4CLIA

Structure of the human anaplastic lymphoma kinase in complex with pf- 06463922 ((10r)-7-amino-12-fluoro-2,10,16-trimethyl-15-oxo-10,15,16, 17-tetrahydro-2h-8,4-(metheno)pyrazolo(4,3-h)(2,5,11) benzoxadiazacyclotetradecine-3-carbonitrile).
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
308
structure length
294
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Discovery of (10R)-7-Amino-12-Fluoro-2,10,16-Trimethyl-15-Oxo-10,15,16,17-Tetrahydro-2H-8,4-(Metheno)Pyrazolo[4,3-H][2,5,11]Benzoxadiazacyclotetradecine-3-Carbonitrile (Pf-06463922), a Macrocyclic Inhibitor of Alk/Ros1 with Pre-Clinical Brain Exposure and Broad Spectrum Potency Against Alk-Resistant Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 294
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cliA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cliA01
5CXHA 3U9NA 3I79A 2CKOA 3AMBA 5HIEA 2UZDA 2XM8A 3PJ8A 4JBVA 4BL1A 4TZRA 4N57A 3WE8A 5DT3A 3R9OA 4S34A 5EG3A 4D5KA 3ATTA 1ZY5A 3KC3A 3Q2JA 4R1YA 2ETKA 4IIRA 3ZBXA 2W1IA 4G9RA 4CFVA 1M14A 2B9IA 3EOCA 3MA6A 2ITXA 2NRYA 3LM5A 5JK3A 1XO2B 2I1MA 2REIA 3IDBA 5F20A 5H9BA 3THBA 4IAKA 2VWYA 3HV5A 4CXAA 4LFIA 3TTJA 2PYWA 4O7YA 1VYWA 3CTQA 3ANQA 4J1RA 1DI9A 4R6VA 3V5JA 5C01A 3VO3A 4CTCA 3PXRA 2GHMA 1M17A 4GMYA 4W8EA 2UZOA 1PXKA 4DH5A 3CS9A 4YUQA 2ZV2A 1RW8A 4Z7HA 4L6QA 2OJIA 3PXZA 3FL5A 4AXAA 4RSSA 3LQ3A 4JIAA 4DCEA 2QVSE 1U5RA 2JKMA 2OFUA 5HBHA 2PL0A 4OT5A 5HESA 2CNUA 3O8TA 4L7SA 3WI6A 1Z5MA 4O38A 4EH6A 3EWHA 3EIDA 3Q4TA 4WBBB 3VUIA 3LKMA 3VW8A 2QOOA 1XBCA 4LGGA 2C4GA 3BLQA 2WTJA 4LUEA 5IQFA 3FAAA 3PY0A 5E9EA 3D5WA 3OWJA 4KAOA 4ASDA 3ZC5A 3COIA 2BTRA 4NUSA 3OT3A 1CMKE 3ZYAA 5TF9A 2HXQA 2XF0A 5ANKA 3TKHA 4IJ9A 1IA9A 4FNWA 3WYYA 5EM8A 5M53A 4WSQA 5HE1A 5IZFA 5AR8A 3Q96A 2C0OA 3KFAA 4W9WA 2ZMDA 3D15A 4DC2A 1PXJA 1W0XC 1RE8A 3CLYA 4G6NA 3P79A 4Q5EA 3JY9A 4YJPA 1JOWB 3CC6A 1KUTA 3WZUA 4QMWA 4M84A 4QD6A 3PPKA 4X3FC 2QKRA 3R8VA 3TV6A 3TT0A 4K6ZA 4ANSA 3KRJA 4FT7A 4IZ5A 2R3MA 2WTCA 3I7BA 4IB5A 4KB8A 2YDJA 2NPQA 3BHHA 4FKVA 3UP7A 4HNIA 5M55A 1PMNA 4OTQA 3PFQA 1VR2A 4BGHA 4AZVA 3ULIA 1KV2A 3TM0A 1BUHA 4RQVA 1Y91A 3KRRA 2I7QA 3WZKA 4BBEA 1Q8ZA 4RC2A 3CR0A 2HIWA 2R2PA 2WTIA 3EQGA 4U45A 3F3ZA 3QLGA 5IPJA 2RG5A 4J7BA 2UW0A 4F6WA 3LFAA 5AP4A 4G6LA 5J95A 4ZTHA 4I5PA 5CASA 4F65A 2R64A 1PRYA 3PWDA 3N4TA 3WIKA 2CCHA 2EB2A 3E3BX 3RAWA 2PVMA 5TOZA 5FP6A 3U87A 4GYGA 4F0GA 3O7LB 4LRJA 4O6LA 1OKYA 3ORTA 1JWHA 5CZHA 3RPVA 2VTQA 4ALUA 5KE0A 5K5XA 4MXYA 5BX0A 4FKUA 3NCGA 3RAKA 4B6LA 3F2AA 4KD1A 2XS0A 4E1ZA 5HQ0A 4C4EA 1P2AA 3M2WA 3PPJA 4P2KA 4EBWA 2W4KA 4ANLA 3CGFA 3R0TA 4AUAA 4KWPA 1P4FA 5AV4A 1MQBA 4QQCA 2X81A 3C50A 3ZEWA 2UV2A 4WKQA 4C59A 3R7UA 5JKGA 4X0MA 2OWBA 2I6LA 2VGOA 2UW7A 3SKCA 5A14A 4R8QA 5DEWA 2JDVA 4YHJA 5LVOA 3ZLWA 3AGLA 1MRUA 3VBQA 4PF4A 1PHKA 3EJ1A 4IADA 2BIYA 3KCFA 4QYHA 2CGXA 4BBFA 4O96A 4BDFA 2PUPA 3TL8A 2XCHA 2C5NA 2W1GA 4YLJA 2AUHA 3ERKA 4RIXB 2J0MB 4QP8A 3E64A 4NU1A 4C2WA 3C0IA 1STCE 1UU7A 5LMKA 4OAUC 3EKNA 4FSRA 4GT5A 4ANQA 4NT4A 3SAYA 3D7TA 5D10A 4F08A 3K54A 3ZDIA 3QC9A 3PXQA 2J0IA 2C0IA 3MH3A 4U42A 4M68A 5KKRC 2BAJA 3NEWA 4A9YA 4F7NA 3F6XA 5C03A 3RM6A 1W7HA 3TUDA 4FIFA 5M08A 3QZIA 3W16A 4HJOA 3TWJA 4EYJA 3MW1A 3RK9A 3O2MA 3BGPA 3U54A 4NCTA 4E8AA 4ZSAA 4IM3A 1WVWA 1UNGA 2WXVA 4ZZOA 3ZRLA 4BDCA 4K11A 4FVQA 3UO5A 5LMBA 3V8TA 5ITAA 5L6PA 5B7VA 1CDKA 2ZYBA 5AIRA 4FA2A 1XBAA 2IVVA 4FKTA 4V04A 4LGDA 3ZSGA 4LV8A 3QTIA 3DFAA 4O1OA 5FTQA 1W84A 4BKZA 5JFVA 3MIAA 1H1RA 4J52A 4YLLA 3VJNA 4QMQA 5FQDC 2YM7A 2H6DA 3FY2A 3IGOA 3U6IA 1GIJA 2B1PA 3FZSA 5ANOA 3UOLA 1FVRA 3ZDUA 2G2IA 2R3FA 4O7TA 2J5EA 5EHLA 4XBRA 4WUNA 1UU3A 3G9NA 2WQBA 2OU7A 3BRBA 3IONA 4BVUA 4FL2A 3NW7A 1ZOHA 4G6OA 3EN9A 2UW8A 3HV4A 4PNKA 4HCVA 3I1AA 2XK8A 2HWPA 4BBMA 3O8UA 3PIZA 2ZVAA 3EKKA 4QTDA 4AP7A 2BRBA 3DOGA 4G3CA 2QO9A 3TIYA 3DB8A 5EYKA 2ERKA 5AV3A 5FBNC 3UJGA 2R4BA 3ZH8A 3ZTXA 4UMTA 5D11A 3UOJA 4QQ5A 2W99B 3D5XA 3ZUVA 4CFMA 5C4KA 5AWMA 2V55A 4JLCA 3FXZA 3ROCA 3L9NA 4AT5A 3QLFA 4E5WA 4NM3A 4I5MA 3VRYA 2OW3A 3QD2B 4M14A 4FTCA 4NM0A 4L3LA 4ASZA 3DAKA 3R63A 4UN0C 4QMUA 4MNFA 3GU8A 5IEYA 1PYEA 2UZLA 2X4FA 3LE6A 4UX9A 2P55A 3CQEA 2IW9A 5I9UA 2H34A 4RIYB 4GL9A 3IPHA 3ZO2A 3ULZA 3VC4A 4EH5A 3QZGA 4IWPA 4DEGA 3HV3A 3SRVA 4O7NA 2PWLA 4DT9A 2C1AA 4NTTA 3HECA 4L52A 3Q4ZA 4DTBA 3FPQA 1WBVA 4D0XA 2PVLA 3FL4A 3OZ6A 3CD3A 4F4PA 2PE0A 1Q24A 2CGWA 5CSXA 5J1WA 2CNQA 3K5VA 5EQEA 2UW9A 3FMEA 2J90A 3ID6C 1ZYLA 3E63A 3O71A 5CAUA 3OUKA 4A9UA 4IAYA 4AZWA 3SOCA 3LXLA 3QQJA 2PSQA 3HYHA 4YJVA 5IDPA 5AR3A 1Q3WA 2JKOA 4HYHA 1YXVA 5ANIA 4G16A 4DG2E 3GVUA 3ZU7A 2Y4IB 2YIWA 5LWNA 1OL6A 4R7IA 2HENA 1DAYA 1VYZA 3FXWA 5C8MA 4JXFA 1KWPA 2WTWA 4JIKA 4PTCA 4J71A 2WELA 4IE9A 5AP6A 4E4MA 2W0JA 3BX5A 4GV1A 4FZFB 2AYPA 2Z60A 2X0GA 4F9YA 2R3LA 3HX4A 4EHVA 4S31A 3RPRA 4EOKA 1M2PA 4XP3A 4O0XA 2F7XE 1M7NA 4YJRA 2BRMA 2HXLA 3FZTA 3N9XA 1GZ8A 4EOSA 3M11A 2QOLA 2X8EA 3HMPA 5JFSA 5JN2A 1MP8A 3SXRA 3R8PA 3HUCA 2VWBA 3AXWA 3QHRA 3SHEA 3CGOA 4UMUA 3G2FA 4AFJA 2QC6A 3FDNA 4BCIA 4PPCA 4IZAA 4W4VA 1YI3A 2XK6A 3F7ZA 1XH4A 3MI9A 3Q4UA 3QHWA 4BIBA 