEDA 4ZSJA 2R3FA 4B7TA 4NIFB 5E92A 3C50A 1OUYA 1TQIA 3KMMA 3C13A 4IHPA 3NWWA 4YJTA 3TKIA 3UG1A 3IW8A 4UALA 4JG8A 3C0HA 3SLSA 3UPXA 4R77A 4O0YA 4H1JA 4DH1A 4H3PA 4EOLA 4EQUA 4F6SA 4B8LA 2CDZA 1SVGA 4D9TA 4RWJA 2OZAB 3D7TB 3A4OX 3OWJA 4LL5A 2GNFA 3F88A 3MIAA 4ZY4A 4KIQA 3VQHA 2QC6A 5AEPA 2FSOX 4FGBA 5A14A 4ZS0A 4J98A 3HMMA 1JSUA 1ZOHA 2YLFA 2R7IA 5KHXA 3THBA 4A9TA 3UODA 4F1TA 1U46A 4MQ1A 2YDJA 3AT2A 4YJRA 3L8XA 3TIZA 4D58A 3TM0A 4DEDA 2HZ4A 3JS2A 4FTJA 2W1DA 2YCQA 2QHMA 3GI3A 1A06A 3DQXA 3IONA 4QP6A 3SDJA 4G9CA 4S34A 1OL6A 2CSNA 4NSTA 4YJSA 3H0YA 5AP3A 1KV1A 3KXGA 4FKLA 3RGFA 1WBOA 4F9AA 4DH3A 4XG7A 4L3JA 4QMOA 2PMOX 2PE0A 1RW8A 5IG1A 5C01A 3TYKA 2IPXA 2VWXA 3COHA 2DS1A 4JQEA 1TVOA 4UY9A 1Q3WA 3I5ZA 4QYGA 5K3YA 1BI7A 2NNWB 1SM2A 2J0LA 3MPAA 3ZOSA 3OP5A 1LP4A 4D5HA 2XK8A 2YIWA 3DOGA 5A46A 3SW4A 4MBJA 3OW3A 1Q41A 4RC3A 2UW0A 5J1VA 4C4EA 3CE3A 2WMVA 5B7VA 3RM7A 1B38A 5IA3A 2E9VA 3QZIA 1JKKA 1YI3A 4XEYA 2UVYA 1WBSA 3QYWA 5IMEA 2ESMA 5KZIA 4F1MA 3BEAA 3ZFMA 3R2BA 1BMKA 3QTIA 4G3FA 2PPQA 3COIA 5CT0A 3SRVA 2VTPA 4L00A 3HMOA 4UEUA 4CZUA 4XRJA 5AAFA 3NR9A 2FH9A 3MB7A 4N6YA 3COKA 2R3QA 3AC3A 2CCHA 2IVVA 2FA2A 3HDMA 5EHYA 1XH7A 3UJGA 2XK3A 1YOMA 3BZ3A 3CR0A 5JRSA 4FODA 4EL9A 3OUNB 3MN3A 1URWA 3EQIA 4ZAUA 2X1NA 3HLLA 4DCAA 4USDA 3ORZA 4IFGA 5AR8A 4EKLA 4CQEA 3T3VA 4N6ZA 3PA5A 1GOLA 2YWVA 4BKJA 3BHVA 3QXPA 5FRIA 4P5QA 2IEWA 1XH5A 2BCJA 4O4EA 5E8SA 5J1WA 3JYAA 3GC8A 1S9IA 4PUZA 3NLBA 4B8MA 5GIPE 4FIIA 3MJ1A 3FZOA 3FQHA 3GU8A 3DXNA 5HE1A 5CU0A 3BGZA 3R30A 2W1HA 2J0IA 5CSPA 3UO5A 1VJYA 4U5JA 1VEBA 4HPUE 4YO4A 3FXWA 4RJ5A 2IZSA 3KXMA 3LVPA 4F78A 1HOWA 2AC3A 2X7FA 4AOIA 2HWOA 4TZRA 4WG5A 5D10A 4EBVA 4UN0C 4BR3A 4OTIA 3TZ9A 4U3YA 3R8ZA 4R5YA 