4CLIA

Structure of the human anaplastic lymphoma kinase in complex with pf- 06463922 ((10r)-7-amino-12-fluoro-2,10,16-trimethyl-15-oxo-10,15,16, 17-tetrahydro-2h-8,4-(metheno)pyrazolo(4,3-h)(2,5,11) benzoxadiazacyclotetradecine-3-carbonitrile).
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
308
structure length
294
Chain Sequence
b'NPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYRGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ALK TYROSINE KINASE RECEPTOR
publication title Discovery of (10R)-7-Amino-12-Fluoro-2,10,16-Trimethyl-15-Oxo-10,15,16,17-Tetrahydro-2H-8,4-(Metheno)Pyrazolo[4,3-H][2,5,11]Benzoxadiazacyclotetradecine-3-Carbonitrile (Pf-06463922), a Macrocyclic Inhibitor of Alk/Ros1 with Pre-Clinical Brain Exposure and Broad Spectrum Potency Against Alk-Resistant Mutations.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 98
structure length 294
sequence length 308
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2014-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4cliA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4cliA01
4JX7A 1YXVA 5L8JA 3PRFA 3R9NA 3PIYA 3DGKA 3R63A 2XNPA 1LEZA 2YISA 3NUYA 3MY1A 2CGUA 3W2OA 2OZAB 4NW5A 3D7TB 3FC2A 3A99A 1VYZA 4FA2A 4ZLYA 3CLYA 3DK7A 3SXFA 2BDWA 4BKZA 3D4QA 4GU6A 4XHKB 2H34A 4CZUA 3POZA 2H9VA 2Q0NA 4BCJA 3Q3BA 4AT4A 4U8ZA 2FSLX 2OJGA 5CS6A 2G01A 3PIZA 5CU2A 3ZM4A 4P5QA 1WZYA 4Q5EA 5FEEA 3NVMB 5HNGA 5KBRA 3MVJA 2O2UA 2UV2A 3ACJA 3I1AA 2YAAA 3PJCA 5C27A 5FRIA 2PVMA 4M7IA 3W16A 3TUDA 2BIKB 3F7WA 4M67A 1J1BA 3LJ1A 2VAGA 4F7SA 2Q83A 4QMUA 3V01A 5IEYA 4CKIA 4R8QA 3FPMA 2C6MA 4I6FA 2VGOA 4ZSAA 5M4UA 4DCAA 5AJQA 1Q4LA 3GU5A 2W1ZA 1SVHA 3DJ7A 4CNHA 5FEDA 1FGIA 2B9HA 4CFNA 5AEPA 3KXMA 3G51A 3R71A 4UX9A 1H08A 4PNIA 3EL8A 3N9XA 5D10A 4GEOA 2R7BA 4QQTA 3BHVA 4PTCA 3U54A 4Y83A 2YM6A 4AE6A 2PVRA 3HP2A 1FQ1B 1O6KA 3D14A 3E87A 2BZKB 4B7TA 4AQCA 3QXOA 4HJOA 3RPRA 2C6DA 2VV9A 2XK9A 4L6QA 4E6QA 4D4SA 4PNKA 4FG8A 5BVWA 3OCGA 4BICA 1CM8A 4M15A 3DKFA 1OPJA 2WQOA 1BI7A 3MB6A 4FTQA 4N6YA 4PL3A 4RGJA 2QOQA 4WNOA 2OH0E 3VS3A 5EDPA 3V8WA 4FV2A 2CPKE 1L3RE 1IASA 4FBXA 3GC8A 5IG1A 3S1HA 3C13A 3ZRKA 3RAKA 3E7VA 4GJ2A 4HW7A 3OCBA 4X2GA 4KBAA 2H96A 2ZDTA 3BYUA 3MDYA 3QL8A 2VWUA 3RKBA 2IW6A 2ZB0A 3HMOA 5C9CA 4D55A 5CF5A 1NW1A 4DBNA 4X3FC 3QX2A 3D9VA 4L45A 5JRQA 2VTJA 2E9VA 2ESMA 1R1WA 3ORTA 2C5OA 4GG5A 3SVVA 4IWPA 5AUWA 4R7HA 4ZTRA 4Y8DA 2VTLA 4JBQA 3VS6A 3I0OA 1U4DA 4BCGA 5IA1A 2PUUA 4H3QA 4MXAA 4ZTSA 4PL5A 4DGNA 3QTUA 3SG8A 2IN6A 3DFCB 5CSVA 3W2SA 4LMNA 3Q9YA 1PRYA 2X7GA 2VX3A 2WMWA 4D4YA 1W84A 2QI8A 3BHHA 2UW9A 1J7UA 2WTKB 2DYLA 3DAEA 5C4LA 2O5KA 2VWBA 3F2AA 3HRBA 4TYEA 3QQFA 3VHKA 5HI2A 1A06A 2WMQA 4JS8A 2FO0A 2X6EA 3MY0A 5CLPA 1R0EA 4FODA 5AR2A 3L8SA 3O51A 4C61A 2X8DA 4QD6A 4ACGA 4U41A 4ZZNA 5IH5A 4CMOA 3QCXA 1MRUA 4NFNA 2XJ1A 4B4LA 4GFGA 2JKOA 3R9RA 2KULA 3H3CA 4TWPA 4ASEA 3LXKA 4DYMA 3A2CA 2UW3A 3NIZA 4JI9A 4KAOA 3TTJA 4C4GA 2BPMA 2YIYA 4FKUA 4FTTA 4ZY4A 5H8EA 4OTIA 4TXCA 2HW6A 4ANQA 4QMPA 3L8XA 4O91A 3FXZA 2C4GA 1WMKA 3FZOA 1WAKA 5I9UA 3OT3A 1SNUA 5AR7A 3AT4A 4I21A 4BY9E 4J53A 5AAEA 2ITWA 2OG8A 4JVGA 4HCVA 2WB8A 2E9OA 5EQYA 5ACKA 4BCHA 2X1NA 5ANOA 4QMNA 3BE9A 4FE2A 4AE9A 3JY9A 4I1ZA 4BIDA 3IECA 3AT2A 1V0BA 4O22A 3ZLSA 5LMKC 3QXPA 5M4FA 2JD5A 2E2BA 3PDTA 1KE5A 5H8GA 3S4QA 4Q9ZA 4NTSA 2UZNA 1QMZA 1E1VA 3DBEA 2R3NA 5CYIA 4LM5A 4ZY6A 4XP3A 4FOCA 1IA8A 3EN4A 2VO0A 2YABA 1TKIA 3CCNA 5FDXA 3ZZWA 4FT5A 4ZAUA 1H00A 3NEWA 5IUGA 2PVYA 3ELJA 2YA9A 3G15A 5EQEA 4F65A 4W4WA 4I5CA 5EW3A 4DGOA 3FI8A 4FV3A 4MAOA 3EZRA 3BHYA 3WI6A 4BR3A 1J1CA 1ZYLA 2HENA 2OJJA 3R2YA 2PMNX 3JUHA 5KKRC 1IA9A 5JZJA 4CFUA 5KMKA 4BHZA 4IAFA 4X7QA 2WZJA 1OZ1A 4C59A 4F70A 2F7EE 2X81A 3EMGA 4BTKA 3GI3A 4MXZA 4M8TA 3NUSA 3RGFA 3DBCA 2ITVA 1PYXA 1YHSA 1ZZLA 3DKCA 4PMPA 4AW5A 2GU8A 5FXQA 3R22A 4DH7A 2WXVA 4FI1A 4E4XA 2CLQA 4I5PA 3TZ9A 4CMUA 5A4EA 2YIWA 5EFQA 3HYHA 5KNJA 3PG1A 5KMIA 5HZNA 2PUPA 2RG6A 4UYNA 4BKJA 1OL5A 3OHTA 4XP2A 5DT0A 3BGZA 2VWVA 3WYYA 4UMQA 3H9RA 4USEA 5J87A 3PTGA 5J9ZA 4ZP5A 4ORKA 3FXWA 4XRLA 2QU6A 5BNJA 2YERA 4RIWB 4ZSLA 4ANNA 4ASDA 4ZJIA 5L2IA 2OF4A 3PE2A 5BYZA 1M7QA 3TUBA 1M7NA 4H3BA 4V0GB 1Q5KA 4QMQA 3LLTA 4RSSA 5AUYA 5CEKA 2C6EA 3F88A 4WG3A 2VTAA 3M42A 4U3YA 3EFLA 2XCHA 1GZ8A 3A7FA 2WMXA 5GJDA 5EW9A 3PG3A 4PQNA 3HZTA 4UXQA 2XNEA 3QRKA 5K0XA 1FINA 5KX8A 4S34A 3IOPA 3OTUA 2XM9A 4RC2A 2ETKA 5M06A 3HMPA 4QMZA 4M69B 3MFSA 1HCKA 3ULIA 2WTVA 2PVLA 3Q9ZA 3R21A 3U8WA 2J0JA 4L7SA 5LMAA 4G6OA 5HIEA 1YDTE 4IX6A 1GJOA 1V0PA 1GZOA 2ZMCA 4ZS0A 5FM2A 4L3PA 4NIFB 1ZYDA 3P5KA 4AZTA 4X3JA 4YNEA 3K2LA 1WBPA 4IC7A 4MEDA 4X3FB 3ZBFA 3FXXA 1M2RA 4P2KA 3G33A 3RZBA 2B53A 4DFYA 5DOSA 2GNHA 4QQ5A 4WD5A 4CG9A 1VJYA 1XQZA 4IANA 4FV8A 1OKZA 1ZOGA 1LUFA 1WVXA 2ITOA 2YZAA 3O23A 5CEMA 4K77A 4WNKA 4XLVA 5CAQA 5CU4A 3PXKA 4NWMA 1VR2A 1R78A 3DB6A 3BKBA 3KU2A 5D9HA 3K3JA 5GIPE 1QL6A 4BCKA 3CGFA 2JAMA 2I1MA 5ITAA 3EYHA 4XBUA 2ONLC 1APME 2BUJA 1YOJA 4D0WA 1J7IA 2PZPA 2XYNA 2G2HA 4RLKA 3LVPA 4CVAA 4RVKA 2XIZA 5GIOE 3R1QA 4S33A 1SVEA 3QTWA 3RWPA 3BX5A 2J51A 4U9AA 2CJMA 5EM8A 1OECA 1URWA 3LFQA 2JKQA 2VN9A 