5BYZA

Erk5 in complex with small molecule
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
348
structure length
348
Chain Sequence
TFDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQSLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 7
publication title Discovery of a novel allosteric inhibitor-binding site in ERK5: comparison with the canonical kinase hinge ATP-binding site.
pubmed doi rcsb
source organism Homo sapiens
total genus 120
structure length 348
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5byzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5byzA01
4RWLA 3RCJA 4APPA 4U43A 3VJOA 2YWPA 4U81A 1OL2A 4WUAA 5E8YA 1UKIA 5C1QB 4WOVA 4A9YA 4JI9A 4GIHA 4Q5EA 3AGLA 5EOLA 2XP2A 3NUUA 4OUCA 2R2PA 4DA5A 1OUKA 3ZXZA 3BHYA 4UZDA 2BVAA 1FGIA 1YHVA 1M14A 3FMKA 4GL9A 5EYKA 3V8SA 3G51A 5FBOA 3ZBFA 4E1ZA 4L45A 3PIZA 1Z57A 2BRGA 2NPQA 4PNIA 3HGKA 3KXMA 4B0GA 4FTKA 2BHHA 3RNYA 2QURA 3KMMA 3MH2A 5AA9A 5IQBA 5CU0A 3MA3A 2VX3A 5HCZA 4X6RA 2R3JA 3TZ9A 4E4MA 3V8WA 4AOIA 1GY3A 1XH7A 3V5QA 2JDTA 4MWHA 3R2YA 4ZAUA 5IPJA 3OD6X 3I5ZA 2O2UA 4O7RA 3EMGA 4CCBA 3UO5A 4DG3E 2Y6OA 4RGJA 4YSMA 4LL0A 5IUGA 3T9IA 2QLUA 4A9TA 2IW9A 3SDJA 5CZIA 1WBPA 3H9OA 5BYLA 2GS2A 5E1SA 4EOOA 4DF3A 4O2PA 2YM6A 1XH6A 3ACJA 5K3YA 3F7WA 2UW8A 3W16A 4ANBA 2ZV2A 4MXOA 3VQHA 1H1WA 3FHIA 3DT1A 5CS6A 4RT7A 4XV3A 2F2UA 5A4CA 5HI2A 3KFAA 4BHZA 4AW2A 5D7AA 5BUIA 3C13A 1OPJA 3QAME 4I21A 3LCOA 5LMKC 4C2VA 3EWHA 1H28A 3ZUUA 4DLJA 5CEOA 5ETAA 3AG9A 4O0VA 5LMBA 4USFA 1AGWA 5HO6A 4F0IA 2CSNA 4BBEA 1PMNA 4IZYA 4EZ7A 4AT5A 3F69A 4J52A 3A7FA 5HIEA 5IQDA 4OTPA 3QTQA 3R00A 2HIWA 3Q4TA 3PXZA 3R28A 4TY1A 5GZ9A 4C36A 5J9ZA 1WCCA 2F7XE 3EN4A 4O22A 4GG5A 3FEGA 3TCPA 4DG0E 4PNKA 3HMNA 3UOJA 2R3HA 1V1KA 2QO9A 4GV1A 3FYKX 3CJGA 4XUFA 2R3LA 3FSKA 4KIOA 1DAWA 4GJ2A 3U4UA 5JN2A 1HCLA 4X3FB 5BQ0A 5E8UA 1ERKA 2EU9A 3F3ZA 4YTFA 4EZ5A 3GB2A 2C3KA 2HW6A 3ZEPA 3HP5A 3C1XA 4XNEA 1IA9A 3BLQA 2C5XA 5AP2A 2AUHA 1Q8TA 3ET7A 4PQNA 3OBGA 5I9WA 3CQEA 4BWXA 1PXIA 4FTJA 5BUJA 2XJ0A 2X2MA 5E8VA 2BILB 3VBWA 2CMWA 3L8PA 3NWWA 5AADA 5M56A 5ETFA 5A3XA 2OF4A 4FTQA 3EN5A 4GT3A 2CN8A 3SXSA 1H1SA 4YNOA 1UU3A 4EBWA 3COHA 3EZVA 1OPLA 4O7YA 3V5PA 4IVBA 4ACGA 5IQEA 1KWPA 2UZVA 1DM2A 4ALUA 4Y85A 4NTSA 5F4NA 1W82A 3FHRA 5IQAA 4TL0A 4YMJA 3POOA 5EM7A 3BLRA 4ITJA 5ETIA 3K5VA 2GSFA 2JEDA 4XCUA 5AAEA 3LFDA 5JGBA 4FZ6A 4FTOA 4HYIA 4AT3A 4UMRA 4DCEA 3QTWA 2VO0A 2XIZA 3ATTA 3G9LX 4N70A 2WZJA 4UMQA 2NRUA 4F9YA 4IEBA 3PSDA 5L2TA 4WBBB 3K3IA 4NZWB 3OTUA 4ZOGA 1ZZLA 5EHYA 5CALA 4L00A 4LV5A 3FI4A 5CZHA 2YDKA 2GU8A 4M12A 2R3KA 4MF1A 4EQMA 4I4EA 4ACMA 4RC3A 4QYHA 3DKOA 4X2JA 1M2QA 3E87A 4BF2A 4PPBA 4NW5A 3QCSA 3BHVA 3PJ3A 4S34A 4BCGA 4DH3A 1VYZA 5AIKA 1SVEA 1OUYA 3ZUVA 5BPYA 3QL8A 2EVAA 4FG9A 4G34A 3C9WA 4QPMA 2RG6A 5FXQA 3UNJA 4A06A 3W10A 2QOFA 3NYOA 2CGXA 2GMXA 4PX6A 3QA0A 2JIIA 3P23A 4LOOA 3CBLA 3IW8A 4GK2A 3ROCA 4QPSA 2I40A 5F1ZA 2XM8A 3A8XA 3PWYA 3EFWA 2HK5A 3G2FA 4CZTA 1J91A 3ZSHA 4H3QA 4TN6A 5AP7A 4FG8A 4LMUA 5LXMA 3DJ7A 1YVJA 5J1VA 2XK9A 4WIHA 4MK0A 3CY3A 5DR6A 3O50A 2ZB1A 4I3ZA 2XCKA 2WMBA 4YHTA 3AGMA 3E8NA 4BCIA 2BHEA 3FXWA 4JDIA 3RK7A 4W9XA 3PE2A 3C0HA 3VS3A 4OGRA 4EOPA 1ZARA 4QYFA 2PVMA 3V8TA 4ITIA 4DLIA 2ITZA 4IB3A 4R1YA 3LCDA 4C57A 4IH8A 4ONAA 4F09A 2IZUA 3L9LA 4EHEA 1Z9XA 5JQ8A 5H3QA 3I79A 4FV0A 1U59A 2IJMA 3CD3A 4M68A 5AR4A 5T3QA 3QQFA 3SRVA 5LMAA 3KA0A 4EK3A 4Y8DA 2WQEA 3UPZA 2G01A 3KVWA 4J99A 3NNWA 4FKLA 3MPAA 3O51A 4DT9A 1JAMA 1K9AA 3CGOA 4NH1A 3UNKA 4CFMA 1OKVA 2J9MA 2G1TA 5D1JA 2J90A 2W1DA 5AP5A 3EQPA 3ORKA 1WAKA 3GT8A 3Q4UA 4FODA 3O17A 1JBPE 3FQHA 4UWYA 4LRMA 3ZDIA 4GFMA 5HE2A 4RJ7A 4EZ3A 3EKKA 2PUNA 3DFAA 1XH5A 4A07A 2YIYA 4QT1A 5HG9A 2IZSA 3BHTA 3Q5ZA 4XS2A 4IIRA 3WF6A 1SVHA 3EFLA 1P4OA 4FKPA 2XK6A 4IC7A 3DGKA 2VTTA 1XJDA 1OIUA 2VRXA 4AZSA 1PRYA 4YC6A 3MIYA 1F3MC 2VO7A 3PZEA 4U40A 5HCYA 2UV2A 2PULA 4FL1A 4FUXA 1XBAA 4R1VA 3R8UA 5CWZA 3FXXA 3VUMA 2WMQA 1YXXA 5M08A 3VBVA 3N9XA 5ACBC 2WHBA 2Z7RA 4KBKA 5IG1A 3FKOA 3QF9A 3GQLA 1OBGA 3E8EA 4NL0A 3LLAA 4BDHA 3TN8A 3LE6A 3TV4A 3C4WA 1YI6A 4HVHA 5A4QA 4BGHA 4G2FA 3GXLA 2WMRA 3HECA 3LAUA 3DDQA 2VTHA 3R7GA 5DR9A 4GUBA 3UG2A 4AX8A 4DFYA 3PPJA 2OFUA 3M2WA 3EN7A 3IOPA 2X2LA 3NPCA 4ZJIA 1GAGA 4PV0A 1Z5MA 4J98A 3MH3A 4FSNA 1URCA 2WTJA 3MYGA 3UIMA 4FL2A 5FRIA 3BKBA 2UZLA 4YGAA 3WF9A 4YJOA 3R1NA 3E92A 3PSCA 4FV9A 3LXKA 1H26A 3BZ3A 3BWFA 4BWKA 5EDQA 2ZMCA 4AA5A 5AUTA 1REKA 3HRFA 3ZH8A 2VWYA 3TIYA 4QP6A 4GU9A 3IO7A 5HKMA 3H4JA 1QPCA 2PVJA 4BC6A 2XVDA 4MYGA 4UYAA 3HUBA 2DS1A 4IX3A 4KBAA 3ID6C 4MBIA 4F6WA 5AUWA 2ITNA 3BHHA 4IFGA 4AW1A 5L2WA 4ANLA 3LMIA 4O7VA 2YIWA 1ND4A 2WQNA 3E88A 4H3PA 3CE3A 3NVMB 4E5BA 3MVLA 4I6BA 5L8LA 3DAKA 3IQ7A 4JR7A 4HVDA 4Q9SA 2GNLA 3Q5IA 4A4OA 3RZFA 1STCE 3DZOA 2R7BA 3FUPA 3PYYA 1ZYJA 3QKMA 2F2CB 2VTSA 3F5XA 3LCSA 3R22A 4IWOA 3R8VA 4JX3A 3MY1A 4CKRA 1PXLA 3LFQA 3DB8A 3I6WA 3WF5A 2R7IA 4RIYA 5KE0A 1ZOGA 3T3VA 3SC1A 3NEWA 2H96A 5KHWA 2XK7A 4J7BA 1Q3DA 2WO6A 4CG9A 1Q99A 5GJDA 3TV6A 2C5VA 1VJYA 2OJJA 4EOKA 4M14A 2QG5A 5HICA 5JEBA 2BCJA 4M84A 3VUDA 