5BYZA

Erk5 in complex with small molecule
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
348
structure length
348
Chain Sequence
TFDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQSLPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCAPPFDFAFDREALTRERIKEAIVAEIEDFHARREGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 7
publication title Discovery of a novel allosteric inhibitor-binding site in ERK5: comparison with the canonical kinase hinge ATP-binding site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 120
structure length 348
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5byzA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5byzA01
4UZHA 4AGDA 1NY3A 4X3FB 3M2WA 2NNWB 4FOCA 4GU6A 4MF1A 4ANMA 4EH3A 4Q9ZA 1YXXA 2QC6A 2VU3A 3ATTA 2X6EA 2OI4X 4MWIA 1SMHA 4H58A 2J0JA 3FI4A 4M68A 1JLUE 4M13A 2DS1A 3BGPA 5CASA 1TQIA 5CAPA 5IH5A 3QGWA 5C4LA 3W55A 1RE8A 3D9VA 4WO5A 4V05A 4NT4A 3F9NA 1DS5A 5E92A 5BYLA 5AR4A 3FI3A 3DV3A 1WCCA 3GCPA 4PDSA 1RDQE 4JBOA 5DN3A 2PVHA 4Q5EA 3SLSA 3VS3A 4D58A 4FEVA 4TYJA 3MVJA 1JBPE 5D10A 3W2RA 2PMIA 4UWYA 3PWDA 4YNEA 2J0KA 4EOMA 1H1RA 4GFMA 2YISA 2B0QA 4O84A 2F2UA 3UQCA 4BCMA 4G6NA 4BDJA 3SW7A 2PVNA 2HZ0A 4R1YA 4LM5A 2Q83A 2GCDA 4AZSA 1Q24A 1OKYA 1A9UA 3QKLA 3A8XA 2C4GA 3FZPA 2YZAA 3OT3A 2B52A 1DAWA 2R64A 2NRUA 3IW5A 4J53A 2ZMDA 3W16A 4K11A 5AR8A 4U0IA 5FTGA 2PZ5A 4G9CA 3CKXA 4RVTA 2ZOQA 2JKQA 4IC7A 4ZSLA 1G3NA 1PY5A 3R2YA 3R7UA 4DG0E 2QLQA 4O0UA 4DGLC 5BMSA 4RLLA 4I0RA 4BDDA 3V04A 2OLCA 3E3BX 2JDOA 4O0XA 3E3PA 4A7CA 3LFSA 4OR5A 4BKJA 4YTCA 5A46A 3EQHA 3RK9A 4RLKA 2C47A 2OXXA 2XNEA 4NW6A 2P33A 5LMAA 4CT1A 5HORA 2C3IB 3PYYA 3KREA 1XH5A 2W9FB 3TV7A 1WMKA 3FDNA 4RIXA 2DYLA 4WNMA 5H8EA 4UEUA 1H07A 3PDTA 2E9PA 1H4LA 4XG7A 5E8WA 3Q9YA 3UODA 3WF6A 1PYXA 4NJ3A 4U79A 2QOQA 4YO4A 4OTGA 2R5TA 3QZHA 1IA9A 4UMQA 5KX8A 3T3UA 5CF6A 2AUHA 3GB2A 2PMOX 3UTOA 4MNEA 1UKHA 3R1YA 4M12A 2QI8A 4AQCA 1P5EA 5CQWA 1XQZA 4NYEA 4C33A 4E1ZA 3MI9A 3DKFA 3V51A 3DB8A 3F5PA 3C4XA 4XG8A 5ANEA 5AR2A 4ACCA 5C8MA 4ASZA 3UNZA 4BDHA 1L8TA 4FVRA 1CMKE 5TF9A 3UO5A 4LV8A 4QMNA 3RZBA 4EKKA 4IWQA 4FODA 2DUVA 3SXRA 2UW0A 4GUEA 2JDRA 4NCTA 4MK0A 5IDNA 5DRBA 3VF8A 2GFCA 2XBJA 3SA0A 4U97A 2X8DA 3OBGA 4ACGA 4FC0A 4TPTA 3HP5A 2JIUA 4X3JA 3IS5A 4I6BA 4AW5A 5GZ9A 5IQHA 5J7HA 2XIYA 5AJQA 3FPQA 1OL7A 2W99B 3PA5A 4O96A 4IZYA 4F6WA 5IEYA 3TEIA 4C61A 2ITUA 3F61A 4MD9E 4FIGA 2VGOA 4IAZA 3QLGA 2QD9A 1Y57A 3P4KA 4Z55A 3GCVA 1G8SA 1MRUA 2WFYA 4QYHA 3MFRA 4F1MA 4N57A 4PY1A 5L8JA 3MSSA 4I6FA 5AX3A 2PZRA 4YP8A 5D7AA 4MXAA 4FICA 3IECA 1XH7A 3FZRA 2ZV8A 3UYTA 4AA5A 3S2PA 3O8TA 4PV0A 1A06A 2UZNA 3I0QA 3JVRA 3P78A 2YIQA 2PHKA 4NL0A 3UE4A 3WYXA 2WKMA 2XS0A 4GEOA 1VEBA 2Y6MA 1CM8A 4K9YA 2AC3A 5CU2A 3DOGA 4W4XA 3GFWA 1M2QA 2IVUA 4ZMEA 5M4IA 2GQSA 3O17A 4X2NA 4A07A 3HRBA 3NUYA 2X9EA 2XEZA 4O0TA 4ZIMA 4Q2AA 4EH9A 1MP8A 4WD5A 3C0HA 4GCJA 2B4SB 3TUCA 3BLQA 2WU7A 2C5VA 3F6XA 3M1SA 4NSTA 2YDKA 1YWVA 5DI1A 3WZKA 5J5TA 3PIXA 2R3PA 2X9FA 4IAYA 5HKMA 4RWLA 4EOSA 3VULA 4ANBA 2X81A 2H96A 2HXQA 4NW5A 3D7TB 4YZNA 2R2PA 3LFNA 4OTRA 4TRLA 4C4FA 3QQLA 5IMEA 3MDYA 4QP4A 4H3PA 4RVMA 4HYSA 2R3KA 2W5HA 5I9WA 5KMNA 3OHTA 2ZV9A 3PLAE 3PFQA 3QQJA 5EOBA 3ROYA 2Y0AA 3R21A 2CNUA 4GH2A 3KXGA 3LJ2A 4B7TA 3ZO4A 1XBCA 3ANRA 4FKRA 4RC3A 3R9NA 3WILA 3DAJA 4J8NA 4CTBA 4O81A 3KRXA 1YHVA 1OKVA 4QT1A 5HBJA 3PXFA 4TYEA 3QTQA 4DFYA 3L8XA 2X7OA 5E8TA 4IX4A 2J0MB 3LFFA 4FGRA 2ITNA 5FLFA 3NNVA 3UG1A 3BELA 4RX8A 4FKTA 3T8OA 3PZEA 4D2VA 4F0FA 3WE4A 5AA9A 2PVYA 3FMJA 3QCSA 1YXVA 3ZH8A 4MHAA 3O2MA 5ICPA 3PIYA 2A0CX 4J99A 1YVJA 2EWAA 4X2FA 3PXYA 2ESMA 3RAHA 1REKA 2XK7A 2IW8A 4NFNA 5DH3A 4YNOA 4DH5A 4MQ2A 1MUOA 3L9NA 3NCZA 4YJPA 5LVLA 3VUIA 3VBWA 4CVAA 3WBLA 5L8KA 3TI1A 4JR7A 5HG7A 3PRIA 3QYZA 3R73A 3VBTA 4U41A 4DGOA 2IZUA 3TUDA 5CEMA 3OWPA 4GJ2A 4U7ZA 2XNOA 3CPBA 2R3FA 2GNHA 3VHKA 3TACA 2YCFA 4PPCA 5L6OA 3E93A 3LFCA 5B0XA 4USDA 4AS0A 4I5MA 4F99A 2WIPA 1ZMWA 5AIRA 5LWMA 3SAYA 4FSWA 1S9IA 3RTPA 3E7OA 1GZNA 3ODYX 1V0BA 4FIHA 3FI2A 4G3EA 1ZRZA 3C13A 3LFDA 3NDMA 4X0MA 1P4FA 4WNOA 5F94A 3GC0A 3UPZA 4ID7A 5FXRA 3AC8A 5B2MA 3QCQA 4EOLA 3CGOA 5E4HA 1WVYA 1OKZA 4D1SA 4LRMA 2YZLA 5HZNA 4EK6A 4GIHA 4QP7A 3PVUA 3KVWA 2LAVA 4S31A 1IAJA 2IG7A 1KE6A 2BRBA 2ERKA 3OTUA 4J95A 4KD1A 3ROCA 5HCZA 5CEPA 3FY0A 5DVRA 4O38A 3FZOA 3ITZA 3CC6A 4K18A 5M44A 2XM8A 4LL5A 3CCNA 3CQEA 3LCOA 4EUTA 5EK7A 2PMNX 3ZDUA 4IJ9A 1H26A 1NVSA 4RIOA 5IQBA 4P90A 1PMUA 4R3CA 3KCKA 2RFDA 2YFXA 3SV0A 1GIIA 3DA6A 4ZLOA 1ZOHA 5C4KA 3EOCA 2PULA 3CGFA 4ZMFA 2EVAA 4C38A 3AD4A 3ORZA 5IQAA 1E9HA 4YC8A 4BC6A 3DBCA 3AD6A 2YEXA 3E62A 4NM3A 5FP6A 4GSBA 3D94A 4PMMA 5EM5A 5HIEA 2VTAA 3BQRA 5AUUA 3V5PA 4ZY5A 5E8YA 2IVSA 4QP1A 1TVOA 1DI9A 2ZM4A 2UZTA 4XV9A 1BKXA 4BTMA 3RPVA 2Z8CA 4HYHA 4USEA 5CNOA 4F1OA 2ZV7A 3OW3A 1ZZLA 4UV0A 5IA4A 3FC2A 1Q41A 1AD5A 2H34A 1QPJA 4DT9A 2J4ZA 4JS8A 4CMUA 4I1ZA 4FUXA 1F3MC 3RM7A 3R04A 4OTQA 4RA5A 4EHEA 3MPTA 2C6IA 3CS9A 3QC4A 3ORMA 2C6DA 3ZRLA 2X7FA 2GTNA 2VTPA 3PTGA 4AXAA 4IVDA 2XBAA 1YXTA 2XKEA 3C0GA 3MBLA 4AT3A 4CKIA 4DC2A 2W4OA 2YDIA 