3NS9A 3PIXA 2OXXA 4IW0A 4L01A 4UMTA 3RK7A 3PYYA 4E93A 3BELA 5AWMA 2GFCA 4J7BA 2OH4A 1H1QA 3N4UA 2JDRA 3BLQA 2UW4A 3QRIA 4O1PA 3UZRA 4DGLC 3D7ZA 4IX4A 5EYDA 3E88A 3GENA 1WBVA 3G5DA 5CU3A 3T9IA 3V8SA 3O8PA 4XG2A 1F3MC 3RCJA 3ZONA 5I0BA 2OLCA 4CKRA 4HOKA 4AF3A 3HLLA 4D2WA 4G9CA 4I23A 5IQDA 3KGAA 5GJFA 3L9MA 3CJGA 4EUUA 2WQEA 3CQEA 5CX9A 2REIA 4PX6A 2XJ0A 3II5A 3D7TA 3QQJA 4PMSA 4CZTA 1KSWA 2GNLA 2OWBA 2ZV7A 4FSZA 5J7HA 4NM7A 4IXPA 3R7IA 2XBAA 4JRNA 5JN2A 4FYNA 2W0JA 1YQJA 2R2PA 4Y73A 4E5WA 5CF4A 1IG1A 1GIHA 5IH4A 1TQIA 2QG7A 2B0QA 5FUTA 1UNHA 2CMWA 3IGGA 4WOVA 3D2KA 3E8DA 4ACHA 3HMMA 3EB0A 3ZU7A 4W8DA 4C7TA 3VVHA 4FK3A 4PPCA 4FNXA 5IA5A 5LWMA 5BUEA 3FKNA 4EHZA 2QKWB 2BROA 5KKRB 3TV6A 3PY1A 4LFIA 4W9XA 2WEVA 3KXHA 4H1MA 4XV2A 3WF8A 3ZXTA 3HP5A 4L46A 2JFLA 2X0GA 4FSMA 3DBDA 4F64A 3FLWA 4UN0C 3R01A 2XIRA 3P0MA 5LVNA 4EK3A 5TF9A 4FZFB 1V0OA 3UIXA 3OWPA 4N57A 5L2SA 5KMMA 3R6XA 4FICA 4NL0A 5I9WA 1Y8YA 3MV5A 3NYXA 1KOBA 4D1SA 5IKWA 4AGUA 3FMMA 4QO9A 3EQGA 4Z16A 5D7AA 4CGAA 3EN5A 3F3UA 1DI9A 2UZEA 4M0YA 3TNQB 3ATTA 2WTJA 5BUJA 2GHMA 4QTAA 4HPTE 1BMKA 3ETAA 3LMHA 2YDIA 4FTLA 3W32A 4JG8A 2QR7A 3PP1A 3QF9A 2IZSA 4BN1A 4C35A 3VW8A 4EUTA 3CE3A 3F3ZA 3GGFA 2C6KA 3TUCA 4YZ9A 1OIRA 1XH4A 2GS2A 3DCVA 1B38A 3QA8A 4I93A 3KVXA 4QMLA 4R6VA 5DWRA 4D9UA 2P4IA 2XJ2A 3A62A 4IH8A 5A9UA 1Y6AA 4I5HA 1H0WA 4IAKA 3L1SA 4XS2A 3KA0A 4RX5A 4EHEA 3PY3A 3MH2A 3V51A 3ZLWA 5HVKA 3N4VA 4G3DA 3FLYA 4FKPA 4FZ7A 2YEXA 4ZSGA 4BIEA 4CV8A 3H10A 4UALA 4AT3A 5AUUA 4QP1A 5A54A 5F95A 5HQ0A 4O0RA 4BCPA 3UZTA 1GIIA 4JXFA 1A48A 3A4OX 4HYSA 4CFVA 3RHKA 3MB7A 5T6KA 3CD8A 2R3JA 5F1ZA 4O7ZA 2YLFA 3V8TA 3DU8A 1JWHA 1U54A 2VO6A 4M14A 1FVRA 4IACA 3CPCA 2R3HA 4O7RA 4DFBA 3DBFA 2XIXA 4MXYA 4FEUA 4CFFA 2X8EA 3GC9A 4F9WA 4A4XA 3IQ7A 3QD4A 4YPSA 2I7QA 3LFEA 5HG7A 4NEUA 5DEWA 1ATPE 3TNIA 5B2MA 3ZFMA 5TT7A 1BYGA 4B8MA 3LJ0A 1PKDA 2QO9A 2Y4PA 2GTNA 3E7OA 4O7TA 4RIYB 5M08A 5EI2A 2CKEA 4U40A 4B6LA 1NT2A 3NW5A 3ZXZA 2YM4A 4HGLA 3V6SA 5JFSA 4ZLOA 4O7VA 5CSXA 4C36A 1H27A 5DLSA 3AC1A 3Q6UA 3U9NA 4QTCA 1SM2A 5HTCA 4RC4A 4YJTA 4TN6A 3S0OA 3HA8A 3F9NA 3NUNA 4PPBA 4Q2AA 4JAJA 4N70A 5DI1A 2Q0BA 4FV1A 1SMHA 2WGJA 2I0VA 2R9SA 2YDJA 5L6WL 3RK5A 3SC1A 2C6TA 3SAYA 2WFYA 3NCZA 4PMTA 4QMVA 1YVJA 1YKRA 1G3NA 2YCRA 5AR3A 4E4LA 3ZDIA 2XK6A 3G9LX 2VTSA 1TQMA 2BCJA 3MFUA 5EK7A 3RP9A 3IW7A 3ZTXA 2R3OA 4BIBA 4O7SA 1ZARA 2YIXA 5J1WA 1PXNA 3KB7A 1PXMA 2ZOQA 4ZLZA 3R9OA 3GT8A 3LOKA 3UVQA 3GXLA 3QD3A 3TNWA 1BLXA 4IX5A 4F7JA 5IMXA 4MH7A 4ZOGA 5J5TA 1O6LA 4E4NA 4DFLA 3D5XA 4UBAA 4XJ0A 5AAFA 1UU8A 3UYTA 1JSVA 5I9ZA 1T46A 4XMOA 5BVDA 2FVDA 4LI5A 4FTRA 4O96A 3VO3A 3A8XA 3PP0A 4KIOA 4YBKA 3ZCLA 4XBRA 1KV1A 3R04A 5JFWA 2IVSA 3ZO3A 3ORXA 3AC4A 2Z02A 5ETFA 2QLUA 3B2WA 2XUUA 3KL8A 5TE0A 4E73A 2Z7RA 4P7EA 1H28A 3ORLA 1MRVA 5HIBA 4G3GA 4I5MA 4P5ZA 2VX0A 1CSNA 4I41A 3FMJA 5I9XA 2XM8A 4WBOA 3U51A 2ITQA 3QQKA 1E9HA 4RJ4A 4TKSA 3VUGA 1JAMA 5EI8A 4C4IA 4LYNA 1WFCA 4YP8A 4APCA 3BGQA 4FGRA 4YMJA 5J5SA 2PVHA 2ETRA 3DLZA 2HWPA 4MD9E 1UKHA 5HE1A 3VBYA 3P78A 3NR9A 1GZNA 4J96A 3DTWA 3EIDA 3MVLA 4K9YA 4U97A 1Q62A 2ERZE 3GFWA 3ALOA 1M2PA 1JSUA 4L52A 4RIXB 1PW2A 1KUTA 3BPRA 3SW7A 4QMOA 3BCEA 3U55A 4E5AX 5LCKA 4AZFA 3KFAA 4UMPA 3H30A 4O6LA 3RM7A 4KS7A 5CXZA 3GQLA 2C0OA 4FKQA 4D58A 4IDVA 4EONA 3SQQA 4F0IA 2KTYA 3UNZA 1U46A 4O27B 2PVJA 3PPZA 3HVCA 4M69A 1KE7A 4O81A 3CR0A 2QR8A 3MH3A 5A3XA 1YI6A 4ITJA 3WE4A 2B4SB 4C02A 3HX4A 4J71A 4WKQA 3G9NA 4TW9A 4EH2A 4XNEA 4FTNA 5EOBA 4LRJA 4NZWB 4EHGA 5AADA 4ALUA 3SRVB 3C51A 3R28A 4K6ZA 3D83A 2PMLX 3FLZA 3LFCA 3TZ8A 3IOKA 4FSYA 4DH3A 2DS1A 3FY2A 3WIGA 1PXJA 4MNEA 4NM3A 3MPAA 3IS5A 3TCPA 3I6UA 4YZDA 1OBDA 1T45A 2CN5A 2Z60A 3H0YA 3ORKA 3OW3A 4AUAA 1IEPA 3VS4A 4X6RA 1Q8TA 3QAME 4ZTNA 1OI9A 1XJDA 2W9FB 4DITA 4JOAA 5HX6A 5LJJA 4GVAA 4XRJA 4EJ7A 3EL7A 2EXCX 5L2WA 1H01A 4P4CA 3I6WA 3CIKA 4PDSA 5AA8A 4Q9SA 1CKPA 1ZOHA 4IBMA 3VUKA 5I5ZA 5LCJA 1Z9XA 3CGOA 4AOTA 4UV0A 5E8SA 3UDBA 1Q3DA 3Q6WA 2WIPA 3PJ8A 5L8KA 5IQHA 4KIKB 3VN9A 3OXTA 2Y8OA 3BRBA 3OY3A 2OJ9A 1J3HA 4O7YA 3G2FA 1UU3A 1ZXEA 2NO3A 3D94A 4FTCA 4R5YA 4U0IA 3QZHA 4H1JA 4A9TA 5JFXA 2YAKA 2ZB1A 3ZLYA 4ERWA 2YFXA 3GFEA 3RALA 4C4EA 2BRNA 4IZ5A 3WF5A 3FDNA 2A1AB 3FZ1A 3WOWA 4W4YA 3ZHPC 2UW5A 4R7BA 4GS6A 3L8PA 4D9TA 2R3GA 2IG7A 1O6YA 2HELA 4EC8A 4RJ5A 4DBXA 3F5GA 2RFNA 5IF1A 1DAWA 3PXYA 1I09A 2C30A 4EOIA 5CNNA 1HOWA 3FMKA 4RWIA 4U3ZA 2F9GA 3ZC5A 4DG0E 5HE3A 5C8NA 1ZRZA 3DK6A 2WKMA 4YLKA 3COKA 3IONA 2GNFA 4HYUA 3QTXA 4YLLA 3F5XA 3BIZA 4OBOA 2F2CB 5B2LA 1W8CA 4EH4A 3A7IA 3I5ZA 1M2QA 4L67A 3PJ3A 5EDRA 4QPSA 4F6SA 2BZJA 3I7CA 4ZTQA 4L00A 1P14A 1JKLA 4S30A 1TVOA 2J2IB 5BMSA 5LMKA 2XKDA 2XVDA 4ZMEA 4FZAB 2FSTX 3NMUF 4IDTA 4NJ3A 4DN5A 5FWKK 2HWOA 3MIYA 1PMEA 3FL5A 1REKA 2Z7QA 4YGAA 4LRMA 5BVKA 1RW8A 2UUEA 4F7NA 5F94A 3CC6A 1J7LA 3RPYA 3DZOA 3V6RA 4N4SA 4RJ3A 2Y7JA 4O0UA 1FOTA 1QPEA 2W4KA 4JBVA 5HVJA 4E5BA 2WTDA 3TTIA 5CANA 5G6VA 2XEYA 2Y4IC 3E92A 3I4BA 4JR7A 5IA2A 4U45A 5L8LA 4W4XA 4ANSA 3ZBXA 4M68A 3E8NA 5F20A 2GQGA 4NUSA 1OL2A 5DHJA 4AW0A 3DBQA 2GQSA 3GVUA 3QLGA 3C50A 3AC8A 4MKCA 5BVNA 4IAYA 1CDKA 4PF4A 3DB8A 4U7ZA 3TEIA 4BVUA 3G0EA 5FXSA 4O7LA 2AC3A 2EU9A 