1GOLA

Coordinates of rat map kinase erk2 with an arginine mutation at position 52
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
357
structure length
357
Chain Sequence
AAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIRKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords EXTRACELLULAR REGULATED KINASE 2
publication title Mutation of position 52 in ERK2 creates a nonproductive binding mode for adenosine 5'-triphosphate.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 110
structure length 357
sequence length 357
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 1996-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1golA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1golA01
5K5XA 2BDFA 4PMMA 5GNKA 2IZRA 4LOQA 3T3VA 5L8KA 3A4PA 5CYIA 5JFXA 2B55A 3KCFA 4M69A 5FRIA 5M55A 1JQHA 4UX9A 3RPVA 2R9SA 3LQ5A 3NUXA 4PDPA 4BDFA 4D1XA 4W4VA 4EOSA 4UYAA 2WQOA 2YITA 4IC8A 5JT2A 4FV0A 4FKSA 1GZKA 4RRVA 3ZH8A 4O7ZA 2ITPA 4D2PA 1RJBA 3S2PA 4C35A 4X3JA 3OWKA 4DN5A 3U54A 2C47A 2WAJA 5G6VA 2WPAA 4CTBA 3ZBXA 4MX9A 3QTSA 1V0PA 4QP6A 4RA4A 4FMQA 4G5JA 3AC3A 3P0MA 4MTAA 4PNIA 3W2OA 2YZAA 4F6UA 4AWIA 5CNNA 2UW9A 3D2IA 3VUHA 4F0IA 4CVAA 3VUIA 2YABA 2A2AA 5D10A 4ID7A 4C8BA 2R3GA 4C4HA 2XCKA 2IO6A 3KRWA 4FNXA 3ZO2A 4AN9A 2YLFA 4U79A 3R7VA 4YP8A 5JSMA 3D5VA 3QYZA 4IWOA 3CQUA 3Q32A 4RX7A 3RCJA 3RWPA 4AGWA 1W82A 2GTMA 3ZLWA 4ANNA 4X6RA 3HX4A 1SZMA 4U44A 1T45A 2R4BA 2ITVA 5CASA 3A4OX 3DBDA 4FSYA 2ZOQA 1XH4A 3OVVA 3KXMA 3RPYA 5BYLA 3LCKA 5EFQA 1JKLA 2CDZA 3V8SA 3Q4ZA 3EQFA 3MH2A 3UO5A 4RSSA 2ZB0A 3TDWA 4FZFB 1OKVA 4HJOA 4EJNA 5LVOA 5M4CA 2CSNA 3FZ1A 4TNDA 3UYTA 1M52A 2WHBA 1PXMA 3P08A 4EQMA 4YBJA 2H96A 4PTCA 5GZ9A 4ZZMA 4D5HA 3WILA 3ACKA 2WTKB 2W9ZB 4ZLOA 5CF8A 3R0TA 2RG6A 3N4TA 4U81A 4CFMA 2UW7A 4CFVA 1JKTA 4BCKA 2QOCA 2YM8A 5HLPA 4AZVA 1Y8YA 3JXWA 4I1ZA 5EOBA 5E8VA 4C57A 4O7SA 4K8AA 2CN5A 4XH6A 4EQUA 5IU2A 2OF2A 2WTDA 1IAHA 4ZMFA 5I5ZA 3ZUUA 3N4UA 2RFSA 3NS9A 4PPAA 5J1WA 4B8LA 2VWXA 1BX6A 4G3CA 4CTCA 5JQ5A 3ATSA 2BTRA 2A19B 4DFUA 2B54A 4ORKA 5CF5A 5A54A 3EZRA 5A4EA 4RJ3A 4OT6A 3R21A 1ZZ2A 3P9JA 3MS9A 3A62A 1KE9A 1YHSA 3OOGA 4N6ZA 1P4FA 3V3VA 3BPRA 3Q3BA 3ZLSA 3S1HA 2R3KA 3A7IA 3GEQA 3DLZA 4MD8E 3HUBA 4O96A 3VN9A 4E73A 1GIIA 3SLSA 1GJOA 3F3WA 1HCKA 4LV8A 5EI2A 1UWHA 5IA0A 2DQ7X 4NK9A 2C5NA 2NP8A 4YTFA 3SG8A 5CAVA 5KZIA 1APME 2OJFE 3GC9A 3NWWA 4H1MA 4FKTA 4EOQA 4DCEA 5HVKA 4ARKA 3OP5A 3QX2A 5I9UA 2C30A 3VBQA 4FTAA 5JQ8A 3FY2A 2C69A 3QC4A 1SVEA 4EK5A 3AMBA 4AT5A 2WNTA 4U3YA 3TV6A 4UMTA 3OOMA 3SDJA 1DI9A 4N0SA 1OIYA 4K77A 5AP5A 5L2WA 2VTTA 3I0QA 4X21A 3HZTA 3FHIA 3U4WA 3MB7A 3GC8A 3RI1A 4EK8A 5A9UA 3P79A 4KNBA 