4IZAA 2X7OA 3DS6A 3AC3A 3O8PA 3P5KA 3Q9WA 1G3NA 3OCTA 5HE0A 4BDIA 4C4GA 2VNWA 4I93A 1FQ1B 3C7QA 2YLFA 3G5DA 2QOBA 3MY5A 1ZYDA 5JMSA 4GH2A 4D2RA 4WKQA 3QC9A 4WRSA 5TOZA 5CEKA 2XIRA 4E5AX 5C9CA 5HVYA 4FMQA 3PLAE 3LIJA 3HKOA 4FTLA 2QU5A 5EI2A 4DT8A 3TZMA 5JFXA 3EKNA 3I0QA 2YM5A 2J0JA 2XKDA 5FP5A 3ZBXA 4V04A 4QQJA 3RI1A 4S33A 1OB3A 3RAWA 4O7SA 2BKKA 1XBBA 3EN6A 1VR2A 5HBEA 3W2RA 3C4XA 4NCTC 3UG1A 1U46A 5A6NA 1XH4A 2O3PA 4OW8A 5IDNA 2QR7A 1CKIA 4EORA 4EK6A 3TUCA 3Q6UA 4OTFA 5LQFA 3S1HA 3DBCA 4FTTA 5FQDC 2V55A 1FVTA 5I0BA 2VTNA 1YDTE 5IUIA 4RVKA 3QRUA 3K2LA 3UO6A 2IG7A 4CZYB 4EHZA 3UQGA 3G33A 4R3RA 2QOLA 1W0XC 4R8QA 3UQFA 4RIWA 2JFLA 5ANEA 5HO8A 4AP7A 4IADA 4BIBA 5J7BA 3Q4CA 3QD0A 4YJVA 2W7XA 2R3OA 2IVVA 4PP9A 3MS9A 2GPHA 4TXCA 4QPAA 2Q83A 2EXMA 2NO3A 3MGYA 4NIFA 3F2RA 4JS8A 3EQRA 2ZOQA 3GFEA 2IW8A 5TKDA 4JRNA 3N4VA 1ZMWA 4BYJA 1GIHA 2R64A 4B99A 4FNZA 5J5TA 3D2IA 4U42A 3FLSA 3PIYA 3TUDA 3MJ2A 3V6RA 3QQGA 4UB7A 4NM7A 3UVRA 4X2GA 3HV6A 4II5A 5H2UA 2HXQA 3PPKA 3QX2A 4YJNA 5BVOA 2HZNA 4O0UA 4F70A 4XP2A 3A62A 3ROYA 4LGHA 4ACDA 3IKAA 4RFZA 3UJGA 5B2MA 5CXZA 3VJNA 3KXHA 4FYOA 4C35A 3M1SA 4UEUA 5AAGA 3TG1A 3O8TA 3IK3A 2W1FA 4L7SA 4KSQA 4RQKA 4QNYA 4J96A 3U4WA 4DGLC 3NDMA 4X3FC 5CAPA 3Q53A 1FVRA 4BCJA 4D1XA 3V5JA 3T3UA 4BTKA 3R83A 4CGAA 4AACA 1XKKA 5L6PA 5GINE 1JPAA 4J53A 4XOZA 5C8MA 5JFWA 4IAZA 3UPXA 2ZM4A 4B7TA 4ANQA 2XNGA 1OIYA 2PUPA 2EB2A 3KF4A 3ODYX 4RJ4A 2R3MA 1PKDA 4FBXA 4DFNA 2XEZA 3DFCB 4UZHA 2W5BA 3P1AA 2YCQA 5HU3A 2PMOX 3G0EA 2C69A 3PJ8A 4UBAA 4IVDA 4WNKA 3PXRA 1X8BA 2REIA 4Y95A 1DI8A 4HCTA 2X7GA 3DBDA 4TWPA 4K0YA 4M66A 3DK7A 4G9CA 1CMKE 4JG7A 1ZYLA 4USDA 5ICPA 2GNIA 5E8XA 3LOKA 1CTPE 3D4QA 1BLXA 5HHWA 5FEDA 4G5JA 1Y91A 3U87A 3TDVA 2ITPA 3R04A 2J0MB 4JLCA 5K4IA 4ASDA 3C0GA 2XUUA 5HLWA 2JKQA 4DFXE 4Z7HA 2YITA 1WFCA 4UMUA 5AV4A 2OXYA 1KV2A 2R0IA 2VGPA 2CGWA 4TW9A 2ITVA 4FL3A 3IS5A 5FD2A 4L42A 3ZTXA 4J1RA 3COKA 3L8XA 3RVGA 2X0GA 1J1BA 3FKNA 4AZVA 3FZPA 4D9UA 4AGCA 3M42A 3PSBA 3OY1A 3OUNB 5AAFA 1O6YA 4IANA 1WVYA 3BV3A 2PZYA 5HOAA 2ZYBA 3CC6A 4FV1A 5LVNA 1G5SA 2P4IA 3GC0A 5FTOA 4FKQA 4LI5A 2W9ZB 5DI1A 2GQRA 2QC6A 1K3AA 4I24A 4OT5A 4GS6A 3OCBA 1IAHA 2P33A 3SLSA 4BKYA 1H01A 2QOKA 2VTIA 5HESA 4BZNA 2RKUA 4AE6A 4U97A 4WUNA 5AP6A 4RX7A 4JOAA 2UVYA 4IC8A 4K77A 2J5EA 4NSTA 2ZJWA 1J7LA 3NS9A 3Q52A 4C37A 1ZAOA 1OZ1A 5M44A 4AOJA 1IRKA 3QUEA 4TNBA 4YR8A 1QCFA 3DXQA 4YZMA 4MD8E 5B0XA 1Y6AA 3H30A 5EFQA 3AC1A 1Q24A 4J8NA 2B4SB 4UXLA 3C4ZA 2RL5A 3R7UA 4CFXA 2A1AB 1HOWA 4IXPA 5IH5A 4ZZNA 4DHFA 2UUEA 5AUYA 3FC2A 4FTIA 4UXQA 4I4FA 4JQ7A 3P7CA 3QC4A 5ETCA 4C7TA 2QI8A 2XM9A 4DTBA 2KTYA 4BYIA 5IU2A 4O6EA 3PUPA 5KNJA 5KBRA 5LMKA 4PDOA 5AM7A 1F0QA 2GFCA 4BHNA 5BMSA 4MTAA 4CLIA 4UALA 5IUHA 4GW8A 3C5IA 4H39A 3TM0A 4I5MA 4XG7A 4ZK5A 4IAKA 4L44A 4QNAA 5I4NA 3QRKA 5KZIA 4C34A 2YFXA 3FAAA 1XO2B 1YRPA 3QCXA 4IB5A 4GK4A 3E7VA 3R8MA 5KX8A 4QQTA 3LW0A 1YXUA 1TQPA 4FKRA 3W2SA 3UGCA 4W8EA 1OKYA 1DAYA 3KXZA 3HAMA 4ORKA 4R7BA 1GNGA 1SYKA 2OJGA 5J79A 3O7LD 5C26A 3JPVA 4EKKA 5HBHA 3HDMA 3W2PA 2P2IA 2PZPA 3BX5A 3I4BA 5EW8A 3ZS5A 1JSVA 3MVJA 3PJ2A 4EQCA 1ATPE 5I3RA 4EH9A 3ZLXA 1ZMVA 5HNGA 3KQ7A 4IM3A 2XNBA 3B8RA 2C6OA 1I44A 2X39A 2OW3A 2BDFA 4HCVA 4LGDA 4FT9A 3FMLA 4TPTA 4Z16A 3ZU7A 2BDWA 3F3VA 2O63A 3OHTA 1FINA 2IWIA 1NA7A 3NAXA 3P7BA 3UYSA 1WBSA 1OI9A 2JDVA 3LHJA 4HW7A 3MWUA 4CQEA 2HENA 4CD0A 4CV8A 4G6NA 2YACA 3DJ6A 1MQBA 4YHFA 3VHEA 1QMZA 3KN6A 3HA8A 1XR1A 4YUQA 2ZDUA 3TJDA 1IAJA 3PPZA 3TNHA 4BCPA 3QQKA 5IQFA 3EH9A 3PJ1A 4BVUA 2JBOA 3HL7A 3PY0A 2QO7A 3Q3BA 4FT3A 5CANA 3OXZA 4ZS0A 3EN9A 3PDTA 4U80A 5EI6A 4CRSA 1PXPA 2PK9A 4M3QA 4BGGA 3HV7A 2QONA 4EOMA 3RPVA 4J97A 4FEVA 3QYZA 4JQ8A 3JS2A 4RFYA 5B7VA 4H05A 4IB0A 4CMUA 4CMOA 2PY3A 5M07A 1XWSA 2XRUA 4U45A 5IZFA 5D9HA 2GQGA 2PVNA 3MPMA 4DFZE 2X7FA 3QRIA 4EOIA 3GCVA 4MHAA 5DR2A 3QX4A 1FOTA 3FLWA 5LCJA 1PXJA 2J0LA 4Z55A 5IEYA 3Q2JA 5EYMA 3SD0A 4ZTLA 3RBWA 4M8TA 3NUPA 4AT4A 3C0IA 3ZFMA 2C5YA 2WQMA 3FC1X 1IEPA 5IQCA 1YHWA 2W1HA 1GZNA 3UMWA 5EDRA 1PJKA 3BGZA 1BL6A 4R3PA 5CT0A 3L8SA 4F9WA 3FMNA 3P7AA 4FVQA 3TJCA 3ZXTA 5EQEA 2XJ2A 2R3QA 3H9FA 5DYJA 3AT4A 3D7TA 4PUZA 5IEVA 3DAEA 4W8DA 3S3IA 3UE4A 4PMSA 3JY9A 3VC4A 5IH4A 3F6XA 2C6DA 3E7OA 1P4FA 4M13A 4XP0A 3RCDA 4BIEA 2C0OA 3NUAA 5J5SA 2XK8A 4ZTQA 3BV2A 5KMLA 4KABA 5AR8A 5K9IA 2VV9A 4Z7GA 3MESA 3QKLA 4QMQA 3QZHA 4O0WA 3BYSA 4OTGA 3ZFYA 4XG9A 4AN3A 4BI2A 3S0OA 2BRMA 4AQCA 5A9UA 4G9RA 2PUUA 1W98A 2CKQA 3UYTA 2YM3A 4FKJA 3DY7A 1OPKA 4EH5A 1H8FA 2Y9QA 4TYHA 1ZY4A 5CU2A 3A7JA 3IECA 5K5XA 3KGAA 2YAAA 4C2WA 1UWHA 4IACA 1E1XA 4G31A 4P4CA 4X0MA 5EDPA 3TV7A 2PPQA 2Y4IB 3FQSA 3AD6A 1H27A 3GOKA 4M15A 4N4SA 4O2ZA 4YJQA 3UTOA 5L2SA 1YWRA 3E3PA 3E8CA 2VTQA 3GU5A 1B38A 2EXEA 3LFNA 4MF0A 4CLJA 2E9NA 1MUOA 3PWDA 3OW4A 3MI9A 2UZDA 3COMA 2GQSA 2OGVA 3IGGA 1KV1A 4DG2E 4IVCA 5CEQA 2WTCA 1XQZA 1WVXA 2PVLA 3AXWA 3D15A 4MVFA 2F57A 4ZTNA 3GCQA 4DFLA 3KMUA 5DBXA 5BNJA 5J1WA 3TI1A 4CCUA 4O96A 3P86A 4IQ6A 2CKOA 2DYLA 2QHMA 3FQEA 5M06A 5ANDA 3PXQA 3NSZA 5AV2A 5GHVA 1W84A 5JRSA 4IDTA 4U9AA 4S32A 3LM5A 3UOLA 4UWBA 3TNIA 4MBLA 