3R2BA 5J5SA 4H39A 5I0BA 4G1WA 4BHNA 4BI2A 2Z60A 4UMRA 4DFBA 4YZCA 4BN1A 4ERWA 3GUBA 3I7BA 4WRSA 2OIBA 5CVFA 3KULA 5JT2A 3QRKA 4UWBA 2P55A 2W7XA 4CLIA 2WMRA 2UW8A 1W84A 4FKOA 4K77A 2ZV2A 4YR8A 2C6EA 2WZJA 4FIJA 5CNNA 5LVPA 5A4LA 3F5XA 3MA6A 4FTQA 3LLTA 3G33A 5F20A 4V0GA 5DOSA 3LOKA 3FLNC 5IA0A 3Q6UA 3KK9A 2XA4A 3QFVA 4ACMA 3N4VA 4L43A 4F09A 3LW0A 3N4UA 3MH1A 3QBNA 4PTCA 4BKZA 3WF7A 5A9UA 3VS7A 2VWUA 3BHYA 3OUNB 4S33A 3KRWA 4B8MA 3ZCLA 3VUHA 1KV2A 2JKKA 3EKNA 3MS9A 1FGKA 3ZXZA 3QCXA 5M4FA 4FKUA 4N4SA 1Y6BA 4FYOA 3HLLA 3MA3A 1W0XC 4EH7A 5K0XA 5KHXA 4FK3A 4ALWA 2IZRA 1R39A 1URCA 3Q5ZA 3CSVA 3NRMA 4I4FA 1YWNA 3HDMA 2HY0A 4JJRA 4OTFA 1H27A 4P5ZA 3R7OA 3EWHA 4CT2A 4YO6A 2WQOA 3FC1X 2IVTA 3R8ZA 3A7JA 3E87A 2VRXA 3C50A 4CYJA 4PPBA 4BDGA 4QRCA 2BALA 4OLIA 5EYKA 3DK7A 3RPSA 4YTFA 4JXFA 3TUBA 2C3KA 3NEWA 4TZRA 4YZBA 4QMXA 4U3ZA 3TNQB 4RJ4A 5I3RA 2ITPA 1Q3WA 4YSMA 3NAYA 4XP2A 3HL7A 4KRDA 3OOMA 5CQUA 3LFAA 4WBBB 2QR8A 3VIDA 4G3CA 2CLQA 4YZMA 4FBXA 4BF2A 3BGQA 4I21A 2BAJA 4RJ7A 2Q0BA 3MB7A 5DEWA 3SKCA 3ZU7A 3C5IA 5HTIA 5I9YA 2XP2A 5EOLA 3W10A 4LOOA 5IUHA 3QALE 4FX3A 4B99A 2XUUA 5FWKK 4D28A 4DEAA 3DCVA 4D0XA 3BHUA 4QPAA 5DIAA 2WEVA 3OY3A 2XK3A 3E88A 4GV1A 4OGRA 3VW8A 1T45A 4G5PA 4WT6A 4ZS4A 3PSDA 5HICA 3TDVA 3FZ1A 4MF0A 4ZTHA 4D4YA 4DFLA 2J0IA 4HOKA 5BQ0A 3NNXA 1H1QA 3RMFA 4LI5A 4RZWA 4QP3A 3UC4A 5CXHA 4AZVA 2BMCA 5E1EA 4EZ5A 3ZOSA 4D4VA 5CF8A 3R02A 3E8CA 4ENXA 1R78A 1XH9A 4AT5A 5BYYA 3FEGA 3BCEA 5CF5A 3ZRMA 2IJMA 4C37A 1H00A 2B9FA 5EYDA 3DS6A 5FM3A 4I3ZA 3VRZA 4ZLYA 2UVZA 4H36A 5L6WL 3QQFA 5DE2A 3V01A 3IW8A 4L45A 2X4FA 5A4CA 5ACBC 4EQCA 3HP2A 5HU3A 1OKWA 3V8TA 3GC7A 2YLFA 1YI3A 2O64A 4XH6A 5CU6A 5D12A 3QKMA 4ZY4A 4UX9A 1WBNA 5JFVA 1U4DA 3RPRA 3IK3A 3MJ2A 4ZJIA 3UGCA 4AN9A 5A6OA 1M17A 4BDKA 4I20A 3CD3A 4E73A 3U55A 3FQSA 1R1WA 4R6VA 4JVGA 3D5UA 1LP4A 2XCHA 5AA8A 3F88A 2EB3A 3MY5A 3QTUA 3ZFXA 3TWJA 5CAOA 3H9RA 3O96A 3DXNA 1U59A 2QO9A 3ZXTA 1KE9A 4DCAA 2PVRA 5IQEA 2B55A 1XHAA 4HW7A 4W4VA 4CZUA 3OBJA 1ERKA 1PW2A 4RQKA 3OCSA 4OW8A 2ZYBA 5FEQA 4K33A 4UN0C 4ERKA 4QQCA 2G1TA 1Q8TA 3SOCA 5A6NA 3NMUF 1ZYDA 5A54A 1ZXEA 3LXKA 5A4EA 4JL9A 4MXXA 2ITTA 3SG8A 4NCTC 4YBJA 4GL9A 4DG2E 2GPHA 3CIKA 3FMMA 4MNFA 2X0GA 5TKDA 3E8EA 1OB3A 2RKUA 1LEWA 3MVHA 1QPCA 1NVRA 3QTXA 2YAAA 4KNBA 4BCJA 4C4GA 4EI4A 5LMBA 3FSFA 1WVWA 2YM6A 4IX3A 4FA2A 3S0OA 3PXKA 3U87A 2P2IA 4YSJA 3UZRA 4XP0A 1MQBA 3EQCA 3IKAA 3U54A 4I5CA 4X6QC 4NFMA 4BGGA 1FVTA 2XIXA 2LGCA 3HGKA 3C0IA 4YC6A 4YJUA 4CFXA 5ETCA 4N70A 1XWSA 2O5KA 4E6AA 1PRYA 3P1AA 4BY9E 5AMNA 4TYHA 4L9IA 4M15A 3I6WA 2VGPA 3GBZA 3DNDA 4FV7A 1AQ1A 5JZNA 3BEGA 1WAKA 4IZ5A 2GNJA 3B2WA 4HVGA 4AW0A 4X21A 5DPVA 2EU9A 5L8LA 4YU2A 2PUPA 2ZM1A 1OUKA 3A7HA 2XMYA 1JNKA 4IAIA 4F7JA 3SXSA 2KULA 3ACKA 4DYMA 4PMPA 3W1FA 4MTAA 4C7TA 3CJFA 3PA4A 2I40A 4C3RA 5BVFA 2VO6A 3OCGA 1G5SA 4QYFA 5ACKA 2JLDA 1BMKA 4CV8A 3ZUTA 3WARA 4GW8A 2Z7QA 5BVEA 2WMBA 3T9TA 2PVLA 4GFOA 3OC1A 3NAXA 3C4FA 4YJRA 3TZMA 5EI2A 5JZJA 5IUGA 2BDWA 4HZRA 5ANOA 4N0SA 2FYSA 3AT3A 4MBJA 4HJOA 5JGAA 4JLCA 4FNXA 4H3QA 3SD0A 5IZFA 4DHFA 2CKPA 4LOQA 2GNLA 3TNWA 4BDEA 3Q04A 5GIPE 4XEYA 5KBRA 3NIZA 3Q4TA 1OL6A 3WZDA 3POZA 3U9NA 3GCQA 4A9TA 2X4ZA 4W9XA 1UA2A 4DH7A 4UB7A 3O50A 5J95A 4D2SA 4RFYA 4O1OA 5FEEA 1O9UA 3TNHA 5M53A 2C5YA 3M11A 1WBSA 1IEPA 3AT2A 5DT0A 4WNKA 4M84A 3I79A 3EZRA 4RIXB 3GOKA 2VWVA 2XK9A 4FNYA 2A19B 3NIEA 4AGWA 3HAVA 5L6PA 4AZEA 3QD0A 2CKOA 4D9UA 2BVAA 4HGTA 3O8UA 4J98A 4QMUA 5JQ5A 4PQNA 2QNJA 4DEGA 3IG7A 2OZAA 2YAKA 5HNIX 3N4TA 2O0UA 1XJDA 3BI6A 3I4BA 3QF9A 2FH9A 2CGXA 3VUTA 4M66A 5LCKA 1OIRA 3UVRA 3F3WA 3A7GA 3CQUA 4WBOA 1XBBA 4KS7A 1BI7A 2X8IA 4FL3A 4E26A 1YW2A 3RAKA 3JYAA 2Y9QA 3KXXA 5IH6A 2HWOA 1HCLA 3IDCA 3VS5A 1PXIA 2CMWA 3MH2A 4CG8A 5J7BA 2BPMA 4FYNA 3FI8A 2NP8A 3IW4A 3FSKA 5IQFA 2O65A 1XO2B 4GFGA 4X2JA 2F9GA 3ZLYA 2IVVA 2EB2A 3KGAA 4R77A 5KMJA 2NO3A 5C26A 2PK9A 4TNBA 3ZRKA 4BIEA 2VWWA 3DT1A 4KKEA 4FT5A 3HYHA 2FVDA 3Q9XA 4R5YA 5AWMA 3UIXA 3ZUUA 4G2FA 3G6HA 4F1TA 2YHVA 4BHZA 4BGQA 4FKVA 5I3OA 5AUYA 3GQLA 4BBEA 3RK7A 3V5TA 4OAUC 2QG7A 3ZTXA 1FOTA 4TXCA 4H05A 3II5A 4XX9A 4XNEA 5HLNA 4XRLA 2OKRA 4CCBA 3NCGA 1JWHA 4IHPA 5IMXA 3ORTA 5KMLA 1A48A 2OJ9A 2UUEA 2Z7LA 4ZSGA 3TZ8A 4FGBA 3FZSA 3KEXA 2ITZA 4CFUA 5KZIA 4D2RA 4ZTMA 5K5NA 3GQIA 5D7VA 5BMMA 5EI8A 4HPUE 2UZWE 4XOZA 3LAUA 2HWPA 4KB8A 1B39A 1KV1A 3QX4A 2QOLA 2VTQA 2WEIA 3P0MA 4EH5A 4FSMA 2ACXA 3CE3A 3D7ZA 5HTBA 3R22A 5L2QA 2R7IA 4EC9A 5K3YA 2UW5A 3PG1A 4II5A 1YWRA 2J2IB 3G90X 2YA9A 4JAJA 4DEEA 4FKWA 4RX7A 3HRCA 2E2BA 4FSZA 3H0YA 4HVDA 5A14A 2WGJA 3W33A 4O7YA 4G3DA 4Y83A 3JY0A 2YIRA 4JT3A 4C02A 5HLWA 2R3GA 4I93A 4W4WA 4YTHA 4AF3A 2QURA 3BE2A 4U8ZA 4UWCA 3W2OA 4BICA 5HTCA 4GU9A 2CSNA 2PY3A 4DGGA 3P7AA 1JSUA 4UBAA 3AC3A 3WIGA 4BYJA 3BPRA 4HZSA 2J51A 2HZNA 4B9DA 3FYKX 3VS0A 3KA0A 3F5GA 4AE6A 4CTCA 4ZLZA 5EM6A 4Y95A 3S00A 3WZUA 1OL1A 2GS7A 4IVBA 4YJNA 2C5NA 5HG8A 5IH4A 3RK5A 3ZLSA 3VJNA 2YIYA 3NUNA 1UVRA 4BZDA 5J79A 2HZIA 2VTJA 3COIA 3U9CA 1TQMA 5HOAA 4DT8A 5DRDA 4F9AA 3IGGA 3LM0A 5KMKA 3NUAA 5AV0A 2G2IA 4O6EA 3AXWA 5CYIA 4BDBA 4D2WA 2I0VA 