5BYZA

Erk5 in complex with small molecule
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
348
structure length
348
Chain Sequence
TFDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQSLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of a novel allosteric inhibitor-binding site in ERK5: comparison with the canonical kinase hinge ATP-binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 7
total genus 120
structure length 348
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5byzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5byzA01
2I7QA 5KMKA 3PVWA 5AJQA 3OFMA 4FL1A 4IVBA 1PYXA 3DBQA 1P5EA 3QQKA 1R3CA 4EHVA 1GOLA 5IEXA 4E26A 5E7RA 3DJ5A 3VS3A 4FKPA 1YW2A 4KIPA 4Z9LA 3V8SA 4EORA 4QPMA 1V0BA 4EOSA 4DH3A 1O6LA 3UC4A 3L1SA 4D28A 3RTPA 4FNZA 4O1OA 2YDIA 3D14A 5CF4A 5CU0A 4C36A 4DGOA 3DFAA 5DGZA 4QYYA 4DGNA 5J5TA 2OF4A 3R6XA 4G3FA 2E2BA 4XS2A 1TVOA 2W4JA 2JFLA 3QC9A 4HGEA 4BCNA 1ZYDA 4RX8A 5M57A 3FPQA 3TUCA 2VWBA 5JQ8A 4KAOA 3FY0A 4TXCA 3ZDUA 4K9YA 3EQHA 4AZTA 3LPBA 5CXZA 3CP9A 4A9UA 5I4NA 3ZSGA 2ZB0A 3KMUA 4B99A 3RHXA 4DTAA 3LJ0A 5AWMA 1PHKA 4FTLA 3C50A 2UW5A 2ETKA 2XNBA 4X7QA 4DG3E 2XKCA 1H01A 1SYKA 3IQ7A 4PX6A 5HCZA 3HV4A 1TKIA 1H07A 3E7VA 2UZUE 4HCTA 2ETMA 3P78A 4HVSA 1WBOA 5HD7A 4FYOA 2R7BA 2C1BA 4DEDA 2XEZA 5JFWA 4HYHA 1Q3WA 3S00A 3AT3A 2FGIA 2WOUA 4KB8A 4UB7A 3G15A 2ITNA 3G0EA 3IW5A 4IDTA 3FI3A 4MTAA 1KOAA 2ZV9A 3LM0A 5C03A 3EMGA 3FMMA 2PU8A 4NIFA 5DR9A 3R9OA 4ZY4A 2VU3A 3WF6A 3RAKA 2PUIA 4U97A 3DBCA 4E5WA 2GHMA 4WBBB 1S9JA 3FSFA 4ZZMA 1IA9A 4G5JA 3P4KA 4L9IA 2WMRA 4I5MA 5IQCA 2C30A 3COHA 3LIJA 3W8LA 2YM4A 4CFNA 4O7YA 2YDJA 3QXOA 3U55A 1YOMA 4IAYA 4UMQA 4TTHB 4YJPA 3M42A 5AP5A 2WMAA 1YQJA 4RJ8A 4XYFA 5DH3A 3VJOA 2ONLA 3CC6A 3E63A 4P2KA 5LVMA 3HECA 5K0KA 2OW3A 2VD5A 4A4XA 4EH6A 4DC2A 1DS5A 4Z3VA 3A8WA 3IW4A 5ANIA 3O7LD 1M7NA 3ZXZA 1Q5KA 3L9NA 1JSUA 2R64A 5L8LA 2CNQA 5GINE 3FE3A 2J90A 3R28A 4O0UA 5EKOA 4LFIA 4GS6A 4R5YA 4M84A 3LCTA 4KIOA 4BCQA 2PZ5A 3FKOA 4TY1A 5AR2A 1QPJA 2YEXA 4B4LA 3FAAA 4F7SA 3QZHA 2RGPA 2B9HA 4FSTA 5BVEA 2OIBA 3C13A 1RQQA 4HGTA 4XUFA 4RX9A 4BDJA 2CPKE 3BEAA 4IVAA 2XKFA 3RWPA 5CT0A 3FZOA 3V5JA 4BKJA 2VTQA 3D5UA 3TV4A 1ZYLA 4BI1A 1KV2A 4I6HA 2ZMDA 4K2RA 2IPXA 1OITA 4FC0A 1K3AA 3KKVA 2R3MA 3RZBA 5AA9A 3H30A 4QPAA 4RA5A 3GBZA 3UZRA 5AM7A 4S31A 4AWIA 5M4UA 4G1WA 4U79A 4K33A 4YR8A 3QBNA 3RAIA 3B2TA 5ETCA 2LGCA 2PULA 5IQHA 4JBPA 1Q97A 3D15A 1SVEA 4AU8A 2WFYA 5H2UA 2HWPA 3L8SA 4CYIA 5BPYA 5FG8A 1QPEA 4MNEB 1KE6A 4FMQA 4FIIA 3KULB 4F7NA 3W32A 3RPSA 4USFA 3P7AA 4M66A 2WTDA 3ZRLA 1M52A 2XF0A 4BN1A 1PXNA 3D7ZA 4QMZA 3RKBA 3CIKA 3RK5A 5C8MA 3SG9A 2JIIA 2VN9A 3F5GA 5BYZA 5A4EA 4ORKA 1YRPA 4EH8A 5HG7A 5DEYA 5L2QA 1Y8GA 4DG0E 1OL5A 3SKCA 3W18A 5ACKA 2EU9A 4MF1A 4OR5A 4XOZA 3NNWA 5LJJA 3NUSA 4M97A 3UP7A 3WBLA 3A7JA 4QMLA 5IH4A 2FSLX 2UZDA 2BIYA 2W99B 3UVQA 3HP5A 4NCTA 3KULA 5L6OA 4ANOA 3OBJA 3HRBA 4XG2A 5DWRA 2C6KA 3MFRA 3SD0A 5DT4A 3F7WA 3PSBA 3QKMA 4MQ1A 5DN3A 4WNMA 4UMRA 4O1PA 5E8ZA 4JX3A 3UOLA 3I60A 5FM3A 2ZB1A 5A54A 3CXWA 3WE8A 4CCUA 4QMOA 4D2SA 3KK8A 2C5XA 4FT3A 4FKSA 2FSTX 5GNKA 4L67A 3CD8A 2V55A 2YDKA 3G0FA 3Q04A 4DGGA 4JLCA 5GIOE 2YLEA 2XNNA 3LCDA 3RAHA 3TDWA 2W1FA 5IH6A 3TI1A 3MPTA 5FXSA 4FIEA 4E6DA 1WBWA 2UZWE 4FBXA 3A60A 5CVFA 2B54A 5LOHA 4ZY6A 4KINA 3E62A 3ODYX 5K4IA 2ZV8A 4DH7A 4X0MA 5AP3A 4EOOA 4MHAA 4ACGA 2VAGA 4EEVA 4EJ7A 4ZTLA 4J52A 3GB2A 3VULA 2VUWA 2BCJA 2WGJA 3R7GA 4S2ZA 4YNEA 4U44A 4IADA 4U8ZA 4C58A 5CF5A 2ERKA 4ARKA 5BMSA 1WAKA 1WBPA 2CGVA 2OZOA 2PE2A 2BRNA 4IJPA 4PNKA 4EWHA 5HORA 1JQHA 3MTLA 3R8PA 3R1SA 4ZLZA 5BYLA 4GMYA 2UW3A 3Q96A 4EQCA 3VQHA 3UG1A 3H9OA 3PG3A 4W4YA 4XV1A 5AR5A 5HICA 3GFEA 2XK3A 3NAYA 1L8TA 3LFBA 1IAHA 3BHHA 3PG1A 3EN6A 4H39A 4ZTRA 4JQEA 2PVLA 4GK3A 3R7IA 4ANLA 3NIZA 2QO9A 4UWCA 3HL7A 4BZDA 3BYMA 3T3VA 3A2CA 5HCYA 1UKIA 1SNUA 2HCKA 4KKEA 3OCTA 4YZNA 2PUNA 4XRJA 3GT8A 2IVSA 2E9PA 3LM5A 3AGMA 4EYJA 2FH9A 3HV6A 3NNUA 5DT0A 4WD5A 2QI8A 3BI6A 3QUDA 4BDAA 4WSQA 4CFUA 4A4LA 4JI9A 5H8BA 2VTHA 2W9FB 4ZTMA 5LCJA 5HVJA 2X1NA 5A3XA 5M09A 4ALVA 4LMNA 2QHNA 2WPAA 3VW8A 4UN0C 5EDPA 4WOVA 2WMSA 4AGWA 2VTJA 4MXXA 4BYIA 4D9UA 3COMA 3D2IA 5A4LA 4ZOGA 5BQ0A 2J5FA 4O2PA 5AP6A 2YCQA 3BU5A 2JDRA 5EH0A 4TYHA 4GCJA 4HVDA 4QP7A 2VTIA 2FUMA 2Z7RA 4PL3A 3QA8A 4NFNA 3ROCA 4DTKA 1WMKA 4QNYA 2P3GX 3ORTA 2BHHA 4LI5A 2JFMA 3MBLA 1E1XA 4MNFA 3RPYA 3QD4A 1BL7A 3F5XA 3C4EA 3GI3A 4PL5A 2R4BA 4LOPA 4WO5A 1OIUA 2YFXA 3VS7A 5IUHA 1NVQA 4DE4A 2DYLA 5EI6A 4AT5A 2QQ7A 4C02A 1YXTA 3IW6A 2R3KA 4FTCA 4HNIA 3MYGA 2UZLA 2BFYA 3ACJA 5AUWA 4BIDA 5DYJA 1YWNA 1P4OA 3KMMA 5EM6A 3QTXA 1ERKA 1URWA 1LUFA 5CX9A 4EOMA 2DUVA 4M0ZA 3ETAA 4IM0A 4YJTA 5AUTA 3OTUA 1JKSA 3QCQA 3FLQA 5J87A 1U46A 2X8EA 4D4YA 4FEUA 3R01A 1Y6AA 2X8DA 5ANDA 4QQTA 3E8EA 3P7CA 4D55A 1R78A 4J8MA 3DA6A 4AE6A 3Q9WA 4N6ZA 4ZSLA 4FSZA 4L7SA 1J7IA 2GTNA 2WMUA 1GAGA 2GHGA 5AAFA 5L2WA 2GFSA 2F2UA 5HIDA 2WTKC 3QC4A 3THBA 4QNAA 3Q4UA 2F9GA 3KRWA 2HYYA 4O6EA 2CJMA 3S0OA 5KCVA 2UZTA 4H1MA 5HIBA 4QMSA 5JMSA 3GCQA 4F9YA 1GZNA 1OL2A 4C3FA 2ERZE 3CBLA 1YWVA 