4OR5A 5KZ0A 2VO3A 4ZSLA 3W55A 2F7EE 4BDBA 4DH1A 4O7TA 2HYYA 5EI8A 3JY0A 4MNEB 3R1QA 3OF0A 4QP7A 3R7EA 3RKBA 3SKCA 5JK3A 4XX9A 2JC6A 3AMYA 1PMEA 3ACKA 3DA6A 3MTLA 5BVDA 2ETRA 5HQ0A 3KMWA 3W2CA 4XBUA 3G90X 4IX5A 2W4JA 1SMHA 4UYNA 3HV4A 4F63A 5E8ZA 2G9XA 3CTQA 4I5PA 2ITXA 4PRJA 4ARKA 2C6TA 5BVFA 2E2BA 2ETKA 2RF9A 2ZV8A 2IZTA 2QODA 4E6DA 3ZSGA 1KUTA 3PG3A 3DZQA 2JDRA 3FMJA 3W2QA 2A0CX 5JH6A 3RP9A 4JNWA 1R1WA 4MD7E 2QQ7A 4W9WA 4YLKA 2SRCA 2W1ZA 3PVUA 3ORXA 3QALE 1UU7A 3HZTA 4MAOA 4FR4A 5IA3A 4MD9E 1UNGA 2ITTA 2QOHA 2VGOA 3VS5A 4LMNA 4HZSA 5I9VA 5T68A 1RW8A 3GUBA 3JVSA 2JBPA 5CXHA 3G6HA 3VUHA 5A54A 3F5UA 3RJCA 4DE4A 4DEIA 4W4WA 2W99B 3CEKA 3OXTA 4A9UA 5KMKA 4BCNA 4BDGA 5HG8A 2OH0E 3LXPA 4DAWA 4CYIA 5I3OA 4HJOA 4FX3A 3FY2A 3UIXA 3U6IA 4EONA 1H1RA 5TT7A 3UIUA 4ASEA 2WMSA 4X3JA 3AD4A 3F5PA 4OTDA 3VBTA 3D7ZA 1V0PA 3DNEA 2UW7A 2X8DA 4CTBA 4MWIA 3QD3A 3ZUTA 3N4TA 2OSCA 3QTIA 4KBCA 3ZYAA 3OBJA 3SW7A 1O9UA 4EHGA 2G2FA 4JDKA 4HZRA 4ZMEA 3ZZWA 2PVFA 4GU6A 3GU4A 1SNXA 3W1FA 3BYVA 3OT3A 3EQHA 3JVRA 3E64A 4TWNA 1PXKA 1TQIA 4RRVA 2UZUE 4XG6A 1J7IA 4DEBA 2QD9A 2W06A 2JITA 4FV6A 4TT7A 3MDYA 3SW4A 4AA0A 5KKRB 4PMMA 2JKKA 3ZDUA 4HYHA 5EG3A 4BL1A 4BN1A 1Q8UA 5LVOA 3IW5A 4BCKA 1CM8A 4TRLA 2YISA 1KE8A 3CJFA 1LEZA 3UVPA 1CDKA 4KIKB 3LFAA 4UY9A 5AV3A 4LRKA 2ZV7A 1R3CA 2Y8OA 4RJ3A 4C61A 5ITAA 4ALWA 3CKWA 4WD5A 2ZDTA 4LOPA 3R2BA 3LJ2A 5IQHA 4LUEA 4G3EA 5EW3A 3NW6A 3SXFA 3DK6A 1GZKA 5IEXA 3B8QA 4FC0A 3TXOA 1B39A 2RFEA 3WF7A 3EQCA 3D83A 4V01A 5C8NA 4E5WA 4JDJA 4Y73A 5HORA 4NKSA 5HVKA 1JKSA 1LPUA 4HYSA 3KULB 2JDSA 4NCTA 4QTAA 4Y83A 4FEWA 4EH3A 3V3VA 4BGQA 4MXYA 1QPEA 1Y8YA 3AOXA 4YPDA 5AP0A 3R8ZA 2W1EA 3E63A 1U5RA 4JX7A 5HG5A 5IA5A 4DEAA 3MH0A 5M51A 5J87A 4OBQA 1ZY5A 5CQUA 4B8LA 2A27A 3ANRA 3FI8A 2O0UA 2YERA 5HO7A 1M2PA 4RJ5A 4MQ2A 5F94A 3I60A 4BWPA 3GU7A 4KA3A 3DXPA 3A8WA 2PZIA 2ITOA 3NCGA 2FYSA 3ZRLA 3K54A 2IVTA 2CCIA 3REPA 4EOQA 3KREA 3NR9A 2R5TA 1ZMUA 2CKPA 3RALA 4ENYA 4GVAA 4YZCA 4EEVA 3LM0A 1J7UA 2QNJA 3ORLA 3G9NA 4E4XA 1OIRA 3NVKI 4GT5A 3SXRA 2V5QA 1ZYSA 1H4LA 2Z7SA 4K18A 5HTIA 3BIZA 4FSZA 3FLQA 4RVMA 3QZIA 2X8IA 5EKOA 3VF8A 2Y6MA 2ERZE 2HZ4A 3V6SA 5HE1A 3RK9A 4HGLA 4BKJA 4HVSA 3D2KA 4CT1A 2OBJA 4ERWA 3KN5A 3HRBA 3R7VA 2R0UA 4M97A 2LAVA 1ZOHA 5LVPA 3D5WA 3EZRA 4NFMA 4QMPA 4A9SA 3GVUA 5E8WA 3ORMA 4X3FA 3ZFXA 4BTJA 4YTCA 2IN6A 2RIOA 2Z8CA 5FG8A 2H6DA 3ALOA 1WBWA 4DEGA 3O96A 4X7QA 4ZY4A 5E8SA 4YSJA 4KS8A 4FKTA 4N6ZA 4M7IA 4U3YA 2WXVA 4MBJA 3NRMA 2J4ZA 2ESMA 4UV0A 4BR3A 5HLPA 2P55A 3HP2A 3UBDA 2VWUA 4HCUA 4MQ1A 2P0CA 3FZRA 4QP1A 5LVLA 4DBXA 4U0IA 2C1AA 2BROA 3II5A 2JKOA 5C4LA 2CPKE 4L43A 2B1PA 3GCPA 5AP4A 4FNYA 4RLKA 5BMMA 2FO0A 3A2CA 4ZP5A 3L8VA 3OC1A 4FKWA 4FZ7A 2YDIA 4LL5A 4IAAA 4HYUA 2I6LA 3C4EA 3VRZA 2BR1A 3DBFA 3PY1A 4XOYA 2XNEA 3HNGA 2ZV9A 3BU3A 5EKNA 3IDCA 4RFMA 3EB0A 1MQ4A 2C6EA 4MNFA 3WZKA 4DTAA 2C47A 2OO8X 5A14A 3U54A 3R63A 2JGZA 3SX9A 3VUGA 3ZZEA 2QKRA 2VN9A 2VWXA 3BBTB 3WYXA 5HTBA 4IWDA 5ANIA 3L9NA 3DTWA 2ZM1A 4K11A 4X2FA 3O0GA 4L3PA 3PRFA 4O91A 1BYGA 4AXAA 3DQXA 1WBTA 4FICA 4QQ5A 5DEWA 4FZAB 5DPVA 3IGOA 3KULA 2BZHB 4U79A 4F0GA 5GZAA 5IH6A 1Q61A 4NJ3A 3EFJA 4IMYA 5BVWA 2ERKA 3FZ1A 2VTJA 3D5XA 3FZSA 2YJSA 5L8JA 3BELA 4MEDA 5DN3A 3SGCA 4QP4A 1V0BA 3R21A 3KC3A 4FSMA 5BVKA 3QRJA 4LGGA 4YTHA 3EYGA 3VIDA 3P79A 1GOLA 4XG4A 3SA0A 4FKIA 1YQJA 3FZOA 4OLIA 4BDJA 3G15A 2NRYA 3F66A 2WQOA 3ZONA 2ZM3A 3EHAA 4DC2A 1OGUA 4O7LA 2JIUA 3WE8A 4FSRA 2C5NA 4JRVA 5AUXA 4QRCA 5L6WL 2CNVA 4S31A 3U9CA 5EHLA 4PF4A 3KB7A 4BKZA 1TVOA 3PA5A 4OTRA 4FF8A 2FSMX 2C5OA 3NUYA 4O0RA 4KKEA 4G3DA 5CU4A 5IMXA 1JOWB 2Y4IC 2Z2WA 3U51A 5CY3A 5FXRA 1M17A 5FBNC 2RFNA 1ZRZA 5CEPA 1TKIA 2PE1A 4C0TA 4JL9A 4ZJJA 2BAJA 3BEGA 1PYEA 3F9NA 3VUTA 4OBOA 4F08A 2VWWA 3QTRA 3GI3A 4YO6A 3BE9A 3QCQA 3LMGA 4GK3A 3SOAA 3UZTA 5H8BA 2VO6A 3VS0A 3D5VA 3ENMA 5I9YA 3BRBA 2BZKB 3FE3A 3LKMA 4YBKA 1OECA 3HV3A 3OOGA 4M67A 3ULIA 4ZSAA 4ASXA 2OKRA 2BFYA 3QLFA 2VTPA 2OIDA 3DTCA 3KY2A 3AQVA 4PP7A 3VRYA 3QQUA 5CQWA 2BPMA 3NW7A 4FV2A 3RPRA 3RZBA 2HAKA 4ZLOA 3DKCA 3R1YA 3QFVA 3PVWA 3TWJA 2FSTX 2OXDA 3I1AA 2GCDA 4EOLA 2CNQA 3SG8A 4XMOA 3QD2B 1U54B 3UC4A 4O7ZA 2ZB0A 4RC4A 3ZLWA 3CSVA 3HDNA 3VW8A 4BCOA 2PMIA 4LM5A 3RGFA 1ZYCA 4ZTMA 4YNEA 2Z7QA 4DEHA 5FUTA 5DWRA 3KVXA 3ZMMA 3DBEA 3F7ZA 3NZ0A 4IJ9A 4G5PA 4F7NA 3QGYA 3PRIA 5I9UA 3GGFA 3GP0A 3SV0A 4IAFA 2XF0A 5EM6A 3HVCA 3WOWA 4QD6A 3LQ3A 4BICA 5DT3A 4ZSGA 2A19B 5FGKA 5TF9A 4HGSA 5IKWA 5ACKA 3O23A 3FYJX 1YXTA 4YJUA 1GZOA 4F99A 4HPTE 2X6DA 3ERKA 1I09A 4F1MA 5AR2A 1IR3A 2XS0A 5AP1A 3QTSA 5CF5A 3MB6A 1T45A 4GVJA 4MXZA 3OWJA 3ZO1A 4V0GB 4XLVA 4FT7A 3LJ0A 4JR3A 4E26A 5M4FA 3HMPA 3TNQB 4FT5A 4XG2A 3BI6A 1H08A 3CIKA 4DYMA 4UX9A 3P78A 2HCKA 4ERKA 5FLFA 4MXAA 4FNWA 2XA4A 4Y5HA 4CXAA 3GCSA 3LXNA 3WIKA 2R3PA 4DITA 4KD1A 4BTFA 4TNDA 4HVIA 3THBA 4DGOA 4P7EA 4AGUA 4JT3A 5J7HA 1UA2A 2J0KA 1OM1A 2YAKA 3AC4A 3BWJA 3QZFA 2HZ0A 4YJSA 3FXZA 3OG7A 5JGDA 3Q96A 3VF9A 4O0XA 3QWKA 3OCSA 2UW9A 3LFBA 2UW5A 4ZS4A 3U8WA 4XJ0A 3QA8A 4FKGA 2GS6A 2A4LA 3S2PA 4AW0A 1FMKA 1NVSA 2V22A 4BDFA 3A61A 5D41A 3HAVA 4M69B 