4CLIA

Structure of the human anaplastic lymphoma kinase in complex with pf- 06463922 ((10r)-7-amino-12-fluoro-2,10,16-trimethyl-15-oxo-10,15,16, 17-tetrahydro-2h-8,4-(metheno)pyrazolo(4,3-h)(2,5,11) benzoxadiazacyclotetradecine-3-carbonitrile).
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
308
structure length
294
Chain Sequence
NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Discovery of (10R)-7-Amino-12-Fluoro-2,10,16-Trimethyl-15-Oxo-10,15,16,17-Tetrahydro-2H-8,4-(Metheno)Pyrazolo[4,3-H][2,5,11]Benzoxadiazacyclotetradecine-3-Carbonitrile (Pf-06463922), a Macrocyclic Inhibitor of Alk/Ros1 with Pre-Clinical Brain Exposure and Broad Spectrum Potency Against Alk-Resistant Mutations.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 294
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cliA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cliA01
4GYIA 4S34A 2QOFA 1WVYA 4FOCA 5ETCA 5J5SA 1Q4LA 4PNIA 2DS1A 3L9LA 5L8JA 3TZ9A 2XM9A 3C50A 4EWQA 4QNYA 4F9YA 4HCVA 4O2PA 4PNKA 1AD5A 4HVGA 3ZCLA 1YHVA 5HEZA 4AGUA 2WMXA 3Q2JA 3NS9A 4Y5HA 3PIZA 5E8ZA 5CEQA 1PXLA 2W9ZB 4FODA 3ZDIA 1KV2A 4AE9A 4BDIA 4XV3A 3QALE 1T46A 5CNNA 1QL6A 5HTIA 1H24A 2F7XE 2OJGA 1YI3A 2OH0E 3I81A 2P55A 3I6UA 4AW5A 3R1YA 4CT2A 5KKRB 2J4ZA 3FBVA 2VU3A 3L9NA 3GI3A 3PXRA 4FV6A 5C8MA 3R8ZA 3V04A 5HBJA 2HAKA 3Q4UA 2CCIA 4YTIA 2UUEA 4BWPA 3ZDUA 4IX6A 4FG8A 3VUKA 4EH6A 2XK4A 4LV5A 4O7RA 4R1YA 2XKCA 3EIDA 1IRKA 5M53A 3GC8A 3QWKA 4XOYA 3VBYA 3W16A 3CBLA 3VS0A 2WMVA 1Q62A 2OO8X 3GFEA 3Q52A 4FZAB 5BVNA 4GH2A 2WTIA 3UG1A 3IOPA 4JDIA 2O3PA 4NZWB 5AFVA 3KMMA 4CTCA 5AM7A 3PJ2A 3BQCA 4FTMA 4U3YA 1Z5MA 5TE0A 3NZ0A 3MTFA 4EK3A 3FLWA 4HYSA 4EOKA 2OZOA 3EYHA 3QYWA 2PU8A 3OCGA 2UZVA 2XRWA 3BQRA 4C3PA 5EH0A 2QURA 4YLLA 5CF6A 4RVKA 3COIA 3N51A 5M56A 4F65A 5F94A 2VAGA 3KA0A 4FG7A 1VZOA 2B55A 2SRCA 2WHBA 1M52A 3NW5A 4LV8A 1YQJA 4MKCA 4FE2A 3A7HA 3NRMA 4OTDA 3TZ7A 3ALNA 4GL9A 5AV1A 2JKMA 2JDTA 2IG7A 4ASXA 4F99A 3JR1A 2UW8A 2YM8A 5JRSA 3I79A 4N6ZA 4EHZA 3CJFA 5CAOA 4KUJA 1WBSA 3GBZA 4GYGA 4IAKA 4XH6A 4C34A 5LVMA 2HK5A 3WIKA 2P33A 1KSWA 3FXZA 3LFDA 3MY5A 4MH7A 2VWVA 1XBBA 4DH8A 5IQFA 3KL8A 4RX7A 5AR4A 3ULZA 3QTXA 5JN2A 5AUTA 2AUHA 5AUWA 3LCDA 4O7ZA 3HRCA 3CP9A 4NK9A 5C26A 4GG7A 3ERKA 4IVDA 2JKOA 4RFMA 5T68A 5HVKA 2R3MA 3R7YA 1OM1A 3OG7A 3VF8A 3MYGA 4EH2A 3ATSA 5FM2A 2JIIA 5AP6A 5CSPA 5AP5A 5HOAA 3S4QA 3NUAA 3ZRLA 4CTBA 2V7AA 2B9FA 2XKDA 3D94A 5CS6A 2BHEA 4HYUA 2KULA 5M4IA 3AG9A 3KVWA 4TN6A 3QLFA 1KE6A 4NTTA 2CSNA 3VW6A 1DM2A 1H1WA 3WARA 4QMOA 5FDPA 2BHHA 4MD7E 5FM3A 2J5FA 4L00A 3ZO4A 4AA5A 1V0OA 3QQLA 3OY3A 1OZ1A 4EEVA 4FEWA 4JNWA 2PVMA 3MJ2A 1GZNA 5DA3A 2Z7QA 3CIKA 4LYNA 4YC8A 4ACHA 5FLFA 4FL2A 4CGAA 5HG7A 1HOWA 4PWNA 2I0EA 4MEDA 4XRJA 2C5XA 4XV2A 3ZSIA 1BUHA 4FTUA 5IA2A 4FTCA 3LFEA 4RA5A 2BFYA 3CY2A 4JBOA 3B8RA 2FB8A 4EL9A 3VUTA 3W2OA 4ZIMA 2YIYA 2R0UA 5ANIA 4UZDA 4NFNA 4ENXA 2R3GA 2YIQA 2ZOQA 1ZLTA 4WBOA 4XV1A 2C6IA 4C02A 5KBQA 3MFUA 4I6HA 2R0IA 4Y8DA 5GZ8A 4IZYA 2PPQA 2GTNA 3ZOSA 4U79A 4BTMA 3SXFA 4ACMA 2YCFA 4ZJVA 3TJCA 4F1MA 5BYYA 3OHTA 1Q8ZA 5AR2A 2YITA 3L1SA 3BIZA 3BX5A 3OOMA 3S3IA 2ZM4A 3VF9A 4R6VA 1PXJA 5JFSA 1NVRA 2PTKA 4QOXA 2GCDA 5JK3A 4O7VA 3KULB 4IWPA 4I4EA 3N4VA 1H00A 4M0ZA 2NPQA 5C03A 2ZB0A 3SXSA 4RIYB 2PVYA 4FSQA 3TNPC 3DAJA 4TW9A 1YHSA 4NM5A 4O91A 4FL3A 3MFSA 4RPVA 4YJVA 1MRVA 2R3IA 2X8EA 2J9MA 4G6LA 4BFMA 4C36A 5K9IA 2X8DA 4I92A 4C4EA 3QFVA 5L4QA 5HKMA 3R01A 4TNBA 3K3IA 3L8VA 5KNJA 3NIZA 5ANOA 2VTRA 4F6WA 2C5VA 4QTBA 4QPSA 3M1SA 4EC9A 4JQ8A 3UVQA 5AUVA 4CRSA 3OWPA 3SHEA 1XJDA 4WUNA 1Q3WA 2OF2A 4GU9A 4CKJA 3OVVA 4FKIA 5J7HA 2CGVA 2BFXA 3UOKA 3IQ7A 3QQFA 3BHHA 4N6YA 1G8SA 3VS1A 3I4BA 5CEMA 1CKPA 4A9TA 5EYCA 3C9WA 4E1ZA 5KMIA 4A9YA 4OTQA 3VQUA 2XBAA 3OZ6A 4L42A 4WHZA 4D58A 4E4XA 4RX8A 1FINA 4GU6A 3ZO2A 2XJ1A 4F08A 2UZDA 3GU7A 4BCHA 1NY3A 4USEA 2QR7A 2JDVA 3PXKA 1H8FA 4FTTA 4FIEA 3SOAA 4ZTHA 4NM3A 4EOPA 3EL8A 5AA8A 3IDPA 2B7AA 2W1FA 5IQBA 1Q8UA 3RPVA 3ZLWA 1KOBA 4C57A 4EQMA 5DYJA 3FLQA 4Z7HA 1PJKA 2OF4A 3R7IA 3ZSGA 1YKRA 2QVSE 4XV9A 4Y72A 1ZMUA 4MF0A 1ZYCA 4YZCA 4D2RA 3IECA 4AN3A 2B9JA 3ORNA 4I94A 4U97A 3II5A 4RT7A 4DH1A 5FGKA 1H1PA 3BEAA 3GEQA 1JKLA 4AP7A 3MB7A 4QNAA 4BCQA 2QONA 1CKIA 3F5PA 4YJRA 4O7SA 3BWFA 3QD4A 1XBAA 3MI9A 4RRVA 4EQUA 2RGPA 2DYLA 4X6QC 2OW3A 4XUFA 5DR9A 4EOQA 4V01A 3OY1A 4RJ8A 3KMWA 4XHKB 2GQSA 1REKA 3R63A 4XBUA 3PRFA 3Q4CA 3UVPA 4MNEA 4NTSA 3EB0A 3DKOA 3PWYA 4RJ5A 3BLRA 5BVEA 4D9TA 2WGJA 2G2FA 3FI3A 5CANA 3F5GA 3QQKA 3IOKA 2X2MA 3NX8A 3DOGA 1GJOA 4V05A 1PXOA 5DOSA 3AT4A 4CV9A 4CMOA 4CQGA 3E62A 4BI2A 3DJ7A 4LRMA 2O64A 2OIQA 4FIGA 1SYKA 4RVMA 2XVDA 4H05A 3CEKA 2QG5A 5FEEA 3HDMA 4B8LA 4O6EA 2ZM1A 4D2VA 5A46A 1JWHA 2W1IA 4EJNA 4FKWA 5BQ0A 4TY1A 2ZM3A 5M51A 4FSMA 4ORKA 1K9AA 4E5AX 3R2YA 5H3QA 2ZV8A 2A19B 3AT3A 4C3RA 5I9VA 5AAGA 2RIOA 1FGKA 4ZAUA 2VZ6A 4YJUA 3ZS5A 3MPAA 4ZZMA 2PE0A 3NGAA 3DNDA 2FSLX 4AGDA 4BICA 3UPZA 2ZAZA 4FVPA 4UV0A 2H8HA 2QOBA 4TYEA 1Y91A 5CU2A 3RZBA 3VRZA 3WZUA 3ZRMA 4D4YA 1E1XA 5BVOA 5E8YA 1H01A 4XG4A 1YOLA 2WQEA 3KXHA 3NUUA 4E73A 4YTHA 4DTBA 4OBPA 2XNNA 4QMTA 3HUBA 