3R1QA 2OSCA 4QYHA 4IANA 3NZ0A 4E3CA 3O51A 3FPMA 2EWAA 4RVMA 4CXAA 5AUUA 4AAAA 4YJVA 3DDPA 5HGIA 4FVPA 1REJA 4RRVA 4IM2A 4DEGA 2X39A 1W7HA 4Y83A 2ZVAA 5HO6A 3WI6A 2BZKB 2UUEA 3U4UA 5CVGA 4C38A 5BVOA 1NA7A 1XJDA 4AZFA 4H58A 3TM0A 4GK2A 3C9WA 1PMVA 1YDTE 3P9JA 3UVPA 3BZ3A 4LV5A 4D2WA 1CKPA 3G6GA 3U51A 3EIDA 3OBGA 2C47A 1YHWA 3FL4A 4KKHA 4BTFA 4JIKA 3LVPA 3PE2A 2YCRA 3VS0A 2Z7QA 2Y0AA 4ASXA 4BGHA 3L9PA 2HIWA 2O65A 4YBJA 2WD1A 4ZMEA 5CVHA 3BEGA 4WUNA 4XBUA 2QCSA 4BVUA 4M0YA 2ZAZA 4ANSA 2KULA 3B8QA 5DLSA 3NCGA 3ORMA 4XG3A 4WUAA 1VJYA 2ZJWA 3NW6A 4G3GA 4NW5A 4O0SA 4QMUA 3VS4A 2CGWA 2PZIA 2XNEA 4F0IA 2B4SB 1K9AA 2YAAA 2BIKB 3JS2A 3P79A 4W4VA 3EYHA 4IB5A 5M44A 3F88A 1L3RE 4IB0A 3OC1A 1OBDA 3PXFA 4IQ6A 3CTQA 4ZS0A 1WBNA 5ANJA 3BHUA 2B52A 2BDFA 4FL3A 5IKWA 1MQBA 4UWBA 3NGAA 3UO4A 2G15A 5LVOA 2C6IA 3VJNA 5DMZA 2W1CA 4CVAA 2CKQA 3GU5A 3PXRA 2BVAA 1M17A 2G1TA 3PY0A 4HJOA 3TZ7A 3QZGA 5HTIA 3PA5A 1ZOEA 2C5VA 4MAOA 2QC6A 4IX3A 4NM5A 4L68A 5KUPA 2ESMA 3EB0A 4M8TA 1R0EA 2B9JA 3OZ6A 2WQMA 4ERWA 3V5QA 3DK6A 1BX6A 4FZDB 5B2KA 4C59A 5HESA 2QURA 4FKRA 3UPXA 4BIBA 1J1BA 2OJGA 3TZ8A 3W10A 5ANKA 4AOJA 1O6KA 2R3QA 3D83A 4MWIA 2XJ1A 2WQEA 2X0GA 2YJRA 4C3PA 4DEEA 4D2PA 3KXXA 3PA4A 4RJ6A 5AP0A 5FP6A 2XS0A 3JVRA 2ZMCA 2YIXA 3RAWA 4NWMA 5EOBA 4V05A 3UG2A 2C6LA 3RHKA 4AGUA 4EYMA 3AT4A 2F7ZE 3UPZA 5HVYA 4F6UA 3F61A 3FUPA 3ZUVA 3QGWA 4G5PA 1JKLA 2F2CB 4IVCA 2XKDA 3SXSA 5HE0A 2GNFA 2YCSA 4EC8A 4FKGA 3KN6A 2QG7A 4YO6A 5ETAA 2HELA 3SRVB 4UWYA 4CCBA 4F0GA 4YGAA 3R9RA 3QKLA 4F9BA 2FVDA 2RFSA 3KU2A 1J91A 3KC3A 3UNZA 1JVPP 3OXZA 5M51A 4E4LA 4XG8A 1UV5A 4E6AA 4EHZA 3E64A 4L44A 3I6UA 4A06A 5AUYA 2I0HA 3F3TA 3PP1A 3TKIA 3ZBXA 5CALA 2QOLA 5FTQA 4BHZA 4JR7A 3GU8A 5M4CA 3IOKA 5A4TA 4AA5A 4NKSA 2A1AB 3E3PA 4FG8A 3MB7A 4FL2A 3I6WA 3QYWA 4IWQA 4ZTHA 4EHGA 4HYUA 2Y9QA 1XQZA 4KWPA 2C5OA 2W96B 3A4PA 3Q5IA 4RG0A 3TNPC 5A9UA 5FDPA 1OZ1A 4W4XA 4FOCA 3ZC6A 5CI6A 1CKJA 3EYGA 2CKOA 1PXLA 4FSWA 2FYSA 4RC4A 4EWQA 5DRDA 5HTCA 4QTAA 2YACA 2H9VA 1I09A 5CSPA 3HUBA 1YXXA 3AC3A 3SOAA 2ZOQA 2Y4PA 3G9NA 2ZM1A 3HDMA 5JGBA 4N57A 2PHKA 3L9LA 4ZEGA 4L7FA 5D10A 2PTKA 4BGQA 4O22A 5CU2A 4IM3A 1MUOA 4QMXA 1FVTA 4O7TA 3A62A 5I9ZA 3V8WA 4IX4A 4I6FA 4NSTA 3EN7A 4TYHB 3S3IA 3R22A 2ITQA 5CI7A 4PNIA 2G2FA 4ZLYA 1OGUA 2PVHA 4M14A 5IH5A 3TNQB 4QP4A 3UQCA 1OI9A 1APME 1MP8A 3R73A 4BI0A 4D2RA 4QMVA 4E1ZA 4FKTA 5E8XA 4KKGA 2VGOA 1SNXA 4L42A 3FC2A 4V01A 4JNWA 3DV3A 4QOXA 3PJ8A 1JPAA 1ZZ2A 3W2PA 3O2MA 2XIRA 4TYJA 2P2HA 1TQPA 2JIVA 2QONA 3FZTA 1V0PA 3JYAA 5AUXA 2WO6A 3C7QA 5E8TA 4DEHA 2XYNA 4FKWA 5FEDA 2GTMA 1R1WA 2QLQA 3VVHA 4BCKA 4B8MA 2GS6A 1NVRA 2WOTA 4FSYA 2VTRA 2EB2A 3BLQA 3DBEA 3KCKA 3ORIA 1F0QA 4OTWA 4XP2A 4ZJIA 3H9FA 3TWJA 4JJRA 3WZDA 2V62A 4TWNA 3I7BA 2UZNA 4YTCA 3E5AA 5CEPA 4F09A 5AIRA 5K5NA 1Q61A 2IW8A 2W1HA 4GFMA 4XLIA 4CG8A 3BYUA 2J7TA 3OF0A 1ND4A 4CLIA 3E7OA 4NCTC 3LFSA 3NYXA 4OTIA 1OKZA 2VWVA 3KXZA 3Q4CA 4RX7A 1XWSA 4FICA 4IVDA 3BX5A 5G1XA 4BBEA 4YO4A 5HG9A 2IG7A 2WIPA 4AQCA 3MY5A 4YLLA 2XM8A 4BCPA 1DAWA 4Q5HA 3VIDA 2Q0BA 1H28A 2PUUA 2PVJA 2W5AA 3FMNA 4CRSA 4FV5A 2QNJA 3L8XA 4XH6A 3WZKA 1PRYA 2XA4A 5DPVA 3OVVA 1JWHA 1G5SA 2YISA 4L6QA 5IPJA 3H0YA 1RJBA 2W1ZA 3CCNA 3LFCA 3QQGA 4LOQA 3WOWA 4USEA 3A7HA 2C3IB 2O3PA 3KF7A 1KOBA 3NR9A 4RJ7A 3DDQA 3ZLWA 2J0MB 3BLHA 2QVSE 1IRKA 3R9NA 3DJ7A 3UE4A 5I0BA 3FKNA 2BZIB 4QMTA 4F63A 3ANRA 2C5NA 3ODZX 5CSVA 3IKAA 2XJ2A 3NVMB 3PPKA 4QP8A 5F20A 5M06A 3SXFA 4NJDA 3OWKA 4XJ0A 3V01A 4IX5A 3O7LB 1HCKA 3R2BA 4X3JA 5EQYA 4RVKA 4BICA 3OWPA 2QHMA 3WYXA 3V5WA 4BBFA 3HMMA 3G2FA 3ZH8A 1WVXA 4O86A 3SAYA 4RFYA 5IMXA 1CSNA 4M7IA 4LGGA 3W2CA 2WNTA 4IZAA 2EXCX 3EFWA 3HX4A 5C8NA 3Q9XA 5I3OA 4BDEA 4FV0A 2GNGA 3V8TA 5CT7A 5CTPA 2X7FA 4GG7A 4MD7E 3LXKA 4E8AA 2YM6A 4PQNA 3RJCA 5EQEA 4BWKA 2VTNA 4UMPA 5C8KA 4W8EA 5D9HA 3F9NA 5F95A 4LUEA 3SC1A 4FT0A 2C4GA 4GT3A 3IPHA 3F3VA 3L8PA 4FTAA 4BHNA 4QTDA 5JGDA 4YHFA 3HAMA 3KRXA 4C2WA 3MB6A 4EQMA 5HTBA 4QMWA 4NM3A 2VWXA 4UBAA 3D5XA 3A61A 3BQRA 4QMMA 4RIWA 1F3MC 1ZZLA 2QOOA 3QQJA 2ITVA 3WIKA 2OIDA 2LAVA 4LM5A 2H34A 4DFZE 3U54A 1Q99A 4RA4A 4CSVA 1Y57A 2WTKB 2WB8A 4DEIA 4WNPA 3FHRA 3QGYA 3NLBA 2RKUA 2XIYA 3O96A 4F1MA 1H08A 2W1EA 3GU7A 4NL0A 4A9TA 3BRBA 3D9VA 5HG5A 4YJQA 3W2RA 2JAMA 4O0VA 1BLXA 5HE3A 4L53A 3PWDA 1I44A 4CZTA 1WVWA 1FINA 4JBVA 3JVSA 4C61A 1XO2B 3C0IA 4E20A 3OW3A 1PXOA 5LVLA 1W84A 1Q3DA 2BDWA 2O64A 3L8VA 4RIYB 2OJ9A 2J0JA 2F4JA 3FLWA 3MS9A 4TYEA 4X3FC 3MSSA 4JBOA 4Y72A 1OM1A 2W4KA 2BAKA 1IG1A 4BCGA 5JGAA 3LQ5A 3U9NA 3Q60A 4XG6A 4PDPA 1PXJA 2VX0A 1DAYA 3BLRA 3EFLA 4ZLOA 2B0QA 4U3YA 3DZQA 3A4OX 3FV8A 5H3QA 5JFXA 1FGIA 2A0CX 4FIHA 2B9IA 3PJ3A 2C6TA 4UMUA 2WELA 3DKGA 5HQ0A 1KSWA 3PP0A 4EZ3A 4R3PA 3PDTA 3ERKA 3MTFA 3HRCA 2W1GA 2Z8CA 4MXCA 1OKWA 1TQIA 4B6LA 4O0TA 3TT0A 4ZIMA 4K18A 4FODA 3VUKA 3U9CA 1WBSA 4XMOA 1Q8WA 2QU6A 2OXYA 3R8VA 3QHRA 1PJKA 5E8VA 4YUQA 5CAOA 2IJMA 3SHEA 2X6DA 3DK7A 3K54A 3QRIA 3TCPA 3DQWA 4IZ7A 3VQUA 2X9FA 3DNEA 2HOGA 2OFUA 3FQEA 2X4FA 3F3WA 2XVDA 3MY0A 2A19B 4AFJA 3RALA 5HLPA 4I20A 2WU7A 5KMJA 4IAIA 4AS0A 2PMIA 3WYYA 3EQPA 2C0IA 