5BYZA

Erk5 in complex with small molecule
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
348
structure length
348
Chain Sequence
b'TFDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQSLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 7
publication title Discovery of a novel allosteric inhibitor-binding site in ERK5: comparison with the canonical kinase hinge ATP-binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 120
structure length 348
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5byzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5byzA01
3UIUA 3G0FA 2R5TA 3NX8A 5HU9A 3A7GA 4ZSJA 1RW8A 3EJ1A 3FZTA 4R1YA 1JKKA 3GCSA 3MH3A 4IB5A 4LGDA 5EHLA 1KV2A 3DDPA 3LAUA 4GYIA 4RIXA 4HYSA 4I4EA 4FSZA 5TKDA 2XEZA 3CPBA 5I9YA 3UPZA 5IQGA 1T45A 3F82A 2BMCA 2XYUA 5ACBC 5A54A 4J99A 4Z55A 4EK8A 2WTVA 2UZBA 3NR9A 1WAKA 2QONA 3BHTA 1ZAOA 3I79A 4DN5A 4WD5A 2EU9A 3O23A 3GNIB 3MGYA 3QZHA 4MHAA 2X6DA 3IKAA 3JUHA 4I94A 5CF8A 3FDNA 2WMQA 2VO3A 4M66A 1YXTA 2ITUA 2JAMA 4B8MA 1TQMA 1BI7A 4YJUA 3JPVA 4EBVA 3M42A 3HZTA 5K5NA 5A3XA 3JVRA 3WF8A 1U54B 1XBAA 2CSNA 4ZZNA 5M55A 2QVSE 3O0GA 4Y8DA 3LFAA 5DPVA 5C26A 3UOJA 3PSCA 1PKDA 5T3QA 4FGRA 2Y7JA 3QRTA 2R3JA 2B55A 4QMPA 5HVKA 3PXYA 5FWKK 1Y8GA 3SW4A 4ALUA 1FMKA 4D1SA 1GZ8A 3I6WA 3EQRA 5F20A 5LMKA 5M57A 5IUIA 2BFYA 5M08A 2Q0BA 3LFNA 3KKVA 2WMTA 4Q9ZA 4RLLA 3C7QA 2HCKA 4JS8A 2W0JA 5CXHA 4QPMA 3CJGA 4IQ6A 2HIWA 3DAEA 4TT7A 1P4OA 4FL3A 5E8ZA 5FQDC 3VBXA 4BKJA 3NUXA 5CQUA 4XV2A 2EXCX 2JDVA 2W1FA 4DH8A 2R3KA 3HRBA 2UW3A 5D10A 5HIDA 4AXAA 3IGOA 4TPTA 2P4IA 2JITA 4AN3A 4WNPA 4CG8A 4OT6A 5DIAA 5L6WL 4ACHA 1TVOA 4CMOA 2EXEA 5KKRC 3COKA 4F0IA 3LFCA 3RINA 5JZNA 1STCE 4DEEA 3BE9A 4TW9A 3FLQA 4X6RA 4WRSA 4RX7A 4D2SA 2FUMA 4BDBA 2J50A 3FC1X 3DB8A 4I5MA 2PSQA 3F6XA 4ZS0A 3UIMA 3KXZA 1YQJA 3KN6A 4DH5A 4E6DA 3AT2A 3FL5A 2XKCA 1BUHA 3BCEA 3D7ZA 3Q52A 4X21A 3UGCA 2BDWA 3OBJA 4LUEA 5CSVA 5AM7A 5JMSA 3FMEA 4UB7A 3U54A 4S34A 2OH0E 3NSZA 4X3JA 2HW7A 1ZZ2A 2JLDA 2W06A 3LHJA 3B8QA 5DR6A 5AV3A 1FQ1B 5EHOA 4E3CA 4F1MA 4RFZA 3DBQA 2C47A 2OBJA 1FMOE 5IDNA 5IUGA 3HP2A 4O0UA 5LCJA 3QD2B 4FTQA 3PPKA 4B4LA 3FKOA 4QMTA 4YLLA 1F0QA 4AT5A 3OCSA 5C8MA 4NYEA 2OGVA 4DGLC 3O8UA 4JDHA 3U4WA 5D7AA 4YMJA 4DF3A 3QBNA 5KO1A 3KREA 4E73A 2WMRA 3EN5A 2XRUA 4L8MA 3SGCA 4C02A 2UW6A 3KXGA 3RALA 2QR8A 3I7CA 1OL1A 2CMWA 3QL8A 1M7NA 2G1TA 3II5A 4NJ3A 4XS2A 4QMQA 3LKMA 2OJFE 4RVMA 3I81A 1VZOA 4CFNA 3ZEWA 5CAQA 3PSDA 5CALA 2NO3A 5HO7A 5LMKC 3MFTA 3FEGA 1M2QA 1Y6AA 3TV6A 1UV5A 2PU8A 3HECA 4LOOA 4C3FA 5JSMA 2QG5A 4I0RA 2I6LA 4Q9SA 1SVGA 4KAOA 1H1RA 3ZDIA 4BC6A 3FMDA 4CTBA 4CNHA 3FI2A 4FZAB 4AE9A 3QU0A 4IEBA 3PRIA 1PXOA 3C0GA 3R8MA 3UQFA 4UMTA 4NM7A 3BHYA 5IUHA 2W1EA 4IZ7A 3A8XA 4RVTA 2HZIA 1G5SA 2P2IA 4J52A 3ZBXA 4UALA 2XIYA 3TKUA 3ENHA 4O0YA 3ATSA 4MQ2A 2BAJA 3C4EA 5CX9A 4IX5A 3UVQA 3CC6A 4O0WA 4QNYA 4AA4A 5CU0A 4S31A 4K1BA 2B52A 3MH1A 5HE1A 4FI1A 2PZPA 3AGMA 1BI8A 4U41A 4O96A 1OPKA 2BALA 3KQ7A 4FZ7A 1OZ1A 2ITNA 2UV2A 3RAHA 4W8DA 4YZDA 3RPOA 3F5UA 4MBIA 2JDRA 5BVKA 4M69B 4FTNA 4QMUA 4C4HA 3C9WA 3D7TB 4XRLA 5LJJA 3SKCA 4D0WA 2W17A 2QO2A 3FPQA 2XNOA 3DLZA 3L8SA 4E4XA 3CCNA 5J1WA 2J0IA 4FKTA 5FTQA 4F6SA 4NK9A 3DK3A 4QNAA 4DFLA 4YZ9A 5FGKA 4RBLA 5CU6A 4IAIA 4NM5A 5DR9A 4R3RA 2WTCA 3RK9A 5HE0A 3P5KA 4YJOA 3UBDA 4FK6A 2P2HA 2F7ZE 2AC5A 5B2LA 4FBXA 4CTCA 1APME 2IPXA 5F94A 1JQHA 2Z7SA 5D1JA 3HL7A 2WIHA 3CD3A 4TWCA 4XHKB 2C4GA 5ETIA 3ID6C 5IQDA 2FH9A 3DKOA 4LRJA 5FEEA 5J9LA 4U8ZA 1FBNA 1OB3A 4NCTC 3A8WA 4BTFA 4EWQA 3TEIA 2GTNA 4KKGA 5HU3A 3ZO2A 4A4LA 2A1AB 3GGFA 5CNOA 4ZAUA 1MRVA 3M1SA 5F1ZA 4CKJA 1VR2A 3VUKA 2YERA 3KXMA 4MF1A 3ORPA 3QCQA 2UW7A 5GZAA 4Q2AA 2XK4A 2GCDA 4DEGA 2Y6MA 4V05A 4OTWA 4H36A 4R7IA 5AP4A 3FLNC 3OT3A 4KIQA 2I1MA 2O8YA 5H2UA 4J53A 3MW1A 4K33A 4D4YA 4Z16A 4KSPA 2OZAB 5IEXA 5FBNC 4BDKA 5CYIA 5C1QB 4FV9A 4HVSA 5BVFA 4FG9A 2ONLA 3GBZA 4U97A 3MIAA 4L9IA 1Q97A 2WXVA 3Q32A 5LVLA 3COHA 3BLQA 3O8TA 3R8UA 1W98A 5IKWA 4D4RA 2XA4A 2X9FA 4J95A 4NZWB 4ENXA 2GHGA 5CAPA 4QMMA 4NSTA 4JRNA 1UVRA 5HNGA 3Q4CA 5BQ0A 5D9HA 3W33A 1YI4A 4ASXA 3QRKA 5DI1A 4KWPA 3RHXA 3ZCLA 5J79A 2BDJA 4HGEA 3F5PA 4M67A 2PZ5A 3PVWA 4RQKA 2NNWB 1R39A 2DWBA 4QO9A 4CG9A 4B9DA 3L8VA 2QC6A 3TN8A 4J1RA 3DK6A 2CN8A 3H0YA 3DPKA 2PK9A 1KOAA 4RJ7A 2P0CA 5LVPA 4Z7HA 1IA9A 2OI4X 2RFEA 3UOHA 2GNGA 4GVAA 1YHWA 5AR3A 3R01A 4ZSEA 1OIYA 4GSBA 4XX9A 3UG1A 1SVEA 3H30A 4IZAA 3VS1A 5CSPA 2PYWA 3NLBA 5CENA 1J1BA 2PUIA 4OW8A 3KF7A 3LFEA 4R3PA 4UZHA 3KK8A 4JDJA 3OW4A 3GFWA 3QKLA 4BDJA 1RDQE 1JPAA 3CY2A 4I5HA 5JEBA 2YWVA 3O8PA 4PMMA 3RVGA 2WTJA 1Y91A 1G3NA 2HENA 2HZ4A 3GC7A 4K0YA 4ITIA 4ZK5A 5IMXA 1TKIA 3DOGA 4RFMA 4CFXA 5IQAA 4F6UA 4DTAA 4QTAA 3V8WA 2V5QA 2VGOA 3UPXA 3E63A 3FYJX 2Z8CA 1WBWA 4J7BA 4BZOA 5HGIA 4RG0A 3RBWA 5HNIX 5TO8A 3RCJA 4DA5A 4R5YA 4BF2A 2JC6A 3VS7A 2W1ZA 1FVVA 4EQCA 1U54A 3OUKA 2VWVA 3NYOA 4YUQA 4P2KA 2IVTA 3QD4A 4IZYA 4UX9A 4E6QA 2KTYA 3PG3A 1DAYA 2CGXA 3QTQA 3QX4A 4II5A 4QTBA 3UIBA 5HCZA 3WBLA 4DGGA 3TV7A 2CCHA 4I0TA 1PXJA 1PXNA 3G2FA 5ETFA 5K0KA 2UZNA 4O0XA 4EEVA 4F0FA 