1UKHA 4KABA 2CNUA 4KKEA 4BDHA 5EFQA 3NMUF 3LQ5A 4K0YA 3F82A 3EN6A 3NVMB 4YMJA 3VHKA 3CC6A 5D41A 3S00A 2Y6OA 2X6EA 4H3BA 3UZPA 5CAUA 2J0MB 4O86A 4QP9A 4C38A 5J79A 3FZTA 4DT8A 4MXXA 3KF7A 3FWQA 3L8PA 2PL0A 4G9RA 4IWOA 4JOAA 5C01A 3Q3BA 4BWXA 4D1SA 5EW8A 2Y7JA 3W2CA 4MWHA 4ZZNA 3MSSA 4YHFA 2VWYA 3VS7A 1Q3DA 2WTJA 1Q24A 3ORLA 1ZYDA 3IONA 4U44A 4DE4A 2Z60A 2V22A 3H0ZA 4ZS0A 3ZLXA 2FO0A 1JBPE 2B54A 3A4OX 3NW6A 3F7WA 4GUBA 4W4YA 4CKRA 1PXPA 2R7BA 4FKLA 3BU5A 3POZA 2R3KA 4O0VA 3VUIA 2IVTA 1OGUA 3UO4A 3BHVA 4H39A 4BIDA 4CNHA 5F20A 3FQHA 2VTTA 3PP1A 4L45A 3EYGA 3O23A 3AXWA 1PKGA 3BLQA 1FMKA 2VWZA 4MCVA 1FVRA 2Y4PA 5LQFA 2WQOA 3MGYA 3TTJA 3UNKA 4Z3VA 5J9ZA 1ZZLA 5IQGA 2B9IA 2XK6A 3ORIA 3QWJA 3E7OA 4FG9A 4U81A 1KE7A 5F1ZA 1XWSA 4UBAA 2R4BA 1BI8A 3NNUA 3PVBA 4E7WA 2ETKA 4K9YA 3LKMA 3N4UA 4MBLA 3RPSA 5IQAA 2P4IA 2W1DA 4BZNA 5BVKA 3G90X 4QTCA 4LI5A 4YP8A 4FV9A 2EXMA 3DZQA 4NFMA 4XEYA 3MESA 2WMRA 3QRTA 3U9NA 3V8WA 3NUPA 3C4XA 3R22A 3TCPA 5TT7A 2VWUA 3VHEA 4ZTRA 2OXYA 2OH4A 4FKOA 5IQHA 3DAKA 4PF4A 4FUXA 3VO3A 2WQMA 3PSDA 4AACA 2CNQA 3RINA 4F0IA 2VTPA 4X2JA 2UZNA 4QMWA 2YIRA 4DITA 5TKDA 3MBLA 3VS2A 1NVSA 1RE8A 3Q4ZA 2C3LA 3B8QA 3LFNA 4HGLA 2XIXA 3UIXA 1BYGA 4NU1A 4IBMA 4XG9A 2WTWA 3BEGA 2R9SA 4AW1A 1XH8A 2PVRA 4X3JA 3HUCA 3O8UA 1ZY5A 3ODYX 4UB7A 4G3GA 4DFNA 4PL5A 2IW9A 3OROA 4WKQA 4L3LA 3Q6UA 4NEUA 5IEVA 3QTQA 5KKRC 3ZEWA 3CTJA 2XP2A 3MH2A 4GJ2A 4YJOA 4CFWA 3EQCA 2Y9QA 3NYNA 2I6LA 5DBXA 5HCYA 4E93A 2FVDA 2BRMA 2YZAA 4XG7A 4P5QA 4X0MA 3IPHA 3VBWA 5KMOA 3Q60A 1TQPA 5DT4A 4HVIA 2ZDUA 3QL8A 3GU6A 3ZBXA 4QP6A 2Y6MA 2REIA 4N4SA 3RAHA 3ZUUA 4BTKA 2XIRA 4CKIA 4I0SA 3G0FA 1NVQA 4WNKA 4ZXTA 3RHKA 4C4JA 4EH8A 5L6WL 3CD3A 4FMQA 2VTIA 3FKLA 4W4VA 4WSYA 1G8AA 3LLTA 3QD0A 4XNEA 5HO6A 4QMZA 5CF8A 3UIMA 4CXAA 4YLJA 2GU8A 3PSBA 3R28A 3R73A 2JDOA 3QXPA 4KAOA 3I1AA 5GJGA 2YDIA 3EQHA 3AT2A 3DFCB 4J97A 4QT1A 3KXXA 4DF3A 5D10A 4IJPA 3O71A 4FKSA 3DFAA 3H30A 3NDMA 1QPEA 4DFYA 4EUTA 1APME 5A4QA 2WPAA 4DGGA 3TDVA 3F3UA 2E9OA 4EZ7A 3MY1A 2IZUA 2Y8OA 3KXMA 1PW2A 2W5HA 4B7TA 4QP4A 3EFJA 5IZFA 3NSZA 4FV7A 4L53A 4M14A 5HNBA 2GS7A 4R78A 1BLXA 4QTAA 3Q6WA 1OIYA 2IVSA 2OJIA 3I7CA 3JY9A 4RVTA 2UZUE 4BCOA 4BYIA 4C33A 4DTAA 2XEYA 3VIDA 2JDSA 4O0XA 5GIPE 4FTKA 5LWMA 2PZYA 3BI6A 3C51A 3TNIA 3T8OA 5IH4A 2PSQA 2Q0BA 1CDKA 3G6HA 3OT3A 5JFWA 1OL6A 2WQNA 2X39A 2X4FA 1DI8A 4FF8A 3MW1A 4R3CA 4QMXA 4DH7A 3PE1A 3F88A 1VYZA 3CGFA 2VV9A 3EMGA 4Q9ZA 1BX6A 4RA4A 5BVWA 5BMMA 4DFLA 1STCE 3OCTA 4IEBA 5BUEA 4OTHA 4M3QA 3RPRA 4B0GA 4M8TA 1JSUA 4K18A 1ZZ2A 4D0XA 1WBVA 4B4LA 3D4QA 5FTOA 1FOTA 3LFFA 1ZY4A 1KE5A 2PK9A 3FL4A 1M2QA 3FI8A 4IVAA 4ZSJA 3NUYA 3ORZA 5J95A 3ZRKA 2VWIA 1YOMA 4J1RA 2XKFA 3PYYA 2X7OA 5KHXA 3QRJA 4PMTA 3PPKA 4UWYA 3WE4A 3ZO1A 2C3IB 3CQWA 4XOZA 4AA4A 5M09A 2VTMA 3TV7A 1XQZA 1YDRE 1WBPA 5BNJA 1H26A 4ANQA 2VWXA 4JBQA 1HCKA 3FXWA 4OTIA 4AS0A 2BKZA 3EQGA 3Q9XA 5E91A 4L67A 4C3FA 4II5A 5CASA 2BDWA 4F7LA 4IZAA 5HBEA 1LUFA 2UVYA 4IIRA 4JS8A 1OBDA 4KIOA 3UO5A 2B4SB 2H34A 4ZK5A 4AFEA 2UZEA 4K33A 2CKPA 4C35A 5JZJA 1ZAOA 4G6OA 5E8UA 4XLIA 3TL8A 5JFXA 3DBDA 3HEGA 3L9MA 3PXQA 4CT1A 4O7WA 4BB4A 3H9FA 3UPXA 4I3ZA 2G1TA 4QP8A 3PY1A 2C5NA 4BDJA 5AJQA 4JAJA 4YZDA 1OKWA 3FZSA 2WMBA 4J71A 3DNEA 2IPXA 5CU3A 2PZPA 4IB5A 4QMVA 4EH3A 3G33A 1ATPE 4LGDA 4ITHA 2BIYA 3FZPA 4CMUA 1OECA 4AAAA 4H36A 5F4NA 1OVEA 4U0IA 4BWKA 5KMLA 5IA4A 5M4UA 3EN5A 5AV4A 4PY1A 4FK3A 4IX5A 4FC0A 4KS7A 4I22A 4NJ3A 5HCXA 3T9IA 4MBIA 4QYHA 5C8NA 5LVNA 4PUZA 3UQFA 4AUAA 2ZVAA 3GCSA 4L8MA 5IEXA 2YAAA 1PMUA 4DLJA 2XNBA 1PF8A 2XKEA 4CSVA 2R3HA 4BTJA 3QTZA 5FXSA 5IMXA 3UJGA 3OTUA 2XK7A 4CV8A 5HTBA 3Q9ZA 4CYJA 5EDPA 3EQRA 4EH5A 4AZTA 3LIJA 2PE2A 4F0FA 1NA7A 3FMDA 3JS2A 3VUGA 5DH3A 5BMSA 5LCJA 5CSHA 4BTFA 5I9WA 2W5AA 4ZTQA 5D7AA 3OMVA 3FJQE 1PXIA 4U8ZA 3ZUVA 5IUGA 3DY7A 1XH5A 3FLSA 3LJ0A 1T45A 2F2UA 1OPLA 2V0DA 3DV3A 4RFYA 4RIXB 3BU3A 1IEPA 3ANQA 5AWMA 2GNFA 3V5PA 3GT8A 3MH0A 3V01A 5DR2A 4CLIA 1URWA 3O17A 4AWIA 3F3WA 1UNGA 5IKWA 4NCTC 4K6ZA 3FLZA 1OIUA 3BELA 5EOLA 1TQIA 3P23A 2WMUA 2B9HA 2QODA 2WEIA 3KULA 4IVCA 4I6FA 4C7TA 5CT0A 3V5JA 4BF2A 5BVFA 1JQHA 4RIYA 1YW2A 1JSTA 4QQJA 5I0BA 3UO6A 5JRQA 3V8SA 2EWAA 4JVGA 3W8QA 1ZWSA 1H28A 4PP9A 3S95A 3GFWA 3OWLA 4EOOA 3R7UA 4HJOA 4QMMA 5J87A 3ZYAA 2W4KA 3NUXA 4GIHA 5D1JA 2PYWA 2WTVA 3FMHA 3VS5A 3ENHA 3DBEA 3ZFYA 2R3NA 4HGEA 4ANNA 2RFEA 5L2TA 4R8QA 5LVLA 5CZHA 3QD2B 1TVOA 2J7TA 2QG7A 3HDNA 1XKKA 3FSKA 4A9UA 4U43A 5IA3A 4M67A 3Q2MA 3R04A 4TL0A 2R3RA 4I1ZA 2I0HA 3JY0A 3HRFA 2HZIA 4WNPA 2Q0NA 4G2FA 4AT4A 4JT3A 3R1QA 3HA8A 4CFNA 4L52A 5G1XA 4NUSA 3RBWA 2JBOA 3REPA 4ZY4A 3G0EA 1PMNA 2YLEA 5JZNA 4KKHA 4PTGA 4GFGA 4XMOA 3SX9A 5JGAA 1PXNA 4I5MA 1UA2A 2WMAA 3LOKA 5LVPA 4YSMA 3E64A 4BCFA 3SW7A 5DMZA 4FKJA 4I5CA 4NCTA 1WZYA 1KUTA 1Y8YA 4TNDA 4YJTA 3OBJA 1OUYA 4LL0A 2F57A 3EFKA 5BYZA 3R30A 1WBWA 3FHIA 4RQKA 4NKAA 4OTGA 2XB7A 3FPMA 2QOKA 3UBDA 4D2WA 4BCIA 2YCQA 3CSVA 3RWQA 4XP3A 3LZBA 4ANSA 4FV5A 5M07A 1XBCA 2XH5A 3CPCA 2C47A 3CQUA 5DVRA 2QLQA 4AG8A 1X8BA 4MTAA 2WMSA 3W2RA 2VTSA 1ZYSA 3R83A 2GNHA 5IA0A 3LXPA 3RAIA 4APPA 2YEXA 5HQ0A 3ULIA 4YJNA 2VX3A 3MFTA 2RG6A 2ITNA 