4S2ZA 3F69A 1JKTA 3CQUA 3TG1A 4EQCA 5CF6A 2CNUA 4V05A 3PVGA 4YC3A 4DE4A 2A0CX 2QVSE 3AD4A 5CF8A 5K3YA 3UPZA 2JBOA 5D41A 4OTHA 4RT7A 4BCOA 4J8NA 3A7JA 3KREA 1KWPA 2YACA 3G90X 3IDPA 3QD2B 5AIKA 4B8LA 4GL9A 4LL0A 4UXLA 4DGGA 4FKJA 4TNBA 5AR5A 5FBNC 3GOKA 4ZTLA 3WZEA 5E4HA 2VGPA 5KHXA 4RBLA 4L9IA 1OPLA 4PDPA 4QRCA 5CAOA 3LXPA 2VO7A 3NUAA 2WTCA 4RFYA 2X4ZA 4DH8A 2GFSA 4DEAA 2WQNA 2YM8A 4BBMA 3TV4A 4ZTMA 3FKOA 2JKMA 5T3QA 3G6HA 4XG8A 2R0UA 4KD1A 4R5SA 3FEGA 3DLSA 4C8BA 4ZXTA 1YW2A 2C3KA 5HTBA 1H1PA 5KO1A 4RVMA 3DT1A 4EOKA 3SA0A 3QKLA 3KMMA 3LFNA 5DFPA 4BYIA 4FYOA 2P55A 2PZIA 2YN8A 3E62A 4PTEA 5GHVA 4FEXA 3FJQE 4CFXA 3COHA 3EQIA 5CVFA 5E8UA 5HU9A 1H1WA 2JIVA 3A8WA 4LGGA 2C68A 1OMWA 4XLIA 4XYFA 1W82A 4CTBA 4R1YA 4C33A 3QRUA 2ZV8A 2OBJA 4F6WA 3HDNA 5HG9A 3F3VA 3UPXA 4MYGA 5HU3A 3LQ8A 4D5HA 2G9XA 5EM5A 3S2PA 5EDQA 3FZTA 5J79A 2JDSA 4QYHA 3RAWA 2WMRA 3TKHA 2R7IA 1Q97A 3QYZA 5JFVA 2W7XA 3Q60A 3D5UA 3D5WA 1Q8UA 5CNOA 3CTJA 5DN3A 4FUYA 4F9BA 4FTKA 1BL7A 3MGYA 4OAUC 4XP0A 4CRSA 5HNIX 3R7GA 5T68A 3WIKA 4FIIA 2HZNA 4QMXA 1K9AA 4EOPA 4M84A 2XNOA 3OOMA 3Q5IA 3W1FA 3BYOA 4CLIA 2VX1A 3QD0A 3Q9XA 3BYSA 2BKZA 3GB2A 3O2MA 2R3LA 3ZZEA 4PDOA 3W2PA 5AM6A 3RI1A 4A9SA 3W10A 2XYUA 3DNDA 1UV5A 3ZSHA 1XH9A 3R7VA 3CP9A 5D11A 3V5QA 4DFUA 4CCUA 2ZV2A 2CCHA 1UWHA 2R64A 3A61A 4H36A 3H9FA 1YHVA 4NT4A 5C1QB 4FNZA 5M51A 4E20A 5L6OA 3WYXA 4B9DA 1YXTA 5M07A 5AX3A 4FSNA 4WNMA 3TDWA 3S3IA 3EWHA 3SXRA 2ITXA 3N4TA 4F99A 4IM0A 3VBWA 3Q53A 4O0XA 4YC8A 1NA7A 4WBBB 4EKLA 2BTRA 2EUFB 2JDOA 3MTLA 3RCDA 2WPAA 5HD7A 1OM1A 4QYGA 4YUQA 3QZGA 4BI2A 3ZEPA 1YHWA 3ORMA 3O8UA 4UWYA 5D7VA 3D5VA 2XKFA 3EQCA 3LFFA 5FM3A 1IR3A 3AMYA 4HNFA 3IW8A 1W83A 3NNXA 3UQFA 4EI4A 3OEZA 3PXQA 2EVAA 4FK6A 3RMFA 3DXNA 4FVQA 3BHTA 4UMUA 4FOBA 1S9JA 4IEBA 4OLIA 2ITUA 2XA4A 2YM7A 1Q61A 2WEIA 4JBOA 3MSSA 1KE6A 3F3TA 4NM5A 3W2RA 4FKWA 3LFBA 4BDDA 3R8UA 2P3GX 3QTZA 5HVYA 5CVGA 3NW7A 4ITHA 2WOTA 4C58A 2PZRA 4HVDA 2XB7A 3R30A 3VS2A 2W1FA 2O64A 3KK9A 5J9YA 2PVFA 4XX9A 2GHLA 3G0FA 2WMAA 4HGEA 3LFDA 3NNWA 3FZRA 4OGRA 5DPVA 2A19B 4F09A 4CQEA 5JGAA 3GEQA 4D28A 2J5FA 1V1KA 4G31A 1RQQA 3QCQA 3BU5A 3BYMA 4DLJA 5IQCA 2Y4IB 2A27A 5CWZA 3QTQA 2XF0A 4FX3A 2WIHA 4G5PA 4WG5A 2PMOX 4OR5A 5EOLA 3OBJA 4OW8A 4E26A 5C8KA 5C26A 2FSOX 2W4OA 4Y46A 4BCNA 2UZTA 2QO2A 4BDJA 3TJDA 3V5TA 3FI2A 3FQHA 4BTFA 3VBQA 2ZYBA 3C4XA 2C69A 4HVSA 5HTIA 2ZAZA 5G1XA 3UTOA 3ID6C 3IGOA 5CTPA 3EYGA 3FSKA 4RPVA 3WF9A 3PSCA 2PTKA 3QZFA 4EZ3A 5DR6A 4KRDA 4AA5A 3KY2A 4DCEA 4F1MA 4MX9A 3P7CA 5LVLA 3UP2A 4FKGA 2FUMA 3NIEA 4MD8E 1OVEA 3L9PA 4BZOA 1MQ4A 3UQCA 1FMKA 4WIHA 2W1IA 4TYHB 1F5QA 3GOPA 4AFEA 4GG7A 1DS5A 4AN2A 5HORA 2BFXA 2QOBA 3CKXA 2VTTA 2BTSA 3U9CA 2QOHA 3HL7A 3HV5A 4KKEA 3P86A 5I3RA 2UZLA 4R3RA 3RNYA 4GYGA 4TYIA 4AS0A 2F57A 4BWPA 2BIYA 4ZS4A 4FEQA 4G1WA 5M55A 2W1EA 5DMZA 4QMYA 3KXGA 5M4IA 3UQGA 3ROYA 5ETAA 5HX8A 2E9PA 3VQHA 1SZMA 3WZDA 3AOXA 5CI6A 5HO6A 2IZUA 4QQJA 3RWQA 2HY0A 4JAIA 5CSWA 2FB8A 3ENHA 3NUPA 1ERKA 1RJBA 3PZHA 4IVBA 4U6RA 3R1SA 5AP4A 3EQDA 4BL1A 4D2PA 4W9WA 5AP0A 4K18A 4KKGA 1ND4A 2Z7LA 3F5UA 5HESA 4GKHA 4LMUA 5EKNA 3R7OA 2VNYA 5DE2A 1JPAA 3TZ7A 4ALVA 4BGQA 1OB3A 3ORNA 2EWAA 4QMTA 3QKMA 3UVRA 5GZAA 4RC3A 3MIAA 5K9IA 3IW5A 3LPBA 4GRBA 5BX0A 4IAZA 5BPYA 4RG0A 4O7NA 5E1SA 2PY3A 3PSDA 3EN6A 5HKMA 4MBLA 4O0SA 1XBBA 4OT6A 1PXPA 2QHMA 3I79A 2Z2WA 3LZBA 4QP4A 5H3QA 5HG5A 4A9RA 2PULA 3LAUA 3HRFA 2BRGA 2X4FA 4I22A 4AG8A 3KCKA 4EOSA 4OTFA 1A9UA 4E4MA 2C47A 1G8AA 4ACDA 4EOQA 4EBVA 3G6GA 5HICA 4GJ3A 4BYJA 5TOZA 2RL5A 3C0IA 3MFTA 3VS1A 2I0YA 5K5XA 2XNGA 3FC1X 2BDJA 5E8VA 3QQLA 2XBJA 3K5VA 4FEVA 4R3CA 5GNKA 3ZH8A 4MCVA 3DOGA 4TWNA 2R3KA 2PSQA 1E1XA 2PK9A 3TZMA 4LOQA 4RJ6A 2UVYA 3ZMMA 3ET7A 2W4JA 1OITA 3P23A 3KMWA 4BZNA 3P7BA 3Q5ZA 4U80A 2OIDA 2OZAA 4X6QC 3R8PA 4ANMA 1XWSA 3LCSA 4FV9A 2BAJA 3OW4A 1NXKA 3VWAA 4CQGA 4MXCA 1RE8A 1P2AA 3FQSA 2XK3A 3OXZA 4G5JA 4Q5HA 3EZVA 4GMYA 2WD1A 3MPMA 5CASA 4YU2A 2UZOA 2J9MA 5JT2A 2ITPA 4RVLA 2B9IA 1KOAA 3KXNA 2XRUA 2HZIA 4HPUE 5F9EA 5CQWA 3TACA 3QCYA 5AV4A 3ZUUA 4EH8A 4J52A 3PLSA 1KV2A 3OWKA 5ANGA 4M13A 5DVRA 5AP1A 5D12A 2Z7SA 2A4LA 1SYKA 2PVKA 1QPDA 3SW4A 3UZPA 5IDPA 4YO6A 3AMAA 3ORIA 4EQMA 2ITZA 1YOMA 3L9LA 3NYOA 4H05A 1G5SA 4LL5A 3U4WA 5FTGA 4BDKA 4DHFA 3NW6A 3R8VA 4C3PA 4RX9A 2YWVA 4CYJA 2R3PA 3LCDA 4JQ8A 3UC3A 3RTPA 4AZSA 4EL9A 3O17A 1GIJA 3O96A 3VRYA 3DXQA 3MI9A 5FBOA 4FIEA 3RBWA 5AMNA 2BHEA 2E9NA 3BYVA 3RVGA 2IVUA 2PMIA 4D2SA 2XEZA 4XG6A 1ZMVA 4BCQA 3B2TA 1DAYA 3FYKX 3QKKA 3KRXA 4GFMA 4W4VA 5IUIA 3BBTB 2VU3A 5EG3A 1GNGA 3QUDA 3AGMA 3QLFA 3SG9A 4HNIA 3Q04A 4DINA 2IJMA 3NLBA 4FSTA 5HBJA 3R9DA 3QWJA 4OAVB 3UIMA 2C5NA 1WVYA 5HBEA 4AFJA 4CG8A 3M1SA 4X2KA 2W1HA 2B52A 3GCUA 1S9IA 3KRJA 5KMNA 4ZJVA 3UNKA 4YLJA 5ETIA 1GY3A 4CSVA 4HVGA 2XP2A 2R3QA 4PRJA 4DH1A 2C0IA 3QTRA 5TO8A 2W17A 4I24A 3DA6A 2YCQA 3B8RA 3FUPA 4GU9A 5HG8A 5JQ8A 4L7FA 1R0PA 5AV0A 2CGXA 3QALE 5HGIA 3ZM9A 1OL7A 3P7AA 3ZFYA 2QLQA 4BFMA 1H1RA 2JKKA 2WMTA 2XH5A 2IZTA 2XKCA 5EI6A 2DQ7X 3B8QA 3W2QA 4UMRA 4R78A 3NWWA 4XOZA 4DEEA 4I0RA 4QPAA 4IWDA 3ZUTA 4DTKA 5HLWA 4NSTA 2V55A 2VWZA 1URCA 2V7AA 3UO5A 1Q99A 4YURA 3ITZA 4IJPA 4AA4A 3D15A 