4IX6A 5HO8A 3QF9A 2ONLC 3JYAA 4XOYA 5AX9A 2BAQA 3K3JA 4BBFA 3PJ3A 2XEYA 2PMOX 5AP1A 4FT9A 1ERKA 2JIIA 2Y4IB 3FI3A 4USFA 4ONAA 3SQQA 5EM8A 3OTVA 2ETMA 2VO7A 4YBJA 3VS6A 4OTFA 1U5RA 3R2BA 4F63A 4BTMA 2ZMCA 3OROA 2VV9A 2CGUA 1FPUA 3P23A 2VO6A 4CRSA 4E26A 2B7AA 3F2NA 1ZOHA 4RWIA 3FKLA 3R1NA 3BYMA 5AUWA 3AGLA 3QQKA 1WCCA 2IWIA 4F7SA 1L8TA 5L8LA 1M52A 5IG1A 4DT9A 3OOGA 4RVLA 5BVDA 5GZ9A 3MV5A 5D12A 4DTBA 3EYGA 2R3FA 2ZB1A 4PDSA 5D11A 2C3LA 2WQNA 3NCGA 4EBWA 4HVGA 2F2CB 3HMNA 4RWLA 4FKRA 2YITA 4QT1A 3VUIA 1OMWA 3OBGA 2QKRA 3D2KA 1MQBA 5AP0A 2JDSA 5HIBA 4LGHA 2BRNA 4BCQA 5IA1A 4L7FA 5AWMA 3QYWA 4GYGA 3KC3A 4FYOA 4IB0A 1S9JA 3Q04A 4YHFA 3QZIA 3V5TA 2XKDA 1H1WA 5AUTA 2I0HA 3PJ2A 4F7NA 3FQHA 2X2LA 4UMQA 3SV0A 4E4NA 3C5UA 4XMOA 4N0SA 5F4NA 5K3YA 1E1XA 4I0SA 5IZFA 4CRLA 5GIOE 3OOMA 3ZEPA 3EOCA 2ZDUA 3ORZA 3I7BA 4UBAA 3UC3A 4DINA 3FYKX 3ULZA 4L45A 5I3OA 3BHUA 4JL9A 3NMUF 3A7FA 2XJ1A 4AOJA 5M09A 5H8GA 4ACMA 2PUPA 3ZTXA 4ALVA 4LRKA 4YR8A 3V01A 1OM1A 3HX4A 2YAKA 3P78A 2XS0A 4DH7A 4E20A 3KRXA 4FSWA 4YJTA 2CNUA 4O81A 5A4CA 3DY7A 3R1QA 4CFWA 2PPQA 3FWQA 3CS9A 3TT0A 5DA3A 2FA2A 3ZM9A 2CGVA 2W5BA 1SVHA 4FSUA 2XZSA 4AW0A 5CY3A 4A9SA 4ACGA 2YZLA 3PIXA 4FKWA 4X2NA 1JNKA 4XRJA 2V55A 1OKWA 4K2RA 4GU6A 5L8KA 2GNLA 4FGBA 4MVFA 5KBRA 3KCFA 5IEVA 4NKAA 1DI8A 2XNGA 4L52A 4WUAA 4FKVA 2WTKB 1M7QA 3IK3A 4IM0A 1TQPA 2FSOX 2QOFA 5TOZA 5A9UA 5J7BA 2IO6A 1RE8A 3QKKA 2H8HA 4PL4A 2VX0A 5KX8A 4ZTQA 5E8VA 4O7LA 2J2IB 3BQRA 3OF0A 4DYMA 2X81A 3I1AA 2BHHA 5I4NA 4GUEA 4CT2A 2WD1A 3RNIA 2UZTA 5AEPA 3BEGA 2JIUA 3EQGA 4G2FA 4C61A 3H9OA 3ZRLA 3KMUA 3F3TA 4S32A 4FICA 3MVLA 4QD6A 4YZNA 1E9HA 2HELA 3QHRA 5J9YA 1GIIA 2RKUA 3FXZA 4RA5A 3EQCA 1UWJA 3NRMA 4GV1A 3OHTA 4C38A 4M69A 3ZONA 2QOQA 3BBTB 4ZSLA 4BWKA 5FUTA 3D7TA 2X9EA 1OKYA 1IAJA 3WZDA 1IA8A 5I9UA 4RFYA 3VF9A 4DITA 4PTGA 3BHVA 2W7XA 4CMTA 3B2WA 4HCUA 1M17A 5ETCA 4IW0A 5J5TA 3RZBA 2C0OA 5DOSA 1NT2A 3VBVA 4R5SA 3WIGA 2UUEA 4XH6A 3NNXA 4JR3A 3P7BA 3K3IA 1S9IA 4DFZE 2YM3A 3E3PA 4RJ3A 3FMJA 4O2PA 3CIKA 3U9CA 3POZA 5CF6A 1CDKA 4FV8A 2EVAA 2CKPA 2HY0A 3O96A 5E90A 4ASEA 4C58A 5IQFA 1FVRA 4A7CA 4B8LA 3ZRKA 3E88A 2J7TA 3G33A 4ANNA 4DCEA 3FZOA 5EM5A 5EDRA 4U79A 5GZ8A 1FINA 1T46A 3ACKA 3N4TA 5AP5A 4ANBA 4IIRA 3ZC5A 2XM8A 3ANQA 5AP7A 3KEXA 1SNUA 2WMWA 3ALOA 4AGDA 5CEQA 3UE4A 1W82A 3E92A 3FZPA 4WT6A 3VVHA 1XH6A 3BIZA 4J8MA 2OZAA 3DS6A 3I0QA 4R6VA 2XNBA 3DZQA 3G90X 3HV5A 3ORXA 3ZMMA 1HCKA 4EKKA 3DKCA 3C4XA 4IMYA 4YC3A 3FPMA 3ZS5A 3QWKA 4EC8A 2QI8A 1EH4A 4ANSA 4WBOA 1YRPA 1OKVA 2G15A 1HCLA 1PMEA 3LFSA 3JY0A 3KK9A 4I22A 4HNFA 3VS0A 4D4SA 5IQIA 1H0WA 3HDNA 5ITAA 3EL8A 5AR8A 4U9AA 5C03A 4I6FA 1F5QA 4FSMA 3D14A 4J98A 4APCA 3PA3A 5HD7A 3QQLA 4IX4A 1OITA 4OTPA 1V0PA 3NAYA 4F9WA 3DFAA 4R7HA 2ZV2A 2LAVA 1ZMWA 4MXCA 3KULA 3IW7A 5KUPA 3CTQA 5CNNA 3QXOA 3PTGA 3F88A 3VS2A 4FKOA 4MWHA 4AF3A 4R1VA 4DFNA 1FGIA 4EK4A 4EWHA 4D9TA 5AA9A 4BYIA 4M15A 5DE2A 4PRJA 5CSXA 3FLYA 4OBOA 5EH0A 5GJDA 4EK5A 3HP5A 3QGYA 4QMXA 5DN3A 5HVYA 4G17A 3VS5A 2XMYA 3QUPA 2Y8OA 3UP7A 2VTRA 4YHJA 4FKSA 1MQ4A 5A4TA 3BU5A 5HCYA 3E5AA 5HG5A 3W32A 3LJ2A 3W2RA 4DG0E 2Y4PA 2Z7QA 5IQBA 4BI1A 4X3FB 3I60A 4GJ3A 3QZFA 4YC6A 4C2WA 2ZM1A 4EH4A 3CQEA 3R9RA 2QOKA 2HY81 4I6QA 4Y5HA 3N9XA 4D28A 4R77A 2V7AA 4FF8A 2OW3A 3SD0A 3ZO1A 2OIQA 2IW9A 4ZMEA 1JBPE 3MVJA 3RAKA 3TACA 4GIHA 4BDHA 4N70A 4FKPA 4UWBA 4E4LA 4A07A 4FV5A 4YNEA 3SX9A 2UW4A 3MY0A 1DAWA 4OBQA 4V04A 4F65A 2XK6A 3A7JA 4F9AA 4GG7A 2UW5A 2VZ6A 4KB8A 5HNBA 3QYZA 2VTOA 3EQPA 4E1ZA 1QPEA 3CTHA 3P0MA 2B0QA 1JAMA 4FZFB 5AUXA 4DE4A 4Z3VA 3NIEA 1XH4A 3CXWA 3MBLA 5JH6A 4C35A 4ZY4A 4WOVA 5ANOA 3W55A 2OF4A 2PMNX 2A27A 2V62A 4IJPA 4PMTA 3T8OA 4CV9A 1YOMA 5C8NA 5KCVA 3SVVA 1H1QA 4NTTA 2CKOA 1OL2A 3Q4TA 3ALNA 4H3PA 5FEQA 2A2AA 5DT4A 3TNQB 1H25A 4ERWA 3DCVA 2AYPA 2VO0A 4CVAA 3MVHA 1QL6A 4BCIA 3LIJA 3NWWA 1Q5KA 1UKIA 5M4UA 1AGWA 4LV5A 2HZNA 4GK3A 3RWPA 4EKLA 1IG1A 4E5AX 3BBWA 3LJ0A 4DBXA 5L2IA 2ITOA 1XH7A 2YIWA 4JX3A 2UZOA 3HV7A 4QTDA 2HOGA 3QGWA 4D55A 4CZYB 4O27B 5G1XA 5IA5A 3MVMA 4JBOA 4S2ZA 3G9NA 4CSVA 5ICPA 3GQLA 3VWAA 2W05A 3EFLA 3ZDUA 2R3QA 2ZV9A 1Q99A 4AACA 1JLUE 3A7IA 4NW6A 1YXUA 3HGKA 4RRVA 4F08A 2V7OA 1ZY5A 5HHWA 2UW9A 4AGCA 4MF0A 3L8PA 5FG8A 3NUAA 5DBXA 4FEQA 3WOWA 3VRZA 5C4LA 4CYJA 5EW9A 1QPDA 4G5PA 4C2VA 3GU7A 4P5ZA 4MXXA 4F70A 3HAMA 3ZSGA 1WBOA 2VTQA 4G3EA 3ZO4A 4QMLA 3EN6A 2B53A 4E4MA 2DQ7X 5EW8A 4XG3A 5AX3A 2QHNA 4DCAA 4EOPA 3GCQA 3MPTA 3SXFA 4X2GA 4FTTA 2GNJA 2WU6A 5HBHA 4KUJA 2VTSA 4PPAA 1GZOA 4FSRA 2YFXA 3O2MA 5B7VA 3R9NA 4ANOA 2PY3A 3FMLA 4M13A 3ZFXA 4TXCA 3CY3A 3PYYA 4FZ6A 4EOJA 4PDOA 4BHNA 4I21A 4J96A 1LP4A 2J0MB 4EQUA 5K9IA 1MUOA 4RJ5A 5AUVA 4OAVB 4BY9E 3B8RA 3DTWA 2P55A 2VWZA 2W1DA 4QPSA 1Q61A 3PVBA 4Y5QA 4ITJA 1UNGA 1PXMA 4ZSGA 2C6OA 1YI6A 4EJ7A 4BZNA 2PVNA 3RMFA 4D1ZA 3GP0A 3FHIA 3TM0A 3HA8A 3QQGA 2OFUA 4ZZOA 4BCJA 4LQMA 4DEAA 2ZVAA 3F7ZA 1AQ1A 3DQXA 3HV6A 4ITHA 4O1OA 4RJ4A 1A06A 5GNKA 3VQHA 5M07A 2VTLA 3DBCA 4X7QA 3OY1A 3UVPA 1OKZA 2UZLA 3NEWA 4IACA 3SAYA 3ORIA 3VUGA 3DNEA 3L1SA 4QP4A 3UZRA 1XHAA 2ZAZA 3Q9WA 3QQFA 4JI9A 3RM7A 4JAJA 