1GOLA

Coordinates of rat map kinase erk2 with an arginine mutation at position 52
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
357
structure length
357
Chain Sequence
b'AAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIRKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXTRACELLULAR REGULATED KINASE 2
publication title Mutation of position 52 in ERK2 creates a nonproductive binding mode for adenosine 5'-triphosphate.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 110
structure length 357
sequence length 357
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 1996-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1golA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1golA01
3QGYA 3VAPA 3QCSA 2R3PA 2GNIA 1PRYA 4J8MA 4TTHB 3MBLA 4EK4A 5IQHA 4I5PA 1E9HA 3EN4A 4ZLYA 3IPHA 3SXRA 3O2MA 3PA3A 4FC0A 2BAQA 3AG9A 2UUEA 4IB5A 4ZS0A 3SW4A 1LR4A 2XEZA 3ORZA 2IZSA 3G0FA 4HJOA 3FQHA 2AUHA 1U5RA 4RIXB 4C7TA 2VWYA 2Z7LA 5BVFA 3AC2A 3RGFA 4DGGA 3GNIB 4AW2A 2WU6A 4FTKA 3TKUA 5EM7A 4AOIA 3FPMA 5EI8A 3DAKA 1KE5A 3PLAE 2VGOA 2UW8A 3OXTA 2UW9A 5DGZA 2YZLA 5F95A 3VBTA 4AQCA 4USFA 4TKSA 2ZDUA 4GIHA 2ZMCA 5TO8A 4Z7HA 2BAKA 4L67A 5EYDA 1PMVA 2Z2WA 4UN0C 1YHSA 3ORLA 4UEUA 3UO4A 3V5JA 4YUQA 5M06A 2OICA 4V04A 2FO0A 4ZS4A 4LUDA 4LMUA 5TE0A 3TXOA 2E2BA 3F2AA 4XRJA 5JMSA 3LFNA 4F0FA 4IH8A 4RJ5A 2XK3A 3BCEA 5CZHA 2RIOA 3EL8A 3MPTA 3BE9A 3C13A 4YHTA 4C3RA 4QP1A 3LE6A 5TKDA 5F9EA 4CG8A 5BNJA 2SRCA 3QL8A 3BQCA 3QQGA 2G1TA 3VBQA 5BVDA 3ZU7A 4G5JA 4HCUA 5I9WA 1B6CB 4FSRA 3FZTA 4XG8A 3F3VA 3ZFXA 3MESA 5IQEA 3ENHA 3UO6A 2OU7A 1OUKA 2E9PA 4L42A 4YSMA 5BVWA 2QO9A 2WMQA 4QQTA 3T3VA 2PVYA 2VN9A 2PVFA 2XMYA 3FZSA 3W18A 3WARA 4AE9A 5HCYA 5L2IA 5J9LA 4JJRA 4YC8A 5J5TA 4E5AX 5T6KA 4RLKA 3VUDA 4JG6A 4QQJA 5AV2A 1YXUA 4FTMA 4G3FA 4ONAA 3W2OA 3C51A 5IA2A 5EFQA 3RM7A 1ZLTA 4GH2A 3SGCA 4E1ZA 4JDIA 1Y8YA 3B8QA 1H28A 3CS9A 2P55A 1Q4LA 3HA8A 4F7SA 1RJBA 4PWNA 2C3IB 3QU0A 4LGDA 3UC4A 4QPAA 3QA8A 4YNOA 4WSQA 3KN6A 3MVJA 3OTVA 2XVDA 3UMXA 4C59A 2J5FA 2UZTA 2YIQA 4GCJA 2RKUA 2R3GA 3RK9A 3ZTXA 5J1VA 3COKA 3RJCA 2A27A 1XH8A 3MGYA 3LMIA 4D4RA 5AA8A 5AM6A 3UYTA 4A4OA 1U59A 2WQBA 3KA0A 4RZVA 3SG9A 4OTGA 3FDNA 3NNVA 3AD6A 4OTHA 3GI3A 3ZOSA 3GQIA 3R30A 4K6ZA 2QG7A 1H27A 4NZWB 3AGLA 4FKTA 5D7AA 2IW9A 3BU6A 4P2KA 2BDFA 4YR8A 4O7WA 5EW8A 2C6TA 1Z57A 1FGIA 3FMHA 3VN9A 4B8MA 4WOVA 1A06A 4PMSA 1H1SA 3PIYA 3ATSA 3LXKA 2QOCA 4GT4A 2R3HA 4IMYA 2WU7A 3C4CA 3DB8A 4CCBA 4YJOA 4EWQA 5I3RA 2GQRA 2ETKA 4B7TA 1JVPP 2VGPA 2YABA 4FNZA 4EQMA 2PUNA 4UMPA 5DR6A 3QTUA 4QTCA 5E8XA 4NKSA 3ANRA 3BLRA 3R2YA 4O38A 4C36A 3C4FA 2P2IA 3ORTA 3LFBA 4AZFA 4TNDA 1RW8A 4NYEA 3E8CA 4HYHA 3TNWA 4XV1A 2CHLA 3RCJA 4ZAUA 4FVPA 1QCFA 3C7QA 5M4CA 2ITYA 4ZP5A 4BCQA 3JS2A 2CSNA 3D5UA 3GOKA 4QP6A 5IMXA 3LMHA 3CJFA 3PIXA 5FEDA 2PWLA 3IGOA 4C58A 3KGAA 3ORNA 4W4WA 3ZFYA 2B55A 2FGIA 4BHNA 2Y4PA 4PL4A 3P23A 1WBTA 3FLNC 2JDSA 4UMQA 4FT9A 3BEGA 4DGMA 3TM0A 3OEZA 3ATTA 2R0IA 3VULA 1P5EA 4RC2A 2GPHA 3KXNA 3OY3A 4QMWA 4QYYA 5FTOA 4DH3A 5J7HA 2ITNA 3VS7A 4CKIA 2JITA 4AGUA 5I0BA 4W4VA 4FTTA 4O22A 1FQ1B 3ENMA 5BUEA 5IQDA 2JAVA 2VWVA 2W06A 5HVKA 5EG3A 1L8TA 5IPJA 5HNIX 3EQFA 5GINE 3HMMA 3R7OA 1GIJA 4PTGA 1K3AA 3BYUA 4NH1A 4W8EA 2V55A 4D4SA 2VO3A 4HVIA 4X2GA 2HIWA 4FKGA 2QVSE 4MBLA 5CXHA 1ZARA 1BLXA 5AUVA 5HVJA 3TEIA 3CSVA 3AD4A 1UNGA 2XBAA 4XOZA 4XV2A 4CEGA 4KIKA 1G8SA 3PZEA 3EFLA 4G3EA 5HG9A 4I0RA 3R1NA 4C3PA 3ZSHA 5G1XA 5JRSA 5AJQA 2XM8A 4GS6A 2FB8A 3AMYA 2BZHB 3QCQA 4U44A 5HX8A 3R83A 4QTAA 2YZAA 4FTOA 3QAME 2WMVA 2ERKA 2NPQA 2RGPA 2F7EE 5KNJA 1W84A 5LCJA 3R9DA 3ZLXA 3Q53A 4MNFA 4ASXA 3H9FA 4H05A 4O0WA 2C47A 4F70A 3SC1A 3OS3A 3JR1A 5AEPA 3IW6A 3UNJA 5K9IA 4DEBA 2XZSA 4FICA 1I09A 2BR1A 3ZEPA 5A6OA 5CLPA 5H8BA 3ERKA 4YHFA 3PJ3A 2RFDA 1JKKA 2GHMA 4QPSA 2C68A 4W4XA 3T3UA 5HQ0A 1J3HA 3EZRA 3IGGA 2X7FA 4I41A 3C0GA 4WG3A 2BZKB 5DYJA 5CS6A 3R7YA 3SA0A 2CNVA 5IQCA 5CF6A 4TWCA 5BMMA 3TKHA 3VUKA 5CU3A 2OXXA 2W9ZB 5K0KA 5KBRA 4O1PA 4Z3VA 2W1GA 4XV9A 3E62A 5HNGA 4RZWA 3BLHA 5CANA 3EN5A 3KMMA 1WBWA 3B2WA 4UZDA 5DR2A 5FXQA 2UZWE 5CU4A 4EI4A 4GV1A 2I0HA 4IW0A 1YKRA 4ZSAA 5K5XA 2W9FB 2GDOA 1H1PA 3QHWA 3VBYA 3ROCA 4IHPA 3I81A 3MS9A 5L3AA 3TUBA 2Y4IB 2NRUA 4IAKA 4F1MA 4YJNA 1ATPE 2EXCX 5HE0A 3Q2JA 4EOSA 1YHVA 5JZNA 3VJOA 4YU2A 4R7IA 2E9VA 2P0CA 4JBVA 3QWKA 4BKZA 5KMLA 3DB6A 3HA6A 1CKIA 4X2JA 2AYPA 2J6MA 4FG8A 2WTWA 2VTIA 4M3QA 2ESMA 5D9HA 3PG3A 2YWPA 3MVHA 3DKGA 5JGBA 1J7LA 1JNKA 5C1QB 4KS7A 4K2RA 4U43A 3RAKA 4RG0A 4TZRA 3E8NA 3HDMA 4MCVA 4UYNA 3FMJA 5C01A 2B9IA 3GOPA 4AW0A 4D55A 1OIYA 5A54A 2WOUA 4IANA 5HKMA 5HTBA 4D1ZA 1OL6A 3PA5A 4XEYA 4YJUA 4LOPA 4R6VA 2J9MA 3DKFA 3H3CA 3IDBA 3QTIA 3VJNA 1J1BA 3W2PA 5IA4A 5CTPA 4CYIA 1BX6A 3ODYX 3HRFA 4IDTA 3KRWA 2ETMA 4QO9A 4EHVA 3ACJA 4FEQA 4U3YA 2GNFA 1G8AA 5EI6A 5LMAA 3NCZA 5LVNA 5JFXA 3WILA 4JBPA 4O84A 2WMRA 3DJ5A 2R3RA 4GW8A 4L7SA 3BHTA 3QLGA 4MXAA 4C61A 3K54A 3WYYA 2JBOA 3LM0A 3PXFA 4C4JA 4EHZA 4OR5A 3SLSA 4O82A 2F7XE 4RFMA 5AUUA 4NTSA 4FG7A 3ZZEA 3KFAA 4Y5HA 3K5UA 3O8TA 4YZBA 3QQKA 4BIBA 1H24A 2ITZA 2X0GA 1H0VA 