2QODA

Human epha3 kinase and juxtamembrane region, y602f mutant
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
310
structure length
274
Chain Sequence
TYVDPVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGYTEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDEGYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSNLLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin receptor
publication title Autoregulation by the Juxtamembrane Region of the Human Ephrin Receptor Tyrosine Kinase A3 (EphA3).
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 274
sequence length 310
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qodA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qodA01
2RFNA 2PMNX 5KZ0A 4P5QA 4NJDA 5AWMA 1H28A 3SRVA 3ZYAA 4PPCA 5M4CA 4U7ZA 4EKKA 1H00A 1G8SA 2X9FA 5JZJA 5C1QB 2OU7A 2R3QA 4ZSAA 1J1CA 2JDTA 3P08A 3HP2A 3R7GA 4XJ0A 3T9IA 4EK6A 3AG9A 4ZMFA 1XH7A 2JGZA 5HX6A 4KIOA 4U0IA 2UW8A 3EWHA 4A9SA 3A7FA 2F2UA 4Z7HA 4IADA 4FKQA 5HTBA 3AMYA 3PWDA 4APPA 5J1VA 1U5RA 2X7GA 3BZ3A 3D14A 5CVHA 5BYYA 3MY1A 3FQHA 3TM0A 3CY2A 1L8TA 1ZOEA 3TACA 1BX6A 3FHRA 4AS0A 1A9UA 3S1HA 5IQIA 1OMWA 2G2HA 2BRMA 4WRSA 5CI6A 2XKDA 3G5DA 5FGKA 4YJQA 5L4QA 5JT2A 2AYPA 3LCSA 4RGJA 3C4FA 5DLSA 4DGMA 5GZ8A 3GI3A 4N0SA 2YDIA 5AUXA 3IONA 2H96A 4E7WA 5TO8A 2HZ0A 4L68A 3QL8A 4S2ZA 3EQHA 1PXNA 4LRMA 2C47A 3RNIA 3EQDA 3LFNA 2Q83A 3UGCA 3FMDA 4FTTA 4F1TA 3S3IA 3P23A 4E3CA 2BMCA 5J95A 2GNLA 3O23A 4B4LA 3RHKA 4U79A 4X3FA 4AW5A 5J9YA 4FF8A 2ETKA 1H0VA 2R3OA 4JG8A 5EHLA 1TVOA 3UBDA 2UW4A 5A46A 3QQHA 4OW8A 4NW6A 3LFEA 1GZ8A 4I94A 4P4CA 1PXMA 3QTZA 5F94A 3A4OX 2PVFA 4MF0A 4CYIA 5AAEA 4C36A 4FZDB 4IC7A 1W8CA 2HOGA 4F9WA 3ANRA 3BLRA 2P3GX 3RZFA 3OWKA 4EH6A 4Z16A 5AA9A 2FA2A 2QVSE 4GK4A 4IWDA 3QQUA 4M84A 1ATPE 5K3YA 4I0SA 3A7IA 4ASDA 4CFWA 3ZRKA 2X2LA 3E64A 4CFNA 2GSFA 2OIBA 2BILB 3KULA 4RWLA 2PWLA 4BCNA 2VWXA 4E4LA 2UW6A 3TUDA 4DE4A 2ZM3A 3EQGA 2H8HA 5EYMA 4W8DA 4IW0A 3WF9A 3ZFXA 2GNJA 4BKYA 3M2WA 3VS4A 3T3VA 4RX9A 4EQCA 5KMIA 2QR7A 5B2KA 5JFVA 3I6WA 3N9XA 4F08A 4PDSA 3A61A 4XYFA 3K54A 3EN5A 1WZYA 2W9ZB 4IBMA 3SKCA 3COMA 2XJ0A 2KULA 3QTIA 4ZTMA 5A4LA 5FP5A 2PVKA 4FV7A 5EQEA 3LVPA 4WG3A 4PNKA 4R1VA 2BRBA 1Z9XA 4AGCA 3C4XA 4UXLA 3BHUA 3FC1X 2WTKB 2CKQA 3FPMA 3OWLA 1REJA 4RIOA 4WHZA 3K5VA 3OUKA 2RL5A 4XG9A 4U40A 3U54A 2VTMA 4YNOA 1M2QA 4AFEA 1YXSA 4YHTA 5L8LA 4O38A 1FGIA 5I9VA 3R8LA 1XQZA 4FEWA 5EKNA 3F7ZA 3Q96A 4ZLYA 1E1XA 3BLQA 3LFAA 4IX4A 3OG7A 3HECA 2YFXA 2O0UA 4AZTA 4RJ8A 5CEMA 4MAOA 5CI7A 2WQOA 4PNIA 3CC6A 2PMLX 5C01A 2ESMA 2VX0A 4PMMA 4BZDA 2XK4A 2UVXA 4YLKA 4F6SA 4OGRA 3R7EA 4BICA 3SGCA 4LRJA 2G9XA 1MQ4A 3LE6A 4IDTA 4WD5A 3IQ7A 3QYWA 1Q3WA 4IFGA 4X7QA 3C50A 5D7VA 4QMUA 4O0TA 5JRSA 2HENA 3ALOA 4ZK5A 1KE9A 4FNZA 4FEVA 5FUTA 5HU9A 3HRCA 4L7SA 3Q9ZA 1YW2A 1KV2A 2QR8A 3UP2A 1CKJA 1TQPA 3R00A 3R30A 4RIYB 2I0VA 3PJ2A 3DA6A 3Q3BA 4KA3A 4O0VA 5EDQA 3UIBA 4CEGA 4FEXA 4Y72A 4TY1A 3B8RA 4G2FA 2J0KA 3O7LB 2VX3A 4TTHB 4U42A 1ZMWA 1PMUA 2RFSA 5DT3A 3WOWA 5K5XA 3CQWA 1PRYA 4P5ZA 5M4IA 3CPCA 4C4GA 5D9HA 4G31A 2PE2A 4AF3A 3MS9A 3BPRA 4GYGA 3FI3A 4Y8DA 5HCXA 4B9DA 4I93A 4LYNA 4H58A 4MD9E 2XM9A 1K3AA 2XP2A 4WUNA 5AUYA 4YP8A 5KKRC 3O50A 4XV3A 2EB3A 4RVKA 5DOSA 4MKCA 4CZTA 3I4BA 4EKLA 5HIEA 4IM3A 4L67A 4BCHA 1QPCA 3IW6A 3V5PA 2WNTA 4CQGA 3C7QA 3DJ5A 5HE3A 4F0GA 3FMNA 3V5QA 4F7SA 3TNWA 3WIKA 1YWVA 5GJDA 4L7FA 3LQ3A 2XB7A 1SVHA 2XNOA 4CG9A 4BWPA 3VF8A 4U97A 2CN8A 5JGBA 2X4FA 4BDHA 2BKKA 3L9LA 4Z55A 3OROA 2W1GA 1J3HA 3L9PA 3LMGA 1ZZLA 4YBKA 2C6MA 2YACA 3EZRA 3KRXA 4BCIA 4QMPA 2PVNA 4AWIA 3BGPA 4HW7A 1FINA 4OTWA 3RM6A 4BKJA 4CV8A 4I6HA 3FLWA 2QHNA 4A4XA 5BMMA 4BIDA 5AV4A 4RC2A 2VU3A 3NVMB 4ZS4A 4BF2A 2OXYA 1Y8YA 1YDRE 4OAUC 2IW9A 3AC1A 3AMAA 3ORMA 5M4UA 3OW3A 1CTPE 2W4OA 3C5UA 4RSSA 3ORLA 2CLXA 4LUDA 3GCSA 3UPXA 3DK7A 1JQHA 2WXVA 4FVPA 4MBIA 3GU8A 4HNFA 4BTKA 4DGNA 4EC8A 4ENYA 4H1JA 4BIEA 3G51A 4ZIMA 3IDPA 3L8VA 3VBQA 4CT1A 3PUPA 3HNGA 2OFUA 4YTCA 2CGXA 1WBTA 3SD0A 4CKRA 2ZOQA 4TWOA 3FV8A 4OT5A 4KUJA 3I0QA 3EN6A 2V62A 2FGIA 2BZIB 3QXPA 1OVEA 3D2KA 1W84A 4IB3A 2YLEA 4F64A 3HUCA 3PRIA 4Y95A 3SRVB 4E5AX 5E4HA 4YU2A 2HWOA 3UNJA 4EBVA 4EOPA 3PTGA 3ENMA 4JBOA 5GIOE 2O8YA 2RFDA 3QC4A 5ANOA 4M66A 2C0OA 3BGZA 4D2RA 5G6VA 2H34A 4A4OA 2RGPA 2WD1A 3TNHA 4UMRA 3IO7A 4FSUA 3V6RA 1PYXA 2OSCA 2B4SB 2YHVA 2ERKA 4BY9E 3P78A 1YHVA 4Q5HA 4I5PA 3MH3A 3NRMA 2F7ZE 4F6UA 3W2SA 4Y46A 4PQNA 3WF7A 5I9ZA 5K4JA 3ZRMA 1WBSA 3U55A 3MBLA 1PKDA 3H0ZA 5DN3A 3PY0A 2QKWB 3VAPA 2C6KA 4YHFA 1ZRZA 3O2MA 5BUEA 3ZEPA 2QOIA 4XHKB 4TN6A 5LCJA 3CJFA 2Y4IC 1H08A 3KF7A 4YJOA 3SHEA 2CNUA 1PMEA 5TKDA 3F3ZA 4M0YA 4PDOA 4RX5A 5DFPA 2W5HA 2XRWA 4LV8A 4WKQA 4XG3A 4L3JA 4C8BA 3I5ZA 3BYSA 3DB6A 5HO7A 5HVYA 3UOKA 4MTAA 3S0OA 3A7JA 3T8OA 4OT6A 3ZLWA 4E73A 2BALA 4ZTLA 2E9NA 3HV3A 4XEYA 5FTOA 4E4MA 5HOAA 3F5XA 4DT9A 3U6HA 3PJ8A 2JFLA 4M0ZA 1J1BA 4ZTRA 4MBLA 3VO3A 5CNOA 5C4KA 5HTCA 4JBPA 3HLLA 2ZDTA 2JIVA 4FG9A 3RP9A 3VJOA 4OUCA 4CCBA 3DZQA 2EUFB 4EH8A 3E7VA 4OTHA 3QHWA 3GU7A 1PKGA 4KIPA 4TZRA 3ZZEA 3OCGA 4AW2A 4EHEA 5BVOA 5KMNA 5BVDA 2C5YA 5AP3A 