4L3PA 3OZ6A 5CT7A 3LFDA 4I5PA 4TRLA 2UZUE 3EFJA 4FK3A 4JBVA 4U5JA 2YCSA 4HNIA 1I44A 4AOTA 2JBOA 2Y4IC 4W9XA 4D9UA 5HLNA 4D2PA 3R71A 1J91A 4UWYA 1X8BA 2PVRA 3VUMA 3GCUA 3ENMA 3GT8A 4YJRA 3R8ZA 4WNOA 4XJ0A 2I40A 2YM6A 1J3HA 2QOLA 4IADA 3EYHA 5EM7A 4F0GA 2GQSA 4UXLA 3QRIA 2B9FA 3K2LA 3M11A 4BCPA 2IZTA 4PPBA 5AR7A 4E6CA 4RA4A 4L46A 3WF6A 4I6HA 1QCFA 4FV3A 3QRJA 1LR4A 4HCTA 5TF9A 3S2PA 3TI1A 4U6RA 4CZTA 5LCKA 4W4YA 4KS8A 1QMZA 2F4JA 2XNPA 4BBEA 3LZBA 3FL4A 3R63A 2JDTA 3LFFA 4O21A 3POOA 1H8FA 4HVIA 3F3UA 4F99A 1BX6A 2JKKA 2Z2WA 4O38A 5CQWA 5DMZA 3T9TA 4NM3A 5HLPA 3PJCA 3HV3A 4G5JA 4F09A 3UTOA 3RTPA 2VTMA 3QQJA 5C01A 3UVRA 4BRXA 1WVYA 4FC0A 2UW0A 1YVJA 4IJ9A 2YCFA 3PG1A 4JQEA 4HPTE 4L01A 3BPRA 5A46A 3UG2A 1CMKE 2XNNA 2BZKB 2UZDA 4AW1A 2XIZA 4RSSA 4FNYA 3TZ8A 4C4EA 5IF1A 2G01A 4F1OA 2E9PA 2ZMDA 3H4JA 2HXQA 4IBMA 1ZYLA 4B7TA 1PXLA 1K9AA 2QU6A 2VAGA 4IVAA 2VWIA 2F7XE 2PVHA 3Q2MA 1H27A 4EH8A 5A6NA 4D0XA 4FVQA 2BROA 4QTCA 3LMIA 2RIOA 1H07A 3V8TA 3ZFMA 4YZMA 3HYHA 4L6QA 3D0EA 5EHYA 4IB1A 2PHKA 3DGKA 2BRGA 4E7WA 4F9CA 3IQ7A 3NUNA 4LUDA 4U81A 5AADA 3E8CA 3P7AA 4XYFA 5HEZA 4C3PA 3IS5A 3SA0A 4PP9A 1H24A 1XKKA 3OCGA 2YIQA 2WMSA 3HMMA 4KA3A 4M7IA 1PRYA 5DWRA 4AP7A 4DGMA 4M84A 2C6IA 3TNHA 1W83A 3D9VA 2C5XA 4TYEA 4YURA 4FTAA 3NUSA 3R02A 2W1CA 3IECA 4IC7A 3Q2JA 4ZXTA 4C57A 4CT1A 4IM3A 3CGFA 3QQHA 2GU8A 4KBKA 4H39A 4NU1A 4OUCA 4ZP5A 4D2VA 3MFUA 3GEQA 2W9FB 3A4OX 1NVQA 4FTLA 4ZTMA 1Z57A 3OEFX 1I09A 3DBEA 1XR1A 3OWLA 5A14A 4W4XA 4EZ3A 3U6JA 5HI2A 3ZOSA 2JBPA 3PP0A 4EYMA 4KNBA 3A61A 3DJ7A 3HRFA 2XJ0A 4IX3A 3V5PA 1NA7A 4EOKA 3K5VA 2O2UA 4YTIA 4AT3A 2PMIA 2XIKA 4A9TA 2O64A 1PXPA 2XJ2A 2C3JA 2WQMA 4W4VA 3PP1A 3SRVB 3VHEA 2Q83A 4LGGA 4QP8A 3UMWA 3RAIA 2GMXA 4G34A 3ZH8A 2R3RA 1MP8A 5CZHA 4RJ8A 3TZ9A 3FZSA 3H10A 4YU2A 4M0ZA 3A2CA 4IFGA 2UVXA 3D5XA 3G6HA 4QMSA 1YHSA 5CAUA 4APPA 3PIYA 2YM7A 3M2WA 4ANQA 5JFVA 2VWYA 4ZSAA 3ETAA 3Q96A 3N51A 4GVJA 4YGAA 1A9UA 2CN5A 5FTGA 4C34A 2PVKA 4X3FA 3UQGA 3QA8A 4RX5A 3FI4A 3HLLA 3ZLXA 1WFCA 3NAXA 3OD6X 3W8LA 5AAGA 2EWAA 4O7NA 3E62A 1OUYA 4YZCA 2A4LA 3QX2A 1J1CA 4X0MA 3FBVA 5C4KA 3TUDA 3ERKA 3FSFA 4RQVA 3U8WA 5CAVA 4XP3A 3D4QA 3MIYA 4WSQA 4AZWA 3GUBA 3L9MA 3I5ZA 2IN6A 3V6SA 4EI4A 4FEWA 3RK5A 4ZMFA 1YKRA 4NW5A 1Q8YA 3LE6A 3WE4A 1NY3A 2OXXA 3WYYA 4EH7A 2XNMA 2O0UA 2VTPA 2BKZA 2W1GA 4FNXA 5E8UA 2C1AA 3QTRA 5HICA 4FOCA 3R7OA 3ULIA 5IA2A 3KXXA 5EYMA 2WU7A 1NW1A 3BLHA 5E8WA 4USEA 5DRBA 5ANIA 5BUEA 2VN9A 3NUPA 3CEKA 1H01A 3D2IA 5AR4A 2QOOA 4ACCA 3R0TA 4FSTA 1GOLA 4BVUA 3C51A 3C0HA 5DEWA 4A4XA 4RJ6A 3BGQA 1FVTA 4WG4A 3VN9A 3AC3A 5IH6A 5KZ0A 5DYJA 1XH8A 4J8NA 4YTCA 5JZJA 2BKKA 3DK7A 2QG7A 2X8EA 3D15A 4H1JA 4O2ZA 4PTEA 5KMKA 1H08A 4FT5A 3CE3A 4QQCA 5TE0A 4C36A 4HW7A 5I9WA 2ITXA 3R7YA 1FOTA 2X4FA 5J7HA 5BVWA 3JVSA 5CWZA 3UDBA 4USDA 2WTIA 3KMMA 4FX3A 2OXYA 2QU5A 3PFQA 3R83A 4FSNA 5AIRA 5CI7A 3U4UA 3PXZA 1Q24A 4G16A 3PRFA 4MXOA 2YIYA 3PY0A 4JDIA 3O7LB 4IB3A 4NT4A 3ZLSA 3RP9A 2WTWA 2W4JA 3TTJA 2XCKA 1Q8WA 1WVXA 2JDOA 4HYUA 4RLKA 2GTMA 2XRWA 3FMNA 3RJCA 4D2RA 3LQ3A 5M06A 1UU3A 2IZSA 2W9ZB 3IW5A 2PL0A 4WG3A 1B39A 4N4SA 4B99A 4AG8A 5JRSA 4MWIA 3VAPA 3F3WA 3FQSA 2R3OA 4C59A 2C5YA 5H9BA 2WMXA 5H8EA 1VEBA 3NW5A 4EONA 4AZEA 2B9JA 1PYXA 2IJMA 3FLWA 2PZRA 3BYSA 4BTKA 5TT7A 5HX8A 3LXNA 2YLFA 4PUZA 3BEAA 3R30A 4EOIA 4MNEB 4AN9A 4IXPA 2OICA 4IAAA 4G1WA 2LGCA 3Q5IA 3V04A 2WMUA 3S0OA 1P5EA 4JVGA 2W5AA 3FMMA 3A99A 1GNGA 1Q3DA 3H9RA 5L6PA 2GQRA 2VNWA 2OF2A 2BIKB 2FO0A 4MD8E 3C50A 2JKMA 3ZUUA 4CGAA 5EOBA 5BUIA 1R0EA 1BYGA 2W1IA 2F9GA 3DTCA 2I0VA 2ITYA 4ZJVA 2WTDA 4HGLA 1YDTE 4I4FA 3UMXA 4FNZA 1Q4LA 5J5SA 3PIZA 3HMIA 4AS0A 5CAOA 5FXSA 4JDKA 3GCVA 3LQ5A 5E8YA 2QQ7A 2YABA 4CCBA 1XJDA 5CXZA 2EB2A 3R8LA 5DH3A 3QRUA 2BDFA 2GS2A 2H96A 4O86A 2P33A 3DLSA 4Y83A 3V51A 4YZBA 5HBEA 3R7EA 4R3CA 3GB2A 4TNBA 3VBWA 5IQCA 4FKGA 3DAJA 1IASA 5DT3A 4GFMA 5JGAA 3V5QA 5KNJA 4K18A 3ACJA 4QP9A 3W8QA 3KVXA 3PE2A 4UY9A 4ZJIA 2ZYBA 3G51A 1ZYDA 3OEZA 2VTTA 1YOJA 3PA4A 5KKRB 3ZZWA 3PXFA 5EG3A 3NCZA 2VWXA 5CEMA 4PNKA 4YJVA 2JGZA 4R8QA 3ORLA 3P9JA 1BLXA 3Q60A 5EM6A 4AW2A 3PSBA 3E7OA 2GS7A 4AWIA 3KB7A 2YWPA 5DNRA 3AT4A 4UWCA 4X2KA 5J9ZA 3NW7A 4AGUA 3EWHA 4BCNA 4O7ZA 3ZRMA 4DFUA 4OT5A 3TNPC 4A9RA 3WZKA 2W1HA 3MWUA 2Y0AA 4GIIA 2VUWA 3AD4A 3BE2A 4KRDA 4GMYA 3F7WA 3ELJA 2RFSA 5IPJA 1Q62A 3BV2A 4Q5EA 5TR6A 3VC4A 3GFEA 3GU5A 3GU6A 4R7BA 2VX1A 3R1YA 5KMLA 4QYGA 4ZLOA 3UQCA 1ZYCA 3WYXA 4YHTA 4XG9A 4L43A 3UOKA 4JR7A 3E93A 2CPKE 2X8DA 4EHVA 5LOHA 4P90A 3EQIA 2GNFA 5E1EA 4GRBA 4RIOA 2J5EA 2GNIA 1WBPA 2XF0A 1UKHA 5FEDA 1ZYSA 2B9HA 4AZTA 2B9IA 5E92A 1J7UA 3RCDA 4FV4A 1YDSE 2IVSA 4FTIA 4DG3E 2PZIA 4L68A 4R78A 2PMLX 3MH2A 3PPJA 5CU3A 2XIXA 3UIXA 1O6LA 3L9LA 5I9XA 2W5HA 4PNIA 3VUDA 3CJFA 3NYNA 3ORNA 2XYNA 3S95A 3FY2A 3O7LD 4MCVA 4JBPA 4TKSA 4FUYA 4HZRA 4A9YA 3UNZA 3GC8A 4IAYA 3PXQA 3TKIA 4BDIA 3D94A 4CFMA 2GFSA 3Q3BA 4IAFA 1REKA 4LOQA 3R21A 3RI1A 4PMSA 3HKOA 1U46A 3MJ1A 3FXXA 3NNUA 5HX6A 1OGUA 1JKLA 1GY3A 2VD5A 5HG8A 3PLSA 3BYVA 4RWKA 2YZAA 1Q8TA 3PWDA 4LM5A 5FM2A 3KF4A 1G8AA 3NVKI 5J8IA 5EK7A 3IO7A 3EN9A 4OTQA 