4C3PA 3GFWA 4HPUE 4HVDA 2EU9A 4IZYA 4OTGA 5EH0A 4QMLA 4XP2A 5CT0A 3TDVA 3DBCA 2CLXA 4CYJA 1KE8A 3PVGA 4UZHA 3PUPA 4CMOA 5CF6A 5EK7A 4ARKA 3QD4A 4CT1A 5M56A 1MRVA 3O51A 5DIAA 4DEIA 3CD8A 1SNXA 3W10A 3SW7A 2HWOA 4R78A 3H4JA 4TXCA 3QZHA 2FH9A 4NYEA 4NH1A 3VHKA 2WNTA 3Q9XA 4QP7A 3AT4A 4E5BA 4E4LA 1QL6A 5GJDA 2YLEA 3DAJA 2I0VA 3UZTA 2YCFA 1URCA 3QKLA 1H1PA 3B2WA 3HAMA 2CN8A 2IW8A 4RJ6A 1Y57A 3FJQE 4GUEA 4LMUA 4JI9A 3HMOA 2VX3A 4DH1A 2HY81 4IDTA 3E8EA 4CGAA 4FV5A 3ZC6A 3OFMA 4BICA 5HOAA 5HO7A 2CLQA 3LXPA 2E2BA 1FGIA 2CDZA 3PZHA 4GEOA 4D1XA 4EWQA 3GBZA 4QMXA 5FEDA 4PP9A 4NIFB 5LVMA 2X2LA 2RIOA 2YM4A 3FC1X 4FEXA 1OPKA 2YAAA 3CTJA 4N0SA 2Z8CA 4FNXA 4FSQA 2GS7A 2VNWA 3MFSA 1CSNA 4TYHB 5FGKA 5I4NA 2R3IA 4ZTQA 4O86A 4UYNA 5FLFA 4D58A 5CAOA 5CEOA 5IDNA 2YM6A 1YRPA 1PXOA 3DJ6A 4EJNA 1H0VA 3AD6A 1ZMVA 4RIWA 3TNQB 4RZVA 4OW8A 3PG1A 4ANMA 1GIHA 2AC3A 1I44A 3P86A 1OKVA 4F09A 2GQRA 3VBVA 4LGHA 5A4LA 4Z16A 3H0YA 2XVDA 3NW5A 4IFCA 4QTAA 4FT0A 1BX6A 4EI4A 1OPLA 3TACA 3CKWA 2XA4A 5C27A 4GU6A 1Q8TA 1Y8GA 2ZDTA 3GENA 3D4QA 4I24A 2FVDA 3O0GA 4GSBA 3LJ2A 1UKHA 3GU7A 4BWKA 2QOIA 4EH9A 2HYYA 3QD3A 4RG0A 3DT1A 3PIYA 5BVKA 3UVQA 4YURA 4YBJA 5CY3A 4WOVA 2LGCA 4UMPA 2O8YA 2YIXA 4MTAA 4U41A 2YITA 4FT3A 4K1BA 3EN5A 3FLWA 2GFCA 4DH8A 5JZJA 2BVAA 2GS6A 4RWJA 1YW2A 2QOKA 5EHYA 5T3QA 2XNEA 5CX9A 1XBBA 3POOA 3VAPA 2IZUA 3EQBA 4HOKA 4D9TA 3BV3A 3F3UA 4FTRA 4F9AA 1OECA 2XP2A 4MF0A 3BU5A 3PLSA 4K0YA 4RC3A 3ZO3A 4ZMFA 2YAKA 3CSVA 3ZBFA 1YXTA 4O0SA 4J96A 3LQ5A 1ZMUA 3IOKA 5BVEA 3R7OA 2XNMA 5CEMA 2BKKA 4UMRA 1WBNA 2QQ7A 4C36A 3GEQA 3DBEA 1XWSA 2PZIA 3FZ1A 4FZAB 1P14A 4D4YA 3P9JA 4Y5HA 5JSMA 3KGAA 3KULA 4D2RA 4E20A 2YDIA 3GUBA 4HCUA 5HI2A 3A99A 3UMXA 2C3LA 2GDOA 3E5AA 3BYSA 3E87A 4WG3A 4DGOA 4ASXA 3MJ1A 4X2FA 4FZ6A 3A60A 5F94A 1DAWA 5CALA 3R6XA 4KBCA 4O82A 1OL5A 3R02A 5CU4A 1R0EA 4JQ7A 4QMPA 4X3FB 3WILA 3VQUA 1U5QA 1MQ4A 5EW9A 3VUTA 5M07A 5E1SA 3LCTA 4IVDA 4QNAA 3LFDA 5JH6A 1OIYA 2BDJA 2XUUA 4OGRA 1Q4LA 2BCJA 4JDIA 4MKCA 1PY5A 4ITIA 3BELA 3ZFXA 4F9WA 2O64A 1URWA 1M2RA 5TO8A 2ITNA 2R3NA 5HU9A 5IG1A 1Q99A 5CYIA 3CP9A 3R22A 4EUUA 5CAVA 4I20A 3TV7A 3W2CA 4CZYB 4QP9A 5HCXA 4PDOA 3TTIA 2BR1A 4XV1A 4IX3A 5BVNA 4IAZA 4JQEA 4O6EA 4O84A 3QALE 2BDWA 5A9UA 1RJBA 1YOMA 4FTKA 3DA6A 5AFVA 5GINE 5TT7A 3TUCA 4YJOA 2JEDA 2P33A 4F6UA 3OP5A 3L8VA 4M69B 2C3JA 3G0FA 4IJPA 3DNEA 4DFUA 4FIEA 3KEXA 1R39A 2JDSA 4FNYA 4U97A 3UOHA 4AA4A 5EYCA 1UA2A 1XHAA 1CKIA 3BEAA 1AQ1A 4OBOA 4HGLA 4EOLA 4ZLZA 5CI6A 1Q8WA 3NVKI 5CU2A 1OB3A 4YC3A 2CHLA 3L8PA 3OUNB 5K0KA 5AA9A 2IPXA 5HNBA 5TR6A 3VRZA 4TYJA 4PUZA 1SM2A 3ENMA 2O3PA 4E3CA 5K9IA 4AS0A 2B9FA 5KZ0A 1YQJA 4YPSA 3TV4A 2VUWA 3PXYA 1XH5A 2OXYA 3EL8A 3EL7A 4FV1A 3VUMA 4MHAA 3Q9WA 4B0GA 2OO8X 2W1CA 4GKHA 3GOKA 4XOYA 5J9ZA 4YZBA 2OIBA 3BYVA 3EFKA 4IXPA 4R5YA 3V51A 4KBKA 2JAVA 3EQFA 3FLQA 4G3FA 2QOFA 3R7GA 5AAFA 4ITJA 2PTKA 3MPAA 1S9JA 3QU0A 4IVAA 1B39A 3O7LD 3BWFA 3TZ9A 4M3QA 1KE7A 4IAFA 3QF9A 4WSYA 4FGBA 2JITA 2JIVA 1BL6A 5FUTA 3SQQA 3SX9A 4D9UA 1ZYDA 5L6WL 3C7QA 1FMKA 3OTUA 1JSTA 3NZ0A 3R7VA 1REKA 2XJ1A 2XMYA 1QCFA 4KRDA 5L4QA 3LMHA 5DNRA 3DZOA 3HP2A 5CU0A 4GKIA 4Q5HA 5KKRB 3SA0A 3A7FA 4F9BA 4CMTA 3EQCA 3P08A 2ITPA 2X1NA 4X21A 4PDPA 4C4FA 3OY1A 4HYIA 1GAGA 3I0QA 1SMHA 5EOLA 2G1TA 4LOOA 2WMWA 3QTZA 2ZJWA 2ZOQA 3K3IA 3QUEA 5AP1A 4AN2A 3BHVA 3GC8A 2VWVA 1UNLA 4B8MA 1CTPE 4IB3A 2OZOA 3DK3A 4AA5A 4NL0A 4Y85A 3DAEA 4GIHA 5IA4A 4FR4A 4ERWA 4EK8A 4FGRA 3GT8A 1Y8YA 4KSPA 4AW0A 4BI1A 5JEBA 3RP9A 3QD0A 5AX3A 3IECA 4ID7A 3LVPA 4FTTA 5LMKC 4FSNA 1U54B 2Z7RA 2R3RA 2XKDA 4WNKA 2B52A 4BKJA 3QCSA 3BHTA 3QQKA 1QPCA 3R04A 4M7IA 3TJCA 2HZ0A 4OBQA 3PXKA 3PY1A 4NK9A 4CFFA 3PPZA 3QTRA 4L46A 4RA5A 3UG1A 4EH8A 3UNZA 4V0GB 3D7ZA 3RI1A 3IOPA 3OXZA 2Y6MA 3DLSA 1HCKA 3HMMA 4FSZA 4NCTC 3KK9A 3KK8A 3ZXTA 3DXPA 3QRTA 5JZNA 4UYAA 1KE9A 5D9HA 3G51A 4ENYA 1LEZA 2JGZA 5I9WA 4CMUA 5BUIA 5E8YA 5ETIA 5JRQA 3T3VA 3S00A 3SXFA 3QUPA 3QQLA 1M52A 1H26A 5HE0A 2WMTA 2QOBA 4O0RA 4E93A 1ZYCA 3BBTB 3BKBA 3GCUA 4MD7E 3H3CA 3F66A 1FINA 5CVFA 3I5ZA 4BC6A 4XHKB 2QOHA 2PZRA 3FWQA 4W8DA 2VTNA 4QTBA 3FKNA 4I0TA 1WBOA 4OTDA 4O7SA 4C4GA 2OXXA 3A4PA 3U9CA 4BYJA 2X7OA 2QR7A 1VEBA 4RBLA 1YWVA 4WRGA 3EB0A 1OMWA 3O23A 4JDHA 4I0RA 4KA3A 4XG8A 2PVNA 3C51A 3PA5A 1W8CA 2VO3A 4JX3A 4U9AA 2OF2A 4NWMA 2XH5A 4X2GA 5DLSA 2J51A 4XP0A 4L42A 5FP5A 3RNYA 3A7IA 4A9RA 3D2IA 2OI4X 4DGLC 5HVKA 3AD4A 3C4EA 4U80A 4AGDA 3QGWA 4WBOA 5HORA 4I94A 4JBOA 5AUYA 4PRJA 5HU3A 4WO5A 4ZSJA 4FF8A 3V8WA 3LFFA 3MFUA 4QT1A 4DTAA 4M13A 5CEPA 3IW4A 4X2JA 5AUTA 2VTAA 5ANDA 5EM7A 3RPOA 3ET7A 2CMWA 3L8SA 1XR1A 2OKRA 1H07A 5I9ZA 4BCKA 3R01A 1H25A 4RIXA 4XG4A 5JFXA 4FG7A 4K8AA 2IZRA 5ANJA 2HOGA 4GFOA 4RFZA 2YJSA 1K3AA 3UPXA 3MV5A 5J5SA 5CF4A 3NLBA 4FEQA 5CSHA 2OZAB 4RJ3A 5HBEA 5FEQA 4Z9LA 2BFXA 3E7VA 4I92A 3GB2A 5J7BA 4FV9A 2E9PA 3FE3A 2C68A 2EXCX 4FSYA 3E3PA 3R9DA 3UQCA 1DS5A 4G31A 3MH1A 3FPMA 5HE3A 5KUPA 4R77A 3F3VA 1WVXA 3AGMA 2BTSA 3VUDA 2CPKE 4BDHA 5M4CA 1FBNA 4C7TA 3RZFA 2C5XA 4AG8A 5IU2A 1SZMA 5AM6A 1SVEA 2OIDA 3L9PA 2YIRA 3BIZA 1OZ1A 4BDJA 4GUBA 3DS6A 4FI1A 4HZRA 2VTPA 3DV3A 4D2WA 2VZ6A 4QMSA 4O21A 4Y5QA 