2CLXA 2R3JA 2G2HA 5FTQA 4YPDA 4KIQA 3WE8A 5C8KA 3PG3A 4TN6A 3V6RA 1J1BA 2VWZA 3L8SA 2W1FA 2GNIA 2XIKA 4U6RA 3ZSHA 1GIJA 4LQMA 1V0PA 3Q53A 5IISA 2X2MA 4YJQA 1YRPA 3PVWA 3NGAA 1ZWSA 3AD5A 4EJNA 3JY9A 5BVOA 3Q5IA 2WOTA 3QZFA 3F3VA 3V5JA 4LRJA 2Z7RA 4TWCA 2OF2A 4BDCA 1R3CA 3HECA 3V8WA 2BROA 2JAMA 3MPAA 4JIAA 4W8DA 3TV6A 4BCKA 5FUTA 3HV3A 3MYGA 2V62A 2XKCA 5DR9A 2BR1A 3AMAA 4G3GA 4QMMA 5TR6A 5H2UA 4FK6A 4Y85A 4IXPA 5LVMA 3PJ3A 4FEWA 3DZOA 3BKBA 2GNFA 2X39A 2UZVA 4G16A 4C0TA 3IONA 4RIWA 1M7QA 3RVGA 4KKGA 2BHEA 3G6GA 3NNUA 4DFZE 5FTOA 4PPAA 5BPYA 4QTDA 3VRYA 2PUNA 2FO0A 3GU5A 4M3QA 4W8EA 2V22A 3QXPA 2O63A 4I24A 1P14A 2W06A 4NIFA 4BCHA 4EHGA 2QOFA 3S1HA 3H30A 1SYKA 3OWLA 4JQ8A 3LM5A 5HD7A 3UQGA 3VBVA 1JKTA 2JFMA 5KCVA 3LXNA 4J97A 4YHTA 3V5QA 4GVAA 3HV4A 3O7LD 2UW7A 4WNPA 1P4OA 3LQ5A 3DFCB 3SX9A 1GIHA 3FLSA 3PXRA 4Y8DA 3DNEA 5A3XA 3TIYA 4CFVA 4RWKA 2YERA 5BVKA 5GZAA 2QONA 3P7BA 3D5XA 5IU2A 1VZOA 4MD7E 3H9OA 3HKOA 4UALA 5CEOA 3BYMA 2Z02A 3RNYA 5TT7A 3GNIB 3HRFA 2IW9A 2OF4A 1Z5MA 1IA8A 3R9OA 4HNIA 4FZAB 4RVLA 2JDVA 2JBPA 5EW9A 4XLIA 1BYGA 4O91A 2XK8A 3V3VA 5J9ZA 2J5FA 3HUCA 5IA1A 3BLHA 1BL7A 1XH8A 3LFBA 3MY0A 3W18A 4DEDA 5M51A 4EOKA 4KAOA 5HBEA 4EC8A 2E9NA 4OTIA 2XRUA 4O7SA 1UU8A 4QP6A 5AP6A 2F4JA 3GXLA 1VR2A 4U45A 5J1WA 4M0ZA 4D5KA 4EOPA 1YI4A 3BYVA 5JH6A 4WG5A 4F9WA 4LGHA 3V5LA 1TKIA 3MWUA 4FTTA 2R0IA 2YITA 4KBAA 4YLJA 3V5WA 4JDIA 2OH0E 3TIZA 3VNTA 2W05A 5J1VA 2RIOA 3DPKA 4FZ7A 3QTWA 4E4NA 2IO6A 2P4IA 4P4CA 3F3TA 3RJCA 5E8SA 4C36A 2QO2A 3C51A 4X3FA 5FBOA 5CALA 4JQ7A 1U5QA 4FT7A 2W0JA 2GSFA 2VV9A 4CEGA 3A4PA 5IEVA 3UVQA 2BUJA 3TL8A 3A99A 1ZY5A 4NM5A 3Q4ZA 4KKHA 4QMYA 3FMHA 2ETRA 4LG4A 3PSCA 3A8WA 3COMA 4X7QA 4ZEGA 3LFEA 5IQIA 1ZY4A 3DK3A 1RW8A 5IPJA 3RHXA 1W98A 2VO7A 1Q8ZA 4ZZOA 1PMVA 4AA4A 3IPHA 4KSPA 3ENMA 2CGWA 2YCQA 4EQMA 2XF0A 2QQ7A 4M0YA 5BUJA 1H25A 4RJ6A 4CZYB 5C9CA 2OWBA 4IB5A 4TYGA 4PDYA 5C01A 4O83A 4FSTA 4O7RA 4IB1A 1XR1A 3DBFA 5KKRC 3OF0A 5EKOA 2I0EA 4IWDA 3EQBA 3ZEWA 2VX0A 2CNQA 4A4LA 4GKHA 4Y5HA 3SGCA 5M4CA 3KULB 2XKFA 4AGCA 3ZONA 3MFTA 1J7IA 1H08A 2YCRA 5F4NA 3GT8A 3RWPA 2R7BA 1PKDA 2VWBA 2BILB 4RIYB 3BIZA 2UZUE 3DJ5A 4V0GB 1Q62A 3RINA 1F0QA 1F5QA 3W2PA 3CXWA 5DEYA 4BGHA 4G17A 1LUFA 5K5XA 3CLYA 3WZJA 2C6TA 3OCTA 4EOIA 5FEDA 1WBTA 3ZS5A 1YDSE 2GFSA 3DXPA 3TCPA 5IA5A 5ETIA 3BX5A 3TN8A 3CPCA 1YXSA 3FY2A 2IZSA 3HA6A 4LGDA 4F6UA 3UZPA 3AT4A 1FMOE 3R1QA 4E6QA 3FLZA 3HMIA 3MGYA 4BTFA 4BCQA 4QMOA 5DWRA 1YDRE 1Q8WA 3ID6C 1DAYA 3GEQA 3QTRA 3TG1A 3PPJA 4D55A 4QTEA 4FT3A 5LQFA 3LQ3A 2XM9A 4FV2A 1H1SA 3O7LB 5K0KA 3U51A 4QMZA 5EW3A 3ZM4A 5CXZA 2DQ7X 2PE2A 3LCTA 5JEBA 3LZBA 4BBFA 3R1NA 3ULZA 2OIQA 1ZYJA 3I81A 4JI9A 4QMQA 1I09A 1UNLA 4RC2A 1YOLA 4ENYA 2IN6A 4GKIA 2ZDUA 3PE1A 3QWJA 3TJCA 4GG5A 3SC1A 2PYWA 4NTSA 3BZ3A 4RG0A 3OFMA 1GZ8A 1YXUA 5DR6A 3E63A 2WMUA 2GS6A 2QODA 5LJJA 2BZHB 2WD1A 2ITYA 4F9BA 4IADA 2WHBA 2W1ZA 2WTJA 3NUPA 4MXOA 4DEBA 2YM8A 3VS2A 4RFZA 2WMQA 3OMVA 5AUZA 3OXZA 4QMPA 4AOJA 3MFSA 4IX6A 1PKGA 5AM7A 4BTJA 3SHEA 4AW1A 4JIKA 4F7SA 3PIZA 1BX6A 3KXZA 4A9YA 2NRYA 4B0GA 2UW3A 1M2PA 5BUEA 5AFVA 3OEFX 2XJ0A 4MXCA 3R7YA 5C1QB 2RFNA 2Y7JA 2VUWA 4K8AA 3PJ8A 4FR4A 4QPSA 5CVGA 1PXLA 5L2WA 3COKA 4FTAA 3VBQA 1UV5A 5K9IA 3W2QA 3EQDA 4FTKA 3Q52A 1U46A 3QTZA 3SW4A 4RMZA 4MXZA 4MWHA 3B8RA 3UQFA 4OBQA 3SRVA 5DG5A 5CI6A 1XBAA 1URWA 3S95A 5M56A 1Y6AA 4ANQA 4KWPA 4XG2A 4AOTA 4IWOA 4XUFA 4QMTA 1W82A 4ZXTA 4F70A 5CWZA 2OBJA 3DQWA 5KKRB 4RPVA 5DLSA 3GU4A 1NVQA 3TDWA 2GTMA 3L9MA 4M69B 4M67A 2CHLA 4FNZA 4FTMA 3DZQA 2JDSA 3EN5A 2HW6A 2BFXA 3QRTA 2XB7A 5ANJA 5EDPA 5F95A 4ZK5A 4QMWA 3CY3A 5EM8A 2ZAZA 4K1BA 3U6IA 4QYYA 2JD5A 3G51A 3QLFA 4PL5A 1FBNA 1PXJA 1XKKA 1LR4A 1YDTE 1O6KA 3PVBA 3NW6A 3CTJA 5IDPA 2PUIA 2OO8X 2FSMX 2W4JA 3D7TA 4HGSA 4Y5QA 3JR1A 3TV4A 4TT7A 4C59A 4I0TA 4CKRA 5B2KA 3KL8A 3NWWA 4D9TA 1JSVA 2WU6A 3RHKA 4BCNA 3FE3A 2F57A 4P7EA 5CAUA 2QLUA 3HA8A 5G6VA 3QL8A 2JIVA 3A7FA 4I22A 3F5UA 4BKYA 3QTIA 3HEGA 3UO4A 2VO0A 2YN8A 3B2TA 2A4LA 1LPUA 4ANLA 4BWKA 2BDFA 4HCVA 4WHZA 4FE2A 2XIZA 3AMYA 3G9NA 2IPXA 2I1MA 2QOKA 3D2IA 3H3CA 3TXOA 3CEKA 4IAAA 3UP7A 3VF9A 4FUYA 5JRSA 3UIBA 3H10A 2W5AA 3JUHA 5T68A 2W9ZB 2WOUA 4GT3A 4TWOA 4CXAA 4EK5A 3R7VA 1GOLA 2CDZA 3I6UA 2XK6A 2C1BA 2R3LA 3NX8A 2OXYA 4KINA 1K9AA 4IAFA 2FA2A 5HD4A 5JK3A 2EXCX 4C8BA 4GK4A 3PXQA 4DF3A 5AAGA 3HMPA 3KMUA 2VTHA 4XG4A 2GNGA 4OTWA 2JDTA 5AV3A 4FKLA 5AAFA 4RGJA 4WG4A 3RPOA 3FL4A 4AGUA 4DFXE 2GDOA 3FHRA 1RJBA 4F7NA 2EXEA 2WQNA 3BV2A 4EOOA 3CY2A 4IM0A 5F9EA 4MQ1A 1G8AA 5AP2A 4HVHA 4B4LA 2B54A 4KA3A 4W4YA 1FPUA 4AACA 5LMKA 3OZ6A 4OTDA 4ZP5A 2BZKB 5B7VA 5L3AA 5HIDA 3UOKA 4NTTA 4GYGA 3GFEA 3QKKA 2WMVA 3IQ7A 3HZTA 2G2FA 3FAAA 2JKOA 2Z7SA 3NW5A 4FKQA 5EI6A 4ZJJA 4BI1A 1PYEA 3T9IA 3COHA 5DMZA 3NLBA 4ZSEA 3TJDA 3OROA 5BVNA 4F0GA 2PTKA 1CKJA 1QPDA 4C4JA 4IQ6A 4BRXA 4FL2A 5FDPA 1FMKA 2WMAA 4S2ZA 1JOWB 4OTHA 4F4PA 4RT7A 2YM4A 4N6YA 5M06A 4K6ZA 4CMOA 4KBCA 1JPAA 5KMOA 2QKWB 1FINA 4JRVA 4W9WA 4MKCA 5CAQA 4PWNA 4AOIA 4V01A 2XJ1A 2ZDTA 4UY9A 2RG6A 2XIRA 3MIAA 4PTGA 2I0HA 4QTBA 3QZGA 3RCDA 4FV6A 4YUQA 1YI6A 3DU8A 2QOIA 