3TTIA 2YACA 3OVVA 3FJQE 2P3GX 2C6MA 2ZV7A 4KKHA 2OIDA 3MDYA 4FT7A 4YPSA 3F3ZA 1OBGA 2C68A 3IDBA 1JVPP 4FG8A 2ZOQA 5CEKA 3P1AA 2F49A 5LARA 4H58A 3KRJA 2R3GA 3ZYAA 2R3IA 1IEPA 1XBCA 4YJPA 3R8PA 3VUHA 4X6QC 3DKGA 4UYAA 4BDAA 4PWNA 3H9FA 5EYKA 5DVRA 3G6GA 3JXWA 1NXKA 3BLRA 4BDCA 1KE6A 3MJ2A 3SXSA 4U43A 2VWBA 3OWPA 2C6LA 4FKUA 3BV3A 5EI8A 2WKMA 5GHVA 3RHKA 4L42A 3SRVA 2VTIA 3ATTA 2C3KA 2IZRA 4BIDA 3PXRA 5CF4A 5E4HA 2FGIA 3KXHA 3DU8A 4QMWA 3LVPA 2XKEA 4EHZA 2UZVA 3PJ1A 3BYOA 3U6HA 4OBPA 3ROYA 3OTUA 5E9EA 2YA9A 3ET7A 3OCBA 3R00A 3NUYA 4I24A 1AD5A 2OZOA 2XBJA 4QYYA 5CU2A 4DFYA 4V01A 2BZHB 3ZFYA 3REPA 3EZRA 3DKFA 4IWDA 4AZFA 2YCQA 2RFDA 5AV4A 4H3QA 1KSWA 3ZBFA 5ANGA 1URWA 1SMHA 1JWHA 4GS6A 4LMUA 2GDOA 3LPBA 4NKSA 5DHJA 3VF8A 4ZTLA 3OC1A 4JT3A 4FOBA 4CKIA 2YDKA 5CSWA 2BTSA 3A62A 1Z5MA 2GS6A 4Y85A 3ZXZA 3EFWA 3Q4ZA 2YIRA 4NFNA 4TY1A 4FEUA 2VTJA 3D5UA 4JLCA 3KA0A 3BU3A 4C3RA 4FVPA 4I3ZA 5LMBA 2O63A 3PVUA 4O0TA 3QCXA 3T9IA 1DM2A 3GU4A 4C8BA 4PQNA 3TIYA 4E6AA 5JGBA 3ZLWA 5JQ5A 3TUBA 2XB7A 3JY9A 3ORTA 4FEVA 2QLUA 3TZ7A 4CLIA 1OL5A 3PVGA 4IZ5A 5HTCA 2RGPA 3Q4UA 4EK3A 4QOXA 3LLTA 1LUFA 2CDZA 3W2QA 4MH7A 3R04A 1U59A 4AA0A 4AGWA 3K54A 5JFXA 3R7UA 2WOTA 2VX3A 4UMRA 4U3YA 3MTLA 5LQFA 2I0EA 4M14A 4C33A 5AUUA 5AM6A 4LG4A 4L53A 4I93A 3AT3A 3AC2A 2QURA 4L00A 5EFQA 5LWNA 3CKWA 1KE9A 3EQHA 1Q8ZA 2HWOA 1ZLTA 4QP7A 4XCUA 2GQGA 3VHKA 1PF8A 3F3VA 2F7EE 3R1SA 4JJRA 3C1XA 5DGZA 3UC4A 4ASZA 3RPVA 5HVJA 3U9NA 4C62A 3HUBA 4FODA 5D41A 3UZPA 4XG4A 3NZ0A 4NTSA 3ZO3A 4EZ5A 5AIKA 3ZZEA 3CD8A 2J0JA 4BGQA 3VBTA 1YI3A 4FEXA 3NNVA 2QODA 4EUUA 3VS3A 3U55A 5HO6A 1PMNA 5HTBA 3VW8A 2VGPA 2W4KA 3PE1A 4U44A 2J6MA 4U80A 5K4JA 3QD3A 2FVDA 3MS9A 3ANRA 3THBA 4KABA 3WI6A 5AA8A 3FUPA 1ND4A 3LCSA 4EH2A 2RSVA 4IVBA 1JSVA 1JSTA 4MBLA 2W99B 4D2TA 2OU7A 2Z7LA 4MBJA 5I0BA 3CSVA 4BKYA 4FUXA 2HW6A 3COIA 5IMEA 2I0YA 5HIEA 1VYZA 5AP6A 5FXRA 2Z02A 1H4LA 3EKNA 1BL6A 4MD7E 3T3VA 4OTHA 3TUCA 3JR1A 3CPCA 3V5JA 5IA0A 2E9UA 2C0IA 4MNEA 4QRCA 2CCIA 3RKBA 4CFUA 4TWPA 4HZSA 4IANA 3VW6A 3AD5A 4RMZA 3TDWA 4YJSA 1ZARA 4GL9A 4YNOA 3GC0A 5E8SA 2GNHA 2Q0NA 3NPCA 3LFBA 3VJNA 2J5FA 3KGAA 4EK6A 2XH5A 1QPCA 1W0XC 5E8XA 5IQHA 3DT1A 4DH3A 4PDPA 4IE9A 3EQFA 3W2SA 4BKZA 4GK2A 4O82A 3DXNA 4NH1A 4IAZA 3UO4A 5CF5A 4E5WA 4TWOA 1PMVA 3PY3A 4JIAA 3FZ1A 3QTZA 3MY5A 4KSQA 5KHXA 1OVEA 4MXYA 1W8CA 4AUAA 4O0VA 2J0LA 3QTXA 2V0DA 1W7HA 3AC1A 2PE1A 3BELA 4FE2A 2C5OA 5IQEA 1JKSA 1V1KA 4PX6A 4WSYA 4XBUA 1WBVA 3OS3A 4OTDA 4JIKA 4PF4A 4TYIA 3LLAA 4QYFA 3SLSA 2QD9A 4KS7A 3NNWA 3LCKA 4E8AA 4HYHA 3D83A 3OXTA 2BR1A 1ZYJA 4O91A 4Y46A 4RVKA 3HRCA 3DAKA 2R0IA 3QQUA 2ESMA 3VBYA 3KMWA 3WF7A 5EKNA 2OJ9A 1XO2B 1XQZA 4YLKA 4CV8A 2PE0A 3QALE 5J95A 4G3CA 4U0IA 1WMKA 2QOHA 4XV9A 3VS4A 3ZUTA 1Y6BA 3OMVA 4J97A 4KINA 4NWMA 4X2FA 5ANDA 1TQIA 2OXDA 4OTGA 3TL8A 3GENA 3FV8A 4J71A 3TNIA 4AZSA 4LMNA 3DQWA 3MB6A 4LYNA 1R3CA 4WNMA 5EOLA 4QMYA 3E3BX 5M56A 2E2BA 3ZM4A 1ATPE 5FP5A 4Z7GA 3W2OA 4GFGA 4HCVA 4BDDA 4EHGA 3O71A 3KL8A 4NIFB 3COMA 5CANA 1IAHA 4XLVA 4FV1A 4ZTHA 3WZJA 3ZU7A 4DEHA 5HKMA 3EN4A 3C5IA 3GU8A 3LW0A 1H28A 4ZS4A 3OUNB 3VBQA 2J4ZA 5BMMA 4BCKA 4JG6A 3TIZA 1F3MC 1SYKA 5ANJA 3C4FA 1J7LA 2YM8A 4NL0A 1O6YA 3ITZA 3CR0A 5JFSA 5KMIA 2QOIA 2X0GA 3V5LA 5B2MA 4IVCA 4V0GB 3SOAA 3FKNA 2OJIA 3FLSA 2X2KA 1UNLA 3LJ1A 4XG2A 3WF5A 3ZXTA 2C0TA 3QUDA 5DLSA 5J87A 4DGOA 3FMKA 3T3UA 4A9UA 3NDMA 2OJGA 3R9DA 4ASDA 1XWSA 5LVOA 3DXQA 5BUJA 3IW8A 1Q8UA 3CQUA 1ZMUA 3OW3A 4EOLA 3UZTA 2UVZA 4EC9A 3WZEA 4C4GA 2WFYA 1IRKA 3L9PA 2R3MA 2REIA 4IWQA 1YW2A 4XP2A 2RG5A 2WHBA 5DFPA 4HVDA 2UZWE 4O22A 1ZRZA 3MYGA 2GHMA 3L9NA 3KFAA 4CQGA 4KBAA 3G15A 4QMVA 4Y95A 5L3AA 5IH5A 2YM4A 5CZIA 4N57A 4QYEA 2JKQA 3GOKA 3NYVA 3ODZX 5AR2A 1RQQA 4I23A 5HD4A 2UVYA 5BYYA 4L44A 3CKXA 4UMUA 5BYLA 4KIKB 3CLYA 3AMBA 2O65A 4QP3A 2BIYA 4BL1A 1OBDA 3AQVA 4RWJA 5KHWA 3IDCA 4ID7A 2RFNA 2SRCA 3FLZA 4F9YA 2WQOA 4Q5HA 3MY1A 3OXIA 4EQMA 4FTUA 5FTOA 2ZV8A 3UJGA 1OL7A 2OO8X 3C13A 1WZYA 4YO4A 3MPMA 3EB0A 1ZXEA 4K6ZA 4S30A 1OI9A 1ZWSA 5AR5A 3SG8A 5L4QA 3PA5A 4IH8A 4YTHA 4PMPA 5HLWA 2IW8A 2XK8A 4UYNA 4CD0A 4O83A 3TWJA 3LXPA 5DT0A 4FNWA 3RZFA 4WG5A 5F95A 4O6EA 4ACDA 4XV1A 4NJDA 2HWPA 4F7JA 4H1MA 2XUUA 4XUFA 4PPCA 5L2SA 3UNKA 4BTJA 4KKEA 1UNHA 2XBAA 3QCYA 4FIFA 3VO3A 2H6DA 4UN0C 2X4ZA 3IOPA 3NYXA 4OLIA 5HQ0A 3LMHA 4EZ7A 4RIYB 4YP8A 4U42A 4HVHA 3FQEA 4GT4A 3KCKA 4MTAA 4WNKA 4YO6A 3A60A 5HBJA 4GKHA 3ORKA 2WB8A 3BQCA 5EI2A 3HDMA 2PUNA 5T68A 3LCDA 4H3BA 3Q6WA 2C6KA 3AC8A 5EYCA 3FXWA 4ZIMA 5LWMA 4A06A 3GXLA 2J0KA 3AMYA 1CSNA 2A19B 3HA6A 1PJKA 5G6VA 5M53A 2PZYA 4JOAA 5EQEA 4I41A 3HAVA 3TG1A 3E8DA 4BDFA 1WBSA 1OUKA 1KV1A 5HCXA 3SDJA 2ITQA 1KE8A 2J51A 2XNEA 4F4PA 3IW6A 3WIKA 5HG7A 1OPLA 2QCSA 4PL5A 1YHVA 5GJGA 5B0XA 4PY1A 1J7IA 4YPDA 3LCTA 2WPAA 4AN2A 1NVSA 4EUTA 1KUTA 2G9XA 1XH5A 5L2TA 5BPYA 5IA4A 4O7TA 2RL5A 1WBTA 3I5NA 5EQYA 3FSKA 5ACKA 2OWBA 3V3VA 2C30A 3AC4A 3KXNA 3BGPA 2BRBA 4M3QA 4NCTA 2VWWA 3GC9A 4MXZA 4NFMA 5L2WA 1Q3WA 4A4OA 2WTKC 2J90A 3G9LX 3HV4A 4RT7A 3BWJA 4ORKA 3MFRA 2QO9A 1CTPE 3IPHA 4EOOA 4JQ7A 3QTIA 4GK4A 4RPVA 3V8SA 