5L2IA 4BDCA 3DB6A 3IOKA 3BGPA 3KK9A 3KRLA 1ZOEA 2ITYA 5M53A 3PP0A 1DI9A 1UWJA 3PE1A 3BPRA 4EL9A 4C4EA 1UNHA 4GIIA 2OLCA 2OJIA 4AZFA 5CASA 5DHJA 4L52A 2Z7LA 5EHOA 5FM2A 2PZ5A 2FA2A 5L2QA 3FPQA 4MX9A 5KKRC 1TQMA 2YHVA 3CS9A 4QYGA 5CAOA 2HELA 4NM3A 4O81A 3GQIA 1Y6BA 1PXNA 5H9BA 3LPBA 5G6VA 3CD8A 1OKWA 3FL4A 1PMUA 2WIPA 2W4OA 4RQVA 4ZMFA 4WG5A 4EH4A 3QUPA 1VZOA 5BYZA 4I6HA 1LUFA 3PIXA 4YZ9A 3AC5A 4YP8A 2JAVA 2JD5A 3LXLA 3F82A 3GEQA 4LUDA 2WMUA 4XV9A 2BIKB 3UNZA 3S00A 2CDZA 4G17A 2X4ZA 5DA3A 2RSVA 5DLSA 4EWQA 3CCNA 3L9MA 4U8ZA 4CKIA 2CLXA 5A4EA 3E62A 4M0YA 2W4KA 2X6EA 4O0TA 4CFVA 3F3WA 5D12A 5D11A 4D58A 1YI4A 4DH7A 4RA5A 2E9OA 4K6ZA 1YOJA 3TL8A 4OTQA 5TO8A 4DEDA 5D10A 4FSUA 2WTVA 5BYYA 1PW2A 1RQQA 1UNLA 2W5HA 2BKZA 4APCA 3QU0A 3ANQA 1Q3WA 4YJPA 5IA0A 2AC3A 2GFSA 3VO3A 3QXPA 3QQLA 2WFYA 5ANGA 3DBQA 3MV5A 4MCVA 4N6YA 1SZMA 4FGBA 2WU6A 2PWLA 4YJTA 5A6OA 2EUFB 5DRBA 3LJ1A 3KRXA 3MTFA 4IX4A 2W17A 4R7HA 4GRBA 4ZLZA 2HOGA 2C3LA 5E1EA 4PY1A 5CT7A 4C59A 3DLZA 2VWVA 4R7IA 4EH2A 5K0XA 5L8KA 5C27A 4MKCA 3LMHA 4Y72A 2OICA 1SVGA 4QMMA 3KL8A 3KXGA 4CFFA 2ZMDA 5FTGA 3IDBA 3I7CA 3ZO4A 2W05A 4C8BA 4KUJA 4FNXA 2G2IA 3PVGA 5DT4A 4QMSA 4BZDA 1YI3A 5M4IA 4FV3A 4CT2A 4U6RA 5IQIA 3R6XA 5KBQA 4DH8A 4QOXA 3W32A 2BRHA 3NNXA 1WMKA 3FLNC 3BBWA 3BQCA 4V0GA 1S9JA 2CGUA 3DOGA 3MFUA 2YZAA 3VAPA 3V01A 4C4HA 4PMTA 3VS1A 4KKHA 4DH5A 5M09A 4EC9A 4FIJA 3FJQE 3QHRA 3QXOA 2PTKA 5AUZA 3VS2A 3Q04A 3EL7A 3R0TA 3SOCA 4E4LA 4FEXA 1OKZA 2F9GA 4RC2A 3B2TA 1HCKA 4D2PA 4IM0A 3CQUA 2X4FA 3JUHA 5C03A 4YPSA 2QO2A 2BRBA 3GFWA 2YZLA 4K8AA 5AUUA 4NJDA 4F6UA 1LP4A 2VTOA 4D1SA 4GG7A 3WI6A 2XNOA 4GJ3A 5H8EA 3MIAA 3K3JA 4CQGA 4EOSA 2J51A 4FOCA 4TWOA 2GNFA 3OS3A 3UZPA 3D0EA 4AA4A 3EQBA 4E8AA 1Q97A 2WMXA 3ITZA 4K9YA 4QTBA 4M69A 2ITWA 3W18A 3PFQA 3W33A 5A46A 5DNRA 3SQQA 4BZOA 4FKSA 2WTWA 1L3RE 5DIAA 2XJ1A 4BCFA 1QPDA 5BUEA 3QUDA 3A7IA 1O6LA 3N4UA 2XBAA 5GJFA 3R30A 3RM7A 2YM4A 2UVXA 3NYVA 3UVQA 2HY81 4BDKA 1Q41A 4XV2A 4P5ZA 3BYUA 5CSPA 4D4VA 4QMYA 4U41A 3KXXA 4EK8A 3CGFA 3HMOA 1O6KA 3QKKA 1OL6A 1W7HA 3B2WA 2XNNA 3VUIA 2VU3A 2JDOA 2H8HA 2QR8A 5IISA 4AGDA 2WEIA 1REJA 5CSHA 5CVHA 2BIYA 1H1PA 4EK4A 4RLLA 4FIIA 1ZZ2A 4JXFA 3KXNA 2JIVA 4G6OA 4E7WA 2PYWA 4D5KA 2WTKB 2Y4PA 3FMDA 2IW6A 3C4CA 4L3JA 5AWMA 2VTRA 3CXWA 2WNTA 2WMWA 1M7NA 5L4QA 3ORPA 1RE8A 2FSOX 4ANSA 3IW4A 4YLJA 4EQUA 4F64A 3OT8A 1S9IA 2XBJA 2XNMA 4GMYA 3ZRMA 3EYHA 3MN3A 4ZY5A 3VUKA 4BBFA 3PVBA 4NW6A 3RTPA 2VD5A 4CFNA 4F1TA 2RFSA 3RK5A 4RVLA 1V0OA 4RG0A 2PMLX 4CEGA 2XH5A 2E9VA 3KCFA 5LOHA 3ATSA 1BUHA 4FTCA 1OMWA 3ORTA 5FP6A 5CEIA 4QYYA 5KMMA 3FPMA 3W8QA 5GZ8A 1YOMA 4RWIA 2DQ7X 5JFSA 1Q4LA 2B55A 2XEYA 4AGWA 4QMWA 4Z3VA 3OCGA 2GTMA 4AZWA 1BL7A 2IVUA 3F2NA 2YWVA 2KULA 2J50A 3OMVA 4RX9A 4D55A 4B9DA 4WRGA 3UC3A 5A4LA 2OF2A 1B6CB 3PZHA 4Z9LA 3C50A 5EOBA 3JR1A 5CF6A 4MXCA 5IMEA 5CAQA 2OG8A 4JAIA 1H00A 3TNPC 3ZLSA 3MY0A 4C62A 4ZSJA 3WYYA 4QP2A 4EYMA 2X9FA 1BMKA 5DMZA 4IVAA 3L9PA 4JG8A 3RAHA 4C3PA 3FDNA 4FGRA 3OOMA 5FEEA 5CAUA 4PMPA 3RWPA 3E8DA 4YLLA 4FZFB 3LFSA 5C8KA 2C4GA 5CLPA 4KINA 3DAJA 2PL0A 2YN8A 3FL5A 5EH0A 3CP9A 2BUJA 2GHGA 4WSYA 4C3RA 4YC8A 2VNYA 4GUEA 3OWPA 4JIKA 5AJQA 1XH9A 5IA2A 5C01A 4F9BA 4RWJA 4XH6A 4XG8A 1YHSA 3NNUA 4LYNA 4I22A 4DINA 2UVZA 4RA4A 2W96B 3NIZA 1KE7A 4QMNA 4YURA 3LFFA 1XH8A 2XYUA 4R5SA 3V04A 3KU2A 4DFBA 1KE9A 2BRNA 3O7LB 4ZXTA 3ZCLA 5AP3A 4FG7A 1YXSA 5B2LA 2UW6A 5HIDA 2W0JA 2UZNA 5EYDA 2PSQA 4O7NA 4BRXA 1PMVA 4C4FA 3HA6A 4I1ZA 5I5ZA 2DUVA 3C4FA 5GIPE 3H3CA 1KOBA 4E93A 3IDPA 4J95A 4JBVA 2XZSA 3OWLA 1QPJA 4IB1A 4EKLA 3H9RA 4ASZA 2X1NA 3MJ1A 4ANMA 1P2AA 2WD1A 2XRWA 4FIGA 2CLQA 2F49A 3ZM4A 3OWKA 1YDRE 2VTAA 3CPCA 4AG8A 3AC8A 3O8UA 1EH4A 3V5TA 4D1ZA 5E9EA 4AFEA 4JBQA 4TYGA 2GDOA 1YOLA 4KS7A 2PVYA 3LCTA 2W9FB 3EQFA 4TYEA 3UQCA 4QQCA 1YDSE 3HMMA 1M7QA 3DQWA 2BAKA 2F4JA 2OJ9A 2EWAA 4PWNA 4YZBA 4E6AA 4YO4A 2V7OA 1YW2A 5HU9A 3I5NA 3AMBA 1LEWA 5JZNA 4C4IA 3VS7A 4BCHA 4HVGA 3GC8A 3OROA 3NGAA 1Y8GA 3F3UA 5KCVA 3R9RA 4I41A 2VAGA 5HLNA 4O38A 1WBNA 5J95A 1AQ1A 1PXMA 3VN9A 5CF8A 4D9TA 4WSQA 3RPOA 5DE2A 3POZA 5K5NA 4D4YA 5E7RA 4AUAA 4NT4A 2XK4A 3R9DA 3SRVB 4BDAA 1WBOA 5CVGA 3TNWA 2YJRA 3A4OX 5HIBA 2YCRA 2ZAZA 3ELJA 4G3GA 2J7TA 4ZTSA 4F7SA 3ZOSA 2E9PA 3OFMA 2WOUA 3BLHA 4KAOA 3I6UA 2C6IA 3RHXA 2VUWA 2WIHA 4OT6A 3VS6A 3Q9XA 2QHNA 3I0OA 4EOJA 2UZBA 4BI0A 4KB8A 1L8TA 4I5CA 4ZSEA 5DGZA 5L3AA 2PE0A 2NNWB 2B9IA 4GFGA 2B0QA 4CNHA 3WE4A 3ORNA 1XBCA 4F7LA 4O6LA 2G2HA 1R0PA 2ONLC 3UDBA 5HBJA 4ZZMA 4RZVA 3OEFX 5AM6A 3P4KA 3RAIA 2CCHA 3KK8A 4AE9A 3QCYA 3MSSA 3EQIA 4FYNA 2R3FA 3BCEA 3JYAA 2QOCA 3I81A 2XIXA 3R71A 4PL4A 2CGVA 3DU8A 3ULZA 4R77A 3UOHA 4RIOA 1ZWSA 3U55A 4XLIA 4IHPA 2I0HA 4IWQA 3ZLYA 1A9UA 2GNHA 2ZVAA 3VW6A 1Q8WA 3ZO2A 1GIJA 3OEZA 4AZEA 4CMTA 2BFXA 4CZUA 4XYFA 2I0VA 3FI2A 1H25A 3PP1A 2Z02A 4K1BA 3S4QA 5KMJA 4JDHA 3MFRA 4FV7A 1FMOE 5M4CA 4C3FA 5BX0A 5LWMA 2PUIA 3EL8A 4RIXB 3QLGA 4I6FA 3ZC6A 3D9VA 3FMEA 3NUNA 3VULA 2FVDA 4BY9E 3ORIA 2XNPA 2YCFA 4PDPA 1UV5A 2QOQA 2W1IA 5F95A 2QVSE 3KF7A 3WF8A 1GIIA 1URWA 3NX8A 4EBVA 3LQ5A 5HE3A 2WEVA 1FVVA 4TTHB 3GCUA 