4G3DA 3HP5A 2GDOA 1YXXA 5K0XA 3ID6C 2O8YA 4NYEA 4DCAA 3LFBA 2ZYBA 5H8EA 5AP3A 4L3PA 4BCKA 3QQUA 5H8GA 4I41A 4C61A 5BYLA 2OKRA 4MNFA 1UU3A 3EL7A 5KUPA 2CPKE 5DE2A 1LP4A 1QPDA 3GGFA 3HVCA 4FA2A 5B2LA 4CLJA 3GB2A 3THBA 3OBGA 2FSOX 4MBJA 4FYNA 5KMJA 3FEGA 3TTIA 3F5UA 4KIQA 3QA8A 4XLVA 3V51A 3I5ZA 4TYHB 3WYYA 5E7RA 3ORMA 2ITXA 5D12A 3WIGA 3DKGA 4DN5A 4UMRA 3EKKA 1SMHA 2QO7A 3TUCA 3GENA 5JH6A 3KN6A 4J52A 3P78A 3SA0A 4ZSGA 5LJJA 2QKRA 5LMKC 4BL1A 1CTPE 5BPYA 5HNIX 3PG1A 3I5NA 2BZKB 3DBCA 1W82A 4OBOA 3H9RA 3S2PA 4FKRA 3BPRA 3FHRA 4IX3A 3OCBA 3PTGA 5A14A 4FR4A 4L7FA 4FL1A 4RSSA 4WG3A 2C1BA 3CD8A 4ZEGA 5IQCA 1ZRZA 2ERZE 2ETRA 3MIAA 2UW9A 4DA5A 5EM5A 3TZ8A 1OMWA 2EB3A 2W99B 4ZSLA 5AA9A 3R7GA 1QPJA 4YPDA 4FV3A 3ZLSA 2VGPA 4YZBA 1ZYJA 4P90A 3A2CA 3RMFA 5B2MA 3B2WA 4HNIA 1Y57A 1YI6A 3ANRA 3GCQA 3PA4A 4O1PA 3R9DA 1J7LA 3TM0A 4AU8A 5EHLA 2RFDA 3FAAA 4E8AA 1UV5A 1E1VA 3HZTA 2CNVA 2JBPA 3PG3A 5IUHA 4RFZA 5ICPA 2V55A 2DQ7X 3OXTA 4NSTA 1PXKA 1R1WA 4QMNA 3NWWA 4MXOA 3TJDA 4G34A 3DQXA 5IEYA 1B38A 1FVTA 3QCYA 4KIKA 5HD4A 5E8WA 2UVZA 4J98A 4Y46A 4YGAA 4QTDA 2HWPA 4RZWA 2OU7A 3F2NA 3FMKA 4QMPA 5DNRA 5BX0A 5LMKA 4EOMA 4YLKA 5CEPA 5LOHA 4Q5HA 2XBJA 4F7NA 4WBBB 4FV2A 3UZTA 1ND4A 2PZIA 4V0GA 5HO7A 3R1NA 3AGLA 4HZSA 5FG8A 2E9NA 4C0TA 4PTCA 1J3HA 3TIZA 3DB6A 4AX8A 4JG6A 4AT5A 3SVVA 3EQIA 3MPTA 4BCJA 2BTRA 2GNLA 3DKFA 3OWKA 4FKGA 2JD5A 5DWRA 4ZTSA 4S31A 2CKOA 4F64A 5BUJA 4ITJA 4YZ9A 2QQ7A 1G3NA 4G3CA 2ETMA 4EJ7A 2XYNA 2UZWE 3RM6A 3N9XA 1EH4A 2VX0A 4HZRA 3O7LD 4Q2AA 1YOJA 3OP5A 3CY3A 3QUPA 4ACDA 5CQWA 4DG2E 2XNOA 4WRGA 4EKLA 1RJBA 3ORTA 2YIWA 5ANJA 4BBMA 2XJ2A 4KA3A 3JPVA 5AEPA 3KRJA 4BDGA 4CVAA 4N0SA 5M55A 3A8XA 4BDBA 3E7VA 3BBTB 3NAYA 5HZNA 1FMOE 4O83A 3W8LA 3QTIA 4ZTNA 2VTQA 1P2AA 1WBTA 4JRVA 3FKOA 4FICA 4IFCA 2GTMA 4EBVA 3F61A 1IR3A 2WOUA 3LM5A 2OJJA 4QQTA 3ZC5A 3D2KA 5H8BA 4BYJA 2IN6A 3QD3A 3PSCA 4AZVA 3AOXA 3NNWA 1YDSE 5LCKA 3DT1A 3F6XA 2HY81 2GHMA 4PPAA 4C4IA 4EK6A 5AUUA 2W1GA 2BRNA 1H1QA 3Q9WA 4FT3A 4RVLA 3D14A 4GUEA 4RJ7A 1H25A 4QRCA 3UOJA 5CI7A 5AP4A 1IAHA 4UYAA 4EZ3A 3BE2A 3IW7A 2C69A 4E26A 3RI1A 2WELA 4GVAA 2GMXA 3EFWA 1B39A 3POOA 3ZM9A 3DK7A 4C58A 3LJ1A 3PJ3A 2YJRA 4FOBA 3ZONA 3RJCA 3UYTA 4O21A 5DLSA 1RQQA 2BAQA 1YHWA 2B1PA 3GU5A 2X1NA 5EM7A 4DTKA 2A4LA 5A4LA 3QBNA 4RC2A 4PL3A 1Z9XA 2W7XA 1K3AA 4RMZA 3RK9A 1Q8TA 3HGKA 4E4NA 3ET7A 4ERWA 1W0XC 1OKVA 2W0JA 2Z7LA 4GT3A 4LM5A 2XCHA 5EYDA 4NH1A 4I0TA 3VUMA 4U42A 4JR3A 2F2CB 4JL9A 5CEIA 2X7FA 4GV1A 3DJ6A 3HMPA 2F4JA 3LVPA 3LXKA 1OKZA 4D1XA 4EH4A 3HX4A 2O0UA 5KBRA 2Y0AA 4FSYA 4F63A 2UW3A 2OLCA 3PPJA 1GIHA 1W7HA 3E8EA 4D0WA 5CF5A 4UZHA 5IUIA 5I9YA 3EN7A 4X21A 3AC3A 1GY3A 4FSRA 2YLFA 3HAMA 3TACA 4R7IA 3R9OA 2W4OA 3DGKA 4G6NA 1J1CA 4KB8A 1JKSA 2A1AB 5HG5A 3CR0A 3MVHA 4G1WA 3MY0A 4QMSA 4YHJA 4F70A 3D83A 4LMNA 2F49A 4PMSA 5HVYA 4MXCA 3GNIB 4A07A 3COHA 3LXLA 4RC3A 4AZEA 5DRDA 4BCNA 5KMMA 5FXRA 5JGDA 4EZ5A 1LEZA 5G6VA 2HZNA 4D2TA 3OEZA 4K2RA 4NW6A 1U59A 2C68A 3UTOA 2BZJA 3TT0A 1K2PA 3OS3A 4HPUE 4P5ZA 3FZOA 4KWPA 3HECA 4FV0A 4IDVA 4BGGA 4EHVA 3UZRA 3UOHA 3RCJA 1JOWB 4PDSA 2YCSA 2J0LA 2QKWB 2ITQA 3D5WA 3FLYA 4A9RA 5HLWA 4O81A 1WMKA 5FDXA 3AD4A 2GS2A 4GK2A 4JQEA 4S30A 5AP1A 5B2KA 4QO9A 4ZJJA 3UOLA 4DGMA 4EK8A 5H9BA 1Y6AA 3DU8A 2W4JA 4FTQA 4I6QA 2PZRA 4HCTA 4A06A 4AFJA 2PVKA 5DI1A 5C1QB 2F7ZE 4EYJA 4IADA 2HCKA 4DEGA 4IAAA 3D15A 5A6OA 3QXOA 4X6RA 2YDJA 3TV6A 2WOTA 1BKXA 4LQMA 1GOLA 2C3KA 3A4PA 4FKUA 2O5KA 4ZP5A 2YWVA 4AOJA 4QP7A 5JQ5A 3BWJA 1UU8A 2BILB 5AR3A 3TN8A 3AC1A 2OIDA 3AMAA 2ZV7A 4U41A 5CSWA 3TKUA 5HHWA 5EDQA 4RIOA 2CN5A 3WF8A 4NL0A 3T3VA 3TUDA 5EYMA 5HIDA 4CFUA 3AMYA 1UWJA 5AX3A 3FMMA 1JNKA 4ZTLA 5JQ8A 4FYOA 1XHAA 1U4DA 3L8XA 5HIEA 1OL1A 3C7QA 3O96A 5KZ0A 2RKUA 3FI4A 3W55A 5HE2A 3UGCA 1MQBA 5CY3A 4BGHA 4DEIA 5C4KA 4JX3A 3OEFX 4G31A 5EG3A 5KMNA 2CKQA 3V5QA 2IO6A 4HNFA 2QO2A 3CGOA 3LW0A 5KX8A 4CG8A 5I3OA 4N57A 4PMMA 4YBJA 3PWDA 4DFZE 3LMHA 2IJMA 2QO9A 4R7BA 1A06A 4KIKB 1GIJA 4Y95A 5EYKA 4ALUA 4IHPA 4GEOA 2W1EA 3IW6A 3HRBA 3P86A 5CXZA 4F7SA 4M84A 3UNJA 3DDPA 1P4FA 4IFGA 4J96A 3R8UA 3SG9A 3BV3A 5AV0A 1I44A 4M68A 4V0GB 3C4ZA 4DG3E 4APCA 5CU0A 1OB3A 3AMBA 5I9UA 1I09A 5AAFA 5LARA 4BY9E 5FTQA 1R39A 4P7EA 4U5JA 3ZZEA 1OBGA 4DAWA 5KE0A 3V5WA 3F3ZA 5EQEA 4D1ZA 2V7OA 3TUBA 2WAJA 5I9XA 3MIYA 3QZHA 2GNGA 3FI2A 2XEZA 3UMWA 3QCQA 4XCUA 4IM2A 2H96A 2XNPA 2PHKA 4FNXA 4U40A 4XRLA 5CYIA 1M17A 3V5LA 3ZFXA 1L8TA 3NAXA 1JKKA 2V5QA 5E8SA 2GS6A 3U87A 4ONAA 4BIBA 4Q9SA 4RX9A 5HNGA 2B0QA 3O2MA 2NP8A 4O0SA 3F9NA 4OBQA 5E1EA 2I1MA 3HV4A 3VW8A 1PRYA 4KBKA 2BROA 2J0KA 2R7IA 4EORA 4AXAA 2QNJA 1Q8WA 4AN9A 3R0TA 4PX6A 4FNWA 4L7SA 4RWLA 4FSNA 4GCJA 4YJQA 4A4LA 2JIVA 3NYVA 4BN1A 3PXYA 3SAYA 3GCVA 4ZLZA 4HVDA 2R3LA 1H4LA 2C6MA 3WF7A 5IQDA 2NRYA 3SC1A 2OWBA 3T3UA 3U4UA 2UZOA 3I7BA 3DS6A 3HMMA 5FXQA 3P4KA 4GS6A 5ANKA 4ZSEA 2VTAA 4JG7A 2QU5A 1JVPP 1Q5KA 3NUNA 4FZFB 4FKVA 1VYWA 3HV7A 4BGQA 2CJMA 3H10A 3IKAA 5IPJA 1Q41A 3D0EA 4MD8E 4BC6A 4E5WA 3TEIA 4M66A 1KWPA 2ZMDA 3KXGA 4RIXA 3G9LX 4Y83A 3F5XA 4LG4A 3T9TA 4DBXA 3F3TA 4G9CA 3GC7A 4BZDA 2YABA 3DCVA 3V8TA 4AW2A 2OI4X 5J8IA 4WOVA 3UQCA 3UIUA 3LPBA 