2WMAA 4QP2A 4BBMA 4O84A 1V0OA 2GPHA 3KRLA 2E9VA 3HNGA 1YWRA 2G2IA 1H1PA 1CKPA 3EL7A 3P79A 2F2UA 4FZDB 4MK0A 4Y72A 2WQBA 3QTUA 4JBQA 4BGGA 4DC2A 2QOBA 4QQJA 2IW6A 4QP6A 5FDXA 3V6RA 4PV0A 4EL9A 4W8EA 4D1XA 2RF9A 3RPRA 5HE2A 3R7VA 1JOWB 2YDJA 4FIGA 4YSMA 2PVFA 2VTNA 4TL0A 4G6OA 4WBBB 1SZMA 4BIEA 5AMNA 4L3JA 2Y9QA 3JS2A 2WOUA 4G9RA 5JRQA 4B0GA 2XP2A 5BVOA 2WELA 3ZSHA 1UU7A 3GCPA 5L6OA 3FMHA 4U45A 4ZTRA 3F2RA 4M12A 4ZEGA 4D4VA 2R3LA 1XH9A 5CVFA 4IC8A 4ZJJA 3SXRA 4OTRA 4RIWB 1LPUA 2WQEA 3QA0A 2NP8A 4FV2A 3OWJA 4FV7A 1A48A 1H1SA 1U5QA 3TV4A 2VU3A 1WVWA 4XG6A 3SOCA 4ZLZA 1YWNA 3FAAA 4MQ1A 4BZDA 3QFVA 3LMGA 2R4BA 5GIPE 2X6EA 3MPAA 2WIPA 4H05A 2WGJA 4FIJA 4FVRA 5JFWA 4EOMA 5LVMA 4AX8A 3TNWA 4WO5A 4AOIA 4FIIA 3QC4A 4JAIA 5AV1A 3DJ5A 3O17A 2CKEA 2BZIB 2F57A 3I4BA 1P4FA 2GFCA 1K3AA 3QZGA 4RX8A 4BB4A 5JGDA 2YAAA 3CGOA 4M97A 5A4LA 2OH4A 5KZIA 2R3PA 2DS1A 3C0IA 3MA3A 5DR2A 5E8TA 3R9OA 2R0UA 2YEXA 2JFMA 4WIHA 5CEOA 5KBQA 5M44A 4XG8A 4BR3A 4G3DA 5ANKA 3W1FA 2C5NA 2V22A 2ZB0A 4JNWA 4UZDA 5JK3A 2X7FA 3NUUA 2BHEA 2ETRA 2G2HA 4C4IA 4G3GA 3C4CA 4CLJA 1YDRE 4FL1A 2CJMA 3QAME 5CTPA 3BRBA 2EXMA 3F5GA 2CGWA 4FL2A 4PP7A 1OIRA 3P08A 3Q9ZA 1ZOGA 2OJJA 3F9NA 1CM8A 4DTKA 3P7CA 2VTAA 3P4KA 3C4WA 3OG7A 4GUBA 3O50A 3D5WA 1OECA 4O7WA 2EUFB 3MSSA 5HORA 2R64A 3V5WA 1KOBA 3BHHA 3OP5A 4O7SA 3GVUA 5JT2A 3IGGA 2BUJA 4U3ZA 4ANLA 4ALWA 3ZC6A 5AP2A 3R7GA 2QLQA 3WARA 4O7VA 3MTFA 4HGTA 3DV3A 2XK7A 4CMUA 3ODYX 4FG7A 4BYJA 1GJOA 2HXLA 4LFIA 1BL7A 4XOZA 4TZRA 2OK1A 4UV0A 1M14A 3CP9A 5AJQA 2OFVA 1IR3A 1UA2A 5JKGA 5FD2A 4PDYA 5I3RA 2BPMA 3TJDA 4FT3A 2E9OA 3TXOA 4IFCA 4OAUC 4F1TA 1GIHA 3DNDA 2HZ0A 4D2WA 3KULB 4G31A 1Z9XA 2C5VA 1DS5A 4I1ZA 4XV3A 4AW5A 5H8BA 1CKJA 2IG7A 5IU2A 2DYLA 3AMAA 1M2PA 1SM2A 2X2MA 4HOKA 4K9YA 2JD5A 1PKGA 5EKOA 4X3FC 5HTIA 3MESA 3AXWA 4XNEA 4CQEA 4NM0A 4PL3A 4NIFA 4EH3A 3OT8A 4G9CA 5EDPA 3RM6A 4BCOA 2C69A 4TYJA 4ENYA 3IW4A 3TKHA 2YJSA 4FV6A 2H34A 4QMZA 5FLFA 1BMKA 2W4OA 3N4VA 1YXSA 3Q5ZA 1H0VA 3DBFA 4GU9A 2FYSA 4GT5A 1G8SA 4AZVA 2X1NA 4N6YA 3PJ8A 4FTRA 4TYHB 4EJNA 4FKJA 4M68A 4QMOA 4FTCA 1ZMVA 4I6BA 3TCPA 4FIEA 4V0GA 3ZLYA 3EKKA 4QYHA 3RK7A 2B4SB 3I6UA 5AV0A 5LMAA 3H0ZA 4EOQA 2ACXA 4YTFA 1YXVA 3DBDA 2R7IA 2H9VA 3DFCB 3VULA 4CEGA 2XIRA 4CFFA 4FV0A 4K8AA 4KIPA 2JIVA 3HVCA 4LRMA 3VIDA 3O51A 4IDVA 3MFSA 4IWOA 2Y6OA 5B2KA 3W2CA 2X8IA 4WKQA 2OLCA 5KE0A 5E91A 3KN5A 3TZMA 5K0XA 3R8VA 4DGNA 4XG7A 1LEWA 2R3HA 3DXPA 2FB8A 2R7BA 3QXPA 4L3LA 5AP3A 3TJCA 1O9UA 2WNTA 4QMNA 2QKWB 2NPQA 2VRXA 3GOPA 5C8KA 2ZM4A 3IONA 3NW6A 3OWKA 4G6NA 2QO7A 4KIKA 3U51A 4FKQA 5LVNA 1OIUA 5HESA 3EQBA 3W2PA 1XBBA 3DDQA 4ZTSA 3RPSA 3MI9A 4FKLA 5C27A 3WF9A 3VRYA 1PY5A 2XK9A 5HG9A 1O6KA 2AC3A 4EH6A 1PHKA 2AUHA 4C37A 3LXLA 3HMPA 2ITWA 4OTIA 1PMUA 3R22A 5KMNA 3F5XA 3AOXA 4IDTA 3UOLA 4C0TA 4ANMA 3FE3A 4I92A 3E64A 4QP1A 4LI5A 5M4CA 4BCHA 3VQUA 4TN6A 3A4PA 5I5ZA 3W16A 4XP0A 4JQ8A 3U87A 3RAWA 4G3FA 2PUUA 2FSLX 2OG8A 4QTEA 3FHRA 3EQDA 4Y73A 2BAKA 4BGHA 4RIXB 4S33A 4HGSA 3N4UA 5BYZA 4ZOGA 5M4IA 1NVRA 3EHAA 4KIOA 3RPYA 3S4QA 3SG9A 3D5VA 3FC2A 2BILB 4I5CA 4RIYA 2R2PA 1H00A 1B38A 1LEZA 3UP2A 3R73A 4RC2A 3HMOA 4ZLYA 5HZNA 1ZOEA 3EZVA 3R28A 5I9VA 2CLQA 1FGKA 4KBCA 5BVNA 2PTKA 4CKRA 2XM9A 2WEIA 2BRHA 5FXQA 4CYIA 2X7GA 3NIZA 2WMBA 5ETAA 4OR5A 4GKIA 3B2TA 2KULA 3EIDA 4F6WA 3LM5A 2IVUA 3UYSA 4UEUA 4FA2A 4BICA 4ZY6A 1DI9A 2BFXA 2CKQA 2QNJA 2R3NA 3IDPA 3F61A 2C6EA 4DBNA 2Z7RA 2WMVA 3L8XA 4EOSA 4BWPA 4YJNA 2QOCA 4C7TA 4E5BA 3VJOA 4F9BA 2ZM3A 5EW3A 5I9ZA 4EORA 5CVHA 3FZRA 2VWUA 4JX7A 5AUZA 4O7YA 3ROCA 3E7VA 4IAKA 5CEIA 3W18A 4AQCA 5HE3A 3QCSA 4FMQA 1RJBA 5FM3A 5T6KA 3R9HA 1R0PA 4GEOA 4LOPA 2JAVA 4RC4A 5CLPA 2C1BA 2I7QA 5CT0A 3EFKA 2HK5A 3BU6A 2OSCA 4DEBA 5JQ8A 4TYGA 4JRVA 4WUNA 4IWPA 3W10A 5IISA 2IZUA 1E1VA 2BCJA 3QUEA 2YN8A 3NGAA 5E1SA 1WBNA 2OIBA 1W84A 2X7OA 4IHPA 4CZUA 1QPJA 2ITTA 2PVYA 3MA6A 4O7RA 1H26A 3OXZA 1JSUA 4FT0A 4LL0A 3E8NA 2J9MA 3UO5A 2FSMX 3BZ3A 3UNJA 5IH4A 2B1PA 3Q9XA 4AT4A 2WO6A 3AC5A 3BI6A 1PW2A 2A0CX 5D7VA 1GZNA 3LOKA 2XCHA 3PDTA 1KE5A 1VJYA 1B6CB 1M2RA 4O6LA 4O1PA 4CFVA 3QHWA 4ZY5A 4FSQA 4WRGA 3CQWA 1OL6A 2YCRA 1OPJA 4MAOA 2XK3A 3BGZA 3EN7A 4LV8A 1ZZLA 4HPUE 3MB7A 1SNXA 3PUPA 4BFMA 1KWPA 2YDIA 3PXKA 5BMSA 1Y8YA 2UZEA 4FTOA 1REJA 5IEYA 1PXKA 3PZEA 4RIWA 3DJ6A 1Y57A 3PZHA 4RZWA 4IM2A 2QHMA 3RWQA 4GJ2A 5EYDA 2YHVA 3KRRA 1GAGA 4MXAA 5CSHA 4UMPA 4BCFA 2YISA 1BKXA 2O5KA 4DFXE 4K77A 4JXFA 4YJQA 1UU9A 2G2FA 3GQIA 3QKMA 4BI0A 5C9CA 4N6ZA 2WZJA 2C3IB 2JEDA 4NUSA 4FYNA 5HOAA 4YSJA 5FDPA 4EH5A 3BKBA 3LQ8A 3KY2A 4P4CA 3QLFA 3TDVA 2QR7A 2YLEA 4EH9A 5ANEA 4O0SA 4F7LA 5L2QA 2GHLA 2C6DA 3R2YA 4FSYA 4FKIA 4DEIA 4O0RA 5H3QA 4MX9A 3F2AA 4CXAA 3DB6A 2ERKA 3Q6UA 4I20A 4U7ZA 4PTCA 3ZHPC 3VNTA 2O3PA 5L8JA 5E7RA 2CLXA 2HYYA 2YJRA 5IDPA 4AAAA 2DUVA 1YXXA 2ERZE 3S3IA 3VUTA 2ITPA 5BNJA 1HOWA 2FSTX 2UW8A 2W96B 1CKIA 4GCJA 3HUCA 4NEUA 4DLJA 4TNDA 3U6IA 4XEYA 3RGFA 4E93A 5BVEA 5DEYA 3PPZA 3QD0A 4HJOA 3RNYA 4BWXA 3E87A 2XVDA 5K5XA 3Q9YA 4QQ5A 3I0OA 4QPAA 4FTKA 4MYGA 4Z9LA 1PXIA 1UU8A 2WEVA 3PY1A 1ZY4A 4C4FA 5FBOA 3R7IA 4G6LA 1OIQA 