4G3EA 3HRBA 2WQOA 1ZARA 3IK3A 3W2SA 1RDQE 4YZ9A 3KXHA 1RQQA 2W06A 4QRCA 4XRJA 5KMNA 4BB4A 1JAMA 3DY7A 4C4JA 4LRKA 5BMSA 2ZV9A 4USEA 5A3XA 4H3BA 2CKEA 2PMOX 3EH9A 3KXNA 4BDIA 5DMZA 4ZY4A 5L3AA 1I09A 1V0BA 4UBAA 4QP6A 1Q8YA 3ZZEA 5DBXA 2C5OA 4AOIA 2WTDA 1K2PA 5GIPE 1YDTE 1FVTA 1J91A 1JKTA 5LJJA 2QU6A 3EQHA 4AACA 5AA8A 4V01A 2ZB0A 4JX7A 3A2CA 4C0TA 3PSDA 3CCNA 2UVXA 4BCPA 3OTVA 3QRJA 3V01A 4BDKA 2DWBA 5AV1A 3KXXA 4K9YA 5LVNA 2I0EA 3OBGA 4FG8A 4CG9A 4D28A 3JR1A 4L3JA 4IFGA 2XNGA 2J0KA 3C5UA 2WMXA 4AQCA 5FXSA 3JVSA 2BZKB 3RPSA 2R3OA 2X2MA 2YM3A 4JNWA 3JYAA 5IH4A 5CANA 4X2KA 3DQWA 3GU5A 4RFMA 3ATSA 5AV2A 4FIJA 4G34A 4I21A 4X3JA 4XV2A 4EH2A 5E4HA 3BQCA 4RIYA 4BCNA 4D1ZA 1Q62A 3FZPA 2YA9A 3KQ7A 4AW5A 3DDPA 5BYYA 3AT3A 4FSWA 2IN6A 4X6RA 4NJDA 3F88A 3COKA 1A9UA 2BHHA 2R9SA 2VO6A 3LFSA 3O96A 3U8WA 4ZZNA 4XH6A 2UZEA 1R1WA 2BDFA 3NNVA 4IDVA 2ACXA 2FGIA 4DEDA 4QYYA 1A48A 2QG7A 2FUMA 1BMKA 3VS0A 3H9RA 4ZXTA 4BZDA 1PXMA 1H8FA 2RKUA 4IWDA 4J98A 4RLLA 3QQHA 3G33A 5IA0A 2BZJA 2F7EE 2YZAA 4GH2A 3PE1A 4K33A 3HKOA 3NUXA 4MXAA 4YO6A 3ZMMA 4DBNA 5HEZA 3PA3A 1F5QA 3Q6WA 4U3ZA 2C6LA 4PNIA 1LPUA 1XH8A 2AC5A 1ERKA 2BKZA 3MTFA 2XNPA 4L3PA 3LZBA 3PJCA 5KMKA 1YXXA 3NUYA 3WF5A 2HY0A 4MNEA 4I3ZA 5AR7A 3T9TA 4F7JA 2GPHA 4E4NA 4BCHA 4JVGA 4PP7A 4G17A 2OSCA 2VTLA 3R9RA 3HDMA 3TKIA 1NA7A 4YC6A 3Q60A 5KMMA 2Y6OA 4JS8A 4DITA 1LEWA 2YIQA 1PXIA 4I6HA 4L45A 4IB1A 3GQLA 4QYGA 2IJMA 4A7CA 3KN5A 3E93A 3QX2A 1NVRA 5CF5A 2Q83A 3C4XA 3PVBA 2G9XA 2PK9A 3QAME 5CI7A 5HLNA 4EKLA 5CU3A 1NT2A 1NY3A 1Q61A 3UIXA 1H01A 3UP2A 5KHXA 4EOQA 2V22A 4DFYA 3MDYA 4F99A 2PY3A 5EQYA 4USDA 3AD5A 1QPJA 3Q2MA 4QQJA 3SG9A 3MYGA 5CQWA 4XRLA 3P78A 3V5TA 1UU9A 3WBLA 2UW5A 3FUPA 4EQCA 4NJ3A 2VTHA 3F5XA 3MY5A 3OW3A 4O1PA 2PE2A 5LWMA 2WMAA 4BZNA 2DYLA 3ODZX 5FWKK 2XIZA 4PMPA 2V0DA 4EZ3A 5AAEA 2X8DA 2WGJA 3RCJA 2W1EA 3ZHPC 2A19B 1BI8A 4FKSA 4XBUA 2BZHB 3QCXA 5DE2A 5K4IA 4AX8A 2C6EA 4I4EA 5DR6A 4R7HA 1BYGA 4E6CA 4F9CA 2X39A 3F5GA 4BCOA 4EEVA 2BUJA 2ZM3A 4FOBA 4Y83A 3HP5A 4FUXA 5J7HA 3EQDA 4BDDA 5KCVA 4DEHA 5LQFA 2R3GA 4GK4A 5BMMA 4DTKA 4YLKA 4YTHA 4LL5A 4ZTMA 5IQBA 2JFLA 3IW6A 3HGKA 3FHIA 4RJ4A 2VRXA 2J50A 2P0CA 3RVGA 1BKXA 1WCCA 1WBSA 5EFQA 1JSVA 5KBRA 5HO6A 3OCGA 3T8OA 1ATPE 1UWJA 3F69A 5EHOA 5LCKA 3TIZA 4HZSA 3W18A 4M12A 1S9IA 2RFDA 4XEYA 3VUGA 1ZAOA 3FQEA 3COMA 4U44A 1IAHA 3ETAA 5A46A 3OCSA 4BR3A 2VTSA 3SG8A 4YTIA 2YWVA 4RWKA 1JVPP 2ERZE 1GNGA 3R1NA 4IBMA 4KIKB 2XBAA 3FC2A 2CKQA 2QONA 3RINA 1JSUA 4JG7A 3R7EA 5HTBA 1UWHA 4EH4A 4BDGA 2H96A 3QWJA 1LR4A 4IVCA 4XYFA 3WF8A 4D2SA 3HNGA 2WTKC 3V8SA 3IDCA 2ITTA 2UW6A 3BYMA 4KS7A 4XG9A 2WOUA 4B4LA 4HVHA 4I23A 2O5KA 4BCMA 4I1ZA 2XIXA 3EQIA 4NM5A 5IQEA 1BLXA 3NDMA 5E92A 4ZK5A 3SLSA 4QNYA 3F2NA 3GGFA 2B53A 2JDTA 2PUNA 3H30A 2XNBA 3C0GA 2WTVA 4PPAA 4FT9A 3MS9A 3UQGA 3WIGA 5IMXA 4HGSA 1H4LA 4EC9A 3H0ZA 5CENA 3JUHA 4TW9A 5HHWA 3R83A 2R3PA 3FZOA 4L53A 5FDPA 4EKKA 3EYHA 4RVMA 3AC4A 5AUXA 4O83A 1U4DA 4XOZA 1WZYA 1XH7A 4C38A 4CLJA 3QZFA 4QMZA 5EW3A 3UYSA 3CXWA 2PZPA 2HZNA 4FV0A 5ANEA 2GSFA 1ZXEA 4AZSA 4CVAA 1JLUE 2QKWB 5JQ5A 3D14A 3KL8A 3QRUA 5DEYA 3SOAA 3VBWA 4R7BA 3BE2A 3UVPA 5AMNA 3NUAA 4HVSA 4G5PA 4NKAA 4KIQA 2QI8A 2V5QA 3K3JA 5M06A 3FZRA 4IM0A 2GTMA 2W1DA 3ROYA 2UZTA 3VS2A 2H9VA 3F5UA 1YI6A 3PVUA 3C5IA 3KMWA 3Q4CA 5CVGA 4APCA 4C02A 3QCYA 2OJFE 4AZFA 4UV0A 4HYSA 4OTFA 5AADA 4PMMA 5ETAA 4QO9A 4ZSLA 4ZTRA 4JR7A 2R3QA 3EHAA 1OI9A 4DT8A 2BROA 3OCTA 1WFCA 3LCKA 4C4IA 3FBVA 2DQ7X 4FIHA 2YIYA 1H1QA 2QR8A 5AUWA 3PG3A 2GNJA 3TUBA 1PXNA 4I22A 4MQ1A 3NMUF 4M67A 4CFWA 3LLTA 4QP2A 4BF2A 2VWWA 1PKDA 1GIIA 2WZJA 4AE9A 2GNIA 4OAVB 1MUOA 4Q9ZA 3NUSA 4HVIA 1V0PA 3CY3A 3OBJA 4EOOA 2G01A 3HLLA 3HA6A 4FC0A 4N6ZA 3RNIA 3VS7A 1J1BA 4M0YA 3DJ5A 5HX8A 4FTNA 3V5PA 2WMBA 2WOTA 4LRMA 4APPA 3DBDA 1OL7A 1J3HA 4C33A 5KBQA 5CQUA 5ICPA 4C62A 3UGCA 1WBWA 3I81A 3P4KA 3BGZA 2JIUA 4AOTA 2QOQA 3W32A 4BCFA 3A62A 5JRSA 4ZMEA 2ZM4A 5B0XA 5EKNA 2R3KA 4E6AA 4M69A 3ZSHA 4IC8A 3AC1A 4E73A 1IAJA 2XB7A 4JG6A 3UE4A 1APME 4U6RA 4DEBA 3ACKA 2W1ZA 2GNFA 3GXLA 5FXRA 2YEXA 4DG3E 5A4QA 3D83A 4J8MA 5I3RA 3DTCA 4LOQA 4N4SA 2EUFB 4FVPA 3OEZA 4I0SA 4KKHA 1Q5KA 4W4WA 1ZY4A 2OGVA 5EKOA 4EONA 3FI3A 4BY9E 3MWUA 2C1BA 5DWRA 2F9GA 2QODA 4RX5A 4PDSA 5IQHA 3MVHA 1T45A 4XMOA 4A06A 1JKLA 5I3OA 4WA9A 4C57A 3UO4A 5DT0A 5ETCA 3GQIA 4WT6A 2W17A 4YSJA 4DA5A 1QPDA 2PVKA 4IMYA 2XYNA 2XEYA 3HVCA 3GOPA 4IVBA 3QRIA 3KY2A 2VGPA 3Q53A 3CTHA 3NYOA 3DXNA 5AR5A 3VVHA 5BUJA 4TRLA 2PMLX 3EQRA 3NNWA 3K2LA 4CKIA 4DYMA 3UPZA 2W96B 4H3PA 3UNKA 3BPRA 4XV3A 1L3RE 3R28A 5CT7A 3F9NA 2XBJA 3R1YA 3SXSA 2W5AA 5BNJA 3R8LA 3LFCA 3CQWA 3BGQA 3ANRA 3EZRA 2CGUA 4YZCA 1M2QA 3OCBA 3W8LA 1VJYA 3AT2A 2ESMA 3DTWA 3F5PA 3ZS5A 1IEPA 2BIKB 4PL3A 1Q3DA 3TI1A 2YN8A 3KXGA 1YWNA 3W1FA 3SGCA 2PVFA 3OC1A 2RG6A 1E1VA 3TEIA 4AT4A 1YDSE 1HCLA 2RFEA 2WU7A 5F9EA 4HGEA 3NVMB 2WAJA 3NIZA 3MGYA 4EL9A 3FXXA 4EK3A 3S2PA 2IVTA 5GZAA 4S33A 4ZS4A 4FV4A 2DS1A 4KKEA 3I60A 4UWBA 1WBTA 3NAYA 3Q3BA 2WO6A 4FTMA 3HMIA 4QMYA 3KKVA 3ZO4A 2GCDA 2B9HA 2GNLA 5KMLA 3V3VA 4GVAA 4DBXA 4E5AX 1OGUA 3NYVA 4KIOA 3E88A 2VTOA 3SVVA 3GCPA 4N70A 4O0VA 4I6QA 