3ELJA 1OITA 2WO6A 3TJCA 4AFJA 3W2SA 3FWQA 3HKOA 4M13A 5FGKA 5HBHA 3U9CA 2CDZA 5A4LA 4I6HA 3QXPA 4WBBB 1P2AA 1PW2A 1J7UA 5L8LA 2J51A 4IM3A 5IH5A 2FUMA 1JPAA 3B2TA 2C3JA 4KSPA 4ZTQA 5CSXA 5HBJA 3HV4A 2ONLC 1V0BA 3HLLA 2OF2A 3KXGA 2JKOA 4CZYB 4ACMA 4HVSA 4IAZA 5FEQA 3TUDA 4OAUC 3GU7A 3BZ3A 5HIDA 2I6LA 3T9TA 2EVAA 1OGUA 2W7XA 4IX6A 3VQHA 2BZJA 2WMXA 3PSCA 2XCHA 4MH7A 4JIKA 3VHKA 3DK6A 5EDPA 3CQUA 1B38A 1WBVA 3A4OX 3KU2A 3E5AA 5CAUA 3N4TA 4L45A 4RWIA 3ZH8A 4XS2A 1YI6A 4NUSA 3DNEA 4O7LA 3F61A 5HGIA 3BYVA 3JYAA 3PIZA 3ZO2A 4UX9A 1Q8UA 1YWVA 3IG7A 4O1OA 3CQWA 3SD0A 2V7AA 4P5QA 3V5PA 3OC1A 2YAAA 3EKKA 2CN8A 3GFEA 4CFVA 5K4JA 3IO7A 4YBJA 4D2RA 1Y6BA 3RAIA 1AGWA 3FSFA 4C62A 4Q2AA 2Y6MA 1DAWA 3DQXA 4CTCA 1SVEA 4EHEA 5DN3A 5J9ZA 4YURA 5GZAA 3MFRA 4O27B 4Y85A 2WQMA 3PA4A 2FSTX 3AMAA 3PJ8A 4RFZA 4E4LA 1JQHA 1NVSA 2ZV2A 2VTTA 2QR8A 4MWHA 3TNIA 2QODA 4KUJA 3P79A 3QCXA 5C8MA 2A4LA 3D15A 3ZZWA 4DG0E 5F20A 4XG9A 5I9YA 2BZIB 4FTAA 4I20A 3DT1A 4TXCA 4J95A 4WSYA 2YM7A 5AP3A 4C2WA 3NEWA 2YDIA 3Q4CA 4WG4A 3S3IA 3FLWA 4C33A 4ZZNA 3FV8A 3CBLA 5IA5A 2A1AB 2GHLA 3QRUA 4ZJJA 4DITA 3IQ7A 3QUPA 3TL8A 4KD1A 3U4UA 3OG7A 5B2LA 3NR9A 4LG4A 4G16A 4NM7A 3UOJA 3F5PA 5DWRA 3FLZA 4GT5A 3LFEA 3PTGA 4LFIA 2A19B 2YISA 5ETFA 3VS6A 5CSVA 5DRDA 1IR3A 4FSWA 1FVRA 3NLBA 4H3QA 3UYSA 4TL0A 4PV0A 4YJVA 4HNFA 3ROYA 5A46A 4IBMA 3UZRA 3ORMA 1YQJA 2IVSA 5C4LA 3E63A 4AN9A 5BYLA 3OHTA 3WF9A 3MFUA 1W7HA 3L8PA 2ZAZA 3QZGA 1K2PA 5D41A 4FYOA 2OJ9A 3DFAA 3VIDA 2QD9A 2BTSA 2V0DA 4B99A 4OTRA 3R9OA 5CXZA 3QD2B 3H4JA 2BRGA 4D2SA 1DI9A 4TWOA 3Q2MA 3A61A 4CT1A 3NYVA 3D0EA 3QC9A 5HHWA 2XUUA 3ORIA 5LWMA 3LCOA 4ZSEA 4BI0A 1UVRA 4UWYA 3FMNA 1ZYCA 5TR6A 2XIKA 2ZJWA 4O7VA 3LFCA 4YZMA 4ZJVA 2QO7A 5HG8A 5ETAA 2J7TA 2UZBA 4UALA 5HICA 4D0XA 5B7VA 2IPXA 5CAPA 4CMUA 4D5HA 1RQQA 1PF8A 1PXKA 2BRMA 2F2CB 2FA2A 2PTKA 4MBIA 5CQUA 3RPYA 3ZBFA 1OL7A 3PXKA 4MHAA 2QOOA 2YJSA 2QG5A 3KK8A 4Y73A 4PL3A 5D10A 5E8YA 3R8MA 4EUUA 3V5LA 5IQIA 4H58A 2IN6A 4BY9E 4A9TA 3ZMMA 2ITOA 4ORKA 2EXMA 2XF0A 1PKGA 2UV2A 4OT6A 4BCFA 2WMSA 4TW9A 4PUZA 4TWNA 5DVRA 3UPXA 5IEVA 4NM3A 3LQ3A 2XRWA 3QUEA 5H3QA 5IH4A 2WIHA 3BE2A 2JC6A 4CGAA 4IEBA 2Y8OA 3UGCA 4BKJA 5FBNC 3M11A 4OBPA 5IUIA 2CJMA 4ZY6A 1M14A 1ZMVA 4YJTA 4RIWA 4WD5A 1SVGA 3VS0A 2XKEA 3CEKA 3L8VA 2ZB1A 4MD9E 4QPMA 5CU0A 3DBFA 3TV6A 1PJKA 4TYIA 4FV2A 1XWSA 2LGCA 3FLYA 1SM2A 4KIOA 4QMOA 2OW3A 4J71A 5I9ZA 3F5UA 2J0IA 2VZ6A 3PXRA 3UOHA 4WO5A 3KCFA 3A60A 1Q24A 4Q9ZA 5IDPA 3PVUA 3DV3A 3ZEWA 2PMLX 5BVOA 4FKQA 5EW9A 4EH3A 3GCVA 4FG9A 4J97A 1URWA 2UZEA 3EZVA 2FSOX 2YHVA 3OZ6A 4GUBA 3AT3A 3ZDIA 4UXLA 1FVVA 4NJDA 3KF7A 3V5WA 4A9SA 2HWOA 3FL5A 1MUOA 4D2WA 3VS2A 3ZHPC 1H8FA 5M51A 5GJFA 2XNBA 4CMTA 4EH4A 3QTSA 4LI5A 3AMBA 4F65A 1H25A 3AGMA 1LEWA 2OZAA 3CTQA 4ANLA 3E64A 3NWWA 4NJ3A 3F6XA 4B4LA 2R2PA 3NUAA 5HTCA 5AV4A 3R63A 3K3JA 3ID6C 3U54A 2ITQA 5IG1A 4PNKA 4QP2A 2A2AA 3QLFA 2ONLA 1O6LA 1FMOE 2CPKE 1KE8A 2VTSA 4FSUA 4LRKA 4FMQA 1APME 3WOWA 2CGXA 2PVMA 3NAYA 4YZDA 4ID7A 4LM5A 1MP8A 3D7ZA 3POZA 4FKUA 2WTVA 3C1XA 3JUHA 3A7JA 3EN9A 4GG7A 3FI3A 3RHXA 2XEYA 4AOTA 3FI2A 2J2IB 3FL4A 4C57A 1J91A 2ITPA 3E88A 2HAKA 5HORA 4WHZA 3U6HA 5FWKK 1YOJA 4EK5A 2F2UA 4KKEA 4V0GA 2WQNA 4LV8A 5JZJA 1IAHA 4QT1A 2YCRA 4KSQA 4PF4A 3DBDA 4MKCA 4OTDA 3VBVA 2QLUA 4HPTE 4AZTA 4F09A 4FKLA 2GQGA 1BUHA 2JIUA 4KBCA 4B9DA 4QMXA 2PZ5A 3OROA 4M15A 4F08A 5M55A 1M17A 4RLLA 4JVGA 4DTBA 2W1FA 3QCYA 5ETCA 5ACKA 3IK3A 2RFNA 2ZDTA 4G34A 1UWHA 4RSSA 2EUFB 4FIJA 5L8KA 3MWUA 5BUJA 5CALA 4I6QA 4RX9A 3UE4A 5M08A 2FYSA 2XNPA 3QXOA 2GS6A 4ZTLA 1QMZA 3BHVA 1TQPA 3UZPA 3HMOA 5J87A 4XHKB 4KIKB 3AT2A 2P2HA 2QLQA 5BYYA 1KSWA 4LGHA 5D12A 3GEQA 3HEGA 3GCUA 3TCPA 4RVLA 3NUPA 3PPKA 4J8NA 5HE3A 2YIXA 3R01A 4BBMA 5AR4A 3L1SA 4ALUA 4IM2A 4XV3A 3IECA 5LXMA 2X8IA 5GZ9A 1P4FA 3U8WA 1JKSA 4ALWA 1U5QA 1G3NA 2WMUA 4RC4A 3R9NA 5BMSA 1CTPE 2FVDA 4AZWA 3DJ7A 4USDA 4A4LA 4IB1A 4AGWA 4AZSA 4ZK5A 3DLSA 3DAJA 2C5OA 1UU3A 2X39A 4TYJA 3NCGA 5C27A 5HD7A 5CEIA 5KKRC 1JBPE 3PLSA 1T46A 4LL5A 1XH7A 4X6RA 4EUTA 4N4SA 4L00A 2FSLX 1Q3WA 2I0VA 3FKOA 4RT7A 2GNGA 3WF8A 3UPZA 3C4XA 1YDRE 3Q5IA 4FZ7A 3MH1A 5E8TA 5EHLA 5AR7A 2C6LA 4FKSA 5DEYA 5IU2A 2ITWA 4A7CA 4D1XA 4QYFA 4IAYA 2I1MA 3LKMA 2EU9A 4KB8A 2JKQA 3HYHA 4OAVB 2UW7A 3QRJA 4IC8A 1DAYA 5HTIA 3F2NA 1ZOEA 2UVZA 5F94A 3FMKA 3GCSA 1FMKA 1HOWA 1MQ4A 5ANOA 5AR5A 5J95A 3RNIA 3RPRA 5I9XA 1IG1A 5AR8A 4BDGA 1U54A 4WNOA 3ZSGA 3UQFA 5IEXA 3PDTA 1YHWA 3EQBA 5EQYA 4FUXA 4BCIA 1UNHA 5KE0A 2VO0A 2YM4A 2J0JA 3QQFA 4L46A 3TTIA 3UP2A 3FHIA 5CSWA 3FC2A 2WMBA 3BV2A 4FKIA 4FVQA 4Y95A 2BFYA 4IB3A 1DI8A 3RBWA 4X2KA 4BRXA 4Y72A 5GJGA 3Q5ZA 2C5NA 3DOGA 1GZOA 1Q61A 4FK6A 4IAAA 5D7VA 5DFPA 5JH6A 3COHA 5LMKC 3MIYA 1QL6A 1JSUA 3IW7A 4C4GA 3QGWA 5CEOA 2XNGA 5HLWA 2WKMA 3QKMA 2B1PA 3BRBA 3QQLA 2O5KA 4IWQA 1V0PA 3R7VA 3D9VA 5JKGA 4RJ4A 5ANEA 4E6CA 1VYWA 2KTYA 3I0OA 4L3JA 4EOKA 4FEWA 3BWFA 2EXEA 3AD5A 3ETAA 5CVGA 3LXPA 4DFYA 1PXLA 3TDWA 4O7ZA 4BCNA 2GQSA 1M2RA 3CGFA 3V04A 3GC9A 3SVVA 4JI9A 4O83A 3OBGA 1XBAA 2C30A 2QOIA 1V1KA 2YEXA 3BV3A 5AP4A 3OD6X 5B0XA 5L8JA 3H10A 5AX3A 2JDRA 5DT0A 