4G31A 3QGYA 4C34A 3P79A 2GQRA 4O2ZA 3D2KA 3L8PA 5HI2A 1GY3A 3C4EA 3F3ZA 1QMZA 3K3IA 3K3JA 4GRBA 2UW4A 4WSQA 4XYFA 4JBVA 4YHJA 3VS1A 3ORLA 2ETMA 1OMWA 5FGKA 5CS6A 2WTKC 2CGVA 3GU8A 4O7WA 2SRCA 4DN5A 3G5DA 4DLJA 4HCTA 4EL9A 4FV1A 4RX5A 1DI8A 3FV8A 1PXPA 1KOBA 2QHMA 3C5UA 3MH0A 4FEXA 4OUCA 3BE9A 1OZ1A 4IX5A 1IRKA 3ORIA 2C0OA 4FG8A 1PXMA 4PTEA 5AV1A 1RQQA 4LFIA 4DTKA 4G6LA 2UZOA 1XH4A 5E8VA 4C3PA 3ZLWA 4A9RA 3JXWA 2J7TA 3A4OX 3L1SA 4DINA 2B9HA 3VW6A 3KRRA 5ANIA 2GMXA 4JAIA 3MJ1A 3QC9A 4XV1A 4E4MA 2BTSA 2C0TA 2I0YA 1ATPE 5GJDA 3SXFA 4D5HA 5AV4A 4DBNA 4G9RA 1BL6A 3LMHA 4ZTNA 5K4JA 5H9BA 3U4WA 5IQGA 2HYYA 3F3UA 4APPA 5CI7A 4R78A 4WG3A 4AZFA 4YGAA 5FD2A 4LV5A 1WBWA 4XJ0A 2BAQA 4OT6A 2QG5A 3FMDA 5CZHA 4F64A 4DEHA 2WPAA 2YIWA 3MVMA 3HNGA 5AP7A 4FEUA 3R0TA 2Y4IC 3GVUA 4H1JA 2X8EA 3BHTA 5AM6A 3ZYAA 4A06A 4O7ZA 2QR7A 5TOZA 3NYVA 2R3MA 1ZYCA 3UVPA 4ALVA 1VYZA 2WIHA 4ALUA 4XHKB 4DH3A 4L7SA 4XV2A 4CKJA 2ZB1A 2W1CA 5DYJA 5D9HA 1B38A 2VZ6A 2CKEA 3DY7A 2QOHA 4JX7A 2R3IA 3L8VA 4Y46A 3EYHA 3GCUA 3M42A 5HESA 2C68A 2PZYA 3KFAA 5HQ0A 1W83A 2C6KA 4IW0A 3KMMA 4I23A 3LCDA 5EFQA 4MYGA 4PNIA 4QYEA 1AGWA 5C03A 2WQMA 4WRGA 2BIYA 2IZTA 4FSRA 4J7BA 3LMIA 4CGAA 1SM2A 4QNAA 5DBXA 3EQFA 2NPQA 3MIYA 5AUXA 5HBHA 4A9UA 5JRQA 4GG7A 5M4UA 4JG8A 3BV3A 2QOBA 5HE3A 3ZSIA 4O7LA 4CFNA 3BU3A 3GOPA 5CX9A 3G0FA 3WF8A 2PPQA 1VJYA 2WMXA 4R5SA 4BZNA 2PUUA 4FKGA 4ONAA 1KUTA 2VN9A 3O51A 3GU6A 4IIRA 3CP9A 3QQKA 3DB6A 3E8NA 2OJJA 4KABA 1ZMVA 2JITA 3R00A 5GNKA 1NXKA 2VD5A 2XH5A 3EH9A 3EN4A 3G0EA 4PDOA 2PZPA 2V7AA 2QOOA 5LOHA 3FKNA 3A2CA 3Q2MA 3RALA 4ITIA 4APCA 1EH4A 3PP0A 5I9UA 4BZOA 3AGLA 4EEVA 3NUUA 4C35A 2I6LA 1ZARA 4DFNA 4NK9A 5FDXA 3EFKA 4BCOA 4CCUA 3EQGA 2F7XE 4X3FC 3PY0A 3AC1A 5AX9A 3E5AA 1MRYA 3QX2A 2OZOA 3TNIA 4D4RA 1X8BA 3EL8A 3HV6A 2OGVA 4CFFA 3A62A 5JN2A 4RJ5A 4ITJA 1OGUA 5FXQA 1GJOA 4E8AA 5IF1A 3HAMA 1SNXA 2ITWA 4RWIA 5C27A 3LMGA 3PLSA 2P3GX 1WBPA 3HV7A 5LCJA 4F6SA 2VTRA 2WXVA 3EB0A 3ZO1A 1YOJA 2JFLA 4D1XA 1IAHA 2IW6A 3DBDA 3FUPA 3HDNA 1Q5KA 3MV5A 3MVLA 3G9LX 4FTLA 4IVCA 4FSYA 3F66A 1JKLA 4IZAA 5TO8A 4YJVA 2QKRA 3ALNA 2WNTA 5EHLA 5ANKA 2J0LA 4FG7A 3DDPA 3VBYA 3NZ0A 4E4XA 3IGOA 3ERKA 2G15A 4AFEA 1KSWA 1Q4LA 5HVKA 2F2CB 1T46A 4EOJA 3BHVA 3ZO2A 1MRVA 2W1HA 3BU6A 3KN6A 2WAJA 3K5UA 5AV2A 1GNGA 3D5VA 3ZM9A 1DM2A 3QRJA 2O8YA 3QA0A 3BU5A 2QCSA 2WTVA 3GGFA 3RWQA 3WYYA 4U44A 1J7UA 1CDKA 3NVKI 5E90A 4MNEB 3UDBA 4F63A 3EQRA 4FSNA 3OEZA 4RIWB 4NH1A 3PJCA 4YZ9A 5E8UA 4L52A 5KHWA 1FVRA 2ITXA 2W4KA 4FNWA 3GI3A 4I0SA 2DWBA 2G01A 4MX9A 3ELJA 3R83A 4DFUA 5I4NA 4YURA 3W2CA 1E1VA 4IWPA 5EHOA 4J52A 2BAKA 5CY3A 1H1WA 5DNRA 5J87A 3UMWA 4J96A 4O0SA 3DBQA 5FP5A 5JGDA 3V8SA 4CMTA 4MBLA 4YPSA 3BBWA 5GJGA 4BYIA 4EWHA 4O82A 1NA7A 1UWJA 3ANQA 4FTOA 3RNIA 3K5VA 3RI1A 3CTHA 5M55A 3FMNA 3I7CA 4ANOA 4UXQA 1L3RE 4CD0A 3TZ9A 3EL7A 3POOA 3W8QA 3EQIA 3GENA 4IBMA 4FTIA 5BVWA 2F49A 5CZIA 2WTIA 5BVDA 3OP5A 4IEBA 2FSLX 4IVAA 3BBTB 3BQCA 3KF7A 1OM1A 4ORKA 4FSQA 4GT4A 3LHJA 4E5BA 3THBA 4WIHA 2UW9A 3I5ZA 5E8XA 2VWXA 3VUMA 2YLEA 2E9VA 3B8QA 5DHJA 2QO7A 5LARA 4C2VA 4LGGA 1CKPA 4GJ3A 4PMTA 3FMEA 2HXLA 2ONLA 2OK1A 4O0WA 1PMNA 4I92A 1V1KA 1MQ4A 4LOPA 2W96B 4XMOA 3EN6A 3PZHA 3E7VA 4IB0A 2JBOA 3UOLA 3OXTA 4FKSA 3UO6A 4QTAA 1WVXA 2J50A 3QHWA 3VVHA 4S32A 3WF5A 3K2LA 3OY1A 4QP2A 5AAEA 2HIWA 3VUKA 4IMYA 4XCUA 3W2SA 2REIA 3RP9A 1SZMA 3FLYA 4D0WA 2F7ZE 3TZ7A 5EW8A 4O86A 3PVGA 5M57A 4EHVA 1JSTA 3FBVA 2VTNA 4JDHA 4TTHB 3FXXA 4ZTRA 4MD8E 4S34A 4IH8A 3AG9A 2R3HA 5CSVA 2RGPA 3A60A 1TQPA 5EH0A 2O3PA 1UWHA 2UZDA 4AN2A 1OBGA 3UYSA 3VWAA 3O71A 3PPZA 4BCPA 3TT0A 4S30A 3BLRA 2YWPA 3BYSA 4CQEA 4R1VA 1XH6A 4KIKA 4KIPA 5H8GA 4QP8A 3IW7A 3R9DA 1Y91A 4CG9A 5M07A 3EN7A 5FBNC 1FVVA 3DLZA 4M8TA 4O21A 4UMTA 4ZOGA 5CTPA 5AP3A 3U6HA 2J90A 5JQ8A 5AUWA 4AA0A 3D15A 2R3OA 2C3LA 1ZLTA 3KC3A 4UMUA 3SQQA 4TWPA 3TNPC 3NYOA 1OIYA 3ZHPC 4UYNA 4I6HA 4BI0A 3D14A 3C4WA 3ZLXA 4HVSA 4FV4A 4RQVA 1FQ1B 3PPKA 3ETAA 5AADA 4I4EA 2OW3A 3CD8A 3QQGA 3UC3A 3V6SA 1K2PA 4QMLA 2GQGA 3VBXA 4BCIA 4U81A 3G15A 5G1XA 2BZJA 4CSVA 3I60A 1BUHA 3LJ1A 3EQPA 3ZBXA 5IKWA 4H1MA 5EYCA 2CN5A 4NKAA 2BRMA 4QOXA 4LL0A 3UOJA 1UKIA 4Y72A 4IANA 1OECA 5LVOA 3FKLA 3A61A 4RRVA 4YLLA 2OFVA 4R3PA 5HHWA 2WMWA 3NYNA 3AQVA 4CFMA 3EIDA 3MTFA 1GAGA 3FQHA 1UU9A 2WQBA 2PMLX 4JBPA 3W8LA 3S3IA 4FVPA 2O2UA 3WI6A 1H01A 2OIDA 1HOWA 3QRIA 4A4XA 3PWYA 4DA5A 3ZO3A 4C57A 1Q99A 2CJMA 4PP7A 5HX6A 2RL5A 5ANGA 5LWNA 2UVYA 4L3LA 3PRFA 3ZZEA 2W1IA 1H28A 4NEUA 4QQ5A 5IG1A 3UNKA 4OTPA 1ZYLA 3LXPA 4R7BA 5ETFA 4R8QA 3FYJX 4NUSA 4B8LA 5CANA 4U3YA 3P86A 4EORA 3CBLA 4HVIA 2HZ4A 3Q4UA 2HELA 3R8VA 1PF8A 3FXWA 3DKOA 3WZEA 4EH4A 1UU7A 1Y8YA 3N9XA 4FV9A 3BWFA 5FG8A 2BRGA 2RF9A 4DEIA 4DTBA 1U54A 5M09A 4CYIA 1GZKA 5LMKC 4OAVB 5KNJA 4E20A 3EJ1A 3H4JA 4HGLA 3WF9A 3U6JA 1YQJA 3MB6A 4Y73A 4CRSA 2HY81 5KMIA 5GZ8A 5E1SA 5AUVA 3ET7A 4O7TA 3P9JA 3WIKA 4XRJA 2YM5A 3ZC6A 4Z7HA 4ZS0A 2X2KA 3ZFYA 3F82A 5CEIA 3HX4A 3R8PA 5A4QA 5AIKA 4GT5A 2W1EA 5CSXA 1QL6A 3UMXA 4ZTSA 1HCKA 5JFWA 2BZIB 2B9IA 3KRLA 5CENA 2CN8A 2KTYA 4GUBA 5L4QA 3SRVB 3RCJA 5H8BA 4NM0A 2WB8A 1YHWA 3OOGA 