2VWYA 2ZM1A 2V5QA 2FGIA 4II5A 5EW8A 5A4LA 1R3CA 4C4FA 2BRHA 3QRJA 4GIHA 4QYYA 4BDEA 4F08A 4YC6A 4JIAA 3R8MA 4BCIA 3F61A 2OSCA 3MYGA 4JDIA 3E8EA 3NVKI 4HVIA 3U6HA 2JBPA 3O7LB 1YWNA 1JKKA 3KF4A 4EQUA 3OEFX 4L3LA 2UW0A 1AD5A 2GNJA 3QTSA 4F9YA 3QFVA 3PJ1A 2F2UA 5KUPA 5HHWA 2CNQA 1ZMUA 3PXFA 2X39A 5CT7A 4V04A 3ALNA 3UMWA 4FVPA 4C62A 2Y6OA 3GNIB 1JVPP 2O63A 2VO3A 3CJFA 3OF0A 3OP5A 3HV4A 4FSQA 2HW7A 5HLNA 5F4NA 4KRCA 2XK8A 3QTIA 1OGUA 3QX4A 4UEUA 4BC6A 2R3RA 4YJSA 5DRBA 4O2ZA 4YZBA 1YRPA 5E91A 3COIA 3VBTA 4FT9A 4XG7A 5I3OA 1Z5MA 2QOOA 3EJ1A 3K5UA 4J99A 3WF6A 4AAAA 4JG7A 1CTPE 5KHWA 3E63A 4O0WA 4RMZA 4EZ7A 4AZEA 4A4LA 2YIRA 3NYVA 5EYKA 4JRVA 5K4IA 5KBQA 2R0IA 3GC7A 4ANLA 4C4HA 1JKSA 2QOIA 5CT0A 3V5PA 4MVFA 4KINA 4FKIA 3E8CA 4OTDA 5BVEA 3QWKA 4I4EA 4YSMA 1PXOA 3EFWA 2BAQA 3I60A 1H07A 3ACKA 3KXXA 4RJ7A 3FLNC 3M2WA 3UODA 4C38A 4CV9A 3CSVA 4MBIA 3NZ0A 2RF9A 3OXIA 2F7XE 4DG2E 4EH5A 2CNVA 1Y8GA 3ERKA 4FIFA 4ANBA 5IQIA 4JDKA 3U87A 5AUVA 3T9TA 1VZOA 3VRZA 3WILA 3R8ZA 4YHTA 5ANDA 4FSUA 3NUXA 4I0TA 4IB3A 1H26A 5DYJA 2RSVA 3VBVA 5CAUA 3C7QA 4IB5A 2DUVA 3BI6A 3FBVA 3AGLA 2X6DA 3MH1A 2UW7A 2W96B 4HCUA 4GCJA 3GQIA 4O7WA 4XUFA 3REPA 2EB2A 4FKTA 2OIBA 4EOLA 1XH6A 2HCKA 3AXWA 3WARA 4C2WA 3ANQA 2VNWA 3T3VA 3QHRA 3TN8A 3AC5A 3DQWA 1BL6A 1W7HA 2OF2A 3HUBA 3OD6X 4LUDA 2WELA 3FQEA 4FTMA 4WUAA 4EWHA 2QO7A 4KB8A 4YTFA 1OBGA 2QHNA 5DRDA 2SRCA 3DFAA 3H9OA 3HRCA 3KRRA 2X8IA 5CSHA 4ASXA 5M09A 2V62A 4RIWA 5L4QA 2Y0AA 3O71A 3RZFA 4YJVA 3UC4A 1OKWA 3F7ZA 2GS6A 4QQCA 4V0GA 2JITA 3DZQA 3JY0A 3BU3A 4KSQA 4U42A 4RRVA 2AYPA 2F4JA 3LM0A 5FGKA 4WA9A 3QZIA 1JQHA 4KWPA 3SOCA 2VTPA 2IPXA 1P4FA 3OZ6A 2W5AA 3SOAA 5HEZA 3HAMA 1J91A 3MW1A 5DBXA 4A07A 2YHVA 3KN6A 4XV9A 4M66A 4O0TA 2A2AA 4PWNA 5AM7A 2YM3A 4QP2A 2HZ4A 2VWXA 3LXNA 3QYWA 5B0XA 3V5JA 3PFQA 2ZM4A 4TYJA 3R1NA 3CTQA 3ULZA 3Q2JA 4U43A 4B0GA 3WE8A 5CY3A 2YZLA 5H8BA 2G2IA 2JLDA 5DR2A 4MWHA 2UW8A 3DJ6A 3TIZA 2WQMA 3OOGA 4RJ8A 4AN3A 3DAKA 5EM7A 4DFZE 5AUXA 4PP9A 4MF1A 2RFDA 3NRMA 4NIFA 3PY0A 1PXIA 4GH2A 3VF8A 4AU8A 3RAHA 4X3FA 1BX6A 3UBDA 3IPHA 3FL4A 2YJRA 3IW6A 3O8TA 3MJ1A 2HZ0A 2J0LA 4IX3A 3HKOA 2GMXA 4LRKA 3C4WA 4IAAA 5CALA 2AC5A 3F82A 4ID7A 5FLFA 4E6AA 4EH3A 3ZS5A 3FMEA 3ZRMA 4JT3A 3BQRA 3LCKA 1B6CB 2CHLA 4PTGA 2X2LA 4BZDA 4EOOA 3NAXA 4NCTC 3TI1A 3QUPA 3MPTA 4FT3A 2PZYA 2C1BA 4FT7A 2B54A 2OW3A 3KXZA 4G3CA 4UWCA 4BGHA 5IQFA 4FZ6A 4HZSA 3W8QA 2BRBA 4X0MA 2OZOA 2WU6A 5L2QA 4BGGA 1WVWA 4AOJA 5K5NA 2C0TA 3BWJA 4QTBA 3VAPA 5EYCA 4IVAA 3SRVA 5DEYA 3EKKA 3LE6A 5E7RA 3VUHA 3R1YA 4QMWA 4CRLA 1W98A 4GT4A 3DDPA 4APPA 5M4CA 2OICA 3OWJA 4K2RA 4TRLA 3EOCA 4RA4A 4DGMA 4HYHA 4EH7A 3TXOA 5IU2A 4D2RA 2BHHA 3F3WA 4GW8A 4FEWA 5E9EA 2UZUE 5C4KA 3R9HA 1LP4A 2I0HA 3FZPA 3OMVA 4H58A 2EB3A 4KIPA 4YZMA 4Z9LA 5E8XA 4BHNA 5KCVA 3EQHA 4QNYA 1NY3A 1WBSA 4D4RA 1VYWA 3FV8A 3HNGA 4F0GA 1IRKA 2QOKA 3KKVA 3LHJA 4CXAA 3GU4A 4YSJA 5AA9A 4C37A 4MXOA 1Q8ZA 2NRYA 2LGCA 4KUJA 4XV1A 5E92A 2QKRA 4BTJA 5CU0A 4E6CA 4JDJA 3I5NA 4V01A 3CBLA 5FD2A 3U4UA 2NNWB 1OIYA 1Q8WA 2FA2A 2PVNA 5ANEA 3R73A 3HAVA 4F4PA 4GUBA 1TQPA 5AUZA 3OWLA 4NK9A 4Y85A 3EQFA 4OT5A 5IMEA 4J98A 2F7ZE 2J0KA 3H4JA 3TM0A 5HCXA 3CEKA 3SXSA 2GHGA 4ANOA 5EM6A 3V5LA 4AXAA 4RX8A 4FNYA 3O7LD 2PE2A 3MBLA 5CAVA 4TPTA 4ZK5A 2EXMA 4FMQA 3W33A 2RFSA 1FVVA 1AGWA 2O65A 3FMDA 4YHJA 3OUNB 3TKUA 2IVVA 3BLRA 3VJOA 1NVSA 1PY5A 3T8OA 5HE0A 4CYIA 4DLIA 3A7GA 4R7IA 5M57A 4ERKA 4MNFA 1DI8A 4KBCA 3FLSA 4PMMA 4FV4A 4YJNA 2CGVA 2ZM3A 3OS3A 2PYWA 4L68A 5IPJA 2ZVAA 4FV5A 4M12A 4RQVA 5E1EA 1K2PA 3DPKA 3JVSA 2HOGA 3AC3A 4DFXE 4CMTA 3BEGA 5LMBA 1WBOA 3A4PA 4AX8A 4AOIA 2X7FA 4WSYA 4XEYA 2ITYA 4NW6A 4U79A 3R0TA 4H3PA 3PA4A 3W18A 4EOJA 1BKXA 5H2UA 3DY7A 1MQBA 2VTNA 4RX7A 3C9WA 4WO5A 1ZLTA 4EK5A 2XNBA 3BLHA 3F6XA 4E7WA 4ZEGA 4JLCA 4AP7A 2OO8X 3SX9A 4Y5QA 5BQ0A 5KMOA 5HOAA 4YTIA 2PUNA 3FI3A 3ZYAA 2C6OA 4F9AA 4R77A 1OL6A 5AIRA 2R3MA 4WHZA 4AW1A 2BALA 3MY5A 5I9YA 5FTQA 4P90A 2W05A 4IM2A 4L43A 4RWLA 5BYYA 3OTVA 4MWIA 3RJCA 3GU6A 3HUCA 3BEAA 4EYMA 4YR8A 2JIUA 3HV7A 2ERKA 4XG4A 4GK4A 2ITNA 4YTHA 3L9NA 3TV7A 5BUIA 4DTAA 2HAKA 2J4ZA 2X9EA 5HO8A 4DTBA 3L8VA 2NRUA 3RAIA 3UOLA 4ACCA 3QA0A 3ATSA 4AN9A 1M52A 3ZO1A 4L53A 2CKOA 1XH8A 3E93A 3OC1A 5KE0A 4GYIA 3QU0A 2YDKA 3T3UA 4MBJA 4I92A 3RINA 3WZKA 3NX8A 3RHXA 1LR4A 4FTIA 2PE1A 4TTHB 4QNAA 4WUNA 3ZLXA 4Z55A 3LKMA 1L8TA 2W1GA 4IZ7A 4HCTA 5GJGA 3C5UA 3UE4A 5AAGA 3LQ3A 5A4CA 1IAJA 3VF9A 1CKJA 3BZ3A 5IH6A 2VWWA 1OIQA 4NM0A 3DNEA 4PDYA 5JGBA 3BGPA 5CEQA 3KQ7A 5FQDC 4YZCA 4WRSA 4YHFA 3P79A 3ZRLA 1IAHA 1RDQE 1YXUA 3R2BA 1Q8YA 3Q2MA 4DH5A 1YWRA 3VUMA 2X2KA 2B1PA 4GVJA 4O1OA 5CZHA 3UIUA 2W9ZB 3OBGA 4ZZOA 3Q9WA 3TDVA 4CLJA 3LJ2A 2P33A 4ACMA 4LUEA 3V5WA 3FMHA 5JH6A 3WBLA 2XK7A 4IVDA 3QUEA 4BDBA 4BDGA 4D2VA 5IA4A 3ZSGA 4BI0A 3LMIA 4RIYA 2VUWA 4YZNA 3ZEWA 1UU7A 4FL2A 2QODA 1U5QA 2QG5A 4FKOA 2UZWE 3HV6A 3FWQA 2BDFA 2YM5A 3FHRA 3MN3A 4OTQA 2ONLA 2YLEA 4CFWA 4K8AA 5KMJA 4ZSEA 1BUHA 3GU8A 1U54B 1KE8A 4OTGA 3EHAA 3S95A 3GBZA 3NNUA 4FV6A 2WU7A 3NYNA 4JR3A 1WBWA 4U44A 2IWIA 1YDRE 1ZOEA 3C4EA 5JMSA 4IFCA 2QOFA 4PY1A 1CMKE 1YI4A 4FV7A 3VUIA 2WMBA 3UGCA 1YOLA 4EOMA 4CEGA 3KC3A 1XH7A 4UYAA 5LARA 