4QMQA 4F7JA 5EQYA 2G01A 3PY3A 4L44A 4ANLA 3OT8A 3BHUA 4E5BA 2I0YA 3COMA 4QQ5A 4L43A 3D7ZA 4EOSA 2KTYA 3KRRA 3LCSA 1WFCA 3NPCA 1YWNA 4E6CA 1ZARA 5HGIA 1PYEA 1OL7A 3DZOA 3NCGA 3O8TA 2G2HA 2EUFB 4PL4A 4JX7A 4XBRA 3ZUTA 1DS5A 3ORXA 3V6RA 3DTWA 5AMNA 4WNMA 1IG1A 4OT6A 3A7FA 5F95A 3R2BA 4GRBA 2HXLA 4FNYA 5C9CA 3RP9A 3DXPA 2Z7SA 5A4EA 4XG6A 3NEWA 1BL7A 1L3RE 2OZAB 3I60A 4FZ6A 4NIFA 4O6LA 3SGCA 4UY9A 4H1JA 5GINE 3WF6A 3A62A 4Y85A 1OUKA 4NJDA 4BCGA 2VWBA 4FIJA 5AX9A 4NT4A 4X2NA 1XO2B 1Q8YA 3E93A 4DH3A 3KEXA 5IA1A 1R78A 3ZLYA 3QTWA 2WIPA 3IDBA 3PJCA 4MXYA 4W8EA 4D5KA 3WYXA 2P3GX 4C62A 1DI9A 3FC2A 4IM0A 4FGBA 3G51A 5EHOA 3ZC6A 4EH7A 4EHGA 4QD6A 3ENMA 5C4LA 1O9UA 5CXHA 2A2AA 1MRYA 2BTSA 1GNGA 4YC6A 3AC8A 3R71A 3TWJA 4EOJA 2GFSA 3HMNA 2WNTA 2HW6A 3AC2A 2X9EA 4TT7A 1M2RA 3BYOA 2QLUA 3CE3A 3VBQA 4TWNA 4DFXE 5J7BA 4FT5A 3QLGA 5ETAA 3TG1A 3VJNA 5KZIA 1KE9A 4WIHA 5FP6A 3Q5ZA 5E8VA 2XZSA 2JKKA 4FNZA 2R3QA 1WBNA 4GT5A 4PP7A 3CS9A 2BKKA 3AGMA 4ACCA 5A4CA 2OJ9A 4IACA 2VD5A 1UWHA 5L2QA 2QOCA 3JXWA 1URCA 2FSMX 2OXDA 1H08A 4KS8A 3A60A 3S1HA 2HOGA 3QHRA 2QI8A 5HX8A 1P14A 4CZUA 3VBTA 4L01A 3R9HA 5HORA 4KSQA 2CN8A 3ORKA 4NW5A 5AR5A 4C2WA 1Y6BA 4E6QA 5GZAA 5E90A 4IVBA 4XYFA 1V0PA 4J95A 4OAVB 1Z57A 4AZFA 2QOHA 3EJ1A 4LMUA 4D2SA 3WE8A 3MVMA 2RFNA 4ZSAA 2E9VA 4QYEA 4U9AA 3HA6A 3IW4A 4YNEA 2PMOX 2UZTA 3GCUA 1SVHA 4AOIA 3QUEA 4TYHA 4UXQA 4IXPA 2CGXA 3E8DA 3A7JA 3MTLA 5AP2A 1OKYA 3KXZA 5ANGA 1P5EA 2BVAA 5B0XA 4ARKA 2UW0A 3JYAA 2JAVA 5DEWA 2X8IA 4NWMA 3Q5IA 1PY5A 2BRBA 4GFMA 5IQEA 1V0BA 2HZ4A 3P5KA 2X2LA 4Q5EA 4U6RA 4YC3A 2OSCA 5HE0A 4DC2A 1IAJA 4D4RA 1VEBA 2XK8A 2YAKA 2ERKA 4DGNA 2ONLC 4I23A 3FMNA 5DGZA 4D2PA 4IM3A 3FY2A 3WBLA 2BDFA 5CF4A 2WO6A 3HKOA 2RFSA 4BDFA 5HICA 3LFSA 3SQQA 4MXZA 4OTFA 2V62A 3LHJA 1B6CB 4FEQA 4OGRA 4QYYA 2O2UA 3RTPA 4E3CA 2PWLA 2C0IA 2Z8CA 4JRNA 1UNHA 5DT3A 5AP0A 2B52A 4HYIA 3RHXA 3MPMA 3VN9A 4DINA 1CKJA 1JKTA 2R3JA 3PY0A 4I5PA 4YTCA 3FUPA 4H3QA 2EVAA 2HWOA 1YXSA 4JJRA 4I93A 4G3EA 3EHAA 5HTCA 3U55A 3W32A 3DKCA 3OCSA 4IMYA 4J53A 4BKZA 4J8NA 4UWBA 5K4IA 3BKBA 2R64A 4FIHA 4V04A 3KMUA 4ANOA 3O7LB 3OD6X 4WG4A 4QPMA 3D7TB 4FSTA 3SG8A 1W98A 5HE1A 4IAIA 4JIKA 5IG1A 5DR6A 1O6YA 3KB7A 5IQIA 3QF9A 1PMVA 4YHTA 4C59A 5B7VA 1NXKA 2XK3A 4IX4A 4R1VA 1PHKA 3A8WA 4ZOGA 1J7IA 4O7TA 3F2RA 1O6KA 4GKHA 2BAKA 3OUNB 4FZDB 2X2KA 5DPVA 5C8KA 4TWCA 1KV1A 2ONLA 5JFVA 4IH8A 4LRKA 4O7YA 1GAGA 1XR1A 4FGRA 5HESA 1ZYLA 2VNYA 2ZV2A 5K4JA 2BR1A 3COKA 4JDKA 1YWRA 4ZJIA 3R7OA 3LFAA 1Y8GA 2BRGA 1IA9A 4YURA 4CG9A 3ZH8A 3QU0A 2XIKA 3OXIA 3PVWA 4FX3A 3W1FA 3KVXA 4EK4A 5HU3A 3LCTA 3PPZA 2VO6A 4MXAA 3PXZA 2HW7A 5ANEA 2VTJA 5HBHA 3QTUA 4R5SA 1MQ4A 2RF9A 2ZV9A 4RBLA 4F9CA 3TKHA 3F69A 4R7HA 4WRSA 3FQEA 5EK7A 2CMWA 4O7NA 2OK1A 3U6IA 5EI2A 4G16A 5DFPA 4S33A 5EM8A 5M4CA 2WD1A 1FBNA 4OAUC 3NVKI 4JAIA 4BDCA 4YU2A 3KCKA 4E4MA 2ITWA 2C6EA 3BYSA 4O7LA 4IZ7A 4OTPA 1AGWA 3FMLA 5E9EA 2F9GA 4NIFB 4KD1A 5D9HA 4DEDA 4DEAA 3FYJX 3O51A 3C0IA 4WA9A 3R1SA 3C1XA 2H6DA 5AAEA 3R8LA 2CGUA 3D5XA 3VUDA 4B99A 5TR6A 3KK9A 2VRXA 1M7NA 4CRLA 2G15A 3ITZA 4EC8A 1PXMA 1BI7A 2YFXA 4BBEA 2ITYA 1WBOA 4PMPA 1ZOGA 5CT7A 2GSFA 3RALA 3WZKA 3OXZA 4IZ5A 4X2GA 2ITOA 4C8BA 2UZLA 3C4WA 3GOPA 5L3AA 3TXOA 3IO7A 2X0GA 3BV2A 1YVJA 1H0WA 1R0PA 1GZKA 2G9XA 3GUBA 3U8WA 4UN0C 4GSBA 1H1SA 3KRWA 2IZRA 3PJ8A 3R00A 4IAYA 4W9XA 4H1MA 5L2SA 3OWJA 3WZJA 2C0TA 3GQLA 2VTHA 3GP0A 2FYSA 2C1AA 4F1OA 2XCKA 4X7QA 4QYFA 4EYMA 2UZBA 3D5UA 2WU6A 5FQDC 5HO8A 2C6KA 2JC6A 4OUCA 4FT9A 1XH6A 3MV5A 5LMAA 4O0YA 2QOQA 2ITVA 5CAVA 2WFYA 4KBAA 2XF0A 5EKNA 1UVRA 2OFVA 3GOKA 2BZIB 3HAVA 3IK3A 4A9SA 4Z55A 3RM7A 3JVRA 5HG9A 4PDPA 4L46A 3SLSA 3IDCA 5K0KA 4YR8A 3C13A 3MFRA 5L2IA 5FUTA 4K77A 4K1BA 3E5AA 4BZOA 3CCNA 4I21A 4FKTA 3ROCA 4AT3A 5ITAA 2W17A 1CSNA 3EQFA 4EI4A 3BZ3A 1F5QA 4L6QA 3UIBA 5FEQA 5HU9A 4Z16A 3L9PA 3H4JA 2WU7A 1RW8A 5EHYA 4RJ4A 4I5HA 3PP0A 4BCMA 4OTRA 3BYMA 2Z7RA 4G17A 4M0YA 4GW8A 4YTFA 3LE6A 2YM5A 2LAVA 5L6OA 5IU2A 1JLUE 3M11A 1RDQE 3K3JA 3NYXA 4MX9A 2VTLA 3VQHA 2HXQA 5CVGA 5E1SA 3WF9A 3C0GA 4ALVA 3FE3A 2YJSA 3O50A 2QD9A 3RAKA 4GK3A 2I40A 1H1RA 3E63A 3LQ8A 4LL5A 3GU8A 5TOZA 2RG5A 4IAZA 1NW1A 2OICA 1F0QA 4YSJA 4EUUA 4JDHA 2BZHB 4ZY6A 4FVRA 2WB8A 4AZSA 5AADA 2PUPA 3FSFA 2W96B 4FIFA 4C4HA 3BGZA 5JEBA 5L8KA 5J9YA 1M7QA 3LAUA 1UU9A 3BGPA 2PE1A 4I24A 4O0RA 3RK7A 5CENA 4I20A 5T6KA 3DBQA 4TKSA 5CALA 2PUIA 3V5TA 4LOPA 3SRVA 2BAJA 3HNGA 1H27A 4RJ6A 4S2ZA 4WT6A 4CFFA 5J5TA 3O0GA 1S9IA 4RC4A 4UMTA 3VAPA 4DHFA 2J0JA 4MD9E 1U5RA 5HI2A 5FD2A 4IB0A 2OXXA 2ZJWA 4JQ7A 2R3FA 5D11A 4QMYA 3PIYA 2XK9A 4FVQA 3E88A 3QKLA 3ZZWA 5J1VA 2AC3A 4JIAA 3ZEPA 3RZFA 2GQGA 1H0VA 4FZ7A 3UG2A 3ACKA 3PA5A 5EOBA 2Z02A 5ACKA 3QC4A 5J1WA 1KE8A 3FLNC 2E2BA 2YA9A 4RG0A 1ZXEA 4TWOA 5K5XA 3PRIA 3FYKX 4FK6A 4IWDA 4YPSA 1YRPA 3CTHA 4JBVA 2OFUA 3P79A 2WTCA 3ZTXA 1E9HA 3QQGA 4HPTE 3D2IA 2R5TA 4WO5A 3QZGA 3PXFA 5EKOA 3S0OA 4BDAA 5IA5A 2BMCA 4DLIA 1U5QA 3DK6A 2I0VA 5DHJA 5CLPA 3LLAA 4LGGA 1A48A 2P2IA 4I0RA 4IB1A 4A4OA 5J9LA 2WXVA 3G2FA 3KREA 3I6WA 3LM0A 2DUVA 2PVNA 2YACA 3W2PA 2NO3A 2ESMA 3Q4TA 5IMEA 3CPBA 3IW8A 4D9UA 3P7AA 5GHVA 1QPCA 2ZMCA 2ITPA 