3RM7A 2NNWB 2HY81 4YU2A 2JKOA 4HZRA 2J51A 4UXQA 1OUKA 5FBNC 1QPCA 2BAJA 3WIGA 4F9AA 2QKRA 2VX1A 5C27A 4TL0A 1ZARA 3FHIA 3GCSA 4MD8E 4O0WA 2YZLA 5EYMA 3BU3A 4ALWA 4FV3A 2WMQA 4BY9E 3A7GA 4PUZA 3NUAA 4RMZA 4ZSAA 2QODA 4C4FA 5LMKA 3HMNA 1H4LA 2PZYA 3PPZA 5ICPA 3P08A 3GC8A 5EFQA 2RF9A 4HVIA 3OCSA 2O8YA 5HU3A 3CGFA 3QQFA 4MVFA 4E4MA 4FT9A 4CYJA 4GKHA 3ITZA 3HZTA 3ZLSA 4JXFA 3WF5A 1Q8ZA 1FVVA 2WMTA 2OK1A 4XV9A 3UVRA 4YBKA 1UU7A 3CKWA 3RPOA 3II5A 1H26A 4BIEA 3I79A 5LWMA 2REIA 2R3LA 3E87A 4I4EA 2WXVA 5CXHA 1PXKA 4EK4A 5IQBA 3MVJA 1JBPE 3C4WA 4H3PA 1OL6A 2BDJA 2BZJA 3B2WA 1W98A 2J4ZA 5EHLA 3UOKA 4RFMA 2C3JA 4RC3A 4D4VA 5GZ9A 1UWJA 4RJ3A 4FVQA 2ITXA 5DRBA 2PZRA 4I5HA 1KWPA 3QUEA 2VO3A 4U42A 3Q2MA 3FBVA 1WBTA 4AA4A 5IQGA 3MVMA 2OJIA 4HPUE 2YITA 4OTRA 3PRFA 4CFFA 3NYNA 4EZ5A 4L8MA 4EK5A 3Q6WA 4IHPA 3BE9A 1PYEA 1UWHA 2E9NA 4YJUA 3DPKA 1Q62A 2GNLA 2G9XA 5GHVA 3AD5A 5IEYA 3QWJA 4R7HA 2NRYA 3TACA 2C6DA 4DH5A 4ITHA 5I9WA 3U6IA 3AD4A 2I0EA 4EOJA 3O0GA 2X2LA 3FZSA 2IO6A 3MJ1A 3O8TA 1DI8A 3F66A 3DGKA 3VUHA 2BKKA 3NW7A 3HA6A 5HD4A 4FV8A 4LRKA 3AC5A 4O7NA 4C2VA 4EH9A 4JG7A 4KBAA 4F9CA 3R1NA 3LW0A 4E6QA 3MPMA 4XBRA 2XB7A 4XEYA 4BTJA 4QMQA 4FTTA 1XR1A 1BKXA 4JRVA 4YZDA 3IDCA 4G2FA 4C0TA 4FTNA 3G51A 3FJQE 3UNJA 3ZTXA 4BL1A 3IW8A 2WTCA 4UX9A 5IDPA 4X2GA 3PZHA 3GC9A 3F2AA 4QYGA 5CEMA 2A2AA 5C4KA 2DQ7X 4HYIA 5A46A 3LHJA 4AGCA 3LCOA 2R0IA 2OZAA 2BPMA 2VTPA 5AUZA 3EL8A 3VS6A 5KKRB 2XNGA 3QCYA 1JKTA 3I0OA 3EQIA 2R3RA 1XH8A 3ZYAA 4I4FA 5EW8A 1WFCA 1ZXEA 4I1ZA 5GJFA 5TO8A 1P14A 2GFCA 5ETIA 4DBXA 3QAME 2CLXA 4NIFB 4RGJA 4BGGA 2RG5A 4CFMA 5CAPA 3ZO4A 5KMNA 5KMIA 3QQHA 2PY3A 3AMAA 3C4FA 3UODA 5GJDA 4DEBA 2YM8A 3ZO3A 2XYUA 2RFNA 2P33A 2HXQA 2BZHB 4IAAA 3VN9A 1B39A 3PUPA 4FKLA 1SMHA 3PLSA 4M15A 4YHJA 3TKUA 3VHEA 4WNOA 1LPUA 2AC3A 4B7TA 1XBAA 3MA3A 4AT3A 4DFNA 2PVFA 2GQSA 2PMOX 3W8QA 3PVBA 4MKCA 1E9HA 5HKMA 4FGRA 3G6HA 4IACA 1FMKA 3Q4ZA 5EK7A 1STCE 3SW4A 4IWOA 1ZOGA 4EH7A 3HV3A 4J96A 4YC3A 4FNYA 2C1AA 3OCBA 4NFMA 4F99A 4M69A 5HLNA 4L3PA 4IEBA 4O2ZA 4CFVA 1WBVA 2HZNA 5IDNA 2I6LA 1OUYA 3QTWA 4BDGA 4JL9A 1NXKA 2O2UA 2WTJA 4MX9A 4GEOA 4GV1A 3GU4A 4RT7A 3OY1A 4I5CA 4NTSA 5FLFA 3LXLA 4ID7A 4TNBA 4AW2A 4GT5A 2WMVA 2W5BA 4AN3A 3GOKA 4O82A 1OECA 1OL1A 3ZLXA 2C69A 4UYNA 2FSOX 4RIXB 1U59A 2JKKA 3AXWA 1XH7A 4PP9A 1H27A 4IXPA 4JS8A 4M69B 4A9YA 4Q9ZA 4NYEA 3OY3A 1H1PA 5IUGA 1Q41A 4KIKA 1MRUA 2QOBA 4XV3A 2E9UA 1H1WA 4P5QA 3MFUA 4U43A 4F7LA 3F5UA 3MIAA 3VHKA 2I40A 3MI9A 4ITIA 5FEEA 2JBOA 3RZFA 3UIUA 5TKDA 4ASDA 4F08A 4GYIA 2R7IA 3P86A 3QD3A 4FUXA 2W9ZB 3Q32A 4G9RA 4R1YA 2IZTA 3EOCA 1OKYA 3C4CA 3JUHA 4MBJA 4ZJVA 1F5QA 1XH6A 1RW8A 2HZ4A 3GU6A 3UZPA 5LXMA 1FOTA 3C5UA 5AUVA 3UJGA 1ZMUA 2VO0A 3QRKA 3OOGA 3PJ1A 1W83A 4EC9A 3R8ZA 2JAVA 1H24A 5JKGA 1R0PA 2OBJA 4E4NA 5CAVA 4I3ZA 3ELJA 3EZVA 2J5EA 4QT1A 4ZS4A 2UZEA 3V6SA 3CQUA 2XEYA 3GENA 4U40A 2OFVA 3O23A 4ZZOA 3A7FA 5B2MA 4FR4A 2AYPA 3FDNA 1XH5A 5HO8A 2XIXA 4DFLA 3FLNC 3PTGA 5DR2A 3V51A 3OHTA 4FKJA 5JZNA 4AGDA 2RFEA 3E8NA 1WCCA 4IZ5A 3EN4A 4C57A 4ZY5A 3KREA 4WG4A 3FMDA 5IU2A 1U54A 3I4BA 4RQKA 2R9SA 3QA0A 3ZSHA 5K9IA 3HNGA 2YWPA 5DVRA 3GCVA 4J7BA 3W55A 4O91A 4BDDA 4YTIA 3TXOA 3O8PA 4MQ2A 5CEIA 2VO6A 1XH4A 4BKZA 3PYYA 4YSMA 3TNWA 3BBTB 3OD6X 4YJSA 4L3LA 4FTQA 4OW8A 3D5VA 4MH7A 3RCJA 5FDXA 3CEKA 4BKYA 2R3IA 4PMMA 2RIOA 5EOLA 4PPBA 4HCVA 3UOHA 5F4NA 4TRLA 4AF3A 3U8WA 2JD5A 4CKJA 4DFBA 4YC8A 2V22A 4G6LA 3BBWA 3TV6A 1H25A 1XHAA 4DT8A 2BFXA 2IVUA 2R0UA 3LFFA 5EI8A 3UMXA 3F5PA 3ACKA 5AV1A 4DFUA 4PV0A 3HV5A 3PVGA 1M7QA 4QRCA 1OIQA 3PXZA 2Z7LA 1VEBA 3SDJA 2YERA 2VGPA 3ZO1A 3N9XA 1YHVA 2BILB 4DN5A 2XIKA 3RPRA 1GJOA 4DGMA 4X2JA 2ITWA 5KNJA 4M67A 4O0RA 2PZPA 5J1WA 3ZZEA 4PMSA 5E1EA 3UDBA 1PW2A 4ACHA 4Z7GA 4XG9A 3BKBA 4O96A 2PMNX 3OS3A 3ATSA 1FGKA 3WE4A 5BMMA 2QOIA 2RL5A 4HPTE 4MBIA 4BCJA 5CZIA 3UC3A 3S2PA 1U5RA 4UZDA 5HHWA 1JAMA 3RGFA 3ZSIA 3LLAA 1YVJA 5T6KA 4U81A 2NP8A 4WIHA 5I9UA 3BHYA 4BF2A 3W2SA 5AP2A 3S95A 3Q6UA 2YHVA 2F57A 1M2QA 3EKNA 4CMTA 4AZVA 4OGRA 1ZYSA 4EJNA 4GUEA 3SX9A 3VBXA 4O7WA 3BGQA 5DR6A 5BYYA 4WA9A 4ACMA 3LFEA 3M11A 4FT5A 3FYJX 3JXWA 5HE2A 1YI6A 3BV3A 5KBQA 5M08A 3RI1A 1PMUA 5DBXA 3EQRA 5CNNA 2FSMX 4QQ5A 3KK9A 4IIRA 4BCIA 3PZEA 3PXYA 3QLGA 5AP1A 4F64A 5CU6A 4MCVA 4FIFA 1BUHA 2XIZA 2PPQA 3UMWA 4DGLC 3GFWA 5HBJA 1GIJA 4EKLA 2HW6A 4YJRA 3FXXA 5AR4A 4APPA 3HLLA 4C4EA 3MIYA 2B7AA 2BALA 2IZUA 3VUGA 4KIQA 2R3JA 3QZFA 4BRXA 5AM6A 2C68A 1IEPA 4HVGA 3HAVA 3NIEA 4FI1A 3NMUF 1JSVA 4CT2A 3Q53A 1U4DA 2XJ0A 5BNJA 5JFVA 3R8UA 3P1AA 4GFGA 4XP3A 2I1MA 3MA6A 3LKMA 2F7XE 3VUTA 3DKCA 3ENHA 5J95A 3E8DA 4J99A 4RIWB 3FYKX 4BCFA 4E5AX 1CM8A 2XCKA 2PE1A 4FSNA 4IZYA 1M2RA 3ZFMA 4F70A 4YURA 5FUTA 4UZHA 2CN8A 3DQXA 3C0HA 3NNXA 4FUYA 1WVYA 2C6OA 1XBCA 3RWQA 2WKMA 4LQMA 5EM7A 5L8KA 3VUIA 2QO7A 4V0GA 5A14A 4O7VA 4PWNA 3V5LA 3PE1A 3LXPA 3SLSA 4I0RA 3VRZA 5BX0A 5JSMA 1ZOHA 1Z9XA 3OEZA 3RVGA 4ASEA 3LQ3A 2XNOA 4JRNA 4JDIA 1GIIA 3ZUUA 1Q8YA 3DXPA 4IC8A 2Y4IB 2VWZA 2XKEA 3O8UA 3K5UA 3WZUA 4OAVB 5G6VA 3PA3A 2IW6A 4K77A 3E3BX 2FA2A 4FYNA 4JG6A 4BDCA 4J71A 5FTOA 4DINA 3AC2A 