2ITUA 3BGQA 4I6BA 4H3QA 2X2MA 2HY0A 4NWMA 1UWJA 5DRDA 4BIBA 1Z57A 4M69A 4TXCA 2WZJA 4R3CA 3JY9A 4RFYA 4ASXA 1V1KA 3Q6WA 4I20A 3RTPA 1PY5A 4O82A 3S4QA 4BZNA 2B54A 3CTHA 5EW8A 5HE1A 4ID7A 1FGKA 3PIYA 5EOBA 4RVMA 4O7WA 1WBOA 4FYNA 3RHXA 3R63A 2YIYA 2DUVA 3FYJX 4HGTA 4UMQA 3RINA 5JN2A 5CSVA 5AP6A 4L44A 5E91A 3UO6A 2GPHA 4ZAUA 3V51A 2OZOA 3KCKA 4K77A 4XG6A 3TNQB 2XYUA 3FMLA 4EJNA 3A8WA 3KKVA 4IM0A 3HMOA 3TNPC 3H10A 2LGCA 3ORKA 1JKKA 3GC7A 3O8UA 5HIBA 3KMWA 3DY7A 4RIXA 5TR6A 4E6DA 3A7GA 3OOMA 3TV6A 4D1SA 4JAJA 4ZTSA 3AOXA 4AXAA 5L2WA 3G33A 2UW0A 2VTLA 1H1RA 3BYVA 2G01A 5EI6A 2I0EA 5AX9A 4LG4A 3MGYA 2RF9A 2ZDUA 4W4VA 3RPSA 3SV0A 2UZNA 2C69A 2QC6A 5IUIA 4ANOA 3SVVA 5EYKA 5HQ0A 3HKOA 2IN6A 1PJKA 4G6OA 5E8TA 3BYOA 4TYEA 4TYHB 3MIAA 3OT3A 2OBJA 3PXRA 4GG7A 5FG8A 4LFIA 5BVNA 5J79A 3SA0A 3SG8A 4YR8A 5CZIA 5AP7A 3RPYA 4EZ7A 3TV7A 3E63A 4HZSA 3NIEA 3W2PA 4B99A 4EOJA 2WFYA 5DT4A 3TJCA 4QMVA 3VRYA 4QMNA 4FTIA 3H30A 4X6QC 3EQCA 2OK1A 3E88A 5FM3A 4U44A 4WSQA 3UO5A 2R3KA 3QX2A 4OBQA 5CSXA 4DFUA 3F2RA 2I0HA 3BHHA 3U9CA 4GFMA 4H36A 3IOPA 2UZOA 3V5WA 2YDKA 3FQSA 2VNYA 2JDRA 5AUVA 3ITZA 4A07A 1PMVA 5HG9A 4L3LA 5EDRA 4KNBA 3MB6A 4C02A 4E5WA 3FI8A 4RC3A 3ORPA 2EWAA 4R5YA 4A06A 5CF5A 5M44A 3V5LA 4BCFA 4IWQA 4ZP5A 5L6WL 3R9DA 3BBWA 4D0WA 4BDKA 5JK3A 4L00A 5DEYA 1XO2B 3IGGA 3EMGA 4FKIA 4MNFA 2BIYA 3TXOA 5HZNA 5A4TA 3UPZA 5J87A 2JDOA 4N6YA 4AUAA 2UVYA 3A4PA 5A4CA 5I9WA 1OL5A 1G8AA 3IGOA 3FL4A 4O7LA 4U43A 3EL8A 2XIZA 3C0HA 1OGUA 2VWIA 1BLXA 3NEWA 2HELA 3VS6A 4H05A 4MCVA 3TIZA 3R01A 4EOLA 1LEWA 2HYYA 5F95A 1ZAOA 2X39A 4A4LA 2B0QA 3CD8A 4BDEA 2CGWA 3UO4A 5FEEA 3MPTA 4CFUA 2WQEA 4G3CA 2YAKA 3F61A 3H9OA 2R0UA 3R7UA 4FVQA 3DB8A 2NNWB 3NS9A 3HZTA 3A7HA 4GVAA 3O96A 4LM5A 2I0YA 2Y7JA 5IZFA 4FTKA 4JOAA 4CTBA 3LXLA 3UOJA 5TT7A 4J95A 5F20A 3EH9A 2ONLA 2XNMA 4KS8A 4XV2A 2J5EA 4YJTA 4F9CA 2OZAB 2ACXA 2BZKB 2YWVA 4QMXA 2QG5A 4QP2A 4BB4A 1IAJA 5EKOA 2W1EA 4G17A 5HE0A 4FSQA 3SXSA 3GQIA 4BDAA 3HV4A 2ZM4A 4QQ5A 4LL0A 2UZVA 4HZRA 3ZDUA 4C34A 2YISA 3REPA 4FKOA 4L52A 4QP6A 4YZ9A 2QODA 3HMNA 4HPUE 3SC1A 3ULZA 4BGGA 3QTRA 2IZRA 4FKRA 1O6LA 4FKUA 4GUEA 2A0CX 1GZKA 3TNIA 1TKIA 2XEYA 3UQCA 2Y4PA 2WTIA 2R3FA 4U41A 2J0MB 5J9LA 3BHTA 4O22A 4D5KA 4YSJA 3ZDIA 1F3MC 1VYZA 2VTAA 2WMWA 1UNLA 3R71A 4BHZA 4I3ZA 2YCRA 3QU0A 3D15A 2F57A 4C37A 2VV9A 4RLLA 2ZB0A 4K2RA 4HCVA 1GZOA 4C62A 4ALUA 3GU5A 2BFXA 3POOA 4X2FA 3ETAA 4YZMA 3PA3A 4XRJA 3FZTA 5AP1A 4MNEB 3IW7A 5I9UA 3L8SA 2W4KA 3RK5A 4M3QA 3OT8A 2BFYA 5DA3A 4IHPA 3K3JA 3Q9YA 4CV9A 3C0GA 4IACA 2ETMA 3F3VA 4FKSA 5H9BA 3B2TA 5M56A 5JGDA 2P2HA 3TDWA 4AU8A 2I7QA 4NH1A 4DFBA 4L46A 3PLAE 3QQLA 3OZ6A 4QQJA 1LPUA 5L8JA 4M97A 5HBJA 5IA3A 2VWUA 2C1BA 4FTAA 1UU3A 4EUUA 2QO9A 4DEIA 4K18A 4LOPA 1YXVA 1XH5A 4BHNA 3LFFA 4R3PA 3AT4A 2R3NA 3DGKA 4O0WA 5CXZA 3C4EA 3PSBA 2VTTA 3UOLA 1FQ1B 4AN2A 4TNDA 4NJ3A 5FDXA 2O3PA 4AE9A 4CFVA 4DC2A 2C5VA 4FVRA 4ACHA 3HDMA 4M8TA 2C6OA 4MF1A 4E8AA 4BCKA 4DEEA 5IH5A 1UU9A 4J96A 3V8SA 2IZSA 3CY3A 3E92A 1KE8A 5HD4A 3H3CA 3Q9WA 3R8PA 4D9TA 4FEQA 5KX8A 4GU6A 4XV9A 2OG8A 3RAHA 3HV5A 5ANJA 4RIYA 1ZARA 3KRLA 2Z60A 3O8TA 3WF5A 5DMZA 3ANQA 3COIA 1M52A 4FV3A 2CMWA 2GHLA 1TQIA 2FSOX 4R8QA 3RCDA 5AMNA 3CBLA 5E8YA 2CNQA 3NYNA 4U9AA 2WTCA 4XBRA 3BWJA 2R64A 3QRUA 1CSNA 2BDWA 4FC0A 3QHRA 4GT4A 2WQBA 3EQBA 4EQUA 3AQVA 3E5AA 1OKYA 1REKA 4JI9A 3GCPA 3U4WA 4BCGA 5IEXA 3ROCA 5LMBA 2JC6A 3TKUA 3HEGA 4JBVA 4TYGA 1STCE 1Q24A 2P0CA 3RCJA 4UYNA 5EM7A 4EZ3A 5GINE 3QCXA 2VTRA 3UVQA 5EM5A 1PMNA 3WIGA 4DGLC 1YWRA 5LVPA 2Y9QA 1KSWA 1SNXA 3WI6A 1YWNA 2NPQA 3EFLA 4KRCA 3ZUUA 3NGAA 4C4FA 2GQRA 1JSUA 3NAXA 5DEWA 4LGHA 2C3IB 3CIKA 4E1ZA 3GNIB 5HNIX 1BUHA 3U51A 5IA0A 3R7OA 3NUSA 4FG7A 4FNYA 3OWPA 3Q4CA 4FIIA 4IAFA 5M51A 1CKPA 2PE1A 2ZV8A 3HDNA 5HKMA 2ITXA 2OWBA 4I41A 4JG7A 1JLUE 2ITTA 3S2PA 2R7BA 3UMXA 4F9YA 4RIXB 1OIRA 3ODYX 3FMKA 4D5HA 2GCDA 2GQGA 2CKPA 3NVKI 4E20A 1UWHA 2W05A 2ZM1A 5CX9A 5J8IA 3WZDA 2OH4A 4C4EA 2C6DA 4F7NA 3RMFA 3BV2A 4EH4A 4LGGA 2QLQA 2YZAA 1H01A 3IS5A 3Q5ZA 4QOXA 4H39A 3UG1A 4XP3A 4R78A 4ZJIA 4CFMA 4QYEA 4QP8A 4JG6A 1OECA 4DG2E 2A2AA 3COKA 4N4SA 4IZYA 5CVFA 3NNVA 4C59A 3IW4A 4XRLA 3LFSA 2UW9A 3QD2B 4DTAA 3VBVA 4EWQA 5IQAA 2B9JA 3QQJA 4QT1A 3R9OA 3FJQE 3GC8A 4RA5A 4QQTA 4L8MA 1M14A 4GJ2A 3QKKA 1OPLA 3RVGA 3W2RA 3V3VA 4EONA 4DFXE 4YSMA 2XBJA 5FXQA 4UMTA 5ACBC 3VBWA 3QCSA 4MHAA 4UEUA 4DCAA 5IA2A 4NK9A 4QYYA 1HCLA 3EZVA 5A4QA 5BVFA 2CN5A 4AZWA 1ZOGA 4JIAA 3Q4ZA 3MPMA 3TDVA 4LMUA 4JVGA 3ZZWA 2BHHA 1JAMA 1SNUA 1IA9A 4IWPA 2LAVA 2PSQA 4GL9A 2VO6A 3RPRA 4F09A 3ZSIA 3EKNA 1K9AA 3QLGA 4J8NA 4FT7A 3LFBA 5EYCA 3BE9A 2VAGA 3WYXA 4IAZA 5I3OA 3OCSA 3OS3A 3R02A 2Z02A 1OIQA 3F5GA 4IZAA 2PVLA 3IK3A 4GT3A 3FY2A 5E8SA 1PHKA 2W96B 3V01A 5KMJA 2PK9A 4JRVA 4CZUA 2ZV9A 3OF0A 1LEZA 4TWNA 3LCDA 3NYVA 5IMXA 3HAVA 4PPBA 2V7AA 4P90A 1H07A 3DPKA 3OXTA 3Q6UA 2VX1A 3LJ0A 3MN3A 4ONAA 3ZHPC 2UW5A 5A6OA 5ANDA 4UXQA 3BU5A 3WE4A 2OKRA 3P1AA 3EQPA 3QTSA 5CEOA 1SZMA 1VJYA 2YCQA 3NNWA 3ORIA 5AR4A 4CFXA 2GHGA 3GT8A 4FV4A 4ITHA 4A9RA 3HA6A 5HHWA 1YDTE 2J6MA 4RX8A 5M06A 4FSNA 1PYEA 4GMYA 4NKSA 1EH4A 4JJRA 4QMTA 4AGDA 