3QZIA 4HGEA 4J1RA 4P5QA 2RFEA 4L68A 4CQGA 3DK6A 4IFGA 3BWJA 4K0YA 2ERZE 1SNUA 4RSSA 4U43A 2OJFE 4YJTA 4XG3A 1NW1A 2W17A 3FL5A 3EMGA 1H1PA 3FMKA 3KMWA 4L3JA 4BWXA 4F9YA 3UIMA 3EFJA 3LIJA 4NZWB 1YHSA 4U40A 3ENHA 4ANNA 4UYAA 5J8IA 5IEXA 4GK3A 1H24A 5I9XA 5IQCA 3LQ8A 3PY3A 3ZC5A 2VTLA 4EH8A 3F7WA 4QQJA 3OG7A 3DJ6A 2PSQA 3QXOA 3C4ZA 4QMVA 2QOCA 2OJGA 2CCIA 5IA2A 4Z3VA 1OIUA 5FQDC 2CNVA 4FL1A 3ZSGA 3QD2B 5J9YA 4XG6A 1Q97A 3NVMB 3MTLA 2Y6OA 4JNWA 4V04A 4E3CA 2X1NA 4LMUA 4PF4A 5HE1A 3LXLA 3GC9A 2C3JA 2AC5A 4J8MA 1PJKA 2XRWA 4FVQA 4JR3A 1JVPP 4MBIA 4BR3A 3JPVA 5GINE 2BHHA 5HCXA 3VHEA 2GHMA 1O6LA 4K2RA 4AWIA 3K54A 4NKSA 2WQEA 4BB4A 4F9CA 3DDQA 3Q6WA 4O2PA 1ZOEA 3ZMMA 4ACDA 4M97A 4RBLA 3G2FA 2VAGA 5M08A 2Z2WA 5HX8A 4MH7A 4IZ7A 3FXZA 1IASA 2C6OA 2EXMA 3FZTA 4JBQA 2FGIA 4FTRA 4M7IA 4L01A 2V0DA 2HOGA 3DFAA 5DFPA 3TTJA 4ZAUA 1CSNA 3HMNA 3OS3A 1U5RA 5DT4A 4E5WA 4FT9A 3DTCA 4J71A 2H9VA 4EZ7A 2OU7A 1REJA 3NW7A 2XEYA 2UZEA 4EH2A 4QP9A 4X2GA 4IM2A 3BEAA 5HO6A 3REPA 4NWMA 5FRIA 3NSZA 4YMJA 4U42A 3GCSA 3OXIA 2A2AA 4E7WA 3OWJA 3UG2A 4GK2A 2C0IA 3KQ7A 4C4EA 2JGZA 4GYIA 4AFJA 3LPBA 1ND4A 4O0VA 3VJOA 1R0PA 2OICA 3BYOA 4IJPA 3QCYA 4KBKA 2XYNA 5HE2A 4O7VA 3ORPA 4DE4A 3R7EA 2WTWA 1J3HA 3R7IA 5BYZA 2PZIA 2PVKA 4I6QA 5ETAA 1OL2A 4L44A 3F2RA 2CPKE 4IACA 2XCKA 5EDQA 4PL3A 3R9HA 4C4HA 2XKDA 4JDJA 4Z7GA 4FKIA 3GP0A 3ALOA 4GIIA 4N6ZA 4C62A 1V0OA 3LJ0A 2V7OA 1WBOA 1OL5A 2HENA 2VWIA 3KCFA 3Q32A 2I7QA 3LKMA 3R6XA 2PL0A 4OBPA 3WOWA 3R9RA 4I41A 1KE8A 3I1AA 3IDPA 3KRJA 4BFMA 2H8HA 4RJ3A 5AR3A 5EQPA 5CLPA 2OH4A 4FZFB 4DCEA 2R0UA 4MXYA 3HV5A 2C5XA 4QD6A 1WBVA 3W32A 4F0IA 4QMSA 3DAKA 3DGKA 5JKGA 2VTMA 3AGMA 2JKMA 5E7RA 4D2PA 1Q3DA 2C30A 4L7FA 2FSOX 4TW9A 3ORKA 4O1PA 3PSBA 4DITA 5BNJA 3F69A 3I0OA 4HYUA 4ASDA 4PL4A 1FGIA 3PP1A 3S4QA 4EJ7A 5HIBA 4FIFA 4EKLA 2ITVA 3KB7A 4AW2A 2HW7A 2QU6A 3MY1A 4ZZMA 1ZMUA 2ITOA 1I44A 2CKQA 4WA9A 5EHYA 4LUDA 4F08A 1O6YA 5EQYA 4LUEA 4ZTLA 3P23A 4WOVA 2C5OA 3E8DA 4O6LA 2ZM3A 5HGIA 4ARKA 4BTKA 2ZB0A 4YC3A 4CRLA 2XNPA 4EONA 3FPMA 2RG5A 1OPLA 4QPMA 4FV8A 3QAME 4L6QA 3QU0A 5AP1A 4FV0A 4AE9A 2OFUA 4MAOA 4OBOA 4L8MA 4RVKA 2PE1A 5CVHA 3DXQA 1GZOA 5AR5A 5EM7A 1JKKA 3FMLA 3QD4A 4FIIA 4NM7A 1M7NA 3IOPA 1YKRA 3RZFA 5CEQA 4I5PA 3VQUA 3VUGA 1SVHA 4O0RA 5EYMA 4BIBA 3O8PA 4D2TA 2BCJA 4I5HA 3UPXA 3RPYA 4WUNA 3C7QA 5AUTA 5A4TA 4BL1A 2IWIA 2Y4PA 3IW6A 5D1JA 2R3RA 4DH8A 2VO3A 4EZ3A 3PXZA 4RJ8A 4FT0A 4GMYA 3U8WA 4EWQA 3P5KA 2E9OA 3DKGA 3Q9ZA 4XOYA 2W5BA 2B53A 4EH6A 2ITQA 1UNHA 4EBWA 4JG6A 4KS8A 1VYWA 3KK8A 4JDKA 4EYMA 4KRCA 3FJQE 4L3PA 4CV9A 4AZWA 5DT3A 4HCUA 4JOAA 3AOXA 2BKZA 1WZYA 5CAVA 2VNWA 4AT4A 4PNKA 3A7IA 5KUPA 4TKSA 4PP9A 3O23A 5AR7A 3EN9A 4X6RA 4L67A 4R3RA 4JRNA 3UIUA 5I9VA 2V5QA 4G6OA 3OWKA 1H0WA 4C2WA 4RIYA 2A1AB 4BBMA 1BI8A 3CKWA 4BDFA 1LEZA 2JEDA 1QCFA 3NYXA 5DA3A 1Z9XA 4EUUA 4BIDA 2QHNA 4C3FA 4DG3E 5JGBA 3KF4A 2YJSA 1CKIA 4FSUA 3TKHA 4L46A 2WMSA 1W7HA 5D41A 4UMPA 2PU8A 5EDRA 4XP3A 2YACA 2B7AA 3EFWA 4EHZA 2QU5A 3OD6X 1KE5A 1R0EA 2RSVA 4NU1A 1JAMA 5LXMA 3LVPA 3MW1A 2XNGA 3QQHA 2X7GA 4G34A 3MPMA 4ZJVA 4TYHB 1IG1A 4JG7A 4LMNA 4IE9A 1PXOA 3ORXA 3KXMA 4DGNA 4Q5HA 3KKVA 5HVJA 1Q8UA 2B1PA 2ONLC 2W1DA 4U5JA 5EQEA 4QNYA 2A27A 1ZZ2A 2OXDA 4YTIA 5E91A 3T3VA 2XYUA 3ORNA 2XNMA 2YABA 3ODZX 4ASXA 3QWKA 4M14A 2C6MA 2ZMCA 2EUFB 2BIKB 2OJIA 2YCSA 3IDBA 3LCSA 3QUDA 5HVYA 4QQTA 1IR3A 4RWJA 4AN3A 3NUSA 3D0EA 4G3FA 2C1AA 2UZBA 5KZ0A 5C8NA 5DGZA 2PVJA 4F7LA 3DKCA 1KE7A 1SVGA 4PRJA 5JFXA 4IC8A 5HG5A 3KXNA 4ZY6A 3TKUA 5CF4A 1Q8YA 3QA8A 5E9EA 4DTAA 4D4SA 4TYIA 4BWPA 3R7GA 3ZFMA 3TKIA 3CQWA 3DTWA 4EK4A 4FI1A 5BUIA 4O0YA 3VUDA 5CU0A 2RFSA 5ANDA 2UVXA 2HCKA 5TE0A 2YM7A 2FSTX 4O7NA 2C6LA 2G9XA 3KN5A 1YOMA 4I94A 3R8MA 3VQHA 4ITHA 5KE0A 5IA3A 4TL0A 1M2RA 3UNJA 3R01A 3RKBA 3UBDA 2R9SA 5CEKA 4AP7A 2YWVA 4YBKA 1E1XA 4U80A 1K3AA 3KVXA 4IM3A 5HLPA 2GHGA 4ACHA 1B6CB 5HNBA 2WO6A 4P2KA 3VN9A 2AYPA 4CFWA 4EYJA 4U9AA 4F65A 4XLVA 2BKKA 3PY1A 3BGZA 1Z57A 2GS2A 3AC2A 3Q96A 1APME 2OZAB 4OT5A 4ZTQA 5H3QA 3Q3BA 5HNGA 1NT2A 2GU8A 4G5JA 3F7ZA 3FLWA 4QO9A 4CNHA 3FWQA 2HAKA 4RC4A 1Q61A 2XNNA 3ZEPA 5I5ZA 4CZTA 1KOAA 1WFCA 4M69A 4HPTE 1H8FA 2WMTA 4YJSA 4E5AX 5AEPA 2V55A 1OBDA 1ZAOA 5KO1A 4PDPA 4C4IA 2JC6A 3OW4A 4IDVA 4DLIA 3F2NA 4FTJA 3FKOA 4XBUA 3Q4CA 4FZDB 4AG8A 5L2SA 4USFA 3GU7A 1JQHA 5I9ZA 3DQXA 2Y8OA 4FTNA 1ZOGA 2VTSA 4R7IA 4C58A 2BRHA 2OSCA 3R1SA 3H0ZA 3NUXA 4AX8A 2P2HA 4EBVA 5FXSA 4DGMA 3SVVA 1H0VA 3RAIA 3UOHA 5KBQA 2VX1A 4KSQA 5T3QA 3CR0A 4DBXA 4YJOA 2PE0A 3MESA 4FKJA 2W1GA 2R3QA 3ATSA 4RFMA 4BVUA 3EYGA 3P7CA 3CTQA 3EHAA 2ZJWA 3QHRA 4ZSJA 3VS4A 5AP4A 1UNGA 3VO3A 1KWPA 3SG9A 4YHFA 4BCFA 2QVSE 3KU2A 3L9PA 3QTSA 4AUAA 4D1ZA 3LFQA 5HO8A 4ANSA 1P2AA 5CU4A 2J6MA 3TM0A 5GHVA 3HMMA 3LCKA 4FZ6A 3UZTA 1UU3A 5L2TA 5CSWA 3ULIA 2PWLA 1ZYSA 4L42A 2XVDA 3R28A 2VTIA 4NJDA 2YJRA 5HG9A 3VAPA 4ASEA 4B6LA 4H3BA 5FM2A 3HUBA 4QYGA 1QPEA 3OTVA 3L9LA 4FKPA 5CSHA 3I5NA 3ACJA 3EKKA 2XK4A 4E93A 4ZSAA 4FTCA 4L53A 5AP5A 4LYNA 3QUEA 5IQDA 5GIOE 4A4OA 5CT0A 5JSMA 3FQEA 3HMOA 3JVSA 5JMSA 1BLXA 3MFUA 3PUPA 4L00A 3Q60A 3FLQA 3R8LA 5EG3A 4FV5A 