4RIYA 3TUDA 4FE2A 2JITA 2CDZA 3QUPA 4IAZA 5FQDC 4NZWB 3CPCA 4GVAA 4NUSA 3V6RA 1ATPE 4LRJA 3CPBA 3KF4A 4YHTA 4BWXA 3IECA 4FVRA 3VC4A 5F94A 3KXNA 2J9MA 3NX8A 5LVNA 4LG4A 5LARA 5IQEA 4Z55A 3R04A 4F7JA 4FG7A 4FX3A 4D2TA 3OROA 4U3ZA 2GCDA 4Y73A 4XG4A 2BUJA 4ONAA 3H10A 1JKKA 2CKPA 2PWLA 2WIHA 2CSNA 4CZUA 3NUYA 3HGKA 4RJ4A 2UVYA 4DFYA 2ZM3A 4S30A 3F82A 4YTFA 1ZLTA 4B0GA 4TWCA 5A6OA 1QPDA 3KY2A 3UIBA 1JNKA 1Q4LA 3NUPA 3QRUA 1H1RA 4FTMA 4KRDA 4PPAA 5DE2A 3IG7A 3IS5A 5EHYA 3A8XA 4BDFA 3QCSA 2Y7JA 5HO7A 4XRLA 3VBWA 4J8NA 2WU6A 4BBMA 1Y8YA 1X8BA 2PMLX 2JGZA 3H3CA 3QKKA 3I5NA 4MXAA 1BMKA 4X3FB 2GS7A 3WZJA 3JPVA 4I94A 1G3NA 4O7RA 4JQ8A 3CJFA 3TV7A 3MH2A 3QX2A 3D4QA 3Q9ZA 2UW9A 1BYGA 4QD6A 4CFWA 2RSVA 4CQGA 1KE8A 2OGVA 3NUXA 4YJNA 4E73A 5HIEA 1M14A 5GIPE 5C01A 3MY1A 4JQ7A 4UXLA 3EFKA 3NPCA 5AV0A 1Y91A 5JZJA 3GGFA 2X2KA 3T9TA 3DJ6A 4R7BA 4TW9A 4X2KA 2GQGA 4Y5QA 1IAJA 4G16A 4RFZA 2YAKA 4M68A 3SW7A 4ZP5A 4BDKA 3QD0A 4A9SA 1CKIA 4QO9A 4ZSJA 2A27A 2QD9A 1U54B 2XRWA 4RZVA 1PMNA 5GJGA 4UALA 4GSBA 4QMYA 3SOCA 3ALNA 2GNJA 2P55A 4BTKA 5CASA 2OICA 1UU3A 2WQOA 2C6EA 3BU6A 3QCXA 3ZZWA 5JH6A 4CTBA 3RK9A 1PKGA 4W9XA 3V04A 4BCMA 5GZAA 5ITAA 3TTJA 1KUTA 4U0IA 3EHAA 3NUUA 4CFXA 4CLJA 5C1QB 3F3ZA 1ZAOA 1A48A 2BTRA 1O6YA 1H8FA 2P0CA 4USDA 2UVZA 4UEUA 3VAPA 2XK6A 1JLUE 2OXDA 3VBVA 4NU1A 3BWJA 1A9UA 4FZ7A 1AD5A 2J0IA 4XOYA 5AIKA 4LGDA 2XP2A 2QOCA 3BHVA 3MV5A 5EYKA 3VUDA 5KO1A 4WRGA 4LGHA 5LQFA 3CS9A 3FC1X 2WTVA 4BCHA 3K3JA 2Z7SA 5I9YA 2OH4A 5IF1A 4L43A 4JDKA 5E9EA 2OLCA 5J7HA 3QQUA 3FL5A 4ZZNA 2PVRA 5LMBA 2R3HA 2WEVA 4EK8A 3NYVA 5IA4A 4HYSA 3A7IA 5DG5A 2EB3A 3UP2A 4EOPA 5A4CA 3OWJA 3LFQA 4Y8DA 5CEKA 2R3FA 4CV8A 2VTLA 3LMGA 5HNIX 3CLYA 3QL8A 2WQBA 3KEXA 4KNBA 3TKHA 3BWFA 2JEDA 1VYZA 3ORLA 4WNKA 3W2OA 1ZRZA 5IMEA 2YN8A 3PSCA 3VUMA 3DNDA 1Z5MA 4E6CA 3DBFA 3EL7A 2ONLC 2RG6A 4QTCA 4F6WA 4F9WA 5EQPA 3ZRKA 2R3GA 3LFDA 4J95A 2V5QA 2X7OA 4TYGA 5AP7A 5ETFA 4FEXA 4ALUA 3PVUA 4FF8A 3ZU7A 3D94A 4RLKA 3KB7A 3Q9YA 4I0SA 4YZBA 3FQHA 5T68A 4EQUA 2WTIA 3K5VA 4D5KA 3FZRA 4L45A 4S32A 1SVHA 3VW6A 3BCEA 5KZ0A 5KBRA 1E1VA 4X6QC 1QL6A 2BAQA 5DOSA 3ZLYA 4GT4A 5CZHA 4BWPA 3BGZA 4PP7A 4ZTSA 4F4PA 5IG1A 2BRBA 4FT7A 4IMYA 5F1ZA 3GQIA 4DBNA 3LLTA 3DB8A 3LE6A 5JFSA 3LMIA 5DI1A 4U9AA 4RLLA 5AR7A 1RDQE 4S34A 4FIGA 3KQ7A 4GK4A 2WTWA 4WKQA 5K4JA 4EUTA 4PDYA 3DLZA 1V0OA 1H1QA 3FQSA 4FTJA 4P90A 4RSSA 5EM5A 3TUBA 5EDQA 4X21A 2OF2A 3FLZA 4H36A 5FD2A 1UU8A 2VWIA 3PIZA 3ZXTA 2F7EE 5IZFA 4V0GB 4RWLA 5CU4A 1FMOE 5E8YA 1MRYA 4JG8A 3B8RA 4JBQA 3ORKA 3CKXA 4YZMA 4YZCA 5ANOA 3EJ1A 4JDHA 2HENA 4FV6A 5TE0A 4FKIA 3SVVA 4C34A 4K1BA 3QALE 2GMXA 4I23A 4DA5A 1UNHA 4D1XA 3N4TA 4H05A 4I41A 1W8CA 3OT3A 4TNDA 2YLFA 4NTTA 3N4VA 4RWJA 2SRCA 3F7ZA 2WAJA 3BPRA 3UQGA 5TT7A 3L9MA 5ANEA 2UW4A 3UYTA 2VTTA 4DT9A 4O83A 2X2MA 3OUKA 5EDRA 3AC8A 1W0XC 5E90A 4OLIA 4I24A 3D7TB 4FKQA 3DTCA 2O63A 4P7EA 4UMTA 1UU9A 3FZ1A 4IE9A 1T45A 2XCHA 3GQLA 4G9CA 5E8UA 3LZBA 2QLUA 3PY1A 5LMKC 4OTFA 4W9WA 2QOKA 4OTPA 4PTEA 3QF9A 2I0VA 3ET7A 5HNGA 3ROYA 4DHFA 1AGWA 3QZIA 3IK3A 5E8WA 5AP4A 2BHEA 4FEQA 4QP1A 3U6HA 2R2PA 4JAIA 1TQMA 4DH1A 2J0LA 3ZMMA 3R71A 5FBOA 3F2NA 5HBEA 4PL4A 1BL6A 3G5DA 1LR4A 4KBKA 4CNHA 2B55A 3P23A 4CQEA 4D2VA 4NW6A 3RP9A 4BDHA 3LJ1A 4AN9A 4APCA 5AX3A 3EZRA 3OCGA 3OXIA 3WF8A 5KHWA 3NAXA 4EUUA 4L46A 4E5BA 3CGOA 2UZVA 1CMKE 4AW1A 2QR7A 4IBMA 1XKKA 3GCUA 4XHKB 1ZY5A 1LP4A 3NRMA 4GFOA 4CKIA 3AD6A 3AOXA 3EN9A 5HOAA 3R7OA 4RVTA 3ZM4A 4MBLA 2VWUA 3GP0A 2JBPA 5CEQA 2IN6A 3UQFA 1PXIA 1H0WA 4OBPA 5C26A 3EWHA 4ZMFA 1PMEA 2QR8A 4BTMA 5IQFA 5EHOA 5F9EA 3E88A 2DS1A 3F2RA 5LMAA 5H9BA 4R8QA 4C33A 1YKRA 2W1IA 3FMHA 4G17A 2CN5A 4MF0A 3V3VA 4EBWA 1QCFA 4OUCA 4O0YA 4V04A 3T8OA 2E9OA 2UZBA 1Y6BA 3DAJA 1KV1A 4MD9E 4A9RA 4IFGA 2ZDUA 3CE3A 3P7BA 4Q9SA 3SXRA 4FOBA 4O84A 1J3HA 4QP3A 3DK3A 4KUJA 4X2NA 4F1TA 2Z02A 2EXMA 4GIHA 3QWKA 4D9TA 3SRVA 5HX8A 4ACDA 5E4HA 3OEFX 3TDVA 5AADA 1A06A 4BI2A 2X9EA 3DU8A 3E93A 4PMPA 2HW7A 4KSQA 4OBQA 4J1RA 3S4QA 4EZ7A 1ZMVA 2ACXA 5GZ8A 3RNYA 5IQAA 2B53A 3ZONA 1YXVA 3MESA 1ZWSA 2XK9A 3TJCA 1BI8A 3R8LA 1YI3A 3QQLA 2P2IA 4YPSA 2CMWA 1K2PA 4AP7A 3DB6A 4AE9A 1H1SA 4N0SA 5IUIA 4FEWA 4KRCA 3TZ9A 4C4HA 2YM5A 4OTHA 3R02A 4PDSA 2JDOA 4G31A 1PXPA 2XBAA 3FI8A 3G9LX 3CJGA 5FGKA 2CKEA 2Q0NA 5EG3A 3MDYA 1H0VA 4ASZA 3ULIA 2XM9A 5HLWA 1YWRA 2BROA 3N51A 4QP6A 3UGCA 3MJ2A 2YABA 2JKMA 4G34A 3ZOSA 4AUAA 5KKRC 3BYOA 4WHZA 4FSRA 4TT7A 5ANGA 3ULZA 1JSTA 3EQCA 4JOAA 2YM7A 3EKKA 3LMHA 4R1VA 4CD0A 4KA3A 3IONA 4YC6A 4EOKA 2H96A 2H8HA 5E92A 3VWAA 1UNLA 3FLYA 3CSVA 5HVKA 3TG1A 2W06A 3T3UA 3C1XA 4E93A 4CEGA 3K3IA 4Z16A 4C37A 3SGCA 5D41A 5AAGA 4DITA 2BRHA 3DFCB 1PY5A 4PF4A 3TJDA 2YIYA 2V7OA 3GXLA 4G3CA 4HVHA 3OW4A 4XNEA 2JDSA 4BB4A 2CNUA 4Z7HA 5TR6A 3BGPA 3SG8A 2R5TA 4EBVA 4H1JA 1CDKA 3ORZA 5AV2A 5M53A 4R77A 4RWKA 4BDIA 4AG8A 4FK6A 3U6JA 3UZTA 1Q8TA 2YIQA 3NDMA 1SZMA 3PWYA 4LL5A 4OT6A 4C35A 4RZWA 4BZOA 4HCUA 3AMYA 1G8SA 3FMKA 4GIIA 1OL7A 4IJ9A 3DLSA 1VR2A 2UW7A 4H3QA 3R0TA 4AX8A 3I81A 3OT8A 4WRSA 3IDBA 3MFSA 4B8LA 2VX3A 4NT4A 4FSMA 2CCIA 4NEUA 4EONA 4DLIA 4R3RA 