4PNKA 3PWDA 1H26A 2ACXA 3EFJA 2FO0A 4DEEA 5JRSA 4ZMEA 4P7EA 5L2IA 4XOYA 3OTUA 4JVGA 1H07A 5AP6A 4DGGA 3NEWA 3KF4A 1URCA 4JDIA 3GU7A 4DGNA 3P86A 2WTVA 1M2RA 4O2PA 4MKCA 3QQGA 4PMTA 4CXAA 4ACHA 4YTCA 3FXZA 3FZSA 5E9EA 3D5WA 3FMHA 3O2MA 3G33A 5C9CA 4EZ5A 4X2JA 2OJJA 3GU4A 3L9MA 4EEVA 1J7LA 3DAKA 3IDCA 4MYGA 4LG4A 5J79A 1E1XA 1OI9A 4FTUA 4TY1A 1W83A 3CQEA 2F7XE 5K4JA 2C6OA 4L42A 4O7LA 2YAAA 1SNUA 3BU5A 4KIKA 3JVSA 4XUFA 4YPDA 3N9XA 3NYVA 2VTSA 3DK7A 5HKMA 3L8SA 3BBTB 3A7GA 1CDKA 3DTCA 4W8DA 5CQWA 5AM6A 2QO7A 3ZUVA 4C62A 4F7NA 2YM3A 4F9CA 2OFVA 2V7AA 1H01A 3QXOA 4FIGA 1WBPA 3U6HA 2X39A 3UZRA 2RIOA 3EYGA 2PVKA 4GUBA 3EQHA 4GIHA 3HV4A 4L68A 3IOKA 2IZSA 5HESA 5K3YA 5I3OA 5LOHA 2P0CA 1FQ1B 2GPHA 2JFMA 1YWRA 3BX5A 3AXWA 3ZDUA 4F63A 4V01A 5LVNA 3PXFA 2C6LA 1ZYJA 3KN5A 3TM0A 2W1DA 3FKOA 5HGIA 2HIWA 3BU3A 5T3QA 4BBFA 2BPMA 3U4UA 2HXQA 4ZTHA 5CF4A 2W4KA 4IVDA 2WD1A 4O81A 4OGRA 4U97A 5DGZA 3LLAA 2PTKA 4R3CA 2JIUA 5HE2A 3WE8A 4QPSA 4AUAA 4JS8A 3HV6A 5AX9A 4DHFA 2PULA 2WZJA 4FV4A 3DKOA 4GT4A 3F5GA 4K6ZA 4R7IA 3WOWA 3B2TA 1OKZA 2E9NA 3PXRA 4UMQA 5CENA 5HBJA 4KIKB 4Z7HA 4U9AA 4I21A 2ZM3A 4D2WA 3ZLXA 3PG1A 4GW8A 5C8MA 3AGLA 4CV9A 3OEFX 1SVHA 3BE2A 4EWQA 3BZ3A 4QP8A 3PYYA 2I40A 2X4ZA 1ATPE 4W4YA 2VWVA 4LMUA 3PVWA 4J71A 3R1QA 5BVDA 2XJ2A 3GUBA 3PY3A 4X2NA 4RZVA 5HNBA 3Q4UA 1Q24A 4NCTA 4KBAA 4L43A 4O0WA 4MNFA 4EH8A 2XMYA 3CGFA 3FHRA 3RBWA 2XK7A 3ENMA 3R9DA 2B4SB 4IM3A 4YNOA 2IWIA 2JGZA 2F2UA 3JS2A 4F70A 4X2FA 3CKXA 4EI4A 4BTFA 3MWUA 5LCJA 4J52A 1OZ1A 5EDPA 4TN6A 3ZM4A 4QMOA 5KBQA 2IZUA 1ZYLA 3AOXA 3BHHA 3KEXA 5IF1A 3TXOA 3W2QA 2XIYA 3BWFA 3R7OA 3II5A 3VW8A 5KMMA 3DB8A 4HNFA 4YZCA 3UGCA 2OXXA 2XM8A 3OS3A 3F69A 3LJ2A 4MXZA 5L2QA 4B6LA 4RWIA 4QNAA 3Q60A 3Q9YA 3QZIA 1S9IA 4G1WA 4F7SA 4P2KA 1SMHA 2JDVA 1YXXA 2CPKE 2GQRA 4LGDA 4B99A 2UZDA 4X0MA 1YHWA 2PVJA 5C1QB 2EVAA 1P4OA 2R3IA 3QQLA 5D12A 4K18A 5E1SA 5DVRA 1V1KA 4BCMA 4O0TA 5EQYA 2VO7A 4PWNA 4H3QA 3EQPA 2X2MA 3LFDA 4M97A 4AW5A 3DXNA 5IUIA 4BB4A 3KL8A 4W8EA 3OHTA 2A4LA 5DEWA 5AFVA 2X81A 2BRBA 1H1SA 2Y6MA 4M68A 2CNUA 4GU9A 4QT1A 3NUUA 5HHWA 2JAMA 2JD5A 4GK4A 4Y83A 3TJDA 4G16A 1S9JA 5L8JA 3BV3A 5IQCA 4ASDA 3KY2A 4TWCA 3TNWA 1OKYA 4CSVA 5H2UA 4JBPA 2OSCA 2VX3A 1FMKA 3CJFA 4ZTRA 1XKKA 3CE3A 5HG5A 1MUOA 1XH5A 1MQ4A 2IVSA 4PL4A 4QYGA 3WI6A 1Q97A 2VGOA 3G5DA 2F7EE 3P7CA 5EW9A 4QTEA 1E9HA 3E93A 5J5TA 4FKLA 3QZFA 2G15A 4KBKA 3W18A 4BN1A 4YO4A 4AP7A 3UODA 5LJJA 5FM3A 2XEZA 1A48A 4I0RA 2Q83A 3B2WA 3NRMA 5I4NA 2PUIA 5DNRA 4FEWA 4M13A 5AA8A 2O65A 2HYYA 2UW0A 2GNFA 3PWYA 3C51A 4NZWB 3F7WA 4XP2A 4DFNA 2XCHA 4FIHA 4AGDA 5F9EA 4WNPA 2UZUE 3CXWA 1ZWSA 3PE2A 4I94A 4KKGA 4MCVA 1B6CB 3D15A 3OBGA 4UALA 4A9RA 