3H9OA 1ERKA 2QR8A 1VJYA 1OI9A 3KFAA 3QQHA 3QZFA 4KBCA 5LWNA 4O82A 3FZ1A 3DJ5A 5ETIA 4LOOA 3DK3A 3MA6A 4R3PA 3Q04A 3TI1A 1AQ1A 4IW0A 3CXWA 3F2AA 4A4XA 4ENYA 4X3FB 3FV8A 2XM8A 3NUSA 2GHGA 4JDJA 3K5UA 4F4PA 2PULA 3HMIA 2YIXA 1FPUA 4HCUA 2XA4A 4ASZA 2W1CA 3HV3A 3BGQA 3QUDA 4WNOA 3P7CA 2EXCX 2XUUA 1Q97A 4EOIA 1ZOHA 3TKIA 4GKIA 2CCHA 3FMJA 1PKDA 4L68A 4BVUA 1YXUA 3W33A 2W9FB 4M69B 5GIOE 1BMKA 1OPJA 1GIIA 2WTKB 3CLYA 2C5OA 3MA3A 3CQEA 2ITTA 3TZMA 1OIRA 2J50A 4EONA 5F9EA 4XG8A 2FGIA 1OPKA 3VC4A 2IZSA 4D5HA 3WZEA 2UV2A 5EW9A 2QOOA 1OIQA 5CNOA 2C30A 3PVGA 3JUHA 4IC8A 3K5VA 4UX9A 3QCSA 2RL5A 5HX6A 4RIWA 5FBOA 3DPKA 1U54A 2WMWA 2GNIA 2O63A 3F7ZA 4O22A 1OITA 2W06A 4Z9LA 4JLCA 4IQ6A 4XG3A 5IF1A 2W1HA 3BE9A 1LEWA 2YWPA 5CU6A 4H3PA 4TRLA 3W2SA 3HL7A 4O1OA 5AV2A 1PMEA 4UYNA 1KOAA 3A7GA 2XRUA 3KK8A 5CWZA 4UMUA 5A9UA 3BYVA 2YERA 4RWIA 4F09A 3UQGA 4U45A 2VN9A 2ITZA 3NCZA 4FEUA 3GC0A 4CCUA 3CKWA 2CDZA 3AC5A 4TWPA 4KINA 4CFVA 4CYIA 2JAMA 2YCRA 4F0GA 2EB2A 2BPMA 3WILA 5I3RA 4GK4A 2BALA 5DN3A 5HLPA 3C5IA 2J6MA 3O8PA 3MN3A 3LCKA 3RGFA 4P4CA 3R7VA 2PVJA 3M2WA 4E6DA 3L8SA 5AV3A 2E9PA 3LMIA 2B53A 4GFOA 3C4FA 5EM6A 3R6XA 2NRUA 1XH4A 1J91A 4U7ZA 2WEVA 4WSQA 5AR7A 2WMTA 4Y5QA 1FQ1B 5AUXA 3DBFA 2OZAA 2QHNA 4S32A 1JSVA 4FSZA 4BDKA 3R8PA 4F6UA 2G2IA 5EW3A 4X2FA 2J2IB 4UMPA 3C4EA 3R8MA 3QX4A 4MVFA 3RNYA 2GNJA 3FC1X 5DEYA 3ZM4A 4CMTA 2QU6A 3ATTA 3G15A 4QMUA 4ASEA 4XS2A 4OT5A 2W1ZA 3OOGA 4DT9A 2IW6A 1M2PA 4BHZA 1YXTA 5JT2A 2JFMA 4K8AA 3VUHA 3VVHA 3C4CA 2WMQA 2J0IA 4UWCA 5FRIA 4DGOA 4FTNA 3U51A 1G5SA 4EWHA 4TYGA 2AC5A 3FXXA 4EHEA 4HW7A 3PFQA 3WF5A 5HVJA 2IVUA 3ZXZA 5FWKK 4ANMA 4AA0A 4F9WA 3RNIA 3E87A 1DAWA 3I0OA 3PLAE 4FEVA 3R7EA 3FQSA 5FP5A 1WAKA 3FDNA 5EI8A 3AC4A 2GHLA 1SZMA 3EQDA 4BDDA 4W8DA 4H58A 5LVOA 3HLLA 4UALA 3HV6A 5CSXA 4CZYB 4D4VA 5CQUA 4UEUA 4G3FA 5E92A 4EKKA 4W9WA 2XMYA 4J7BA 3BCEA 4NKSA 4X2KA 1ZMWA 5H2UA 5CTPA 4LUDA 4KNBA 3SRVB 4ZMFA 2QOIA 3SXRA 3MH1A 2X4ZA 3C5UA 4J99A 2CKEA 5L8LA 3W18A 4RWJA 3EZVA 2PMNX 4JG8A 4QP1A 4KSPA 4XG2A 4MF1A 1VR2A 5EDRA 2J51A 2VO0A 2YDKA 5CI6A 3F66A 2YISA 3RPOA 5HG8A 3EWHA 2BIKB 4YO4A 4ZLYA 2HENA 4A7CA 3MJ1A 4O0WA 4YUQA 3BHTA 1YDTE 3FY0A 4RWKA 5AIRA 5CU4A 5E8XA 4USFA 4DFBA 4QP3A 3NLBA 2PVFA 4FTRA 2R3OA 4YZMA 3VNTA 3MVJA 3P0MA 4HGSA 2FUMA 4FKPA 1P4OA 4MAOA 4QQCA 3FKNA 3BLHA 1XH7A 5GZ9A 5JMSA 5K3YA 1NT2A 4EBWA 5HE3A 5D7VA 2HY0A 2C6LA 2WTDA 3KU2A 3P7BA 2Y4IC 3VS6A 4Z7GA 1ZMVA 5AM6A 3WI6A 4FV4A 3SKCA 2VWWA 4WG5A 2JGZA 3QTSA 2VNWA 3CJGA 4AF3A 3ODZX 3U6JA 4I4FA 4QPAA 3DDQA 1Q99A 2PMLX 4FIIA 4FSWA 5L2WA 2YM7A 4PV0A 5AUYA 4IJ9A 3PLSA 5CAQA 1CMKE 2HELA 3DAEA 3MB6A 4GT4A 4OTWA 1A9UA 4ZTMA 4IDTA 4FTAA 3QA0A 2J90A 4CCBA 3FL5A 2R2PA 3ETAA 3V6SA 4MK0A 3E3BX 1IA8A 3IW5A 3VS3A 5AUZA 4YJSA 5TF9A 2PY3A 4HGTA 3ZXTA 1QMZA 1JAMA 4HYHA 1CM8A 2QOLA 3HYHA 3DLSA 3KRXA 3A99A 2WKMA 3R21A 5DRBA 4BCPA 4YJPA 4AE6A 5HLNA 2F7EE 4AN2A 3RPYA 5IDPA 4TYIA 2WIHA 3EN4A 5CVHA 1OL2A 4E20A 4Y73A 3U9CA 3DB8A 4BI1A 4B6LA 3LJ2A 3FPQA 2C0OA 3BU6A 5IDNA 4U80A 4NM0A 3NNXA 4KRCA 1O6LA 2ZB1A 3EZRA 5M06A 4M15A 2VTNA 3D7TA 3EQBA 1U46A 4RZVA 4M13A 3MS9A 3TNHA 4FTIA 4JXFA 4DBNA 4QYGA 2C6TA 4L9IA 3IGGA 2UW7A 4F9BA 2IZTA 4AZWA 3GU4A 1YI4A 1OL5A 4QP2A 3E3PA 3NNVA 4RLKA 3QTRA 2EXEA 4AQCA 2YM3A 3OF0A 3NIEA 4RIWB 3ZFMA 2RSVA 1U54B 3P08A 3F3VA 3LFQA 4CZTA 3CTQA 4AW0A 2JITA 4WD5A 1LPUA 4TYJA 4YBKA 4EK5A 4F6SA 4YO6A 4L3JA 2C6OA 3HV5A 5K5NA 3OC1A 2IVVA 3VWAA 3LMGA 2PZ5A 4OLIA 5KCVA 4MHAA 4AGCA 3HMOA 3K2LA 4FEXA 3ZHPC 3GXLA 5FEDA 5FTGA 5LMBA 5C27A 5ANDA 3TV4A 3DLZA 3UE4A 4C2VA 2PUNA 4WUAA 3N4TA 3OW4A 3QKMA 4IC7A 4BBFA 3B2TA 5KMKA 4DFUA 2YM4A 5A54A 3QQJA 2P0CA 4C4FA 4CFMA 4ERKA 3PJ1A 5LXMA 4LRJA 2J5EA 3PZHA 3G9NA 5JGBA 4FV8A 4C37A 3EKNA 5FBNC 3AD6A 2YZLA 4PPCA 3SOCA 2HYYA 2JKQA 3FZRA 3PA3A 1GZOA 2XNMA 4FUYA 5M44A 4GG5A 4N70A 3U6HA 3A7IA 3AQVA 2CHLA 4R3RA 3RWPA 4FI1A 5JKGA 4CFXA 3UP2A 3QCXA 2FSTX 2BRHA 3UC3A 3EN9A 3DQWA 2XNEA 3TNWA 3UYSA 4CQEA 1MRUA 4KIPA 4KRDA 4XP0A 2GQRA 4IANA 4G5JA 1SNUA 3PIXA 5A4TA 3LCOA 1ZOEA 4O27B 3GVUA 4CD0A 2QHMA 3KGAA 3Q96A 3P1AA 3R9RA 3R02A 1TQMA 1W84A 2QCSA 2W5BA 3OFMA 4AGWA 3UP7A 5CZIA 4YZNA 4BDEA 1IASA 4MNEB 5CEKA 5M08A 3QKKA 4DCEA 2UW5A 3MVLA 4J8MA 3GQIA 1H07A 1YXVA 4PTEA 4C4GA 5M4FA 2I7QA 4PDYA 5DIAA 5CAPA 1JPAA 3DXNA 2FH9A 2P2HA 4FKQA 4P2KA 3H0YA 4TZRA 4O38A 2IWIA 3G5DA 3Q53A 3RAWA 4W4XA 3UMXA 3V3VA 4FTLA 3PE2A 2BCJA 4B9DA 3PDTA 5TO8A 5I9ZA 5BVDA 2H9VA 3KF4A 3DA6A 3DTCA 3P9JA 3ZSHA 4O0UA 2C6DA 2XYUA 3TIYA 3U4WA 4UMQA 4HVSA 5KHWA 1J7UA 5HIBA 4GMYA 3IGOA 1GZ8A 4FT0A 4BHNA 2YN8A 3KC3A 2LGCA 1MP8A 3QYZA 4AOTA 4USDA 1Q61A 4FV1A 4ZY5A 4DEBA 4EQCA 1HCLA 4IB3A 3D9VA 3QRKA 5E4HA 4YNOA 2QC6A 1FVVA 4TPTA 4O0TA 4RLLA 3AD5A 4XX9A 2OIBA 4JI9A 4LUEA 3GC9A 3EQPA 4DG0E 3G6GA 4O84A 2W05A 2VGOA 3LXNA 4D55A 5AIKA 3EOCA 3KKVA 3QGWA 2ACXA 4JBPA 2XNGA 5CVFA 5CX9A 1TKIA 2A0CX 3PZEA 5E8TA 2BDJA 3QRIA 3VJOA 4PRJA 2VTOA 3VS4A 4ANBA 3TDWA 1WVXA 4M7IA 3IS5A 4DYMA 5ACBC 4D28A 4ZS4A 3QC9A 4BRXA 5AR8A 3MDYA 3I0QA 4PPBA 3ZO3A 3UDBA 2X9FA 4JR7A 5EQPA 3KXNA 4MWIA 5EI6A 4OW8A 3VBVA 4F9AA 5A6NA 4GVJA 3OW3A 3DXQA 2CLQA 5I5ZA 3UNZA 3R8VA 1R0EA 