3BPRA 4I6BA 4DG3E 3PY1A 3FZ1A 1HCKA 4JDJA 4CD0A 3PP0A 3L8SA 4PQNA 4CVAA 2I7QA 1B39A 3D7TA 3QZIA 4GKHA 3CP9A 3HV7A 1KOAA 1ZY5A 4MXYA 5LVLA 3UOLA 4YJPA 3GC0A 3BX5A 2HZIA 4I4EA 5CSPA 4O7YA 3UC3A 3AC8A 4QTEA 2BROA 2V62A 2YIRA 3S2PA 3UG1A 2UZOA 4J53A 4PMMA 3C5UA 2HENA 3P9JA 4U0IA 4EYJA 3HMPA 3R9RA 3RK5A 2JBPA 4U45A 1MRVA 3A8XA 5HVYA 3VBXA 5J79A 3TT0A 3LXLA 4EC8A 4OTQA 1KE9A 3LCDA 3HVCA 4FV7A 1FPUA 4IWOA 2R3NA 4YJSA 1F3MC 2OJGA 4F0IA 3VO3A 1J1CA 4JRVA 4E5BA 3LOKA 4CG9A 4RX5A 1GJOA 3NX8A 1ZYDA 1AD5A 4W9WA 5K4IA 3PPZA 3QZFA 4X0MA 3A62A 5HCXA 1Q99A 3R2BA 4K33A 5EHYA 3TV4A 4FSZA 3Q6WA 4CXAA 1QPCA 2JFMA 1R3CA 4ERWA 3E7OA 4YSJA 5C26A 4K8AA 4YTIA 1ZMUA 4IVDA 4O0TA 4C4IA 2R3LA 4DCAA 2ZV9A 3E3PA 3FBVA 3QQHA 4FSMA 4RVMA 5C8NA 1Y6AA 4FSNA 4ZMFA 2XK9A 3LJ0A 2WQEA 2HW6A 2F4JA 4QNYA 5HD4A 2QO2A 4YTFA 4NM0A 3OXZA 4R7BA 4Q9SA 4HOKA 4Y46A 3T8OA 4CTBA 5M44A 1IEPA 4I0TA 4BGHA 2PU8A 3G6GA 3NS9A 1W83A 3GFWA 1IASA 3NYOA 4QTDA 3F5GA 3RNYA 4II5A 4LRJA 4N6ZA 4B8LA 2O63A 3CPBA 1OBDA 1I44A 2BDWA 4HVHA 5HIEA 3BWJA 2PK9A 3E93A 3Q32A 3NMUF 2YACA 3U55A 4IZ5A 5FDPA 1R0EA 3MY0A 2IJMA 3VS1A 3W2CA 4AF3A 4JAJA 3HDNA 1K9AA 3H0YA 4C02A 1A48A 1YRPA 1XR1A 1PYEA 2F57A 3EN6A 4WBOA 3ZM4A 4DEGA 2W4KA 3OUKA 1GNGA 1KV2A 2W5HA 2QOLA 5CY3A 4TT7A 4YTCA 4HYIA 4BDHA 1IA8A 1UWJA 3RCDA 3VS4A 3EH9A 4ZTNA 2NO3A 4F1TA 3BI6A 2VUWA 2CCIA 5H8EA 2PE0A 4G9RA 4GEOA 5IQAA 4M97A 3ZLYA 3TN8A 1F0QA 3RWQA 2WEIA 3KCKA 3EOCA 2C5XA 3DBQA 5HO7A 4JLCA 4JRNA 4F4PA 2CKEA 4FIGA 1QPEA 4EQUA 1IAJA 4QP3A 3C9WA 2VTLA 3KULA 1ZYLA 2F7ZE 2YM8A 2EWAA 4IDVA 2YERA 4RWKA 2Y6OA 4ANQA 4BIDA 2VU3A 3I4BA 4AX8A 4QMZA 3EJ1A 4FEUA 4ZSGA 2OKRA 2C3LA 3KY2A 3COMA 1X8BA 2WTIA 4MX9A 4IJPA 2G9XA 5BQ0A 5AUXA 1Q97A 5AM7A 3FC1X 3GT8A 5HOAA 3OVVA 4HYSA 4G2FA 1NVQA 4IXPA 4ZTHA 3ZSIA 1S9IA 3F66A 3BEAA 3R0TA 5ANGA 3AC4A 4C8BA 4DEAA 5HX6A 3R00A 2XIZA 3I7CA 1YXSA 3FSKA 1YW2A 2GNJA 3TNPC 2WOTA 3HP2A 3AT4A 1DS5A 2BFXA 3IDPA 4KBAA 4W4YA 5DRBA 4RA4A 4UBAA 4RIYA 5KZ0A 3M42A 4BF2A 3RAWA 1U4DA 2CGVA 4IFGA 3BU5A 2BIKB 4OBOA 2O3PA 2ZM4A 3U87A 4NM5A 5AWMA 4R7HA 2WMTA 2FH9A 3CCNA 1QPJA 2YA9A 3R28A 2XBJA 4PPAA 4RRVA 2HZ0A 5AADA 5G6VA 4QMMA 5E1SA 4RJ8A 5JSMA 4DF3A 4L7FA 4U6RA 3OMVA 2J5EA 2VWUA 3EQRA 4O7TA 4WNMA 5CAQA 4KINA 2W96B 5E9EA 4P5ZA 5E8SA 5A4QA 5KHWA 3KXXA 4I93A 4BDAA 2UZUE 4MNEA 4G6NA 4RQVA 4KAOA 2V7OA 3MJ2A 2QOQA 3EQDA 1OMWA 4KNBA 5E8VA 1Q5KA 4FKWA 4DLJA 3P7AA 1CM8A 4CNHA 4MEDA 2H34A 5LMKA 3S00A 4RIWB 1ZZ2A 3NW6A 2OI4X 4YGAA 4U42A 4F9AA 2BKZA 2WZJA 1UU8A 5A14A 5EOBA 5LVPA 4N70A 3CY2A 1URCA 3QWJA 2H9VA 2HCKA 1WBNA 3IOKA 4BWXA 4S32A 2BTRA 2HY81 1VZOA 3F82A 4F9YA 5CU2A 3HAVA 4G1WA 3OOMA 5FM3A 4ZZMA 4AZVA 3UNZA 3LPBA 2PE1A 2VTAA 4E5WA 3MV5A 5TOZA 2JDTA 4LL0A 4WNPA 1OI9A 4GRBA 4IZ7A 1GAGA 4TYHA 1XBBA 1HCLA 2Y7JA 4GYGA 3QQUA 2IZUA 3VUTA 3MPMA 5KMOA 1XH9A 4KA3A 4OBQA 3MH0A 4DGOA 2RG6A 3CXWA 2CMWA 4JT3A 4ERKA 3SKCA 3VQUA 2C0IA 1G5SA 3Q3BA 3QD0A 4C38A 4E26A 4EC9A 4L52A 5KMKA 1KUTA 2WB8A 1YWRA 4K0YA 4TPTA 3PVGA 3E92A 4AGDA 1TVOA 4EBVA 5KX8A 2OZAB 3UTOA 4DBNA 1XKKA 2PVRA 2GHGA 3LVPA 4IZYA 4CFNA 3D4QA 3NZ0A 3R7GA 2NNWB 4OUCA 5BYZA 4EKKA 3EQIA 3TKIA 2ACXA 2HK5A 2VRXA 4RGJA 4UXQA 2CNUA 3SG8A 5IQFA 4KWPA 3EYHA 3NIEA 3JVSA 3RPSA 5JFSA 3BHYA 1PMEA 4IVBA 3FKLA 3W8QA 5CF4A 3GU5A 1TQIA 4ZY4A 4IX3A 3OTUA 1ZY4A 4CLIA 5CAOA 2CN5A 2OFVA 3FY2A 3G90X 2PE2A 3MVLA 1YOLA 2RL5A 4FNYA 3W2QA 1OM1A 5KMMA 3FEGA 3FJQE 3FZRA 4PRJA 4R3RA 3R22A 2ZOQA 4JBQA 4ZTMA 1FGKA 3FHRA 1WVWA 1PYXA 3QUDA 4R5YA 3F3UA 4YZ9A 3THBA 4R5SA 2RFEA 3KVXA 4EOQA 2J0MB 3KF4A 3SXFA 1OPLA 3IS5A 3ZO4A 5CI6A 1PMNA 4A9RA 4BDJA 2VWWA 4FIFA 4BWKA 3PZHA 5AV0A 3U51A 4F1OA 3W10A 4E73A 4V0GB 4XG3A 3OCTA 5JN2A 5JEBA 2VWXA 2YCSA 2VV9A 4IWPA 4Z9LA 4G5PA 3FQEA 4V05A 3MFSA 1YDSE 5IKWA 3TIYA 4ACGA 4RX8A 4PNIA 3KXHA 1Z9XA 4PMPA 4BCPA 3EQGA 1H00A 2XYNA 2I0YA 2QHMA 4XCUA 2PMOX 3UVRA 4APPA 5CVHA 2I0EA 2KULA 3LCTA 4D2PA 1O9UA 1Q8WA 1YI4A 4AS0A 3SW7A 4FEVA 3E7VA 4N6YA 1WVYA 4FTLA 2VTNA 4CSVA 3MH2A 3R8ZA 1M7QA 3OW4A 2C4GA 3QKKA 1YXVA 5J5SA 4F6SA 1W98A 2YM3A 2UW0A 3CC6A 4BI2A 5AV1A 4M12A 4EH5A 4CZUA 4XOYA 3R02A 2AC3A 2GS7A 2W1ZA 2HXQA 3FMLA 3S0OA 3W8LA 5FXRA 2VWIA 5JFVA 3CPCA 1PKDA 2PZIA 3RHKA 4FNXA 5AUTA 3MYGA 2XIXA 3QTQA 3ALNA 4FOCA 3D5XA 5CYIA 5J7BA 4MK0A 3D83A 2X8EA 4BWPA 3RPOA 3BGZA 1ZYJA 5M4IA 2GSFA 2OXYA 5AR2A 4IVAA 3WF5A 3OWJA 5IA3A 1Q8YA 3LJ1A 1E1VA 4R77A 2FSMX 1OIQA 2BDJA 4NKAA 4XX9A 1ZXEA 4FT7A 4ASDA 2OF4A 3ZCLA 5IH6A 4YPDA 4EQCA 1NY3A 4IC7A 3QALE 1OL1A 3BHHA 2HOGA 2YCFA 4GK2A 4NTTA 4CFMA 4YMJA 4O7NA 4GFGA 3O50A 4OW8A 4XP3A 1H07A 3EL7A 5DPVA 3RMFA 3ZDUA 4DH5A 1T45A 3KRXA 4F6WA 2CNQA 3DU8A 3M1SA 4E6QA 4AT3A 4E3CA 5LARA 3K2LA 4NW6A 1VEBA 4I6FA 4I5MA 1BKXA 1H4LA 3AQVA 4P4CA 5E8UA 3CTJA 3QRTA 4QP7A 4PDOA 3OF0A 4OTFA 2PMIA 4QQ5A 5A4CA 4TNBA 5IEYA 4XLVA 3AC3A 1GOLA 4X2FA 4O91A 3W1FA 4DT8A 4RJ6A 3QQJA 3NYXA 4FIEA 3VRYA 4LRMA 2IG7A 4OGRA 4QYHA 1U54B 5AR3A 3LFAA 5BVEA 3LAUA 5IMEA 3R1QA 1RDQE 5DMZA 4CKJA 2PY3A 4M7IA 3W2RA 5I5ZA 2NP8A 3S95A 3RPVA 5CVFA 3SQQA 3G2FA 4G17A 2B9JA 4AT4A 2A0CX 4L9IA 1XBCA 1PXIA 5M53A 3ORPA 3D2KA 2VTQA 3ANQA 4FTJA 4B6LA 