2G1TA 2GQRA 5AP6A 1PJKA 1WBTA 2WTIA 4ZJJA 5AUTA 4QP3A 5BVOA 4M97A 3WZUA 1REJA 5FG8A 5IDNA 1UA2A 5LOHA 5CAPA 1GZKA 1U59A 4BWKA 3C4CA 2OU7A 5AR8A 4E1ZA 2BRMA 4MQ2A 5I4NA 3Q52A 3P08A 1QPJA 3HV3A 4FVRA 5JKGA 4YJUA 2ITTA 4XV3A 1FGKA 3GCPA 2W1CA 4S31A 2HXLA 3MVMA 2H8HA 2VZ6A 2VTQA 1STCE 4XOYA 3UYSA 2OJFE 1ZYCA 3R7EA 4CZYB 5ETCA 1UNGA 2P2HA 3KRWA 2VTIA 2X7OA 3KVWA 3VBXA 3FMNA 1XO2B 3OG7A 3I81A 4FG9A 3V04A 4QYEA 4G2FA 1H4LA 2ACXA 3DKGA 3GCQA 3PWDA 3QBNA 3ZUVA 4BI1A 4YO4A 3SLSA 4WNPA 3LFAA 1PMVA 2XK4A 4DEHA 1BI8A 2CGWA 4I20A 1Q41A 2IO6A 4CCBA 1YXXA 1K3AA 3R7YA 3Q96A 5EH0A 5ACBC 4EC9A 4JIKA 4J97A 2C5YA 3EH9A 2ZMDA 4FKVA 1P4OA 3LW0A 2Y9QA 4FKSA 1B39A 4L42A 3MJ2A 5FP5A 3JS2A 3FI4A 4MTAA 4FSWA 4EEVA 1XH5A 4ENXA 2ZDUA 3PE1A 3U6IA 4KKHA 2X2MA 4MK0A 1M14A 3VNTA 3GC0A 5L3AA 4DAWA 4F63A 4RIXA 1PYEA 5J7BA 3BU6A 5FXRA 5FEQA 3ZOSA 1GOLA 2PU8A 3TNHA 4DFNA 4BDCA 3VUDA 2CKPA 4O2PA 5ANKA 4AGCA 2QU5A 4FF8A 5AX9A 5LVMA 2E9UA 3HMIA 3MH0A 4G9RA 2UZBA 4IVCA 4ZIMA 1PF8A 4KIQA 4EORA 4NYEA 3LMGA 4CKJA 4MHAA 3FPQA 4I94A 3CXWA 4U5JA 2HY81 3NGAA 2F49A 5FTOA 2WAJA 1YXSA 4UZDA 4NKAA 2Y6MA 3UNJA 3C5IA 4QPMA 4OUCA 4JG6A 2PL0A 4IB1A 4LGDA 3UVPA 1WCCA 4FG7A 4OTRA 2BZHB 3EQBA 5LWNA 3PPKA 3RK9A 4MD7E 5ICPA 4F0FA 5E8WA 2QC6A 3ANRA 1U5RA 4RZVA 5J1VA 4PPAA 3GUBA 2GNGA 1ZMWA 1R39A 3KULB 2OGVA 5IA0A 3IKAA 3SKCA 5IQGA 1PHKA 4UY9A 5EKOA 3C0HA 3OUKA 4QP6A 5EQPA 2QOLA 5JEBA 4E3CA 5JK3A 4KS8A 1FMOE 1UVRA 4J8MA 5A6OA 3VIDA 4JNWA 3AT3A 3VS5A 4IJ9A 5CSPA 2UVZA 5HLPA 4D2TA 2JIIA 1Y6BA 1X8BA 3MWUA 3A7HA 2CSNA 1H0VA 4JQ7A 5HO7A 2FYSA 2JEDA 4O6EA 4FNWA 3W55A 1SVGA 2OXDA 4ZY5A 3IG7A 3E64A 5L2TA 2DWBA 5I9VA 3PVWA 2J5EA 3Q4CA 4C34A 4EHVA 2JC6A 3RPVA 2IW9A 3OVVA 5BVFA 1ZY5A 2B7AA 4KIKA 3DQXA 5HD4A 2VD5A 5CXHA 3FHIA 5H9BA 5LQFA 4X2NA 3CKWA 1I44A 5LVOA 4MNEB 5HCZA 4GFOA 1AQ1A 3OCTA 4FTAA 4ZZMA 3AD6A 4F6UA 5JQ5A 1PMNA 5CEPA 3DDQA 3NCGA 3LCTA 4DT8A 3FAAA 2P2IA 1OKVA 5B2KA 2HIWA 3QQUA 1H1SA 3EFKA 4FV0A 4DEBA 4F1OA 2VWIA 2B9JA 3LFSA 3IK3A 3NUUA 4PUZA 4XCUA 5HIDA 3UO4A 4FTJA 4IB0A 2JDTA 1CKIA 4XG3A 4ENYA 3C4FA 3HEGA 5A46A 2YWPA 4IC8A 4N0SA 3VUTA 4S32A 5JSMA 4CTCA 1OPKA 5KZIA 2CDZA 4ALWA 2RFEA 2R3FA 4FR4A 2WQBA 3HECA 4BRXA 2C5XA 1GAGA 2PHKA 1WBNA 4TWOA 3QC4A 5HCYA 3GU7A 2YIQA 4H39A 3LLAA 3ZDUA 3PA3A 4M0ZA 3ENMA 1Y91A 1Q24A 3QQHA 4RZWA 4USFA 5CVHA 2XCKA 5GZ8A 4RLLA 4KBKA 2O0UA 4IM3A 2R4BA 4FTUA 3FZSA 5K0KA 4KNBA 2CN8A 2XIYA 3KCFA 3HGKA 3PLAE 2PZ5A 4DG3E 1HCLA 4JQEA 2PE0A 4R3PA 3BV3A 3VS7A 4M3QA 3UOJA 4QP8A 2XS0A 4NJDA 2GNIA 2JDVA 3HMNA 3EN7A 4GT5A 4J1RA 4RFMA 2OK1A 3QQGA 4OBQA 5CZIA 3DTCA 4UZHA 4GKIA 2X9FA 4R1VA 2WMVA 3EN9A 3LQ5A 4D5KA 4JX3A 5IQBA 1YWVA 4QTDA 4K33A 3BQCA 5CEIA 1W0XC 2IZRA 3E3PA 4O86A 4RVTA 2VTOA 3A60A 4O0VA 1ZZ2A 3DAJA 3DS6A 4IZAA 5EHYA 3PWYA 3MA3A 4LOPA 4MXXA 4Z7HA 5A4QA 4BF2A 3AQVA 2Z8CA 4DC2A 4C57A 4X2FA 3PPJA 4O82A 3AC2A 1XR1A 5DA3A 2GTMA 4BB4A 3BE2A 2VTHA 4C0TA 2BILB 2YJSA 4FKRA 3FSFA 4YJQA 1EH4A 2BKKA 4A7CA 3P4KA 5IZFA 4WSQA 3IDBA 2B55A 4E6DA 3ZO2A 4AZVA 4TY1A 3S00A 1JOWB 4TZRA 3ORZA 3KK8A 5CU6A 4EWQA 3UO6A 2XMYA 3JXWA 4K0YA 3CTHA 2OI4X 3P9JA 4PL4A 4NFMA 2C1AA 5D1JA 3THBA 3PXZA 3QHWA 1ZY4A 1F0QA 3JPVA 4AA0A 1OUYA 3H0ZA 3I7BA 1UKIA 3Q4UA 4FL3A 2HK5A 4X21A 4ASZA 4O84A 4C3RA 5FP6A 3MVHA 3K54A 4CT2A 2YITA 1ZAOA 3ORPA 4TYGA 2OKRA 3POOA 1XBAA 2ZJWA 2GPHA 2WMSA 3LXLA 4O0YA 4IADA 5IEXA 2WHBA 4LV5A 4FC0A 2GSFA 3KRLA 2W99B 4NTTA 2R3IA 2CLXA 4UWBA 2QOCA 2IW8A 4C2VA 2CKQA 4O83A 2CCIA 4D1XA 3RPOA 3D0EA 4JDHA 5EYMA 1P5EA 2RKUA 3Q4ZA 4FTOA 3UOKA 3UJGA 4FL1A 4G16A 5EHLA 4JL9A 2W5BA 1H8FA 2C6LA 2OXYA 5IUHA 5TKDA 2I0EA 2FSMX 5J9LA 3NSZA 4GV1A 4OBPA 4OTPA 3LIJA 4FIHA 3QRTA 2H6DA 4ITIA 3JYAA 3QGWA 3UMXA 4BKYA 2QONA 2V22A 4FUXA 1QPCA 2WMUA 2UVXA 1NVQA 2XRWA 4MF0A 3W8LA 4F9CA 3R83A 3VJNA 2J6MA 2QCSA 3BBWA 5AV1A 3TL8A 4XH6A 3PUPA 1O9UA 1KE9A 1JSTA 4D1ZA 2NPQA 4KA3A 5AP7A 1XKKA 4ZSJA 3FYJX 4AW2A 3KF7A 4QMSA 5K4JA 3E5AA 4USDA 4GK3A 4EK4A 1OIUA 3LCOA 2J0MB 4U81A 1QCFA 4C4JA 2C3IB 5CI7A 4HVHA 3PJ2A 1H24A 3KMUA 2O8YA 3WF7A 5BYLA 5DR9A 3IO7A 4FIJA 2VRXA 3EQRA 4Z7GA 4NCTA 3V3VA 4G3EA 3IDCA 2YCSA 4EKKA 1XBCA 5HE2A 5LVPA 5AFVA 3NPCA 3DJ5A 3TT0A 3O0GA 2PPQA 1FBNA 5CQUA 5DT3A 3KN5A 5HBHA 3QC9A 4AZWA 4WG4A 4BDFA 4N6ZA 4G6NA 4YJRA 4EH6A 4QOXA 4NU1A 4BDHA 4JBPA 4RQKA 1YI3A 4DEDA 5M53A 4FKLA 5C03A 1M17A 4BCMA 2BMCA 2YCFA 3FMLA 4BBFA 4XG9A 3K3IA 3VS0A 1UNLA 3SD0A 3E3BX 4HZRA 3LM5A 2LAVA 3SV0A 4EH9A 4YTCA 4I4FA 2V0DA 5HNBA 3R02A 4QYFA 3UOHA 1JNKA 2W1DA 1MP8A 3AG9A 3TNPC 5FDPA 2O3PA 5AR4A 5CENA 1PXLA 1UWJA 4EZ5A 3IW4A 1PKGA 4QT1A 4RFZA 4G3FA 5BMMA 2PWLA 4L8MA 3RPSA 1XHAA 3PZEA 3F5PA 2PUIA 4PP7A 2GS7A 4DEGA 4QP7A 3VW6A 2R5TA 3PVUA 4G34A 2G2FA 5A14A 3FY0A 2J50A 4G6LA 3SHEA 3P1AA 4LG4A 4LGHA 5M44A 1JLUE 2AUHA 3WZJA 5JRSA 4A9YA 5DGZA 4YNOA 3FLQA 3ODZX 3EQPA 3ROCA 3CPBA 4F7LA 4ARKA 1Z57A 4TWCA 4BDIA 3GCSA 3U6JA 3MS9A 5ANJA 3UIBA 1MUOA 3MA6A 4AT5A 1ZWSA 4O38A 4YJOA 2HXQA 1PXKA 3HA6A 4AWIA 4A06A 5E8ZA 3VULA 4TT7A 4QTEA 5M56A 3AD5A 2I40A 5EHOA 4LQMA 4HYIA 4UB7A 4YJPA 4C3FA 4DEIA 2BR1A 5AP3A 5C8MA 4EK6A 3Q4TA 2UZDA 4BTMA 4L44A 3UP7A 2IVTA 4HGTA 4IHPA 2XZSA 2G15A 4Y5HA 1LEWA 4DA5A 4YPDA 4B99A 3JVRA 