3QZIA 4ALWA 3SD0A 1SVEA 5L6PA 2PUUA 4FSUA 4B8MA 4E4LA 3ACJA 3EH9A 2UW4A 3R9NA 2C3JA 1F3MC 2HIWA 3BHYA 4G5PA 3Q9YA 4DH5A 1UU7A 2UW6A 3QGYA 5DG5A 2PVHA 1MUOA 1SM2A 3UVRA 5DT0A 1BL6A 2O65A 2GPHA 4RGJA 4BR3A 2Q83A 2OJFE 4DGLC 3UODA 3ZU7A 4EOLA 4HVHA 2PVLA 4RX5A 3ALOA 2OBJA 2X81A 4RJ3A 4FTOA 3RVGA 2VO3A 4ZZOA 4IWQA 1S9JA 4PDOA 4QTEA 1YWVA 2XJ0A 4X3FC 5GJFA 5HD7A 3SV0A 1V1KA 3SDJA 3OTVA 3W2QA 3ZBFA 2EU9A 4EH9A 5JSMA 2FA2A 4ZMEA 2C4GA 2PMIA 2JDRA 2WQBA 1M14A 3K54A 5AP7A 3RK5A 3RKBA 3VULA 4BIEA 3W10A 2YM6A 4R5YA 4BKYA 1LR4A 4XJ0A 4E6AA 3U54A 2R3PA 4DEEA 3E8NA 2JLDA 4D4SA 2NNWB 3LFCA 3E92A 3NYOA 3D5VA 1UKIA 3PVUA 4MYGA 5M57A 3BRBA 3E8CA 4M12A 3ROYA 3SW4A 4BI0A 4I6BA 3UC4A 2VO7A 4GJ3A 1REJA 3QAME 4RQVA 4U3ZA 2Y4IB 2WTKC 2OG8A 4FTJA 3A61A 4QMLA 2JFLA 2XIYA 5BUIA 2UVXA 4FBXA 3QRUA 3CKXA 3OUKA 5GJDA 5A3XA 3WOWA 1PYXA 5I4NA 2OGVA 4OR5A 4TTHB 4TXCA 4CEGA 4KKGA 2JIUA 2DWBA 5HCZA 3RCDA 1W8CA 4ID7A 4MQ1A 4UXLA 4LOQA 1SVGA 3ORPA 2AYPA 4M97A 5KO1A 2HZ0A 3BBWA 3IG7A 3EFLA 5IISA 2Z2WA 2C5YA 4NM7A 3VRYA 3VBXA 4LFIA 5CEOA 3BYUA 1QCFA 5IH5A 3HP2A 1WVWA 2BUJA 1SNXA 3C0HA 2CGWA 3KQ7A 2XS0A 5T3QA 3KN5A 2E9UA 4X3FA 3ZMMA 3JVSA 3NW7A 2JEDA 2WZJA 4ASDA 4HOKA 4FT7A 5CSVA 1UNLA 3M42A 4LGHA 2VX1A 2A27A 3KCFA 2X7GA 4GIIA 3ELJA 5ETFA 1WCCA 5IH6A 3Q32A 4XP2A 4R77A 4DEHA 1XH9A 5GNKA 3PUPA 1FGIA 2ZDTA 2X6DA 3KY2A 4BKJA 4K11A 4IE9A 2IW8A 3TNQB 4W4WA 3MH3A 4F1TA 4ZLOA 2GFCA 2VUWA 3KRLA 4PQNA 3WZDA 1W83A 2XIZA 1R3CA 4M69A 4O2ZA 4ITIA 3H3CA 4O96A 3LQ3A 4IAFA 1DAYA 3FMEA 1J1BA 2ITUA 3MWUA 3QHWA 4MQ2A 2CLXA 2YHVA 3QX2A 3GCPA 3NR9A 4ACGA
chains in the Genus database with same CATH superfamily
4GYIA 4S34A 2QOFA 1WVYA 4FOCA 5ETCA 5J5SA 1Q4LA 4PNIA 2DS1A 3L9LA 5L8JA 3TZ9A 2XM9A 3C50A 4EWQA 4QNYA 4F9YA 4HCVA 4O2PA 4PNKA 1AD5A 4HVGA 3ZCLA 1YHVA 5HEZA 4AGUA 2WMXA 3Q2JA 3NS9A 4Y5HA 3PIZA 5E8ZA 5CEQA 1PXLA 2W9ZB 4FODA 3ZDIA 1KV2A 4AE9A 4BDIA 4XV3A 3QALE 1T46A 5CNNA 1QL6A 5HTIA 1H24A 2F7XE 2OJGA 1YI3A 4AXDA 2OH0E 3I81A 2P55A 3I6UA 4AW5A 3R1YA 4CT2A 5KKRB 2J4ZA 3FBVA 2VU3A 3L9NA 3GI3A 3PXRA 4FV6A 5C8MA 3R8ZA 3V04A 5HBJA 2HAKA 3Q4UA 2CCIA 4YTIA 2UUEA 4BWPA 3ZDUA 4IX6A 4FG8A 3VUKA 4EH6A 2XK4A 4LV5A 4O7RA 4R1YA 2XKCA 2XARA 3EIDA 1IRKA 5M53A 3GC8A 3QWKA 4XOYA 3VBYA 3W16A 3CBLA 3VS0A 2WMVA 1Q62A 2OO8X 3GFEA 3Q52A 4FZAB 5BVNA 4GH2A 2WTIA 3UG1A 3IOPA 4JDIA 2O3PA 4NZWB 5AFVA 3KMMA 4CTCA 5AM7A 3PJ2A 3BQCA 4FTMA 4U3YA 1Z5MA 5TE0A 3NZ0A 3MTFA 4EK3A 3FLWA 4HYSA 4EOKA 2OZOA 3EYHA 3QYWA 2PU8A 3OCGA 2UZVA 2XRWA 3BQRA 4C3PA 5EH0A 2QURA 4YLLA 5CF6A 4RVKA 3COIA 3N51A 5M56A 4F65A 5F94A 2VAGA 3KA0A 4FG7A 1VZOA 2B55A 2SRCA 2WHBA 1M52A 3NW5A 4LV8A 1YQJA 4MKCA 4FE2A 3A7HA 3NRMA 4OTDA 3TZ7A 3ALNA 4GL9A 5AV1A 2JKMA 2JDTA 2IG7A 4ASXA 4F99A 3JR1A 2UW8A 2YM8A 5JRSA 3I79A 4N6ZA 4EHZA 3CJFA 5CAOA 4KUJA 1WBSA 3GBZA 4GYGA 4IAKA 4XH6A 4O4DA 4C34A 2HK5A 3WIKA 5LVMA 2P33A 1KSWA 3FXZA 3LFDA 3MY5A 4MH7A 2VWVA 1XBBA 4DH8A 5IQFA 3KL8A 4RX7A 5AR4A 3ULZA 3QTXA 5JN2A 5AUTA 2AUHA 5AUWA 3LCDA 4O7ZA 3HRCA 3CP9A 4NK9A 5C26A 4GG7A 3ERKA 4IVDA 2JKOA 4RFMA 5T68A 5HVKA 1G8KA 2R3MA 3R7YA 1OM1A 3OG7A 3VF8A 3MYGA 4EH2A 3ATSA 5FM2A 2JIIA 5AP6A 5CSPA 5AP5A 5HOAA 3S4QA 3NUAA 3ZRLA 4CTBA 2V7AA 2B9FA 2XKDA 3D94A 5CS6A 2BHEA 4HYUA 2KULA 5M4IA 3AG9A 3KVWA 4TN6A 3QLFA 1KE6A 4NTTA 1ST0A 2CSNA 3VW6A 1DM2A 1H1WA 3WARA 4QMOA 5FDPA 2BHHA 4MD7E 5FM3A 2J5FA 4L00A 3ZO4A 4AA5A 1V0OA 3QQLA 3OY3A 1OZ1A 4EEVA 4FEWA 4JNWA 2PVMA 3MJ2A 1GZNA 5DA3A 2Z7QA 3CIKA 4LYNA 4YC8A 4ACHA 5FLFA 4FL2A 4CGAA 5HG7A 3BL9A 1HOWA 4PWNA 2I0EA 4MEDA 4XRJA 2C5XA 4XV2A 3ZSIA 1BUHA 4FTUA 5IA2A 4FTCA 3LFEA 4RA5A 2BFYA 3CY2A 4JBOA 3B8RA 2FB8A 4EL9A 3VUTA 3W2OA 4ZIMA 2YIYA 2R0UA 5ANIA 4UZDA 4NFNA 4ENXA 2R3GA 2YIQA 2ZOQA 1ZLTA 4WBOA 4XV1A 2C6IA 4C02A 5KBQA 3MFUA 1G8JA 4I6HA 2R0IA 4Y8DA 5GZ8A 3AKLA 4IZYA 2PPQA 2GTNA 3ZOSA 4U79A 4BTMA 3SXFA 4ACMA 2YCFA 4ZJVA 3TJCA 4F1MA 5BYYA 3OHTA 1Q8ZA 5AR2A 2YITA 3L1SA 3BIZA 3BX5A 3OOMA 3S3IA 2ZM4A 3VF9A 4R6VA 1PXJA 5JFSA 1NVRA 2PTKA 4QOXA 2GCDA 5JK3A 4O7VA 3KULB 4IWPA 4I4EA 3N4VA 1H00A 4M0ZA 2NPQA 5C03A 2ZB0A 3SXSA 4RIYB 2PVYA 4FSQA 3TNPC 3DAJA 4TW9A 1YHSA 4NM5A 4O91A 4FL3A 3MFSA 4RPVA 4YJVA 1MRVA 2R3IA 2X8EA 2J9MA 4G6LA 4BFMA 4C36A 5K9IA 2X8DA 4I92A 4C4EA 3QFVA 5L4QA 5HKMA 3R01A 4TNBA 3K3IA 3L8VA 5KNJA 3NIZA 5ANOA 2VTRA 4F6WA 2C5VA 4QTBA 4QPSA 3M1SA 4EC9A 4JQ8A 3UVQA 5AUVA 4CRSA 3OWPA 3SHEA 1XJDA 4WUNA 1Q3WA 2OF2A 4GU9A 4CKJA 3OVVA 4FKIA 5J7HA 2CGVA 2BFXA 3UOKA 3IQ7A 3QQFA 3BHHA 4N6YA 1G8SA 3VS1A 3I4BA 5CEMA 1CKPA 4A9TA 5EYCA 3C9WA 4E1ZA 5KMIA 4A9YA 4OTQA 3VQUA 2XBAA 3OZ6A 4L42A 4WHZA 4D58A 4E4XA 4RX8A 1FINA 4GU6A 3ZO2A 2XJ1A 4F08A 2UZDA 3GU7A 4BCHA 1NY3A 4USEA 2QR7A 2JDVA 3PXKA 1H8FA 4FTTA 4FIEA 3SOAA 4ZTHA 4NM3A 4EOPA 3EL8A 5AA8A 3IDPA 2B7AA 2W1FA 5IQBA 1Q8UA 3RPVA 3ZLWA 1KOBA 4C57A 4EQMA 5DYJA 3FLQA 4Z7HA 1PJKA 2OF4A 3R7IA 3ZSGA 1YKRA 2QVSE 4XV9A 4Y72A 1ZMUA 4MF0A 1ZYCA 4YZCA 4D2RA 3IECA 4AN3A 2B9JA 3ORNA 4I94A 4U97A 3II5A 4RT7A 4DH1A 5FGKA 1H1PA 3BEAA 3GEQA 1JKLA 4QEBA 4AP7A 3MB7A 4QNAA 4BCQA 2QONA 1CKIA 2X0PA 3F5PA 4YJRA 4O7SA 3BWFA 3QD4A 1XBAA 3MI9A 4RRVA 4EQUA 2RGPA 2DYLA 1TZDA 4X6QC 2OW3A 