4WUAA 3Q2JA 2BFYA 2YM3A 3E64A 3EZVA 1OI9A 5KMMA 4EQUA 3DLSA 2FUMA 3RAWA 2GHLA 1PMEA 1SVEA 4MCVA 3VS6A 2WTKB 4CLJA 4KIOA 5HE0A 3NPCA 4E6CA 5IUIA 2XJ2A 4IFCA 4UXLA 2CCHA 3MH3A 3BHHA 3Q9WA 2J9MA 4Z9LA 1Y8GA 1OITA 4Q9SA 2ETKA 3D4QA 4KIKB 5L2IA 3D83A 1STCE 3AMBA 3MN3A 4FEQA 4BDIA 2WTDA 5EKNA 4FIEA 4XS2A 1OPJA 4PMSA 2F7EE 5LVNA 2E9UA 4JQEA 2H6DA 1OIQA 3OT8A 3QYWA 3JS2A 4O27B 1J1CA 3RM6A 3ZZWA 4AZTA 4IDTA 3VC4A 3O0GA 5GJFA 4WKQA 4ZZNA 3PJ1A 3QQUA 4DH1A 4IB3A 4QTCA 4GS6A 2C69A 3H9FA 4MEDA 5CT7A 4E6DA 3QUPA 4FF8A 5BX0A 3PA3A 3D5WA 3R71A 5HU9A 2Q0NA 5CU3A 3PJ2A 2J5EA 2JAVA 4LRKA 4EOQA 4DAWA 3IOKA 1W8CA 3C4CA 3N51A 4WSYA 3CJGA 4PX6A 5B2LA 1PXKA 2R3NA 3EFLA 4A9SA 5K4IA 3KXHA 2FB8A 3C9WA 5J9LA 4RZVA 5AP0A 5HCYA 3FHIA 1S9JA 2X6DA 3LE6A 2Y4IB 3DAEA 3PE2A 3OCBA 2BRNA 4FOBA 5D11A 2UW6A 4AU8A 1M14A 3QRUA 4BDAA 4E4LA 2WTCA 3QD3A 4RX9A 5F1ZA 2WELA 2JIIA 3AC5A 4NIFB 4EK8A 4R7HA 2XNBA 5HO7A 3NS9A 1OUYA 1PHKA 4HNFA 3UJGA 2HK5A 2OG8A 4Z16A 4GVJA 3R30A 3AC4A 1OPKA 4O22A 1J7LA 1M52A 3U4UA 3NR9A 4UZDA 3TTIA 5CSPA 4X2KA 4YLKA 4TNDA 4JX3A 3OUKA 2VX3A 3LLAA 5T6KA 3GC8A 3ZBFA 2BDJA 4BCGA 4XBRA 3IO7A 4HYIA 2VTOA 1PXNA 3R8UA 4FTUA 2XZSA 3OVVA 4XV3A 4TY1A 2PVFA 4PUZA 4RA4A 4EK3A 2PVMA 5E8ZA 4KUJA 2CGUA 3KY2A 4XG9A 4TWNA 2BTRA 4AAAA 2B9JA 2YIXA 3E92A 1J91A 3RBWA 3DBEA 4MVFA 1OVEA 3DJ7A 3C1XA 5ITAA 1U54B 4YZDA 1JKSA 3ZDIA 3SDJA 3UP2A 3ZUVA 2P0CA 3BYUA 3RGFA 3F2AA 4IAKA 2VTTA 3HVCA 4FMQA 4FV3A 2ZVAA 2X2LA 4FG9A 3R63A 5JFSA 2R4BA 2UV2A 2YDJA 3NNWA 2VWYA 3BRBA 3SOAA 5DR2A 5HEZA 2VNYA 2UZLA 3P08A 1CTPE
chains in the Genus database with same CATH superfamily
4UZHA 4AGDA 1NY3A 4X3FB 3M2WA 2NNWB 4FOCA 4GU6A 4MF1A 4ANMA 4EH3A 4Q9ZA 1YXXA 2QC6A 2VU3A 3ATTA 2X6EA 2OI4X 4MWIA 1SMHA 4H58A 2J0JA 3FI4A 4M68A 1JLUE 4M13A 2DS1A 3BGPA 5CASA 1TQIA 5CAPA 5IH5A 3QGWA 5C4LA 3W55A 1RE8A 3D9VA 4WO5A 4V05A 4NT4A 3F9NA 1DS5A 5E92A 5BYLA 5AR4A 3FI3A 3DV3A 1WCCA 3GCPA 4PDSA 1RDQE 4JBOA 5DN3A 2PVHA 4Q5EA 3SLSA 3VS3A 4D58A 4FEVA 4TYJA 3MVJA 1JBPE 1VLRA 5D10A 3W2RA 2PMIA 4UWYA 3PWDA 4YNEA 2J0KA 4EOMA 1H1RA 4GFMA 2YISA 2B0QA 4O84A 2F2UA 3UQCA 4BCMA 4G6NA 4BDJA 3SW7A 2PVNA 2HZ0A 4R1YA 4LM5A 2Q83A 2GCDA 4AZSA 1Q24A 1OKYA 1A9UA 3QKLA 3A8XA 2C4GA 3FZPA 2YZAA 3OT3A 2B52A 1DAWA 2R64A 2NRUA 3IW5A 4J53A 2ZMDA 3W16A 4K11A 5AR8A 4U0IA 5FTGA 4DHIB 2PZ5A 4G9CA 3CKXA 4RVTA 2ZOQA 2JKQA 4IC7A 4ZSLA 1G3NA 1PY5A 3R2YA 3R7UA 4DG0E 2QLQA 4O0UA 4DGLC 5BMSA 4RLLA 4I0RA 4BDDA 3V04A 2OLCA 3E3BX 2JDOA 4O0XA 3E3PA 4A7CA 3LFSA 4OR5A 4BKJA 4YTCA 5A46A 3EQHA 3RK9A 4RLKA 2C47A 2OXXA 2XNEA 4NW6A 2P33A 5LMAA 4CT1A 5HORA 2C3IB 3PYYA 3KREA 1XH5A 2W9FB 3TV7A 1WMKA 3FDNA 4RIXA 2DYLA 4WNMA 5H8EA 4UEUA 1H07A 3PDTA 2E9PA 1H4LA 4XG7A 5E8WA 3Q9YA 3UODA 3WF6A 1PYXA 4NJ3A 4U79A 2QOQA 4YO4A 4OTGA 2R5TA 3QZHA 1IA9A 4UMQA 5KX8A 3T3UA 5CF6A 2AUHA 3GB2A 2PMOX 3UTOA 4MNEA 1UKHA 3R1YA 4M12A 2QI8A 4AQCA 1P5EA 5CQWA 1XQZA 4NYEA 4C33A 4E1ZA 3MI9A 3DKFA 3V51A 3DB8A 3F5PA 3C4XA 4XG8A 5ANEA 5AR2A 4ACCA 5C8MA 4ASZA 3UNZA 4BDHA 1L8TA 4FVRA 1CMKE 5TF9A 3UDZA 3UO5A 4LV8A 4QMNA 3RZBA 4EKKA 4IWQA 4FODA 2DUVA 3SXRA 2UW0A 4GUEA 2JDRA 4NCTA 4MK0A 5IDNA 5DRBA 3VF8A 2GFCA 2XBJA 3SA0A 4U97A 2X8DA 3OBGA 4ACGA 4FC0A 4TPTA 3HP5A 2JIUA 4X3JA 3IS5A 4I6BA 4AW5A 5GZ9A 5IQHA 5J7HA 2XIYA 5AJQA 3FPQA 1OL7A 2W99B 3PA5A 4O96A 4IZYA 4F6WA 5IEYA 3TEIA 4C61A 2ITUA 3F61A 4MD9E 4FIGA 2VGOA 4IAZA 3QLGA 2QD9A 1Y57A 3P4KA 4Z55A 3GCVA 1G8SA 1MRUA 2WFYA 4QYHA 3W0RA 3MFRA 4F1MA 4N57A 4PY1A 5L8JA 3MSSA 4I6FA 5AX3A 2PZRA 4YP8A 5D7AA 4MXAA 4FICA 3IECA 1XH7A 3FZRA 2ZV8A 3UYTA 4AA5A 3S2PA 3O8TA 4PV0A 1A06A 2UZNA 3I0QA 3JVRA 3P78A 2YIQA 2PHKA 4NL0A 3UE4A 3WYXA 2WKMA 2XS0A 4GEOA 1VEBA 2Y6MA 1CM8A 4K9YA 2AC3A 5CU2A 3DOGA 4W4XA 3GFWA 1M2QA 2IVUA 4ZMEA 5M4IA 2GQSA 3O17A 4X2NA 4A07A 3HRBA 3NUYA 2X9EA 2XEZA 4O0TA 4ZIMA 4Q2AA 4EH9A 1MP8A 4WD5A 3C0HA 4GCJA 2B4SB 3TUCA 3BLQA 4AXDA 2WU7A 2C5VA 3F6XA 3M1SA 4NSTA 2YDKA 1YWVA 5DI1A 3WZKA 5J5TA 3PIXA 2R3PA 2X9FA 4IAYA 5HKMA 4RWLA 4EOSA 3VULA 4ANBA 2X81A 2H96A 2HXQA 4NW5A 3D7TB 4YZNA 2R2PA 3LFNA 4OTRA 4TRLA 4C4FA 3QQLA 5IMEA 3MDYA 4QP4A 4H3PA 4RVMA 4HYSA 2R3KA 2W5HA 5I9WA 5KMNA 3OHTA 2ZV9A 3PLAE 3PFQA 3QQJA 5EOBA 3ROYA 2Y0AA 3R21A 2CNUA 4GH2A 3KXGA 3LJ2A 4B7TA 3ZO4A 1XBCA 3ANRA 4FKRA 4RC3A 3R9NA 3WILA 3DAJA 4J8NA 4CTBA 4O81A 4DHJA 3KRXA 1YHVA 1OKVA 4QT1A 5HBJA 3PXFA 4TYEA 4QDVA 3QTQA 4DFYA 3L8XA 2X7OA 5E8TA 4IX4A 2J0MB 3LFFA 4FGRA 2ITNA 5FLFA 3NNVA 3W0OA 3UG1A 3BELA 4RX8A 4FKTA 3T8OA 3PZEA 4D2VA 4F0FA 3WE4A 5AA9A 2PVYA 3FMJA 3QCSA 1YXVA 3ZH8A 4MHAA 3O2MA 5ICPA 3PIYA 2A0CX 4J99A 1YVJA 2EWAA 4X2FA 3PXYA 3ML1A 2ESMA 3RAHA 1REKA 2XK7A 2IW8A 4NFNA 5DH3A 4YNOA 4DH5A 4MQ2A 1MUOA 3L9NA 3NCZA 4YJPA 5LVLA 3VUIA 3VBWA 4CVAA 3WBLA 5L8KA 3TI1A 4JR7A 5HG7A 3PRIA 3W0NA 3QYZA 3R73A 3VBTA 4U41A 4DGOA 2IZUA 3TUDA 5CEMA 1G8JA 3OWPA 4GJ2A 4U7ZA 2XNOA 3CPBA 2R3FA 2GNHA 3VHKA 3TACA 2YCFA 4PPCA 5L6OA 3E93A 4FRFA 3LFCA 5B0XA 4USDA 4AS0A 4I5MA 4F99A 2WIPA 1ZMWA 5AIRA 5LWMA 3SAYA 4FSWA 1S9IA 3RTPA 3E7OA 1GZNA 3ODYX 1V0BA 4FIHA 3FI2A 4G3EA 1ZRZA 3C13A 3LFDA 3NDMA 4X0MA 1P4FA 4WNOA 5F94A 3GC0A 