2ZV9A 4QP9A 2BFYA 5E8YA 2WNTA 1VEBA 2C5VA 2V7OA 5IISA 3GP0A 4AGDA 1Y57A 3R8LA 4KABA 3AMBA 4I6HA 3C1XA 1Q3WA 4FSRA 4MQ1A 4FZDB 3HDMA 5KMLA 5GZ9A 4EJNA 2I6LA 4G17A 5AV2A 5J95A 4IWOA 4D0XA 3JR1A 3DK3A 3I0QA 3QGYA 4I6BA 4IMYA 5J8IA 4AGWA 4BCFA 3COMA 3PSBA 4CFMA 4NH1A 4BWXA 2QURA 5AV3A 4F1TA 3PVBA 2BZIB 2OFUA 3PXRA 3ZSIA 3NDMA 4TYHA 5B7VA 2OJIA 4A9UA 1OUKA 1UU9A 2JFMA 4GT3A 5C01A 4EK8A 4ZMFA 4FT0A 4ONAA 5AP2A 4CT1A 4DT9A 2J7TA 2OIQA 5LXMA 3UG1A 4KSPA 3BWFA 3F2NA 4L3JA 3DXPA 5IA3A 5AP5A 4YBJA 4WRGA 4LOOA 3CQWA 3KULA 3NNVA 3PRIA 3MTFA 2VTRA 4I3ZA 4TL0A 4RIOA 3BHUA 4IAIA 4IIRA 3ZO4A 3KEXA 4QMMA 4TNDA 4NKSA 2P0CA 1DM2A 2GCDA 3NAYA 3OCSA 5ANIA 3ZC6A 5JGDA 2RG5A 3ODYX 2J90A 3TIYA 2J0IA 3OFMA 3TJCA 1YDSE 3TWJA 1MRYA 2WTKC 1OKYA 1ZYSA 4I6QA 4BDAA 3CY2A 3RM6A 4GUEA 1NVRA 2WO6A 4EYJA 2GDOA 2C6IA 3QCSA 2BVAA 3OY1A 5TR6A 5A6NA 3W2CA 4IZYA 3M11A 5L6PA 5GINE 3C4ZA 1JBPE 3Q32A 2UZVA 3FKLA 3GCVA 5CEOA 3VHEA 2WTWA 3N51A 4W8EA 2UW6A 3UG2A 3F66A 1FVTA 2HYYA 2BAKA 3EFJA 4JJRA 4FIGA 2VTMA 4FGBA 3FE3A 1SNXA 5IQAA 5DT4A 3F2RA 5E8TA 4K11A 3RNIA 4HGSA 5IEVA 2XIKA 5KZ0A 4LV8A 2B9FA 2RIOA 2C3JA 4GSBA 4ZTHA 2QNJA 4RWKA 4D4VA 2QD9A 4RWJA 1LPUA 4K1BA 4DF3A 3ZFXA 4O21A 4E8AA 3C0GA 3SGCA 1OL1A 3CY3A 1FPUA 2JGZA 4OTWA 3TKIA 3MFRA 2ETMA 4Z3VA 1G8SA 3BV2A 4I0SA 4IE9A 3R00A 5DH3A 3SDJA 4A4OA 3DV3A 3EKNA 3OROA 4X2JA 5A4TA 2WOUA 5DG5A 5E90A 2RGPA 3OT8A 2W5HA 4PV0A 3R7UA 5DIAA 3DKOA 4Y72A 2JAVA 2OFVA 3CD3A 3PA5A 2NP8A 2FH9A 2W06A 4GIIA 1PMUA 2XNMA 1H25A 5DNRA 4IQ6A 3MESA 4J95A 3VC4A 4IWQA 3O50A 1ZYJA 3D2IA 4GK2A 3VQUA 4RA5A 4WT6A 4EBWA 2QQ7A 2EXEA 4AACA 2XNNA 4BBEA 4IFGA 2C3LA 5IQEA 4Y95A 4CD0A 2XKEA 3CS9A 5JZNA
chains in the Genus database with same CATH superfamily
4JX7A 1YXVA 5L8JA 3PRFA 3R9NA 3PIYA 3DGKA 3R63A 2XNPA 1LEZA 2YISA 3NUYA 3MY1A 2CGUA 3W2OA 2OZAB 4NW5A 3D7TB 3FC2A 3A99A 1VYZA 4FA2A 4ZLYA 3CLYA 3DK7A 3SXFA 2BDWA 4BKZA 3D4QA 4GU6A 4XHKB 2H34A 4CZUA 3POZA 2H9VA 2Q0NA 4BCJA 3Q3BA 4AT4A 4U8ZA 2FSLX 2OJGA 5CS6A 2G01A 3PIZA 5CU2A 3ZM4A 4P5QA 1WZYA 4Q5EA 5FEEA 3NVMB 5HNGA 5KBRA 3MVJA 2O2UA 2UV2A 3ACJA 3I1AA 2YAAA 3PJCA 5C27A 5FRIA 2PVMA 4M7IA 3W16A 3TUDA 2BIKB 3F7WA 4M67A 1J1BA 3LJ1A 2XANA 2VAGA 4F7SA 2Q83A 4QMUA 3V01A 5IEYA 4CKIA 4R8QA 3FPMA 2C6MA 4I6FA 2VGOA 4ZSAA 5M4UA 4DCAA 5AJQA 1Q4LA 3GU5A 2W1ZA 1SVHA 3DJ7A 4CNHA 5FEDA 1FGIA 2B9HA 4CFNA 5AEPA 3KXMA 3G51A 3R71A 4UX9A 1H08A 4PNIA 3EL8A 3N9XA 5D10A 4BJJA 4GEOA 2R7BA 4QQTA 3BHVA 4PTCA 3U54A 4Y83A 2YM6A 4AE6A 2PVRA 3HP2A 1FQ1B 1O6KA 3D14A 3E87A 2BZKB 4B7TA 4AQCA 3QXOA 4HJOA 3RPRA 2C6DA 2VV9A 2XK9A 4L6QA 4E6QA 4D4SA 4PNKA 4FG8A 5BVWA 3OCGA 4BICA 1CM8A 4M15A 3DKFA 1OPJA 2WQOA 1BI7A 3MB6A 4FTQA 4N6YA 4PL3A 4RGJA 2QOQA 4WNOA 2OH0E 4FJVA 3VS3A 5EDPA 3V8WA 4FV2A 2CPKE 1L3RE 1IASA 4FBXA 3GC8A 5IG1A 3S1HA 3C13A 3ZRKA 3RAKA 3E7VA 4GJ2A 4HW7A 3OCBA 4X2GA 4KBAA 2H96A 2ZDTA 3BYUA 3MDYA 3QL8A 2VWUA 3RKBA 2IW6A 2ZB0A 3HMOA 5C9CA 4D55A 5CF5A 1NW1A 4DBNA 4X3FC 3QX2A 3D9VA 4L45A 5JRQA 2VTJA 2E9VA 2ESMA 1R1WA 3ORTA 2C5OA 4GG5A 3SVVA 4IWPA 5AUWA 4R7HA 4ZTRA 4Y8DA 2VTLA 4JBQA 3VS6A 3I0OA 1U4DA 4BCGA 5IA1A 2PUUA 4H3QA 4MXAA 4ZTSA 4PL5A 4DGNA 3QTUA 3SG8A 2IN6A 3DFCB 5CSVA 3W2SA 4LMNA 3Q9YA 1PRYA 2X7GA 2VX3A 2WMWA 4D4YA 1W84A 2QI8A 3BHHA 2UW9A 1J7UA 2WTKB 2DYLA 3DAEA 5C4LA 2O5KA 2VWBA 3F2AA 3HRBA 4TYEA 3QQFA 3VHKA 5HI2A 1A06A 2WMQA 4JS8A 2FO0A 2X6EA 3MY0A 5CLPA 4AAYA 1R0EA 4FODA 5AR2A 3L8SA 3O51A 4C61A 2X8DA 4QD6A 4ACGA 4U41A 4ZZNA 5IH5A 4CMOA 3QCXA 1MRUA 4NFNA 2XJ1A 2X0QA 4B4LA 4GFGA 2JKOA 3R9RA 2KULA 3H3CA 4TWPA 4ASEA 3LXKA 4DYMA 3A2CA 2UW3A 3NIZA 4JI9A 4KAOA 4O4FA 3TTJA 2BPMA 2YIYA 4FKUA 4FTTA 4C4GA 4ZY4A 5H8EA 4OTIA 4TXCA 2HW6A 4ANQA 4QMPA 3L8XA 4O91A 3FXZA 2C4GA 1WMKA 3FZOA 1WAKA 5I9UA 3OT3A 1SNUA 5AR7A 3AT4A 4I21A 4BY9E 4J53A 5AAEA 2ITWA 2OG8A 4JVGA 4HCVA 2WB8A 2E9OA 5EQYA 5ACKA 4BCHA 2X1NA 5ANOA 4QMNA 3BE9A 4FE2A 4AE9A 3JY9A 4I1ZA 4BIDA 3IECA 3AT2A 1V0BA 3BL7A 4O22A 3ZLSA 5LMKC 3QXPA 5M4FA 2JD5A 2E2BA 3PDTA 1KE5A 5H8GA 3S4QA 4Q9ZA 4NTSA 2UZNA 1QMZA 1E1VA 3DBEA 2R3NA 5CYIA 4LM5A 4ZY6A 4XP3A 4FOCA 1IA8A 3EN4A 2VO0A 2YABA 1TKIA 3CCNA 5FDXA 3ZZWA 4FT5A 4ZAUA 1H00A 3NEWA 5IUGA 2PVYA 3ELJA 2YA9A 3G15A 5EQEA 4F65A 4W4WA 4I5CA 5EW3A 4DGOA 3FI8A 4FV3A 4MAOA 3EZRA 3BHYA 3WI6A 4BR3A 1J1CA 1ZYLA 2HENA 2OJJA 3R2YA 2PMNX 3JUHA 5KKRC 1IA9A 5JZJA 4CFUA 5KMKA 4BHZA 4IAFA 4X7QA 2WZJA 1OZ1A 4C59A 4F70A 2F7EE 2X81A 3EMGA 4BTKA 3GI3A 4MXZA 4M8TA 3NUSA 3RGFA 1W2CA 2ITVA 3DBCA 1PYXA 1YHSA 1ZZLA 3DKCA 4PMPA 4AW5A 2GU8A 5FXQA 3R22A 4DH7A 2WXVA 4FI1A 4E4XA 2CLQA 4I5PA 3TZ9A 4CMUA 5A4EA 2YIWA 5EFQA 3HYHA 5KNJA 3PG1A 5KMIA 5HZNA 2PUPA 2RG6A 4UYNA 4BKJA 1OL5A 2X0PA 3OHTA 4XP2A 5DT0A 3BGZA 2VWVA 3WYYA 4UMQA 3H9RA 4USEA 5J87A 3PTGA 5J9ZA 4ZP5A 4ORKA 3FXWA 4XRLA 2QU6A 5BNJA 2YERA 4RIWB 4ZSLA 4ANNA 4ASDA 4ZJIA 5L2IA 2OF4A 3PE2A 5BYZA 1M7QA 3TUBA 1M7NA 4H3BA 4V0GB 1Q5KA 4QMQA 3LLTA 4RSSA 5AUYA 5CEKA 2XALA 2C6EA 3F88A 4WG3A 2VTAA 3M42A 4U3YA 3EFLA 2XCHA 1GZ8A 3A7FA 3AKLA 2WMXA 5GJDA 5EW9A 3PG3A 4PQNA 3HZTA 4UXQA 2XNEA 3QRKA 5K0XA 1FINA 5KX8A 4S34A 3IOPA 3OTUA 2XM9A 4RC2A 2ETKA 5M06A 3HMPA 4QMZA 4M69B 3MFSA 1HCKA 3ULIA 2WTVA 2PVLA 3Q9ZA 