4XUFA 2A98A 5DR9A 4V01A 4EOQA 3OY1A 4RJ8A 3KMWA 4XHKB 2GQSA 1REKA 3R63A 4XBUA 3PRFA 3Q4CA 3UVPA 4MNEA 4NTSA 3EB0A 3DKOA 3PWYA 4RJ5A 3VONA 3BLRA 5BVEA 4D9TA 2WGJA 2G2FA 3FI3A 5CANA 3F5GA 3QQKA 3IOKA 2X2MA 1W2CA 3NX8A 3DOGA 1GJOA 4V05A 1PXOA 5DOSA 3AT4A 4CV9A 4CMOA 4CQGA 3E62A 4BI2A 3DJ7A 4LRMA 1ST4A 2O64A 2OIQA 4FIGA 1SYKA 4RVMA 2XVDA 4H05A 3CEKA 2QG5A 5FEEA 3HDMA 4B8LA 4O6EA 2ZM1A 4D2VA 5A46A 1JWHA 2W1IA 4EJNA 4FKWA 5BQ0A 4TY1A 2ZM3A 5M51A 4FSMA 3UDSA 4ORKA 1K9AA 4E5AX 3R2YA 5H3QA 2ZV8A 2A19B 3AT3A 4C3RA 5I9VA 5AAGA 2RIOA 1FGKA 1XMLA 3O5AA 4ZAUA 2VZ6A 4YJUA 3ZS5A 3MPAA 4ZZMA 2PE0A 3NGAA 3DNDA 2FSLX 4AGDA 4BICA 3UPZA 2ZAZA 4FVPA 4UV0A 2H8HA 2QOBA 4TYEA 1Y91A 5CU2A 3RZBA 3VRZA 3WZUA 3ZRMA 4D4YA 1E1XA 5BVOA 5E8YA 1H01A 4XG4A 1YOLA 2WQEA 3KXHA 3NUUA 4E73A 4YTHA 4DTBA 4OBPA 2XNNA 4QMTA 3HUBA 1UKHA 4KABA 2CNUA 4KKEA 4BDHA 5EFQA 3NMUF 3LQ5A 4K0YA 3F82A 3EN6A 3NVMB 4YMJA 3VHKA 3CC6A 5D41A 4AQKA 3S00A 2Y6OA 2X6EA 4H3BA 3UZPA 5CAUA 2J0MB 4O86A 4QP9A 4C38A 5J79A 3FZTA 4DT8A 4MXXA 3KF7A 3FWQA 3L8PA 2PL0A 4G9RA 4IWOA 4JOAA 5C01A 3Q3BA 4BWXA 4D1SA 5EW8A 2Y7JA 3W2CA 4MWHA 4ZZNA 3MSSA 4YHFA 2VWYA 3VS7A 1Q3DA 2WTJA 1Q24A 3ORLA 3W0OA 1ZYDA 3IONA 4U44A 4DE4A 2Z60A 2V22A 3H0ZA 4ZS0A 3ZLXA 2FO0A 1JBPE 2B54A 3A4OX 3NW6A 3F7WA 4GUBA 4W4YA 4CKRA 1PXPA 2R7BA 4FKLA 3BU5A 3POZA 2R3KA 4O0VA 3VUIA 2IVTA 1OGUA 3UO4A 3BHVA 4H39A 4BIDA 4CNHA 5F20A 3FQHA 2VTTA 3PP1A 4L45A 3EYGA 3O23A 3AXWA 1PKGA 3BLQA 1FMKA 2VWZA 4MCVA 1FVRA 2Y4PA 5LQFA 2WQOA 3MGYA 3TTJA 3UNKA 4Z3VA 5J9ZA 1ZZLA 5IQGA 2B9IA 2XK6A 3ORIA 3QWJA 3E7OA 4FG9A 4U81A 1KE7A 5F1ZA 1XWSA 4UBAA 2R4BA 1BI8A 3NNUA 3PVBA 4E7WA 2ETKA 4K9YA 3LKMA 3N4UA 4MBLA 3RPSA 5IQAA 2P4IA 2W1DA 4BZNA 5BVKA 3G90X 4QTCA 4LI5A 4YP8A 4FV9A 2EXMA 3DZQA 4NFMA 4XEYA 3MESA 2WMRA 3QRTA 3U9NA 3V8WA 3NUPA 3C4XA 3R22A 3TCPA 5TT7A 2VWUA 3NFFB 3VHEA 4ZTRA 2OXYA 2OH4A 4FKOA 5IQHA 3DAKA 4PF4A 4FUXA 3VO3A 2WQMA 3PSDA 4AACA 2CNQA 3RINA 4F0IA 2VTPA 4X2JA 2UZNA 4QMWA 2YIRA 4DITA 5TKDA 3MBLA 3VS2A 1NVSA 1RE8A 3Q4ZA 2C3LA 3B8QA 3LFNA 4HGLA 2XIXA 3UIXA 1BYGA 4NU1A 4IBMA 4XG9A 2WTWA 3BEGA 2R9SA 4AW1A 1XH8A 2PVRA 4X3JA 3HUCA 3O8UA 1ZY5A 3ODYX 4UB7A 4G3GA 4DFNA 4PL5A 2IW9A 3OROA 4WKQA 4L3LA 3Q6UA 4NEUA 5IEVA 3QTQA 5KKRC 3ZEWA 3CTJA 2XP2A 3MH2A 4GJ2A 4YJOA 4CFWA 3EQCA 2Y9QA 3NYNA 2I6LA 5DBXA 5HCYA 4E93A 3W0SA 2FVDA 2BRMA 2YZAA 4XG7A 4P5QA 4X0MA 3IPHA 3VBWA 5KMOA 3Q60A 1TQPA 5DT4A 4HVIA 2ZDUA 3QL8A 3GU6A 3ZBXA 4QP6A 2Y6MA 2REIA 4N4SA 3RAHA 3ZUUA 4BTKA 2XIRA 4CKIA 4I0SA 1TFFA 3G0FA 1NVQA 4WNKA 4ZXTA 3RHKA 3P5JC 4C4JA 4EH8A 5L6WL 3CD3A 4FMQA 2VTIA 3FKLA 4W4VA 4WSYA 1G8AA 3LLTA 3QD0A 4XNEA 5HO6A 4QMZA 5CF8A 3UIMA 4CXAA 4YLJA 2GU8A 3PSBA 3R28A 3R73A 2JDOA 3QXPA 4KAOA 3I1AA 5GJGA 3NFGB 2YDIA 3EQHA 3AT2A 3DFCB 4J97A 4QT1A 3KXXA 4DF3A 5D10A 4IJPA 3O71A 4FKSA 3DFAA 3H30A 3NDMA 1QPEA 4DFYA 4EUTA 1APME 5A4QA 2WPAA 4DGGA 3TDVA 3F3UA 2E9OA 4EZ7A 3MY1A 2IZUA 2Y8OA 3KXMA 1PW2A 2W5HA 4B7TA 4QP4A 3EFJA 5IZFA 3NSZA 4FV7A 4L53A 4M14A 5HNBA 2GS7A 4R78A 1BLXA 4QTAA 3Q6WA 1OIYA 2IVSA 2OJIA 3I7CA 3JY9A 4RVTA 2UZUE 4BCOA 4BYIA 4C33A 4DTAA 2XEYA 3VIDA 2JDSA 4O0XA 5GIPE 4FTKA 5LWMA 2PZYA 3BI6A 3C51A 3TNIA 3T8OA 5IH4A 2PSQA 2Q0BA 1CDKA 3G6HA 3OT3A 5JFWA 1OL6A 2WQNA 2X39A 2X4FA 1DI8A 4FF8A 3MW1A 4R3CA 4QMXA 4DH7A 3PE1A 3BL7A 3F88A 1VYZA 3CGFA 2VV9A 3EMGA 4Q9ZA 1BX6A 4RA4A 5BVWA 5BMMA 4DFLA 1STCE 3OCTA 4IEBA 5BUEA 4OTHA 4M3QA 3RPRA 4B0GA 4M8TA 1JSUA 4K18A 1ZZ2A 4D0XA 1WBVA 4B4LA 3D4QA 5FTOA 1FOTA 3LFFA 1ZY4A 2XALA 1KE5A 2PK9A 3FL4A 1M2QA 3FI8A 4IVAA 4ZSJA 3NUYA 3ORZA 5J95A 3ZRKA 2VWIA 1YOMA 4J1RA 2XKFA 3PYYA 2X7OA 5KHXA 3QRJA 4PMTA 3PPKA 4UWYA 3WE4A 3ZO1A 2C3IB 3CQWA 4XOZA 4AA4A 5M09A 2VTMA 3TV7A 1XQZA 1YDRE 1WBPA 5BNJA 1H26A 4ANQA 2VWXA 4JBQA 1HCKA 3FXWA 4OTIA 4AS0A 2BKZA 3EQGA 3Q9XA 5E91A 4L67A 4C3FA 4II5A 5CASA 2BDWA 4F7LA 4IZAA 5HBEA 1LUFA 2UVYA 4IIRA 4JS8A 1OBDA 4KIOA 3UO5A 2B4SB 2H34A 4ZK5A 4AFEA 2UZEA 4K33A 2CKPA 4C35A 5JZJA 1ZAOA 4G6OA 5E8UA 4XLIA 3TL8A 5JFXA 3DBDA 3HEGA 3L9MA 3PXQA 4CT1A 4O7WA 4BB4A 3H9FA 3UPXA 4I3ZA 2G1TA 4QP8A 3PY1A 2C5NA 4BDJA 5AJQA 4JAJA 4YZDA 1OKWA 3FZSA 2WMBA 4J71A 3DNEA 2IPXA 5CU3A 2XAMA 2PZPA 4IB5A 4QMVA 4EH3A 3G33A 1ATPE 4LGDA 4ITHA 2BIYA 3FZPA 1W2DA 4CMUA 1OECA 4AAAA 4H36A 5F4NA 1OVEA 4U0IA 4BWKA 5KMLA 5IA4A 5M4UA 3EN5A 5AV4A 4PY1A 4FK3A 4IX5A 4FC0A 4KS7A 4I22A 4NJ3A 5HCXA 3T9IA 4MBIA 4QYHA 5C8NA 5LVNA 4PUZA 3UQFA 4AUAA 2ZVAA 3GCSA 4L8MA 5IEXA 2YAAA 1PMUA 4DLJA 2XNBA 3PFYA 1PF8A 2XKEA 4CSVA 2R3HA 4BTJA 3QTZA 5FXSA 5IMXA 3UJGA 3OTUA 2XK7A 4CV8A 5HTBA 3Q9ZA 4CYJA 5EDPA 3EQRA 4EH5A 4AZTA 3LIJA 2PE2A 4F0FA 1NA7A 3FMDA 3JS2A 3VUGA 5DH3A 5BMSA 5LCJA 5CSHA 4BTFA 5I9WA 2W5AA 4ZTQA 5D7AA 3OMVA 3FJQE 1PXIA 4U8ZA 3ZUVA 5IUGA 3DY7A 1XH5A 3FLSA 3LJ0A 1T45A 2F2UA 1OPLA 2V0DA 3DV3A 4RFYA 4RIXB 3BU3A 1IEPA 3ANQA 5AWMA 2GNFA 3V5PA 3GT8A 3MH0A 3V01A 5DR2A 4CLIA 1URWA 3O17A 4AWIA 3F3WA 1UNGA 5IKWA 4NCTC 4K6ZA 3FLZA 1OIUA 3BELA 5EOLA 1TQIA 3P23A 2WMUA 2B9HA 2QODA 2WEIA 3KULA 4IVCA 4I6FA 4C7TA 5CT0A 3V5JA 4BF2A 5BVFA 1JQHA 4RIYA 1YW2A 1JSTA 4QQJA 5I0BA 3UO6A 5JRQA 3V8SA 2EWAA 4JVGA 3W8QA 1ZWSA 1H28A 4PP9A 3S95A 