5D7AA 1FOTA 2I40A 5GZ9A 3ZOSA 3ZXZA 2WB8A 3ODYX 4FICA 5IQCA 3NPCA 4FTQA 2C6MA 5M09A 4EOPA 1J7UA 2J0JA 4F64A 3G6GA 4P7EA 5HNGA 3N4UA 2XK4A 1X8BA 4S30A 4FTIA 4V0GA 1YVJA 3AOXA 3OW4A 5AJQA 3BE9A 4M8TA 1NXKA 4UY9A 2OJJA 4PMTA 5CSWA 5FBOA 4KRCA 1H0WA 2OFVA 3FQHA 4GYIA 3ELJA 3DKOA 1CM8A 4JRVA 3M42A 4ZTNA 4BWXA 4O7ZA 3PSCA 3QL8A 4O0WA 5HE2A 2ONLA 4RFYA 5GIOE 3FV8A 3EMGA 1W98A 2C6DA 3ALNA 2R7IA 4FK6A 4B99A 1E1XA 3BI6A 3N51A 4I93A 3QA8A 1ZOEA 1JBPE 5EI6A 5CXZA 5LMAA 3UODA 4CNHA 4MBIA 3CJFA 5G6VA 4IX4A 2P2IA 2C6KA 4YTCA 3QYZA 2ITUA 4Z7GA 5M4UA 1E9HA 5E8ZA 3RKBA 4ZIMA 3Q5ZA 4TPTA 4RWLA 4B8LA 4Y72A 2YZLA 4X2NA 2G2HA 4MWIA 3Q52A 2F4JA 1ZRZA 1AGWA 2C0TA 2C69A 4BCJA 3RPYA 5K5NA 2YABA 4CCUA 4U43A 4CV9A 3GC7A 4QPSA 4D2PA 1VZOA 4NSTA 3ALOA 3F61A 3TZ7A 3Q32A 4M15A 5AV0A 3OY3A 4LUDA 3DBQA 3R73A 2NRUA 4RVTA 1P4OA 4GT4A 3S3IA 4BI0A 5KMOA 3WARA 4KKGA 5CEKA 2IZTA 2IO6A 4C3FA 4YZNA 5L2WA 3HEGA 3UBDA 4ZSEA 5I9XA 3MH0A 2FSMX 2C30A 2VO0A 5HGIA 2R3JA 4A4XA 2UZWE 4EHGA 3C4ZA 4AA0A 5BYZA 3D5VA 2CCIA 4MXOA 3RHXA 4TWPA 5GJFA 3ZLXA 5M4IA 3MIYA 5AAGA 3G15A 2NO3A 3EQPA 3KMMA 3VHEA 4AGUA 5DVRA 2ZV7A 3A8WA 3LM0A 4XG2A 5D1JA 1O6KA 5DH3A 5K3YA 2GQGA 2XJ2A 1LUFA 2C3KA 4FG9A 4KNBA 5DR2A 2C5YA 2PMIA 3K5UA 4BTFA 2UUEA 3E7OA 2WMVA 2XYUA 3QBNA 4FT5A 4FKIA 5IA1A 2Y0AA 3I6UA 4IH8A 4R3PA 5C8NA 4IM2A 3F7WA 3VS3A 4GK2A 3NUPA 3MFRA 4YJUA 2UZVA 4FIGA 3TNPC 5HLWA 3LLAA 2F2UA 2I0HA 2NP8A 4DAWA 2A2AA 4ITHA 2VAGA 2YCRA 4CFUA 2Y7JA 3L8XA 3TCPA 4EK5A 1YI4A 1FGKA 2QHMA 3II5A 3PZEA 5J87A 1XQZA 4KIPA 3DJ7A 2FO0A 3SDJA 5BUEA 2JIIA 3L1SA 4ZJIA 4C34A 3LFEA 4D0WA 4O7LA 5AX9A 3NAXA 4I5CA 4ANOA 3P1AA 3ZO1A 4WNOA 4DLIA 4O0TA 4WG4A 2Q0BA 5CNNA 3MBLA 4O22A 3R9HA 4CQGA 4UZDA 4ZZMA 4FKPA 2RFNA 3UG2A 3NR9A 4GCJA 4U5JA 5KZIA 5FM3A 4AW1A 3W2RA 4Z55A 4HGTA 3V5QA 4EOIA 3FI2A 3FI8A 1YHWA 4MCVA 3LXNA 1YDRE 4GS6A 3R21A 3RK7A 2FYSA 4UB7A 4AT3A 2KULA 3CIKA 3UOKA 4EC8A 2W9ZB 4G2FA 3QYWA 4L68A 2QNJA 4PL4A 3BU3A 4Q2AA 5AP2A 5EM5A 4AF3A 1P5EA 3UIMA 3QCQA 5IEVA 4PMSA 4XG6A 3VF9A 1Z57A 2VWZA 4PV0A 4MK0A 1IRKA 4JQ8A 2C6OA 1Q97A 4FL1A 2B54A 4RX7A 5EI2A 3R71A 2E9OA 2J6MA 4Y73A 5CS6A 4H05A 3IW5A 3LJ1A 2A4LA 2PUUA 3DFCB 3QFVA 3U55A 1QMZA 2A0CX 2W4JA 3LCDA 5K4JA 2HW7A 3O8PA 1PYXA 3IO7A 4FYNA 3LXKA 5DOSA 4FKGA 4YBKA 3VULA 3NNUA 3MVJA 2CNVA 2ITVA 4QTEA 2PVJA 2JKKA 3V6RA 4B7TA 4ANNA 5FM2A 4YNOA 3GCQA 3KULB 1H00A 4BZOA 4O81A 5CSVA 1NVQA 4CEGA 2WMRA 4GIIA 4AAAA 2WEIA 3V5LA 1JKSA 3H9OA 3IGGA 4BWPA 1J7IA 1NVSA 3MY1A 1WVYA 4JAJA 4E6DA 4FMQA 3MVLA 4AGCA 2PVYA 2ZV8A 2JBOA 4JL9A 4WHZA 4DEEA 5E8WA 4ZLOA 1YOJA 3DKFA 1BL7A 4LI5A 3RAIA 2UZNA 3A7HA 4Y46A 4RT7A 1WMKA 3LFQA 4FKQA 4OTWA 4DE4A 4NEUA 2BMCA 5CU6A 4EWHA 1PXLA 2RF9A 3E8DA 3ORNA 4LQMA 3QTSA 4G3DA 2WTKB 3H10A 5EDPA 5LVPA 3UZRA 4GK3A 3A8XA 4RC4A 4YGAA 5J5TA 4Z3VA 4ZY5A 3MFTA 4TWNA 4A9TA 3KB7A 4BGGA 4F1TA 2ZAZA 3FSKA 3UQFA 4R3CA 3JXWA 3FYKX 1PMVA 5IISA 5CF8A 3C0HA 3QTWA 2WPAA 3DBFA 4CSVA 4TYGA 2HK5A 3W2QA 5I9YA 3PVWA 1CKJA 3BV2A 2UVZA 1QPEA 4BRXA 4OBPA 5HTIA 3RALA 4JJRA 2YM5A 5ETFA 5LARA 3DNDA 4L9IA 4DFLA 3MB7A 3R00A 2YHVA 3FMHA 5IMEA 1OL2A 5IH5A 4H3QA 2FSTX 5HVJA 4RVKA 3TNIA 4C37A 3VW6A 3VBXA 3FMKA 4BCGA 2ETMA 5DGZA 5J9LA 2YISA 4XG7A 5DI1A 4YO4A 4NFNA 3P7AA 4BGQA 1CKPA 3OVVA 4JOAA 5DR9A 2GS2A 4BIEA 2NNWB 4LMNA 3BQRA 3DKCA 5J8IA 4GJ3A 4XLIA 4CT2A 2ITOA 2X6DA 1GZKA 4U40A 2XIRA 2YFXA 3DCVA 2WMUA 4YU2A 4JG8A 3ZUUA 4EBVA 2CSNA 3MVMA 3RCDA 3ZRKA 4QMNA 4RX8A 4RX9A 3F3WA 4R5SA 3FEGA 5F1ZA 4J95A 4FTJA 4JDJA 1LP4A 4OT6A 3KRWA 3P0MA 3BLHA 1UV5A 3E8NA 4RJ7A 1PW2A 2H8HA 5EW8A 3PXFA 1V0OA 5EI8A 3IDPA 3EZVA 5M51A 2PZYA 3MY0A 3M1SA 3QTQA 1JPAA 2J4ZA 4XJ0A 3OF0A 1G3NA 5T6KA 3VBTA 1OPJA 3C4WA 4IANA 1ND4A 3QA0A 3D94A 3GNIB 4QP3A 4FZ7A 4YR8A 2VWXA 4NTSA 4P4CA 3RK5A 2JDRA 2F57A 3HUBA 3JY0A 3LW0A 4H1JA 2Z7SA 3RHKA 1Y6AA 3A7GA 4YSMA 3R8ZA 3ORPA 3TG1A 3BHUA 4XS2A 2X7GA 3NRMA 4M66A 4YNEA 5H8EA 3SC1A 5AR4A 3MPMA 4TL0A 4D2VA 1OUKA 4AZTA 1GZNA 2WFYA 3R30A 2GNGA 5HG7A 2ITQA 3QQUA 4EH7A 2RSVA 3FMMA 2WMQA 2XIYA 2PZ5A 4FSTA 4G3GA 5DN3A 2XKFA 5DPVA 4AFEA 1SVHA 1OITA 4TYIA 3FMDA 2R5TA 3FMLA 3W8QA 3NX8A 4MQ2A 5HTCA 1YXSA 3HV6A 4PTGA 3HAVA 1OIQA 2OIQA 4MBJA 2XK7A 2O2UA 4Y95A 1A06A 2JD5A 4WG5A 2F2CB 3R2BA 2YERA 3IQ7A 5AUVA 4KIKA 3E62A 3AQVA 4R1VA 4RA4A 4YC8A 5H8BA 5CEIA 4DG0E 4E6QA 2XNOA 2CN5A 3OEFX 3UC4A 4U7ZA 5GHVA 4IX6A 3KA0A 3QQFA 1OVEA 2XIKA 4GFGA 1XKKA 2YACA 5H8GA 5IA2A 4J99A 4MVFA 3QC4A 5C26A 3N4VA 2BHEA 3I4BA 2VO7A 4U79A 3ORMA 5IKWA 3VF8A 4MXZA 3U6JA 2RGPA 4KBAA 3BWJA 3NYNA 3AC5A 3ZM4A 2QG5A 4NKSA 5HIBA 4H1MA 3SD0A 3T3UA 4P5ZA 3U4WA 4CZTA 1ZYJA 2W5BA 4RWIA 1JQHA 4CCBA 5JGAA 5JQ8A 3Q6UA 3RM7A 3WE4A 3MA3A 4I6FA 4XUFA 1H24A 4DLJA 5BVFA 4F7LA 3RJCA 3IS5A 5L8LA 4EJ7A 3DLZA 2FA2A 4FYOA 3NUUA 4XNEA 2W9FB 2PU8A 5DYJA 4JDKA 4H36A 4UXLA 3P23A 1O9UA 3TZMA 5JGDA 4C2VA 5I5ZA 4C3RA 4BDEA 5G1XA 2EWAA 4FEWA 1L8TA 4F7SA 3QX4A 2F49A 3OMVA 2I0YA 4ACGA 4WUAA 4GG5A 1IG1A 3U51A 3KCKA 4HW7A 5IA5A 2BALA 5H2UA 4QPAA 2OG8A 3PJ2A 5A4EA 4L01A 1HOWA 2EVAA 4PPBA 4WNPA 2SRCA 5HIDA 5LVLA 4BDAA 1KE6A 4CRLA 4F1OA 4TNDA 3TZ8A 4X7QA 3EFLA 1G5SA 2W5HA 4J53A 3LMIA 2PULA 4DF3A 4IHPA 4TN6A 