4AT4A 5BUJA 3MTFA 3OEZA 3FXZA 4I0TA 4WRGA 2IVSA 4HJOA 3WF6A 3QTUA 3ZRLA 5M4FA 5EI8A 3HAMA 3PVUA 4RJ3A 4U45A 2G2FA 4HGSA 2GDOA 4WG5A 1W0XC 4Y73A 3TKIA 4C3PA 5K9IA 2FSLX 4IB5A 5HG5A 3F6XA 3JVRA 2YM3A 4FG8A 4IC8A 2VTHA 4L42A 5T3QA 2E9PA 3TIYA 2R3LA 3DNDA 4C61A 3KRRA 4AFJA 5LARA 4EUTA 5D41A 3K3IA 3BCEA 1IG1A 4GK3A 3DDPA 4KWPA 3CR0A 3NUXA 4U80A 4JDJA 2O63A 3QZIA 2VTNA 3DKCA 3E93A 4XG4A 5FEQA 3HP5A 5A14A 1ZYLA 3ET7A 4G9RA 4XG7A 2R3JA 5FLFA 3TZ9A 3UOHA 3S00A 2FO0A 2XMYA 2BTRA 3KB7A 3FL5A 4I22A 2JAMA 5E1EA 4AGUA 4BYJA 4CMUA 4CQEA 5I9XA 4D4SA 2A27A 3D7TA 4TYJA 2C5NA 4XS2A 3NMUF 2JKMA 3G2FA 5ICPA 1MP8A 4PDYA 1YQJA 4L53A 4HGLA 4F9BA 4YNEA 3UTOA 3NWWA 1XJDA 5LMKC 3FMMA 4ANNA 4DYMA 1UV5A 5D7AA 5JQ5A 3C9WA 3ODZX 2BDJA 5C4LA 4BRXA 2VWVA 4QPMA 3RAWA 4O83A 3G15A 3G9NA 4MH7A 2JBOA 3VUGA 4QTEA 3CPBA 1QL6A 1ZYDA 1Q4LA 2QOCA 5EM6A 5J7HA 3LFCA 3QCYA 4DFNA 5CASA 3PXZA 2JKKA 4N57A 4BKZA 4K8AA 2FSTX 5E9EA 3T3UA 2QONA 3QX4A 4GYIA 1J91A 3EQIA 5GZAA 3W16A 3QGYA 3THBA 4IE9A 5IQGA 4MD8E 2HW6A 4FMQA 3JUHA 2QU6A 4M15A 4TYHA 3CP9A 4WBBB 4ZY6A 3R8MA 4AA5A 1I44A 2WMVA 2W17A 4GIIA 3KY2A 4V0GA 3SQQA 3LMIA 3FMJA 2XM8A 3UNKA 1IRKA 3FKNA 3POZA 3TV4A 3LAUA 3VS1A 3VVHA 2F9GA 4AACA 2B7AA 5AEPA 5IQFA 4RVLA 4DH5A 1UA2A 3NUYA 3GC9A 3ZSHA 3WILA 3WF8A 1WMKA 3CXWA 4BZOA 3FI2A 4IVCA 5E92A 4ALVA 4TL0A 3R7IA 4NU1A 2BPMA 4RQVA 5CTPA 5J1WA 4RMZA 4FT9A 3U9NA 4GG5A 5CS6A 3P4KA 3MIYA 3RZBA 2RFEA 3HA8A 2BTSA 2XK9A 5AAGA 3U8WA 5AR8A 4O86A 3NUAA 4EH2A 1CKIA 1JNKA 2ZMDA 3I0OA 5AAFA 5CANA 5A9UA 4FSWA 1OBDA 2HW7A 5JGAA 4RJ4A 3GFWA 2J51A 4BDGA 3JXWA 1JKTA 3P5KA 5GJFA 4DA5A 3MJ2A 1MRUA 2Y0AA 4ASZA 4EWHA 4RG0A 4DAWA 1J7IA 4EC9A 2V7OA 3MW1A 4I92A 4IM2A 4WT6A 5D1JA 1VYWA 4G3GA 4A9UA 3AT2A 2IVTA 2JIUA 5AP0A 1JOWB 4Q2AA 4F63A 4HYIA 5HLPA 2QKRA 5CALA 4FV2A 1XH8A 2WIPA 2GFCA 3DKFA 4IFCA 5BX0A 2JBPA 4QMOA 5GNKA 2HIWA 3SW4A 2C30A 1APME 1AQ1A 5KBRA 3OXZA 1ZMVA 3DXPA 3IKAA 1FPUA 2WTJA 3OEFX 4R7IA 4Y5HA 4QPAA 4FNXA 3ZLXA 3HX4A 2Z7SA 4K33A 3OXIA 4RJ6A 3FMHA 5KCVA 3PY1A 2JITA 5E8WA 3GEQA 5C8NA 3B8QA 2QD9A 4I1ZA 5AR7A 3N4UA 4WG4A 3QRKA 4X0MA 2G2IA 3AC4A 2OZAA 3G0FA 3IDBA 1YXTA 4RWJA 4FKVA 5FQDC 3SXRA 3ZSGA 4C4JA 4YC3A 2QOBA 4FIGA 2ZAZA 4O7RA 3FZPA 2J4ZA 3EFJA 3FEGA 1M2RA 5DBXA 4JL9A 4EK5A 3AD5A 1WVYA 1GJOA 2WTVA 5LCKA 1JKSA 2C1AA 1LP4A 4M13A 3QYZA 3KXHA 4O1OA 4CGAA 2WTWA 2VTIA 4CSVA 4IDVA 1JWHA 2X1NA 4KBAA 5HE2A 3QUPA 4TPTA 4FZFB 3HL7A 4NCTA 2IG7A 5CQUA 3TL8A 3ZO3A 3M11A 4YZDA 2OJJA 1OPJA 3CJGA 4IXPA 4ZY4A 4X3FC 3BQCA 4J98A 4O0RA 5DVRA 5H8GA 5HBHA 5HEZA 4FV8A 2GNIA 3N51A 1OITA 5KKRB 3MA6A 2UZBA 2CNVA 4LI5A 4RT7A 3II5A 1YOMA 4C58A 4Y83A 1ZYJA 1Q8YA 4RWKA 3DT1A 3HMPA 3KGAA 4QD6A 3RKBA 4C33A 5KMLA 2PUIA 4FIJA 3NCGA 3KN6A 2QQ7A 5AR3A 4YLJA 3BI6A 4OTRA 2P4IA 2C0TA 5AV3A 4BWXA 2OI4X 4MXYA 4YJVA 5FTGA 2Z8CA 4L6QA 4FL2A 3BLHA 4YPDA 1JSTA 4EOOA 4MNEA 3EQRA 4MVFA 3ZBXA 2X8EA 2C3JA 3C1XA 4OBOA 4XP0A 4PMSA 4PY1A 1MQBA 4YJSA 3UZTA 2PE0A 3ZLSA 3WZUA 3LXPA 3ZU7A 1QCFA 1J7LA 1RW8A 3CE3A 3TEIA 3IW5A 5IF1A 5B2LA 2VD5A 4E4XA 3EIDA 4HCTA 1S9JA 4CNHA 4TW9A 3RPVA 3BRBA 3D2IA 5LVLA 3HGKA 4AT5A 2W1FA 3UZPA 4ZTNA 1R39A 5CU0A 2CLQA 4L3PA 4QP4A 2R3RA 3ELJA 4ZZOA 3BELA 3V5JA 3UODA 3MVLA 3ZC6A 4RBLA 2P33A 2XCHA 4F7LA 2E2BA 3KU2A 3I81A 5TOZA 4Z7GA 2XIYA 3GGFA 3FXWA 1L3RE 2WPAA 4BI2A 4D1ZA 4LL5A 2V55A 4GKHA 4G6NA 1PW2A 1W82A 5IPJA 3DXQA 3F3UA 3TJDA 2ITQA 4RJ5A 3RM7A 4I6QA 1OPKA 3QQGA 4FIFA 3UYTA 4F6WA 5KHXA 4CCUA 4BCQA 4TYIA 1NVSA 1GIHA 4AP7A 3SLSA 4NFMA 2C3KA 2P2IA 1ZOHA 2X8DA 4FT3A 3TZ7A 4DH7A 4ERKA 5L2IA 2G1TA 3ZONA 4F9AA 2YERA 3C0IA 2ITWA 3NUPA 3G9LX 3LZBA 1RDQE 2C6IA 2R3IA 4XLVA 4ZZMA 5IU2A 3DLZA 4FL3A 5DYJA 2FH9A 4BTFA 1Z5MA 4GIHA 3DQWA 5EQPA 2E9VA 5AUZA 4PMTA 3EN7A 4DTKA 4FKGA 2J2IB 1DAYA 3KCFA 3QD0A 3V04A 3IDCA 3LQ5A 4IMYA 1DI9A 4HOKA 3ROYA 2HXQA 2WQMA 3P86A 2XNEA 3FDNA 4FKPA 5ANGA 4GU9A 5T6KA 3ZUTA 5AR5A 4AW0A 2BVAA 2CGVA 4U81A 2BKZA 3D7TB 3VS3A 2GQSA 5HD7A 3W10A 2BAJA 2ITYA 3DTCA 3GCQA 1GAGA 3HRFA 3QRJA 3VF9A 2NO3A 5HO6A 3GU6A 3PZHA 4FV0A 5CWZA 2W7XA 5I9YA 2UW3A 2OH0E 3PG1A 4Y5QA 4S30A 4XX9A 3VUDA 2I1MA 3E8CA 2YZLA 2Y4IB 1QPJA 2PZRA 5G1XA 1P2AA 4X6RA 3Q52A 3R8ZA 3ZCLA 4LOOA 1OZ1A 3VNTA 1XBAA 5AFVA 4O0SA 5L8KA 3LCOA 1IEPA 5HIDA 4CFFA 4FL1A 3QBNA 5I5ZA 5M09A 4BN1A 2VN9A 4ENXA 4QMZA 5IQEA 2Q0BA 4GV1A 4GW8A 4DEBA 3IW8A 3OD6X 4EH3A 1PXLA 4FSRA 4RZVA 3KVWA 4FODA 1NA7A 4UV0A 4ZXTA 4MEDA 1RJBA 1QMZA 3C4CA 4ZTQA 4M67A 4ACGA 4U3YA 4YO4A 4V0GB 3EOCA 3QKMA 4C38A 2IO6A 4NEUA 1OBGA 4ERWA 1WBVA 2BUJA 4QP3A 4D4RA 3PP1A 3Q60A 4HCUA 5IISA 5LXMA 1NXKA 1H25A 2R3HA 1M2PA 2X8IA 4BDCA 3LKMA 3QF9A 2WMUA 2Y6OA 5TE0A 2HZ4A 4D4VA 3QTXA 4NM0A 1JSVA 4HYSA 2F4JA 3I7CA 4QO9A 4J53A 3BEGA 5AIKA 3VQHA 5LMAA 3VS2A 4DG0E 1A48A 1V0PA 3AGMA 4EK4A 3R73A 5JSMA 2FYSA 5C8KA 3W8LA 1VEBA 5KMOA 3RAIA 4FGRA 1E9HA 3GC0A 3TKHA 3OBGA 4NKAA 2EXMA 1U4DA 3MVMA 1VR2A 3ZFMA 4O0XA 2C5OA 2OO8X 1PF8A 5CVGA 4PV0A 2X9EA 2OF2A 4YBJA 5JKGA 2WTDA 4IAYA 4IAAA 4JX3A 2PL0A 1T46A 2WMSA 3VBYA 5IQDA 2WMRA 2WQNA 5IDPA 4JXFA 3RBWA 3UIUA 5LVOA 4B0GA 3V8WA 3LOKA 3LHJA 4JAIA 4UWBA 5T68A 2BRNA 1ZMUA 3RPOA 4EOMA 3OW4A 4YO6A 