4ZXTA 2OJJA 3IOPA 3UO5A 3ATTA 4PTCA 4OTDA 4C8BA 4BR3A 4MXYA 4CGAA 2ITYA 2Q83A 5JN2A 3DXNA 5M4FA 3H9RA 5FTGA 3DTWA 3AQVA 5DHJA 4UV0A 5IEVA 4EH5A 3KVWA 5AR8A 2ITZA 4DLJA 3EH9A 3NEWA 5FRIA 3Q4TA 4AA0A 4GU9A 4KS7A 1P2AA 4GKIA 2QG5A 3NW5A 5K5XA 5LWNA 3TEIA 3QTQA 4FV1A 4Y46A 4YLJA 5IA3A 3F69A 5DFPA 3LFAA 2Y6OA 3FSKA 4FNWA 3KXHA 2WEIA 5J79A 5M4IA 1OIYA 4MWHA 4PDOA 3ALOA 2XRUA 3G90X 3DOGA 4FV4A 4ZSGA 1O9UA 4ZK5A 2Z2WA 5ACBC 3DT1A 3GEQA 4GVJA 1UNGA 2IZRA 3FMEA 4MYGA 2PVYA 2F49A 2C5YA 2HWOA 3M2WA 3PJ2A 5B0XA 1PXMA 5IQIA 4FZFB 3ORPA 4JDJA 5HG8A 3R9HA 4TWOA 2YIRA 4RPVA 3QLFA 3MVLA 5FXQA 2OWBA 4XCUA 4DEAA 3TNHA 2VTAA 2V7AA 3RPVA 2GNIA 4U7ZA 4NM0A 4KSPA 5M07A 4U5JA 1YI4A 2VTSA 5CF6A 4AZEA 4IC7A 5JQ5A 2E9VA 1DM2A 3ZFXA 4O7ZA 5BVDA 3R8MA 4BFMA 4HZSA 4YPDA 5HEZA 3CQWA 2R3OA 3QRJA 4QQJA 3TL8A 3BELA 4I0TA 4IDVA 5J7BA 3QTIA 3PXQA 3BYSA 4J53A 5K0XA 4O6LA 3ZEWA 1XH9A 3VS2A 2BRGA 5J9ZA 2AUHA 3V5PA 4ANBA 5EW9A 3OUNB 3IO7A 5L2IA 1OB3A 1NW1A 4GYGA 2VWWA 2W1DA 2XH5A 3H4JA 4R6VA 4W8DA 5CS6A 2VNYA 3JY0A 4U6RA 4X6RA 4DF3A 5KE0A 2YZAA 5CSHA 4AW0A 2JKQA 5FM2A 3QFVA 1NT2A 2RFDA 3RCDA 5AA8A 4I22A 4QP2A 3MWUA 4RC2A 3ZHPC 4OAUC 2YJSA 4DYMA 3PFQA 2ZV7A 4FSQA 4G6OA 3NCZA 2HZ0A 4NKAA 3MW1A 4R3CA 3Q52A 4DFXE 3VF9A 4MXOA 2OZAB 3REPA 3GCPA 1IA8A 2ZYBA 4D1SA 4E4XA 4JX7A 4U80A 3U4WA 2JC6A 4Q2AA 3R9DA 3VF8A 1RE8A 3ZCLA 3KFAA 3DCVA 5I9XA 3I0QA 3HV7A 4LUDA 5E8SA 5BVNA 4MEDA 2JIUA 1B38A 3KCFA 2VTOA 3VRYA 1AQ1A 4B9DA 2CNVA 2XNPA 3CTHA 4HGSA 4G3DA 3AT2A 3DBDA 3KL8A 5I9VA 5IA0A 5AV3A 4LYNA 4EK6A 2VRXA 3PY3A 2J6MA 1SVGA 2PK9A 4AXAA 5T3QA 5AFVA 2ZDTA 3FI2A 5KHXA 4R78A 4XLVA 2YCFA 2CCHA 4RVLA 5J1VA 3FZPA 2OKRA 4AN2A 5H8GA 3A99A 3RM6A 4WT6A 3FKLA 4QTEA 3TN8A 2NPQA 2C3LA 3P5KA 3WARA 2JDTA 3FXZA 2PYWA 1Z57A 1PKDA 1REKA 3HUCA 3DAKA 3HEGA 3IGGA 1Q8UA 2FO0A 4U45A 4QMNA 1SM2A 4LMUA 4C7TA 1LEWA 2I0YA 3N4UA 3ZRMA 4FKVA 2AC5A 1KE5A 3RINA 4ANMA 3MPAA 1KE7A 3POOA 3BQCA 1FBNA 1UVRA 2H6DA 3MVHA 4O7SA 5EM8A 2EXEA 2ITOA 2XZSA 5B2LA 4WSYA 1R39A 3OG7A 3F3UA 5D12A 2IWIA 3TIYA 3DS6A 2IVVA 3DY7A 3SQQA 4BC6A 2C6MA 4F0FA 3LOKA 4PMTA 5J9YA 5IA5A 3NYOA 4ACCA 4YZ9A 4AW5A 3DZOA 2C0TA 3HRFA 3IDPA 3C51A 3HMOA 5B7VA 2W17A 3TZMA 4RIOA 4YSJA 3OMVA 3FY2A 2VZ6A 3WILA 4NK9A 2GSFA 1YOLA 1ZY4A 3C4XA 4KS8A 2HZIA 5LVPA 3H0ZA 5DNRA 3ID6C 4C4JA 4EL9A 4FTIA 4GL9A 4C4GA 3W16A 4K11A 4XV2A 5CNOA 3TIZA 5HI2A 5CSXA 3NS9A 3W2QA 5J9LA 4FTRA 1IASA 2WQNA 1GY3A 5FWKK 5D7VA 4FTUA 1XBBA 4ERKA 3Q3BA 4OBOA 4JR3A 3HYHA 4BYJA 2IW9A 3KRRA 2X7GA 2X8IA 2QOFA 3CD3A 3KRJA 4JVGA 2V0DA 4GG5A 3HMIA 3HDNA 4RJ5A 3JY9A 3WF9A 4AOTA 4A07A 3PLAE 2W4OA 4I6QA 4X3FA 3RNIA 4EKKA 3FI4A 4FKOA 2UVXA 4GU6A 4YMJA 2QU5A 3EQDA 4XP0A 4AOIA 4FV9A 5M56A 1GNGA 2XBJA 3SV0A 3DAEA 2X81A 3UBDA 4C3RA 3NNVA 3CTJA 5EYCA 3TTIA 3QTSA 3BIZA 2HY0A 3R30A 4UYAA 5CQUA 2GNHA 3ORXA 4YTHA 5HU9A 3LQ8A 5AX9A 5AMNA 4PTGA 5EKNA 2OIQA 3MH3A 2VV9A 4FNXA 5A4QA 2IVTA 2JDVA 4ZAUA 3AG9A 3NVKI 3PIYA 4KABA 5JEBA 2CGXA 3E8CA 3KXMA 4M3QA 4EK3A 3R21A 3UTOA 3RK7A 5BUJA 5AAEA 4TN6A 5HE1A 4F65A 2ITUA 4E7WA 4WG5A 4IW0A 3T9IA 2PE0A 5EYDA 3OOMA 3OP5A 3AGLA 1GIHA 4RWIA 4CG9A 1ZMWA 5BVFA 5HBHA 1YXSA 5CY3A 4M13A 4KD1A 2PVNA 3POZA 1J7LA 2W7XA 1OPLA 1YXUA 3PRIA 3LCKA 5L2TA 4LL0A 3FEGA 2PVMA 2WMXA 4O38A 2B9FA 3BV2A 1H00A 3C4ZA 4L01A 5L8JA 4A7CA 4WG3A 4HGLA 5DT3A 1WZYA 2VO7A 5JRSA 4TYIA 4FTKA 2YM3A 3FWQA 1URCA 4FZ6A 1Q24A 4HNFA 1S9IA 4ENXA 1M2PA 3V5TA 1NVSA 4O27B 2YIWA 4YP8A 4II5A 2W05A 2HK5A 3QTZA 2WZJA 5LCKA 3VS1A 4OT5A 4Y95A 5CQWA 4ZSEA 1CTPE 5BVWA 3VO3A 1B6CB 3I5ZA 2OG8A 2OJFE 2UV2A 3I7CA 5D7AA 4L3JA 4FG9A 4NH1A 3VBTA 4UY9A 4P4CA 5EW3A 3VBQA 2PL0A 4QP9A 2ITTA 3CQEA 4GH2A 5DIAA 4D0XA 5A6NA 2GQRA 1ZYJA 3D7TA 5C4LA 3ZUTA 2NO3A 5BUIA 2XK4A 3GVUA 3ANQA 1VZOA 5KZIA 4EH4A 4P5ZA 4FTOA 4ZTQA 3LFNA 4IWPA 4Y5HA 2UZOA 4G3EA 1PF8A 3PPJA 2OXXA 4I5PA 4TZRA 2EVAA 4HOKA 3HMPA 4IB3A 5D11A 2G01A 2UW6A 5BVKA 5IA1A 4GJ2A 3OWLA 3LCSA 4EOLA 3TNIA 4IH8A 5C9CA 2XUUA 4CT1A 4ZJJA 3PSDA 1HOWA 2PSQA 5D1JA 5FEQA 2Y4IC 4IFCA 5I3RA 2CGUA 1VYWA 5IQDA 5DEWA 2B1PA 3EQBA 4FZAB 4LRMA 5CLPA 4BCOA 4FSUA 4KBCA 4OTQA 3UIXA 3R7EA 2QO2A 5TF9A 1GZOA 3R83A 1OIRA 3R00A 4Q5EA 4Y85A 4DCAA 4QMPA 4O7LA 2BKZA 4D1ZA 3FMJA 3KMWA 4FIJA 2PUPA 4U41A 2J2IB 5CENA 4AFEA 3DKOA 4L00A 3QU0A 5M55A 5CANA 4EH3A 2UW8A 3BYVA 4YNOA 5L6PA 4D4RA 5KMMA 3E92A 2YWVA 1UA2A 4XG7A 3BHTA 3R2YA 2CHLA 4QYEA 3VNTA 1UKHA 4K6ZA 4DTBA 1LEZA 4FV2A 3PJCA 1YOJA 3EQGA 4A4OA 3GC7A 3KA0A 3KRLA 2BR1A 1IR3A 5DA3A 2BTSA 3R7VA 3QX4A 5EI2A 3BE2A 4K8AA 2C0OA 2BRMA 2Y8OA 3MN3A 3NSZA 5K3YA 3COIA 2J0KA 3MFTA 3PIXA 3EFJA 3O17A 4NJ3A 3HVCA 4EOQA 2QOHA 4F1OA 5IA2A 2O5KA 4N6YA 3ENMA 1J1CA 3RMFA 1YHSA 3PXKA 4J98A 3D0EA 3UO6A 1OKVA 4R5SA 1EH4A 5HCXA 1OPKA 3KVXA 2G2HA 3Q5ZA 1OPJA 4ANQA 3UYSA 3F6XA 1OMWA 1U5QA 5AR3A 3ZO2A 1NY3A 4RIXA 4YLKA 4AZSA 1OBGA 4FA2A 2J50A 4QYFA 3DXQA 5H8EA 1MRVA 3LAUA 3U87A 5CEOA 4W4WA 2O0UA 3VBYA 4EH2A 3RBWA 4ITJA 4LOOA 3QTUA 4RBLA 4KIKB 4ENYA 2ZV2A 1BI7A 1OVEA 2OU7A 2VTMA 3R7UA 3UOJA 1P4FA 4BDBA 2JLDA 1KE9A 2Y6MA 4D0WA 1W82A 2GPHA 3AMBA 4N70A 4O21A 1GZKA 3MGYA 3OXTA 2XMYA 4MXZA 4YJOA 