2VWUA 2Z7QA 2W1FA 5HKMA 3KVWA 2WD1A 3W55A 2V62A 1H08A 2PVHA 2YLFA 3ZUTA 3W2OA 5IF1A 4CRSA 5E90A 3VWAA 2J2IB 2XEZA 4PY1A 2XK3A 1KE5A 3AMAA 4TYEA 5CZIA 4TY1A 2QO2A 4O2PA 3PWYA 3P7BA 5M44A 1GZOA 2W7XA 4MWHA 3PJ1A 4CD0A 4DCAA 1YOLA 5KO1A 4C58A 4TNBA 3P7CA 3WF6A 2J7TA 3QTXA 3WZJA 1FMOE 4ZJJA 3DQXA 3VJOA 2OBJA 2EXEA 5IQAA 3WZDA 3QXPA 3TJDA 2QHNA 1YHVA 3JPVA 4H39A 1OBDA 1IASA 3NW6A 3PLAE 2BAKA 3U4UA 4O7RA 1OBGA 5AIKA 3RWQA 2B7AA 4FKWA 3UIBA 2XRWA 3IW8A 4MXXA 4QMOA 4TWCA 3F2RA 4GT3A 5K0XA 3HL7A 4YJNA 2Y4PA 3PP0A 3SV0A 3B8RA 3HA8A 3PSBA 3EFJA 4ERKA 4RGJA 4A07A 4QQTA 4I4FA 3V5WA 4J97A 4NIFA 3ORIA 1J1CA 5EYDA 4ACMA 3Q9ZA 2GQSA 4YPDA 4RZWA 3VUKA 4D2TA 3NSZA 4CTBA 2XCKA 5EQPA 2HELA 4TYHA 3KXZA 2ZMCA 4O2ZA 4EYMA 2YJRA 1OM1A 3LCSA 4O0YA 3WF9A 2LAVA 3UYTA 4DFXE 4LOPA 3KU2A 2ONLC 4MD9E 4OTRA 3VS1A 3LFBA 1W83A 2YWPA 5D7VA 5AP7A 4UALA 2BFYA 2HW6A 2XZSA 3FLNC 3HMNA 3E92A 4ALWA 5CTPA 2W1HA 2XRUA 3KN6A 3R7YA 4ENXA 5B2LA 4HNFA 4IB0A 4G5JA 4LM5A 4KABA 4MBLA 3OD6X 3G9LX 3UZPA 1NW1A 1ZMWA 5A4CA 3O17A 3UDBA 3ZSIA 1SYKA 1YXUA 2F7ZE 4ALVA 4EZ7A 3EN7A 3VNTA 4L8MA 3I6WA 1UVRA 3WZEA 1ZLTA 3MH2A 4DFZE 3AC2A 4UXQA 4OTHA 3KMUA 5L8JA 3LJ0A 2IZSA 3R8UA 2B4SB 2VTMA 3BCEA 3CPCA 3GC9A 3KXMA 5HICA 3R1SA 4QMVA 4PX6A 4CFNA 2EXMA 3FLYA 5B2MA 3L9MA 5BQ0A 3MN3A 1BI7A 5HD7A 3UO6A 4DGNA 3IG7A 5I9VA 5E1EA 4IW0A 2A1AB 4YTFA 5IQDA 4RRVA 4GRBA 4MD8E 4YJQA 4YJSA 2BAQA 4GU9A 2WKMA 4UWYA 4KINA 2ZM1A 1IA8A 2WQMA 3DK7A 3EN4A 3ZONA 2GTNA 3O50A 4R3RA 3LIJA 4NW5A 3SW4A 2HZ4A 2P2HA 5AM7A 2VNYA 4OTPA 4FODA 3C13A 3UNJA 2DUVA 3POZA 4WIHA 3GCSA 4BIDA 4FV6A 3NYXA 3QTUA 4FVRA 3KF4A 4JR3A 4JBPA 1TQIA 2C47A 3LMGA 3ORLA 5C1QB 2Q0NA 2QOCA 4DFBA 5HCYA 3VS6A 4IAIA 5IA3A 3PRIA 3BEGA 2BRNA 4IZ7A 3S0OA 2VN9A 1YWRA 2WEVA 3G90X 4MNEB 1TQMA 1GY3A 1KOAA 1ZZ2A 2ETRA 5DT4A 4C4HA 2W05A 2A27A 4D4VA 3R7IA 3C4CA 4OUCA 4IWOA 3OS3A 2VX0A 4BCQA 4O0UA 3UC3A 5AP0A 4ORKA 4L44A 4X3FA 4MAOA 5HG8A 3GC0A 1W82A 3PTGA 3D7TB 3A7JA 3UTOA 2EB3A 1MRYA 2JBPA 3FLZA 3Q04A 5F4NA 2R0IA 3R1QA 4MX9A 5AUZA 4FV8A 5L2SA 5EYMA 2OF4A 5DA3A 2VTTA 1WAKA 3REPA 2HAKA 4PWNA 1R0PA 3PA4A 1ZZLA 2OH0E 2QO7A 3DGKA 4A9SA 1H27A 2RL5A 2B9JA 5HNIX 3R2YA 4HCTA 2BRGA 3I0OA 1XJDA 4A4OA 5J9YA 2HZIA 4EOMA 2IVUA 4TTHB 5HD4A 4O7WA 5GZ8A 3KF7A 4MYGA 4QYEA 5M4FA 4BKYA 2YCSA 3TN8A 3CJGA 4U8ZA 4FTUA 3PE2A 4TWOA 4L7FA 3LOKA 1DI8A 1UNHA 3DDQA 4N6YA 5D12A 2C6IA 3QKKA 3V04A 4DINA 5FXQA 1FPUA 4KUJA 2VTIA 5HLPA 5BVOA 3B8QA 3FSFA 4MH7A 2UVYA 1ZWSA 3BYOA 2E9VA 4FKRA 5JT2A 5M57A 3QRKA 2ITWA 5IUGA 4XX9A 4FKOA 3DKGA 2KTYA 5I0BA 3CEKA 4XG3A 2G2FA 4B9DA 3OWLA 1KV1A 2OICA 4FZDB 4K18A 2QU5A 2UW4A 4U81A 4PDYA 3RZBA 3U6HA 3BLRA 3CY2A 4MEDA 4BN1A 2QLQA 3ORXA 3D5UA 5AP5A 3PJ3A 4RQKA 4TKSA 1FVVA 2X6EA 3PIXA 5FRIA 3ITZA 5L2IA 4AU8A 4DGGA 4FV2A 3KREA 1M7QA 2VU3A 4GVJA 5GJGA 3G0EA 3C9WA 4CG8A 4BFMA 2ZDUA 3GP0A 5JGBA 2XM9A 4EK4A 3NWWA 5E8SA 4BHZA 4I6BA 3Q5IA 3PRFA 2O63A 1PXPA 4CKJA 4D5HA 2C3IB 2ITYA 3BBWA 4IEBA 3BZ3A 4DEAA 4F0IA 5EDQA 5EOBA 4XLVA 1JNKA 3EN6A 5FEEA 2VX1A 4ANBA 2V7AA 1Y6BA 3OHTA 5J79A 4DN5A 4QP1A 4YJTA 4JAIA 3G6HA 4JT3A 2FSOX 3KRLA 3FKLA 4L00A 2Z7LA 3ACJA 3F3TA 2ZB1A 4OTIA 1H1WA 2HCKA 2O0UA 5HX6A 3E8CA 3KRXA 3OWPA 3WF7A 4TT7A 4BYIA 1B38A 2JKQA 4HPTE 4QTCA 3PY3A 3SRVB 4AN9A 3S95A 5L2TA 1G8AA 1PMUA 2PMNX 4Q9SA 4RLKA 3DU8A 3VS4A 4EHEA 5CAQA 3RTPA 3CQUA 3DB6A 4DH3A 5IQIA 2JLDA 3QWKA 4CYIA 4Y8DA 3LQ8A 3NNXA 4CV8A 4EH3A 4F70A 5L8KA 2GHLA 2CJMA 2UZUE 5FTOA 1GOLA 4QPMA 4D1SA 3ZM9A 4YZMA 2UZBA 1OIRA 4S32A 5KMIA 1Q8UA 3IKAA 4JBQA 2OXDA 4ZTLA 4F0FA 1U54A 2GNHA 5E91A 3QGYA 3F82A 4ZTSA 4FTLA 3QXOA 4IC7A 4M97A 3FLSA 3GU6A 3QQGA 5DHJA 2Y8OA 5HCZA 5HZNA 2GU8A 4O7VA 2O65A 4FTAA 1OUYA 2ITZA 5KHWA 4ZLYA 4U3YA 3VN9A 3OOGA 1PKGA 1Z9XA 1DM2A 3D9VA 4FEUA 3MPTA 3P5KA 4W4YA 1SNUA 3MB6A 5E8XA 4K77A 3AC3A 3WOWA 3QKMA 4YMJA 3GI3A 4ACHA 2C6TA 3DK6A 3FHRA 4CZUA 1J7LA 5C4LA 1R3CA 1U59A 3NCZA 4LV5A 3GFEA 5LCJA 4E7WA 4G9CA 3LPBA 2VTJA 4PQNA 4ASEA 4EQUA 1O6YA 4OR5A 4EORA 1KOBA 4WRSA 4EUTA 2X4ZA 4S2ZA 4RJ5A 3QUDA 4QOXA 4ONAA 2B0QA 2E9UA 5HVYA 4ZJVA 3DXQA 3FQSA 3FMJA 2E9NA 3ORKA 4P5QA 5IQGA 4YP8A 4WD5A 3S1HA 5IH6A 4K2RA 4AW2A 4HVGA 2PUIA 2IW6A 4LL0A 4FL3A 1OL1A 4FKLA 4GFMA 3W2PA 3A4OX 4FE2A 5D41A 2QURA 3MJ2A 5F95A 3V6SA 2PVRA 3LFNA 3GCVA 1V1KA 2WQNA 4IX5A 1GJOA 4AZEA 5IUHA 2J5FA 3LAUA 2VV9A 5B2KA 5T68A 3JVRA 3OG7A 1O6LA 2VWIA 4HYUA 2WHBA 4ZY6A 1ZOGA 1FQ1B 1ZYSA 5DRBA 4AE6A 1K9AA 4F63A 3BHYA 4RVLA 4RPVA 4EK6A 4E4XA 3FMNA 4IACA 3NUNA 1JKKA 5HG9A 2X7FA 3BU6A 4DH7A 4F6SA 4FV7A 3ZLSA 4FTOA 5A6OA 4D55A 5AUUA 2VD5A 4M0ZA 2XKEA 3FI4A 4FSUA 5AP3A 5L2QA 4EHZA 3T9IA 5A54A 2BRHA 3A61A 4FKJA 5DRDA 4H58A 4MF1A 4YHFA 1SVGA 1PMEA 5C9CA 2VTRA 3HZTA 3ZZWA 3UIUA 4ZSGA 2JDOA 3VUHA 4UEUA 4FEVA 4ZP5A 1Q41A 4QMMA 4V05A 2X9EA 2Y9QA 5GNKA 4ZAUA 4IWQA 3GU4A 2OZAA 3TDWA 1TVOA 4JRNA 3LCOA 3FY0A 4BHNA 2X8IA 3C1XA 2WIHA 3KVXA 2GHGA 5H3QA 2PE1A 2GMXA 3FKOA 4ACCA 4KSQA 4BTKA 2Z2WA 3D0EA 2WIPA 4C61A 4IAAA 4E26A 4KS8A 4RIWB 2QLUA 4W9XA 3OXIA 4EOJA 4BI2A 1T46A 5L6OA 1OKZA 4FUYA 1G8SA 4G1WA 3EYGA 2PPQA 3HRCA 2P4IA 2YM8A 5EM6A 2CKPA 4ZEGA 5IUIA 3RAHA 3CPBA 4YZDA 5TE0A 3VBYA 3ZFYA 4ACDA 2OLCA 