3IPHA 5EDPA 2YCSA 1Q8WA 3SG9A 4G34A 2FSMX 4JDHA 5LVMA 2BRHA 3FZOA 3LFQA 2BZHB 1SVGA 4EOIA 3QC9A 4FEUA 3QA0A 5ACKA 2JLDA 3PWYA 2WMXA 4E6QA 3MB7A 3FMEA 1KUTA 4YJUA 1OUYA 2YEXA 2DWBA 1JBPE 4GFGA 2VNWA 3RWPA 4GS6A 4J7BA 4YURA 2C6EA 4YUQA 3KK9A 4RQKA 5FBOA 3QZHA 1XBCA 4G1WA 3R1SA 1DAWA 4JR3A 3MFSA 3EYHA 3EN9A 4BVUA 2IVVA 4S32A 5DE2A 3SOAA 4B8LA 2R9SA 4FKTA 4HPTE 4AOJA 3BHYA 4O7NA 4WNKA 3ZBFA 1YOLA 3DFCB 4USEA 3R9HA 2QNJA 1WBPA 3E3BX 2XNNA 1Y6BA 1U59A 2C4GA 4DGGA 3NAYA 4OTPA 3VUIA 1NT2A 5KO1A 1WBNA 1F0QA 3ZTXA 4KBKA 5FP6A 5KNJA 2BZJA 2NRYA 4QYFA 5CF6A 3DXNA 2VGPA 2R4BA 1AD5A 3NX8A 3OCTA 4FICA 4QMLA 2PPQA 2QOHA 4YC8A 4GRBA 2UZTA 1URWA 2ZVAA 2VGOA 2OGVA 3NW5A 4FK6A 4I0RA 3UC4A 4C3FA 3LIJA 4GT5A 2GHMA 3CKWA 2F7EE 3HMMA 3KQ7A 4DN5A 1BI7A 3O7LD 2PULA 4MXAA 3HYHA 2PY3A 1OL2A 3PA5A 3U6JA 3WE8A 1P5EA 4AX8A 5H8BA 3OFMA 5BUIA 4Q9SA 4CLIA 2UUEA 2XIRA 5HNBA 2BHEA 5BYZA 4PTGA 4F4PA 4DITA 3NW6A 3Q04A 4F65A 4O7ZA 3MFTA 2YITA 3DBFA 3VULA 4K1BA 1H1QA 2I6LA 3CD3A 4EQMA 5JH6A 2XVDA 2QOKA 2PMOX 3PRFA 1IR3A 3ZFYA 3D0EA 4EYJA 5CEQA 4W9WA 1XH6A 3VBXA 4LQMA 4D2VA 1Q97A 2C3LA 3FKLA 2XYNA 5DT0A 5IA5A 5IKWA 1NVRA 1XBBA 2UW7A 5IEYA 3ACJA 3FKOA 4LRKA 3P9JA 5DHJA 3DZOA 4A7CA 5CEIA 4R6VA 4CMTA 3AMBA 1YHSA 4XNEA 2R3PA 4YTIA 3R1NA 3QFVA 5KMMA 2KTYA 4NZWB 3I6UA 3W18A 3PSDA 4FR4A 4FKJA 3B2WA 3T9TA 5CAQA 3FLQA 4G16A 4PTCA 4JQ8A 4XCUA 1YKRA 3O17A 1OKZA 5E8VA 4DGOA 3CQEA 3KXNA 4RVTA 2ITOA 2QCSA 2V5QA 4EEVA 1P4FA 4WUAA 4IAIA 5DR6A 3RALA 3F2NA 5JFXA 3RWQA 3GCVA 3D5VA 2ITVA 5CU3A 4AAAA 5AJQA 5E90A 1Q8TA 3AC3A 1JPAA 1Q41A 5CSWA 3PVBA 3QCQA 4XV1A 1GNGA 2XEZA 2YA9A 3LW0A 5BVEA 1PXIA 1FVRA 3NUNA 2PUUA 5BVKA 3UE4A 1U54A 3R9NA 3OY3A 2CGUA 1KE7A 5I4NA 5FTQA 4O2ZA 3HRBA 3C13A 3NZ0A 4PP9A 5FRIA 2XA4A 4L43A 4LOQA 4BWKA 3BHVA 4YJNA 3UZRA 5M07A 2WMTA 3KA0A 3D5XA 4RPVA 2GU8A 2BAQA 2WO6A 3LCKA 4ZY5A 2JAVA 4FSTA 3P0MA 1JVPP 3I79A 1MRVA 4GJ3A 4O7VA 1CDKA 1UU7A 1K2PA 5C26A 3PDTA 2BRGA 3OC1A 4PX6A 5HNGA 3RK7A 4BBFA 3CGFA 2FB8A 3P7AA 2JDSA 4H1MA 4WIHA 2Z7RA 3R1QA 2XBAA 3MH1A 3TTJA 4MXOA 5C27A 5LQFA 1FOTA 4OTGA 4D2WA 4W8EA 4V01A 4EOQA 3PXQA 3UQFA 2W9FB 2X4ZA 2IZUA 4PDPA 5CENA 4EOSA 3F2AA 3KFAA 4NTTA 3K5UA 3S95A 2OICA 4FUYA 3JPVA 2PVMA 1CMKE 3GOKA 2QO7A 2XS0A 3F66A 3JYAA 1JKLA 3KMUA 3NDMA 3OHTA 3BYMA 3EQFA 3C5IA 5CF4A 2UZWE 3EYGA 3IECA 4FV9A 5CNNA 3VUKA 4CMOA 3BBTB 3DBCA 3FLNC 3QGWA 5FEDA 3UVRA 4EHVA 4GKIA 4BR3A 4CRSA 2UZUE 3LPBA 5K5NA 4EZ5A 4CLJA 2ETRA 2GMXA 2GTNA 3Q9XA 2H9VA 4IB1A 3PVWA 2W0JA 3WYYA 1M7NA 4QTAA 2ZB1A 1FMKA 4O6EA 2OLCA 3MSSA 1E1VA 3UJGA 2CKOA 4TKSA 3U87A 3DJ7A 2VWWA 4WA9A 5ETAA 5HESA 2GS7A 4QNYA 1ERKA 5C8MA 3KMMA 3R6XA 4WBOA 3CSVA 5ETIA 4J99A 1RQQA 3TI1A 2PHKA 3LFDA 3LQ8A 3QTWA 2I40A 4P2KA 4O7SA 3ALNA 2YM4A 3CTQA 1B38A 4CXAA 1OKWA 3DS6A 4GH2A 5K0KA 4X3JA 4FTLA 3C4WA 2WKMA 3NPCA 3H9FA 2JKOA 3Q4TA 4G9CA 5JZNA 3W8QA 2ZMCA 4BCMA 5JEBA 5EHOA 2OXXA 5DH3A 4ZSGA 3BWFA 2J5FA 5D11A 3FZRA 4FE2A 4S34A 1KE6A 1MUOA 3KRJA 4HVSA 4FIHA 4PL5A 1PXPA 1YI6A 3UG2A 4KABA 4XG8A 2ONLC 2A1AB 5L6OA 1DM2A 4JRNA 4RX7A 4DH1A 4U5JA 5IH6A 5CU4A 3VS7A 4S31A 3R0TA 4TRLA 5FXSA 2W1ZA 1H1PA 3D4QA 1OB3A 2JEDA 2PTKA 3NR9A 4RIWB 4WO5A 4ANMA 4B7TA 4DEAA 5C9CA 3AT3A 3CTJA 3MVJA 4FK3A 1BI8A 4I5CA 4E26A 3MH0A 3UP7A 3L9NA 2QG7A 2Z7QA 2B9HA 3MA3A 4FIEA 4LGDA 1W83A 3JY0A 5DR9A 5AP4A 5ETFA 5K0XA 4AOTA 4QMQA 4F1MA 4I4FA 5EFQA 4OTIA 2ZV7A 4F0FA 2Z2WA 3QUDA 3KXZA 4KB8A 3TZ8A 3FSKA 4HYUA 3V6SA 4D0XA 2V22A 2PU8A 3DQXA 3Q53A 1R3CA 3MESA 3BV3A 3PXYA 4R7HA 3QZFA 5F1ZA 2PVHA 5J7BA 2RG6A 4IB0A 4I6FA 4YJPA 4L45A 4UWYA 4BDBA 4IANA 3QQFA 1WFCA 3FYKX 3D94A 2WHBA 4FTJA 3ZO1A 4D2TA 4G3FA 5CAVA 4NUSA 4ZSEA 4FZAB 4JX7A 5A54A 3BKBA 2WTKC 4MXZA 4C2WA 3ORZA 1Q61A 4FTCA 5D10A 4E5BA 4KIQA 4QP9A 3EFKA 2CSNA 3NW7A 4YJRA 5IEVA 5IUHA 3ZO4A 2YDJA 2ITNA 4FI1A 4B8MA 4GFOA 4PL3A 5IMEA 3NIZA 3W2QA 5BYLA 4X21A 3D5UA 1IASA 3WARA 5L2QA 3PA4A 3AGLA 2WB8A 1OL7A 3GFEA 3TCPA 3ZLYA 4AA0A 3JR1A 3TWJA 1NW1A 1O6KA 1WAKA 3MDYA 4O1PA 5E8UA 1Q8ZA 2HZNA 4BYIA 3ATSA 3LLTA 4D2PA 3FSFA 3VW8A 1PXJA 1NVQA 1SMHA 3NLBA 4GEOA 4ARKA 4ZZNA 5L2TA 3WZEA 2WGJA 4FKWA 5EW3A 3MPAA 2WEVA 3FXXA 3OUNB 3MY5A 3ENHA 3R8VA 4FZ7A 1URCA 1ZY4A 3PE1A 4XH6A 4BC6A 3BE2A 4UALA 4M68A 4HYHA 5CSHA 3ZUVA 1LR4A 2WU7A 4JLCA 4J97A 5ANKA 5AV2A 2IW8A 3R83A 5AUUA 4AE6A 3PG3A 2BR1A 4ZMEA 3CKXA 4EOKA 2Q0NA 4U8ZA 1OUKA 4G5JA 2E9UA 2VTPA 2YIQA 3DTWA 3L8PA 4JS8A 3N4TA 4YGAA 5HORA 3NUUA 2GNFA 4FZ6A 4G3DA 4IH8A 4QMWA 3R2YA 3MH2A 2VWBA 2IJMA 4MD7E 2YJRA 2OXDA 1XH4A 4BBEA 3O0GA 3V5TA 4I5MA 5J9ZA 1XH9A 5CZHA 2CDZA 3VUTA 5A4EA 4NIFA 4JQ7A 2XIXA 2YLFA 2PVYA 4CG8A 5CYIA 4EHZA 3GOPA 3BQRA 4FSZA 5DIAA 2F49A 3Q32A 2W1CA 1MRYA 4UWCA 4Q5EA 1DS5A 5DPVA 4R1YA 1OIYA 3PLSA 3PJCA 4NFNA 3LM5A 4GUBA 1X8BA 3MFRA 5DWRA 3ATTA 3GB2A 4J71A 4NM3A 2A4LA 2EVAA 4W9XA 2XZSA 3KXMA 5CY3A 2J0JA 5ANEA 5GZ9A 5BNJA 3BEAA 3OTUA 3RK9A 3R04A 5JRQA 3MTLA 5CQWA 1SM2A 3L9MA 3ORTA 3H0YA 5AM7A 3SAYA 5IDNA 4X2JA 4DF3A 2E9OA 2XKCA 2A19B 4AQCA 4BL1A 2GFSA 2VZ6A 1VZOA 3LM0A 5E7RA 2REIA 3DBQA 2OJGA 3F3TA 3KK8A 3MWUA 4QTCA 1A06A 3QRTA 4PTEA 3ZXZA 2IWIA 4ZLZA 3OY1A 4HVGA 3U6IA 1QPEA 2YJSA 4BBMA 