2R3QA 1VEBA 1UA2A 1B38A 3H0ZA 4EKKA 4PUZA 4NU1A 2WQNA 1DI8A 3UIBA 4IW0A 4PP7A 3OCSA 2WQMA 1FBNA 3SW7A 2ITOA 5TKDA 3CJGA 1PHKA 1XH6A 2GCDA 3CS9A 3KCKA 3O51A 3PE1A 3Q9ZA 3R01A 4QOXA 4TWPA 4JIAA 4XBRA 4BHZA 4YZNA 5DE2A 2YZLA 5HIDA 5D1JA 3PA5A 3RTPA 4FKGA 3VRYA 3OFMA 3UJGA 1MP8A 4UV0A 3TG1A 2ZVAA 3IW5A 3DU8A 4O38A 3VQHA 3OXTA 1UNLA 5HE0A 2CGVA 3T3UA 3QLGA 1R39A 3RCDA 4BKJA 5DWRA 4DG0E 3V5WA 1H0WA 1RE8A 5EHOA 1GY3A 2UW4A 4GYGA 4FVRA 5TO8A 3UQGA 1OKWA 2B1PA 2YCRA 1G8AA 3P23A 4EH2A 3HRBA 4NM3A 4RVKA 2G2HA 5IQDA 4ZIMA 2BZIB 5FDXA 2F4JA 1Q8ZA 3F3UA 2F2CB 4EQCA 4YURA 5G1XA 4R6VA 5HU9A 2GS6A 4ERWA 2J4ZA 3T9IA 1XJDA 4J8MA 3U6JA 3VWAA 2ZV2A 4ZJJA 3FYJX 3BEGA 3OT8A 5AV0A 5HU3A 2OGVA 3D5UA 3GU5A 4G9CA 2PSQA 3TEIA 5E8TA 1J7UA 2WELA 3PA3A 4IWQA 4CZYB 4EKLA 4DINA 4HVIA 4ZAUA 4H05A 2ERKA 2OH0E 4Y73A 4XG7A 3RGFA 3WE4A 4AOIA 2W06A 4YHFA 4CKRA 2UW5A 2IG7A 2YAKA 5GJDA 2CLQA 3R9OA 2GFCA 4FI1A 2XRWA 3UO4A 3UMWA 3QCXA 4RQVA 4BDEA 4EOJA 2JIIA 3G15A 3SOAA 3K5UA 4L52A 2IJMA 3FLSA 1JWHA 3OY3A 2OIBA 3W8QA 4ASXA 2XK6A 2W1IA 3TZ7A 1ZARA 5I3RA 4A9TA 4JG7A 1PXPA 3OD6X 5FM2A 4RIWA 4I23A 5ACBC 4WUNA 3RAKA 2H9VA 4QMTA 3ID6C 3H9FA 5FBOA 2B52A 5IA2A 5IQIA 3R83A 1KUTA 3WYYA 3LLTA 3PA4A 3MJ1A 4YJPA 5H8EA 5BQ0A 4ZXTA 1HCLA 2VWZA 5HTCA 3DOGA 4ZS0A 3PSDA 5AUUA 3K2LA 4JXFA 5JFWA 2C5YA 3UNJA 2WTIA 4GV1A 4DGLC 5CAPA 1OL6A 2JDTA 3RALA 4UZHA 4KB8A 1JBPE 3QRIA 5CVGA 4YSMA 2P4IA 3LAUA 4FTKA 5EDQA 4MXOA 1K2PA 4KKHA 4FYNA 4K9YA 4FC0A 3UG2A 5M07A 4XJ0A 4F9AA 2W1EA 3K54A 2XM9A 2F9GA 3LMIA 3SQQA 3FC1X 2WIPA 3KB7A 4GSBA 3UVPA 2OBJA 2XVDA 2XK8A 4NCTC 1XQZA 2HY81 3GP0A 4D55A 1UU8A 4JIKA 3V5PA 4EOIA 4YC8A 4WO5A 3HUCA 1JKSA 4DH5A 1ZOHA 3EL7A 3F66A 1VZOA 3QTWA 5J9LA 4YTHA 5FUTA 2I1MA 4ENXA 4FSRA 4YJNA 4FK6A 2Z7QA 3CC6A 4MBIA 2BFYA 3GU6A 3ORTA 4KIOA 5EI6A 5EW8A 4EC8A 5DMZA 2C6MA 4YUQA 5EHLA 1Y8GA 3NAXA 4CGAA 1BYGA 2QONA 2I6LA 2B9HA 4FG9A 3ROYA 3GI3A 1LEWA 3G0FA 4UEUA 2XK3A 3QAME 4K1BA 4FZ6A 2QCSA 4IVBA 4NYEA 5E8ZA 3E87A 4E4XA 2XIZA 3F3ZA 2Y9QA 3VBYA 4C4JA 4ZZNA 1J7IA 3P7AA 1MRUA 3PVUA 3ZXZA 2C5XA 4IZ5A 1PKGA 5E8UA 4QYYA 3T9TA 2W17A 3C4ZA 4R78A 3ALNA 4EZ3A 5ANEA 2BILB 5C27A 4MWIA 2OH4A 4QQ5A 5CNOA 5GIOE 1DM2A 3R02A 2WMXA 3W2PA 3QTXA 5IUGA 3SG9A 2O5KA 3HLLA 5E8YA 2WU6A 4QMWA 2CGWA 4RBLA 2J5EA 4RJ4A 2P55A 5AA9A 4FT5A 2VO0A 4YLLA 4CQEA 2X8DA 5AIKA 3ULIA 2QR7A 5HORA 2ZM1A 2WOUA 4LRMA 5HO6A 2C1AA 4FKQA 4L46A 4EOPA 4HZRA 4U6RA 2OXYA 3AT4A 4FIEA 2WB8A 4TYEA 5JGBA 2PVHA 5M53A 4AE6A 3UZPA 4D4VA 4FTMA 2BAJA 1REKA 2VTRA 3OCBA 3C4EA 4XYFA 3K3JA 5EH0A 2R3MA 4CEGA 3PXQA 5A6NA 3TUBA 4ZS4A 3MTLA 3R71A 3PJCA 4X2KA 2QOKA 3Q2MA 3QGYA 3CY2A 5EW3A 4Z3VA 4A9SA 4Q5EA 2WQBA 3PRIA 4LYNA 1WBNA 4S31A 4EZ7A 