5TOZA 4C62A 4HW7A 3D2KA 4GRBA 4X2FA 3ZC5A 2X4ZA 5CWZA 2HAKA 3EN5A 3QTRA 5BUEA 2OI4X 5E1SA 4CMUA 5E91A 3DKFA 2UW0A 4ZTNA 3C0GA 2YA9A 3CY3A 2NRUA 3O50A 3QYZA 2WHBA 3NWWA 4JT3A 3ZM9A 4MK0A 5L4QA 4GW8A 5HZNA 5L3AA 3MH0A 4IAFA 4PRJA 3KGAA 4QPSA 5AV4A 4PPCA 2XK8A 2PVKA 4M12A 2GU8A 1T46A 2W0JA 2W5HA 3NUNA 4FKUA 5CSWA 3P0MA 3AC4A 5KX8A 4IX6A 1DI9A 3IGOA 3QD2B 4RQVA 3S1HA 5IISA 1JOWB 4CZYB 3K2LA 5CYIA 3GOPA 4OTGA 3QHWA 5HX6A 3ORNA 2KTYA 3EQFA 4GUBA 4QTBA 3JR1A 4K0YA 3Q2JA 4JIAA 4BZNA 4I6BA 4LV8A 3HKOA 4ANNA 1FVRA 2IZSA 1V1KA 5J8IA 5JK3A 2R3PA 3WF7A 3ZDIA 4L52A 4FEVA 2OO8X 2ZM4A 4JAJA 2BMCA 3ZEPA 3LXNA 4DH8A 4D5HA 4D58A 4XX9A 4C4IA 3QXPA 4FGBA 4I21A 5FXRA 4IWDA 3W33A 2GHLA 3FLSA 2HXLA 4TPTA 4G6NA 5KMLA 3HP2A 4MNEA 5HNBA 3FMLA 2FB8A 4D4SA 3CY2A 3GUBA 4I92A 5AEPA 3SA0A 4DAWA 4R7IA 3VS5A 1FPUA 5CAUA 5KMOA 1QMZA 2XNMA 3GC0A 3OTVA 2Z60A 3R1YA 1MQ4A 1ZYCA 3D5WA 4DG2E 4CKRA 5J5SA 4PY1A 4GJ3A 3O71A 4CV9A 5CU3A 2XK7A 2P4IA 3G33A 3KN5A 3M1SA 1HCLA 3MH1A 3R63A 5CAQA 4DCEA 1YDSE 1YDRE 3GNIB 4CRLA 2A4LA 2WMBA 1G8AA 3R7YA 4F6SA 5L2SA 4AT4A 2OH0E 2G2IA 3CR0A 2DWBA 4TWPA 1FQ1B 4QQCA 5JT2A 5JRQA 2GS2A 4IB1A 3QRTA 4IAKA 3AC1A 4S33A 3C5IA 2QOQA 2ETRA 4WBOA 3UIMA 4AZWA 3LJ2A 3ZS5A 2VWYA 3KXGA 4O0XA 4TKSA 3UNKA 1J7UA 2R3NA 2VNWA 2GDOA 4J97A 4FV7A 4N4SA 2ITPA 3I1AA 5FP5A 4AACA 4CMOA 2QKWB 2X6EA 4CTCA 5CF8A 2C3KA 3ZFYA 3IW7A 5L6WL 3W1FA 4I93A 3HA8A 2EUFB 4RX5A 3COKA 4H3BA 3WZEA 5I5ZA 1GZ8A 2CLQA 4O81A 4NM7A 4EHEA 3FXWA 4FK3A 4EOIA 4EI4A 3ZBFA 2WMWA
chains in the Genus database with same CATH superfamily
2I7QA 5KMKA 3PVWA 5AJQA 3OFMA 4FL1A 4DHIB 4IVBA 1PYXA 3DBQA 1P5EA 3QQKA 1R3CA 4EHVA 1GOLA 5IEXA 4E26A 5E7RA 3DJ5A 3VS3A 4FKPA 1YW2A 4KIPA 4Z9LA 3V8SA 4EORA 4QPMA 1V0BA 4EOSA 4DH3A 1O6LA 3UC4A 3L1SA 4D28A 3RTPA 4FNZA 4O1OA 2YDIA 3D14A 5CF4A 5CU0A 4C36A 4DGOA 3DFAA 5DGZA 4QYYA 4DGNA 5J5TA 2OF4A 3R6XA 4G3FA 2E2BA 4XS2A 1TVOA 2W4JA 2JFLA 3QC9A 4HGEA 4BCNA 1ZYDA 4RX8A 5M57A 3FPQA 3TUCA 2VWBA 5JQ8A 4KAOA 3FY0A 4TXCA 3ZDUA 4K9YA 3EQHA 4AZTA 3LPBA 5CXZA 3CP9A 4A9UA 5I4NA 4QEBA 3ZSGA 2ZB0A 3KMUA 4B99A 3RHXA 4DTAA 3LJ0A 5AWMA 1PHKA 4FTLA 3C50A 2UW5A 2ETKA 2XNBA 4X7QA 4DG3E 2XKCA 1H01A 1SYKA 3IQ7A 4PX6A 5HCZA 3HV4A 1TKIA 1H07A 3E7VA 2UZUE 4HCTA 2ETMA 3P78A 4HVSA 1WBOA 5HD7A 4FYOA 2R7BA 2C1BA 4DEDA 2XEZA 5JFWA 4HYHA 1Q3WA 3S00A 3AT3A 2FGIA 2WOUA 4KB8A 4UB7A 3G15A 2ITNA 3G0EA 3IW5A 4IDTA 3FI3A 4MTAA 1KOAA 2ZV9A 3LM0A 5C03A 3EMGA 3FMMA 2PU8A 4NIFA 5DR9A 3R9OA 4ZY4A 2VU3A 3WF6A 3RAKA 2PUIA 4U97A 3DBCA 4E5WA 2GHMA 4WBBB 1S9JA 3FSFA 4ZZMA 1IA9A 4G5JA 3P4KA 4L9IA 2WMRA 4I5MA 5IQCA 2C30A 3COHA 3LIJA 3W8LA 2YM4A 4AXEA 4CFNA 4O7YA 2YDJA 3QXOA 3U55A 1YOMA 4IAYA 4UMQA 4TTHB 4YJPA 3M42A 5AP5A 2WMAA 2AEGA 1YQJA 4RJ8A 4XYFA 5DH3A 3VJOA 2ONLA 3CC6A 3E63A 4P2KA 5LVMA 3HECA 5K0KA 2OW3A 2VD5A 4A4XA 4EH6A 4DC2A 1DS5A 4Z3VA 3A8WA 3IW4A 5ANIA 3O7LD 1M7NA 3ZXZA 1Q5KA 3L9NA 1JSUA 2R64A 5L8LA 2CNQA 5GINE 3FE3A 2J90A 3R28A 4O0UA 5EKOA 4LFIA 4GS6A 4R5YA 4M84A 3LCTA 4KIOA 4BCQA 2PZ5A 3FKOA 4TY1A 5AR2A 1QPJA 2YEXA 4B4LA 3FAAA 4F7SA 3QZHA 2RGPA 2B9HA 2IF8A 4FSTA 5BVEA 2OIBA 3C13A 1RQQA 4HGTA 4XUFA 4RX9A 4BDJA 2CPKE 3BEAA 4IVAA 2XKFA 3RWPA 5CT0A 3FZOA 3V5JA 4BKJA 2VTQA 3D5UA 3TV4A 1ZYLA 4BI1A 1KV2A 4I6HA 2ZMDA 4K2RA 4AAYA 2IPXA 1OITA 4FC0A 1K3AA 3KKVA 2R3MA 3RZBA 5AA9A 3H30A 4QPAA 4RA5A 3GBZA 3UZRA 5AM7A 4S31A 4AWIA 5M4UA 4G1WA 4U79A 4K33A 1W2CA 4YR8A 3QBNA 3RAIA 3B2TA 5ETCA 2LGCA 2PULA 5IQHA 4JBPA 1Q97A 3D15A 1SVEA 4AU8A 2WFYA 5H2UA 2HWPA 3L8SA 4CYIA 5BPYA 5FG8A 1QPEA 4MNEB 1KE6A 4FMQA 4FIIA 3KULB 4F7NA 3W32A 3RPSA 4USFA 3P7AA 4M66A 2WTDA 3ZRLA 1M52A 2XF0A 4BN1A 1PXNA 3D7ZA 4QMZA 3RKBA 3CIKA 3RK5A 5C8MA 3SG9A 2JIIA 2VN9A 3F5GA 5BYZA 5A4EA 4ORKA 1YRPA 4EH8A 5HG7A 5DEYA 5L2QA 1Y8GA 4DG0E 1OL5A 3SKCA 3W18A 5ACKA 2EU9A 4MF1A 4OR5A 4XOZA 3NNWA 5LJJA 3NUSA 4M97A 3UP7A 3WBLA 3A7JA 4QMLA 5IH4A 2FSLX 2UZDA 2BIYA 2W99B 3UVQA 3HP5A 4NCTA 3KULA 5L6OA 4ANOA 3OBJA 3HRBA 4XG2A 5DWRA 2C6KA 3MFRA 3SD0A 5DT4A 3F7WA 3PSBA 3QKMA 4MQ1A 5DN3A 4BJJB 4WNMA 4UMRA 4O1PA 5E8ZA 4JX3A 3UOLA 3I60A 5FM3A 2ZB1A 5A54A 3CXWA 3WE8A 4CCUA 4QMOA 4D2SA 3KK8A 2C5XA 4FT3A 4QDVA 4FKSA 2FSTX 5GNKA 4L67A 3CD8A 2V55A 2YDKA 3G0FA 3Q04A 4DGGA 4JLCA 5GIOE 2YLEA 2XNNA 3LCDA 3RAHA 3TDWA 2W1FA 5IH6A 3TI1A 3MPTA 5FXSA 4FIEA 4E6DA 1WBWA 2UZWE 4FBXA 4BJJA 3A60A 5CVFA 2B54A 5LOHA 4ZY6A 4KINA 3E62A 3ODYX 5K4IA 2ZV8A 4DH7A 4X0MA 5AP3A 4EOOA 4MHAA 4ACGA 2VAGA 4EEVA 4EJ7A 4ZTLA 4J52A 3GB2A 3VULA 2VUWA 2BCJA 2WGJA 3R7GA 4S2ZA 4YNEA 4U44A 4IADA 4U8ZA 4C58A 5CF5A 2ERKA 4ARKA 5BMSA 1WAKA 1WBPA 2CGVA 2OZOA 2PE2A 2BRNA 4IJPA 4PNKA 4EWHA 5HORA 1JQHA 3MTLA 3R8PA 3R1SA 4ZLZA 5BYLA 4GMYA 2UW3A 3Q96A 4EQCA 3VQHA 3UG1A 3H9OA 3PG3A 4W4YA 4XV1A 5AR5A 5HICA 3GFEA 2XK3A 3NAYA 1L8TA 3LFBA 1IAHA 3BHHA 3PG1A 3EN6A 4H39A 4ZTRA 4JQEA 2PVLA 4GK3A 3R7IA 4ANLA 3NIZA 2QO9A 4UWCA 3HL7A 4BZDA 3AKKA 3BYMA 3T3VA 3A2CA 5HCYA 1UKIA 1SNUA 2HCKA 4KKEA 3OCTA 4YZNA 2PUNA 4XRJA 3GT8A 2IVSA 2E9PA 3LM5A 3AGMA 4EYJA 2FH9A 4JMQA 3HV6A 3NNUA 5DT0A 4WD5A 2QI8A 3BI6A 3QUDA 4BDAA 4WSQA 4CFUA 4A4LA 