5AR2A 2XJ0A 5FTGA 5BYLA 4OLIA 5E8TA 4EZ5A 2BILB 4II5A 3ZFMA 4FNZA 3OXTA 2QD9A 3IW7A 4FK3A 5IEXA 3VQHA 1UU8A 5KMJA 3Q9YA 3CKXA 2Y4IC 3I5NA 3D2KA 4P90A 3EFWA 4UMQA 3TNHA 3ZRMA 5E8UA 1F3MC 5CAPA 5HO8A 1REJA 3ENHA 4UWCA 4BTJA 3VIDA 4BTMA 3CE3A 5CNOA 5BPYA 4XCUA 2BPMA 5ACKA 1IR3A 4D4RA 4DFNA 2FB8A 3G5DA 3PDTA 3S4QA 4QP4A 2R3HA 5FDXA 3COHA 2C5VA 2WQEA 3L9LA 5BVWA 4L43A 5LXMA 3WYXA 4D4SA 2B55A 4X6QC 2X9FA 4NFMA 3TNWA 5CVHA 4NW6A 2GFSA 3BYUA 4O91A 3TXOA 3DPKA 4GG7A 4RIOA 4BDBA 1YKRA 3DZQA 4FSMA 4DGMA 2P3GX 1U46A 2FSLX 3UVRA 2JAMA 4IQ6A 3NS9A 3MTLA 5JFWA 2JFMA 3TKUA 3CBLA 5ANGA 3B2TA 1EH4A 3PP1A 3ZEPA 2RFSA 3LHJA 3AC8A 1AD5A 4F1MA 2IVSA 4GW8A 3RMFA 3MESA 5CSPA 2OH4A 4NZWB 2XNNA 4ZOGA 4O27B 2R0UA 5FG8A 4AGWA 1KSWA 4AOJA 4LYNA 5KNJA 2IG7A 4W4XA 3RWPA 3ZCLA 4NM7A 3UMWA 1XH9A 4RMZA 4J8NA 3OWKA 2UW3A 3AG9A 2YCQA 2QCSA 1YHSA 5E8VA 2V7OA 3NIEA 4XV9A 4AN3A 3RBWA 5LOHA 4I41A 4C8BA 4ZS0A 2R7BA 2YDKA 4L67A 3R8MA 4PL5A 4CLIA 5C8KA 2WMSA 4A4LA 2G15A 2JC6A 2J0LA 2W4OA 1PJKA 3PYYA 5J1VA 3FYJX 2OJGA 2PHKA 3MSSA 1H1SA 4FIIA 2XKCA 4FBXA 1WBPA 4LG4A 2IWIA 4EQMA 5HBJA 5KX8A 2CGVA 4C35A 4FX3A 4YHTA 5DFPA 3HDNA 1XH6A 5DG5A 1R78A 5ACBC 3W33A 5AEPA 3AMYA 4I5HA 2XK9A 5BVDA 4QMTA 5HG5A 4FV3A 3C4FA 1OIUA 3RGFA 1UKIA 5TKDA 2WU6A 2OK1A 4DHFA 4CKRA 1B6CB 4U0IA 4GJ2A 5EDRA 3ZLYA 3JS2A 5CLPA 3OT8A 1OKWA 4AWIA 3HV7A 3OROA 5FD2A 5CEQA 2J9MA 5CWZA 5E7RA 3H9FA 4CQEA 4QYFA 3HRFA 4RJ8A 2X2KA 2Z02A 4MXCA 4PTEA 5A4TA 1PF8A 2OJ9A 2BZIB 1F0QA 3NGAA 1TQPA 3VS5A 4WNMA 5A6NA 1H28A 4FOCA 3I7CA 4CFXA 1TKIA 4USFA 5JMSA 3R9NA 3OOMA 3ORZA
chains in the Genus database with same CATH superfamily
5CXHA 3U9NA 3I79A 2CKOA 3AMBA 5HIEA 2UZDA 2XM8A 3PJ8A 4JBVA 4BL1A 4TZRA 4N57A 3WE8A 5DT3A 3R9OA 4S34A 5EG3A 4D5KA 3ATTA 1ZY5A 3KC3A 3Q2JA 4R1YA 2ETKA 4IIRA 3ZBXA 2W1IA 4G9RA 4CFVA 1M14A 2B9IA 3EOCA 3MA6A 2ITXA 2NRYA 3LM5A 5JK3A 1XO2B 2I1MA 2REIA 3IDBA 5F20A 5H9BA 3THBA 4IAKA 2VWYA 3HV5A 4CXAA 4LFIA 3TTJA 2PYWA 4O7YA 1VYWA 3CTQA 3ANQA 4J1RA 1DI9A 4R6VA 3V5JA 5C01A 3VO3A 4CTCA 3PXRA 2GHMA 1M17A 4GMYA 4W8EA 2UZOA 1PXKA 4DH5A 3CS9A 4YUQA 2ZV2A 2AQXA 1RW8A 4Z7HA 4L6QA 2OJIA 3PXZA 3FL5A 4AXAA 4RSSA 3LQ3A 4JIAA 4DCEA 2QVSE 1U5RA 2JKMA 2OFUA 5HBHA 2PL0A 4OT5A 5HESA 2CNUA 3O8TA 4L7SA 3WI6A 1Z5MA 4O38A 4EH6A 3EWHA 3EIDA 3Q4TA 4WBBB 3VUIA 3LKMA 3VW8A 2QOOA 1XBCA 4LGGA 2C4GA 3BLQA 2WTJA 4LUEA 5IQFA 3FAAA 3PY0A 5E9EA 3D5WA 3OWJA 4KAOA 4ASDA 3ZC5A 3COIA 2BTRA 4NUSA 3OT3A 1CMKE 3ZYAA 5TF9A 2HXQA 2XF0A 5ANKA 3TKHA 4IJ9A 1IA9A 4FNWA 3WYYA 5EM8A 5M53A 4WSQA 5HE1A 5IZFA 5AR8A 3Q96A 2C0OA 3KFAA 4W9WA 2ZMDA 3D15A 4DC2A 1PXJA 1W0XC 1RE8A 3CLYA 4G6NA 3P79A 4Q5EA 3JY9A 4YJPA 1JOWB 3CC6A 1KUTA 3WZUA 4QMWA 4M84A 4QD6A 3PPKA 4X3FC 2QKRA 3R8VA 3TV6A 3TT0A 4K6ZA 4ANSA 3KRJA 4FT7A 4IZ5A 2R3MA 2WTCA 3I7BA 4IB5A 4KB8A 2YDJA 2NPQA 3BHHA 4FKVA 4O4EA 4HNIA 3UP7A 5M55A 1PMNA 4OTQA 3PFQA 1VR2A 4BGHA 4AZVA 3ULIA 1KV2A 3TM0A 1BUHA 4RQVA 1Y91A 3KRRA 2I7QA 3WZKA 4BBEA 1Q8ZA 4RC2A 2R2PA 2HIWA 2WTIA 3CR0A 3EQGA 4U45A 3F3ZA 3QLGA 5IPJA 2RG5A 4J7BA 2UW0A 4F6WA 3LFAA 5AP4A 4G6LA 5J95A 4ZTHA 4I5PA 5CASA 4F65A 2R64A 1PRYA 3PWDA 3N4TA 3WIKA 2CCHA 2EB2A 3E3BX 3RAWA 2PVMA 5TOZA 5FP6A 3U87A 4GYGA 4F0GA 3O7LB 4LRJA 4O6LA 1OKYA 3ORTA 1JWHA 5CZHA 3RPVA 2VTQA 4ALUA 5KE0A 5K5XA 4MXYA 5BX0A 4FKUA 3NCGA 3RAKA 4B6LA 3F2AA 4KD1A 2XS0A 4E1ZA 5HQ0A 4C4EA 1P2AA 3M2WA 3PPJA 4P2KA 4EBWA 2W4KA 4ANLA 3CGFA 3R0TA 4AUAA 4KWPA 1P4FA 5AV4A 1MQBA 4QQCA 2X81A 3C50A 3ZEWA 2UV2A 4WKQA 4C59A 3R7UA 5JKGA 4X0MA 2OWBA 2I6LA 2VGOA 2UW7A 3SKCA 5A14A 4R8QA 5DEWA 2JDVA 4YHJA 5LVOA 3ZLWA 3AGLA 1MRUA 3VBQA 4PF4A 1PHKA 3EJ1A 4IADA 2BIYA 3KCFA 4QYHA 2CGXA 4BBFA 4O96A 4BDFA 1G8KA 2PUPA 3TL8A 2XCHA 2C5NA 2W1GA 4YLJA 2AUHA 3ERKA 4RIXB 2J0MB 4QP8A 3E64A 4NU1A 4C2WA 3C0IA 1STCE 1UU7A 5LMKA 4OAUC 3EKNA 4FSRA 4GT5A 4ANQA 4NT4A 3SAYA 3D7TA 5D10A 4F08A 3K54A 3ZDIA 3QC9A 3PXQA 2J0IA 2C0IA 3MH3A 4U42A 4M68A 5KKRC 2BAJA 3NEWA 4A9YA 4F7NA 3F6XA 5C03A 3RM6A 1W7HA 3TUDA 4FIFA 5M08A 3QZIA 3W16A 4HJOA 3TWJA 4EYJA 3MW1A 3RK9A 3O2MA 3BGPA 3U54A 4NCTA 4E8AA 4ZSAA 4IM3A 1WVWA 1UNGA 2WXVA 4ZZOA 3ZRLA 4BDCA 4K11A 4FVQA 3UO5A 5LMBA 3V8TA 5ITAA 5L6PA 5B7VA 1CDKA 2ZYBA 5AIRA 4FA2A 1XBAA 2IVVA 4FKTA 4V04A 4LGDA 3ZSGA 4LV8A 3QTIA 3DFAA 4O1OA 5FTQA 1W84A 4BKZA 5JFVA 3MIAA 1H1RA 4J52A 4YLLA 3VJNA 4QMQA 5FQDC 2YM7A 2H6DA 3FY2A 3IGOA 3U6IA 1GIJA 2B1PA 3FZSA 5ANOA 3UOLA 1FVRA 3ZDUA 2G2IA 2R3FA 4O7TA 2J5EA 5EHLA 4XBRA 4WUNA 1UU3A 3G9NA 2WQBA 2OU7A 3BRBA 3IONA 3W0PA 4BVUA 4FL2A 3NW7A 1ZOHA 4G6OA 3EN9A 2UW8A 3HV4A 4PNKA 4HCVA 3I1AA 2XK8A 2HWPA 4BBMA 3O8UA 3PIZA 2ZVAA 3EKKA 4QTDA 4AP7A 2BRBA 3DOGA 4G3CA 2QO9A 2XARA 3TIYA 3DB8A 5EYKA 2ERKA 5AV3A 5FBNC 3UJGA 2R4BA 3ZH8A 3ZTXA 4UMTA 5D11A 3UOJA 3UDSA 4QQ5A 2W99B 3D5XA 3ZUVA 4CFMA 5C4KA 5AWMA 2V55A 4JLCA 3FXZA 3ROCA 3L9NA 4AT5A 3QLFA 4E5WA 4NM3A 4I5MA 3VRYA 2OW3A 3QD2B 4M14A 4FTCA 4NM0A 4AXCA 4L3LA 4ASZA 3DAKA 3R63A 4UN0C 4QMUA 4MNFA 3GU8A 5IEYA 1PYEA 2UZLA 2X4FA 3LE6A 4UX9A 2P55A 3CQEA 2IW9A 5I9UA 2H34A 4RIYB 4GL9A 3IPHA 3ZO2A 3ULZA 3VC4A 4EH5A 3QZGA 4IWPA 4DEGA 3HV3A 3SRVA 4O7NA 2PWLA 4DT9A 2C1AA 4NTTA 3HECA 4L52A 