5I9XA 3MBLA 5I0BA 1FINA 4U3ZA 3SVVA 2XKFA 2RG5A 2R7IA 3MH0A 2PMIA 3HKOA 3UOLA 4TZRA 3UO6A 1SM2A 3VS7A 5F94A 2QR8A 3NLBA 1OIUA 4XLVA 2OK1A 3ZC6A 1YOJA 3QA0A 5BUEA 4EH5A 4IZ7A 3LCSA 2ZB1A 2NRYA 3P78A 4UXLA 3FLWA 4JL9A 5H3QA 1QPJA 3ZS5A 3P1AA 3SGCA 3DS6A 1R0EA 4BWKA 3HYHA 5A4TA 5HX6A 3C4WA 1AD5A 4L01A 3TTIA 5D11A 3MA3A 1Q61A 4U42A 2BHEA 1XH9A 3NUPA 3NUSA 1PYEA 2W4JA 3PLAE 3DFAA 3IQ7A 1FOTA 5IISA 2YCFA 3QQUA 1Q4LA 1QPCA 4GG7A 2OJIA 3QQFA 1UNHA 1VYWA 4YC3A 3PTGA 3IONA 4IM0A 1RDQE 4DTKA 4C4IA 1H8FA 5E1EA 2BALA 2W5HA 4G2FA 4OTQA 4DT9A 2VX1A 2V55A 5HCXA 4E4NA 5B2LA 3G9LX 3TUDA 2X8IA 5CI7A 2PZYA 1K3AA 2QLUA 4APCA 1JSTA 4RPVA 3TNPC 3FI2A 2UW3A 3R7GA 5M4FA 5JH6A 1FVVA 1UVRA 2EWAA 5ANDA 3C1XA 4KBCA 3DGKA 1FVRA 2YJRA 2GQGA 2PK9A 3RZFA 4D2SA 2ETKA 4QNYA 3PY1A 2CNVA 4JI9A 4FF8A 1O6LA 3M42A 4RFMA 3FDNA 4BL1A 3OWJA 1YQJA 3KFAA 3PPZA 3QTQA 1YOLA 1FVTA 3HMMA 1YWVA 3UBDA 3FMLA 2XIXA 5ETAA 3E62A 2JLDA 4WBBB 4CCUA 2P2IA 4FZDB 2BRNA 4BI1A 5J9ZA 1NVQA 3RM7A 3BGZA 3BYOA 3PPKA 3G90X 3P7BA 5K9IA 3LPBA 5FGKA 3MH3A 3V8WA 3NAYA 5CT7A 3EB0A 3FSFA 4W4XA 2YM5A 4AOJA 4ZJIA 2B9IA 4CNHA 1BLXA 4L67A 1OECA 4FKRA 4RFZA 1NA7A 5J8IA 4R3RA 4CFXA 4AFJA 4RMZA 2OZAA 4FV1A 4IMYA 4J99A 4RX8A 2BROA 3R1NA 5AUWA 4NW5A 3S4QA 4XX9A 2WTJA 5CLPA 4WOVA 5GINE 3QUDA 4OAUC 2V62A 3UC4A 4C61A 4DFBA 4C3RA 3MFSA 3F9NA 1KSWA 4FBXA 1J91A 1PYXA 3DJ7A 5JGAA 5C8NA 4QYEA 2BVAA 3LJ1A 2XK9A 3Q4CA 1UKIA 4YZBA 3BHTA 3I5ZA 3BYSA 3HV7A 3KQ7A 4FTJA 2Z2WA 2ZMCA 2R3OA 2CNQA 2IVTA 3D4QA 4UB7A 4A7CA 1U5QA 5FLFA 4D9TA 3ENHA 3L9LA 3TDVA 1AGWA 4E5WA 5AR4A 4RWKA 4PF4A 2C6KA 3KXNA 4E5BA 5BVNA 1LP4A 1ZMWA 4C7TA 3U8WA 2E9PA 4I20A 4L00A 4O0RA 1VR2A 3AD5A 5K5NA 1XHAA 3UQFA 1IASA 4M0ZA 2VV9A 3TI1A 1P14A 2CKOA 3W1FA 5EKNA 4HYUA 5CSVA 4FKOA 3W2RA 2VTAA 3R8PA 3ELJA 4EJ7A 1BI7A 5BUJA 2GNGA 3C0HA 3RPRA 3NIZA 5M44A 4NTTA 3FI4A 3E3PA 4NUSA 2X6DA 2OZAB 3CIKA 4IDTA 4M8TA 5F4NA 4FICA 2C6DA 2H34A 2HCKA 3FC2A 3R73A 4RVMA 4IFGA 4BDDA 2QOFA 4DBXA 3KXZA 3JY9A 1H24A 4MK0A 1NVRA 4GYIA 4FTNA 5CS6A 3RAHA 1Q8YA 2QVSE 4AG8A 4IFCA 4CV8A 3NMUF 4ZTNA 4C4EA 4XV1A 5LQFA 3G9NA 3GFEA 4MH7A 4M69B 3TTJA 3ZONA 3OW4A 2VAGA 4EK6A 2OXDA 3KMWA 4DG2E 3QRTA 3EN4A 3W32A 3UPZA 4GS6A 4WD5A 4ONAA 1GNGA 4L6QA 4QP1A 1AQ1A 4Y5QA 3DTWA 4MQ1A 4Q2AA 1G5SA 1W98A 2R3FA 4AN2A 4D2VA 4FZ7A 3GCQA 3ANRA 1DAWA 4MXAA 4E4LA 4GJ2A 4HYHA 2QKRA 3FQHA 3QC9A 3DQXA 5J1VA 3EN6A 1JLUE 1G3NA 3FI3A 1R0PA 3DKFA 2J0MB 4RC3A 4ACDA 4F9YA 1WVXA 3QKKA 3CPBA 4FL2A 5KMKA 3HL7A 2OG8A 1OL7A 2XF0A 4RT7A 5FP6A 4EONA 4FEVA 5DLSA 4TPTA 3H0YA 4QMQA 1L8TA 2OLCA 4II5A 2CGXA 1ZAOA 5KZ0A 2YHVA 4BIEA 3CPCA 3BU6A 2HW7A 3HNGA 3UTOA 4C33A 4OTPA 4BBMA 4CMUA 4XV3A 3THBA 3TT0A 3R22A 3TJCA 