3OT8A 1OKVA 1FBNA 3EB0A 4H36A 4BDBA 3IW8A 2J4ZA 3EFWA 4JDKA 4KIPA 3PWDA 4G3CA 4EL9A 5IUGA 3V5TA 3NW5A 4AW5A 2JGZA 4FZAB 4ANNA 2PVNA 3S1HA 4RJ7A 2OH4A 2OBJA 5DEWA 2YWVA 2QOBA 3ODZX 3OXIA 3QZHA 4YHJA 5EM5A 5H8GA 4AWIA 1Q3DA 5M4FA 3POOA 3Q4UA 4O7RA 4GJ2A 4QMYA 5F1ZA 4C34A 2BHHA 3GGFA 2WMAA 5CF5A 4MYGA 4FZFB 2WD1A 3NPCA 4FSTA 3V5QA 3U9NA 4AOJA 5L2SA 5J1WA 3OCGA 4ITHA 4F7NA 1O6YA 4YLJA 3NVKI 3DZOA 4DEIA 4QMQA 2XNNA 3WZUA 3DGKA 1UU7A 5IZFA 3QTRA 2H8HA 5I3OA 1SYKA 3P4KA 5ICPA 2RG5A 3D7TB 3VUMA 4O0XA 4X3JA 4ZOGA 3KRLA 4JDHA 1LPUA 4BDEA 3O51A 4PY1A 2HXLA 3SRVA 3ZS5A 3CD8A 2XJ0A 4JL9A 4K1BA 2B9HA 1JSTA 3OP5A 3GCQA 3TNHA 3WI6A 4CRSA 2WQOA 1Q8ZA 3LCKA 4YPSA 4CKRA 4DEHA 3DKOA 3QRKA 4FTCA 3CGOA 3OWKA 5DI1A 5HI2A 2R64A 4O0YA 5ETIA 5D11A 2W4JA 1WBSA 1WZYA 2OIDA 4BKYA 4NL0A 1OKYA 2IWIA 2VTHA 4MQ2A 2YDKA 1YVJA 2VX3A 4JOAA 2WTDA 4LOQA 1XH4A 4G9CA 4NSTA 2GS2A 4FKPA 3QTXA 3VC4A 4FIIA 2XK6A 3IOPA 1SNXA 3Q6UA 4I1ZA 1SZMA 3ACKA 3PJCA 2W1IA 1PXPA 3PSDA 5HO8A 5L6WL 3SHEA 5C4KA 3A7GA 5EOLA 5IDNA 4DTAA 3BHUA 3VBWA 2Y9QA 2UZNA 4GL9A 4M67A 2RFSA 3IDCA 1BI8A 1YXTA 2HELA 3DS6A 3NNWA 5EDQA 2XK7A 4BR3A 3MI9A 3DBCA 2WXVA 2PZYA 4FTQA 2OG8A 3FI8A 4R8QA 4L44A 4MAOA 2C5YA 1ZRZA 1U46A 4BI1A 3NAXA 3L9LA 4F7LA 5DH3A 1KWPA 4QQCA 3M2WA 2DS1A 4EWHA 4CFXA 2YM6A 3L8XA 1GY3A 3UJGA 3REPA 3A7HA 3Q4TA 4QP4A 4RVKA 3R04A 4CQGA 4O7SA 3FUPA 4X21A 5EQEA 3PP1A 5CASA 2PVKA 2GTMA 2WTKC 5AP7A 3WIKA 4DGLC 4Y8DA 1H01A 3G51A 3C4ZA 5LOHA 3OW3A 3ZLWA 2JAMA 3RM6A 2C3KA 1JWHA 2C6OA 2IVUA 3H0ZA 4MXOA 3OOGA 4E6AA 4NIFA 4IADA 1H26A 1FOTA 2QC6A 3NRMA 4XRLA 4DEEA 2B4SB 5D1JA 3O7LB 4RFYA 1ZYSA 4I3ZA 5LVOA 4G3DA 4X3FC 2VTPA 3BYMA 4FV0A 3NIZA 5HLNA 2XIRA 1V0OA 4D58A 3AOXA 3PXYA 4XG7A 3SOAA 4W8DA 3CLYA 5KMIA 1OPKA 3DK7A 5DIAA 3KULB 3COIA 3PJ1A 4IAFA 4N0SA 4X2NA 4BC6A 2PUPA 3GBZA 4FV9A 5JQ5A 1KE6A 4LQMA 4R1YA 3II5A 1OB3A 1NXKA 1BYGA 4QOXA 5E8ZA 4C4FA 1Q8TA 3UQGA 1YWNA 4D1SA 1KE7A 4O0RA 3V8TA 4ACDA 4ENXA 2VNYA 3AC5A 5FTGA 4EJ7A 4FVRA 4O2ZA 5DT3A 4Z16A 4MXZA 5BUIA 4UMTA 2W05A 5ANIA 3R73A 5JRQA 3GXLA 3PPJA 3R1YA 1S9JA 4RIYB 2YAKA 4AUAA 5T3QA 4IJ9A 3HGKA 3OT3A 4EEVA 5BPYA 3QTWA 4MD7E 4D28A 3B8RA 3RZBA 4LGGA 2UVXA 5AP1A 4C4EA 2OGVA 5K3YA 3P0MA 5BX0A 4XUFA 4QMPA 3GVUA 2OK1A 2QOKA 3HV5A 5M09A 3F7ZA 5GIPE 3C4EA 3IONA 2XNEA 4MTAA 2OJIA 4E8AA 4YO6A 4I22A 4DE4A 1OECA 1REKA 4HGSA 3PXZA 3DBEA 3N9XA 4WUAA 4IX5A 3VW6A 3FY0A 4ZEGA 5KO1A 2F9GA 3L9MA 4IIRA 2DUVA 4I92A 4MNEB 4DTKA 3EMGA 5J8IA 4WG5A 3NGAA 2W5AA 5EH0A 4A06A 5JK3A 5HO6A 4NFMA 4NWMA 5TT7A 2XJ1A 4I4FA 1ZOHA 5I9VA 2ZM1A 2HZ4A 3R21A 3QYWA 4BIEA 4S33A 4ITJA 4U97A 5GZ8A 4HCVA 3PRIA 2X9FA 4UV0A 1R1WA 4BL1A 5TF9A 4RMZA 4YZCA 3JY9A 3ZONA 2PZPA 3W32A 1R78A 2RSVA 4MVFA 3Q9ZA 4TRLA 3WZKA 4BBEA 4E4XA 4O2PA 5B2MA 4R1VA 3DXQA 1UKHA 4HGLA 5KUPA 1OZ1A 4E20A 3LFQA 4EH6A 3R8LA 4M14A 3ULZA 2OJFE 5I9UA 3WBLA 4L53A 1NT2A 2C0TA 2EB3A 3LFDA 2GNHA 3MN3A 3V8WA 4BICA 4D4YA 4TYHB 3LMGA 5EYCA 4Z55A 2YIWA 4DH8A 5ITAA 2DWBA 3FXZA 3WZEA 1XJDA 4ZXTA 3QYZA 4M0YA 4FTNA 3MTLA 5FUTA 5KCVA 3VS3A 5GNKA 2PHKA 5HLPA 4YZNA 2JKMA 5ACBC 3EIDA 4O86A 5HG7A 3I6WA 4MF0A 4BFMA 1RE8A 4HW7A 2F49A 3LQ8A 1CSNA 3Q52A 5FXSA 2CLQA 4BHZA 5EYKA 1VJYA 3RALA 3HV3A 3ITZA 3ET7A 2PZRA 5CEQA 3O8UA 3TNQB 5DLSA 2PVJA 3GQLA 3MIAA 3UZTA 3ZRKA 4FYNA 2Y0AA 1IA9A 2J50A 3RAHA 2BKKA 2ERZE 2XKFA 2VD5A 2BHEA 5CWZA 3VWAA 4BYIA 4QYGA 4AW1A 3I79A 4CV9A 2C0OA 4IB0A 4ASEA 4MQ1A 3N51A 4DC2A 3NNUA 5IUHA 5KMJA 3BYOA 1H1RA 2R0UA 1TQMA 5EW3A 2XRUA 1REJA 4N57A 2C6KA 3UQCA 4ZSLA 2IZRA 1W82A 5IQBA 4FTUA 3UOKA 4XP0A 1R39A 5CNNA 2UW3A 3R7EA 4DEDA 4XG6A 5DR9A 2BRBA 4ANOA 3LHJA 2QU5A 4XNEA 3FZOA 2R3KA 5HU3A 1JSVA 4LV5A 3F7WA 2C1BA 2PVHA 2BAJA 3PY3A 1ZZLA 2E9OA 2WMWA 1ZOGA 4JS8A 4XG4A 4DA5A 5CSHA 4FL1A 4RX7A 1SVHA 2QQ7A 4DFLA 4EZ7A 4GKIA 4Q5HA 4A07A 5EM8A 4RBLA 5A4TA 4BTMA 3UO5A 1ERKA 4EOIA 4AA5A 4BGQA 3RKBA 3ZC6A 4EHGA 5JQ8A 4HGEA 3ZUTA 3P86A 4B0GA 3NNXA 5CQWA 2W1CA 2Z7SA 4E93A 1XQZA 3LFSA 3LW0A 4MXCA 1UU9A 4Y5QA 4E4MA 4BZDA 2DYLA 2AC5A 2YDJA 3WZJA 3R9HA 3TIZA 2C69A 1P14A 3CD3A 1M2QA 3VUHA 1OUYA 3ZO3A 3G15A 3F88A 1OVEA 4AZEA 4L43A 4K11A 2BMCA 3PE1A 4C4HA 4D9TA 4GVAA 4U41A 2UVYA 3GC7A 3HX4A 5K0XA 4BCOA 4L01A 3DKCA 4HCTA 2ZVAA 5IA0A 2XNMA 3KRJA 2RF9A 4OTIA 2PL0A 4DFXE 4X3FA 1Y57A 4EOMA 4K9YA 3TZ8A 1A9UA 3SXSA 4NFNA 2OFUA 3TACA 2HYYA 5M4UA 3QFVA 2WNTA 3DQWA 5AAEA 3P1AA 1XHAA 5L4QA 2OLCA 3DDQA 3FE3A 3UIBA 4O0VA 4HVGA 3C50A 2OO8X 4FF8A 4YC6A 2P3GX 3F9NA 3VW8A 4F7JA 1WAKA 4IE9A 4X6QC 4FKOA 1H08A 2WTCA 5FBOA 4ZTRA 3KREA 3GB2A 4WUNA 3UODA 2O0UA 2YFXA 4F0GA 4KKHA 3GC8A 4V01A 3MA3A 3F3TA 3CQEA 2JFLA 1Q62A 3OWPA 5AUWA 4M66A 1Z5MA 3WZDA 4ZIMA 1Q41A 4ACCA 3KQ7A 2X7OA 4UB7A 2XKCA 4P90A 4R3CA 4GU6A 2LAVA 3MTFA 3FLQA 4IX4A 3I7BA 4BYJA 4BGGA 5C8KA 3HMNA 1JOWB 3UIMA 4FGBA 3E8DA 3QX4A 1H1WA 3GU6A 3P78A 4IM0A 2R3MA 4BDCA 3NUXA 3ZUVA 2XK4A 2OIBA 3AXWA 3U6IA 4YP8A 3PVWA 4FL3A 4M69A 2R3JA 4ENYA 3BLQA 2YLFA 1MQBA 3DCVA 1R0PA 4RPVA 3E87A 3IW5A 5L2TA 3HMIA 3QKLA 1BL7A 4RWJA 5KHXA 5AAFA 2EB2A 2ZM3A 4FBXA 4KKGA 4U80A 3DTCA 5M07A 4KRDA 4RQKA 3TZ9A 2V5QA 5IF1A 2Z60A 4U8ZA 4AN2A 3CIKA 5BVNA 3NUUA 