4YHJA 4ZLYA 4H36A 1PY5A 2EXCX 4O21A 4YZNA 1H24A 4ZJVA 2ACXA 4KIQA 3A7HA 2CHLA 3DV3A 3HV5A 2RGPA 2C0TA 3PXYA 3Q9YA 4MNEA 5CENA 4E6QA 4QTEA 3EIDA 4ZTHA 4WT6A 5BVEA 3R8LA 3AT3A 4QO9A 3CY2A 4FUYA 4ANNA 3EOCA 3QQJA 4X2NA 4RMZA 3IONA 4USEA 3G0FA 4WBOA 1VYWA 3UIBA 4F0FA 5DEYA 3QD4A 1JLUE 3A7GA 3OZ6A 5EK7A 4IZ7A 4MH7A 2ITUA 4XHKB 4EH8A 3COIA 4KRDA 4I94A 4F9AA 4YU2A 2QLQA 2Q0NA 3FBVA 4KNBA 4RBLA 1JKTA 4AN2A 2V0DA 2J2IB 2C3IB 4RIYB 4O83A 2UZEA 4J8MA 2C68A 2R3IA 5IQGA 4PL5A 3U9NA 5CF4A 3EQGA 3O2MA 4FZDB 2P2HA 3WIGA 4XRJA 1JWHA 4LOQA 3VWAA 3P9JA 4FSYA 2O5KA 5FDPA 4ITHA 3WZUA 5M55A 3LZBA 3EFKA 1W8CA 2G15A 4EHVA 3RPYA 4W4YA 4NK9A 3BEAA 4JQEA 1Q5KA 3MW1A 3LLTA 3OVVA 2O65A 4D0WA 4FV5A 2OWBA 2FB8A 3A99A 3MBLA 5AUVA 1QL6A 2C6KA 3DCVA 2FGIA 2JFMA 2QOIA 3DLSA 1SNUA 2H34A 3RAKA 3UP7A 4YC3A 5IF1A 2WMVA 5E90A 3QQHA 3RINA 3V5LA 4D4SA 2J6MA 3QRTA 4GSBA 2OI4X 2XKFA 3WZJA 2GNGA 2BAQA 4ALVA 2W5AA 1M2RA 2J5FA 2F7ZE 4CTCA 1MP8A 5A4TA 5BVNA 4AWIA 2YDJA 2WTDA 1PHKA 3BE2A 3DDPA 2BALA 4Q9ZA 4CFUA 3CQWA 1VEBA 1UU8A 2C6LA 3HX4A 2XK3A 3TKUA 5G1XA 2PVHA 5HGIA 3R1SA 3FV8A 3WZDA 2ETMA 2AC5A 4RIWB 3UOKA 3V51A 4CSVA 1BX6A 2PMNX 3MFSA 3P08A 4NU1A 3Q2MA 3ZC5A 1OITA 2R3RA 4BB4A 4ZZOA 1UVRA 4JBPA 3KRRA 5T6KA 2PZRA 1NVRA 2NP8A 4KIKA 4O0YA 3VNTA 3AT2A 4NIFB 4S2ZA 4FOBA 5CVFA 4O1PA 1CKJA 4B8MA 3L1SA 1JKLA 3ZO3A 4L53A 5GJGA 4PPCA 2WTKC 2XYNA 3ETAA 4S30A 3R9HA 3E5AA 1H1QA 4LG4A 3ZEWA 4P2KA 3NAYA 4GCJA 1IASA 2XCHA 4XG3A 3T9TA 4B4LA 1YWNA 5CSWA 4OAUC 4H58A 4RIXA 3SHEA 4F1OA 3GENA 3NYXA 3Q6WA 4X2KA 3QTUA 3W2OA 2R3GA 3MB7A 3PJCA 4M0ZA 1JSUA 3GBZA 4MXXA 4DGNA 1CKPA 4FKUA 4L46A 3TT0A 2UZOA 2OU7A 1YWVA 3TKHA 4I0SA 1WZYA 2B9FA 4QMXA 3VQUA 4BDDA 3FSFA 3CLYA 2WMAA 4PTEA 1KOAA 4FKOA 1Q8ZA 4IM2A 4D2WA 1NY3A 3HEGA 2UW4A 3JXWA 4FT0A 2Y0AA 3QYWA 2RG5A 3F61A 3FZTA 2WPAA 4TKSA 5AV1A 3R7YA 5K4JA 4JAJA 1FBNA 3C5UA 3BU6A 3LFCA 4KWPA 2C3JA 4OBPA 4N57A 4A7CA 5I9ZA 5KMOA 5LJJA 3SAYA 1U4DA 2UZWE 4U5JA 2CKEA 3UO4A 3QHWA 5LWNA 3PLSA 5FEQA 2X81A 4F4PA 3QTZA 1Q8YA 2UZTA 5EW9A 4JBOA 4H1MA 4QTDA 4D5HA 1JVPP 1OL5A 3QWJA 4TYJA 3O71A 4NWMA 3D14A 4CVAA 3FMHA 4AS0A 2PU8A 4NTTA 3MVHA 5LVMA 4GYIA 5TR6A 2WTIA 5ANOA 5LCKA 3TTJA 3R01A 4GKIA 2YA9A 3UP2A 4AOTA 2ITQA 5AR3A 2YIRA 2QCSA 3T8OA 5CSVA 1OL1A 4BDEA 5M4UA 3H0YA 4H1JA 3RNIA 4QYEA 5HVJA 4OTIA 3PY3A 5AR5A 1PYXA 4G6LA 4E4NA 4EK5A 2GHMA 3FY0A 1E9HA 3U6JA 2R9SA 1H0VA 1PXOA 4IAYA 3KEXA 1OVEA 1APME 4PDSA 4U44A 4IDVA 3H0ZA 5IA4A 4W4VA 3RM6A 4CG8A 4IBMA 1ZLTA 3SVVA 4FKVA 1Q62A 2UW0A 3NYNA 3H10A 3EQDA 5DRDA 4ENXA 4FK3A 4AN9A 4G3FA 3WILA 4QMLA 3CKXA 3WBLA 4EYJA 4NM5A 5AX9A 2FUMA 3FWQA 5KMNA 3FI3A 4WNOA 4D28A 2YIQA 4XV1A 3TUBA 1A48A 2VZ6A 4CYJA 4DBNA 4I92A 3R73A 5HD4A 3C51A 3DJ5A 3E3BX 1G8AA 5AMNA 2OZAB 4YJRA 4KIPA 4C58A 3LVPA 2VWZA 5F20A 4JG6A 1YKRA 2HWOA 2UW3A 5CAVA 4FSWA 4K33A 3Q9ZA 4CRLA 3TDWA 1CSNA 1KE6A 4LV8A 4F65A 5AV0A 1H0WA 4AF3A 5IDPA 3U6HA 1WBVA 1RDQE 4L68A 4I5HA 4EUUA 1W83A 4OAVB 3BHUA 4DGMA 2YIXA 2HW7A 5CI7A 4D0XA 1PF8A 3NLBA 4I6QA 2XIYA 4U3ZA 3TZ7A 4BCQA 4KSPA 5HZNA 5JSMA 4I0TA 2IPXA 4BI1A 4EH7A 2C6MA 3GC9A 5IA1A 4WG4A 1LR4A 1P5EA 3VS4A 4I0RA 5KMIA 4TWCA 5FM3A 4G1WA 5CYIA 4IWPA 4FTAA 4FSQA 4D2TA 1ZXEA 4WHZA 4NKAA 2YM8A 2IZRA 1M52A 5CI6A 2R3NA 2GS7A 3BYOA 3UODA 3ZSIA 4BBMA 4O84A 2GHLA 4H3BA 4AU8A 3MA6A 2VX1A 1BI8A 5HD7A 3IW7A 1BKXA 4FVPA 4F9CA 5FWKK 2JKMA 2VWBA 4W4XA 4EWHA 5DOSA 1U5QA 5K0KA 4DEEA 1YXVA 2BTSA 4PTCA 4O82A 2JLDA 4L6QA 5EQYA 1UU9A 4ACHA 2O8YA 2X2KA 4GFOA 4O0SA 4WO5A 2QKWB 2V7AA 5I9XA 1K2PA 3ZRKA 1BI7A 1F5QA 1Y57A 2O64A 2J0IA 3VBXA 2WKMA 1A06A 3FKLA 4FEUA 2HWPA 3GC7A 2YLEA 4PDYA 1H07A 2PHKA 4QP9A 4D4RA 2I1MA 4AAAA 1SM2A 5HEZA 2WB8A 4R5YA 3KCKA 4IE9A 3TTIA 1JSTA 3WZEA 3EJ1A 1KSWA 4KKGA 1OL7A 2QU6A 5FTQA 4F6SA 2OIBA 1XHAA 3M11A 4WNPA 1NW1A 3A60A 3RPSA 4O7WA 4FSTA 4QMTA 4FIHA 5M57A 3HLLA 2B7AA 3HUCA 4XBRA 5KUPA 4RJ6A 4RWKA 3QZGA 3VBQA 3NMUF 4QMOA 3SG9A 1OIQA 4EI4A 4RX5A 2OXXA 4A9RA 3R9OA 4CKJA 3MFTA 4GKHA 4KRCA 2LGCA 2XKCA 4CV9A 3I7BA 2OZOA 5B2KA 2IVSA 4L01A 4K2RA 2CJMA 5CNNA 5GIOE 3Q60A 5AEPA 5E91A 1J1CA 3IG7A 5L6OA 1FGKA 4IJPA 4FV4A 4L7FA 3VVHA 3MPTA 4QMZA 2P3GX 4E73A 3G6GA 4J71A 3R9NA 3CPBA 5AIRA 4FV8A 4I23A 3UZRA 2RFDA 4EJ7A 3ENHA 2W1GA 3N51A 5E92A 2PE2A 3BGQA 3Q4ZA 3PXFA 1U54A 4ZEGA 3RWQA 3D94A 3FLZA 4JVGA 3D5UA 4Q2AA 5LARA 1RJBA 3ALNA 3CTJA 4HGTA 5GNKA 3R8PA 2JAMA 3DKFA 1DS5A 4U7ZA 3K5UA 2WU7A 4IW0A 3LQ8A 5J9LA 2FSLX 5HTCA 4X21A 5CU6A 4D2VA 1KE5A 3MH1A 3GNIB 4LRJA 3OP5A 3S95A 4ACCA 4C38A 3E93A 2BZJA 5ANKA 4WA9A 3VHKA 2C1BA 3NIEA 3FLYA 2BMCA 4EC8A 4C4JA 2XB7A 3AD5A 5HCXA 4IZ5A 4RSSA 5FXSA 2YEXA 2OZAA 3D7TB 4AFJA 3CTHA 4L8MA 1MRVA 4FA2A 4Y46A 3TEIA 2R4BA 3MVMA 4RZWA 1NT2A 2W1CA 2A2AA 3BYMA 4AZTA 4FE2A 4G16A 5F9EA 4P90A 4HNFA 4A4LA 3HMIA 3R7OA 4UMPA 1P14A 4AW5A 5JQ5A 4JJRA 2B54A 2WAJA 3A4PA 4RJ8A 4ZIMA 4FIEA 5AA8A 4G3CA 1WVWA 4C33A 4QP3A 3ZM9A 4L9IA 4UWCA 5JGAA 5JKGA 3TKIA 2CN5A 4PTGA 4RPVA 4LQMA 4NYEA 4EUTA 2HZIA 2B53A 4YTIA 3TZ8A 2HXLA 3ODZX 3AC2A 2OIQA 4E6CA 5AX3A 2BZIB 4TYHB 3P0MA 4FVRA 4O1OA 2QOOA 5JFVA 4NM0A 1T46A 3Q32A 4D2SA 3ORZA 4BTMA 4DTKA 4HNIA 