5KBQA 2OFVA 2J50A 3NSZA 4IAKA 4W4YA 4YLLA 3ID6C 4JT3A 4O96A 5DNRA 4ASEA 1WCCA 4I24A 4LV5A 1S9IA 1U54B 4IJPA 2R5TA 3P79A 5DRBA 5HCZA 4OR5A 3DKGA 4KS7A 3VW6A 3LMHA 3ORNA 4AZFA 4PPAA 4R3RA 4CRLA 4XLIA 3ZXTA 1OM1A 4P7EA 3G6GA 4RJ7A 4O84A 2AC5A 3UIMA 3NYOA 2X6EA 4CZYB 4DEHA 4HVHA 2XK6A 4CD0A 2QOOA 3PJ1A 4U6RA 4ACMA 3VUHA 3DBDA 3PJ3A 4QNAA 3PXFA 4UZDA 3W1FA 4W4XA 3MVHA 4DBXA 4TT7A 2B52A 3VRZA 2ITZA 4BTJA 3VBTA 2XNGA 4W4WA 3RAKA 2RKUA 3AC2A 5HI2A 3PPKA 2J0IA 4JDKA 1Q99A 4MK0A 1R78A 2WAJA 4FKLA 2PUPA 4I5HA 3FUPA 3E8EA 4D58A 4F70A 4HGEA 4YTHA 4ZOGA 4RWIA 2PZYA 2YM6A 4K6ZA 4R5SA 3VS0A 4UZHA 4ZTHA 3R9RA 2Z7LA 4U3ZA 2EB2A 2GS6A 1Q62A 3A62A 3FE3A 4KIKA 5M08A 4KSQA 4WSYA 5A6NA 5B0XA 5M53A 2DYLA 3MYGA 5I3RA 2CPKE 4GK2A 2WOUA 5EH0A 1KOBA 4E6CA 2PZ5A 4XMOA 4DH8A 5IQCA 2XNBA 5EYDA 3UC3A 4FGBA 5BMSA 3KREA 2WMAA 4QTDA 3V8TA 5BVWA 5BQ0A 2JDVA 4DH3A 2WEIA 4FT5A 2W1HA 1XKKA 4X2KA 1UKHA 1XR1A 3LXNA 4PF4A 4ANLA 3C51A 2OJIA 4I4EA 4Q9ZA 3R1YA 3I5NA 2Y6MA 4J52A 4ZJJA 4C35A 4RLKA 3ZM4A 4EK3A 4BCOA 5AP5A 2WIHA 3FY0A 4PUZA 3EKKA 5EW9A 5AA8A 2R3GA 3EFWA 2CCIA 2W1DA 4X2NA 5L2SA 3Q5IA 3DK3A 5HX8A 2F2CB 4FTUA 3ZS5A 4G3EA 4XOYA 4D1XA 2XNPA 5F9EA 3UYSA 1Y57A 4NT4A 1FVVA 2VWZA 5AM6A 1YRPA 5EOLA 1H0WA 2YCFA 3E8DA 4D28A 3BU3A 3F82A 3E7OA 5D12A 1UVRA 2GTMA 4UX9A 4KKGA 3FPQA 4IIRA 4KRDA 4DG3E 1ZY5A 2VTJA 4FX3A 4V04A 3OOGA 4QMMA 4DEDA 1GY3A 2HZIA 5AIRA 1B6CB 3GVUA 3VQUA 4MQ2A 1ZYSA 2O64A 1T45A 2X81A 4N6ZA 4AZEA 4FTNA 2QI8A 4KSPA 5HGIA 4J8MA 3UIXA 4BDDA 3TZMA 1FMOE 2R2PA 3ERKA 4XG2A 2FUMA 3OP5A 4B6LA 3N4VA 2C0IA 1Y91A 3BYUA 3LXKA 4D2SA 3KXXA 3A2CA 1H1WA 4AG8A 4ALWA 1GIIA 4FSYA 3AXWA 4YHJA 3VWAA 4ANQA 1Q3DA 4QQCA 2OJFE 1OI9A 3CS9A 4IZ5A 2ITPA 4IX3A 2QU5A 4C2VA 3HV7A 5CSPA 1YVJA 3CGOA 1AGWA 2IW6A 1CM8A 3OCBA 4FV6A 4EYMA 1GIJA 1UKIA 2PVRA 4O91A 5AV0A 2ERZE 3OBJA 3QLFA 3FLYA 4XUFA 1H27A 4RFMA 3R7YA 3R21A 4EHGA 3W32A 2HWPA 4ZLOA 5IUGA 4QTBA 5M57A 2QLUA 4I23A 1WVWA 3DAKA 4MWHA 2XK8A 3F5PA 4II5A 1XHAA 4M12A 4AA4A 4RZWA 2B9FA 4IEBA 5HVKA 4X3FB 4A9YA 4R77A 3KL8A 3PIZA 4GSBA 4IX6A 4O2PA 4QMSA 3MV5A 3QWKA 3TUCA 5AR2A 1Q8UA 3BX5A 1R0EA 2DS1A 2R0IA 3H9RA 3DAEA 5KHWA 4OAVB 2HY81 3DBEA 2XJ1A 1I09A 3UQGA 4ZJVA 4K9YA 3KXGA 5H3QA 3DOGA 4AOIA 1V0BA 4QPSA 3TTIA 1GOLA 2CHLA 3TN8A 2X7OA 3W2CA 2YIXA 2XKFA 4FV5A 4M7IA 4DEGA 5HU3A 1HCKA 4KINA 3ACKA 3SX9A 4UMUA 3KULB 3VN9A 2OIQA 5HVJA 4DINA 3OTVA 2J0LA 5JMSA 3IG7A 4ORKA 3HVCA 3VS5A 3M1SA 2AUHA 3NNXA 4XOZA 3UNZA 4BDFA 4UMPA 4IX5A 3SOCA 1XWSA 3F3WA 5KMKA 3FC2A 3F7WA 5LJJA 5CF8A 1P14A 4FTOA 3GENA 2YM8A 5E8ZA 5FWKK 4WNMA 2PZIA 4D55A 2HCKA 2NP8A 1BL6A 5JQ8A 5M55A 4OTDA 4MXXA 5FXRA 1WBWA 2W4JA 4EBWA 2RIOA 3O51A 3TG1A 4EK8A 5GIPE 2VUWA 1DI8A 3DKOA 4E4NA 3GXLA 4FTRA 3KF4A 5CAOA 2VWYA 4G5PA 1H1SA 4NIFB 2YN8A 2XK3A 3ZM9A 2W5BA 1R1WA 3O71A 2XRUA 1W98A 2XIKA 3F9NA 4RRVA 2PUNA 4DT8A 3MY0A 4IWOA 4AN3A 3PPZA 2SRCA 2YM5A 3QAME 3CLYA 4IVDA 4DTBA 4TWPA 4YC6A 5HBEA 2OW3A 3VHKA 4KKEA 3K2LA 5GHVA 4DLJA 5GJGA 4EH9A 1SYKA 2WMBA 2J7TA 2RSVA 1KV1A 1IAHA 4IQ6A 4PWNA 2HXLA 4WNPA 3FZ1A 4YZCA 3LJ2A 4E6AA 3L8XA 5ITAA 3ORXA 2EU9A 1UNGA 3G6HA 3FQEA 5ETCA 4IZ7A 2YIWA 1Y8GA 2O65A 2B53A 3P7BA 3EL7A 1G5SA 3TT0A 4PL4A 5HTIA 4F7JA 4USFA 1HOWA 2VRXA 5CEPA 4NM7A 5HG8A 4HVDA 2W06A 2C6LA 4UB7A 4C4IA 3M42A 3DU8A 1GZNA 3COHA 3D7ZA 2CCHA 4FBXA 4ANBA 2IVUA 4OLIA 3F69A 3R22A 5CU6A 4C4HA 3BIZA 4FTMA 4G6LA 4GVJA 4M14A 3NCZA 2QOFA 5CU2A 1G3NA 5J5TA 1H8FA 4FOCA 3ZMMA 5K4IA 1UU8A 1YOJA 2XF0A 4RIWA 4FSMA 3D9VA 4ITIA 4K11A 4RA4A 2BCJA 2CJMA 2OF4A 4MWIA 4O6LA 5EM8A 4C0TA 3NYXA 3DFAA 3MJ1A 5E1SA 2HAKA 3PFQA 4KD1A 3RI1A 3KN5A 1OKVA 3E87A 5KUPA 2VTQA 3E3PA 4NTSA 4PMPA 5B2MA 3E8NA 3MI9A 4NCTC 3JVSA 4UBAA 4L9IA 3W33A 1NY3A 3AC5A 3QZGA 3QALE 4BFMA 3HUBA 2XKEA 1V0OA 5KE0A 3ZC5A 3Q4UA 1YDSE 4I21A 4IJ9A 4S33A 4BDJA 4AZVA 3D83A 1TQMA 4IVAA 4AGWA 4NYEA 3OWJA 1P4OA 2VTSA 4H3PA 1KE5A 2OIDA 5FM2A 4MX9A 3CCNA 4MYGA 4KIKB 3LCTA 1ZWSA 4XP2A 5AADA 1IA8A 5HICA 3DCVA 2Y8OA 5JFSA 2VTOA 3SDJA 2X6DA 5EG3A 4KKHA 4ZSJA 4AZSA 3VC4A 1BMKA 1ZLTA 3I7BA 2QHMA 2YABA 2G15A 3ZEWA 3KC3A 3VIDA 3W55A 4AW1A 1F5QA 4UN0C 3C4ZA 5CAPA 2PZPA 2XK7A 2OJ9A 5DR2A 2VO3A 1YI4A 4TNBA 3FLZA 3JS2A 4ACDA 2UVZA 4EH7A 4EL9A 3FWQA 5CAUA 4OBPA 1U5QA 3TUBA 5EK7A 4EI4A 4JDIA 4O21A 1H4LA 1R0PA 4DFLA 1W7HA 4BGQA 3R8UA 5J5SA 5L3AA 4DCEA 1YI3A 2J90A 4E93A 3VHEA 2PVJA 4FYOA 4NSTA 4QYGA 2F7XE 5B7VA 1J7UA 3CQUA 5FD2A 3A60A 3I1AA 2XUUA 3G90X 5F4NA 3DAJA 3SXFA 3U4UA 3DLSA 3R7VA 4DBNA 2YM7A 4JNWA 4QRCA 4F1OA 3CEKA 2YIRA 3FI4A 2GNHA 3PY3A 4O0UA 5CT0A 4WNOA 4Z9LA 2AC3A 5HLWA 5AX3A 2IZTA 3DJ6A 4CKIA 2HK5A 4O7YA 2J9MA 3GQLA 4CTCA 4BCJA 2X2KA 3I60A 1KOAA 4KBCA 4FNWA 3DNEA 1WVXA 2GNGA 5C03A 4QP7A 4C7TA 5ANIA 1OL6A 3E62A 5H2UA 3ZOSA 5LWMA 3RJCA 1PXOA 1Y6AA 1ZYCA 2QO2A 2BROA 3F88A 3PIXA 3PSCA 4TWCA 2B55A 1O9UA 2GS2A 1Q5KA 2WOTA 4QMYA 4YZBA 3PVGA 1OIUA 4WOVA 5IH4A 2ZV2A 3PZEA 2DQ7X 3HV6A 3QRIA 4YPSA 4CVAA 2XJ2A 5IA1A 2ZYBA 4YTFA 2VO0A 1ND4A 3QKLA 4JIKA 5DI1A 2XCKA 3EB0A 3EHAA 4FOBA 3QUEA 3DDQA 5CT7A 3UVPA 4ACCA 4NL0A 4QP1A 3QXOA 4OTFA 2X7FA 4FV1A 3GP0A 2R7IA 1H26A 3KVXA 2JD5A 2UZLA 3QQKA 3VJNA 3R28A 4DFYA 