3FMEA 3UVPA 3K5VA 3G9LX 2E9NA 5T68A 1BMKA 3F69A 4ZY5A 3BU3A 5FEEA 2ITVA 4WNKA 3V8SA 3A7FA 4XP2A 4JQ7A 2ZYBA 2GCDA 1F5QA 4U3ZA 4FTIA 3VHEA 4EBWA 2OJJA 4Q5EA 2VX1A 3DTWA 3O7LD 4F9BA 5I4NA 4IFCA 4WRSA 4OTPA 2OXDA 2W5BA 4KABA 5AP6A 4OT5A 3VRZA 4AA4A 4ASZA 4ANBA 2QU6A 5AAGA 5AX9A 4J98A 4NK9A 1FVTA 5EYMA 4LUEA 2HZNA 1GZNA 1M7NA 3JVRA 3VVHA 3WE4A 5L6PA 3R71A 3D14A 1YI3A 4MBJA 4DFZE 3OCBA 4FTRA 2J0LA 3MVMA 2IW6A 2X6EA 3SDJA 3G0EA 4FK3A 2X2KA 4EZ3A 2C6IA 3DLZA 2XCKA 3SX9A 4FSYA 3ZC5A 4EK3A 4FX3A 3G6HA 1MRYA 2QHNA 3W33A 1WBPA 3Q9XA 1Y8GA 2GTNA 4BCHA 2O64A 2W1HA 4FT3A 3CR0A 1UNLA 3KXZA 4G31A 2VO6A 3SRVB 5EKNA 4GYIA 5EKOA 2J0KA 3V6SA 4FT0A 4QMNA 1OPJA 3A2CA 5F4NA 4FV4A 3VNTA 3ZFMA 3JXWA 3EFKA 3MY1A 3N4VA 1LP4A 5E90A 3SV0A 4YTHA 3DAEA 4PTEA 5JT2A 2BPMA 4APCA 3CY3A 4DHFA 2H96A 3GU8A 3R1SA 4CFWA 2GNLA 5KZIA 3KC3A 4WRGA 4JG8A 4XG2A 1J7IA 3LIJA 2IVVA 3I60A 3VUIA 3ZRLA 4BZNA 4AAAA 3W16A 2R3FA 3OFMA 3D94A 4YO4A 3TUCA 5DNRA 3FKNA 3FMDA 5HG5A 5JGAA 4J99A 2W1EA 2B53A 4EOOA 2IVTA 3OBJA 4ANMA 3PUPA 2XNOA 1PXMA 2O65A 4QMUA 4D4VA 4FGRA 4DAWA 4O6EA 3LLTA 2CLXA 2B0QA 2YLEA 4RWLA 4AGCA 1UA2A 2X1NA 3JPVA 4O21A 3NW7A 5EI2A 3UIXA 4BVUA 2GFSA 3MH3A 4M84A 1XH5A 1JAMA 2QURA 4BB4A 4KIQA 3DK3A 3G5DA 3RP9A 4QTBA 4PDYA 1GIIA 2JIVA 4TN6A 4O6LA 5L2WA 2BUJA 5CT0A 4CFUA 1MRUA 2XK8A 5IISA 3NUSA 3UP7A 3EFJA 4GVJA 4XYFA 2JD5A 4E4NA 4U40A 4JQEA 5E92A 4UMUA 2Q0NA 2CGWA 2YCQA 2B9FA 2XIYA 3CKXA 4FV1A 4GSBA 2BRNA 2XS0A 4HPUE 3Q9WA 3FXWA 3A8WA 5A3XA 3OUNB 4D9UA 3QD3A 3C0HA 3U6JA 4DFUA 2PVLA 4J7BA 4BCGA 2C6DA 1KOBA 4U79A 4PL5A 4QD6A 1PXJA 2CKQA 1W0XC 3PYYA 3P7CA 4FUYA 4RIXA 5E7RA 1GZ8A 3KN5A 3KMWA 3O8PA 4UWCA 4KBKA 2UW5A 4K18A 3F3ZA 4YBKA 5CNOA 5AP5A 4EORA 3UNKA 1WFCA 5AA9A 4CYJA 4FZDB 2X81A 3FQSA 4G3GA 2V22A 2VTOA 4TYGA 3R8VA 3GU4A 3RK7A 2PYWA 3AC1A 4YJQA 4YLLA 5LCKA 5AP0A 3FPQA 3FLSA 1VR2A 2PPQA 3ZXTA 3UMWA 3LFFA 2UZDA 3R7IA 2BIYA 2CCHA 3Q60A 5HBEA 3WF6A 5HU9A 3BIZA 2JDVA 4NIFB 3TG1A 2W17A 3VUGA 3MPAA 1OL2A 4FODA 5E8WA 3DJ6A 3DA6A 3LQ5A 5CI7A 4YC3A 5FRIA 5JGDA 5IQGA 2Q83A 4M0ZA 4DGNA 5CEMA 5BVKA 4UZHA 3ORKA 4IWDA 1WVXA 3P08A 5LWNA 4EJNA 2G2IA 4S31A 3TDVA 2R4BA 3H9OA 3HUCA 4HYUA 4PPBA 3PVBA 2R3IA 3MA6A 4MD8E 3W55A 3O96A 4FE2A 4O0SA 1ND4A 4A4XA 3QD4A 4GMYA 1EH4A 4EH8A 4KRCA 4QMVA 2W0JA 3QC4A 2VAGA 3EKNA 5L2QA 2QKRA 2WELA 3ALOA 3KL8A 3V3VA 4BTKA 3KK9A 3MFTA 2JLDA 3PE2A 4M68A 4IVCA 1JKTA 4XMOA 5EM6A 2UW6A 4PDSA 2R5TA 2Y4IC 4TYEA 1FINA 4EZ5A 4BDIA 2VTMA 2HY0A 3HRCA 4AXAA 4L8MA 1YDTE 4U7ZA 4IAIA 4JQ8A 1M52A 3TTJA 3HECA 4HVDA 3QX2A 4ITIA 4U81A 3T9IA 4FV6A 4JR7A 1NW1A 2OSCA 4R3PA 2YJRA 3ZXZA 3DNDA 5C9CA 1SMHA 2BCJA 4CV8A 3C4WA 2X9EA 3GP0A 1KV1A 3ZM9A 2C6MA 4BTJA 2B54A 3WF7A 5M56A 4JG7A 4C2VA 4R78A 2G01A 4GJ3A 4IACA 5DA3A 4JR3A 2QI8A 1CDKA 5CU6A 2VO7A 2VTRA 3EQHA 3ZBXA 3CKWA 2VX0A 2HWPA 2XYUA 4DLIA 3UIUA 4HNIA 1NA7A 4I5CA 4MWIA 5FP5A 3TJDA 5GIOE 4FL2A 1OIUA 1TKIA 4CLJA 3D5VA 4GU9A 1CKJA 3QA0A 4H1MA 3NVMB 4NCTC 4EKLA 4GIIA 4PPCA 4FIHA 3QHRA 2H6DA 2JKKA 5AMNA 4S30A 3U4WA 1L3RE 2C5VA 3PSBA 5AUZA 2G2HA 2QOFA 3MJ1A 4YLKA 3CJGA 2J90A 3A4PA 3V51A 2X7GA 1P4OA 1O6KA 1WCCA 3CTHA 4A9YA 4HZSA 5CENA 3IW4A 4C0TA 1QPDA 2X4ZA 3DXPA 3VF8A 3OCSA 3BBTB 4GG5A 4ACHA 4AE6A 5JFWA 2X6DA 4EK8A 2O2UA 3QTZA 1XH6A 3I6UA 2GU8A 4FKRA 4A9UA 4BCJA 1E1XA 5FG8A 4DINA 1W8CA 2CKPA 3TV7A 1BI7A 2WPAA 2X2LA 3HZTA 3KKVA 5DG5A 1LUFA 3BYSA 4FZ6A 3UG2A 3MSSA 4J96A 5FD2A 5M57A 5DHJA 4JAIA 5AUYA 3R7UA 2ITUA 4UYAA 4F64A 4I24A 3JY0A 3MB6A 4HZRA 3IKAA 4C3FA 2IW8A 4OTWA 4CMOA 2OIQA 3EYGA 2CGUA 4U5JA 4CFFA 4AU8A 4LYNA 5A6NA 3LXNA 2OZOA 3L9NA 1UKIA 4WKQA 4NU1A 3MDYA 2B7AA 2Q0BA 3RZFA 2YIYA 1CMKE 5LMBA 4ZMEA 1NVRA 4P7EA 2VTJA 4RA5A 2UZLA 3DY7A 2O8YA 2XH5A 3C0IA 3NYNA 1H1QA 4PMTA 2G15A 3PG1A 4XLIA 4YJRA 5FTQA 3LCSA 4F9WA 1ZMWA 1LEZA 3EHAA 3HRBA 3P7BA 3H9RA 2WGJA 4O96A 3O23A 2W4OA 4F99A 4TY1A 4CQEA 2XA4A 3MY5A 4LOOA 4D2VA 2PMNX 5GJDA 3RWPA 4AT5A 1YXXA 4J52A 2BILB 4G6OA 4DG2E 5CEPA 4USEA 4CT2A 2Z02A 3O0GA 2ITXA 3BELA 4FI1A 4M8TA 5FM2A 3WIGA 4EH9A 3R6XA 5E4HA 3FI4A 2GMXA 4EYMA 4DFBA 3A99A 3BQRA 3EN7A 1H0WA 3RTPA 4BZOA 2WEVA 4QRCA 4DH7A 4E7WA 3KB7A 3KXMA 1STCE 3LJ2A 4JXFA 4TWPA 4O81A 3BBWA 2ZV8A 2X4FA 3P5KA 4FOBA 1YOMA 5HCZA 4FEXA 5AP2A 1AQ1A 3L9PA 3O17A 5B2KA 3DZQA 4FKJA 5HE2A 4L68A 4AN3A 4UMRA 1PMUA 4F9CA 4GK4A 5AV3A 5KBQA 5C03A 4BCMA 4QMTA 4JX7A 2XM9A 3V6RA 1OKZA 2I40A 3BGPA 2UW4A 1ZWSA 2WTKB 3I5NA 3TWJA 4EOPA 4ZZOA 5H9BA 5LVMA 3LM5A 4H1JA 3PWYA 3RINA 5DT4A 2NRYA 5CT7A 2PUUA 3R8UA 4BDKA 4ZSJA 3UVQA 3WYXA 3G9NA 4JIAA 4XJ0A 4FNWA 4NEUA 2PULA 5EK7A 3GCPA 4JBOA 4ANSA 2VNWA 4CCUA 4KS8A 3HV6A 3WE8A 1OIRA 4WIHA 4UWBA 3KMUA 3SOCA 4FV5A 4RVTA 5EQPA 4X3FB 3DPKA 3EWHA 2VWBA 2REIA 2XJ2A 3UBDA 1UV5A 3RI1A 2UZVA 4DT9A 2X8DA 4K77A 4MF1A 2Z7QA 2JDOA 3MW1A 3C5IA 4PX6A 5CF8A 3QBNA 2OWBA 4AP7A 5A4EA 3ORXA 2QR7A 4I94A 2YITA 3VS5A 4QMSA 4E6DA 4EK6A 1ZAOA 3OY1A 5GHVA 4FSQA 2JIIA 3E3BX 4X7QA 3ZYAA 4C37A 3NUNA 1JLUE 3PY0A 2R7BA 3DDPA 4S2ZA 4AA0A 3GUBA 1BL6A 2QCSA 3FYJX 3PFQA 4DYMA 2YN8A 3OWLA 2IZTA 4DH1A 3FZPA 3PXQA 2BVAA 5L6OA 5DE2A 5AFVA 5DOSA 4U9AA 3H30A 3Q9YA 3A7IA 4S34A 4Y83A 