3R21A 3U8WA 2J0JA 4L7SA 5LMAA 4G6OA 5HIEA 1YDTE 4IX6A 1GJOA 1V0PA 1GZOA 2ZMCA 4ZS0A 5FM2A 4L3PA 4NIFB 1ZYDA 3P5KA 4AZTA 4X3JA 4YNEA 3K2LA 1WBPA 4IC7A 4MEDA 4X3FB 3ZBFA 3FXXA 1M2RA 4P2KA 3G33A 3RZBA 2B53A 4DFYA 5DOSA 2GNHA 4QQ5A 4WD5A 4CG9A 1VJYA 1XQZA 4IANA 4FV8A 4LDTA 1OKZA 1ZOGA 1LUFA 1WVXA 2ITOA 2YZAA 3O23A 5CEMA 4K77A 4WNKA 4XLVA 5CAQA 5CU4A 3PXKA 4NWMA 1VR2A 1R78A 3DB6A 3BKBA 3KU2A 5D9HA 3K3JA 5GIPE 1QL6A 4BCKA 3CGFA 2JAMA 2I1MA 5ITAA 3EYHA 4XBUA 2ONLC 1APME 2BUJA 1YOJA 2XARA 4D0WA 1J7IA 2PZPA 2XYNA 2G2HA 4RLKA 3LVPA 4CVAA 4RVKA 2XIZA 5GIOE 3R1QA 4S33A 1SVEA 3QTWA 3RWPA 3BX5A 2J51A 4U9AA 2CJMA 5EM8A 1OECA 1URWA 3LFQA 2JKQA 2VN9A 3NS9A 3PIXA 2OXXA 4IW0A 4L01A 4UMTA 3RK7A 3PYYA 4E93A 3BELA 5AWMA 2GFCA 4J7BA 2OH4A 1H1QA 3N4UA 2JDRA 4O7SA 3BLQA 2UW4A 3QRIA 4O1PA 3UZRA 4DGLC 3D7ZA 4IX4A 5EYDA 3E88A 3GENA 1WBVA 3G5DA 5CU3A 3T9IA 3V8SA 3O8PA 4XG2A 1F3MC 3RCJA 3ZONA 5I0BA 2OLCA 4CKRA 4HOKA 4AF3A 3HLLA 4D2WA 4G9CA 4I23A 5IQDA 3KGAA 5GJFA 3L9MA 3CJGA 4EUUA 2WQEA 3CQEA 5CX9A 2REIA 4PX6A 2XJ0A 3II5A 3D7TA 3QQJA 4PMSA 4CZTA 1KSWA 2GNLA 2OWBA 2ZV7A 4FSZA 5J7HA 4NM7A 4IXPA 3R7IA 2XBAA 4JRNA 5JN2A 4FYNA 2W0JA 1YQJA 2R2PA 4Y73A 4E5WA 5CF4A 1IG1A 1GIHA 5IH4A 1TQIA 2QG7A 2B0QA 5FUTA 1UNHA 2CMWA 3IGGA 4WOVA 3D2KA 3E8DA 4ACHA 3HMMA 3EB0A 3ZU7A 4W8DA 4C7TA 3VVHA 4FK3A 4PPCA 4FNXA 5IA5A 5LWMA 5BUEA 3FKNA 4EHZA 2QKWB 2BROA 5KKRB 3TV6A 3PY1A 4LFIA 4W9XA 2WEVA 3KXHA 4H1MA 4XV2A 3WF8A 3ZXTA 3HP5A 4L46A 2JFLA 2X0GA 4FSMA 3DBDA 4F64A 4O4CA 3FLWA 4UN0C 3R01A 2XIRA 3P0MA 5LVNA 4EK3A 5TF9A 4FZFB 1V0OA 3UIXA 3OWPA 4N57A 5L2SA 5KMMA 3R6XA 4FICA 4NL0A 5I9WA 1Y8YA 3MV5A 3NYXA 1KOBA 4D1SA 5IKWA 4AGUA 3FMMA 4QO9A 3EQGA 4Z16A 5D7AA 4CGAA 3EN5A 3F3UA 1DI9A 2UZEA 4M0YA 3TNQB 3ATTA 2WTJA 5BUJA 2GHMA 4QTAA 4HPTE 1BMKA 3ETAA 3LMHA 2YDIA 4FTLA 3W32A 4JG8A 2QR7A 3PP1A 3QF9A 2IZSA 4BN1A 4C35A 3VW8A 4EUTA 3TMOA 3CE3A 3F3ZA 3GGFA 2C6KA 3TUCA 1W2FA 1OIRA 1XH4A 2GS2A 3DCVA 1B38A 3QA8A 4YZ9A 4I93A 3KVXA 4QMLA 4R6VA 5DWRA 4D9UA 2P4IA 2XJ2A 3A62A 4IH8A 5A9UA 1Y6AA 4I5HA 1H0WA 4IAKA 2A98A 3L1SA 4XS2A 3KA0A 4RX5A 4EHEA 3PY3A 3MH2A 3V51A 3ZLWA 5HVKA 3N4VA 4G3DA 3FLYA 4FKPA 4FZ7A 2YEXA 4ZSGA 4BIEA 4CV8A 3H10A 4UALA 4AT3A 5AUUA 4QP1A 5A54A 5F95A 4O4BB 4O0RA 5HQ0A 4BCPA 3UZTA 1GIIA 4JXFA 1A48A 3A4OX 4HYSA 4CFVA 3RHKA 3MB7A 5T6KA 3CD8A 2R3JA 5F1ZA 4O7ZA 2YLFA 3V8TA 3DU8A 1JWHA 1U54A 2VO6A 4M14A 1FVRA 4IACA 3CPCA 2R3HA 4O7RA 4DFBA 3DBFA 2XIXA 4MXYA 4FEUA 4CFFA 3W0NA 2X8EA 3GC9A 4F9WA 4A4XA 3IQ7A 3QD4A 4YPSA 2I7QA 3LFEA 5HG7A 4NEUA 5DEWA 1ATPE 3TNIA 5B2MA 3ZFMA 5TT7A 1BYGA 4B8MA 3LJ0A 1PKDA 2QO9A 2Y4PA 2GTNA 3E7OA 4O7TA 4RIYB 5M08A 5EI2A 2CKEA 4U40A 4B6LA 1NT2A 3NW5A 1XMLA 3ZXZA 2YM4A 4HGLA 3V6SA 5JFSA 4ZLOA 4O7VA 5CSXA 4C36A 1H27A 5DLSA 3AC1A 3Q6UA 3U9NA 4QTCA 1SM2A 5HTCA 4RC4A 4YJTA 4TN6A 3S0OA 3UDTA 3HA8A 3F9NA 3NUNA 4PPBA 4Q2AA 4JAJA 4N70A 5DI1A 2Q0BA 4FV1A 1SMHA 2WGJA 2I0VA 2R9SA 2YDJA 5L6WL 3RK5A 3SC1A 2C6TA 3SAYA 2WFYA 3NCZA 4PMTA 4QMVA 1YVJA 1YKRA 1G3NA 2YCRA 5AR3A 4E4LA 3ZDIA 4QDVA 2XK6A 3G9LX 2VTSA 1TQMA 2BCJA 3MFUA 5EK7A 2X0OA 3IW7A 3RP9A 2R3OA 3ZTXA 4BIBA 1ZARA 2YIXA 5J1WA 1PXNA 3KB7A 1PXMA 2ZOQA 4ZLZA 3R9OA 3GT8A 3LOKA 3UVQA 3GXLA 3QD3A 3TNWA 1BLXA 4IX5A 4F7JA 5IMXA 4MH7A 4ZOGA 5J5TA 1O6LA 4E4NA 4DFLA 3D5XA 4UBAA 4XJ0A 5AAFA 1UU8A 3UYTA 1JSVA 5I9ZA 1T46A 4XMOA 5BVDA 2FVDA 4LI5A 4FTRA 4O96A 3VO3A 3A8XA 3PP0A 4KIOA 4YBKA 3ZCLA 4XBRA 1KV1A 3R04A 5JFWA 2IVSA 3ZO3A 3ORXA 3AC4A 2Z02A 5ETFA 2QLUA 3B2WA 2XUUA 3KL8A 5TE0A 4E73A 1OGYA 2Z7RA 4P7EA 1H28A 3ORLA 1MRVA 5HIBA 4G3GA 4I5MA 4P5ZA 2VX0A 1CSNA 4I41A 3FMJA 5I9XA 2XM8A 4WBOA 3U51A 1TFFA 2ITQA 3QQKA 1E9HA 4RJ4A 4TKSA 3VUGA 1JAMA 5EI8A 4C4IA 4LYNA 2AEGA 1WFCA 4YP8A 4APCA 3BGQA 4FGRA 4YMJA 5J5SA 2PVHA 2ETRA 3DLZA 2HWPA 4MD9E 1UKHA 5HE1A 3VBYA 3P78A 3NR9A 1GZNA 4J96A 3DTWA 3EIDA 3MVLA 4K9YA 4U97A 1Q62A 2ERZE 3GFWA 3ALOA 1M2PA 1JSUA 4L52A 4RIXB 1PW2A 1KUTA 3BPRA 3SW7A 4QMOA 3BCEA 3U55A 4E5AX 5LCKA 4AZFA 3KFAA 4UMPA 3H30A 4O6LA 3RM7A 4KS7A 5CXZA 3GQLA 2C0OA 4FKQA 4D58A 4IDVA 4EONA 3SQQA 4F0IA 2KTYA 3UNZA 1U46A 4O27B 2PVJA 3PPZA 3HVCA 4M69A 1KE7A 4O81A 3CR0A 2QR8A 3MH3A 5A3XA 1YI6A 4ITJA 3WE4A 2B4SB 4C02A 3HX4A 4J71A 4WKQA 3G9NA 4TW9A 4EH2A 4XNEA 4FTNA 5EOBA 4LRJA 4NZWB 4EHGA 5AADA 4ALUA 3SRVB 3C51A 3R28A 4K6ZA 3D83A 2PMLX 3FLZA 3LFCA 3TZ8A 3IOKA 4FSYA 4DH3A 2DS1A 3FY2A 3WIGA 3NFFB 1PXJA 4MNEA 4NM3A 3MPAA 3IS5A 3TCPA 3I6UA 4YZDA 1OBDA 1T45A 2CN5A 2Z60A 3H0YA 3ORKA 3OW3A 4AUAA 1IEPA 3VS4A 4X6RA 1Q8TA 3QAME 4ZTNA 1OI9A 1XJDA 2W9FB 4DITA 4JOAA 5HX6A 5LJJA 4GVAA 4XRJA 4EJ7A 3EL7A 2EXCX 5L2WA 1H01A 4P4CA 3I6WA 3CIKA 4PDSA 5AA8A 4Q9SA 1CKPA 1ZOHA 4IBMA 3VUKA 5I5ZA 5LCJA 1Z9XA 3CGOA 4AOTA 4UV0A 5E8SA 3UDBA 1Q3DA 3Q6WA 2WIPA 3PJ8A 5L8KA 5IQHA 4KIKB 3VN9A 3OXTA 2Y8OA 3BRBA 3OY3A 2OJ9A 1J3HA 4O7YA 3G2FA 1UU3A 1ZXEA 2NO3A 3D94A 4FTCA 4R5YA 4U0IA 3QZHA 4H1JA 4A9TA 5JFXA 2YAKA 2ZB1A 3ZLYA 4ERWA 2YFXA 3GFEA 3RALA 4C4EA 2BRNA 4IZ5A 3WF5A 3FDNA 2A1AB 3FZ1A 3WOWA 2XAOA 4W4YA 3ZHPC 2UW5A 4R7BA 4GS6A 3L8PA 4D9TA 2R3GA 2IG7A 1O6YA 2HELA 4EC8A 4RJ5A 4DBXA 3F5GA 2RFNA 5IF1A 1DAWA 3PXYA 1I09A 2C30A 4EOIA 5CNNA 1HOWA 3FMKA 4RWIA 4U3ZA 