2B52A 4I20A 5EQPA 3F2AA 5AR7A 2OH4A 4XRLA 3F3TA 2WQBA 4F7JA 5ANJA 2E9UA 3PXKA 5KHXA 3GU6A 1NVQA 2XKEA 3HRCA 4N0SA 3TIZA 1OBDA 4IFCA 4BCMA 2YABA 3NUSA 4E20A 4TZRA 4L67A 2WOTA 1IA8A 2XMYA 5C4KA 5JRQA 3RHKA 3OTVA 4FTNA 4EH6A 4FTRA 1NXKA 2PVRA 4R6VA 1IG1A 3OY3A 2HY0A 2GTNA 4R3CA 4YZDA 3UMXA 4C02A 5CNOA 2BDJA 2V62A 2X9EA 3R02A 2ONLA 3GOPA 4FTUA 4RVTA 4X6QC 3DPKA 5D7VA 5DH3A 5J8IA 2CNUA 3GU8A 1AD5A 2WMTA 4LFIA 5HG7A 2XIKA 3QTXA 5DVRA 3NNVA 4YBJA 4IAIA 3NCZA 4IX6A 3BU5A 3KRJA 4BFMA 4NFNA 5E4HA 2AYPA 4OTWA 5KO1A 3DKGA 3LFEA 4UMTA 5AFVA 2FH9A 3V5WA 3KKVA 2Y7JA 2I0YA 5DFPA 3QGWA 4HPUE 4DFUA 3NW5A 5FDXA 2WELA 3BQRA 4XP3A 1E1VA 4QMVA 1MRUA 5HX8A 3IW6A 4DGGA 3AMAA 3W8LA 2H9VA 5H8GA 3DNDA 3TACA 4HOKA 3F5GA 4FK6A 4FIFA 2EB3A 2WGJA 4L3LA 4Q5HA 4TYIA 4XEYA 1G8SA 2DWBA 3F88A 2Q0BA 2IO6A 4E3CA 4NEUA 3OXIA 1R39A 3FMMA 4ZY6A 5DT0A 4FEQA 3NUXA 4HGEA 2B9JA 4FI1A 5EYCA 4WNMA 3RMFA 5J9YA 4V05A 1FPUA 3LCKA 2YCSA 4Y5QA 2OFVA 3R7IA 2X8EA 3ZHPC 1JQHA 4FTMA 4PL3A 2C30A 3OW3A 4QMUA 4GT4A 2C0IA 4DN5A 2I7QA 3WARA 2PVKA 5JZJA 4GYGA 5HX6A 5EM5A 2VTMA 5E8TA 3KRWA 5JT2A 4QP8A 5HNIX 3CR0A 4P5QA 5CSXA 1UKHA 4RX8A 1JNKA 4BIDA 5CTPA 4ANOA 4JIAA 5CEMA 2I0EA 3DK3A 3PTGA 2YM7A 2QG7A 2BTRA 3PG1A 5CX9A 2Z60A 3DXNA 4GEOA 5EM8A 4O86A 4QTCA 5DG5A 1JKKA 3PA4A 2OJFE 2VX0A 4A4XA 4R78A 1J3HA 4WG3A 3HYHA 5TE0A 1PKGA 1R78A 4PPAA 3IPHA 1GJOA 3OUKA 3PA3A 3VBYA 2B9HA 4ZTRA 4ID7A 1MRYA 2VTLA 4NUSA 5HNBA 2GNJA 4EJNA 4DCAA 5CU3A 3QBNA 4O27B 1GZ8A 4UN0C 2OK1A 1R0EA 2VWIA 4CFWA 4B6LA 4OTHA
chains in the Genus database with same CATH superfamily
4RWLA 3RCJA 4APPA 4U43A 3VJOA 2YWPA 4U81A 1OL2A 4WUAA 5E8YA 1UKIA 5C1QB 4WOVA 4A9YA 4JI9A 4GIHA 4Q5EA 3AGLA 5EOLA 2XP2A 3NUUA 4OUCA 2R2PA 4DA5A 1OUKA 3ZXZA 3BHYA 4UZDA 2BVAA 1FGIA 1YHVA 1M14A 3FMKA 4GL9A 5EYKA 3V8SA 3G51A 5FBOA 3ZBFA 4E1ZA 4L45A 3PIZA 1Z57A 2BRGA 2NPQA 4PNIA 3HGKA 3KXMA 4B0GA 4FTKA 2BHHA 3RNYA 2QURA 3KMMA 3MH2A 5AA9A 5IQBA 5CU0A 3MA3A 2VX3A 5HCZA 4X6RA 2R3JA 3TZ9A 4E4MA 3V8WA 4AOIA 1GY3A 1XH7A 3V5QA 2JDTA 4MWHA 3R2YA 4ZAUA 5IPJA 3OD6X 3I5ZA 2O2UA 4FJVA 4O7RA 3EMGA 4CCBA 3UO5A 4DG3E 2Y6OA 4RGJA 4YSMA 4LL0A 5IUGA 3T9IA 2QLUA 4A9TA 2IW9A 3SDJA 5CZIA 1WBPA 3H9OA 5BYLA 2GS2A 5E1SA 4EOOA 4DF3A 4O2PA 2YM6A 1XH6A 3ACJA 5K3YA 3F7WA 2UW8A 3W16A 4ANBA 2ZV2A 4MXOA 3VQHA 1H1WA 3FHIA 3DT1A 5CS6A 4RT7A 4XV3A 2F2UA 5A4CA 5HI2A 3KFAA 4BHZA 4AW2A 5D7AA 5BUIA 1TFFA 3C13A 1OPJA 3QAME 4I21A 3LCOA 5LMKC 4C2VA 3EWHA 1H28A 3ZUUA 4DLJA 5CEOA 5ETAA 3AG9A 4O0VA 5LMBA 4USFA 1AGWA 5HO6A 4F0IA 2CSNA 4BBEA 1PMNA 4IZYA 4EZ7A 4AT5A 3F69A 4J52A 3A7FA 5HIEA 5IQDA 4OTPA 3QTQA 3R00A 2HIWA 3Q4TA 3PXZA 3R28A 4TY1A 5GZ9A 4C36A 5J9ZA 1WCCA 2F7XE 3EN4A 4O22A 4GG5A 3FEGA 3TCPA 4DG0E 4PNKA 3HMNA 3UOJA 2R3HA 1V1KA 2QO9A 4GV1A 3FYKX 3CJGA 3ML1A 4XUFA 2R3LA 3FSKA 4KIOA 1DAWA 4GJ2A 3U4UA 5JN2A 1HCLA 4X3FB 5BQ0A 5E8UA 1ERKA 2EU9A 3F3ZA 4YTFA 4EZ5A 3GB2A 2C3KA 2HW6A 3ZEPA 3HP5A 3C1XA 4XNEA 1IA9A 3BLQA 1W2FA 2C5XA 5AP2A 2AUHA 1Q8TA 3ET7A 4PQNA 3OBGA 5I9WA 3CQEA 4BWXA 1PXIA 4FTJA 5BUJA 2XJ0A 2X2MA 5E8VA 2BILB 3VBWA 2CMWA 3L8PA 3NWWA 5AADA 5M56A 5ETFA 5A3XA 2OF4A 4FTQA 3EN5A 4GT3A 2CN8A 3SXSA 1H1SA 4YNOA 1UU3A 4EBWA 3COHA 3EZVA 1OPLA 3SG8A 4O7YA 3V5PA 4IVBA 4ACGA 5IQEA 1KWPA 2UZVA 1DM2A 4ALUA 4Y85A 4NTSA 5F4NA 1W82A 3FHRA 5IQAA 4AAYA 4TL0A 4YMJA 3POOA 5EM7A 3BLRA 4ITJA 5ETIA 3K5VA 2GSFA 2JEDA 4XCUA 5AAEA 3LFDA 5JGBA 3W0SA 4FZ6A 4FTOA 4HYIA 4AT3A 4UMRA 4DCEA 3QTWA 2VO0A 2XIZA 3ATTA 3G9LX 4N70A 2WZJA 4UMQA 2NRUA 4F9YA 4IEBA 3PSDA 5L2TA 4WBBB 3K3IA 4NZWB 3OTUA 4ZOGA 1ZZLA 5EHYA 5CALA 4L00A 4LV5A 3FI4A 5CZHA 2YDKA 2GU8A 4M12A 2R3KA 4MF1A 4EQMA 4I4EA 4ACMA 4RC3A 4QYHA 3DKOA 4X2JA 1M2QA 3E87A 4BF2A 4PPBA 4NW5A 3QCSA 3BHVA 3PJ3A 4S34A 4BCGA 4DH3A 1VYZA 5AIKA 1SVEA 1OUYA 3ZUVA 5BPYA 3QL8A 2EVAA 4FG9A 4G34A 3C9WA 4QPMA 2RG6A 5FXQA 3UNJA 4A06A 3W10A 2QOFA 3NYOA 2CGXA 2GMXA 4PX6A 3W0MA 3QA0A 2JIIA 3P23A 4LOOA 3CBLA 3IW8A 4GK2A 3ROCA 4QPSA 2I40A 5F1ZA 2XM8A 3A8XA 3PWYA 3EFWA 2HK5A 3G2FA 4CZTA 1J91A 3ZSHA 4H3QA 4TN6A 5AP7A 4FG8A 4LMUA 5LXMA 3DJ7A 1YVJA 5J1VA 2XK9A 4WIHA 4MK0A 3CY3A 5DR6A 3O50A 2ZB1A 4I3ZA 2XCKA 2WMBA 4YHTA 4O4FA 3AGMA 3E8NA 4BCIA 2BHEA 3FXWA 4JDIA 3RK7A 4W9XA 3PE2A 3C0HA 3VS3A 4OGRA 4EOPA 1ZARA 4QYFA 2PVMA 3V8TA 4ITIA 4DLIA 2ITZA 4IB3A 4R1YA 3LCDA 4C57A 4IH8A 4ONAA 4F09A 2IZUA 3L9LA 4EHEA 1Z9XA 5JQ8A 5H3QA 3I79A 4FV0A 1U59A 2IJMA 3CD3A 4M68A 5AR4A 5T3QA 3QQFA 3SRVA 5LMAA 3KA0A 2X0PA 4EK3A 4Y8DA 2WQEA 3UPZA 2G01A 3KVWA 4J99A 3NNWA 4FKLA 3MPAA 3O51A 4DT9A 1JAMA 1K9AA 3CGOA 4NH1A 3UNKA 4CFMA 1OKVA 2J9MA 2G1TA 5D1JA 2J90A 2W1DA 5AP5A 3EQPA 3ORKA 1WAKA 3GT8A 3Q4UA 4FODA 3O17A 1JBPE 3FQHA 4UWYA 4LRMA 3ZDIA 4GFMA 4QDEA 5HE2A 4RJ7A 4EZ3A 3EKKA 2PUNA 3DFAA 1XH5A 4A07A 2YIYA 4QT1A 5HG9A 2IZSA 3BHTA 3Q5ZA 4XS2A 4IIRA 3WF6A 1SVHA 3EFLA 1P4OA 4FKPA 2XK6A 4IC7A 3DGKA 2VTTA 1XJDA 1OIUA 2VRXA 4AZSA 1PRYA 4YC6A 3MIYA 1F3MC 2VO7A 3PZEA 4U40A 5HCYA 2UV2A 2PULA 4FL1A 4FUXA 1XBAA 4R1VA 3R8UA 5CWZA 3FXXA 3VUMA 2WMQA 1YXXA 5M08A 3VBVA 3N9XA 5ACBC 2WHBA 2Z7RA 4KBKA 5IG1A 3FKOA 3QF9A 3GQLA 1OBGA 3E8EA 4NL0A 