4FR4A 5CZIA 3N4UA 2DQ7X 3KEXA 3HUBA 5HZNA 3ULIA 5E1EA 5CX9A 3Q4ZA 1DM2A 3FYKX 3HL7A 3QRIA 1VYZA 5EHOA 2QNJA 4J1RA 4F63A 2E9UA 4YNEA 3DFCB 4AACA 4QNAA 5CAVA 4M69B 2W99B 3PRFA 2R7IA 4IZAA 3SAYA 5HIBA 3LLAA 1Y91A 3PJ2A 2R3OA 4NT4A 2C1AA 3F5XA 4L6QA 4AG8A 1XO2B 4GFMA 4F6UA 2QOHA 3NDMA 3EQPA 4ZJIA 2QONA 4QMLA 2W1DA 3FMMA 5LJJA 3BKBA 3KVWA 4I0SA 4PDPA 4XBRA 2Z8CA 2ZV7A 5KKRB 4PP9A 2GFCA 2QKWB 4GUEA 5AIKA 2WAJA 4NCTA 4EONA 4BTFA 4D0WA 5K5NA 4Z7GA 4IQ6A 4EOJA 5A9UA 2Z7RA 4WT6A 3TZ7A 5CEKA 3V01A 2R3QA 4QP8A 3ZRMA 4ARKA 3BGQA 4FV3A 4CZTA 5ANDA 3ZUUA 3I0QA 3OEFX 3R8PA 1OBGA 2YM5A 3E8EA 4XH6A 2BALA 5AIRA 3Q04A 5FP6A 4WA9A 3FAAA 1PHKA 4BDDA 1JKLA 3I1AA 4RC3A 2P33A 2JEDA 5J9YA 2BRHA 5FLFA 2PSQA 2PUIA 3K3IA 2ETRA 4EH7A 2ZB0A 5FQDC 3RVGA 2XP2A 3HNGA 2WIPA 2XKDA 4O0UA 4DCEA 1IRKA 4FA2A 3HAMA 4H3PA 4GFOA 4PP7A 2OH0E 5EDRA 4ZTSA 4BDFA 3KRRA 4CRLA 4JNWA 3F2RA 2WTJA 3Q96A 4DFNA 1WMKA 2IO6A 2XB7A 3F3WA 2X2MA 4OLIA 4UY9A 3LZBA 5E91A 4BCKA 4ZLZA 2P4IA 4HGTA 4D2TA 3GENA 4FKVA 5HESA 3NSZA 4FV8A 2ZMDA 4RIOA 4ALVA 3MB7A 1GZKA 4FT5A 5KMNA 4GT3A 1WBOA 4ZLOA 2WFYA 2VWZA 1PXNA 5HE1A 2R9SA 4H39A 4QP9A 4D5KA 3QF9A 4QYEA 4MXXA 3ZO1A 4GK3A 3G33A 2HW7A 1SNUA 3DXNA 3FXXA 3I5ZA 4L3LA 4PTCA 3HP5A 5HNBA 4C35A 1PY5A 5ANKA 3NUYA 3CE3A 2B52A 4BN1A 5LQFA 4DN5A 5FDXA 4RJ3A 4EH2A 2ITTA 5H2UA 3D5WA 3ZLSA 1PXOA 4XBUA 4JX3A 3D2IA 4G6LA 1GIHA 3O71A 2WHBA 3S4QA 4EOLA 2CKOA 2C6EA 4DBXA 4LMNA 3EQCA 4I5HA 3TI1A 5HEZA 3VF9A 1CKPA 1OKWA 4NW5A 5DBXA 4W9XA 4BBFA 2G2FA 4I23A 5IA1A 4I21A 4AFEA 4L3PA 3TZMA 4H3BA 5ANJA 3UDBA 1M2PA 1OL5A
chains in the Genus database with same CATH superfamily
3QGYA 3VAPA 3QCSA 2R3PA 2GNIA 1PRYA 4J8MA 4TTHB 3MBLA 4EK4A 5IQHA 4I5PA 1E9HA 3EN4A 2XALA 4ZLYA 3IPHA 3SXRA 3O2MA 3PA3A 4FC0A 2BAQA 3AG9A 2UUEA 4IB5A 4ZS0A 3SW4A 1LR4A 2XEZA 3ORZA 2IZSA 3G0FA 4HJOA 3FQHA 2AUHA 1U5RA 4RIXB 4C7TA 2VWYA 2Z7LA 5BVFA 3AC2A 3RGFA 4DGGA 4O4DA 3GNIB 4AW2A 2WU6A 4FTKA 3TKUA 5EM7A 4AOIA 3FPMA 5EI8A 3DAKA 1KE5A 3PLAE 2VGOA 2UW8A 3OXTA 2UW9A 5DGZA 2YZLA 5F95A 3VBTA 4AQCA 4USFA 4TKSA 2ZDUA 4GIHA 2ZMCA 5TO8A 4Z7HA 2BAKA 4L67A 5EYDA 1PMVA 2Z2WA 4UN0C 1YHSA 3ORLA 4UEUA 3UO4A 3V5JA 4YUQA 5M06A 2OICA 4V04A 2FO0A 4ZS4A 4LUDA 4LMUA 5TE0A 3TXOA 2E2BA 3F2AA 4XRJA 5JMSA 3LFNA 4F0FA 4IH8A 4RJ5A 2XK3A 3BCEA 5CZHA 2RIOA 3EL8A 3MPTA 3BE9A 3C13A 4YHTA 4C3RA 4QP1A 3LE6A 5TKDA 5F9EA 4CG8A 5BNJA 2SRCA 3QL8A 3BQCA 3QQGA 2G1TA 3VBQA 5BVDA 3ZU7A 4G5JA 4HCUA 5I9WA 1B6CB 4FSRA 3FZTA 4XG8A 3F3VA 3ZFXA 3MESA 5IQEA 3ENHA 3UO6A 2OU7A 1OUKA 2E9PA 4L42A 4YSMA 5BVWA 2QO9A 2WMQA 4QQTA 4DHZA 3T3VA 4FJVA 2PVYA 2VN9A 2PVFA 2XMYA 3FZSA 3W18A 3WARA 4AE9A 5HCYA 5L2IA 5J9LA 4JJRA 4YC8A 5J5TA 4E5AX 5T6KA 4RLKA 3VUDA 4JG6A 4QQJA 5AV2A 1YXUA 4FTMA 4G3FA 4ONAA 3W2OA 3C51A 5IA2A 5EFQA 3RM7A 1ZLTA 4GH2A 3SGCA 4E1ZA 4JDIA 1Y8YA 3B8QA 1H28A 3CS9A 2P55A 1Q4LA 3HA8A 4F7SA 1RJBA 4PWNA 2C3IB 3QU0A 4LGDA 3UC4A 4QPAA 3QA8A 4YNOA 4WSQA 3KN6A 3MVJA 3OTVA 2XVDA 4O4BB 3UMXA 4C59A 2J5FA 2UZTA 2YIQA 4GCJA 2RKUA 2R3GA 3RK9A 3ZTXA 5J1VA 3COKA 3RJCA 2A27A 1XH8A 3MGYA 3LMIA 4D4RA 5AA8A 5AM6A 3UYTA 4A4OA 1U59A 2WQBA 3KA0A 4RZVA 3SG9A 4OTGA 1VLRA 3FDNA 3NNVA 3AD6A 4OTHA 3GI3A 3ZOSA 3GQIA 3R30A 4K6ZA 2QG7A 1H27A 4NZWB 3AGLA 4FKTA 5D7AA 2IW9A 3BU6A 4P2KA 2BDFA 4YR8A 4O7WA 5EW8A 2C6TA 1Z57A 1FGIA 3FMHA 3VN9A 4B8MA 4WOVA 1A06A 4PMSA 1H1SA 3PIYA 3ATSA 3LXKA 2QOCA 4GT4A 2R3HA 4IMYA 2WU7A 3C4CA 3DB8A 4CCBA 4YJOA 4EWQA 5I3RA 2GQRA 2ETKA 4B7TA 1JVPP 2VGPA 2YABA 4FNZA 4EQMA 2PUNA 4UMPA 3BL9A 3UDZA 5DR6A 3QTUA 4QTCA 5E8XA 4NKSA 3ANRA 3BLRA 3R2YA 4O38A 4C36A 3C4FA 2P2IA 3ORTA 3LFBA 4AZFA 4TNDA 1RW8A 4NYEA 3E8CA 4HYHA 3TNWA 4XV1A 2CHLA 3RCJA 4ZAUA 4FVPA 1QCFA 3C7QA 5M4CA 2ITYA 4ZP5A 4BCQA 3JS2A 2CSNA 3D5UA 3GOKA 4QP6A 5IMXA 3LMHA 3CJFA 3PIXA 5FEDA 2PWLA 3IGOA 4C58A 3KGAA 3ORNA 4W4WA 3ZFYA 2B55A 2FGIA 4BHNA 2Y4PA 4PL4A 3P23A 1WBTA 3FLNC 2JDSA 4UMQA 4FT9A 3BEGA 4DGMA 3TM0A 3OEZA 3ATTA 2R0IA 3VULA 1P5EA 4RC2A 2GPHA 3KXNA 3OY3A 4QMWA 4QYYA 5FTOA 4DH3A 5J7HA 2ITNA 3VS7A 4CKIA 2JITA 4AGUA 5I0BA 4W4VA 4FTTA 4O22A 1FQ1B 3ENMA 5BUEA 5IQDA 2JAVA 2VWVA 2W06A 5HVKA 5EG3A 1L8TA 5IPJA 5HNIX 3EQFA 5GINE 3HMMA 3R7OA 1GIJA 4PTGA 1K3AA 3BYUA 4NH1A 4W8EA 2V55A 4D4SA 2VO3A 4HVIA 4X2GA 2HIWA 4FKGA 2QVSE 4MBLA 5CXHA 1ZARA 1BLXA 5AUVA 5HVJA 3TEIA 3CSVA 3AD4A 1UNGA 2XBAA 4XOZA 4XV2A 4CEGA 4KIKA 1G8SA 3PZEA 3EFLA 4G3EA 5HG9A 4I0RA 3R1NA 4C3PA 3ZSHA 5G1XA 5JRSA 5AJQA 2XM8A 4GS6A 2FB8A 3AMYA 2BZHB 3QCQA 4U44A 5HX8A 3R83A 4QTAA 2YZAA 4FTOA 3QAME 2WMVA 2ERKA 2NPQA 2RGPA 2F7EE 5KNJA 1W84A 5LCJA 3R9DA 3ZLXA 3Q53A 4MNFA 4ASXA 3H9FA 4H05A 4O0WA 2C47A 4F70A 3SC1A 3OS3A 3JR1A 5AEPA 3IW6A 3UNJA 5K9IA 4DEBA 2XZSA 4FICA 1I09A 2BR1A 3ZEPA 5A6OA 5CLPA 5H8BA 3ERKA 4YHFA 3PJ3A 2RFDA 1JKKA 2GHMA 4QPSA 2C68A 4W4XA 3T3UA 5HQ0A 1J3HA 3EZRA 3IGGA 2X7FA 4I41A 3C0GA 4WG3A 2BZKB 5DYJA 5CS6A 3R7YA 3SA0A 2CNVA 5IQCA 5CF6A 4TWCA 5BMMA 3TKHA 3VUKA 5CU3A 2OXXA 2W9ZB 5K0KA 5KBRA 4O1PA 4Z3VA 2W1GA 4XV9A 3E62A 5HNGA 4RZWA 3BLHA 5CANA 3EN5A 3KMMA 1WBWA 3B2WA 4UZDA 5DR2A 5FXQA 2UZWE 5CU4A 4EI4A 4GV1A 2I0HA 4IW0A 1YKRA 4ZSAA 5K5XA 2W9FB 