4JG8A 1VYWA 3LM0A 3LCOA 3K5UA 3IG7A 4TWNA 3BWFA 5IA3A 3DZOA 1GZKA 2BZJA 4F64A 3WZUA 3S00A 1UWHA 5BX0A 2PWLA 4TTHB 4AA5A 4EYJA 4FTMA 1PYEA 4M0YA 4DLIA 3HEGA 2BVAA 4D58A 5CEPA 3EH9A 3IOKA 3QWJA 4ZZMA 1YWVA 3UODA 3EMGA 4RZVA 5FP6A 4ERKA 2ZJWA 3Q53A 2BTRA 3QTSA 4WHZA 2RG6A 5AAFA 5JN2A 5KMMA 5J1VA 4DFBA 5DG5A 4W9WA 2VNYA 1K2PA 4BI2A 5AAEA 2CNVA 4W4WA 2BRMA 4AFJA 4AE6A 2IVVA 5A4EA 1L3RE 4K11A 3H3CA 1GIJA 4OGRA 4P5QA 1U4DA 4XLIA 2JKOA 1YOLA 4RX9A 4JG7A 5AUYA 2PVLA 2ITVA 4XBRA 3GI3A 4RGJA 1V0BA 2C6TA 4LL5A 4U40A 4DEDA 2YIXA 4FIHA 4BHZA 4DH1A 2E9NA 4BDEA 3OCTA 3F66A 2YM5A 4FTJA 3AG9A 3QLGA 5CASA 5KMJA 2XKFA 5GJFA 4DT8A 4WA9A 3DA6A 4C4JA 3LFQA 3SC1A 4ZTNA 3E8EA 3F69A 3LXKA 3C4ZA 3SHEA 4TYHA 3A7HA 2EB3A 2JFLA 1Q41A 5M51A 1KE7A 4MNFA 2CNQA 3ORMA 4QQTA 2OKRA 5EDQA 2ZDTA 4L67A 2PE2A 3ZUVA 5F9EA 3S1HA 1R1WA 4DAWA 1URCA 5CI6A 2WAJA 4FR4A 4B6LA 4AU8A 5KMOA 2PULA 4MEDA 4M8TA 5EQPA 5CU4A 3BYUA 4DHFA 3AD6A 4CCUA 1P14A 4GG5A 5CVGA 3G0EA 2NRUA 3PWYA 3FI8A 4UXQA 4YLJA 2Z60A 5FRIA 3PLAE 3CTJA 2PVJA 4YC8A 4DG2E 1JKTA 3OFMA 3MN3A 4BCGA 4IVDA 1MRYA 3WE8A 5EI6A 3UYTA 4GH2A 2VTHA 2ETKA 3OY3A 1R78A 3P86A 2CHLA 1MRUA 3QC9A 2ITZA 3KU2A 4P7EA 4X2JA 5GINE 5CS6A 3QTWA 3MH0A 4KRCA 4MD9E 5AFVA 3FY0A 2R9SA 4GFOA 3UO6A 4KD1A 3KVWA 3SW7A 4EHEA 3NS9A 2B54A 5AV2A 3G5DA 4YBKA 4RC3A 4BIBA 4L7SA 5A4QA 4BDGA 3WILA 5LXMA 5M4FA 4BCMA 3ZSIA 3R6XA 2X39A 1P2AA 5A6OA 4MKCA 2GSFA 5K4IA 3NVMB 4BN1A 3BX5A 4D5HA 5DRDA 4GT3A 4ARKA 4D5KA 4HYIA 4AFEA 3KRWA 4GW8A 2HAKA 2NRYA 2PVMA 3CBLA
chains in the Genus database with same CATH superfamily
3UIUA 3G0FA 2R5TA 3NX8A 5HU9A 3W0PA 3A7GA 4ZSJA 1RW8A 3EJ1A 3FZTA 4R1YA 1JKKA 3GCSA 3MH3A 4IB5A 4LGDA 5EHLA 1KV2A 3DDPA 3LAUA 4GYIA 4RIXA 4HYSA 4I4EA 4FSZA 5TKDA 2XEZA 3CPBA 5I9YA 3UPZA 5IQGA 1T45A 3F82A 2BMCA 2XYUA 5ACBC 4FJVA 5A54A 4J99A 4Z55A 4EK8A 2WTVA 2UZBA 3NR9A 1WAKA 2QONA 3BHTA 1ZAOA 3I79A 4DN5A 4WD5A 2EU9A 3O23A 3GNIB 3MGYA 3QZHA 4MHAA 2X6DA 3IKAA 3JUHA 4I94A 5CF8A 3FDNA 2WMQA 2VO3A 4M66A 1YXTA 2ITUA 2JAMA 4B8MA 1TQMA 1BI7A 4YJUA 3JPVA 4EBVA 3M42A 3HZTA 3W0NA 5K5NA 5A3XA 3JVRA 3WF8A 1U54B 1XBAA 2CSNA 4QDEA 4ZZNA 5M55A 2QVSE 3O0GA 4Y8DA 3LFAA 5DPVA 5C26A 3UOJA 3PSCA 1PKDA 5T3QA 4FGRA 2Y7JA 3QRTA 2R3JA 2B55A 4QMPA 5HVKA 3PXYA 5FWKK 1Y8GA 3SW4A 4ALUA 1FMKA 4D1SA 1GZ8A 3I6WA 3EQRA 5F20A 5LMKA 5M57A 5IUIA 2BFYA 5M08A 2Q0BA 3LFNA 3KKVA 2WMTA 4Q9ZA 4RLLA 3C7QA 2HCKA 4JS8A 2W0JA 5CXHA 4QPMA 3CJGA 4IQ6A 2HIWA 3DAEA 4AQKA 4TT7A 1P4OA 4FL3A 5E8ZA 5FQDC 3VBXA 4BKJA 3NUXA 5CQUA 4XV2A 2EXCX 2JDVA 2W1FA 4DH8A 2R3KA 3HRBA 2UW3A 5D10A 5HIDA 4AXAA 3IGOA 4TPTA 2P4IA 2JITA 4AN3A 4WNPA 4CG8A 4OT6A 3BLAA 5DIAA 5L6WL 4ACHA 1TVOA 4CMOA 2EXEA 5KKRC 3COKA 4F0IA 3LFCA 3RINA 5JZNA 1STCE 4DEEA 3BE9A 4TW9A 3FLQA 4X6RA 4WRSA 4RX7A 4D2SA 2FUMA 4BDBA 2J50A 3FC1X 3DB8A 4I5MA 2PSQA 3F6XA 4ZS0A 3UIMA 3KXZA 1YQJA 3KN6A 4DH5A 4E6DA 3AT2A 3FL5A 2XKCA 1BUHA 3BCEA 3D7ZA 3Q52A 4X21A 3UGCA 2BDWA 3OBJA 4LUEA 5CSVA 5AM7A 5JMSA 3FMEA 4UB7A 3U54A 4S34A 2OH0E 3NSZA 4X3JA 3AKJA 2HW7A 1ZZ2A 2JLDA 2W06A 3LHJA 3B8QA 5DR6A 5AV3A 1FQ1B 5EHOA 4E3CA 4F1MA 4RFZA 3DBQA 2C47A 2OBJA 1FMOE 5IDNA 5IUGA 3HP2A 4O0UA 5LCJA 3QD2B 4FTQA 3PPKA 4B4LA 3FKOA 4QMTA 4YLLA 1F0QA 4AT5A 3OCSA 5C8MA 4NYEA 2OGVA 4DGLC 3O8UA 4JDHA 3U4WA 5D7AA 4YMJA 4DF3A 3QBNA 4DDGA 5KO1A 3KREA 4E73A 2WMRA 3EN5A 2XRUA 4L8MA 3SGCA 4C02A 2UW6A 3KXGA 3RALA 2QR8A 3I7CA 1OL1A 2CMWA 3QL8A 1M7NA 2G1TA 3II5A 4NJ3A 4XS2A 4QMQA 3LKMA 2OJFE 4RVMA 3I81A 1VZOA 4CFNA 3ZEWA 5CAQA 3PSDA 5CALA 2NO3A 5HO7A 5LMKC 3MFTA 3FEGA 1M2QA 1Y6AA 3TV6A 1UV5A 2PU8A 3HECA 4LOOA 4C3FA 5JSMA 2QG5A 4I0RA 2I6LA 4Q9SA 1SVGA 4KAOA 1H1RA 3ZDIA 4BC6A 3FMDA 4CTBA 4CNHA 3FI2A 4FZAB 4AE9A 3QU0A 4IEBA 3PRIA 1PXOA 3C0GA 3R8MA 3UQFA 4UMTA 4NM7A 3BHYA 5IUHA 2W1EA 4IZ7A 3A8XA 4RVTA 2HZIA 1G5SA 2P2IA 4J52A 3ZBXA 4UALA 2XIYA 3TKUA 3ENHA 4O0YA 3ATSA 4MQ2A 2BAJA 3C4EA 5CX9A 4IX5A 3UVQA 3CC6A 4O0WA 4QNYA 4AA4A 5CU0A 4S31A 4K1BA 2B52A 3MH1A 5HE1A 4FI1A 2PZPA 3AGMA 1BI8A 4U41A 4O96A 1OPKA 2BALA 3KQ7A 4FZ7A 1OZ1A 2ITNA 2UV2A 3RAHA 4W8DA 4YZDA 3RPOA 3F5UA 4MBIA 2JDRA 5BVKA 4M69B 4FTNA 4QMUA 4C4HA 3C9WA 3D7TB 4XRLA 5LJJA 3SKCA 4D0WA 2W17A 2QO2A 3FPQA 2XNOA 3DLZA 3L8SA 4E4XA 3CCNA 5J1WA 2NYAA 2J0IA 4FKTA 5FTQA 4F6SA 4NK9A 3DK3A 4QNAA 4DFLA 4YZ9A 5FGKA 4RBLA 5CU6A 4IAIA 4NM5A 5DR9A 4R3RA 2WTCA 3RK9A 5HE0A 3P5KA 4YJOA 3UBDA 4FK6A 2P2HA 2F7ZE 2AC5A 5B2LA 4FBXA 4CTCA 1APME 2IPXA 5F94A 1JQHA 2Z7SA 5D1JA 3HL7A 2WIHA 3CD3A 4TWCA 4XHKB 2C4GA 5ETIA 3ID6C 5IQDA 2FH9A 3DKOA 4LRJA 5FEEA 5J9LA 4U8ZA 1FBNA 1OB3A 4NCTC 3A8WA 4BTFA 4EWQA 3TEIA 2GTNA 4KKGA 5HU3A 4FRFA 3ZO2A 4A4LA 2A1AB 3GGFA 5CNOA 4ZAUA 1MRVA 3M1SA 5F1ZA 4CKJA 1VR2A 3VUKA 2YERA 3KXMA 4MF1A 3ORPA 3QCQA 2UW7A 5GZAA 4Q2AA 2XK4A 2GCDA 4DEGA 2Y6MA 4V05A 4OTWA 4H36A 4R7IA 5AP4A 3FLNC 3OT3A 4KIQA 2I1MA 2O8YA 5H2UA 4J53A 3MW1A 4K33A 4D4YA 4Z16A 4KSPA 2OZAB 5IEXA 5FBNC 4BDKA 5CYIA 5C1QB 4FV9A 4HVSA 5BVFA 4FG9A 2ONLA 3GBZA 4U97A 3MIAA 4L9IA 1Q97A 2WXVA 3Q32A 5LVLA 3COHA 3BLQA 3O8TA 3R8UA 1W98A 5IKWA 4D4RA 2XA4A 2X9FA 4J95A 4NZWB 4ENXA 2GHGA 5CAPA 4QMMA 