4JI9A 1OGYA 5H8BA 2VTHA 2W9FB 4ZTMA 5LCJA 5HVJA 2X1NA 5A3XA 5M09A 4ALVA 4LMNA 2QHNA 2WPAA 3VW8A 4UN0C 4FJVA 5EDPA 4WOVA 2WMSA 4AGWA 2VTJA 4MXXA 4BYIA 4D9UA 3COMA 3D2IA 5A4LA 4ZOGA 5BQ0A 2J5FA 4O2PA 5AP6A 2YCQA 3BU5A 2JDRA 5EH0A 4TYHA 4GCJA 4HVDA 4QP7A 2VTIA 2FUMA 2Z7RA 4PL3A 3QA8A 4NFNA 3ROCA 4DTKA 1WMKA 4QNYA 2P3GX 3ORTA 2BHHA 4LI5A 1TZDA 2JFMA 3MBLA 1E1XA 4MNFA 3RPYA 3QD4A 1BL7A 3F5XA 3C4EA 3GI3A 4PL5A 2R4BA 2IEWA 4LOPA 4WO5A 1OIUA 2YFXA 3VS7A 5IUHA 1NVQA 3O5AA 2DYLA 5EI6A 4AT5A 2QQ7A 4C02A 4DE4A 1YXTA 3IW6A 2R3KA 4FTCA 4HNIA 3MYGA 2UZLA 2BFYA 3ACJA 5AUWA 4BIDA 5DYJA 1YWNA 1P4OA 3KMMA 5EM6A 3QTXA 1ERKA 1URWA 1LUFA 5CX9A 4EOMA 2DUVA 4M0ZA 3ETAA 4IM0A 4YJTA 5AUTA 3OTUA 1JKSA 3QCQA 3FLQA 5J87A 1U46A 2X8EA 4D4YA 4FEUA 3R01A 1Y6AA 2X8DA 5ANDA 4QQTA 3E8EA 3P7CA 4D55A 1R78A 4J8MA 3DA6A 4AE6A 3Q9WA 4N6ZA 4ZSLA 4FSZA 4L7SA 1J7IA 2GTNA 2WMUA 1GAGA 2GHGA 5AAFA 5L2WA 2GFSA 2F2UA 5HIDA 2WTKC 3QC4A 3THBA 4QNAA 3Q4UA 2F9GA 3KRWA 2HYYA 4O6EA 2CJMA 3S0OA 5KCVA 2UZTA 4H1MA 5HIBA 4QMSA 5JMSA 3GCQA 4F9YA 1GZNA 1OL2A 4C3FA 2ERZE 3CBLA 1YWVA 3R1QA 2OSCA 4QYHA 4IANA 3NZ0A 4E3CA 3O51A 3FPMA 2EWAA 4RVMA 4CXAA 5AUUA 4AAAA 4YJVA 3DDPA 5HGIA 4FVPA 1REJA 4RRVA 4IM2A 4DEGA 2X39A 1W7HA 4Y83A 2ZVAA 5HO6A 3WI6A 2BZKB 2UUEA 3U4UA 5CVGA 4C38A 5BVOA 1NA7A 1XJDA 4AZFA 4H58A 3TM0A 4GK2A 3C9WA 1PMVA 1YDTE 3P9JA 3UVPA 3BZ3A 4LV5A 4D2WA 1CKPA 3G6GA 3U51A 3EIDA 3OBGA 2C47A 1YHWA 3FL4A 4KKHA 4BTFA 4JIKA 1G8JA 3LVPA 3PE2A 2YCRA 3VS0A 2Z7QA 2Y0AA 4ASXA 4BGHA 3L9PA 2HIWA 2O65A 4YBJA 2WD1A 4ZMEA 5CVHA 3BEGA 4WUNA 4XBUA 2QCSA 4BVUA 4M0YA 2ZAZA 4ANSA 2KULA 3B8QA 5DLSA 3NCGA 3ORMA 4XG3A 4WUAA 1VJYA 2ZJWA 3NW6A 4G3GA 4NW5A 4O0SA 4QMUA 3VS4A 2CGWA 2PZIA 2XNEA 4F0IA 2B4SB 1K9AA 2YAAA 2BIKB 3JS2A 3P79A 4W4VA 3EYHA 4IB5A 5M44A 3F88A 1L3RE 4IB0A 3OC1A 1OBDA 3PXFA 4IQ6A 3CTQA 4ZS0A 1WBNA 5ANJA 3BHUA 2B52A 2BDFA 4FL3A 5IKWA 1MQBA 4UWBA 3NGAA 3UO4A 2G15A 5LVOA 2C6IA 3VJNA 5DMZA 2W1CA 4CVAA 2CKQA 3GU5A 3PXRA 2BVAA 1M17A 2G1TA 3PY0A 4HJOA 3TZ7A 3QZGA 5HTIA 3PA5A 1ZOEA 2C5VA 4MAOA 2QC6A 4IX3A 4NM5A 4L68A 5KUPA 2ESMA 3EB0A 4M8TA 1R0EA 2B9JA 3OZ6A 2WQMA 4ERWA 3V5QA 3DK6A 1BX6A 4FZDB 5B2KA 4C59A 5HESA 2QURA 4FKRA 3UPXA 4BIBA 1J1BA 2OJGA 3TZ8A 3W10A 5ANKA 4AOJA 1O6KA 2R3QA 3D83A 4MWIA 2XJ1A 2WQEA 2X0GA 2YJRA 4C3PA 4DEEA 4D2PA 3KXXA 3PA4A 4RJ6A 5AP0A 5FP6A 2XS0A 3JVRA 2ZMCA 2YIXA 3RAWA 4NWMA 5EOBA 4V05A 3UG2A 2C6LA 3RHKA 4AGUA 4EYMA 3AT4A 2F7ZE 3UPZA 5HVYA 4F6UA 3F61A 3FUPA 3ZUVA 3QGWA 4G5PA 1JKLA 2F2CB 4IVCA 2XKDA 3SXSA 5HE0A 2GNFA 2YCSA 4EC8A 4FKGA 3KN6A 2QG7A 4YO6A 5ETAA 2HELA 3SRVB 4UWYA 4CCBA 4F0GA 1W2FA 4YGAA 3R9RA 3QKLA 4F9BA 2FVDA 2RFSA 3KU2A 1J91A 3KC3A 3UNZA 5CAQA 1JVPP 3OXZA 5M51A 4E4LA 4XG8A 1UV5A 4E6AA 4EHZA 3E64A 4L44A 3I6UA 4A06A 5AUYA 2I0HA 3F3TA 3PP1A 3TKIA 3ZBXA 5CALA 2QOLA 5FTQA 4BHZA 4I6LA 4JR7A 3GU8A 5M4CA 3IOKA 5A4TA 4AA5A 4NKSA 2A1AB 3E3PA 4FG8A 3MB7A 4FL2A 3I6WA 3QYWA 4IWQA 4ZTHA 4EHGA 4HYUA 2Y9QA 1XQZA 4KWPA 2C5OA 2W96B 3A4PA 3Q5IA 4RG0A 3TNPC 5A9UA 5FDPA 1OZ1A 4W4XA 4FOCA 3ZC6A 5CI6A 1CKJA 3EYGA 2CKOA 1PXLA 4FSWA 2FYSA 4RC4A 4EWQA 5DRDA 5HTCA 4QTAA 2YACA 2H9VA 3UDZA 1I09A 5CSPA 3HUBA 1YXXA 3AC3A 3SOAA 2ZOQA 2Y4PA 3G9NA 2ZM1A 3HDMA 5JGBA 4N57A 2PHKA 3L9LA 4ZEGA 4L7FA 5D10A 2PTKA 4BGQA 4O22A 5CU2A 4IM3A 1MUOA 4QMXA 1FVTA 4O7TA 3A62A 5I9ZA 3V8WA 4IX4A 4I6FA 4NSTA 3EN7A 4TYHB 3S3IA 3R22A 2ITQA 5CI7A 4PNIA 2G2FA 4ZLYA 1OGUA 2PVHA 4M14A 5IH5A 3TNQB 4QP4A 3UQCA 1OI9A 1APME 1MP8A 3R73A 4BI0A 4D2RA 4QMVA 4E1ZA 4FKTA 5E8XA 4KKGA 2VGOA 1SNXA 4L42A 3FC2A 4V01A 4JNWA 3DV3A 4QOXA 3PJ8A 1JPAA 1ZZ2A 3W2PA 3O2MA 2XIRA 4TYJA 2P2HA 1TQPA 2JIVA 2QONA 3FZTA 1V0PA 3JYAA 5AUXA 2WO6A 3C7QA 3W0RA 5E8TA 4DEHA 2XYNA 4FKWA 5FEDA 2GTMA 1R1WA 2QLQA 3VVHA 4BCKA 4B8MA 2GS6A 1NVRA 2WOTA 4FSYA 2VTRA 2EB2A 3BLQA 3DBEA 3KCKA 3ORIA 1F0QA 4OTWA 4XP2A 4ZJIA 3H9FA 3TWJA 4JJRA 3WZDA 2V62A 4TWNA 3I7BA 2UZNA 4YTCA 3E5AA 5CEPA 4F09A 5AIRA 5K5NA 1Q61A 2IW8A 2W1HA 4GFMA 4XLIA 4CG8A 3BYUA 2J7TA 3OF0A 1ND4A 4CLIA 3E7OA 4NCTC 3LFSA 3NYXA 4OTIA 1OKZA 2VWVA 3KXZA 3Q4CA 4RX7A 1XWSA 4FICA 4IVDA 3BX5A 5G1XA 4BBEA 4YO4A 5HG9A 2IG7A 2WIPA 4AQCA 3MY5A 4YLLA 2XM8A 4BCPA 1DAWA 4Q5HA 3VIDA 2Q0BA 1H28A 2PUUA 2PVJA 2W5AA 3FMNA 4CRSA 4FV5A 2QNJA 3L8XA 4XH6A 3WZKA 1PRYA 2XA4A 5DPVA 3OVVA 1JWHA 1G5SA 2YISA 4L6QA 5IPJA 3H0YA 1RJBA 2W1ZA 3CCNA 3LFCA 3QQGA 4LOQA 3WOWA 4USEA 3A7HA 3ML1A 2C3IB 2O3PA 3KF7A 1KOBA 3NR9A 4RJ7A 3DDQA 3ZLWA 2J0MB 3BLHA 2QVSE 1IRKA 3R9NA 3DJ7A 3UE4A 5I0BA 3FKNA 2BZIB 4QMTA 4F63A 3ANRA 2C5NA 3ODZX 5CSVA 3IKAA 2XJ2A 3NVMB 3PPKA 4QP8A 5F20A 5M06A 3SXFA 4NJDA 3OWKA 4XJ0A 3V01A 4IX5A 2XAMA 2X0OA 3O7LB 1HCKA 3R2BA 4X3JA 5EQYA 4RVKA 4BICA 3OWPA 2QHMA 3WYXA 3V5WA 4BBFA 3HMMA 3G2FA 3ZH8A 1WVXA 4O86A 3SAYA 4RFYA 5IMXA 1CSNA 4M7IA 4LGGA 3W2CA 2WNTA 4IZAA 2EXCX 3EFWA 3HX4A 5C8NA 3Q9XA 5I3OA 4BDEA 4FV0A 2GNGA 3V8TA 5CT7A 5CTPA 2X7FA 4GG7A 4MD7E 3LXKA 4E8AA 2YM6A 4PQNA 3RJCA 5EQEA 4BWKA 2VTNA 4UMPA 5C8KA 4W8EA 5D9HA 3F9NA 5F95A 4LUEA 3SC1A 4FT0A 2C4GA 4GT3A 3IPHA 3F3VA 3L8PA 4FTAA 4BHNA 4QTDA 5JGDA 4YHFA 3HAMA 3KRXA 4C2WA 