1RDQE 5DRDA 4TYJA 4D2SA 4EH5A 5G1XA 4QPSA 2H34A 1IAJA 3MS9A 2EXEA 5E1SA 2R0UA 5LMAA 4AG8A 4AE6A 3VIDA 4NM7A 3RMFA 4ZLYA 3G33A 4XX9A 3FZSA 5LARA 3JUHA 4OTGA 4E4XA 3A99A 4RGJA 4IX3A 5CXHA 5CEPA 3FUPA 3DGKA 3LXNA 4I5PA 4IM3A 1PYEA 2VV9A 5L6WL 2OJGA 3PLSA 5KMJA 1ZAOA 2YIYA 4IDTA 4A07A 4AGUA 3TTJA 5M57A 4M0ZA 2WMXA 3KCFA 5GZ8A 3ATSA 3W2CA 3PJ3A 3Q5IA 4G6NA 3LFBA 3QWJA 5CXZA 3LJ2A 3QGWA 3LAUA 2QO9A 1W98A 4ALUA 4LOOA 5ETCA 3E3BX 4ASDA 3K3IA 5HG5A 4F7JA 1SVEA 4TWOA 3QLFA 4FV5A 4LRKA 5AJQA 4YTCA 2O64A 4AP7A 3R00A 2P0CA 5CY3A 5EM8A 4BDBA 5FXSA 5K5NA 4DH5A 3ZDUA 2X0GA 3KU2A 1J7UA 1U5RA 2F2UA 3S3IA 2VAGA 3VN9A 1M17A 5ETIA 1TQMA 4QYHA 5M08A 3Q9XA 2CKPA 4GIHA 2UZTA 4AN3A 5BPYA 4W8EA 2A98A 5ITAA 4KSPA 3L9MA 3R7VA 5CEIA 1H1RA 5EM7A 4ORKA 2ZMDA 4CZYB 3KF7A 4GW8A 4E73A 4NU1A 3QGYA 5HTIA 1VR2A 4YJOA 5JQ8A 3ENMA 2PTKA 4DFNA 1YWVA 1AD5A 4PNIA 2VTOA 3UVQA 5CALA 2ZM3A 3CXWA 2BZIB 3JY0A 1WBNA 3OBGA 3R9DA 2Y7JA 3MW1A 2RFDA 4J53A 5I9ZA 3FWQA 1RQQA 5AM7A 1T45A 3DBDA 3RPRA 1H8FA 2ITVA 5AWMA 4XG3A 4PV0A 2J90A 3ZU7A 4GT3A 2RF9A 3FI8A 2GS6A 2YIRA 5K0KA 2XARA 4GS6A 4OTQA 4DTBA 1CM8A 2R3LA 3UZTA 3MH2A 1ZYSA 1P5EA 2F9GA 4FL2A 5AR4A 3T9IA 3UQFA 3V8TA 3SGCA 3NSZA 4JR7A 4UWYA 3UIXA 3ALOA 4KS8A 5H2UA 3CTHA 1R78A 2X2KA 5C26A 1H27A 4NCTC 4AA4A 3FMMA 1DAYA 3A7IA 5HI2A 3WOWA 4GUEA 3VS1A 4OBPA 4YJVA 3G2FA 3K2LA 3C4ZA 3I0QA 4JJRA 4O1PA 3KRLA 3LCKA 3QRKA 4K0YA 4G5PA 3P9JA 1I09A 2WTWA 3CIKA 2R3NA 4U8ZA 5CU6A 2AYPA 2WMTA 4ZTLA 1W2FA 3WARA 4BDIA 4YBJA 2GU8A 4AAYA 4ZJJA 3O5AA 3UOLA 2Y9QA 4HCTA 1YRPA 3K5VA 3KQ7A 3QRIA 4IAFA 2QOCA 4FV6A 4E6CA 1OBDA 3DKGA 3HKOA 3FYKX 2A2AA 4JIKA 2VU3A 2Z2WA 4TY1A 3GUBA 4DC2A 4GG7A 4YU2A 2XRUA 4IADA 5JMSA 4YP8A 2W4OA 1UU9A 2GDOA 3ODYX 