3Q4ZA 4DTBA 3FPQA 1WBVA 4D0XA 2PVLA 3FL4A 3OZ6A 3CD3A 4F4PA 2PE0A 1Q24A 2CGWA 5CSXA 5J1WA 2CNQA 3K5VA 5EQEA 2UW9A 3FMEA 2J90A 3ID6C 1ZYLA 3E63A 3O71A 5CAUA 3OUKA 4A9UA 4IAYA 4AZWA 3SOCA 3LXLA 3QQJA 2PSQA 3HYHA 4YJVA 5IDPA 5AR3A 1Q3WA 2JKOA 4HYHA 1YXVA 5ANIA 4G16A 4DG2E 3GVUA 3ZU7A 2Y4IB 2YIWA 5LWNA 1OL6A 4R7IA 2HENA 1DAYA 1VYZA 3FXWA 5C8MA 4JXFA 1KWPA 2WTWA 4JIKA 4PTCA 4J71A 2WELA 4IE9A 5AP6A 4E4MA 2W0JA 3BX5A 4GV1A 4FZFB 2AYPA 2Z60A 2X0GA 4F9YA 2R3LA 3HX4A 4EHVA 4S31A 3RPRA 4EOKA 1M2PA 4XP3A 4O0XA 2F7XE 1M7NA 4YJRA 2BRMA 2HXLA 3FZTA 3N9XA 1GZ8A 4EOSA 3M11A 2QOLA 2X8EA 3HMPA 5JFSA 5JN2A 1MP8A 3SXRA 3R8PA 3HUCA 2VWBA 3AXWA 3QHRA 3SHEA 4DDIA 3CGOA 4UMUA 3G2FA 4AFJA 2QC6A 3FDNA 4BCIA 4PPCA 4IZAA 4W4VA 1YI3A 2XK6A 3F7ZA 1XH4A 3MI9A 3Q4UA 3QHWA 4BIBA 4C3PA 3GFWA 4HPUE 4HVDA 2EU9A 4IZYA 4OTGA 5EH0A 4QMLA 4XP2A 5CT0A 3TDVA 3DBCA 2CLXA 4CYJA 1KE8A 3PVGA 4UZHA 3PUPA 4CMOA 5CF6A 5EK7A 4ARKA 3QD4A 4CT1A 5M56A 1MRVA 3O51A 5DIAA 4DEIA 3CD8A 1SNXA 3W10A 3SW7A 2HWOA 4R78A 3H4JA 4TXCA 3QZHA 2FH9A 4NYEA 4NH1A 3VHKA 2WNTA 3Q9XA 4QP7A 3AT4A 4E5BA 4E4LA 1QL6A 5GJDA 2YLEA 3DAJA 2I0VA 3UZTA 2YCFA 1URCA 3QKLA 1H1PA 3B2WA 3HAMA 2CN8A 2IW8A 4RJ6A 1Y57A 3FJQE 4GUEA 4LMUA 4JI9A 3HMOA 2VX3A 4DH1A 2HY81 4IDTA 3E8EA 4CGAA 4FV5A 3ZC6A 3OFMA 4BICA 5HOAA 5HO7A 2CLQA 3LXPA 2E2BA 1FGIA 2CDZA 3PZHA 4GEOA 4D1XA 4EWQA 3GBZA 4QMXA 5FEDA 4PP9A 4NIFB 4BJJA 5LVMA 2X2LA 2RIOA 2YM4A 1ST4A 3FC1X 4FEXA 1OPKA 2YAAA 3CTJA 4N0SA 2Z8CA 4FNXA 4FSQA 2GS7A 2VNWA 3MFSA 1CSNA 4TYHB 4O4FA 5FGKA 5I4NA 2R3IA 4ZTQA 4O86A 4UYNA 5FLFA 4D58A 5CAOA 5CEOA 5IDNA 2YM6A 3AKKA 1YRPA 1PXOA 3DJ6A 4EJNA 1H0VA 3AD6A 1ZMVA 4RIWA 3TNQB 4RZVA 2X0QA 4OW8A 3PG1A 4ANMA 1GIHA 2AC3A 1I44A 3P86A 1OKVA 4F09A 2GQRA 3VBVA 4LGHA 5A4LA 4Z16A 4JMQA 3H0YA 2XVDA 3NW5A 4IFCA 4QTAA 4FT0A 1BX6A 4EI4A 1OPLA 3TACA 3CKWA 2XA4A 5C27A 4GU6A 1Q8TA 1Y8GA 2ZDTA 3GENA 3D4QA 4I24A 2FVDA 3O0GA 4GSBA 3LJ2A 1UKHA 3GU7A 4BWKA 2QOIA 4EH9A 2HYYA 3QD3A 4RG0A 3DT1A 3PIYA 5BVKA 3UVQA 4YURA 4YBJA 5CY3A 4WOVA 2LGCA 4UMPA 2O8YA 2YIXA 4MTAA 4U41A 2YITA 4FT3A 4K1BA 3EN5A 3FLWA 2GFCA 4DH8A 5JZJA 2BVAA 2GS6A 4RWJA 1YW2A 2QOKA 5EHYA 5T3QA 2XNEA 5CX9A 1XBBA 3POOA 3VAPA 2IZUA 3EQBA 4HOKA 4D9TA 2XALA 3BV3A 3F3UA 4FTRA 4F9AA 1OECA 2XP2A 4MF0A 3BU5A 3PLSA 4K0YA 4RC3A 3ZO3A 4ZMFA 2YAKA 3CSVA 3ZBFA 1YXTA 4O0SA 4J96A 3LQ5A 1ZMUA 3IOKA 5BVEA 3R7OA 2XNMA 5CEMA 2BKKA 4UMRA 1WBNA 2QQ7A 4C36A 3GEQA 3DBEA 1XWSA 2PZIA 3FZ1A 4FZAB 1P14A 4D4YA 3P9JA 4Y5HA 5JSMA 3KGAA 3KULA 4D2RA 4E20A 2YDIA 3GUBA 4HCUA 5HI2A 3A99A 3UMXA 2C3LA 2GDOA 3E5AA 3BYSA 3E87A 4WG3A 4DGOA 4ASXA 3MJ1A 4X2FA 4FZ6A 3A60A 5F94A 1DAWA 5CALA 3R6XA 4KBCA 4O82A 1OL5A 3R02A 5CU4A 1R0EA 4JQ7A 4QMPA 4X3FB 3WILA 3VQUA 1U5QA 1MQ4A 5EW9A 3VUTA 5M07A 5E1SA 3LCTA 4IVDA 4QNAA 3LFDA 5JH6A 1OIYA 2BDJA 2XUUA 4OGRA 1Q4LA 2BCJA 4JDIA 4MKCA 1PY5A 4ITIA 3BELA 3ZFXA 4F9WA 2O64A 1URWA 1M2RA 5TO8A 2ITNA 2R3NA 5HU9A 5IG1A 1Q99A 5CYIA 3CP9A 3R22A 4EUUA 5CAVA 4I20A 3TV7A 3W2CA 4CZYB 4QP9A 5HCXA 4PDOA 3TTIA 2BR1A 4XV1A 4IX3A 5BVNA 4IAZA 4JQEA 4O6EA 4O84A 3QALE 2BDWA 5A9UA 1RJBA 1YOMA 4FTKA 3DA6A 5AFVA 5GINE 5TT7A 3TUCA 4YJOA 2JEDA 2P33A 4F6UA 3OP5A 3L8VA 4M69B 2C3JA 3G0FA 4IJPA 3DNEA 4DFUA 4FIEA 3KEXA 1R39A 2JDSA 4FNYA 4U97A 3UOHA 4AA4A 5EYCA 1UA2A 1XHAA 1CKIA 3BEAA 1AQ1A 4OBOA 4HGLA 4EOLA 4ZLZA 5CI6A 1Q8WA 3NVKI 5CU2A 1OB3A 4YC3A 2CHLA 3L8PA 3OUNB 5K0KA 5AA9A 2IPXA 5HNBA 5TR6A 3VRZA 4TYJA 4PUZA 1SM2A 3ENMA 2O3PA 4E3CA 5K9IA 4AS0A 2B9FA 5KZ0A 1YQJA 4YPSA 3TV4A 2VUWA 3PXYA 1XH5A 2OXYA 3EL8A 3EL7A 4FV1A 3VUMA 4MHAA 3Q9WA 4B0GA 2OO8X 2W1CA 4GKHA 3GOKA 4XOYA 5J9ZA 4YZBA 2OIBA 3BYVA 3EFKA 4IXPA 4R5YA 3V51A 4KBKA 2JAVA 3EQFA 3FLQA 4G3FA 2QOFA 3R7GA 5AAFA 4ITJA 2PTKA 3MPAA 1S9JA 3QU0A 4IVAA 1B39A 3O7LD 3BWFA 3TZ9A 4M3QA 1KE7A 4IAFA 3QF9A 4WSYA 4FGBA 2JITA 2JIVA 1BL6A 5FUTA 3SQQA 3SX9A 4D9UA 1ZYDA 5L6WL 3C7QA 1FMKA 3OTUA 1JSTA 3NZ0A 3R7VA 1REKA 2XJ1A 2XMYA 1QCFA 4KRDA 5L4QA 3LMHA 5DNRA 3DZOA 3HP2A 5CU0A 4GKIA 4Q5HA 5KKRB 3SA0A 3A7FA 4F9BA 4CMTA 3EQCA 3P08A 2ITPA 2X1NA 4X21A 4PDPA 4C4FA 3OY1A 4HYIA 1GAGA 3I0QA 1SMHA 5EOLA 2G1TA 4LOOA 2WMWA 3QTZA 2ZJWA 2ZOQA 3K3IA 3QUEA 5AP1A 4AN2A 3BHVA 3GC8A 2VWVA 1UNLA 4B8MA 1CTPE 4IB3A 2OZOA 3DK3A 4AA5A 4NL0A 4Y85A 3DAEA 4GIHA 5IA4A 4FR4A 4ERWA 4EK8A 4FGRA 3GT8A 1Y8YA 4KSPA 4AW0A 4BI1A 5JEBA 3RP9A 3QD0A 5AX3A 3IECA 4ID7A 3LVPA 4FTTA 5LMKC 4FSNA 1U54B 2Z7RA 2R3RA 2XKDA 4WNKA 2B52A 4BKJA 3QCSA 3BHTA 4AXFA 3QQKA 1QPCA 3R04A 4M7IA 3TJCA 2HZ0A 4OBQA 3PXKA 3PY1A 4NK9A 4CFFA 3PPZA 3QTRA 4L46A 4RA5A 3UG1A 4EH8A 3UNZA 4V0GB 3D7ZA 3RI1A 3IOPA 3OXZA 2Y6MA 3DLSA 1HCKA 3HMMA 4FSZA 4NCTC 3KK9A 3KK8A 3ZXTA 3DXPA 3QRTA 5JZNA 4UYAA 1KE9A 5D9HA 3G51A 4ENYA 1LEZA 2JGZA 5I9WA 4CMUA 5BUIA 4F78A 5E8YA 5ETIA 5JRQA 3T3VA 3S00A 3SXFA 3QUPA 3QQLA 1M52A 1H26A 5HE0A 3AKJA 2WMTA 2QOBA 4LDTA 4O0RA 4E93A 1ZYCA 3BBTB 3BKBA 3GCUA 4MD7E 3H3CA 3F66A 1FINA 5CVFA 3I5ZA 4BC6A 4XHKB 2QOHA 2PZRA 3FWQA 4W8DA 2VTNA 4QTBA 3FKNA 4I0TA 1WBOA 4OTDA 4O7SA 4C4GA 2OXXA 3A4PA 3U9CA 4BYJA 2X7OA 2QR7A 1VEBA 4RBLA 1YWVA 4WRGA 3EB0A 1OMWA 3O23A 4JDHA 4I0RA 4KA3A 4XG8A 2PVNA 3C51A 3PA5A 