5FDPA 3DK6A 4V05A 1FVTA 4F0IA 2O2UA 2PMIA 5EI2A 2BAKA 3GCUA 2QOLA 4FT0A 2C6TA 3H4JA 3VUMA 5TF9A 4ANSA 2NRUA 1UNHA 4O81A 3OVVA 5I0BA 3ZH8A 3EJ1A 3R2BA 1O6YA 5IG1A 2B9IA 4H3BA 4J1RA 4XBUA 1QPDA 4FA2A 3ZO2A 4EJ7A 3W2OA 4BDIA 3WZJA 2QURA 3QTQA 3RGFA 4R7BA 3NNUA 1YHWA 2JFMA 4K0YA 2YWPA 1B39A 3FBVA 3PXKA 4USDA 3AC8A 4ZS0A 4BGHA 5LVNA 2UZEA 3G0EA 4CKJA 4CT2A 1BL7A 4LMNA 3PE2A 3WZKA 5L6PA 4AT3A 2H6DA 4FTQA 5EQYA 4LUEA 3HMIA 5FBNC 5IQBA 2RG5A 5LMKA 3UMWA 3ULIA 1BYGA 3KRWA 2FVDA 3FAAA 2YAAA 3O8PA 2JKQA 4KAOA 1PXKA 2ZJWA 4QYHA 4EH5A 3UDBA 5AV1A 5A3XA 3A99A 4PRJA 2XH5A 1YXUA 4FUXA 3Q2MA 4JQEA 4UYAA 3QWJA 5EHYA 3Q2JA 3P7CA 4C3RA 3GUBA 3QD3A 2PYWA 4MXCA 5LOHA 1OL1A 2WELA 4YZNA 3MFUA 5JFWA 4BI1A 4AN9A 1M7QA 2UZDA 4ITJA 3BU6A 5DGZA 5DG5A 2BDFA 2C5XA 4D4YA 4YMJA 3RNYA 5LWNA 5CXHA 1FBNA 1LUFA 2BIKB 4GCJA 4M69B 4DFZE 5HLNA 3F5UA 3KEXA 1ZXEA 1M17A 2EXCX 4HNIA 4BTMA 3GBZA 2UV2A 1RE8A 3QA8A 1KWPA 1BKXA 2V0DA 2EXEA 3A8XA 3LJ1A 4PP7A 3AD4A 4ZSLA 4BCPA 1YXXA 4CYJA 4EORA 3OMVA 4Y85A 2W99B 5H8EA 3GU4A 3FZSA 4O27B 2QOQA 4RFZA 4MQ1A 3WBLA 4DLIA 4JR7A 3FHIA 1U46A 1ZZ2A 2WMQA 1H24A 3D5WA 3PYYA 4BI0A 4UY9A 4C57A 2P55A 3QD4A 4JBQA 3SW7A 2IPXA 5CEKA 3L1SA 4RC4A 3DV3A 5BPYA 4O0YA 3FLSA 4A9TA 4L01A 5HO8A 5AP2A 1SVEA 5IQHA 2JIIA 5HG7A 5HCYA 4NW5A 2WU6A 4D9UA 3AD6A 3PPJA 4MBJA 2W5AA 2X0GA 5AUTA 5CLPA 3IOKA 4ZEGA 5KZIA 5AUWA 2C68A 4APCA 2B1PA 5E8XA 4OTQA 2W1IA 4DHFA 4F99A 4X2GA 2O5KA 3EN4A 4HVIA 2VO7A 3LLAA 2R3MA 4N70A 3PP0A 4O7TA 4NM5A 5IA4A 4Z3VA 4IVBA 2CKEA
chains in the Genus database with same CATH superfamily
2RFNA 2PMNX 5KZ0A 4P5QA 4NJDA 5AWMA 1H28A 3SRVA 3ZYAA 4PPCA 5M4CA 4U7ZA 4EKKA 1H00A 1G8SA 2X9FA 5JZJA 5C1QB 2OU7A 2R3QA 4ZSAA 1J1CA 2JDTA 3P08A 3HP2A 3R7GA 4XJ0A 3T9IA 4EK6A 3AG9A 4ZMFA 1XH7A 2JGZA 5HX6A 4KIOA 4U0IA 4DHZA 2UW8A 3EWHA 4A9SA 3A7FA 2F2UA 4Z7HA 4IADA 4FKQA 5HTBA 3AMYA 3PWDA 4APPA 5J1VA 1U5RA 2X7GA 3BZ3A 3D14A 5CVHA 5BYYA 3MY1A 3FQHA 3TM0A 3CY2A 1L8TA 1ZOEA 3TACA 1BX6A 3FHRA 4AS0A 1A9UA 3S1HA 5IQIA 1OMWA 2G2HA 2BRMA 4WRSA 5CI6A 2XKDA 3G5DA 5FGKA 4YJQA 5L4QA 5JT2A 2AYPA 3LCSA 4RGJA 3C4FA 5DLSA 4DGMA 5GZ8A 3GI3A 4N0SA 2YDIA 5AUXA 3IONA 2H96A 4E7WA 5TO8A 2HZ0A 4L68A 3QL8A 4S2ZA 3EQHA 1PXNA 4LRMA 2C47A 3RNIA 3EQDA 3LFNA 2Q83A 3UGCA 3FMDA 4FTTA 4F1TA 3S3IA 3P23A 4E3CA 2BMCA 5J95A 2GNLA 3O23A 4B4LA 3RHKA 4U79A 4X3FA 4AW5A 5J9YA 4FF8A 2ETKA 1H0VA 2R3OA 4JG8A 5EHLA 1TVOA 3UBDA 2UW4A 5A46A 3QQHA 4OW8A 4NW6A 3LFEA 1GZ8A 4I94A 4P4CA 1PXMA 3QTZA 5F94A 3A4OX 2PVFA 4MF0A 4CYIA 5AAEA 4C36A 4FZDB 4IC7A 1W8CA 2HOGA 4F9WA 3ANRA 3BLRA 2P3GX 3RZFA 3OWKA 4EH6A 4Z16A 5AA9A 2FA2A 2QVSE 4GK4A 4IWDA 3QQUA 4M84A 1ATPE 5K3YA 4I0SA 3A7IA 4ASDA 4CFWA 3ZRKA 2X2LA 3E64A 4CFNA 2GSFA 2OIBA 2BILB 3KULA 4RWLA 2PWLA 4BCNA 2VWXA 4E4LA 2UW6A 3TUDA 4DE4A 2ZM3A 3EQGA 2H8HA 5EYMA 4W8DA 4IW0A 3WF9A 3ZFXA 2GNJA 4BKYA 3M2WA 3VS4A 3T3VA 4RX9A 4EQCA 5KMIA 2QR7A 5B2KA 5JFVA 3I6WA 3N9XA 4F08A 4PDSA 3A61A 4XYFA 3K54A 3EN5A 1WZYA 2W9ZB 4IBMA 3SKCA 3COMA 2XJ0A 2KULA 3QTIA 4ZTMA 5A4LA 5FP5A 2PVKA 4FV7A 5EQEA 3LVPA 4WG3A 4PNKA 4R1VA 2BRBA 1Z9XA 4AGCA 3C4XA 4UXLA 3BHUA 3FC1X 2WTKB 2CKQA 3FPMA 3OWLA 1REJA 4RIOA 4WHZA 3K5VA 3OUKA 2RL5A 4XG9A 4U40A 3U54A 2VTMA 4YNOA 1M2QA 4AFEA 1YXSA 4YHTA 5L8LA 4O38A 1FGIA 5I9VA 3R8LA 1XQZA 4FEWA 5EKNA 3F7ZA 3Q96A 4ZLYA 1E1XA 3BLQA 3LFAA 4IX4A 3OG7A 3HECA 2YFXA 2O0UA 4AZTA 4RJ8A 5CEMA 4MAOA 5CI7A 2WQOA 4PNIA 3CC6A 2PMLX 5C01A 2ESMA 2VX0A 4PMMA 4BZDA 3AKLA 2XK4A 2UVXA 4YLKA 4F6SA 4OGRA 3R7EA 4BICA 3SGCA 4LRJA 2G9XA 1MQ4A 3LE6A 4IDTA 4WD5A 3IQ7A 3QYWA 1Q3WA 4IFGA 4X7QA 3C50A 5D7VA 4QMUA 4O0TA 5JRSA 2HENA 3ALOA 4ZK5A 1KE9A 4FNZA 4FEVA 5FUTA 5HU9A 3HRCA 4L7SA 3Q9ZA 1YW2A 1KV2A 2QR8A 3UP2A 1CKJA 1TQPA 3R00A 3R30A 4RIYB 2I0VA 3PJ2A 3DA6A 3Q3BA 4KA3A 4O0VA 5EDQA 3UIBA 4CEGA 4FEXA 4Y72A 4TY1A 3B8RA 4G2FA 2J0KA 3O7LB 2VX3A 4TTHB 4U42A 1ZMWA 1PMUA 2RFSA 5DT3A 3WOWA 5K5XA 3CQWA 1PRYA 4P5ZA 3ML1A 5M4IA 3CPCA 4C4GA 5D9HA 4G31A 2PE2A 4AF3A 3MS9A 3BPRA 4GYGA 3FI3A 4Y8DA 5HCXA 4B9DA 4I93A 4LYNA 4H58A 4MD9E 2XM9A 1K3AA 2XP2A 4WUNA 5AUYA 4YP8A 5KKRC 3O50A 4XV3A 2EB3A 4RVKA 5DOSA 4AAYA 4MKCA 4CZTA 3I4BA 4EKLA 5HIEA 4IM3A 4L67A 4BCHA 1QPCA 3IW6A 3V5PA 2WNTA 4CQGA 3C7QA 3DJ5A 5HE3A 4F0GA 3FMNA 3V5QA 4F7SA 3TNWA 3WIKA 1YWVA 5GJDA 4L7FA 3LQ3A 2XB7A 1SVHA 2XNOA 4CG9A 4BWPA 3VF8A 4U97A 2CN8A 5JGBA 2X4FA 4BDHA 2BKKA 3L9LA 4Z55A 3OROA 2W1GA 1J3HA 3L9PA 3LMGA 1ZZLA 4YBKA 2C6MA 2YACA 3EZRA 3KRXA 4BCIA 4QMPA 2PVNA 4AWIA 3BGPA 4HW7A 1FINA 4OTWA 3RM6A 4BKJA 4CV8A 4I6HA 3UDSA 3FLWA 2QHNA 4A4XA 5BMMA 4BIDA 5AV4A 4RC2A 2VU3A 3NVMB 4ZS4A 4BF2A 2OXYA 1Y8YA 1YDRE 4OAUC 2IW9A 3AC1A 3AMAA 3ORMA 5M4UA 3OW3A 1CTPE 2W4OA 3C5UA 4RSSA 3ORLA 2CLXA 4LUDA 3GCSA 3UPXA 3DK7A 1JQHA 2WXVA 4FVPA 4MBIA 3GU8A 4HNFA 4BTKA 4DGNA 4EC8A 4ENYA 4H1JA 4BIEA 3G51A 4ZIMA 3IDPA 4BJJA 3L8VA 3VBQA 4CT1A 3PUPA 3HNGA 2OFUA 4YTCA 2CGXA 1WBTA 3SD0A 2ZFYA 4CKRA 2ZOQA 4TWOA 3FV8A 3AKKA 4OT5A 4KUJA 3I0QA 3EN6A 2V62A 2FGIA 2BZIB 3QXPA 1OVEA 3D2KA 1W84A 4IB3A 2YLEA 4F64A 3HUCA 3PRIA 4Y95A 3SRVB 4E5AX 5E4HA 4YU2A 2HWOA 3UNJA 4EBVA 4EOPA 3PTGA 3ENMA 4JBOA 5GIOE 2O8YA 