5IZFA 4RWIA 4EHGA 3NUAA 3R01A 3NYXA 4TTHB 1CKJA 4NEUA 4FIJA 3UIUA 3KXHA 3EFWA 4GRBA 3C1XA 5IUIA 3WF7A 2PZPA 3LXKA 2JGZA 2CNQA 3PG3A 3GEQA 3ZRKA 2PVNA 2X2MA 3OS3A 5I9VA 3GVUA 1PXPA 4O0SA 4C61A 4BBEA 3EKKA 4KINA 4QP1A 3F6XA 4L45A 4QPAA 4D2WA 3PDTA 4DDGA 5E8XA 3FZPA 1YWNA 4K11A 2XKDA 1SNXA 4XV9A 4LI5A 3FY0A 3PY3A 3ORTA 2XKCA 2ZJWA 4LGHA 2BHEA 2VNWA 3UC3A 5EQPA 2DWBA 2YM7A 1ZRZA 5AAEA 4IZYA 3F61A 4ZS4A 5DT0A 1SVHA 1YDRE 2OWBA 4NWMA 1UWHA 1Z57A 1VYWA 5BVEA 3UC4A 3WF5A 2V5QA 2GTNA 4ZXTA 4EK4A 3CC6A 1UWJA 2JBOA 3VS2A 2RIOA 4KBCA 5KHWA 4DBXA 1KE8A 2QOHA 5M53A 1JSTA 3C4WA 3RALA 3V8WA 3C4EA 4GK4A 2C0OA 4DGLC 2PY3A 1U4DA 2GTMA 4M66A 1HCLA 3FJQE 1LUFA 2E9UA 3NNXA 4DHFA 1BUHA 4TT7A 5LMKC 5LVMA 2ZV7A 3C4FA 5CQWA 1ERKA 4E4LA 3EJ1A 2I1MA 4HJOA 2X2LA 2UVXA 3EL8A 4H58A 3PP0A 1HCKA 4O0XA 3QCSA 4IAIA 4RIWB 2PE1A 4LM5A 2QOFA 3VBVA 3FZRA 4E1ZA 1MRUA 4JLCA 3VBTA 3VC4A 5D12A 3N4TA 4GUBA 2VWZA 3H10A 3W10A 5DHJA 3Q2MA 3UYTA 4EZ3A 5HNIX 1H1PA 4F09A 1XQZA 3E62A 4LUEA 2OIDA 5BYZA 4EZ5A 4I0SA 5HU9A 2E9PA 1QCFA 1ZZLA 2BRGA 4GFGA 4GVJA 2VNYA 4IFCA 4IB5A 4NW6A 1Y6BA 2G1TA 3U9NA 4EUUA 2HELA 5KMIA 3EB0A 3QCQA 4M15A 4FSQA 4NCTA 2B54A 2C5XA 4CEGA 2IVUA 5HX8A 4RJ3A 2VWYA 3ID6C 5CVGA 5HBHA 3ZM9A 4BF2A 3CCNA 4D1ZA 5HNBA 3Q04A 4HNIA 4CRSA 5BX0A 5IQHA 3FY2A 3I5NA 2XIRA 3LQ5A 5D7VA 4D1XA 1NXKA 4FKOA 4ANBA 4CFUA 1CTPE 2XKFA 2X0OA 3H4JA 5F95A 3RVGA 4M13A 4YZNA 3V5QA 4CT2A 2V7OA 3ATTA 4HYHA 4O84A 5E8YA 1A48A 3SX9A 4DT9A 2XJ1A 1NA7A 4NK9A 3L8PA 4J71A 5TKDA 2OJIA 4IB3A 3ZYAA 4O0TA 2BZJA 3QKMA 3CLYA 4FTUA 1YHWA 4YZMA 5BUEA 3QX4A 5ANEA 4UYNA 5ANIA 4OAUC 4O7LA 4I3ZA 4XLIA 2QQ7A 3W16A 3OCBA 4M14A 4BGHA 3L9PA 2ACXA 3POOA 4LYNA 5ANGA 3TG1A 4RWKA 2XUUA 4XP0A 4G3EA 3OOMA 