2F9GA 3ZC5A 4DG0E 5HE3A 5C8NA 3W0PA 1ZRZA 3DK6A 2WKMA 4YLKA 3COKA 3IONA 2GNFA 4HYUA 3QTXA 4YLLA 3F5XA 3BIZA 4OBOA 2F2CB 5B2LA 1W8CA 4EH4A 3A7IA 3I5ZA 1M2QA 4L67A 3PJ3A 5EDRA 4QPSA 4F6SA 2BZJA 3I7CA 4ZTQA 4L00A 1P14A 1JKLA 4S30A 1TVOA 2J2IB 5BMSA 5LMKA 2XKDA 2XVDA 4ZMEA 4FZAB 2FSTX 3NMUF 4IDTA 4NJ3A 4DN5A 5FWKK 2HWOA 3MIYA 1PMEA 3FL5A 1REKA 2Z7QA 4YGAA 4LRMA 5BVKA 3TYKA 1RW8A 2UUEA 4F7NA 5F94A 3CC6A 1J7LA 3RPYA 3DZOA 3V6RA 4N4SA 4RJ3A 2Y7JA 4O0UA 1FOTA 1QPEA 2W4KA 4JBVA 5HVJA 4E5BA 2WTDA 3TTIA 5CANA 5G6VA 2XEYA 2Y4IC 3E92A 3I4BA 4JR7A 5IA2A 4U45A 5L8LA 4W4XA 4ANSA 3ZBXA 4M68A 3E8NA 5F20A 2GQGA 4NUSA 1OL2A 2ZFYA 5DHJA 4AW0A 3DBQA 2GQSA 3GVUA 3QLGA 3C50A 3AC8A 4MKCA 5BVNA 4IAYA 1CDKA 4PF4A 3DB8A 4U7ZA 3TEIA 4BVUA 3G0EA 5FXSA 4O7LA 2AC3A 2EU9A 4DDGA 4S2ZA 3F69A 1JKTA 3CQUA 3TG1A 4EQCA 5CF6A 2CNUA 4V05A 3PVGA 4YC3A 4DE4A 2A0CX 2QVSE 3AD4A 5CF8A 5K3YA 3UPZA 2JBOA 5D41A 4OTHA 4RT7A 4BCOA 4J8NA 3A7JA 1G8KA 3KREA 1KWPA 2YACA 3G90X 3IDPA 3QD2B 5AIKA 4B8LA 4GL9A 4LL0A 4UXLA 4DGGA 4FKJA 4TNBA 5AR5A 5FBNC 3GOKA 4ZTLA 3WZEA 5E4HA 2VGPA 5KHXA 4RBLA 4L9IA 1OPLA 4PDPA 4QRCA 5CAOA 3LXPA 2VO7A 3NUAA 2WTCA 4RFYA 2X4ZA 4DH8A 2GFSA 4DEAA 2WQNA 2YM8A 4BBMA 3TV4A 4ZTMA 3FKOA 2JKMA 5T3QA 3G6HA 4XG8A 2R0UA 4KD1A 4R5SA 3FEGA 3DLSA 4C8BA 4ZXTA 1YW2A 2C3KA 5HTBA 1H1PA 5KO1A 4RVMA 3DT1A 4EOKA 3SA0A 3QKLA 3KMMA 3LFNA 5DFPA 4BYIA 4FYOA 2P55A 2PZIA 2YN8A 3E62A 4PTEA 5GHVA 4FEXA 3FJQE 4CFXA 3COHA 3EQIA 5CVFA 5E8UA 5HU9A 1H1WA 2JIVA 3A8WA 4LGGA 2C68A 4AXFA 1OMWA 4XLIA 4XYFA 4QEBA 1W82A 4CTBA 4R1YA 4C33A 3QRUA 2ZV8A 2OBJA 4F6WA 3HDNA 5HG9A 3F3VA 3UPXA 4MYGA 5HU3A 3LQ8A 4D5HA 2G9XA 5EM5A 3S2PA 5EDQA 3FZTA 5J79A 2JDSA 4QYHA 3RAWA 2WMRA 3TKHA 2R7IA 1Q97A 3QYZA 5JFVA 2W7XA 3Q60A 3D5UA 3D5WA 1Q8UA 5CNOA 3CTJA 5DN3A 4FUYA 4F9BA 4FTKA 1BL7A 3MGYA 4OAUC 4XP0A 4CRSA 5HNIX 3R7GA 5T68A 3WIKA 4FIIA 2HZNA 4QMXA 1K9AA 4EOPA 4M84A 2XNOA 3OOMA 3Q5IA 3W1FA 3BYOA 4CLIA 2VX1A 3QD0A 3Q9XA 3BYSA 2BKZA 3GB2A 3O2MA 2R3LA 3ZZEA 4PDOA 3W2PA 5AM6A 3RI1A 4A9SA 3W10A 2XYUA 3DNDA 1UV5A 3KIOC 3ZSHA 1XH9A 3R7VA 3CP9A 5D11A 3V5QA 4DFUA 4CCUA 2ZV2A 2CCHA 1UWHA 2R64A 3A61A 4H36A 3H9FA 1YHVA 4NT4A 5C1QB 4FNZA 5M51A 4E20A 4DDIA 5L6OA 3WYXA 4B9DA 1YXTA 5M07A 5AX3A 4FSNA 4WNMA 3TDWA 3S3IA 3EWHA 3SXRA 3W0OA 2ITXA 3N4TA 4F99A 4IM0A 3VBWA 3Q53A 4O0XA 4YC8A 1NA7A 4WBBB 4EKLA 2BTRA 2EUFB 2JDOA 3MTLA 3RCDA 2WPAA 5HD7A 1OM1A 4QYGA 4YUQA 3QZGA 4BI2A 3ZEPA 1YHWA 3ORMA 3O8UA 4UWYA 5D7VA 3D5VA 2XKFA 3EQCA 3LFFA 5FM3A 1IR3A 3AMYA 4HNFA 3IW8A 1W83A 3NNXA 3UQFA 4EI4A 3OEZA 3PXQA 2EVAA 4FK6A 3RMFA 3DXNA 4FVQA 3BHTA 4UMUA 4FOBA 1S9JA 4IEBA 2AQXA 4OLIA 2ITUA 2XA4A 2YM7A 1Q61A 2WEIA 4JBOA 3MSSA 1KE6A 3F3TA 4NM5A 3W2RA 4FKWA 3LFBA 4BDDA 3R8UA 2P3GX 3QTZA 5HVYA 5CVGA 3NW7A 4ITHA 2WOTA 4C58A 2PZRA 4HVDA 2XB7A 3R30A 3VS2A 2W1FA 2O64A 3KK9A 5J9YA 2PVFA 4XX9A 2GHLA 3G0FA 2WMAA 4HGEA 3LFDA 3NNWA 3FZRA 4OGRA 5DPVA 2A19B 4F09A 4CQEA 5JGAA 3GEQA 4D28A 2J5FA 1V1KA 4G31A 1RQQA 3QCQA 3BU5A 3BYMA 4DLJA 5IQCA 2Y4IB 2A27A 5CWZA 3QTQA 2XF0A 4FX3A 2WIHA 4G5PA 4WG5A 2PMOX 4OR5A 5EOLA 3OBJA 4OW8A 4E26A 5C8KA 5C26A 2FSOX 2W4OA 4Y46A 4BCNA 2UZTA 2QO2A 4BDJA 3TJDA 3V5TA 3FI2A 3FQHA 4BTFA 3VBQA 2ZYBA 3C4XA 2C69A 4HVSA 5HTIA 2ZAZA 5G1XA 3UTOA 3ID6C 3IGOA 5CTPA 3EYGA 3FSKA 4RPVA 3WF9A 3PSCA 2PTKA 3QZFA 4EZ3A 5DR6A 4KRDA 4AA5A 3KY2A 4DCEA 4F1MA 4MX9A 3P7CA 5LVLA 3UP2A 4FKGA 2FUMA 3NIEA 4MD8E 1OVEA 3L9PA 4BZOA 1MQ4A 3UQCA 1FMKA 4WIHA 2W1IA 4TYHB 1F5QA 3GOPA 4AFEA 4GG7A 1DS5A 4AN2A 5HORA 2BFXA 2QOBA 3CKXA 3W0SA 2VTTA 2BTSA 3U9CA 2QOHA 4LV7A 3HL7A 3HV5A 4KKEA 3P86A 5I3RA 2UZLA 4R3RA 3RNYA 4GYGA 4TYIA 4AS0A 2F57A 4BWPA 2BIYA 4ZS4A 4FEQA 4G1WA 5M55A 2W1EA 5DMZA 4QMYA 3KXGA 5M4IA 3UQGA 3ROYA 5ETAA 5HX8A 2E9PA 3VQHA 1SZMA 3WZDA 3AOXA 5CI6A 5HO6A 2IZUA 4QQJA 3RWQA 2HY0A 4JAIA 5CSWA 2FB8A 3ENHA 3NUPA 4AXCA 1ERKA 1RJBA 3PZHA 4IVBA 4U6RA 3R1SA 3BLAA 5AP4A 3EQDA 4BL1A 4D2PA 4W9WA 5AP0A 4K18A 4KKGA 1ND4A 2Z7LA 3F5UA 5HESA 4GKHA 4LMUA 5EKNA 3R7OA 2VNYA 5DE2A 1JPAA 3TZ7A 4ALVA 4BGQA 1OB3A 3ORNA 2EWAA 4QMTA 3QKMA 3UVRA 5GZAA 4RC3A 3MIAA 5K9IA 3IW5A 3LPBA 4GRBA 5BX0A 4IAZA 5BPYA 4RG0A 4O7NA 5E1SA 2PY3A 3PSDA 3EN6A 5HKMA 4MBLA 4O0SA 1XBBA 4OT6A 1PXPA 2QHMA 3I79A 2Z2WA 3LZBA 4QP4A 5H3QA 5HG5A 4A9RA 2PULA 3LAUA 3HRFA 2BRGA 2X4FA 4I22A 4AG8A 3KCKA 4EOSA 4AXEA 4OTFA 1A9UA 4E4MA 2C47A 1G8AA 4ACDA 4EOQA 4EBVA 3G6GA 5HICA 4GJ3A 4BYJA 5TOZA 2RL5A 3C0IA 3MFTA 1G8JA 3VS1A 2I0YA 5K5XA 2XNGA 3FC1X 2BDJA 5E8VA 3QQLA 2XBJA 3K5VA 4FEVA 4R3CA 5GNKA 3ZH8A 4MCVA 3DOGA 4TWNA 2R3KA 2PSQA 1E1XA 2PK9A 3TZMA 4LOQA 4RJ6A 2UVYA 3ZMMA 3ET7A 2W4JA 1OITA 3P23A 3KMWA 4BZNA 3P7BA 3Q5ZA 4U80A 2OIDA 2OZAA 4X6QC 3R8PA 4ANMA 4F78A 1XWSA 3LCSA 4FV9A 2BAJA 3OW4A 1NXKA 3VWAA 4CQGA 4MXCA 1RE8A 1P2AA 3FQSA 2XK3A 3OXZA 4G5JA 4Q5HA 3EZVA 4GMYA 2WD1A 3MPMA 5CASA 4YU2A 2UZOA 2J9MA 5JT2A 2ITPA 4RVLA 2B9IA 1KOAA 3KXNA 2XRUA 2HZIA 4HPUE 5F9EA 5CQWA 3TACA 3QCYA 5AV4A 3ZUUA 4EH8A 4J52A 3PLSA 1KV2A 3OWKA 5ANGA 4M13A 5DVRA 5AP1A 5D12A 2Z7SA 2A4LA 1SYKA 2PVKA 1QPDA 3SW4A 3UZPA 5IDPA 4YO6A 3AMAA 3ORIA 4EQMA 2ITZA 1YOMA 3L9LA 3NYOA 4H05A 1G5SA 4LL5A 3U4WA 5FTGA 4BDKA 4DHFA 3NW6A 3R8VA