3LLAA 4BDHA 3TN8A 3LE6A 3TV4A 3C4WA 1YI6A 4HVHA 5A4QA 4BGHA 4G2FA 3GXLA 2WMRA 3HECA 3LAUA 3DDQA 2VTHA 3R7GA 5DR9A 4GUBA 3UG2A 4AX8A 4DFYA 3PPJA 2OFUA 3M2WA 3EN7A 3IOPA 2X2LA 3NPCA 4ZJIA 1GAGA 4PV0A 1Z5MA 4J98A 3MH3A 4FSNA 1URCA 2WTJA 3MYGA 3UIMA 4FL2A 5FRIA 3BKBA 2UZLA 4YGAA 3WF9A 4YJOA 3R1NA 3E92A 3PSCA 4FV9A 3LXKA 1H26A 3BZ3A 3BWFA 4BWKA 5EDQA 2ZMCA 4AA5A 5AUTA 1REKA 3HRFA 3ZH8A 2VWYA 3TIYA 2XARA 3AKKA 4QP6A 4GU9A 3IO7A 5HKMA 3H4JA 1QPCA 2PVJA 4BC6A 2XVDA 4MYGA 4UYAA 3HUBA 2DS1A 4IX3A 4KBAA 3ID6C 4MBIA 4F6WA 5AUWA 2ITNA 3BHHA 4IFGA 4AW1A 5L2WA 4ANLA 3LMIA 4O7VA 2YIWA 1ND4A 2WQNA 3E88A 3W0NA 4H3PA 3CE3A 3NVMB 4E5BA 3MVLA 4I6BA 5L8LA 3DAKA 3IQ7A 4JR7A 4HVDA 4Q9SA 2GNLA 3Q5IA 4A4OA 3RZFA 1STCE 3DZOA 2R7BA 3FUPA 3PYYA 1ZYJA 3QKMA 2F2CB 2VTSA 3F5XA 3LCSA 3R22A 4IWOA 3R8VA 4JX3A 3MY1A 4CKRA 1PXLA 3LFQA 3DB8A 3I6WA 3WF5A 2R7IA 4RIYA 5KE0A 1ZOGA 3T3VA 3SC1A 3NEWA 2H96A 5KHWA 2XK7A 4J7BA 1Q3DA 4MUQA 2WO6A 4CG9A 1Q99A 5GJDA 3TV6A 2AEGA 2C5VA 1VJYA 2OJJA 4EOKA 4M14A 2QG5A 5HICA 5JEBA 2BCJA 4M84A 3VUDA 4IZAA 2X7OA 3DS6A 3AC3A 3O8PA 3P5KA 3Q9WA 1G3NA 3OCTA 5HE0A 4BDIA 4C4GA 2VNWA 4I93A 1FQ1B 3C7QA 2YLFA 3G5DA 2QOBA 3MY5A 1ZYDA 5JMSA 4GH2A 4D2RA 4WKQA 3QC9A 4WRSA 5TOZA 5CEKA 2XIRA 4E5AX 5C9CA 5HVYA 4FMQA 3PLAE 3LIJA 3HKOA 4FTLA 2QU5A 5EI2A 4DT8A 3TZMA 5JFXA 3EKNA 3I0QA 2YM5A 2J0JA 2XKDA 5FP5A 3ZBXA 4V04A 4QQJA 3RI1A 4S33A 1OB3A 3RAWA 4O7SA 2BKKA 1XBBA 3EN6A 1VR2A 5HBEA 3W2RA 3C4XA 4NCTC 3UG1A 1U46A 5A6NA 1XH4A 2O3PA 4OW8A 5IDNA 2QR7A 1CKIA 4EORA 4EK6A 3TUCA 3Q6UA 4OTFA 5LQFA 3S1HA 3DBCA 4FTTA 3VONA 5FQDC 2V55A 1FVTA 5I0BA 2VTNA 1YDTE 5IUIA 4RVKA 3QRUA 3K2LA 3UO6A 2IG7A 4CZYB 4EHZA 3UQGA 3G33A 4R3RA 2QOLA 1W0XC 4R8QA 3UQFA 4RIWA 2JFLA 5ANEA 5HO8A 4AP7A 4IADA 4BIBA 5J7BA 3Q4CA 3QD0A 4YJVA 2W7XA 2R3OA 2IVVA 4PP9A 3MS9A 2GPHA 4TXCA 4QPAA 2Q83A 2EXMA 2NO3A 3MGYA 4NIFA 3F2RA 4JS8A 3EQRA 2ZOQA 3GFEA 2IW8A 5TKDA 4JRNA 3N4VA 1ZMWA 1TZDA 4BYJA 1GIHA 2R64A 4B99A 4FNZA 5J5TA 3D2IA 4U42A 3FLSA 3PIYA 3TUDA 3MJ2A 3V6RA 3QQGA 4UB7A 4NM7A 3UVRA 4X2GA 3HV6A 4II5A 5H2UA 2HXQA 3PPKA 3QX2A 4YJNA 5BVOA 2HZNA 4O0UA 4JMQA 4F70A 4XP2A 3A62A 3ROYA 4LGHA 4ACDA 3IKAA 4RFZA 3UJGA 5B2MA 5CXZA 3VJNA 3KXHA 4FYOA 4C35A 3M1SA 4UEUA 5AAGA 3TG1A 3O8TA 3IK3A 2W1FA 4L7SA 4KSQA 4RQKA 4QNYA 4J96A 3U4WA 4DGLC 3NDMA 4X3FC 5CAPA 3Q53A 1FVRA 4BCJA 4D1XA 3V5JA 3UDZA 3T3UA 4BTKA 3R83A 4CGAA 4AACA 1XKKA 5L6PA 5GINE 1JPAA 4J53A 4XOZA 5C8MA 5JFWA 4IAZA 3UPXA 2ZM4A 4B7TA 4ANQA 2XNGA 1OIYA 2PUPA 2EB2A 3KF4A 3ODYX 4RJ4A 2R3MA 1PKDA 4FBXA 4DFNA 2XEZA 3DFCB 4UZHA 2W5BA 4LDTA 3P1AA 2YCQA 5HU3A 2PMOX 3G0EA 2C69A 3PJ8A 4UBAA 4IVDA 4WNKA 3PXRA 1X8BA 2REIA 4Y95A 1DI8A 4HCTA 2X7GA 3DBDA 4TWPA 4K0YA 4M66A 3DK7A 4G9CA 1CMKE 4JG7A 1ZYLA 4USDA 5ICPA 4AXEA 2GNIA 5E8XA 3LOKA 1CTPE 3D4QA 1BLXA 5HHWA 5FEDA 4G5JA 1Y91A 3U87A 3TDVA 2ITPA 3R04A 2J0MB 4JLCA 5K4IA 4ASDA 3C0GA 2XUUA 5HLWA 2JKQA 4DFXE 4Z7HA 2YITA 1WFCA 4UMUA 5AV4A 2OXYA 1KV2A 2R0IA 2VGPA 2CGWA 4TW9A 2ITVA 4FL3A 3IS5A 5FD2A 4L42A 3ZTXA 4J1RA 3COKA 3L8XA 3RVGA 2X0GA 1J1BA 3FKNA 4AZVA 3FZPA 4D9UA 4AGCA 3M42A 3PSBA 3OY1A 3OUNB 4DHIB 5AAFA 1O6YA 4IANA 1WVYA 3BV3A 2PZYA 5HOAA 2ZYBA 3CC6A 4FV1A 5LVNA 1G5SA 2P4IA 3GC0A 5FTOA 4FKQA 4LI5A 2W9ZB 5DI1A 2GQRA 2QC6A 1K3AA 4I24A 4OT5A 4GS6A 3OCBA 1IAHA 2P33A 3SLSA 4BKYA 1H01A 2QOKA 2VTIA 5HESA 4BZNA 2RKUA 4AE6A 4U97A 4WUNA 5AP6A 4RX7A 4JOAA 2A98A 2UVYA 4IC8A 4K77A 2J5EA 4NSTA 2ZJWA 1J7LA 3NS9A 3Q52A 4C37A 1ZAOA 1OZ1A 5M44A 4AOJA 1IRKA 3QUEA 4TNBA 4YR8A 1QCFA 3DXQA 4YZMA 4MD8E 5B0XA 1Y6AA 3H30A 1W2CA 3AC1A 5EFQA 1Q24A 4J8NA 2B4SB 4UXLA 3C4ZA 2RL5A 3R7UA 4CFXA 2A1AB 1HOWA 4IXPA 5IH5A 4ZZNA 4DHFA 2UUEA 5AUYA 3FC2A 4FTIA 4UXQA 4I4FA 4JQ7A 3P7CA 3QC4A 5ETCA 4C7TA 2QI8A 2XM9A 4DTBA 2KTYA 4BYIA 5IU2A 4O6EA 3PUPA 5KNJA 5KBRA 5LMKA 4PDOA 5AM7A 1F0QA 2GFCA 4BHNA 5BMSA 4MTAA 4CLIA 4UALA 5IUHA 4GW8A 3C5IA 4H39A 3TM0A 4I5MA 4XG7A 4ZK5A 4IAKA 4L44A 4QNAA 5I4NA 3QRKA 5KZIA 4C34A 2YFXA 3FAAA 1XO2B 1YRPA 3QCXA 4IB5A 4GK4A 3E7VA 3R8MA 5KX8A 4QQTA 3LW0A 1YXUA 1TQPA 4FKRA 3W2SA 3UGCA 4W8EA 1OKYA 1DAYA 3KXZA 3HAMA 4ORKA 4R7BA 1GNGA 1SYKA 2OJGA 5J79A 3O7LD 5C26A 3JPVA 4EKKA 5HBHA 3HDMA 3W2PA 2P2IA 2PZPA 3BX5A 3I4BA 5EW8A 3ZS5A 2NYAA 1JSVA 3MVJA 3PJ2A 4EQCA 1ATPE 5I3RA 4EH9A 3ZLXA 1ZMVA 5HNGA 3KQ7A 4IM3A 2XNBA 3B8RA 2C6OA 1I44A 2X39A 2OW3A 2BDFA 4HCVA 4LGDA 4FT9A 3FMLA 4TPTA 4Z16A 3ZU7A 2BDWA 3F3VA 2O63A 3OHTA 1FINA 2IWIA 1NA7A 3NAXA 3P7BA 3UYSA 1WBSA 1OI9A 2JDVA 3LHJA 4HW7A 3MWUA 4CQEA 2HENA 4CD0A 4CV8A 4G6NA 2YACA 3DJ6A 1MQBA 4YHFA 3VHEA 1QMZA 3KN6A 3HA8A 1XR1A 4YUQA 2ZDUA 3TJDA 1IAJA 3PPZA 3TNHA 4BCPA 3QQKA 3UDSA 3EH9A 5IQFA 3PJ1A 4BVUA 2JBOA 3AKJA 3HL7A 3PY0A 2QO7A 3Q3BA 4FT3A 5CANA 3OXZA 4ZS0A 3EN9A 3PDTA 4U80A 5EI6A 4CRSA 1PXPA 2PK9A 4M3QA 4BGGA 3HV7A 2QONA 4EOMA 3RPVA 4J97A 4FEVA 3QYZA 4JQ8A 3JS2A 4RFYA 5B7VA 4H05A 4IB0A 4CMUA 4CMOA 2PY3A 5M07A 1XWSA 2XRUA 4U45A 5IZFA 5D9HA 2GQGA 2PVNA 3MPMA 4DFZE 2X7FA 3QRIA 4EOIA 3GCVA 4MHAA 5DR2A 3QX4A 1FOTA 3FLWA 5LCJA 1PXJA 2J0LA 4Z55A 5IEYA 3Q2JA 5EYMA 3SD0A 4ZTLA 3RBWA 4M8TA 3NUPA 4AT4A 