3RAHA 3Q96A 3IOKA 4I22A 1PXIA 2BFXA 1KOAA 2G2IA 3BRBA 3E8DA 2JC6A 4RX9A 5ETFA 1UA2A 3G90X 4X21A 3Q9YA 1KUTA 4L52A 4F7NA 3KK8A 3SVVA 1BL7A 4QO9A 3DXPA 1H26A 5BNJA 1REJA 1V0OA 1G8SA 2WGJA 3NUUA 3EQGA 4PMMA 5EQEA 4FEWA 2JIIA 3G51A 4O6EA 4C57A 4DAWA 4ZP5A 4LRJA 1BX6A 3VBXA 1SMHA 2GMXA 4IAZA 4XUFA 1S9JA 4M69A 3WZKA 4RLLA 5CF5A 3V5TA 3RI1A 3L8VA 3GU4A 3TKHA 2Y0AA 5JRQA 3VBYA 4X6QC 4ZTQA 5AR7A 3R04A 5AFVA 4AW5A 3QCXA 4RJ4A 5FM2A 2EB3A 3MY1A 3UOKA 1PRYA 4QP7A 4FC0A 3HX4A 5LMKA 1OGYA 3TWJA 4FT9A 4XOYA 4MXOA 1XMMA 3TMOA 5AR2A 4DYMA 5D11A 4FKWA 4G16A 5IU2A 2EXMA 3QA0A 4PNKA 2B53A 3T3UA 3U8WA 4HGSA 4HGLA 3HV3A 3WIKA 1O6YA 3FBVA 4YSMA 4IANA 4YR8A 3LKMA 3BYMA 3PFYA 4I4EA 3QKLA 5CASA 5CTPA 1H0VA 4IJ9A 5C8KA 2VRXA 2CGVA 4PPBA 4NZWB 3GT8A 2OJJA 4FX3A 2UZDA 2X7GA 2EXCX 4ASEA 2HYYA 3DCVA 4EWQA 2JFLA 3QX2A 5J79A 3ORNA 2W1IA 3FI3A 3SXSA 4U9AA 4ANNA 3P86A 2ZFYA 2O8YA 2OKRA 3B8RA 1G3NA 3FDNA 3O8PA 1U54B 3DY7A 4M8TA 4P5ZA 2PUIA 4L8MA 3BHTA 2EB2A 3F3WA 4LV5A 4DE4A 4RX8A 4NFNA 4EK3A 4RSSA 2HZNA 2QNJA 5AIKA 1ZYJA 4L7SA 4S30A 5BQ0A 3R7YA 3JVSA 4BY9E 1G5SA 1J7LA 2WTKC 5A4TA 4BDFA 3D5WA 3QHRA 4I24A 2BRBA 2XM8A 3QZHA 3O23A 3PPKA 2BIYA 3CGOA 2YJRA 4J95A 4BFMA 4HW7A 2ZVAA 5DG5A 1MP8A 1Q5KA 4EH8A 4MUQA 2VTNA 2FB8A 5LMBA 4GCJA 3B2WA 4I5MA 4BCOA 5IQFA 4R3PA 4C37A 5JGDA 4RQKA 4XV1A 3SV0A 4DFLA 1FBNA 5J7BA 2YAAA 4C36A 2GNHA 3O51A 5I9UA 4D2TA 2RG6A 4U43A 4BCPA 4ITIA 5T3QA 3V51A 5F1ZA 3R9NA 3PY1A 4QPMA 2QONA 1W2CA 4FV4A 3ML1A 2ZB1A 3PTGA 4JNWA 4FT7A 3NNWA 4QP2A 5F4NA 3W0MA 4LOPA 4X3FC 5TOZA 5CAPA 5FP5A 2OXDA 3NW7A 1GZNA 3ETAA 2QOOA 1KE5A 2PMIA 4J8NA 4QNYA 4AE9A 2GHMA 5GJDA 3RPSA 2XNNA 2IW9A 4S2ZA 1QPEA 1B39A 3ROCA 2UZEA 2BIKB 4LG4A 2OH4A 1YOJA 3FLYA 4XS2A 4AXDA 