5AUTA 2WEVA 5BMSA 4JQ8A 4IB3A 4PPCA 4XG6A 2X2LA 5GZAA 3RWQA 1NXKA 3ITZA 4ITHA 5IA3A 2R3LA 3NX8A 4GEOA 3UYSA 2EB3A 3PJ3A 3MIYA 4PV0A 5DH3A 2O0UA 5EG3A 5DT0A 4O1PA 4DAWA 4CFNA 5EOLA 3UVQA 4CLJA 1F5QA 2IZTA 3DCVA 4LRKA 5FD2A 3ZZWA 2VTMA 3GBZA 2CCIA 3WARA 4F0GA 4FKUA 1JOWB 2P33A 3FWQA 2E9UA 3QKMA 3QU0A 4ITIA 4DFYA 1G8SA 4LM5A 4RC4A 5JGDA 3LM0A 3IPHA 4BI0A 3V01A 3A7FA 4TRLA 4GKIA 1ZYDA 2C6IA 2QOQA 3OCGA 5FQDC 5DFPA 4F7JA 5HZNA 3FBVA 2OJ9A 3POZA 4FNWA 4FUXA 2H8HA 3GCUA 1QPEA 3ZRMA 1TQIA 2BAKA 3KXXA 4Y95A 3TV7A 1RQQA 3W2CA 2VRXA 4E8AA 2EB2A 3VS0A 3RK9A 3FL5A 4MAOA 3CTQA 5CAQA 3DBFA 4I5MA 5AR2A 1XWSA 4RFYA 4AS0A 1A9UA 1WMKA 2W9FB 4A4OA 1UWJA 3V51A 4GKHA 4IJ9A 4QQTA 2CKPA 3I60A 3TWJA 5CZHA 3KREA 4LI5A 4CG8A 5CZIA 2YCQA 2PMNX 5J5SA 3BI6A 4EHGA 3DT1A 2PZIA 3HA6A 3FMJA 3NYOA 3QBNA 1STCE 5AP7A 4ANLA 5CSPA 5ANGA 4CMOA 2X2KA 4YR8A 4R8QA 5FTOA 3KVWA 4DEAA 2IPXA 3H9OA 3DBEA 3LFAA 2X4FA 4QRCA 4ZEGA 3RNIA 3V8TA 4I6HA 3JY0A 2ETRA 2G9XA 4OTRA 3E8CA 3S95A 3HECA 5C8KA 2BFXA 5IQFA 5TF9A 4RC2A 5LMBA 1K9AA 4O6LA 4BZNA 1CTPE 3MFUA 3L8XA 3O7LB 5HBEA 5AV4A 2F57A 3A7HA 3TCPA 3PIXA 3G2FA 5HG8A 2XP2A 2E9VA 5DI1A 4G3DA 2AYPA 1ZZLA 5L2SA 2DYLA 1M2QA 2HK5A 4OTWA 4IZAA 1OB3A 2CHLA 4E3CA 4E6AA 5E90A 3PJ2A 3RKBA 1BI8A 3O71A 2B0QA 5IDNA 2V7OA 4UMRA 1WVWA 3ACJA 2VWYA 3T8OA 2WMRA 3JUHA 1YXUA 4KS8A 5B2MA 5IDPA 4FUYA 3KULA 2FSMX 2PVRA 2BZKB 4F64A 2GFSA 5M09A 3VS6A 4M15A 3RNYA 2PZRA 4ZY6A 4GL9A 4MVFA 4CYJA 1OL1A 3DY7A 5JZJA 3OZ6A 1H00A 5BVOA 5LVMA 1GIHA 3LQ3A 2CKEA 3WZEA 2C3KA 4K2RA 5FEEA 4CQGA 3U55A 2QO2A 3LFSA 3RAWA 3F6XA 2BUJA 3AD6A 4HPTE 4NEUA 4RIOA 4CRLA 4ZOGA 3PRFA 3RHXA 3ORPA 3WZJA 3F88A 1OVEA 3GQIA 5J95A 3UOHA 4FZAB 1Z5MA 3IGGA 2HWOA 2VTIA 4X3FA 3QCSA 1GIJA 3VW6A 1R78A 2RFEA 3H10A 4QP7A 2W1ZA 2VTOA 4IAZA 2VWUA 4XRJA 4LUDA 1H27A 1PMNA 3IO7A 4G34A 3POOA 3HV3A 3IKAA 2ZMDA 4WHZA 4ALUA 1YI6A 4BY9E 3UC3A 4LUEA 5JZNA 3BELA 2PE2A 2UW6A 3I0OA 4UZDA 4U41A 3ZO3A 4GCJA 3BLHA 2VTLA 5GZ8A 4H1JA 5HLWA 4DEGA 3ZM9A 4N4SA 3DAJA 5CU0A 1HOWA 1OPKA 4XG3A 1ZYCA 3VQUA 4Z9LA 4O0UA 3QRJA 1T46A 5K4IA 2VD5A 3KULB 1X8BA 2OIQA 3R7EA 2O63A 1YI4A 3EFWA 3FQSA 3LFQA 3C4FA 4C59A 3O96A 3LFFA 4A06A 4MXYA 3E63A 3LFBA 2WMAA 3QWJA 5JFSA 3TACA 2PZPA 1OPJA 4B9DA 2UZNA 1WVYA 4RWLA 2PMLX 3NNUA 2B9JA 3MIAA 4QP3A 3VUTA 3ZU7A 2PVLA 5DT4A 5CAOA 2X7FA 5IQEA 3COMA 4XLIA 4GU6A 2R3HA 4PL5A 5HD4A 4HGEA 4AT3A 1XO2B 3QUEA 4ZSJA 2HZNA 3A8WA 3DDQA 4I93A 5EYMA 3OC1A 3QGWA 2OI4X 2YWVA 4ZP5A 1O6YA 4YPSA 1WBSA 3I7BA 2HOGA 5CXHA 3FEGA 3VVHA 4HW7A 3COIA 3C4XA 4EK4A 4YU2A 4O7WA 4F9WA 1FGKA 2V22A 3KMMA 3ORZA 4QQCA 4AA0A 3KC3A 1TQPA 2CN8A 2J6MA 2RF9A 3DNDA 3VS4A 1J1CA 3RM6A 1SNXA 3ANQA 4CD0A 4EOMA 4O7TA 3RVGA 