3C0IA 3ZFMA 2C5YA 2WQMA 3FC1X 1IEPA 5IQCA 1YHWA 2W1HA 1GZNA 3UMWA 2X0OA 1PJKA 3BGZA 1BL6A 4R3PA 5CT0A 3L8SA 5EDRA 4F9WA 3FMNA 3P7AA 4FVQA 3TJCA 3ZXTA 5EQEA 2XJ2A 2R3QA 3H9FA 5DYJA 3AT4A 3D7TA 4PUZA 5IEVA 3DAEA 4W8DA 3S3IA 3UE4A 4PMSA 3JY9A 3VC4A 5IH4A 3F6XA 2C6DA 3E7OA 1P4FA 4M13A 4XP0A 3RCDA 4BIEA 2C0OA 3NUAA 5J5SA 2XK8A 4ZTQA 3BV2A 5KMLA 4KABA 5AR8A 5K9IA 2VV9A 4Z7GA 3MESA 3QKLA 4QMQA 3QZHA 4O0WA 3BYSA 4OTGA 3ZFYA 4XG9A 4AN3A 4BI2A 3S0OA 2BRMA 4AQCA 5A9UA 4G9RA 2PUUA 1W98A 2CKQA 3UYTA 2YM3A 4FKJA 3DY7A 1OPKA 4EH5A 1H8FA 2Y9QA 4TYHA 1ZY4A 5CU2A 3A7JA 3IECA 5K5XA 3KGAA 2YAAA 4C2WA 1UWHA 4IACA 1E1XA 4G31A 4P4CA 4X0MA 5EDPA 3TV7A 2PPQA 2Y4IB 3FQSA 3AD6A 1H27A 3GOKA 4M15A 4N4SA 4O2ZA 4YJQA 3UTOA 5L2SA 1YWRA 3E3PA 3E8CA 2VTQA 3GU5A 1B38A 2EXEA 3LFNA 4MF0A 4CLJA 2E9NA 1MUOA 3PWDA 3OW4A 3MI9A 2UZDA 3COMA 2GQSA 2OGVA 3IGGA 1KV1A 4DG2E 4IVCA 5CEQA 3W0QA 2WTCA 1XQZA 1WVXA 2PVLA 3AXWA 3D15A 4MVFA 2F57A 4ZTNA 3GCQA 4DFLA 3KMUA 5DBXA 5BNJA 5J1WA 3TI1A 4CCUA 4BJJA 4O96A 3P86A 4IQ6A 2CKOA 2DYLA 2QHMA 3FQEA 5M06A 5ANDA 3PXQA 3NSZA 5AV2A 5GHVA 1W84A 5JRSA 4IDTA 4U9AA 4S32A 3LM5A 3UOLA 4UWBA 3TNIA 4MBLA 4OR5A 5KZ0A 2VO3A 4ZSLA 3W55A 2F7EE 4BDBA 4DH1A 4O7TA 2HYYA 5EI8A 3JY0A 4MNEB 3R1QA 3OF0A 4QP7A 3R7EA 3RKBA 3SKCA 5JK3A 4XX9A 2JC6A 3AMYA 1PMEA 3ACKA 3DA6A 3MTLA 5BVDA 2ETRA 5HQ0A 3KMWA 3W2CA 4XBUA 3G90X 4IX5A 2W4JA 1SMHA 4UYNA 3HV4A 4F63A 5E8ZA 2G9XA 3CTQA 4I5PA 2ITXA 4PRJA 4ARKA 2C6TA 5BVFA 2E2BA 2ETKA 2RF9A 2ZV8A 2IZTA 2QODA 4E6DA 3ZSGA 1KUTA 3PG3A 3DZQA 2JDRA 3FMJA 3W2QA 2A0CX 5JH6A 3RP9A 4JNWA 1R1WA 4MD7E 2QQ7A 4W9WA 4YLKA 2SRCA 2W1ZA 3PVUA 3ORXA 3QALE 1UU7A 3HZTA 4MAOA 4FR4A 5IA3A 4MD9E 1UNGA 2ITTA 2QOHA 2VGOA 3VS5A 4LMNA 4HZSA 5I9VA 5T68A 1RW8A 3GUBA 3JVSA 2JBPA 5CXHA 3G6HA 3VUHA 5A54A 3F5UA 3RJCA 4DE4A 4DEIA 4W4WA 2W99B 3CEKA 3OXTA 4A9UA 5KMKA 4BCNA 4BDGA 5HG8A 2OH0E 3LXPA 4DAWA 4CYIA 5I3OA 4HJOA 4FX3A 3FY2A 3UIXA 3U6IA 4EONA 1H1RA 5TT7A 3UIUA 4ASEA 2WMSA 4X3JA 3AD4A 3F5PA 4OTDA 3VBTA 3D7ZA 1V0PA 3DNEA 1ST0A 2UW7A 2X8DA 4CTBA 4MWIA 3QD3A 3ZUTA 3N4TA 2OSCA 3QTIA 4KBCA 3ZYAA 3OBJA 3SW7A 1O9UA 4EHGA 2G2FA 4JDKA 4HZRA 4ZMEA 3ZZWA 2PVFA 4GU6A 3GU4A 1SNXA 3W1FA 3BYVA 3OT3A 3EQHA 3JVRA 3E64A 4TWNA 1PXKA 1TQIA 4RRVA 2UZUE 4XG6A 1J7IA 4DEBA 2QD9A 2W06A 2JITA 4FV6A 4TT7A 3MDYA 3SW4A 4AA0A 5KKRB 4PMMA 2JKKA 3ZDUA 4HYHA 5EG3A 4BL1A 4BN1A 1Q8UA 5LVOA 3IW5A 4BCKA 1CM8A 4DDGA 4TRLA 2YISA 1KE8A 3CJFA 1LEZA 3UVPA 1CDKA 4KIKB 3LFAA 4UY9A 5AV3A 4LRKA 4AXCA 2ZV7A 1R3CA 2Y8OA 4RJ3A 4C61A 5ITAA 4ALWA 3CKWA 4WD5A 2ZDTA 4LOPA 3R2BA 3LJ2A 5IQHA 4LUEA 4G3EA 5EW3A 3NW6A 3SXFA 3DK6A 1GZKA 5IEXA 3B8QA 4FC0A 3TXOA 1B39A 2RFEA 3P5JC 3WF7A 3EQCA 3D83A 4V01A 5C8NA 4E5WA 4JDJA 4Y73A 5HORA 4NKSA 5HVKA 1JKSA 1LPUA 4HYSA 3KULB 2JDSA 4NCTA 4QTAA 4Y83A 4FEWA 4EH3A 3V3VA 4BGQA 4MXYA 1QPEA 1Y8YA 3AOXA 4YPDA 5AP0A 3R8ZA 2W1EA 3E63A 1U5RA 4JX7A 5HG5A 5IA5A 4DEAA 3MH0A 5M51A 5J87A 4OBQA 1ZY5A 5CQUA 4B8LA 2A27A 3ANRA 3FI8A 2O0UA 2YERA 5HO7A 1M2PA 4RJ5A 4MQ2A 5F94A 3I60A 4BWPA 3GU7A 4KA3A 3DXPA 3O5AA 3A8WA 2PZIA 2ITOA 3NCGA 2FYSA 3ZRLA 3K54A 2IVTA 2CCIA 3REPA 4EOQA 3KREA 3NR9A 2R5TA 1ZMUA 2CKPA 3RALA 4ENYA 4GVAA 4YZCA 4EEVA 2XAMA 4QEBA 3LM0A 1J7UA 2QNJA 3ORLA 3G9NA 4E4XA 1OIRA 3NVKI 4GT5A 3SXRA 2V5QA 1ZYSA 1H4LA 2Z7SA 4K18A 5HTIA 3BIZA 4FSZA 3FLQA 4RVMA 3QZIA 2X8IA 5EKOA 3VF8A 2Y6MA 2ERZE 2HZ4A 3V6SA 5HE1A 3RK9A 4HGLA 4BKJA 4HVSA 3D2KA 4CT1A 2OBJA 4ERWA 3KN5A 3HRBA 3R7VA 2R0UA 4M97A 2LAVA 1ZOHA 5LVPA 3D5WA 3EZRA 4NFMA 4QMPA 4A9SA 3GVUA 5E8WA 3ORMA 4X3FA 3ZFXA 4BTJA 4YTCA 2IN6A 2RIOA 2Z8CA 5FG8A 2H6DA 3ALOA 1WBWA 4DEGA 3O96A 4X7QA 4ZY4A 5E8SA 4YSJA 4KS8A 4FKTA 4N6ZA 4M7IA 4U3YA 2WXVA 4MBJA 3NRMA 2J4ZA 2ESMA 4UV0A 4BR3A 5HLPA 2P55A 3HP2A 3UBDA 2VWUA 4HCUA 4MQ1A 2P0CA 3FZRA 4QP1A 5LVLA 4DBXA 4U0IA 2C1AA 2BROA 3II5A 2JKOA 5C4LA 2CPKE 4L43A 2B1PA 3GCPA 5AP4A 4FNYA 4RLKA 5BMMA 2FO0A 3A2CA 4ZP5A 3L8VA 3OC1A 4FKWA 4FZ7A 2YDIA 4LL5A 4IAAA 4HYUA 2I6LA 3C4EA 3VRZA 2BR1A 3DBFA 3PY1A 4XOYA 2XNEA 3HNGA 2ZV9A 3BU3A 5EKNA 3IDCA 4RFMA 3EB0A 1MQ4A 2C6EA 4MNFA 3WZKA 4DTAA 2C47A 2OO8X 5A14A 3U54A 3R63A 2JGZA 3SX9A 3VUGA 3ZZEA 2QKRA 2VN9A 2VWXA 3BBTB 3WYXA 5HTBA 4IWDA 5ANIA 3L9NA 3DTWA 2ZM1A 4K11A 4X2FA 3O0GA 4L3PA 3PRFA 4O91A 1BYGA 4AXAA 3DQXA 1WBTA 4FICA 4QQ5A 5DEWA 4FZAB 5DPVA 3IGOA 3KULA 2BZHB 4U79A 4F0GA 5GZAA 5IH6A 1Q61A 4NJ3A 3EFJA 4IMYA 5BVWA 2ERKA 3FZ1A 2VTJA 3D5XA 3FZSA 2YJSA 5L8JA 3BELA 4MEDA 5DN3A 3SGCA 4QP4A 1V0BA 3R21A 3KC3A 4FSMA 5BVKA 3QRJA 4LGGA 4YTHA 3EYGA 3VIDA 3P79A 1GOLA 4XG4A 3SA0A 4FKIA 1YQJA 3FZOA 4OLIA 4BDJA 3G15A 2NRYA 3F66A 2WQOA 3ZONA 2ZM3A 3EHAA 4DC2A 1OGUA 4O7LA 2JIUA 3WE8A 4FSRA 2C5NA 4JRVA 5AUXA 4QDVA 4QRCA 5L6WL 2CNVA 4S31A 3U9CA 5EHLA 4PF4A 3KB7A 4BKZA 1TVOA 3PA5A 4OTRA 4O4DA 4FF8A 2FSMX 2C5OA 3NUYA 4O0RA 4KKEA 4G3DA 5CU4A 5IMXA 1JOWB 2Y4IC 2Z2WA 3U51A 5CY3A 5FXRA 1M17A 5FBNC 2RFNA 1ZRZA 5CEPA 1TKIA 2PE1A 4C0TA 4JL9A 4ZJJA 2BAJA 3BEGA 1PYEA 3F9NA 3VUTA 4OBOA 4F08A 2VWWA 3QTRA 3GI3A 4YO6A 3BE9A 3QCQA 3LMGA 4GK3A 3SOAA 3UZTA 5H8BA 2VO6A 3VS0A 3D5VA 3ENMA 5I9YA 3BRBA 2BZKB 3FE3A