4BTKA 3BCEA 5DE2A 3ZMMA 2HY0A 4FTMA 2CCIA 4QYFA 4PMPA 3DV3A 2WTCA 3QZGA 4OT6A 4OTPA 3NCZA 3FKLA 4KS7A 4Z9LA 5BMMA 3ZRLA 2WEVA 3SHEA 4FICA 4JDIA 3VW8A 1V1KA 5IKWA 4JAJA 4DG0E 4EOPA 4OT5A 3EQRA 3LOKA 4PRJA 2NRUA 4G6LA 4F65A 4BHNA 4D5KA 4DHJA 2UV2A 4EK6A 4BJJB 1XWSA 3ZFYA 2WEIA 3O2MA 4G5JA 3E8NA 1V0PA 4WBBB 4Q5EA 4MK0A 4CG9A 4NM5A 3TACA 4YMJA 4YUQA 3CBLA 4FNYA 4O38A 1DI9A 1F5QA 2ITNA 2W4JA 3I1AA 5ACBC 3DTCA 4OAVB 1LPUA 4AN9A 3ANQA 2YLEA 4O6LA 1Y6AA 2X8IA 2GNJA 2PUUA 2X0PA 3D2IA 4I20A 4IVCA 5CEOA 5DR6A 5FM3A 5LCKA 1YVJA 2PE2A 2PVRA 4ZJVA 4NM0A 2WPAA 4XV3A 4ASXA 2C6KA 2O3PA 1OB3A 5I5ZA 3NFFB 4MVFA 2CGXA 2F57A 4JDHA 4F4PA 3E7VA 2NYAA 4I1ZA 3NVMB 5A9UA 1DM2A 4JRNA 1IG1A 4ZTSA 4AZTA 2QI8A 5AV2A 4EOSA 4EH7A 5E8VA 2JAMA 2W99B 4U42A 3PJ1A 3VS0A 3W2SA 1GY3A 4HYIA 2WQOA 3Q4UA 4TYHB 4C2VA 4GU9A 2JBPA 4PWNA 2VWWA 3MH3A 4QD6A 5TE0A 4DEAA 1GNGA 4I6BA 1PMVA 2UW5A 4GT5A 4O22A 4WBOA 3PPZA 4O0RA 3RNYA 2BRNA 5CSXA 4DG3E 5A4QA 3EQCA 3AD5A 3LQ8A 2WD1A 4EK8A 4FV8A 1E1XA 1F3MC 2YACA 4GEOA 2C5VA 3FI4A 4Y8DA 3MYGA 3TUBA 4Z16A 2XIXA 4RIXB 1WAKA 5GNKA 2J2IB 1P4FA 4HCVA 1WBTA 4FTOA 3ZSHA 4YLLA 5EW3A 1W84A 4YNEA 3OEZA 3QLGA 5C8NA 1H08A 3MV5A 4GKHA 1KV2A 3BYVA 3KA0A 4CGAA 4AT5A 3ZLYA 4F6WA 2BVAA 5CAQA 5K0XA 3IG7A 4D4RA 2YJSA 5AX3A 1MRYA 2IZRA 2BTRA 4G6OA 2X39A 5AUZA 4I6HA 1KWPA 3E92A 4FG7A 4PX6A 5CZIA 4CD0A 3G5DA 3F69A 3OC1A 3TJDA 2QO7A 4IWQA 4CFFA 3Q6WA 3U87A 3K5UA 4F0FA 2F7EE 2OJFE 4FA2A 2E2BA 4EOKA 3W0PA 3NNVA 4X3FA 1YWRA 4CCUA 3RWPA 4BDHA 2C1BA 2IW6A 2VWBA 3AGMA 4FZAB 4KIKA 2XJ2A 5HG9A 3R9RA 3UVPA 3LFQA 5FDPA 2A4LA 3PG1A 5JKGA 4Z3VA 5DGZA 1FGKA 3PIYA 1IA8A 1IASA 4JXFA 3QUPA 1YHSA 3FI2A 2I40A 5AUWA 5K4IA 3R8LA 4BN1A 4E5BA 1U54A 4LQMA 1ZYCA 3BHUA