3UPZA 4ID7A 5FXRA 3TMOA 3AC8A 5B2MA 3QCQA 4EOLA 3CGOA 5E4HA 1WVYA 1OKZA 4D1SA 4LRMA 2YZLA 5HZNA 4EK6A 4GIHA 4QP7A 3PVUA 3KVWA 2LAVA 4S31A 1IAJA 2IG7A 1KE6A 2BRBA 2ERKA 3OTUA 4J95A 4KD1A 3ROCA 5HCZA 5CEPA 3FY0A 5DVRA 4O38A 3FZOA 3ITZA 3CC6A 4K18A 5M44A 2XM8A 4LL5A 3CCNA 3CQEA 3LCOA 4EUTA 5EK7A 2PMNX 3ZDUA 4IJ9A 1H26A 1NVSA 4RIOA 3NFGB 5IQBA 4P90A 1PMUA 4R3CA 3KCKA 2RFDA 2YFXA 3SV0A 1GIIA 3DA6A 4ZLOA 1ZOHA 5C4KA 3EOCA 2PULA 3CGFA 4ZMFA 2EVAA 4C38A 3AD4A 3ORZA 5IQAA 1E9HA 4YC8A 4BC6A 3DBCA 3AD6A 2YEXA 3E62A 4NM3A 5FP6A 2X0OA 4GSBA 3D94A 4PMMA 5EM5A 5HIEA 2VTAA 3BQRA 5AUUA 3V5PA 4ZY5A 5E8YA 2IVSA 4QP1A 1TVOA 1DI9A 2ZM4A 1TFFA 2UZTA 4XV9A 1BKXA 4BTMA 3RPVA 2Z8CA 4HYHA 4USEA 5CNOA 4F1OA 2ZV7A 3OW3A 1ZZLA 4UV0A 5IA4A 3FC2A 1Q41A 1AD5A 2H34A 1QPJA 4DT9A 2J4ZA 4JS8A 4CMUA 4I1ZA 4FUXA 1F3MC 3RM7A 3R04A 4OTQA 4RA5A 4EHEA 3MPTA 2C6IA 3CS9A 3QC4A 3ORMA 2C6DA 3ZRLA 2X7FA 2GTNA 2VTPA 3PTGA 4AXAA 4IVDA 2XBAA 1YXTA 2XKEA 3C0GA 3MBLA 4AT3A 4CKIA 4DC2A 2W4OA 2YDIA 3R2BA 5J5SA 4H39A 5I0BA 4G1WA 4BHNA 4BI2A 2Z60A 4UMRA 4DFBA 4YZCA 4BN1A 4ERWA 3GUBA 3I7BA 4WRSA 2OIBA 5CVFA 3KULA 5JT2A 3QRKA 4UWBA 2P55A 2W7XA 4CLIA 2WMRA 2UW8A 1W84A 4FKOA 4K77A 2ZV2A 4YR8A 2C6EA 2WZJA 4FIJA 5CNNA 5LVPA 5A4LA 3F5XA 3MA6A 4FTQA 3LLTA 3G33A 5F20A 4V0GA 5DOSA 3LOKA 3FLNC 5IA0A 3Q6UA 3KK9A 2XA4A 3QFVA 4ACMA 3N4VA 4L43A 4F09A 3LW0A 3N4UA 3MH1A 3QBNA 4PTCA 4BKZA 3WF7A 5A9UA 3VS7A 2VWUA 3BHYA 3OUNB 4S33A 3KRWA 4B8MA 3ZCLA 3VUHA 1KV2A 2JKKA 3EKNA 3MS9A 1FGKA 3ZXZA 3QCXA 5M4FA 4FKUA 4N4SA 1Y6BA 4FYOA 3HLLA 3MA3A 1W0XC 4EH7A 5K0XA 5KHXA 4FK3A 4ALWA 2IZRA 1R39A 1URCA 3Q5ZA 3CSVA 3NRMA 4I4FA 1YWNA 3HDMA 2HY0A 4JJRA 4OTFA 1H27A 4P5ZA 2AEGA 3R7OA 3EWHA 4CT2A 4I6LA 4YO6A 2WQOA 3FC1X 2IVTA 3R8ZA 3A7JA 3E87A 2VRXA 3C50A 4CYJA 4PPBA 4BDGA 4QRCA 2BALA 4OLIA 5EYKA 3DK7A 3RPSA 4YTFA 4JXFA 3TUBA 2C3KA 3NEWA 4TZRA 4YZBA 1W2DA 4QMXA 4U3ZA 4RJ4A 3TNQB 2ITPA 5I3RA 1Q3WA 4YSMA 3NAYA 4XP2A 3HL7A 4KRDA 3OOMA 5CQUA 3LFAA 4WBBB 2QR8A 3VIDA 4G3CA 2CLQA 4YZMA 4FBXA 4BF2A 3BGQA 4I21A 2BAJA 4RJ7A 2Q0BA 3MB7A 5DEWA 3SKCA 3ZU7A 3C5IA 5HTIA 5I9YA 2XP2A 5EOLA 3W10A 4LOOA 5IUHA 3QALE 4FX3A 4B99A 2XUUA 5FWKK 4D28A 4DEAA 3DCVA 4D0XA 3BHUA 4QPAA 5DIAA 2WEVA 3OY3A 2XK3A 3E88A 4GV1A 4OGRA 3VW8A 1T45A 4G5PA 4WT6A 4ZS4A 3PSDA 5HICA 3TDVA 4BJJA 3FZ1A 4MF0A 4ZTHA 4D4YA 4DFLA 2J0IA 4HOKA 5BQ0A 3NNXA 1H1QA 3RMFA 4LI5A 4RZWA 4QP3A 3UC4A 5CXHA 4AZVA 2BMCA 5E1EA 4EZ5A 3ZOSA 4D4VA 5CF8A 3R02A 3E8CA 4ENXA 1R78A 1XH9A 4AT5A 5BYYA 3FEGA 3BCEA 5CF5A 3ZRMA 2IJMA 4C37A 1H00A 2B9FA 5EYDA 3DS6A 5FM3A 4I3ZA 3VRZA 4ZLYA 2UVZA 4H36A 5L6WL 3QQFA 5DE2A 3V01A 3IW8A 4L45A 2X4FA 5A4CA 5ACBC 4EQCA 3HP2A 5HU3A 1OKWA 3V8TA 3GC7A 2YLFA 1YI3A 2O64A 4XH6A 5CU6A 5D12A 3QKMA 4ZY4A 4UX9A 1WBNA 5JFVA 1U4DA 3RPRA 3IK3A 3MJ2A 4ZJIA 3UGCA 4AN9A 5A6OA 1M17A 4BDKA 4I20A 3CD3A 4E73A 3U55A 3FQSA 1R1WA 4R6VA 4JVGA 3D5UA 1LP4A 2XCHA 5AA8A 3F88A 2EB3A 3MY5A 3QTUA 3ZFXA 3TWJA 5CAOA 3H9RA 4DDIA 3O96A 3DXNA 1U59A 2QO9A 3ZXTA 1KE9A 4DCAA 2PVRA 5IQEA 2B55A 1XHAA 4HW7A 4W4VA 4CZUA 3OBJA 1ERKA 1PW2A 4RQKA 3OCSA 4OW8A 2ZYBA 5FEQA 4K33A 4UN0C 4ERKA 4QQCA 2G1TA 1Q8TA 3SOCA 5A6NA 3NMUF 1ZYDA 5A54A 4O4FA 1ZXEA 3LXKA 5A4EA 4JL9A 4MXXA 2ITTA 4AAYA 3SG8A 4NCTC 4YBJA 4GL9A 4DG2E 2GPHA 3CIKA 3FMMA 4MNFA 2X0GA 5TKDA 3E8EA 1OB3A 2XAMA 2RKUA 1LEWA 3MVHA 1QPCA 1NVRA 3QTXA 2YAAA 4KNBA 4BCJA 4C4GA 4EI4A 5LMBA 3FSFA 1WVWA 2YM6A 4IX3A 4FA2A 3S0OA 3PXKA 3U87A 2P2IA 4YSJA 3UZRA 4XP0A 1MQBA 3EQCA 3IKAA 3U54A 4I5CA 4X6QC 4NFMA 4BGGA 1FVTA 2XIXA 2LGCA 3HGKA 3C0IA 4YC6A 4YJUA 4CFXA 5ETCA 4N70A 1XWSA 2O5KA 4E6AA 1PRYA 3P1AA 4BY9E 5AMNA 4TYHA 4L9IA 4M15A 3I6WA 2VGPA 3GBZA 3DNDA 4FV7A 1AQ1A 5JZNA 3BEGA 1WAKA 4IZ5A 2GNJA 3B2WA 4HVGA 4AW0A 4X21A 5DPVA 2EU9A 5L8LA 4YU2A 2PUPA 2ZM1A 1OUKA 3A7HA 2XMYA 1JNKA 4IAIA 4F7JA 3SXSA 2KULA 3ACKA 4DYMA 4PMPA 3W1FA 4MTAA 4C7TA 3CJFA 3PA4A 2I40A 4C3RA 5BVFA 3AKJA 2VO6A 3OCGA 1G5SA 4QYFA 5ACKA 2JLDA 1BMKA 4CV8A 3ZUTA 3WARA 4GW8A 2Z7QA 5BVEA 2WMBA 3T9TA 2PVLA 4GFOA 3OC1A 3NAXA 3C4FA 4YJRA 3TZMA 5EI2A 5JZJA 5IUGA 2BDWA 4HZRA 5ANOA 4N0SA 2FYSA 3AT3A 4MBJA 4HJOA 5JGAA 4JLCA 4FNXA 4H3QA 3SD0A 5IZFA 4DHFA 2CKPA 4LOQA 2GNLA 3TNWA 4BDEA 3Q04A 5GIPE 4XEYA 5KBRA 3NIZA 3Q4TA 1OL6A 3WZDA 3POZA 3U9NA 3GCQA 4A9TA 2X4ZA 4W9XA 1UA2A 4DH7A 4UB7A 3O50A 5J95A 4D2SA 4RFYA 4O1OA 5FEEA 1O9UA 3TNHA 5M53A 2C5YA 3M11A 1WBSA 1IEPA 3AT2A 5DT0A 4WNKA 4M84A 3I79A 3EZRA 4RIXB 3GOKA 2VWVA 2XK9A 4FNYA 2A19B 3NIEA 4AGWA 3HAVA 5L6PA 4AZEA 3QD0A 2CKOA 4D9UA 2BVAA 4HGTA 3O8UA 4J98A 4QMUA 5JQ5A 4PQNA 2QNJA 4DEGA 3IG7A 2OZAA 2YAKA 5HNIX 3N4TA 2O0UA 1XJDA 3BI6A 3I4BA 3QF9A 2FH9A 2CGXA 3VUTA 4M66A 5LCKA 1OIRA 3UVRA 3F3WA 3A7GA 3CQUA 4WBOA 1XBBA 4KS7A 1BI7A 2X8IA 4FL3A 4E26A 1YW2A 3RAKA 3JYAA 2Y9QA 3KXXA 5IH6A 2HWOA 1HCLA 3IDCA 3VS5A 1PXIA 2CMWA 3MH2A 4CG8A 5J7BA 2BPMA 4FYNA 3FI8A 2NP8A 3IW4A 3FSKA 5IQFA 2O65A 1XO2B 4GFGA 4X2JA 2F9GA 3ZLYA 2IVVA 2EB2A 3KGAA 4R77A 5KMJA 2NO3A 5C26A 2PK9A 4TNBA 3ZRKA 4BIEA 2VWWA 3DT1A 4KKEA 4FT5A 2X0PA 3HYHA 2FVDA 3Q9XA 4R5YA 5AWMA 3UIXA 3ZUUA 4G2FA 3G6HA 4F1TA 2YHVA 4BHZA 4BGQA 