3GFWA 3OWLA 4EOOA 3R7UA 4HJOA 4QMMA 5J87A 3ZYAA 2W4KA 3NUXA 4GIHA 5D1JA 2PYWA 2WTVA 3FMHA 3VS5A 3ENHA 3DBEA 3ZFYA 2R3NA 4HGEA 4ANNA 2RFEA 5L2TA 4R8QA 5LVLA 5CZHA 3QD2B 1TVOA 2J7TA 2QG7A 3HDNA 1XKKA 3FSKA 4A9UA 4U43A 5IA3A 4M67A 3Q2MA 3R04A 4TL0A 2R3RA 4I1ZA 2I0HA 3JY0A 3HRFA 2HZIA 4WNPA 2Q0NA 4G2FA 4AT4A 4JT3A 3R1QA 3HA8A 4CFNA 4L52A 5G1XA 4NUSA 3RBWA 2JBOA 3REPA 4ZY4A 3G0EA 1PMNA 2YLEA 5JZNA 4KKHA 4PTGA 4GFGA 4XMOA 3SX9A 5JGAA 1PXNA 4I5MA 1UA2A 2WMAA 3LOKA 5LVPA 4YSMA 3E64A 4BCFA 3SW7A 5DMZA 4FKJA 4I5CA 4NCTA 1WZYA 1KUTA 1Y8YA 4TNDA 4YJTA 3OBJA 1OUYA 4LL0A 2F57A 3EFKA 5BYZA 3R30A 1WBWA 3FHIA 4RQKA 4NKAA 4OTGA 2XB7A 3FPMA 2QOKA 3UBDA 4D2WA 4BCIA 2YCQA 3CSVA 3RWQA 4XP3A 3LZBA 4ANSA 4FV5A 5M07A 1XBCA 2XH5A 3CPCA 2C47A 3CQUA 5DVRA 2QLQA 4AG8A 1X8BA 4MTAA 2WMSA 3W2RA 2VTSA 1ZYSA 3R83A 2GNHA 5IA0A 3LXPA 3RAIA 4APPA 3TMOA 2YEXA 5HQ0A 3ULIA 4YJNA 2VX3A 3MFTA 2RG6A 2ITNA 4G3DA 3HP5A 2GDOA 1YXXA 5K0XA 3ID6C 2O8YA 4NYEA 4DCAA 3LFBA 2ZYBA 5H8EA 5AP3A 4L3PA 4BCKA 3QQUA 5H8GA 4I41A 4C61A 5BYLA 2OKRA 4MNFA 1UU3A 3EL7A 5KUPA 2CPKE 5DE2A 1LP4A 1QPDA 3GGFA 3HVCA 4FA2A 5B2LA 4CLJA 3GB2A 3THBA 3OBGA 2FSOX 4MBJA 4FYNA 5KMJA 3FEGA 3TTIA 3F5UA 4KIQA 3QA8A 4XLVA 3V51A 3I5ZA 4TYHB 3WYYA 5E7RA 3ORMA 2ITXA 5D12A 3WIGA 3DKGA 4DN5A 4UMRA 3EKKA 1SMHA 2QO7A 3TUCA 3GENA 5JH6A 3KN6A 4J52A 3P78A 3SA0A 4ZSGA 5LJJA 2QKRA 5LMKC 4BL1A 1CTPE 5BPYA 5HNIX 3PG1A 3I5NA 2BZKB 3DBCA 1W82A 4OBOA 3H9RA 3S2PA 4FKRA 3BPRA 3FHRA 4IX3A 3OCBA 3PTGA 5A14A 4FR4A 4L7FA 4FL1A 4RSSA 4WG3A 2C1BA 3CD8A 4ZEGA 5IQCA 1ZRZA 2ERZE 2XANA 2ETRA 3MIAA 2UW9A 4DA5A 5EM5A 3TZ8A 1OMWA 2EB3A 2W99B 4ZSLA 5AA9A 3R7GA 1QPJA 4YPDA 4FV3A 3ZLSA 2VGPA 4YZBA 1ZYJA 4P90A 3A2CA 3RMFA 5B2MA 3B2WA 4HNIA 1Y57A 1YI6A 3ANRA 3GCQA 3PA4A 4O1PA 3R9DA 1J7LA 3TM0A 2IF8A 4AU8A 5EHLA 2RFDA 3FAAA 4E8AA 1UV5A 1E1VA 3HZTA 2CNVA 2JBPA 3PG3A 5IUHA 4RFZA 5ICPA 2V55A 2DQ7X 3OXTA 4NSTA 1PXKA 1R1WA 4QMNA 3NWWA 4MXOA 3TJDA 4G34A 3DQXA 5IEYA 1B38A 1FVTA 3QCYA 4KIKA 5HD4A 5E8WA 2UVZA 4J98A 4Y46A 4YGAA 4QTDA 2HWPA 4RZWA 2OU7A 3F2NA 3FMKA 4QMPA 5DNRA 5BX0A 5LMKA 4EOMA 4YLKA 5CEPA 5LOHA 4Q5HA 2XBJA 4F7NA 4WBBB 4FV2A 3UZTA 1ND4A 2PZIA 4V0GA 5HO7A 3R1NA 3AGLA 4HZSA 5FG8A 2E9NA 4C0TA 4PTCA 1J3HA 3TIZA 3DB6A 4AX8A 4JG6A 4AT5A 3SVVA 3EQIA 3MPTA 3W0MA 4BCJA 2BTRA 2GNLA 3DKFA 3OWKA 4FKGA 2JD5A 5DWRA 4ZTSA 4S31A 2CKOA 4F64A 5BUJA 4ITJA 4YZ9A 2QQ7A 1G3NA 4G3CA 2ETMA 4EJ7A 2XYNA 2UZWE 3RM6A 3N9XA 1EH4A 2VX0A 4HZRA 3O7LD 4Q2AA 1YOJA 3OP5A 3CY3A 3QUPA 4ACDA 5CQWA 4DG2E 2XNOA 4WRGA 4EKLA 1RJBA 3ORTA 2YIWA 5ANJA 4BBMA 2XJ2A 4KA3A 3JPVA 4O4EA 3KRJA 4BDGA 5AEPA 4CVAA 4N0SA 5M55A 3A8XA 4BDBA 3E7VA 3BBTB 3NAYA 5HZNA 1FMOE 4O83A 3W8LA 3QTIA 4ZTNA 2VTQA 1P2AA 1WBTA 4JRVA 3FKOA 4FICA 4IFCA 2GTMA 4EBVA 3F61A 1IR3A 2WOUA 3LM5A 2OJJA 4QQTA 3ZC5A 3D2KA 5H8BA 4BYJA 2IN6A 3QD3A 3PSCA 4AZVA 3AOXA 3NNWA 1YDSE 5LCKA 3DT1A 3F6XA 2HY81 2GHMA 4PPAA 4C4IA 4EK6A 5AUUA 2W1GA 2BRNA 1H1QA 3Q9WA 4FT3A 4RVLA 3D14A 4GUEA 4RJ7A 1H25A 4QRCA 3UOJA 5CI7A 5AP4A 1IAHA 1XMMA 4UYAA 4EZ3A 3BE2A 3IW7A 4F78A 2C69A 4E26A 3RI1A 2WELA 4GVAA 2GMXA 3EFWA 1B39A 3POOA 3ZM9A 3DK7A 4C58A 3LJ1A 3PJ3A 2YJRA 4FOBA 3ZONA 3RJCA 3UYTA 4O21A 5DLSA 1RQQA 2BAQA 1YHWA 2B1PA 3GU5A 2X1NA 5EM7A 4DTKA 2A4LA 5A4LA 3QBNA 4RC2A 4PL3A 1Z9XA 2W7XA 1K3AA 4RMZA 3RK9A 1Q8TA 3HGKA 4E4NA 3ET7A 4ERWA 1W0XC 1OKVA 2W0JA 2Z7LA 4GT3A 4LM5A 2XCHA 5EYDA 4NH1A 4I0TA 3VUMA 4U42A 4JR3A 2F2CB 4JL9A 5CEIA 2X7FA 4GV1A 3DJ6A 3HMPA 2F4JA 3LVPA 3LXKA 1OKZA 4D1XA 4EH4A 3HX4A 2O0UA 5KBRA 2Y0AA 4FSYA 4F63A 2UW3A 2OLCA 3PPJA 1GIHA 1W7HA 3E8EA 4D0WA 5CF5A 4UZHA 5IUIA 5I9YA 3EN7A 4X21A 3AC3A 1GY3A 4FSRA 2YLFA 3HAMA 3TACA 4R7IA 3R9OA 2W4OA 3DGKA 4G6NA 1J1CA 4KB8A 1JKSA 2A1AB 5HG5A 3CR0A 3MVHA 4G1WA 3MY0A 4QMSA 4YHJA 4F70A 3D83A 4LMNA 2F49A 4PMSA 5HVYA 4MXCA 3GNIB 4A07A 3COHA 3LXLA 4RC3A 4AZEA 5DRDA 4BCNA 5KMMA 5FXRA 5JGDA 4EZ5A 1LEZA 5G6VA 2HZNA 4D2TA 3OEZA 4K2RA 4NW6A 1U59A 2C68A 3UTOA 2BZJA 3TT0A 1K2PA 3OS3A 4HPUE 4P5ZA 3FZOA 2X0QA 4KWPA 3HECA 4FV0A 4IDVA 4BGGA 4EHVA 3UZRA 3UOHA 3RCJA 1JOWB 4PDSA 2YCSA 2J0LA 2QKWB 2ITQA 3D5WA 3FLYA 4A9RA 5HLWA 4O81A 1WMKA 5FDXA 3AD4A 2GS2A 4GK2A 4JQEA 4S30A 5AP1A 5B2KA 4QO9A 4ZJJA 3UOLA 4DGMA 4EK8A 5H9BA 1Y6AA 3DU8A 2W4JA 4FTQA 4I6QA 2PZRA 4HCTA 4A06A 4AFJA 2PVKA 5DI1A 5C1QB 2F7ZE 4EYJA 4IADA 2HCKA 4DEGA 4IAAA 3D15A 5A6OA 3QXOA 4X6RA 2YDJA 3TV6A 2WOTA 1BKXA 4LQMA 1GOLA 2C3KA 3A4PA 4FKUA 2O5KA 4ZP5A 2YWVA 4AOJA 4QP7A 5JQ5A 3BWJA 1UU8A 2BILB 5AR3A 3TN8A 3AC1A 2OIDA 3AMAA 2ZV7A 4U41A 5CSWA 3TKUA 5HHWA 5EDQA 4RIOA 2CN5A 3WF8A 4NL0A 3T3VA 3TUDA 5EYMA 5HIDA 4CFUA 3AMYA 1UWJA 5AX3A 3FMMA 1JNKA 4ZTLA 5JQ8A 4FYOA 1XHAA 1U4DA 3L8XA 5HIEA 1OL1A 3C7QA 3O96A 5KZ0A 2RKUA 3FI4A 3W55A 5HE2A 3UGCA 1MQBA 5CY3A 4BGHA 4DEIA 5C4KA 4JX3A 3OEFX 4G31A 5EG3A 5KMNA 2CKQA 3V5QA 2IO6A 4HNFA 2QO2A 3CGOA 3LW0A 5KX8A 4CG8A 5I3OA 4N57A 4PMMA 4YBJA 3PWDA 4DFZE 3LMHA 2IJMA 2QO9A 4R7BA 1A06A 4KIKB 1GIJA 4Y95A 5EYKA 4ALUA 4IHPA 4GEOA 2W1EA 3IW6A 3HRBA 3P86A 5CXZA 4F7SA 4M84A 3UNJA 3DDPA 1P4FA 4IFGA 4J96A 3R8UA 3SG9A 3BV3A 5AV0A 1I44A 4M68A 4V0GB 3C4ZA 4DG3E 4APCA 5CU0A 1OB3A 3AMBA 5I9UA