2GDOA 1H1PA 3QHWA 3VBYA 3NFGB 3ROCA 4IHPA 3I81A 3MS9A 5L3AA 3TUBA 2Y4IB 2NRUA 4IAKA 4F1MA 4YJNA 1ATPE 2EXCX 5HE0A 3Q2JA 4EOSA 1YHVA 5JZNA 3VJOA 4YU2A 4R7IA 2E9VA 2P0CA 4JBVA 3QWKA 4BKZA 5KMLA 3DB6A 3HA6A 1CKIA 4X2JA 2AYPA 2J6MA 4FG8A 2WTWA 2VTIA 4M3QA 2ESMA 5D9HA 3PG3A 2YWPA 3MVHA 3DKGA 5JGBA 1J7LA 1JNKA 5C1QB 4KS7A 4K2RA 4U43A 3RAKA 4RG0A 4TZRA 3E8NA 3HDMA 4MCVA 4UYNA 3FMJA 5C01A 2B9IA 3GOPA 4AW0A 4D55A 1OIYA 5A54A 2WOUA 4IANA 5HKMA 5HTBA 4D1ZA 1OL6A 3PA5A 4XEYA 4YJUA 4LOPA 4R6VA 2J9MA 3DKFA 3H3CA 3IDBA 3QTIA 3VJNA 1J1BA 3W2PA 5IA4A 5CTPA 4CYIA 1BX6A 3ODYX 3HRFA 4IDTA 3KRWA 2ETMA 4QO9A 4EHVA 3ACJA 4FEQA 4U3YA 2GNFA 1G8AA 5EI6A 5LMAA 3NCZA 5LVNA 5JFXA 3WILA 4JBPA 4O84A 2WMRA 3DJ5A 2R3RA 4GW8A 4L7SA 3BHTA 3QLGA 4MXAA 4C61A 3K54A 3WYYA 2JBOA 3LM0A 3PXFA 4C4JA 4EHZA 4OR5A 3SLSA 4O82A 2F7XE 4RFMA 5AUUA 4NTSA 4FG7A 3ZZEA 3KFAA 4Y5HA 3K5UA 3O8TA 4YZBA 3QQKA 4BIBA 1H24A 2ITZA 2X0GA 1H0VA 3ELJA 1OITA 2WO6A 3TJCA 4AFJA 3W2SA 3FWQA 3HKOA 4M13A 5FGKA 5HBHA 3U9CA 2CDZA 5A4LA 4I6HA 3QXPA 4WBBB 1P2AA 1PW2A 1J7UA 5L8LA 2J51A 4IM3A 5IH5A 2FUMA 1JPAA 3B2TA 2C3JA 4KSPA 4ZTQA 5CSXA 5HBJA 3HV4A 2ONLC 1V0BA 3HLLA 2OF2A 3KXGA 2JKOA 4CZYB 4ACMA 4HVSA 4IAZA 5FEQA 3TUDA 4OAUC 3GU7A 3BZ3A 5HIDA 2I6LA 3T9TA 2EVAA 1OGUA 2W7XA 4IX6A 3VQHA 2BZJA 2WMXA 3PSCA 2XCHA 4MH7A 4JIKA 3VHKA 3DK6A 5EDPA 3CQUA 1B38A 1WBVA 3A4OX 3KU2A 3E5AA 5CAUA 3N4TA 4L45A 4RWIA 3ZH8A 4XS2A 1YI6A 4NUSA 3DNEA 4O7LA 3F61A 5HGIA 3BYVA 3JYAA 3PIZA 3ZO2A 4UX9A 1Q8UA 1YWVA 3IG7A 4O1OA 3CQWA 3SD0A 2V7AA 4P5QA 3V5PA 3OC1A 2YAAA 3EKKA 2CN8A 3GFEA 4CFVA 5K4JA 3IO7A 4YBJA 4D2RA 1Y6BA 3RAIA 1AGWA 3FSFA 4C62A 4Q2AA 2Y6MA 1DAWA 3DQXA 4CTCA 1SVEA 4EHEA 5DN3A 5J9ZA 4YURA 5GZAA 3MFRA 4O27B 4Y85A 2WQMA 3PA4A 2FSTX 3AMAA 3PJ8A 4RFZA 4E4LA 1JQHA 1NVSA 2ZV2A 2VTTA 2QR8A 4MWHA 3TNIA 2QODA 4KUJA 3P79A 3QCXA 5C8MA 2A4LA 3D15A 3ZZWA 4DG0E 5F20A 4XG9A 5I9YA 2BZIB 4FTAA 4I20A 3DT1A 4TXCA 4J95A 4WSYA 2YM7A 5AP3A 4C2WA 3NEWA 2YDIA 3Q4CA 4WG4A 3S3IA 3FLWA 4C33A 4ZZNA 3FV8A 3CBLA 5IA5A 2A1AB 2GHLA 3QRUA 4ZJJA 4DITA 3IQ7A 3QUPA 3TL8A 4KD1A 3U4UA 3OG7A 5B2LA 3NR9A 4LG4A 4G16A 4NM7A 3UOJA 3F5PA 5DWRA 3FLZA 4GT5A 3LFEA 3PTGA 4LFIA 2A19B 2YISA 5ETFA 3VS6A 5CSVA 5DRDA 1IR3A 4FSWA 1FVRA 3NLBA 4H3QA 3UYSA 4TL0A 4PV0A 4YJVA 4HNFA 3ROYA 5A46A 4IBMA 3UZRA 3ORMA 1YQJA 2IVSA 5C4LA 3E63A 2AEGA 4AN9A 5BYLA 3OHTA 3WF9A 3MFUA 1W7HA 3L8PA 2ZAZA 3QZGA 1K2PA 5D41A 4FYOA 2OJ9A 3DFAA 3VIDA 2QD9A 2BTSA 2V0DA 4B99A 4OTRA 3R9OA 5CXZA 4O4EA 3QD2B 4FRFA 3H4JA 2BRGA 4D2SA 1DI9A 4TWOA 3Q2MA 3A61A 4CT1A 3NYVA 3D0EA 3QC9A 5HHWA 2XUUA 3ORIA 5LWMA 3LCOA 4ZSEA 4BI0A 1UVRA 4UWYA 3FMNA 1ZYCA 5TR6A 2XIKA 2ZJWA 4O7VA 3LFCA 4YZMA 4ZJVA 2QO7A 5HG8A 5ETAA 2J7TA 2UZBA 4UALA 5HICA 4D0XA 5B7VA 2IPXA 5CAPA 4CMUA 4D5HA 1RQQA 1PF8A 1PXKA 2BRMA 2F2CB 2FA2A 2PTKA 4MBIA 5CQUA 3RPYA 3ZBFA 1OL7A 3PXKA 4MHAA 2QOOA 2YJSA 2QG5A 3KK8A 4Y73A 4PL3A 5D10A 5E8YA 3R8MA 4EUUA 3V5LA 5IQIA 2ZFYA 4H58A 2IN6A 4BY9E 4A9TA 3ZMMA 2NYAA 2ITOA 4ORKA 2EXMA 2XF0A 1PKGA 2UV2A 4OT6A 4BCFA 2WMSA 4TW9A 4PUZA 4TWNA 5DVRA 3UPXA 5IEVA 4NM3A 3LQ3A 2XRWA 3QUEA 5H3QA 5IH4A 2WIHA 3BE2A 2JC6A 4CGAA 4IEBA 2Y8OA 3UGCA 4BKJA 5FBNC 4F78A 3M11A 4OBPA 5IUIA 2CJMA 4ZY6A 1M14A 3W0NA 1ZMVA 4YJTA 4RIWA 4WD5A 1SVGA 3VS0A 2XKEA 3CEKA 3L8VA 2ZB1A 1G8KA 4MD9E 4QPMA 5CU0A 3DBFA 3TV6A 1PJKA 4TYIA 4FV2A 1XWSA 2LGCA 3FLYA 1SM2A 4KIOA 4QMOA 2OW3A 1W2FA 4J71A 3F5UA 5I9ZA 2J0IA 2VZ6A 3PXRA 3UOHA 4WO5A 3KCFA 3A60A 1Q24A 4Q9ZA 5IDPA 3PVUA 3DV3A 3ZEWA 2PMLX 5BVOA 4FKQA 5EW9A 4EH3A 3GCVA 4FG9A 4J97A 1URWA 4O4CA 2UZEA 3EZVA 2FSOX 2YHVA 3OZ6A 4GUBA 3AT3A 3ZDIA 4UXLA 1FVVA 4NJDA 3KF7A 3V5WA 4A9SA 2HWOA 3FL5A 1MUOA 4D2WA 3VS2A 3ZHPC 1H8FA 5M51A 5GJFA 2XNBA 4BJJA 4CMTA 4EH4A 3QTSA 4LI5A 3AMBA 4F65A 1H25A 3AGMA 1LEWA 2OZAA 3CTQA 4ANLA 3E64A 3NWWA 4NJ3A 3F6XA 4B4LA 2R2PA 3NUAA 5HTCA 5AV4A 3R63A 3K3JA 3ID6C 2IEWA 3U54A 2ITQA 5IG1A 4PNKA 4QP2A 2A2AA 3QLFA 2ONLA 1O6LA 1XMLA 1FMOE 2CPKE 1KE8A 2VTSA 4FSUA 4LRKA 4FMQA 4LDTA 1APME 3WOWA 3VONA 2CGXA 2PVMA 3NAYA 4YZDA 4ID7A 4LM5A 1MP8A 3D7ZA 3POZA 4FKUA 2WTVA 3C1XA 3JUHA 3A7JA 3EN9A 4GG7A 3FI3A 3RHXA 2XEYA 4AOTA 3FI2A 2J2IB 3FL4A 4C57A 1J91A 2ITPA 3E88A 2HAKA 5HORA 4WHZA 3U6HA 5FWKK 1YOJA 4EK5A 2F2UA 4KKEA 4V0GA 2WQNA 4LV8A 5JZJA 1IAHA 4QT1A 2YCRA 4KSQA 4PF4A 3DBDA 4MKCA 4OTDA 3VBVA 2QLUA 4HPTE 4AZTA 4F09A 4FKLA 2GQGA 1BUHA 2JIUA 4KBCA 4B9DA 4QMXA 2PZ5A 3OROA 4M15A 4F08A 5M55A 1M17A 4RLLA 4JVGA 3NFFB 4DTBA 2W1FA 3QCYA 5ETCA 5ACKA 3IK3A 2RFNA 2ZDTA 4G34A 1UWHA 1W2DA 4RSSA 2EUFB 4FIJA 5L8KA 3MWUA 5BUJA 5CALA 4I6QA 4RX9A 3UE4A 5M08A 2FYSA 1OGYA 2XNPA 3QXOA 2GS6A 4ZTLA 1QMZA 3BHVA 1TQPA 3UZPA 3HMOA 5J87A 4XHKB 4KIKB 3AT2A 2P2HA 2QLQA 5BYYA 1KSWA 4LGHA 5D12A 3GEQA 3HEGA 3GCUA 3TCPA 3W0MA 4RVLA 3NUPA 3PPKA 4J8NA 5HE3A 2YIXA 3R01A 4BBMA 5AR4A 3L1SA 4ALUA 4IM2A 4XV3A 3IECA 5LXMA 2X8IA 5GZ9A 1P4FA 3U8WA 3W0QA 1JKSA 4ALWA 1U5QA 1G3NA 2WMUA 4RC4A 3R9NA 5BMSA 1CTPE 2FVDA 4AZWA 3DJ7A 4USDA 4A4LA 4IB1A 4AGWA 4AZSA 4ZK5A 3DLSA 3DAJA 2C5OA 1UU3A 2X39A 4TYJA 3NCGA 5C27A 5HD7A 5CEIA 5KKRC 1JBPE 3PLSA 1T46A 4LL5A 1XH7A 4X6RA 