2RFDA 3QC4A 5ANOA 4M66A 1G8JA 2C0OA 3BGZA 4D2RA 5G6VA 2H34A 4A4OA 2RGPA 2WD1A 3TNHA 4UMRA 3IO7A 4FSUA 3V6RA 1PYXA 2OSCA 2B4SB 2YHVA 2ERKA 4BY9E 3P78A 1YHVA 4Q5HA 4I5PA 3MH3A 3NRMA 2F7ZE 4F6UA 3W0NA 3W2SA 4Y46A 4PQNA 3WF7A 5I9ZA 5K4JA 3ZRMA 1WBSA 3U55A 3MBLA 1PKDA 3H0ZA 5DN3A 3PY0A 2QKWB 3VAPA 2C6KA 4YHFA 1ZRZA 3O2MA 5BUEA 3ZEPA 2QOIA 4XHKB 4TN6A 5LCJA 3CJFA 2Y4IC 1H08A 3KF7A 4YJOA 3SHEA 2CNUA 1PMEA 5TKDA 3F3ZA 4AQKA 4M0YA 4PDOA 4RX5A 5DFPA 2W5HA 2XRWA 4LV8A 1ST0A 4WKQA 4XG3A 4L3JA 4C8BA 3I5ZA 3BYSA 3DB6A 5HO7A 5HVYA 3UOKA 4MTAA 3S0OA 3A7JA 3T8OA 4OT6A 3ZLWA 4E73A 2BALA 4ZTLA 2E9NA 3HV3A 4XEYA 5FTOA 4E4MA 5HOAA 3F5XA 4DT9A 3U6HA 3PJ8A 2JFLA 4M0ZA 1J1BA 4ZTRA 4MBLA 3VO3A 5CNOA 2X0QA 5C4KA 5HTCA 4JBPA 3HLLA 2ZDTA 2JIVA 4FG9A 3RP9A 3VJOA 4OUCA 4CCBA 3DZQA 2EUFB 4EH8A 3E7VA 4OTHA 3QHWA 3GU7A 1PKGA 4KIPA 4TZRA 3ZZEA 3OCGA 4AW2A 4EHEA 5BVOA 5KMNA 5BVDA 2C5YA 5AP3A 2ITUA 3BGQA 4I6BA 4H3QA 2X2MA 2HY0A 4NWMA 1UWJA 5DRDA 4BIBA 1Z57A 4M69A 4TXCA 2WZJA 4R3CA 3JY9A 4RFYA 4ASXA 2IEWA 1V1KA 3Q6WA 4I20A 3RTPA 1PY5A 4O82A 3S4QA 4BZNA 2B54A 3CTHA 5EW8A 5HE1A 4ID7A 1FGKA 3PIYA 5EOBA 4RVMA 4O7WA 1WBOA 4FYNA 3RHXA 3R63A 2YIYA 2DUVA 3FYJX 4HGTA 4UMQA 3RINA 5JN2A 4O4CA 5CSVA 4L44A 5E91A 5AP6A 2GPHA 3UO6A 3V51A 4ZAUA 2OZOA 3KCKA 4K77A 4XG6A 3TNQB 2XYUA 3FMLA 4EJNA 3A8WA 3KKVA 4IM0A 3HMOA 3TNPC 3H10A 2LGCA 3ORKA 1JKKA 3GC7A 3O8UA 5HIBA 3KMWA 3DY7A 4RIXA 2X0PA 5TR6A 4E6DA 3A7GA 3OOMA 3TV6A 4D1SA 4JAJA 4ZTSA 3AOXA 4AXAA 5L2WA 3G33A 2UW0A 2VTLA 1H1RA 3BYVA 2G01A 5EI6A 2I0EA 5AX9A 3TMOA 4LG4A 3MGYA 2RF9A 2ZDUA 4W4VA 3RPSA 3SV0A 2UZNA 2C69A 2QC6A 5IUIA 4ANOA 3SVVA 5EYKA 5HQ0A 3HKOA 2IN6A 1PJKA 4G6OA 5E8TA 3BYOA 4TYEA 4TYHB 3MIAA 3OT3A 2OBJA 3PXRA 4GG7A 5FG8A 4LFIA 5BVNA 5J79A 3SA0A 3SG8A 4YR8A 5CZIA 5AP7A 3RPYA 4EZ7A 3TV7A 3E63A 4HZSA 3NIEA 3W2PA 4B99A 4EOJA 2WFYA 5DT4A 3TJCA 4QMVA 3VRYA 4QMNA 4FTIA 3H30A 4X6QC 3EQCA 2OK1A 3AKJA 3E88A 5FM3A 4U44A 4WSQA 3UO5A 2R3KA 3QX2A 4OBQA 5CSXA 4DFUA 3F2RA 2I0HA 3BHHA 3U9CA 4GFMA 4H36A 3IOPA 2UZOA 3V5WA 2YDKA 3FQSA 2VNYA 2JDRA 5AUVA 3ITZA 4A07A 1PMVA 5HG9A 4L3LA 5EDRA 4KNBA 3MB6A 4C02A 4E5WA 3FI8A 4RC3A 3ORPA 2EWAA 4R5YA 4A06A 5CF5A 5M44A 3V5LA 4BCFA 4IWQA 4ZP5A 5L6WL 3R9DA 3BBWA 4D0WA 4BDKA 5JK3A 4L00A 5DEYA 1XO2B 3IGGA 3EMGA 4FKIA 4MNFA 2BIYA 3TXOA 5HZNA 5A4TA 3UPZA 5J87A 2JDOA 4N6YA 4AUAA 2UVYA 3A4PA 5A4CA 5I9WA 1OL5A 1G8AA 3IGOA 3FL4A 4O7LA 4U43A 3EL8A 2XIZA 3C0HA 1OGUA 2VWIA 1BLXA 3NEWA 2HELA 3VS6A 4H05A 4MCVA 3TIZA 3R01A 4EOLA 1LEWA 2HYYA 5F95A 1ZAOA 2X39A 4A4LA 2B0QA 3CD8A 4BDEA 2CGWA 3UO4A 5FEEA 3MPTA 4CFUA 2WQEA 4G3CA 2AQXA 2YAKA 3F61A 3H9OA 2R0UA 3R7UA 4FVQA 3DB8A 2NNWB 3NS9A 3HZTA 3A7HA 4GVAA 3O96A 4LM5A 2I0YA 2Y7JA 5IZFA 4FTKA 4JOAA 4CTBA 3LXLA 3UOJA 5TT7A 4J95A 5F20A 3EH9A 2ONLA 2XNMA 4KS8A 4XV2A 2J5EA 4YJTA 4F9CA 2OZAB 3P5JC 2ACXA 2BZKB 2YWVA 4QMXA 2QG5A 4QP2A 4BB4A 1IAJA 5EKOA 2W1EA 4G17A 5HE0A 4FSQA 3SXSA 3GQIA 4BDAA 3HV4A 2ZM4A 4QQ5A 4LL0A 2UZVA 4HZRA 3ZDUA 2NYAA 4C34A 2YISA 3REPA 4FKOA 4L52A 4QP6A 4YZ9A 2QODA 3HMNA 4HPUE 3SC1A 3ULZA 4BGGA 3QTRA 2IZRA 4FKRA 1O6LA 4FKUA 4GUEA 2A0CX 1GZKA 3TNIA 1TKIA 2XEYA 3UQCA 2Y4PA 2WTIA 2R3FA 4U41A 2J0MB 5J9LA 3BHTA 4O22A 4D5KA 4YSJA 3ZDIA 1F3MC 1VYZA 2VTAA 2WMWA 1UNLA 3R71A 4BHZA 4I3ZA 2YCRA 3QU0A 3D15A 2F57A 4C37A 2VV9A 4RLLA 2ZB0A 4K2RA 4HCVA 1GZOA 4C62A 4ALUA 3GU5A 2BFXA 3UDTA 3POOA 4X2FA 3ETAA 4YZMA 3PA3A 4XRJA 3FZTA 5AP1A 4MNEB 3IW7A 5I9UA 3L8SA 2W4KA 3RK5A 4M3QA 3OT8A 2BFYA 5DA3A 4IHPA 3K3JA 3Q9YA 4CV9A 3C0GA 4IACA 2ETMA 3F3VA 4FKSA 5H9BA 3B2TA 5M56A 5JGDA 2P2HA 3TDWA 4AU8A 2I7QA 4NH1A 4DFBA 4L46A 3PLAE 3QQLA 3OZ6A 4QDEA 4QQJA 1LPUA 5L8JA 4M97A 5HBJA 5IA3A 2VWUA 2C1BA 4FTAA 1UU3A 4EUUA 2QO9A 4DEIA 4K18A 4LOPA 1YXVA 1XH5A 4BHNA 3LFFA 4R3PA 3AT4A 2R3NA 3DGKA 4O0WA 5CXZA 3C4EA 3PSBA 2VTTA 3UOLA 1G8KA 1FQ1B 4AN2A 4TNDA 4NJ3A 5FDXA 2O3PA 4AE9A 4CFVA 4DC2A 2C5VA 4FVRA 4ACHA 3HDMA 4M8TA 2C6OA 4MF1A 4E8AA 4BCKA 4DEEA 5IH5A 1UU9A 4J96A 3V8SA 2IZSA 3CY3A 3E92A 1KE8A 5HD4A 3H3CA 3Q9WA 3R8PA 4D9TA 4FEQA 5KX8A 4GU6A 4XV9A 2OG8A 3RAHA 3HV5A 5ANJA 4RIYA 1ZARA 3KRLA 2Z60A 3O8TA 3WF5A 5DMZA 3ANQA 3COIA 1M52A 4FV3A 2CMWA 2GHLA 1TQIA 2FSOX 4R8QA 3RCDA 5AMNA 3CBLA 5E8YA 2CNQA 3NYNA 4U9AA 2WTCA 4XBRA 3BWJA 2R64A 3QRUA 1CSNA 2BDWA 4FC0A 3QHRA 4GT4A 2WQBA 3EQBA 4EQUA 3AQVA 3E5AA 1OKYA 1REKA 4JI9A 3GCPA 3U4WA 4BCGA 5IEXA 3ROCA 5LMBA 2JC6A 3TKUA 3HEGA 4JBVA 4TYGA 1STCE 1Q24A 2P0CA 3RCJA 4UYNA 5EM7A 4EZ3A 5GINE 3QCXA 2VTRA 3UVQA 5EM5A 1PMNA 3WIGA 4DGLC 1YWRA 5LVPA 2Y9QA 1KSWA 1SNXA 3WI6A 1YWNA 2NPQA 3EFLA 2X0OA 4KRCA 3ZUUA 3NGAA 4C4FA 2GQRA 1JSUA 3NAXA 5DEWA 4LGHA 2C3IB 3CIKA 4E1ZA 3GNIB 5HNIX 1BUHA 3U51A 5IA0A 3R7OA 3NUSA 4FG7A 4FNYA 3OWPA 3Q4CA 4FIIA 4IAFA 5M51A 1CKPA 2PE1A 2ZV8A 3HDNA 5HKMA 2ITXA 2OWBA 4I41A 4JG7A 1JLUE 2ITTA 3S2PA 2R7BA 3UMXA 4F9YA 4RIXB 1OIRA 3ODYX 3FMKA 4D5HA 2GCDA 2GQGA 2CKPA 3NVKI 4E20A 1UWHA 2A98A 2W05A 2ZM1A 5CX9A 5J8IA 3WZDA 2OH4A 4C4EA 2C6DA 4F7NA 3RMFA 3BV2A 4EH4A 4LGGA 2QLQA 2YZAA 1H01A 3IS5A 3Q5ZA 4QOXA 4H39A 3UG1A 4XP3A 4R78A 4ZJIA 4CFMA 4QYEA 4QP8A 4JG6A 1OECA 4DG2E 2A2AA 3COKA 4N4SA 