4FKVA 5I3OA 4AXFA 5AUYA 3GQLA 4BBEA 3RK7A 3V5TA 4OAUC 2QG7A 3ZTXA 1FOTA 4TXCA 4H05A 3II5A 4XX9A 4XNEA 5HLNA 1G8KA 4XRLA 2OKRA 4CCBA 3NCGA 1JWHA 4IHPA 5IMXA 3ORTA 5KMLA 1A48A 2OJ9A 2UUEA 2Z7LA 4ZSGA 3TZ8A 4FGBA 3FZSA 3KEXA 2ITZA 4CFUA 5KZIA 4D2RA 4ZTMA 5K5NA 3GQIA 5D7VA 5BMMA 5EI8A 4HPUE 2UZWE 4XOZA 3LAUA 2HWPA 4KB8A 1B39A 1KV1A 3QX4A 2QOLA 2VTQA 2WEIA 3P0MA 4EH5A 4FSMA 2ACXA 3CE3A 3D7ZA 5HTBA 3R22A 5L2QA 2R7IA 4EC9A 5K3YA 2UW5A 3PG1A 4II5A 1YWRA 2J2IB 3G90X 2YA9A 4JAJA 4DEEA 4FKWA 4RX7A 3HRCA 2E2BA 4FSZA 3H0YA 4HVDA 5A14A 2WGJA 3W33A 4O7YA 4G3DA 4Y83A 3JY0A 2YIRA 4JT3A 4C02A 5BV3A 5HLWA 2R3GA 4I93A 4W4WA 4YTHA 4AF3A 2QURA 3BE2A 4U8ZA 4UWCA 3W2OA 4BICA 5HTCA 4GU9A 2CSNA 2PY3A 4DGGA 3P7AA 1JSUA 4UBAA 3AC3A 3WIGA 4BYJA 3BPRA 4HZSA 2J51A 2HZNA 4B9DA 3FYKX 3VS0A 3KA0A 3F5GA 4AE6A 4CTCA 4ZLZA 5EM6A 4Y95A 3S00A 3WZUA 1OL1A 2GS7A 4IVBA 4YJNA 3BL7A 2C5NA 5HG8A 5IH4A 3RK5A 3ZLSA 3VJNA 2YIYA 3NUNA 1UVRA 4BZDA 5J79A 2HZIA 3COIA 2VTJA 2A98A 1TQMA 5HOAA 3U9CA 5DRDA 4F9AA 3IGGA 3LM0A 5KMKA 3NUAA 5AV0A 2G2IA 4O6EA 3AXWA 5CYIA 4BDBA 4D2WA 2I0VA 2CLXA 2R3JA 2G2HA 5FTQA 4YPDA 4KIQA 3WE8A 5C8KA 3PG3A 4TN6A 3V6RA 1J1BA 2VWZA 3L8SA 2W1FA 2GNIA 2XIKA 4U6RA 3ZSHA 1GIJA 4LQMA 1V0PA 3Q53A 5IISA 2X2MA 4YJQA 1YRPA 3PVWA 3NGAA 1ZWSA 3AD5A 4EJNA 3JY9A 5BVOA 3Q5IA 2WOTA 3QZFA 3F3VA 3V5JA 4LRJA 2Z7RA 4TWCA 2OF2A 4BDCA 1R3CA 3BL9A 3HECA 3V8WA 2BROA 2JAMA 3MPAA 4JIAA 4W8DA 3TV6A 4BCKA 5FUTA 3HV3A 3MYGA 2V62A 2XKCA 5DR9A 2BR1A 3AMAA 4G3GA 4QMMA 5TR6A 5H2UA 4FK6A 4Y85A 4IXPA 5LVMA 3PJ3A 4FEWA 3DZOA 3BKBA 2GNFA 2X39A 2UZVA 4G16A 4C0TA 3IONA 4RIWA 1M7QA 3RVGA 4KKGA 2BHEA 3G6GA 3NNUA 4DFZE 5FTOA 4PPAA 5BPYA 4QTDA 3VRYA 2PUNA 2FO0A 3GU5A 4M3QA 4W8EA 2V22A 3QXPA 2O63A 4I24A 1P14A 2W06A 4NIFA 4BCHA 4EHGA 2QOFA 3S1HA 3H30A 1SYKA 3OWLA 4JQ8A 3LM5A 5HD7A 3UQGA 3VBVA 1JKTA 2JFMA 5KCVA 3LXNA 4J97A 4YHTA 3V5QA 4GVAA 3HV4A 3O7LD 2UW7A 4WNPA 1P4OA 3LQ5A 3DFCB 3SX9A 1GIHA 3FLSA 3PXRA 4Y8DA 3DNEA 5A3XA 3TIYA 4CFVA 4RWKA 2YERA 5BVKA 5GZAA 2QONA 3P7BA 3W0SA 3D5XA 5IU2A 1VZOA 4MD7E 3H9OA 3HKOA 4UALA 5CEOA 3BYMA 2Z02A 3RNYA 5TT7A 3GNIB 3HRFA 2IW9A 2OF4A 1Z5MA 1IA8A 3R9OA 4HNIA 4FZAB 4RVLA 2JDVA 2JBPA 5EW9A 4XLIA 1BYGA 4O91A 2XK8A 3V3VA 5J9ZA 2J5FA 3HUCA 5IA1A 3BLHA 1BL7A 1XH8A 3LFBA 3MY0A 3W18A 4DEDA 5M51A 4EOKA 4KAOA 5HBEA 4EC8A 2E9NA 4OTIA 2XRUA 4O7SA 1UU8A 4QP6A 5AP6A 2F4JA 3GXLA 1VR2A 4U45A 5J1WA 4M0ZA 4D5KA 4EOPA 1YI4A 3BYVA 5JH6A 4WG5A 4F9WA 4LGHA 3V5LA 1TKIA 3MWUA 4FTTA 2R0IA 2YITA 4KBAA 4YLJA 3V5WA 4JDIA 2OH0E 3TIZA 4LV7A 3VNTA 2W05A 5J1VA 2RIOA 3DPKA 4FZ7A 3QTWA 4E4NA 2IO6A 2P4IA 4P4CA 3F3TA 3RJCA 5E8SA 4C36A 2QO2A 3C51A 4X3FA 5FBOA 5CALA 4JQ7A 1U5QA 3P5JC 3TYKA 4FT7A 2W0JA 2GSFA 2VV9A 4CEGA 3A4PA 5IEVA 3UVQA 2BUJA 3TL8A 3A99A 1ZY5A 4NM5A 3Q4ZA 4KKHA 4QMYA 3FMHA 2ETRA 4LG4A 3PSCA 3A8WA 3COMA 4X7QA 4ZEGA 3LFEA 5IQIA 1ZY4A 3DK3A 1RW8A 5IPJA 3RHXA 1W98A 2VO7A 1Q8ZA 4ZZOA 1PMVA 4AA4A 3IPHA 4KSPA 3ENMA 2CGWA 2YCQA 4EQMA 2XF0A 2QQ7A 4M0YA 5BUJA 1H25A 4RJ6A 4CZYB 5C9CA 2OWBA 4IB5A 4TYGA 4PDYA 5C01A 4O83A 4FSTA 4O7RA 4IB1A 1XR1A 3DBFA 5KKRC 3OF0A 5EKOA 2I0EA 4IWDA 4O4DA 3EQBA 3ZEWA 2VX0A 2CNQA 4A4LA 4GKHA 4Y5HA 3SGCA 5M4CA 3KULB 2XKFA 4AGCA 3ZONA 3MFTA 1J7IA 1H08A 2YCRA 5F4NA 3GT8A 3RWPA 2R7BA 1PKDA 2VWBA 2BILB 4RIYB 3BIZA 2UZUE 3DJ5A 4V0GB 1Q62A 3RINA 1F0QA 1F5QA 3W2PA 3CXWA 5DEYA 4BGHA 4G17A 1LUFA 5K5XA 3CLYA 3WZJA 3NFFB 2C6TA 3OCTA 4EOIA 5FEDA 1WBTA 3ZS5A 1YDSE 2GFSA 3DXPA 3TCPA 5IA5A 5ETIA 3BX5A 3TN8A 3CPCA 1YXSA 3FY2A 2IZSA 3HA6A 4LGDA 4F6UA 3UZPA 3AT4A 1FMOE 3R1QA 4E6QA 3FLZA 3HMIA 3MGYA 4BTFA 4BCQA 4QMOA 5DWRA 1YDRE 1Q8WA 3ID6C 1DAYA 3GEQA 3QTRA 3TG1A 3PPJA 4D55A 4QTEA 4FT3A 5LQFA 3LQ3A 2XM9A 4FV2A 1H1SA 2AQXA 3O7LB 5K0KA 4QMZA 3U51A 5EW3A 3ZM4A 5CXZA 2DQ7X 2PE2A 3LCTA 5JEBA 3LZBA 4BBFA 3R1NA 3ULZA 2OIQA 1ZYJA 3I81A 4JI9A 4QMQA 1I09A 1UNLA 4RC2A 1YOLA 4ENYA 2IN6A 4GKIA 2ZDUA 3PE1A 3QWJA 3TJCA 4GG5A 3SC1A 2PYWA 4NTSA 3BZ3A 4RG0A 3OFMA 1GZ8A 1YXUA 5DR6A 3E63A 2WMUA 2GS6A 2QODA 5LJJA 2BZHB 2WD1A 2ITYA 4F9BA 4IADA 2WHBA 2W1ZA 2WTJA 3NUPA 4MXOA 4DEBA 2YM8A 3VS2A 4RFZA 2WMQA 3OMVA 5AUZA 3OXZA 4QMPA 4AOJA 3MFSA 4IX6A 1PKGA 5AM7A 4BTJA 3SHEA 4AW1A 4JIKA 4F7SA 3PIZA 1BX6A 3KXZA 4A9YA 2NRYA 4B0GA 2UW3A 1M2PA 5BUEA 5AFVA 3OEFX 2XJ0A 4MXCA 3R7YA 5C1QB 2RFNA 4FJVA 2Y7JA 2VUWA 4K8AA 3PJ8A 4FR4A 4QPSA 5CVGA 1PXLA 5L2WA 3COKA 4FTAA 3VBQA 1UV5A 5K9IA 3W2QA 3EQDA 4FTKA 3Q52A 1U46A 3QTZA 3SW4A 4BJJB 4RMZA 4MXZA 4MWHA 3B8RA 3UQFA 4OBQA 3SRVA 5DG5A 5CI6A 1XBAA 1URWA 3S95A 5M56A 1Y6AA 4ANQA 4KWPA 4XG2A 4AOTA 4IWOA 4XUFA 4QMTA 1W82A 4ZXTA 4F70A 5CWZA 2OBJA 3DQWA 5KKRB 4RPVA 5DLSA 3GU4A 1NVQA 3TDWA 2GTMA 3L9MA 4M69B 4M67A 2IEWA 2CHLA 4FNZA 4FTMA 3DZQA 2JDSA 3EN5A 2HW6A 2BFXA 3QRTA 2XB7A 5ANJA 5EDPA 5F95A 4ZK5A 4QMWA 3CY3A 5EM8A 2ZAZA 4K1BA 3U6IA 4QYYA 2JD5A 3G51A 3QLFA 4PL5A 1FBNA 1PXJA 1XKKA 1LR4A 1YDTE 1O6KA 3PVBA 3NW6A 3CTJA 5IDPA 2PUIA 2OO8X 2FSMX 2W4JA 3D7TA 4HGSA 4Y5QA 3JR1A 3TV4A 4TT7A 4C59A 4I0TA 4CKRA 5B2KA 3KL8A 3NWWA 4D9TA 1JSVA 2WU6A 3RHKA 4BCNA 3FE3A 2F57A 4P7EA 1XMLA 5CAUA 2QLUA 3HA8A 5G6VA 3QL8A 2JIVA