1W8CA 2VO3A 4JX3A 4U9AA 2OF2A 4NWMA 2XH5A 4X2GA 5DLSA 2J51A 4XP0A 4L42A 5FP5A 3RNYA 3A7IA 4A9RA 3D2IA 2OI4X 4DGLC 5HVKA 3AD4A 3C4EA 4U80A 4AGDA 3QGWA 4WBOA 5HORA 4I94A 4JBOA 5AUYA 4PRJA 5HU3A 4WO5A 4ZSJA 4FF8A 3V8WA 2X0OA 4DHJA 3LFFA 3MFUA 4QT1A 4DTAA 4M13A 5CEPA 3IW4A 4X2JA 5AUTA 2VTAA 3P5JC 5ANDA 5EM7A 3RPOA 3ET7A 2CMWA 3L8SA 1XR1A 2OKRA 1H07A 5I9ZA 4BCKA 3R01A 1H25A 4RIXA 4XG4A 5JFXA 4FG7A 4K8AA 2IZRA 5ANJA 2HOGA 4GFOA 4RFZA 2YJSA 1K3AA 3UPXA 3MV5A 5J5SA 5CF4A 3NLBA 4FEQA 5CSHA 2OZAB 4RJ3A 5HBEA 5FEQA 4Z9LA 4QDVA 2BFXA 3E7VA 4I92A 3GB2A 5J7BA 4FV9A 2E9PA 3FE3A 2C68A 2EXCX 4FSYA 3E3PA 3R9DA 3UQCA 1DS5A 4G31A 1VLRA 3MH1A 3FPMA 5HE3A 5KUPA 4R77A 3F3VA 4MUQA 1WVXA 4LV7A 3AGMA 2BTSA 3VUDA 2CPKE 4BDHA 5M4CA 1FBNA 4C7TA 3RZFA 2C5XA 4AG8A 5IU2A 1SZMA 5AM6A 1SVEA 2OIDA 3L9PA 2YIRA 3BIZA 1OZ1A 4BDJA 4GUBA 3DS6A 4FI1A 4HZRA 2VTPA 3DV3A 4D2WA 2VZ6A 4QMSA 4O21A 4Y5QA 4G3EA 3HRBA 2WQOA 1ZARA 3IK3A 3W2SA 1TFFA 1RDQE 4YZ9A 3KXHA 1RQQA 2W06A 4QRCA 4XRJA 5KMNA 4BB4A 1XMLA 1JAMA 3DY7A 4C4JA 4LRKA 5BMSA 2ZV9A 4USEA 5A3XA 4H3BA 2CKEA 2PMOX 3EH9A 3KXNA 4BDIA 5DMZA 4ZY4A 5L3AA 1I09A 1V0BA 4UBAA 4QP6A 1Q8YA 3ZZEA 5DBXA 2C5OA 4AOIA 2WTDA 1K2PA 5GIPE 1YDTE 1FVTA 1J91A 1JKTA 5LJJA 2QU6A 3EQHA 4AACA 5AA8A 4V01A 2ZB0A 4JX7A 3A2CA 4C0TA 3PSDA 3CCNA 2UVXA 4BCPA 3OTVA 3QRJA 3V01A 4BDKA 2DWBA 5AV1A 3KXXA 4K9YA 5LVNA 2I0EA 3OBGA 4FG8A 4CG9A 4D28A 3JR1A 4L3JA 4IFGA 2XNGA 2J0KA 3C5UA 2WMXA 4AQCA 5FXSA 3JVSA 2BZKB 3RPSA 2R3OA 2X2MA 2YM3A 4JNWA 3JYAA 5IH4A 5CANA 4X2KA 3DQWA 3GU5A 4RFMA 3ATSA 5AV2A 4FIJA 4G34A 4I21A 4X3JA 4XV2A 4EH2A 5E4HA 3BQCA 4RIYA 4BCNA 4D1ZA 1Q62A 3FZPA 2YA9A 3KQ7A 4AW5A 3DDPA 5BYYA 3AT3A 4FSWA 2IN6A 4X6RA 4NJDA 3F88A 3COKA 1A9UA 2BHHA 2R9SA 2VO6A 3LFSA 3O96A 3U8WA 4ZZNA 4XH6A 2UZEA 1R1WA 2BDFA 3NNVA 4IDVA 2ACXA 2FGIA 4DEDA 4QYYA 1A48A 2QG7A 2FUMA 1BMKA 3VS0A 3H9RA 4ZXTA 4BZDA 1PXMA 1H8FA 2RKUA 4IWDA 4J98A 4RLLA 3QQHA 3G33A 5IA0A 2BZJA 2F7EE 2YZAA 4GH2A 3PE1A 4K33A 3HKOA 3NUXA 4MXAA 4YO6A 3ZMMA 4DBNA 5HEZA 3PA3A 1F5QA 3Q6WA 4U3ZA 2C6LA 4PNIA 1LPUA 1XH8A 2AC5A 1ERKA 2BKZA 2X0PA 3MTFA 2XNPA 4L3PA 3LZBA 3PJCA 5KMKA 1YXXA 3NUYA 3WF5A 2HY0A 4MNEA 4I3ZA 5AR7A 3T9TA 4F7JA 2GPHA 4E4NA 4BCHA 4JVGA 4PP7A 4G17A 2OSCA 2VTLA 3R9RA 3HDMA 3TKIA 1NA7A 4YC6A 3Q60A 5KMMA 2Y6OA 4JS8A 4DITA 1LEWA 2YIQA 1PXIA 4I6HA 4L45A 4IB1A 3GQLA 4QYGA 2IJMA 4A7CA 3KN5A 3E93A 3QX2A 1NVRA 5CF5A 2Q83A 3C4XA 3PVBA 2G9XA 2PK9A 3QAME 5CI7A 5HLNA 4EKLA 5CU3A 1NT2A 1NY3A 1Q61A 3UIXA 1H01A 3UP2A 5KHXA 4EOQA 2V22A 4DFYA 3MDYA 4F99A 2PY3A 5EQYA 4USDA 3AD5A 2NYAA 1QPJA 3Q2MA 4QQJA 3SG9A 3MYGA 5CQWA 4XRLA 3P78A 4O4CA 3V5TA 1UU9A 3TYKA 3WBLA 2UW5A 3FUPA 4EQCA 4NJ3A 2VTHA 3F5XA 3MY5A 3OW3A 4O1PA 2PE2A 5LWMA 2WMAA 4BZNA 2DYLA 3ODZX 5FWKK 2XIZA 4PMPA 2V0DA 4EZ3A 5AAEA 4O4DA 2X8DA 2WGJA 3RCJA 2W1EA 3ZHPC 2A19B 4AAYA 1BI8A 4FKSA 4XBUA 2BZHB 3QCXA 5DE2A 5K4IA 4AX8A 2C6EA 4I4EA 5DR6A 4R7HA 1BYGA 4E6CA 4F9CA 2X39A 3F5GA 4BCOA 4EEVA 2BUJA 2ZM3A 4FOBA 4Y83A 3HP5A 4FUXA 5J7HA 3EQDA 4BDDA 5KCVA 4DEHA 5LQFA 2R3GA 4GK4A 5BMMA 4DTKA 4YLKA 4YTHA 4LL5A 4ZTMA 5IQBA 2JFLA 3IW6A 3HGKA 3FHIA 4RJ4A 2VRXA 2J50A 2P0CA 3RVGA 1BKXA 1WCCA 1WBSA 5EFQA 1JSVA 5KBRA 5HO6A 3OCGA 3T8OA 1ATPE 1UWJA 3F69A 5EHOA 5LCKA 3TIZA 4HZSA 3W18A 4M12A 1S9IA 2RFDA 4XEYA 3VUGA 1ZAOA 3FQEA 3COMA 4U44A 1IAHA 3ETAA 5A46A 3OCSA 4BR3A 2VTSA 3SG8A 4YTIA 2YWVA 4RWKA 1JVPP 2ERZE 1GNGA 3R1NA 4IBMA 4KIKB 2XBAA 3FC2A 2CKQA 2QONA 3RINA 1JSUA 4JG7A 3R7EA 5HTBA 1UWHA 4EH4A 4BDGA 2H96A 3QWJA 1LR4A 4IVCA 4XYFA 3WF8A 4D2SA 3HNGA 2WTKC 3V8SA 3IDCA 2ITTA 2UW6A 3BYMA 4KS7A 4XG9A 2WOUA 4B4LA 4HVHA 4I23A 2O5KA 4BCMA 4I1ZA 2XIXA 3EQIA 4NM5A 5IQEA 1BLXA 3NDMA 5E92A 4ZK5A 3SLSA 3BL7A 4QNYA 3F2NA 3GGFA 2B53A 2JDTA 2PUNA 3H30A 2XNBA 3C0GA 2WTVA 4PPAA 4FT9A 3MS9A 3UQGA 3WIGA 5IMXA 4HGSA 1H4LA 1ST0A 4EC9A 3H0ZA 5CENA 3JUHA 4TW9A 5HHWA 3R83A 2R3PA 3FZOA 4L53A 5FDPA 4EKKA 3EYHA 4RVMA 3AC4A 5AUXA 4O83A 1U4DA 4XOZA 1WZYA 1XH7A 4C38A 4CLJA 3QZFA 4QMZA 5EW3A 3UYSA 3CXWA 2PZPA 2HZNA 4FV0A 5ANEA 2GSFA 1ZXEA 4AZSA 4CVAA 1JLUE 2QKWB 5JQ5A 3D14A 3KL8A 3QRUA 5DEYA 3SOAA 3VBWA 4R7BA 3BE2A 3UVPA 5AMNA 3NUAA 4HVSA 4G5PA 4NKAA 4KIQA 2QI8A 2V5QA 3K3JA 5M06A 3FZRA 4IM0A 2GTMA 2W1DA 3ROYA 2UZTA 3VS2A 2H9VA 3F5UA 4DHIB 1YI6A 3PVUA 3C5IA 3KMWA 3Q4CA 5CVGA 4APCA 4C02A 3QCYA 2OJFE 4AZFA 4UV0A 4HYSA 4OTFA 5AADA 4PMMA 5ETAA 4QO9A 4ZSLA 4ZTRA 4JR7A 2R3QA 3EHAA 1OI9A 4DT8A 2BROA 3OCTA 1WFCA 3LCKA 4C4IA 3FBVA 2DQ7X 4FIHA 2YIYA 1H1QA 2QR8A 5AUWA 3PG3A 2GNJA 3TUBA 1PXNA 4I22A 4MQ1A 2XAOA 4M67A 4CFWA 3NMUF 3LLTA 4QP2A 4BF2A 2VWWA 1PKDA 1W2CA 1GIIA 2WZJA 4AE9A 2GNIA 4OAVB 1MUOA 4Q9ZA 3NUSA 4HVIA 1V0PA 3CY3A 3OBJA 4EOOA 2G01A 3HLLA 3HA6A 4FC0A 4N6ZA 3RNIA 3VS7A 1J1BA 4M0YA 3DJ5A 5HX8A 4FTNA 3V5PA 2WMBA 2WOTA 4LRMA 4APPA 3DBDA 1OL7A 1J3HA 4C33A 5KBQA 5CQUA 5ICPA 4C62A 3UGCA 3PFYA 1WBWA 3I81A 3P4KA 3BGZA 2JIUA 4AOTA 2QOQA 3W32A 4BCFA 3A62A 5JRSA 4ZMEA 2ZM4A 4BY9E 5B0XA 5EKNA 2R3KA 4E6AA 4M69A 3ZSHA 4IC8A 3AC1A 4E73A 1IAJA 2XB7A 4JG6A 3UE4A 1APME 4U6RA 4DEBA 3ACKA 2W1ZA 2GNFA 3GXLA 5FXRA 2YEXA 4DG3E 5A4QA 3D83A 4J8MA 5I3RA 3DTCA 4LOQA 4N4SA 2EUFB