5L3AA 3FSKA 1I44A 5DN3A 4QP9A 4EBWA 4BTMA 2WEIA 5ETFA 2GSFA 5M4UA 1NY3A 1BL7A 4DLIA 3KN6A 3FUPA 2Y4PA 4RGJA 3UE4A 2PY3A 3L9NA 1KV2A 3WIGA 2PL0A 4JAIA 1JAMA 5HICA 3ZUTA 3MSSA 4DE4A 3FLQA 4F0FA 3HRCA 4OAVB 3CD3A 4LGHA 3IW4A 4K0YA 2RL5A 2PUNA 3PSBA 4IX4A 3LMHA 1IEPA 2J0JA 1JNKA 4ANBA 3NNWA 4OBPA 3ZFMA 4ASZA 4DEHA 3MFTA 3P5KA 4AXAA 5B0XA 4DITA 4F9BA 4DFLA 4MNEA 3QQJA 4I0TA 4KKEA 2YEXA 4E20A 1JKKA 4BKZA 2VTNA 3DK3A 3OEZA 1FMOE 2IVVA 4U80A 4OTGA 4C2WA 3I81A 3UOJA 5ANJA 3C0IA 1RW8A 3QD3A 2J50A 2FGIA 3BLQA 3PVBA 5A14A 3WIKA 5TT7A 3UQCA 3F61A 3R7YA 4MQ2A 2OICA 2ITWA 1KE5A 4JR7A 5JK3A 5HTIA 2BKKA 2PYWA 4DF3A 5B7VA 3EL8A 2XNPA 1M7NA 2VN9A 2ZAZA 5FXQA 5HG7A 2REIA 3LZBA 1U54A 3MJ2A 4ZTMA 3GCPA 3TZMA 4C58A 4USFA 4GMYA 4NT4A 4DLJA 3N4VA 3W33A 1OUYA 3HGKA 4ZTLA 1W8CA 2NPQA 3EHAA 3LW0A 3QD0A 4W4WA 3BHYA 3BYVA 4FOCA 4GT5A 3K5VA 4WSYA 3AG9A 4M67A 3EMGA 2ESMA 4YJTA 3ZFYA 4QD6A 3A61A 5CAUA 5ANIA 3QL8A 4FKIA 4B8MA 3HAVA 4QMZA 3VRZA 2C68A 1JSUA 1M7QA 4FOBA 1JPAA 3A99A 1Q5KA 3DB6A 4OTDA 2OKRA 2BCJA 5K0KA 3IDBA 1ZY4A 3KVXA 3WF8A 4XBUA 4BDHA 5AP1A 5IH4A 4ANQA 2YIYA 3PXYA 2ITXA 4FL1A 5DR9A 5F1ZA 1I09A 2ZDUA 5EQPA 5AUYA 4FEQA 3KMUA 4YHTA 4IX6A 4JQEA 4BF2A 2UVXA 4J97A 2HELA 4ZK5A 4O86A 1Z9XA 4X7QA 1U54B 5K0XA 4JBQA 3NYXA 4PMPA 3SXSA 1OITA 2G01A 3PZHA 3WF7A 3VULA 3PIZA 3D7ZA 3NSZA 2QD9A 5A4LA 4Y72A 3NNVA 4NH1A 2VU3A 3QTIA 1YWNA 5ACKA 4EYJA 5ITAA 3AC8A 2E9OA 4OBOA 3BWJA 1IRKA 4JR3A 3HEGA 1WBVA 4UXQA 1XBAA 3AC1A 3R04A 4EH4A 2SRCA 1WBOA 2B53A 4FSWA 4AW2A 3TN8A 4IHPA 2QC6A 3GB2A 4FIFA 4TWNA 3NNXA 2XH5A 3V5QA 1F0QA 4DTAA 5KMJA 4Y5HA 4CZTA 3ZSGA 2I0HA 4XG4A 5CX9A 4YSJA 4MXCA 4BCOA 3ORLA 4ZSAA 2O3PA 4IIRA 3UIUA 1FPUA 2Y4IC 4Q5HA 1URWA 4I6BA 5CSWA 5EM5A 3RK5A 2Z7SA 4QMXA 5EDRA 3VUMA 4X3FC 4BYIA 2JITA 4FEUA 2A1AB 4DEIA 4FKVA 2KULA 2XNNA 4X2GA 2XRUA 2YDJA 4LMNA 4RVLA 3VUDA 3FYKX 3EKKA 1GAGA 5EKOA 3VUKA 4PDSA 1ZY5A 2C0OA 1Y6AA 2BIKB 4PP9A 4EH6A 1NT2A 2AC3A 2VZ6A 4J1RA 2J2IB 5IQHA 5LVLA 4G3FA 4UYNA 3DK6A 2XNBA 4AA5A 4C3PA 5AADA 3TNIA 5HTBA 5E91A 3D9VA 3QF9A 4XP0A 3SXRA 5BNJA 3ZMMA 4HCVA 2Y8OA 3BHUA 3RP9A 3NW7A 2UZTA 2YM7A 3I6WA 3QD2B 1MRVA 2OJGA 1KOBA 3ORNA 4BDAA 3SA0A 3H4JA 4V0GA 3ROCA 4L45A 3SD0A 4KD1A 5KCVA 2B9FA 3ZDIA 4O7YA 2GNJA 4RIWB 3AGMA 4Q9SA 5J7HA 3GC7A 5CANA 3R00A 2XS0A 5AR3A 4V04A 5EYCA 5C01A 5CEQA 4BCQA 1QPDA 3DAEA 4QTCA 3FMDA 3ZO4A 5FWKK 4HZSA 4FNYA 4LQMA 5JKGA 2J51A 2KTYA 3DFCB 3LCDA 4NWMA 5GHVA 2AUHA 4OLIA 4UWYA 2FA2A 2QNJA 4EHEA 2DS1A 4XNEA 5HO7A 4O27B 2WMQA 4PL3A 5M08A 1PXJA 2JBPA 4CRSA 4MWHA 3PIYA 4FSUA 2UV2A 4JDKA 4PY1A 3C9WA 1WBTA 5HBHA 4JX7A 3KRRA 2OWBA 4KSPA 2OW3A 4P90A 5C03A 2C3IB 4BWPA 4YNEA 4FR4A 1XBBA 4BCGA 3A2CA 3F3VA 3QRUA 