4EUTA 4N4SA 4L00A 2FSLX 1Q3WA 2I0VA 3FKOA 4RT7A 2GNGA 3WF8A 3UPZA 3C4XA 1YDRE 3Q5IA 4FZ7A 3MH1A 5E8TA 5EHLA 5AR7A 2C6LA 4FKSA 5DEYA 5IU2A 2ITWA 4A7CA 3PUFC 4D1XA 4QYFA 4IAYA 2I1MA 3LKMA 2EU9A 4KB8A 2JKQA 3HYHA 4OAVB 2UW7A 3QRJA 4IC8A 1DAYA 5HTIA 3F2NA 1ZOEA 2UVZA 5F94A 3FMKA 3GCSA 1FMKA 1HOWA 1MQ4A 5ANOA 5AR5A 5J95A 3RNIA 3RPRA 5I9XA 1IG1A 5AR8A 4BDGA 1U54A 4WNOA 3ZSGA 3UQFA 5IEXA 3PDTA 1YHWA 3EQBA 5EQYA 4FUXA 4BCIA 1UNHA 5KE0A 2VO0A 2YM4A 2J0JA 3QQFA 4L46A 3TTIA 3UP2A 3FHIA 5CSWA 3FC2A 2WMBA 3BV2A 4FKIA 4FVQA 4Y95A 2BFYA 4IB3A 1DI8A 3RBWA 4X2KA 4BRXA 4Y72A 5GJGA 3Q5ZA 2C5NA 3DOGA 1GZOA 1Q61A 4FK6A 4IAAA 5D7VA 5DFPA 5JH6A 3COHA 5LMKC 3UDSA 3MIYA 1QL6A 1JSUA 3IW7A 4C4GA 3QGWA 5CEOA 2XNGA 5HLWA 2WKMA 3QKMA 2B1PA 3BRBA 3QQLA 2O5KA 4IWQA 1V0PA 3R7VA 3TYKA 3D9VA 5JKGA 4RJ4A 5ANEA 3O5AA 4E6CA 1VYWA 2KTYA 3I0OA 4L3JA 4EOKA 4FEWA 3BWFA 2EXEA 3AD5A 3ETAA 5CVGA 3LXPA 4DFYA 1PXLA 3TDWA 4O7ZA 4BCNA 2GQSA 1M2RA 3CGFA 3V04A 3GC9A 3SVVA 4JI9A 4O83A 3OBGA 1XBAA 2C30A 2QOIA 1V1KA 2YEXA 3BV3A 5AP4A 3OD6X 5B0XA 5L8JA 3H10A 5AX3A 2JDRA 5DT0A 3BPRA 4I6BA 4DG3E 3PY1A 3FZ1A 1HCKA 4JDJA 4CD0A 3PP0A 3L8SA 4PQNA 4CVAA 2I7QA 1B39A 3D7TA 3QZIA 4GKHA 3CP9A 3HV7A 1KOAA 1ZY5A 4MXYA 5LVLA 3UOLA 4YJPA 3GC0A 3BX5A 2HZIA 4I4EA 5CSPA 4O7YA 3UC3A 3AC8A 4QTEA 2BROA 2V62A 2YIRA 3S2PA 3UG1A 2UZOA 4J53A 4PMMA 3C5UA 2HENA 3P9JA 4U0IA 4EYJA 3HMPA 3R9RA 3RK5A 2JBPA 4U45A 1MRVA 3A8XA 5HVYA 3VBXA 5J79A 3TT0A 3LXLA 4EC8A 4OTQA 1KE9A 3LCDA 3HVCA 4FV7A 1FPUA 4IWOA 2R3NA 4YJSA 1F3MC 2OJGA 4F0IA 3VO3A 1J1CA 4JRVA 4E5BA 3LOKA 4CG9A 4RX5A 2XANA 1GJOA 3NX8A 3W0RA 1ZYDA 1AD5A 4W9WA 5K4IA 3PPZA 3QZFA 4X0MA 3A62A 5HCXA 1Q99A 3R2BA 4K33A 5EHYA 3TV4A 4FSZA 3Q6WA 4CXAA 1QPCA 2JFMA 1R3CA 4ERWA 3E7OA 4YSJA 5C26A 4K8AA 4YTIA 1ZMUA 4IVDA 4O0TA 4C4IA 2R3LA 4DCAA 2ZV9A 3E3PA 3FBVA 3QQHA 4FSMA 4RVMA 5C8NA 1Y6AA 4LV7A 4FSNA 4ZMFA 2XK9A 3LJ0A 2WQEA 2HW6A 2F4JA 4QNYA 5HD4A 2QO2A 4YTFA 4NM0A 3OXZA 4R7BA 4Q9SA 4HOKA 4Y46A 3T8OA 4CTBA 5M44A 1IEPA 4I0TA 4BGHA 2PU8A 3G6GA 3NS9A 1W83A 3GFWA 1IASA 3NYOA 4QTDA 3F5GA 3RNYA 4II5A 4LRJA 4N6ZA 4B8LA 2O63A 3CPBA 1OBDA 1I44A 2BDWA 4HVHA 5HIEA 3BWJA 2PK9A 3E93A 3Q32A 3NMUF 2YACA 3U55A 4IZ5A 5FDPA 1R0EA 3MY0A 2IJMA 3VS1A 3W2CA 4AF3A 4JAJA 3HDNA 1K9AA 3H0YA 4C02A 1A48A 1YRPA 1XR1A 1PYEA 2F57A 3EN6A 4WBOA 3ZM4A 4DEGA 2W4KA 3OUKA 1GNGA 1KV2A 2W5HA 2QOLA 5CY3A 4TT7A 4YTCA 4HYIA 4BDHA 1IA8A 1UWJA 3RCDA 3VS4A 3EH9A 4ZTNA 2NO3A 4F1TA 3BI6A 2VUWA 2CCIA 5H8EA 2PE0A 4G9RA 4GEOA 5IQAA 4M97A 3ZLYA 3TN8A 1F0QA 3RWQA 2WEIA 3KCKA 3EOCA 2C5XA 3DBQA 5HO7A 4JLCA 4JRNA 4F4PA 2CKEA 4FIGA 1QPEA 4EQUA 1IAJA 4QP3A 3C9WA 2VTLA 2X0OA 1ZYLA 2F7ZE 2YM8A 2EWAA 3KULA 2YERA 4IDVA 2Y6OA 4RWKA 4ANQA 2VU3A 3I4BA 4AX8A 4QMZA 3EJ1A 4BIDA 4ZSGA 2OKRA 4FEUA 2C3LA 3KY2A 3COMA 1X8BA 2WTIA 4MX9A 4IJPA 2G9XA 5BQ0A 5AUXA 1Q97A 5AM7A 3FC1X 3GT8A 5HOAA 3OVVA 4HYSA 4G2FA 1NVQA 4IXPA 4ZTHA 3ZSIA 1S9IA 3F66A 3BEAA 3R0TA 5ANGA 3AC4A 4C8BA 4DEAA 5HX6A 3R00A 2XIZA 3I7CA 1YXSA 3FSKA 1YW2A 2GNJA 3TNPC 2WOTA 3HP2A 3AT4A 1DS5A 2BFXA 3IDPA 4KBAA 4W4YA 5DRBA 4RA4A 4UBAA 4RIYA 5KZ0A 3M42A 4BF2A 3RAWA 1U4DA 2CGVA 4IFGA 3BU5A 2BIKB 4OBOA 2O3PA 2ZM4A 3U87A 4NM5A 5AWMA 4R7HA 2WMTA 2FH9A 3CCNA 1QPJA 2YA9A 3R28A 2XBJA 4PPAA 4RRVA 2HZ0A 5AADA 5G6VA 4QMMA 5E1SA 4RJ8A 5JSMA 4DF3A 4L7FA 4U6RA 3OMVA 2J5EA 2VWUA 3EQRA 4O7TA 4WNMA 5CAQA 4KINA 2W96B 5E9EA 4P5ZA 5E8SA 5A4QA 5KHWA 3KXXA 4I93A 4BDAA 2UZUE 4MNEA 4G6NA 4RQVA 4KAOA 2V7OA 3MJ2A 2QOQA 3EQDA 1OMWA 4KNBA 5E8VA 1Q5KA 4FKWA 4DLJA 3P7AA 1CM8A 4CNHA 4MEDA 2H34A 5LMKA 3S00A 4RIWB 1ZZ2A 3NW6A 2OI4X 4YGAA 4U42A 4F9AA 2BKZA 2WZJA 1UU8A 5A14A 5EOBA 5LVPA 4N70A 3CY2A 1URCA 3QWJA 2H9VA 2HCKA 1WBNA 3IOKA 4BWXA 4S32A 2BTRA 2HY81 1VZOA 3F82A 4F9YA 5CU2A 3HAVA 4G1WA 3OOMA 5FM3A 4ZZMA 4AZVA 3UNZA 4AQKA 3LPBA 2PE1A 2VTAA 4E5WA 3MV5A 5TOZA 2JDTA 4LL0A 4WNPA 4I6LA 1OI9A 4GRBA 4IZ7A 1GAGA 4TYHA 1XBBA 1HCLA 2Y7JA 4GYGA 3QQUA 2IZUA 3VUTA 3MPMA 5KMOA 1XH9A 4KA3A 4OBQA 3MH0A 4DGOA 2RG6A 3CXWA 2CMWA 4JT3A 4ERKA 3SKCA 3VQUA 2C0IA 1G5SA 3Q3BA 3QD0A 4C38A 4E26A 4EC9A 4L52A 5KMKA 1KUTA 2WB8A 4BJJB 1YWRA 4K0YA 4TPTA 3PVGA 3E92A 4AGDA 1TVOA 4EBVA 5KX8A 2OZAB 3UTOA 4DBNA 1XKKA 2PVRA 2GHGA 3LVPA 4IZYA 4CFNA 3D4QA 3NZ0A 3R7GA 2NNWB 4OUCA 5BYZA 4EKKA 3EQIA 3TKIA 2ACXA 2HK5A 2VRXA 4RGJA 4UXQA 2CNUA 3SG8A 5IQFA 4KWPA 3EYHA 3NIEA 3JVSA 3RPSA 5JFSA 3BHYA 1PMEA 4IVBA 3FKLA 3W8QA 5CF4A 3GU5A 1TQIA 4ZY4A 4IX3A 3OTUA 1ZY4A 4CLIA 5CAOA 2CN5A 2OFVA 3FY2A 3G90X 2PE2A 3MVLA 1YOLA 2RL5A 4FNYA 3W2QA 1OM1A 5KMMA 3FEGA 3FJQE 3FZRA 4PRJA 4R3RA 3R22A 2ZOQA 4JBQA 4ZTMA 1FGKA 3FHRA 1WVWA 1PYXA 3QUDA 4R5YA 3F3UA 4YZ9A 3THBA 1W2CA 4R5SA 2RFEA 3KVXA 4EOQA 2J0MB 3KF4A 3SXFA 1OPLA 3IS5A 3ZO4A 4DHJA 5CI6A 1PMNA 4A9RA 4BDJA 2VWWA 4FIFA 4BWKA 3PZHA 5AV0A 3U51A 4F1OA 1ST0A 3W10A 4E73A 4V0GB 4XG3A 3OCTA 5JN2A 5JEBA 2VWXA 2YCSA 2VV9A 4IWPA 4Z9LA 4G5PA 3FQEA 4V05A 3MFSA 1YDSE 5IKWA 3TIYA 4ACGA 4RX8A 4PNIA 3KXHA 1Z9XA 4PMPA 4BCPA 3EQGA 1H00A 2XYNA 2I0YA 2QHMA 4XCUA 2PMOX 3UVRA 4APPA 5CVHA 2I0EA 2KULA 3LCTA 4D2PA 1O9UA 1Q8WA 1YI4A 4AS0A 3SW7A 4FEVA 3E7VA 4N6YA