4IZYA 5CVFA 3NNVA 4C59A 3IW4A 4XRLA 3LFSA 2UW9A 3QD2B 4DTAA 3VBVA 4EWQA 5IQAA 2B9JA 3QQJA 4QT1A 3R9OA 3FJQE 3GC8A 1VLRA 4RA5A 4QQTA 4L8MA 1M14A 4GJ2A 3QKKA 1OPLA 3RVGA 3W2RA 3NFGB 3V3VA 4EONA 4DFXE 4YSMA 2XBJA 5FXQA 1XMMA 4UMTA 5ACBC 3VBWA 3QCSA 4MHAA 3TYKA 4UEUA 4DCAA 5IA2A 4NK9A 4QYYA 1HCLA 3EZVA 5A4QA 5BVFA 2CN5A 4AZWA 1ZOGA 4JIAA 3Q4ZA 3MPMA 3TDVA 4LMUA 4JVGA 3ZZWA 2BHHA 5BV3A 1JAMA 1SNUA 1IA9A 4IWPA 2LAVA 2PSQA 4GL9A 2VO6A 3RPRA 4F09A 3ZSIA 3EKNA 1K9AA 3QLGA 4J8NA 4FT7A 3LFBA 5EYCA 3BE9A 2VAGA 3WYXA 4IAZA 5I3OA 3OCSA 3OS3A 3R02A 4O4BB 1OIQA 3F5GA 4IZAA 2Z02A 2PVLA 4LV7A 3IK3A 4GT3A 3FY2A 5E8SA 1PHKA 2W96B 3V01A 5KMJA 2PK9A 4JRVA 4CZUA 2ZV9A 3OF0A 1LEZA 4TWNA 3LCDA 3NYVA 5IMXA 3HAVA 4PPBA 2V7AA 4P90A 1H07A 3DPKA 3OXTA 3Q6UA 2VX1A 3LJ0A 3MN3A 4ONAA 3ZHPC 2UW5A 5A6OA 5ANDA 4UXQA 3BU5A 3WE4A 2OKRA 3P1AA 3EQPA 3QTSA 4I6LA 5CEOA 1SZMA 1VJYA 2YCQA 3NNWA 3ORIA 5AR4A 4CFXA 2GHGA 3GT8A 4FV4A 4ITHA 4A9RA 3HA6A 5HHWA 1YDTE 2J6MA 4RX8A 5M06A 4FSNA 1PYEA 4GMYA 4NKSA 1EH4A 4JJRA 4QMTA 4AGDA 4AT4A 5BUJA 3MTFA 3OEZA 3FXZA 4I0TA 4WRGA 2IVSA 4HJOA 3WF6A 3QTUA 3ZRLA 5M4FA 5EI8A 3HAMA 3PVUA 4RJ3A 4U45A 2G2FA 4HGSA 2GDOA 4WG5A 1W0XC 4Y73A 3TKIA 4C3PA 5K9IA 2FSLX 4IB5A 5HG5A 3F6XA 3JVRA 2YM3A 4FG8A 4IC8A 2VTHA 4L42A 5T3QA 2E9PA 3TIYA 2R3LA 3DNDA 4C61A 3KRRA 4AFJA 5LARA 4EUTA 5D41A 3K3IA 3BCEA 1IG1A 4GK3A 3DDPA 4KWPA 1W2FA 3CR0A 3NUXA 4U80A 4JDJA 2O63A 3QZIA 2VTNA 3DKCA 3E93A 4XG4A 5FEQA 3HP5A 5A14A 1ZYLA 3ET7A 4G9RA 4XG7A 2R3JA 5FLFA 3TZ9A 3UOHA 3S00A 2FO0A 2XMYA 2BTRA 3KB7A 3FL5A 4I22A 2JAMA 5E1EA 4AGUA 4BYJA 4CMUA 4CQEA 5I9XA 4D4SA 2A27A 3D7TA 4TYJA 2C5NA 4XS2A 4AXDA 3NMUF 2JKMA 3G2FA 5ICPA 1MP8A 4PDYA 1YQJA 4L53A 4HGLA 4F9BA 4YNEA 3UTOA 3NWWA 1XJDA 5LMKC 3FMMA 4ANNA 4DYMA 1UV5A 5D7AA 5JQ5A 3C9WA 3ODZX 2BDJA 5C4LA 4BRXA 2VWVA 4QPMA 3RAWA 4O83A 3G15A 3G9NA 4MH7A 2JBOA 3VUGA 4QTEA 3CPBA 1QL6A 1ZYDA 1Q4LA 2QOCA 5EM6A 5J7HA 3LFCA 3QCYA 4DFNA 5CASA 3PXZA 2JKKA 4N57A 4BKZA 4K8AA 2FSTX 5E9EA 4AXCA 3T3UA 2QONA 3QX4A 4GYIA 1J91A 3EQIA 5GZAA 3W16A 3QGYA 3THBA 4IE9A 5IQGA 4MD8E 2HW6A 4FMQA 3JUHA 2QU6A 4M15A 4TYHA 3CP9A 4WBBB 4ZY6A 3R8MA 4AA5A 1I44A 2WMVA 2W17A 4GIIA 4DDGA 3KY2A 4V0GA 3SQQA 3LMIA 3FMJA 2XM8A 3UNKA 1IRKA 3FKNA 3POZA 3TV4A 3LAUA 3VS1A 3VVHA 2F9GA 4AACA 2B7AA 5AEPA 5IQFA 4RVLA 4DH5A 1UA2A 3NUYA 3GC9A 3ZSHA 3WILA 3WF8A 1WMKA 3CXWA 4BZOA 3FI2A 4IVCA 5E92A 4ALVA 4TL0A 3R7IA 4NU1A 2BPMA 4RQVA 5CTPA 5J1WA 4RMZA 4FT9A 3U9NA 4GG5A 5CS6A 3P4KA 3MIYA 3RZBA 2RFEA 3HA8A 2BTSA 2XK9A 5AAGA 3U8WA 5AR8A 4O86A 3NUAA 4EH2A 1CKIA 1JNKA 2ZMDA 3I0OA 5AAFA 5CANA 5A9UA 4FSWA 1OBDA 2HW7A 5JGAA 4RJ4A 3GFWA 2J51A 4BDGA 3JXWA 1JKTA 3P5KA 5GJFA 4DA5A 3MJ2A 1MRUA 2Y0AA 4ASZA 4EWHA 4RG0A 4DAWA 1J7IA 4EC9A 2V7OA 3MW1A 4I92A 4IM2A 4WT6A 5D1JA 1VYWA 4G3GA 4A9UA 3AT2A 2IVTA 2JIUA 5AP0A 1JOWB 4Q2AA 4F63A 4HYIA 5HLPA 2QKRA 5CALA 4FV2A 1XH8A 2WIPA 2GFCA 3DKFA 4IFCA 5BX0A 2JBPA 4QMOA 5GNKA 2HIWA 3SW4A 2C30A 1APME 1AQ1A 5KBRA 3OXZA 1ZMVA 3DXPA 3IKAA 1FPUA 2WTJA 3OEFX 4R7IA 4Y5HA 4QPAA 4FNXA 3ZLXA 3PUFC 3HX4A 2Z7SA 4K33A 3OXIA 4RJ6A 3FMHA 5KCVA 3PY1A 2JITA 5E8WA 3GEQA 5C8NA 3NFFB 3B8QA 2QD9A 4I1ZA 5AR7A 3N4UA 4WG4A 3QRKA 4X0MA 2G2IA 3AC4A 2OZAA 3G0FA 3IDBA 1YXTA 4RWJA 4FKVA 5FQDC 3SXRA 3ZSGA 4DHIB 4C4JA 4YC3A 2QOBA 4FIGA 2ZAZA 4O7RA 3FZPA 2J4ZA 3EFJA 3FEGA 1M2RA 5DBXA 4JL9A 4EK5A 3AD5A 1WVYA 1GJOA 2WTVA 5LCKA 1JKSA 2C1AA 1LP4A 4M13A 3QYZA 3KXHA 4O1OA 4CGAA 2WTWA 2VTIA 4CSVA 4IDVA 1JWHA 2X1NA 4KBAA 5HE2A 3QUPA 4TPTA 4FZFB 3HL7A 4NCTA 2IG7A 5CQUA 3TL8A 3ZO3A 3M11A 4YZDA 2OJJA 1OPJA 3CJGA 4IXPA 4ZY4A 4X3FC 3BQCA 4J98A 4O0RA 5DVRA 5H8GA 5HBHA 5HEZA 4FV8A 2GNIA 3N51A 1OITA 5KKRB 3MA6A 2UZBA 2CNVA 4LI5A 2IF8A 4RT7A 3II5A 1YOMA 4C58A 4Y83A 1ZYJA 1Q8YA 4RWKA 3DT1A 3HMPA 3KGAA 4QD6A 3RKBA 4C33A 5KMLA 2PUIA 4FIJA 3NCGA 3KN6A 2QQ7A 5AR3A 4YLJA 3BI6A 4OTRA 2P4IA 2C0TA 5AV3A 4BWXA 2OI4X 4MXYA 4YJVA 5FTGA 2Z8CA 4L6QA 4FL2A 3BLHA 4YPDA 1JSTA 4EOOA 4MNEA 3EQRA 4MVFA 3ZBXA 2X8EA 2C3JA 3C1XA 4OBOA 3BLAA 4XP0A 4PMSA 4PY1A 1MQBA 4YJSA 3UZTA 2PE0A 3ZLSA 3WZUA 3LXPA 3ZU7A 1QCFA 1J7LA 1RW8A 3CE3A 3TEIA 3IW5A 5IF1A 5B2LA 2VD5A 4E4XA 3EIDA 4HCTA 1S9JA 4CNHA 4TW9A 3RPVA 3BRBA 3D2IA 5LVLA 3HGKA 4AT5A 2W1FA 3UZPA 4ZTNA 1R39A 5CU0A 2CLQA 4L3PA 4QP4A 2R3RA 3ELJA 4ZZOA 3BELA 3V5JA 3UODA 3MVLA 3ZC6A 4RBLA 2P33A 2XCHA 4F7LA 2E2BA 3KU2A 3I81A 5TOZA 4Z7GA 2XIYA 3GGFA 3FXWA 1L3RE 2WPAA 4BI2A 4D1ZA 4LL5A 2V55A 4GKHA 4G6NA 1PW2A 1W82A 5IPJA 3DXQA 3F3UA 3TJDA 2ITQA 3BL7A 4RJ5A 3RM7A 4I6QA 1OPKA 3QQGA 4FIFA 3UYTA 4F6WA 5KHXA 4CCUA 4BCQA 4TYIA 1NVSA 1GIHA 4AP7A 4O4DA 3SLSA 4NFMA 2C3KA 2P2IA 1ZOHA 2X8DA 4FT3A 3TZ7A 4DH7A 4ERKA 5L2IA 2G1TA 3ZONA 4F9AA 2YERA 3C0IA 2ITWA 3NUPA 3G9LX 3LZBA 1RDQE 2C6IA 2R3IA 4XLVA 4ZZMA 5IU2A 3DLZA 4FL3A 5DYJA 2FH9A 4BTFA 1Z5MA 4GIHA 3DQWA 5EQPA 2E9VA 5AUZA 4PMTA 3EN7A 4DTKA 4FKGA 2J2IB 1DAYA 3KCFA 3QD0A 3V04A 3O5AA 3IDCA 3LQ5A 4IMYA 1DI9A 4HOKA 3ROYA 2HXQA 2WQMA 3P86A 2XNEA 3FDNA 4FKPA 5ANGA 4GU9A 5T6KA 3ZUTA 5AR5A 4AW0A 2BVAA 2CGVA 4U81A 4O4FA 2BKZA 3D7TB 3VS3A 2GQSA 5HD7A 3W10A 2BAJA 2ITYA 3DTCA 3GCQA 1GAGA 3HRFA 3QRJA