4G9RA 2HZIA 3MY0A 5EM8A 3AD4A 2W0JA 3F2RA 2PUPA 3SX9A 1ZXEA 1JSVA 3ZTXA 3LFCA 3JR1A 4QMYA 3GC0A 5BVEA 4G6NA 4UMUA 1UV5A 2YN8A 4RJ7A 3HMNA 4V0GB 4CT2A 2O64A 1OUKA 3KKVA 4NJ3A 3U9NA 3RMFA 4RQKA 3IW6A 3NGAA 2P2HA 2J0LA 3S00A 3FKNA 2BRGA 3N51A 1TKIA 4F08A 1UKHA 3EYHA 4IC7A 2C5OA 3G6GA 1P2AA 4BDGA 5KE0A 4F65A 3UZTA 3BV2A 4P5ZA 2XJ0A 4O84A 2C0TA 4TW9A 3FZTA 3O8PA 3ET7A 3FMKA 3GT8A 3GENA 5DRDA 2WMWA 3PXZA 4LL0A 4APPA 2W96B 5ANKA 3U87A 2GHMA 4ASEA 4YHJA 3RHKA 1UU7A 4FTRA 2PE1A 2CKQA 5HG9A 3QXPA 5FDPA 3QHRA 4AZWA 4XV9A 4HGSA 3ZYAA 2VNYA 2QOLA 3D14A 3KXGA 1YXVA 3ZO1A 4O0YA 1Q8TA 3R7IA 3TNQB 3I1AA 3CY3A 1PW2A 4QMPA 2QURA 4TT7A 5ETCA 3ODZX 4O7VA 3GCVA 2X7OA 3PP1A 4JBVA 3QZHA 4OTFA 5HO8A 2ITNA 3VBVA 4HPUE 2PPQA 4ZJVA 3ZHPC 1OIQA 5CEPA 2QOHA 3V5LA 4JG6A 5AP4A 1IG1A 1IAJA 4Y46A 5KO1A 3D5XA 4A4LA 4O83A 4ANSA 2ITTA 4EHZA 4BGHA 2XNOA 2QOOA 4O0SA 4BCHA 4O91A 2WIHA 2Y6OA 4FT7A 5KKRB 3NZ0A 4R5SA 4YBKA 2V0DA 4Y8DA 3F5UA 3E64A 2FB8A 4LOOA 5I9YA 4RX9A 1YVJA 3PY0A 4O22A 2VTHA 4KRCA 3GOKA 3R8UA 2O8YA 2WKMA 4GVJA 3TIZA 1LUFA 3ORKA 4AE9A 3IW8A 3EOCA 3QD4A 2BDJA 2XBJA 5AX3A 4E26A 4M66A 2R0UA 4BBEA 4BZDA 3CBLA 3C5IA 4RVTA 2IW8A 3MY1A 3NUYA 3OXZA 4ZY4A 3BGQA 3A8XA 2GTNA 3R63A 4JDHA 5IG1A 3I4BA 3O50A 4PQNA 1YDRE 4DA5A 2BHHA 1IR3A 4FK3A 5IQAA 3R9NA 2JFLA 4IH8A 1XBCA 2QOIA 4PDOA 4DEDA 5A46A 5BPYA 2GNLA 2J0KA 5FEDA 4FL3A 4D4RA 5CXZA 1YHVA 1LEZA 2VO3A 5FXSA 4M3QA 2W05A 3QQKA 4JDJA 3ZRLA 3Q9XA 4AZSA 4EHVA 3DNEA 5JEBA 5BVKA 3MH1A 4D4SA 4J7BA 4L9IA 3AQVA 4BFMA 1H4LA 3EQGA 4FNZA 4ZTQA 4FT0A 5H9BA 4IACA 4AX8A 1Q8WA 3IDPA 4JBOA 3AC2A 3PG3A 4WNMA 3VS5A 2NNWB 1H28A 5AIRA 3R1SA 5CSHA 4D1ZA 4XHKB 3HMOA 3QTZA 4WKQA 3CR0A 3Q2JA 3QALE 3UOKA 2QLQA 3D94A 4IX3A 4AGCA 4NKSA 3W10A 3VUGA 5L6OA 5DYJA 2JKQA 2YACA 5DR2A 3EQIA 3OTVA 2HXLA 4P4CA 3BHVA 5HCYA 2X7GA 5BMMA 3JVRA 3BRBA 4FIJA 4TL0A 3O23A 3QTUA 4GVAA 5CVHA 4D2RA 3L9PA 3M1SA 1ZYSA 5CU6A 4U40A 4FT9A 3UG1A 3FZPA 4BCIA 3EQDA 4WG3A 3WBLA 4D4YA 5CEOA 2YIQA 1P5EA 4FV7A 3FV8A 1WFCA 3CLYA 3W2SA 5AUXA 2Z02A 1U46A 1O6KA 3AC5A 3UDBA 4CCBA 1YKRA 4S2ZA 4FV2A 4FV3A 4WG4A 5F95A 5AAFA 4I6FA 4BICA 3NW5A 5AR8A 4S30A 4G3GA 2VTJA 3R1YA 2G1TA 3NW6A 3C50A 3GXLA 4FKPA 5KUPA 3TUCA 4FSMA 4UBAA 3VF9A 5DRBA 1NVSA 5CWZA 1V0OA 2A0CX 3ZSHA 4NTSA 4B4LA 4GFGA 4MHAA 3V04A 2XYNA 2PUUA 2CCHA 4IM2A 4N70A 2XKDA 3BLRA 4J53A 5BVFA 1WCCA 1GZNA 4NFNA 3M11A 5CY3A 3V6SA 5LWMA 3Q6WA 4C2VA 4WNKA 5T6KA 4H36A 4O7RA 4BTKA 2EUFB 3MVJA 5DT3A 5KMNA 4OW8A 4NFMA 4RLLA 4O6EA 3E92A 1PRYA 4IXPA 4R1YA 4IVAA 2BAQA 2BKZA 4AT4A 3MV5A 3TZ9A 4A4XA 4JOAA 4RIXA 2JC6A 2BZHB 3SXFA 3ORMA 3ZXTA 5TE0A 3U9CA 1M14A 4Q9ZA 3QA8A 3VC4A 4UY9A 4EUUA 4HVSA 4YJRA 4DT8A 4IBMA 3R8MA 4IAYA 5H8BA 