3MB6A 4EQMA 5HTBA 4QMWA 4NM3A 2VWXA 4UBAA 3D5XA 3A61A 3BQRA 4QMMA 4RIWA 1F3MC 1ZZLA 2QOOA 3QQJA 2ITVA 3WIKA 2OIDA 2LAVA 4LM5A 2H34A 4DFZE 3U54A 1Q99A 4RA4A 4CSVA 1Y57A 2WTKB 2WB8A 4DEIA 4WNPA 3FHRA 3QGYA 3NLBA 2RKUA 2XIYA 3O96A 4F1MA 1H08A 2W1EA 3GU7A 4NL0A 4A9TA 3BRBA 3D9VA 5HG5A 4YJQA 3W2RA 2JAMA 4O0VA 1BLXA 5HE3A 4L53A 3PWDA 1I44A 4CZTA 4QDEA 1WVWA 1FINA 4JBVA 3JVSA 4C61A 1XO2B 3C0IA 4LDTA 4E20A 3OW3A 1PXOA 5LVLA 1W84A 1Q3DA 2BDWA 2O64A 3L8VA 4RIYB 2OJ9A 2J0JA 2F4JA 3FLWA 3MS9A 4TYEA 4X3FC 3MSSA 4JBOA 4Y72A 4AQKA 1OM1A 2W4KA 2BAKA 1IG1A 4BCGA 5JGAA 3LQ5A 3U9NA 3Q60A 4XG6A 4PDPA 1PXJA 2VX0A 1DAYA 3BLRA 3EFLA 4ZLOA 2B0QA 4U3YA 3DZQA 3A4OX 3FV8A 5H3QA 5JFXA 1FGIA 2A0CX 4FIHA 2B9IA 3PJ3A 2C6TA 4F78A 4UMUA 2WELA 3DKGA 5HQ0A 1KSWA 3PP0A 4EZ3A 4R3PA 3PDTA 3ERKA 3MTFA 3HRCA 2W1GA 2Z8CA 4MXCA 1OKWA 1TQIA 4B6LA 4O0TA 3PUFC 3TT0A 4ZIMA 4K18A 4FODA 3VUKA 3U9CA 1WBSA 4XMOA 1Q8WA 2QU6A 2OXYA 3R8VA 3QHRA 1PJKA 5E8VA 4YUQA 5CAOA 2IJMA 3SHEA 2X6DA 3DK7A 3K54A 3QRIA 3TCPA 3DQWA 4IZ7A 3VQUA 2X9FA 3DNEA 2HOGA 2OFUA 3FQEA 2X4FA 3F3WA 2XVDA 3MY0A 2A19B 4AFJA 3RALA 5HLPA 4I20A 2WU7A 5KMJA 4IAIA 4AS0A 2PMIA 3WYYA 3EQPA 2C0IA 3RM7A 2NNWB 2HY81 4YU2A 2JKOA 4HZRA 2J51A 4UXQA 1OUKA 5FBNC 1QPCA 2BAJA 3WIGA 4F9AA 2QKRA 2VX1A 5C27A 4TL0A 1ZARA 3FHIA 3GCSA 4MD8E 4O0WA 2YZLA 5EYMA 3BU3A 4ALWA 4FV3A 2WMQA 4BY9E 3A7GA 4PUZA 3NUAA 4RMZA 4ZSAA 2QODA 4C4FA 5LMKA 3HMNA 1H4LA 2PZYA 3PPZA 5ICPA 3P08A 3GC8A 5EFQA 2RF9A 4HVIA 3OCSA 2O8YA 5HU3A 3CGFA 3QQFA 4MVFA 4E4MA 1XMMA 4FT9A 4CYJA 4GKHA 3ITZA 3HZTA 3ZLSA 4JXFA 3WF5A 1Q8ZA 1FVVA 2WMTA 2OK1A 4XV9A 3UVRA 4YBKA 1UU7A 3CKWA 3RPOA 3II5A 1H26A 4BIEA 3I79A 5LWMA 2REIA 2R3LA 3E87A 4I4EA 2WXVA 5CXHA 1PXKA 4EK4A 5IQBA 3MVJA 1JBPE 3C4WA 4H3PA 1OL6A 2BDJA 2BZJA 3B2WA 1W98A 2J4ZA 5EHLA 3UOKA 4RFMA 2C3JA 4RC3A 4D4VA 5GZ9A 1UWJA 4RJ3A 4FVQA 2ITXA 5DRBA 2PZRA 4I5HA 1KWPA 3QUEA 2VO3A 4U42A 3Q2MA 3FBVA 1WBTA 4AA4A 5IQGA 3MVMA 2OJIA 4HPUE 2YITA 4OTRA 3PRFA 4CFFA 3NYNA 4EZ5A 4L8MA 4EK5A 3Q6WA 4IHPA 3BE9A 1PYEA 1UWHA 2E9NA 4YJUA 3DPKA 1Q62A 2GNLA 2G9XA 5GHVA 3AD5A 5IEYA 3QWJA 4R7HA 2NRYA 3TACA 2C6DA 4DH5A 4ITHA 5I9WA 3U6IA 3AD4A 2I0EA 3BL7A 4EOJA 3O0GA 2X2LA 3FZSA 2IO6A 3MJ1A 3O8TA 1DI8A 3W0SA 3F66A 3DGKA 3VUHA 2BKKA 3NW7A 3HA6A 5HD4A 4FV8A 4LRKA 3AC5A 4O7NA 4C2VA 4EH9A 4JG7A 4KBAA 4F9CA 3R1NA 3LW0A 4E6QA 3MPMA 4XBRA 2XB7A 4XEYA 4BTJA 4QMQA 4FTTA 1XR1A 1BKXA 4JRVA 4YZDA 3IDCA 4G2FA 4C0TA 4FTNA 3G51A 3FJQE 3UNJA 3ZTXA 4BL1A 3IW8A 2WTCA 4UX9A 5IDPA 4X2GA 3PZHA 3GC9A 3F2AA 4QYGA 5CEMA 2A2AA 5C4KA 4DDIA 2DQ7X 4HYIA 5A46A 3LHJA 4AGCA 3LCOA 2R0IA 2OZAA 2BPMA 2VTPA 5AUZA 3EL8A 3VS6A 5KKRB 3VONA 2XNGA 3QCYA 1JKTA 3I0OA 3EQIA 2R3RA 1XH8A 3ZYAA 4I4FA 5EW8A 1WFCA 1ZXEA 4I1ZA 5GJFA 5TO8A 1P14A 2GFCA 5ETIA 4DBXA 3QAME 2CLXA 4NIFB 4RGJA 4BGGA 2RG5A 4CFMA 5CAPA 3ZO4A 5KMNA 5KMIA 3QQHA 2PY3A 3AMAA 3C4FA 3UODA 5GJDA 4DEBA 2YM8A 3ZO3A 2XYUA 2RFNA 2P33A 2HXQA 2BZHB 4IAAA 3VN9A 1B39A 3PUPA 4FKLA 1SMHA 3PLSA 4M15A 4YHJA 3TKUA 3VHEA 4WNOA 1LPUA 2AC3A 4B7TA 1XBAA 3MA3A 4AT3A 4MUQA 4DFNA 2PVFA 2GQSA 2PMOX 3W8QA 3PVBA 4MKCA 1E9HA 5HKMA 4FGRA 3G6HA 4IACA 1FMKA 3Q4ZA 5EK7A 1STCE 3SW4A 4IWOA 1ZOGA 4EH7A 3HV3A 4J96A 4YC3A 4FNYA 2C1AA 3OCBA 4NFMA 4F99A 4M69A 5HLNA 4L3PA 4IEBA 4O2ZA 4CFVA 1WBVA 2HZNA 5IDNA 2I6LA 1OUYA 3QTWA 4BDGA 4JL9A 1NXKA 2O2UA 2WTJA 4MX9A 4GEOA 4GV1A 3GU4A 4RT7A 3OY1A 4I5CA 4NTSA 5FLFA 3LXLA 4ID7A 4TNBA 4AW2A 4GT5A 2WMVA 2W5BA 4AN3A 3GOKA 4O82A 1OECA 1OL1A 3ZLXA 2C69A 4UYNA 2FSOX 4RIXB 1U59A 2JKKA 3AXWA 1XH7A 4PP9A 1H27A 4IXPA 4JS8A 4M69B 4A9YA 4Q9ZA 4NYEA 3OY3A 1H1PA 5IUGA 1Q41A 4KIKA 1MRUA 2QOBA 4XV3A 2E9UA 1H1WA 4P5QA 3MFUA 4U43A 4F7LA 3F5UA 3MIAA 3VHKA 2I40A 3MI9A 4ITIA 5FEEA 2JBOA 3RZFA 3UIUA 5TKDA 4ASDA 4F08A 4GYIA 2R7IA 3P86A 3QD3A 4FUXA 2W9ZB 3Q32A 4G9RA 4R1YA 2IZTA 3EOCA 1OKYA 3C4CA 3JUHA 4MBJA 4ZJVA 1F5QA 1XH6A 1RW8A 2HZ4A 3GU6A 3UZPA 5LXMA 1FOTA 3C5UA 5AUVA 3UJGA 3P5JC 1ZMUA 2VO0A 3QRKA 3OOGA 3PJ1A 1W83A 4EC9A 3R8ZA 2JAVA 1H24A 5JKGA 1R0PA 2OBJA 4E4NA 5CAVA 4I3ZA 3ELJA 3EZVA 2J5EA 1VLRA 4QT1A 4ZS4A 2UZEA 3V6SA 3CQUA 2XEYA 3GENA 4U40A 2OFVA 3O23A 4ZZOA 3A7FA 5B2MA 4FR4A 2AYPA 3FDNA 1XH5A 5HO8A 2XIXA 4DFLA 3PFYA 3FLNC 3PTGA 5DR2A 3V51A 3OHTA 4FKJA 5JZNA 4AGDA 2RFEA 3E8NA 1WCCA 4IZ5A 3EN4A 4C57A 4ZY5A 3KREA 3NFGB 4WG4A 3FMDA 5IU2A 1U54A 3I4BA 4RQKA 2R9SA 3QA0A 3ZSHA 5K9IA 3HNGA 2YWPA 5DVRA 3GCVA 4J7BA 3W55A 4O91A 4BDDA 4YTIA 3TXOA 3O8PA 4MQ2A 5CEIA 2VO6A 1XH4A 4BKZA 3PYYA 4YSMA 3TNWA 3BBTB 3OD6X 4YJSA 4L3LA 4FTQA 4OW8A 3D5VA 4MH7A 3RCJA 5FDXA 3CEKA 4BKYA 2R3IA 4PMMA 2RIOA 5EOLA 4PPBA 4HCVA 3UOHA 5F4NA 3UDTA 4TRLA 4AF3A 3U8WA 2JD5A 4CKJA 4DFBA 4YC8A 2V22A 4G6LA 3BBWA 3TV6A 1H25A 1XHAA 4DT8A 2BFXA 2IVUA 2R0UA 3LFFA 5EI8A 3UMXA 3F5PA 3ACKA 5AV1A 4DFUA 4PV0A 3HV5A 3PVGA 1M7QA 4QRCA 1OIQA 3PXZA 2Z7LA 1VEBA 3SDJA 2YERA 2VGPA 3ZO1A 3N9XA 1YHVA 2BILB 4DN5A 2XIKA 3RPRA 1GJOA 3W0QA 4DGMA 4X2JA 2ITWA 5KNJA 4M67A 4O0RA 2PZPA 5J1WA 3ZZEA 4PMSA 5E1EA 3UDBA 1PW2A 4ACHA 4Z7GA 4XG9A 3BKBA 4O96A 2PMNX 3OS3A 3ATSA 1FGKA 3WE4A 5BMMA 2QOIA 2RL5A 4HPTE 4MBIA 4