4NSTA 4JRNA 1UVRA 5HNGA 3Q4CA 5BQ0A 5D9HA 3W33A 1YI4A 4ASXA 3QRKA 5DI1A 4KWPA 3RHXA 3ZCLA 5J79A 2BDJA 4HGEA 3F5PA 4M67A 2PZ5A 3PVWA 4RQKA 2NNWB 1R39A 2DWBA 4QO9A 4CG9A 4B9DA 3L8VA 2QC6A 3TN8A 4J1RA 3DK6A 2CN8A 3H0YA 3DPKA 2PK9A 1KOAA 4RJ7A 2P0CA 5LVPA 4Z7HA 1IA9A 1TFFA 2OI4X 2RFEA 3UOHA 2GNGA 4GVAA 1YHWA 5AR3A 3R01A 4ZSEA 1OIYA 4GSBA 4XX9A 3UG1A 1SVEA 3H30A 4IZAA 3VS1A 5CSPA 2PYWA 3NLBA 5CENA 1J1BA 2PUIA 4OW8A 3KF7A 3LFEA 4R3PA 4UZHA 3KK8A 4JDJA 3OW4A 3GFWA 3QKLA 4BDJA 1RDQE 1JPAA 3CY2A 4I5HA 5JEBA 2YWVA 3O8PA 4PMMA 3RVGA 2WTJA 1Y91A 1G3NA 2HENA 2HZ4A 3GC7A 4K0YA 4ITIA 4ZK5A 5IMXA 1TKIA 3DOGA 4RFMA 4CFXA 5IQAA 4F6UA 4DTAA 4QTAA 3V8WA 2V5QA 2VGOA 3UPXA 3E63A 3FYJX 2Z8CA 1WBWA 4J7BA 4BZOA 5HGIA 4RG0A 3RBWA 5HNIX 5TO8A 3RCJA 4DA5A 4R5YA 4BF2A 2JC6A 3VS7A 2W1ZA 1FVVA 4EQCA 1U54A 3OUKA 2VWVA 3NYOA 4YUQA 4P2KA 2IVTA 3QD4A 4IZYA 4UX9A 4E6QA 2KTYA 3PG3A 1DAYA 2CGXA 3QTQA 3QX4A 4II5A 4QTBA 3UIBA 5HCZA 3WBLA 4DGGA 3TV7A 2CCHA 4I0TA 1PXJA 1PXNA 3G2FA 5ETFA 5K0KA 2UZNA 4O0XA 4EEVA 4F0FA 4IX6A 5HO8A 3QF9A 2ONLC 3JYAA 4XOYA 5AX9A 2BAQA 3K3JA 4BBFA 3PJ3A 2XEYA 2PMOX 5AP1A 4FT9A 1ERKA 2JIIA 2Y4IB 3FI3A 4USFA 4ONAA 3SQQA 5EM8A 3OTVA 2ETMA 2VO7A 4YBJA 3VS6A 4OTFA 1U5RA 3R2BA 4F63A 4BTMA 2ZMCA 3OROA 2VV9A 2CGUA 1FPUA 3P23A 2VO6A 4CRSA 4E26A 2B7AA 3F2NA 1ZOHA 4RWIA 3FKLA 3R1NA 3BYMA 5AUWA 3AGLA 3QQKA 1WCCA 2IWIA 4F7SA 1L8TA 5L8LA 1M52A 5IG1A 4DT9A 3OOGA 4RVLA 5BVDA 5GZ9A 3MV5A 5D12A 4DTBA 3EYGA 2R3FA 2ZB1A 4PDSA 5D11A 2C3LA 2WQNA 3NCGA 4EBWA 4HVGA 2F2CB 3HMNA 4RWLA 4FKRA 2YITA 4QT1A 3VUIA 1OMWA 3OBGA 2QKRA 3D2KA 1MQBA 5AP0A 2JDSA 5HIBA 4LGHA 2BRNA 4BCQA 5IA1A 4L7FA 5AWMA 3QYWA 4GYGA 3KC3A 4FYOA 4IB0A 1S9JA 3Q04A 4YHFA 3QZIA 3V5TA 2IF8A 2XKDA 1H1WA 5AUTA 2I0HA 3PJ2A 4F7NA 4QDVA 3FQHA 2X2LA 4UMQA 3SV0A 4E4NA 3C5UA 4XMOA 4N0SA 5F4NA 5K3YA 1E1XA 4I0SA 5IZFA 4O4CA 4CRLA 5GIOE 3OOMA 3ZEPA 3EOCA 2ZDUA 3ORZA 3I7BA 4UBAA 3UC3A 4DINA 3FYKX 3ULZA 4L45A 5I3OA 3BHUA 4JL9A 3NMUF 3A7FA 2XJ1A 4AOJA 5M09A 5H8GA 4ACMA 2PUPA 3ZTXA 4ALVA 4LRKA 4YR8A 3V01A 1OM1A 3HX4A 2YAKA 3P78A 2XS0A 4DH7A 4E20A 3KRXA 4FSWA 4YJTA 2CNUA 4O81A 5A4CA 3DY7A 3R1QA 4CFWA 2PPQA 3FWQA 3CS9A 3TT0A 5DA3A 2FA2A 3ZM9A 2CGVA 2W5BA 1SVHA 4FSUA 2XZSA 4AW0A 5CY3A 4A9SA 4ACGA 2YZLA 3PIXA 4FKWA 4X2NA 1JNKA 4XRJA 2V55A 1OKWA 4K2RA 4GU6A 5L8KA 2GNLA 4FGBA 4MVFA 5KBRA 3KCFA 5IEVA 4NKAA 1DI8A 2XNGA 4L52A 4WUAA 4FKVA 2WTKB 1M7QA 3IK3A 4IM0A 1TQPA 2FSOX 2QOFA 5TOZA 5A9UA 5J7BA 2IO6A 1RE8A 3QKKA 2H8HA 4PL4A 2VX0A 5KX8A 4ZTQA 5E8VA 4O7LA 2J2IB 3BQRA 3OF0A 4DYMA 2X81A 3I1AA 2BHHA 5I4NA 4GUEA 4CT2A 2WD1A 3RNIA 2UZTA 5AEPA 3BEGA 2JIUA 3EQGA 4G2FA 4C61A 3H9OA 3ZRLA 3KMUA 3F3TA 4S32A 4FICA 3MVLA 4QD6A 4YZNA 1E9HA 2HELA 3QHRA 5J9YA 1GIIA 2RKUA 3P5JC 3FXZA 4RA5A 3EQCA 1UWJA 3NRMA 4GV1A 3OHTA 4C38A 4M69A 3ZONA 2QOQA 3BBTB 4ZSLA 4BWKA 5FUTA 3D7TA 2X9EA 1OKYA 1IAJA 3WZDA 1IA8A 5I9UA 4RFYA 3VF9A 4DITA 4LV7A 4PTGA 3BHVA 2W7XA 4CMTA 3W0OA 3B2WA 4HCUA 1M17A 5ETCA 4IW0A 5J5TA 3RZBA 2C0OA 5DOSA 1NT2A 3VBVA 4R5SA 3WIGA 2UUEA 4XH6A 2ZFYA 3NNXA 4JR3A 3P7BA 3K3IA 1S9IA 4DFZE 2YM3A 3E3PA 4RJ3A 3FMJA 4O2PA 3CIKA 3U9CA 3POZA 5CF6A 1CDKA 4FV8A 2EVAA 2CKPA 2HY0A 3O96A 5E90A 4ASEA 4C58A 5IQFA 1FVRA 4A7CA 4B8LA 3ZRKA 3E88A 2J7TA 3G33A 4ANNA 4DCEA 3FZOA 5EM5A 5EDRA 4U79A 5GZ8A 1FINA 1T46A 3ACKA 3N4TA 5AP5A 4ANBA 4IIRA 3ZC5A 2XM8A 3ANQA 5AP7A 3KEXA 1SNUA 2WMWA 3ALOA 4AGDA 4I6LA 5CEQA 3UE4A 1W82A 3E92A 3FZPA 4WT6A 3VVHA 1XH6A 3BIZA 4J8MA 2OZAA 3DS6A 3I0QA 4R6VA 2XNBA 3DZQA 3G90X 3HV5A 3ORXA 3ZMMA 1HCKA 4EKKA 3DKCA 3C4XA 4IMYA 4YC3A 3FPMA 3ZS5A 3QWKA 4EC8A 2QI8A 1EH4A 4ANSA 4WBOA 1YRPA 1OKVA 2G15A 1HCLA 1PMEA 3LFSA 3JY0A 3KK9A 4I22A 4HNFA 3VS0A 4D4SA 5IQIA 1H0WA 3HDNA 5ITAA 3EL8A 5AR8A 4U9AA 5C03A 4I6FA 1F5QA 4FSMA 3D14A 4J98A 4APCA 3PA3A 5HD7A 3QQLA 4IX4A 1OITA 4OTPA 1V0PA 3NAYA 4F9WA 3DFAA 4R7HA 2ZV2A 2LAVA 1ZMWA 4MXCA 3KULA 3IW7A 5KUPA 3CTQA 5CNNA 4DHZA 3QXOA 3PTGA 3F88A 3VS2A 4FKOA 4MWHA 4AF3A 4R1VA 4DFNA 1FGIA 4EK4A 4EWHA 4D9TA 5AA9A 4BYIA 4M15A 5DE2A 4PRJA 5CSXA 3FLYA 4OBOA 5EH0A 5GJDA 4EK5A 3HP5A 3QGYA 4QMXA 5DN3A 5HVYA 4G17A 3VS5A 2XMYA 3QUPA 2Y8OA 3UP7A 2VTRA 4YHJA 4FKSA 1MQ4A 5A4TA 3BU5A 5HCYA 3E5AA 5HG5A 3W32A 3LJ2A 3W2RA 4DG0E 2Y4PA 2Z7QA 5IQBA 4BI1A 4X3FB 3I60A 4GJ3A 3QZFA 4YC6A 4C2WA 2ZM1A 4EH4A 3CQEA 3R9RA 2QOKA 2HY81 4I6QA 4Y5HA 3N9XA 4D28A 4R77A 2V7AA 4FF8A 2OW3A 3SD0A 3ZO1A 1ST0A 2OIQA 2IW9A 4ZMEA 1JBPE 3MVJA 3RAKA 3TACA 4GIHA 4BDHA 4N70A 4FKPA 4UWBA 4E4LA 4A07A 4FV5A 4YNEA 3SX9A 2UW4A 3MY0A 1DAWA 4OBQA 4V04A 4F65A 2XK6A 3A7JA 4F9AA 4GG7A 2UW5A 2VZ6A 4KB8A 5HNBA 3QYZA 2VTOA 3EQPA 4E1ZA 1QPEA 3CTHA 3P0MA 2B0QA 1JAMA 4FZFB 5AUXA 4DE4A 4Z3VA 3NIEA 1XH4A 3CXWA 3MBLA 5JH6A 4C35A 4ZY4A 4WOVA 5ANOA 3W55A 2OF4A 2PMNX 2A27A 2V62A 4IJPA 4PMTA 3T8OA 4CV9A 1YOMA 5C8NA 5KCVA 3SVVA 1H1QA 4NTTA 4LDTA 2CKOA 1OL2A 3Q4TA 3ALNA 4H3PA 5FEQA 2A2AA 5DT4A 3TNQB 1H25A 4ERWA 3DCVA 2AYPA 2VO0A 4CVAA 3MVHA 1QL6A 4BCIA 3LIJA 3NWWA 1Q5KA 1UKIA 5M4UA 1AGWA 4LV5A 2HZNA 4GK3A 3RWPA 4EKLA 1IG1A 4E5AX 3BBWA 3LJ0A 4DBXA 5L2IA 2ITOA 1XH7A 2YIWA 4JX3A 2UZOA 3HV7A 4QTDA 2HOGA 3QGWA 4D55A 4CZYB 4O27B 5G1XA 5IA5A 3MVMA 4JBOA 4S2ZA 3G9NA 4CSVA 5ICPA 3GQLA 3VWAA 2W05A 3EFLA 3ZDUA 2R3QA 2ZV9A 1Q99A 4AACA 1JLUE 3A7IA 4NW6A 1YXUA 3HGKA 4RRVA 4F08A 2V7OA 1ZY5A 5HHWA 2UW9A 4AGCA 4MF0A 3L8PA 5FG8A 3NUAA 5DBXA 4AXDA 4FEQA 3WOWA 3VRZA 5C4LA 4CYJA 5EW9A 1QPDA 4G5PA 4C2VA 3GU7A 4P5ZA 4MXXA 4F70A 3HAMA 3ZSGA 1WBOA 2VTQA 4G3EA 3ZO4A 4QMLA 3EN6A 2B53A 4E4MA 2DQ7X 5EW8A 4XG3A 5AX3A 2QHNA 4DCAA 4EOPA 3GCQA 3MPTA 3SXFA 4X2GA 4FTTA 2GNJA 2WU6A 5HBHA 4KUJA 2VTSA 4PPAA 1GZOA 4FSRA 2YFXA 3O2MA 5B7VA 3R9NA 4ANOA 2PY3A 3FMLA 4M13A 3ZFXA 4TXCA 3CY3A 3PYYA 4FZ6A 4EOJA 4PDOA 4BHNA 4I21A 3UDZA 4J96A 1LP4A 2J0MB 4EQUA 5K9IA 1MUOA 4RJ5A 5AUVA 4OAVB 4BY9E 3B8RA 3DTWA 2P55A 2VWZA 2W1DA 4QPSA 1Q61A 3PVBA 4Y5QA 4ITJA 1UNGA 1PXMA 4ZSGA 2C6OA 1YI6A 4EJ7A 4BZNA 2PVNA 3RMFA 4D1ZA 3GP0A 3FHIA 3TM0A 3HA8A 3QQGA 2OFUA 4ZZOA 4BCJA 4LQMA 4DEAA 2ZVAA 3F7ZA 1AQ1A 3DQXA 3HV6A 4ITHA 4O1OA 4RJ4A 1A06A 5GNKA 3VQHA 5M07A 2VTLA 3DBCA 4X7QA 3OY1A 3UVPA 1OKZA 2UZLA 3NEWA 4IACA 3SAYA 4DDIA 3ORIA 3VUGA 3DNEA 3L1SA 4QP4A 3UZRA 1XHAA 2ZAZA 3Q9WA 3QQFA 4JI9A 3RM7A 4JAJA 4L3PA 3OZ6A 5CT7A 3LFDA 4I5PA 4TRLA 2UZUE 3EFJA 4FK3A 4JBVA 4U5JA 2YCSA 4HNIA 1I44A 4AOTA 2JBOA 2Y4IC 4W9XA 4D9UA 5HLNA 4D2PA 3R71A 1J91A 4UWYA 1X8BA 2PVRA 3VUMA 3GCUA 3ENMA 3GT8A 4YJRA 3R8ZA 4WNOA 4XJ0A 2I40A 2YM6A 1J3HA 2QOLA 4IADA 3EYHA 5EM7A 4F0GA 2GQSA 4UXLA 3QRIA 2B9FA 3K2LA 3M11A 4BCPA 2IZTA 4PPBA 5AR7A 4E6CA 4RA4A 4L46A 3WF6A 4AAYA 4I6HA 1QCFA 4FV3A 3QRJA 1LR4A 4HCTA 5TF9A 3S2PA 3TI1A 4U6RA 4CZTA 5LCKA 4W4YA 4KS8A 1QMZA 2F4JA 2XNPA 4BBEA 3LZBA 3FL4A 3R63A 2JDTA 3LFFA 4O21A 3POOA 1H8FA 4HVIA 3F3UA 4F99A 1BX6A 2JKKA 2Z2WA 4O38A 5CQWA 5DMZA 3T9TA 4NM3A 5HLPA 1XMMA 3PJCA 3HV3A 4G5JA 4F09A 3UTOA 3RTPA 2VTMA 3QQJA 5C01A 3UVRA 4BRXA 1WVYA 4FC0A 2UW0A 1YVJA 4IJ9A 2YCFA 3PG1A 4JQEA 4HPTE 4L01A 3BPRA 5A46A 3UG2A 1CMKE 2XNNA 2BZKB 2UZDA 4AW1A 2XIZA 4RSSA 4FNYA 3TZ8A 4C4EA 5IF1A 2G01A 4F1OA 2E9PA 2ZMDA 3H4JA 2HXQA 4IBMA 1ZYLA 3AKKA 4B7TA 1PXLA 3W0SA 1K9AA 2QU6A 2VAGA 4IVAA 2VWIA 2F7XE 2PVHA 3Q2MA 1H27A 4EH8A 5A6NA 4D0XA 4FVQA 2BROA 4QTCA 3LMIA 2RIOA 1H07A 3V8TA 3ZFMA 4YZMA 3HYHA 4L6QA 3D0EA 5EHYA 4IB1A 2PHKA 3DGKA 2BRGA 4E7WA 4F9CA 3IQ7A 3NUNA 4LUDA 4U81A 5AADA 3E8CA 3P7AA 4XYFA 5HEZA 4C3PA 3IS5A 3SA0A 4PP9A 1H24A 1XKKA 3OCGA 2YIQA 2WMSA 3HMMA 4KA3A 4M7IA 1PRYA 5DWRA 4AP7A 4DGMA 4M84A 2C6IA 3TNHA 1W83A 3D9VA 2C5XA 4TYEA 4YURA 4FTAA 1XMLA 3NUSA 3R02A 2W1CA 3IECA 4IC7A 3Q2JA 4ZXTA 4C57A 4CT1A 3VONA 4IM3A 3CGFA 3QQHA 2GU8A 4KBKA 4H39A 4NU1A 4OUCA 4ZP5A 4D2VA 3MFUA 3GEQA 2W9FB 3A4OX 1NVQA 4FTLA 4ZTMA 1Z57A 3OEFX 1I09A 3DBEA 1XR1A 3OWLA 5A14A 4W4XA 4EZ3A 3U6JA 5HI2A 3ZOSA 2JBPA 3PP0A 4EYMA 4KNBA 3A61A 3DJ7A 3HRFA 2XJ0A 4IX3A 3V5PA 1NA7A 4EOKA 3K5VA 2O2UA 4YTIA 4AT3A 2PMIA 2XIKA 4A9TA 2O64A 1PXPA 2XJ2A 2C3JA 2WQMA 4W4VA 3PP1A 3SRVB 3VHEA 2Q83A 4LGGA 4QP8A 3UMWA 3RAIA 2GMXA 4G34A 3ZH8A 2R3RA 1MP8A 5CZHA 4RJ8A 3TZ9A 3FZSA 3H10A 4YU2A 4M0ZA 3A2CA 4IFGA 2UVXA 3D5XA 3G6HA 4QMSA 1YHSA 5CAUA 4APPA 3PIYA 2YM7A 3M2WA 4ANQA 5JFVA 2VWYA 1W2FA 4ZSAA 3ETAA 3Q96A 4F78A 3N51A 4GVJA 4YGAA 1A9UA 2CN5A 5FTGA 4C34A 2PVKA 4X3FA 3UQGA 3QA8A 4RX5A 3FI4A 3HLLA 3ZLXA 1WFCA 3NAXA 3OD6X 3W8LA 5AAGA 2EWAA 4O7NA 3E62A 1OUYA 4YZCA 2A4LA 3QX2A 1J1CA 4X0MA 3FBVA 5C4KA 3TUDA 3ERKA 3FSFA 4RQVA 3U8WA 5CAVA 4XP3A 3D4QA 3MIYA 4WSQA 4AZWA 3GUBA 3L9MA 3I5ZA 2IN6A 3V6SA 4EI4A 4FEWA 3RK5A 4ZMFA 1YKRA 4NW5A 1Q8YA 3LE6A 3WE4A 1NY3A 2OXXA 3WYYA 4EH7A 2XNMA 2O0UA 2VTPA 2BKZA 2W1GA 4FNXA 5E8UA 2C1AA 3QTRA 5HICA 4FOCA 3R7OA 3ULIA 5IA2A 4BJJB 3KXXA 5EYMA 2WU7A 1NW1A 3BLHA 5E8WA 4USEA 5DRBA 5ANIA 5BUEA 2VN9A 3NUPA 3CEKA 1H01A 3D2IA 5AR4A 2QOOA 4ACCA 3R0TA 4FSTA 1GOLA 4BVUA 3C51A 3C0HA 5DEWA 4A4XA 4RJ6A 3BGQA 1FVTA 4WG4A 3VN9A 3AC3A 5IH6A 5KZ0A 5DYJA 1XH8A 4J8NA 4YTCA 5JZJA 2BKKA 3DK7A 2QG7A 2X8EA 3D15A 4H1JA 4O2ZA 4PTEA 5KMKA 1H08A 4FT5A 3CE3A 4QQCA 5TE0A 4C36A 4HW7A 5I9WA 2ITXA 3R7YA 1FOTA 2X4FA 5J7HA 5BVWA 3JVSA 5CWZA 3UDBA 4USDA 2WTIA 3KMMA 4FX3A 2OXYA 2QU5A 3PFQA 3R83A 4FSNA 5AIRA 5CI7A 3U4UA 3PXZA 1Q24A 4G16A 3PRFA 4MXOA 2YIYA 3PY0A 4JDIA 3O7LB 4IB3A 4NT4A 3ZLSA 3TMOA 3RP9A 2WTWA 2W4JA 3TTJA 2XCKA 1Q8WA 1WVXA 2JDOA 4HYUA 4RLKA 2GTMA 2XRWA 3FMNA 3RJCA 4D2RA 3LQ3A 5M06A 1UU3A 2IZSA 2W9ZB 3IW5A 2PL0A 4WG3A 1B39A 4N4SA 4B99A 4AG8A 5JRSA 4MWIA 3VAPA 2XARA 3F3WA 3FQSA 2R3OA 4C59A 2C5YA 5H9BA 2WMXA 5H8EA 1VEBA 3NW5A 4EONA 4AZEA 2B9JA 1PYXA 2IJMA 3FLWA 2PZRA 3BYSA 4BTKA 2X0PA 5TT7A 5HX8A 3LXNA 2YLFA 4PUZA 3BEAA 3R30A 4EOIA 4MNEB 4AN9A 4IXPA 2OICA 4IAAA 4G1WA 2LGCA 1W2CA 3Q5IA 3V04A 2WMUA 3S0OA 1P5EA 4JVGA 2W5AA 3FMMA 3A99A 1GNGA 1Q3DA 3H9RA 5L6PA 2GQRA 2VNWA 2OF2A 2BIKB 2FO0A 4MD8E 3C50A 2JKMA 3ZUUA 4CGAA 5EOBA 5BUIA 1R0EA 1BYGA 2W1IA 2F9GA 3DTCA 2I0VA 3TYKA 2ITYA 4ZJVA 2WTDA 4HGLA 1YDTE 4I4FA 3UMXA 4FNZA 1Q4LA 5J5SA 3PIZA 3HMIA 4AS0A 5CAOA 2XAOA 5FXSA 4JDKA 3GCVA 3LQ5A 5E8YA 2QQ7A 2YABA 4CCBA 1XJDA 5CXZA 2EB2A 3R8LA 5DH3A 3QRUA 2BDFA 2GS2A 2H96A 4O86A 2P33A 3DLSA 4Y83A 3V51A 4YZBA 5HBEA 3R7EA 4R3CA 3GB2A 4TNBA 3VBWA 5IQCA 4FKGA 3DAJA 1IASA