1LPUA 2R3RA 3LIJA 3UMXA 3V6RA 1YXTA 4IVCA 4AF3A 4BCPA 4HYSA 5BYZA 4D28A 4RZWA 3JYAA 2VWBA 4R5YA 1PXNA 1PMVA 1XH7A 2WFYA 4AZTA 2ERZE 4IZYA 3LCOA 3QQHA 4FKJA 3FY0A 4QMSA 4S33A 3EFKA 4TYIA 2FSTX 3ETAA 4I4EA 1YW2A 1H08A 4F1TA 4DH7A 2XB7A 4NL0A 3HMIA 4MEDA 4C37A 3LOKA 3E8NA 3QKLA 4X6QC 4L3JA 3WZDA 3VS3A 3DKGA 2AC5A 3WF6A 3OT3A 2R3NA 3QRKA 2UUEA 4OTIA 5HLNA 3R8ZA 4XG9A 4Z7GA 1WZYA 3QUPA 5E4HA 3VAPA 4I4FA 2C4GA 4ANMA 3CSVA 2WMTA 3PSCA 2B7AA 4V05A 4ANOA 1YRPA 2RFDA 4HGLA 4IB1A 3LKMA 3QCYA 4RIXB 4WRSA 3LQ8A 4AQCA 3RJCA 1CSNA 2JDRA 4O0XA 2WXVA 5KKRC 3KRJA 5KHWA 5JMSA 2F7ZE 2GQSA 4J96A 2PU8A 1H25A 2A27A 3GGFA 4EH3A 2Q0BA 3MY5A 3SAYA 5FTGA 1J1BA 4IE9A 2R2PA 3EZVA 1KE6A 1O9UA 2QODA 2YM4A 3L8VA 4F6SA 4FYOA 3DZQA 3W8LA 4YC6A 1XH8A 4WSQA 4BCNA 2ITUA 1SVGA 4EL9A 2W1CA 4E5AX 2UZLA 4TNBA 3NUAA 1H1PA 3OY1A 4L7FA 5I9WA 3LMGA 2C3LA 1PKDA 2R0IA 5DEYA 3LFEA 5HCZA 3UP7A 3ZC5A 4ACCA 4B7TA 2Z60A 5CALA 5ANOA 3F7ZA 4CKJA 5A6OA 1EH4A 2QG5A 3TKHA 3R2YA 4IX5A 3RINA 1Y91A 5E8XA 1A06A 1YDTE 1YI3A 3PLSA 2J0IA 4KAOA 3Q53A 4YJUA 3Q96A 3EQRA 5TR6A 4AW0A 3AT2A 3NVMB 4G3EA 4YZMA 1W84A 5EM6A 1H1WA 4EH9A 4ZTSA 5M56A 2VO6A 2ONLA 4E93A 5BUIA 5IMEA 2X8EA 5L6WL 4QPAA 3PPJA 3FI8A 3A7JA 4ACMA 4MF0A 2BIYA 3OW3A 3LFNA 2CLXA 5DOSA 5EYDA 5HQ0A 1R1WA 3DXPA 4PDYA 2HW6A 4XCUA 2C5VA 4EK3A 3LXPA 3DQWA 5IH5A 2UVZA 3TZ8A 3L8PA 4HCUA 3AT3A 5C4LA 3LXNA 4F09A 3LE6A 4M84A 5AAGA 3WF5A 4D2TA 5JRQA 4F7LA 5HEZA 3PXKA 2ITYA 4USEA 4MBLA 3VJNA 2XKCA 1OL5A 2YIWA 3E3BX 4LRJA 4P5QA 2WMUA 2BRHA 2J5FA 5AV2A 4H3BA 2ZV9A 4JLCA 3G6HA 1FGIA 4YGAA 5E8WA 4RG0A 2PVYA 4KA3A 5BVWA 3EN5A 1JVPP 2NO3A 3RAIA 2CJMA 2EU9A 4DH3A 2OO8X 3K3IA 4FEXA 3FMEA 3O7LD 1YDSE 3F2AA 3PJ8A 4G6OA 4R3PA 3QX4A 4F99A 3FQEA 4FV9A 4JX3A 4QYFA 4F1MA 3TKIA 3NPCA 1PXOA 2XBAA 4NM7A 3I5NA 4XRLA 5CI6A 5L8LA 3P4KA 3JPVA 2ZM4A 4QP2A 4HGTA 4TKSA 4O1OA 1OPLA 3ATTA 2R3JA 1DAYA 4C4GA 4R77A 3OWLA 5KMIA 4GK3A 2BDWA 2IN6A 3TL8A 5IQGA 5HD7A 2PVFA 3RPOA 4BDBA 3FKLA 3ZEWA 1OGUA 4AZEA 3DA6A 5M57A 2W99B 3FLYA 4PX6A 2C3JA 3D7TA 3BBWA 3SRVA 4J8NA 2PZ5A 2HAKA 4IAFA 2C6TA 3QFVA 2UZVA 2XIKA 4JJRA 3BGPA 5M51A 2C0IA 3Q4TA 3NDMA 1OIRA 2R64A 2WOTA 1SYKA 3CTHA 3OMVA 4EOLA 3MA6A 4LFIA 2OIDA 3E88A 3MW1A 3LXLA 3OF0A 4H39A 3D2KA 3O17A 3HMPA 3F2NA 2Y7JA 4JT3A 5AP0A 4AGUA 4D5KA 4C3FA 5A4QA 4FTOA 3KRLA 3I7CA 4I5CA 3KK8A 4LL5A 4EC9A 4AA4A 4GH2A 1Z57A 4IAIA 4HVHA 4DFXE 5I9VA 3HAMA 5CT0A 4XV2A 3KA0A 4HVDA 4UWBA 5HVJA 5AV3A 2PHKA 4JRVA 4QMVA 4A07A 4BDIA 2VX0A 2W1FA 2GNHA 4R7BA 1QCFA 2YA9A 2WMVA 5IH6A 1MRYA 2Q0NA 2OF4A 4QMNA 5HIEA 2QHMA 3EIDA 2BR1A 4JG8A 3SW4A 2XJ1A 4R1VA 2HWPA 4DH8A 3FPMA 4BIDA 3V5TA 5D9HA 4KUJA 4IWPA 5AP2A 4ALWA 3VBWA 5IKWA 4FSZA 2Z7RA 3D7TB 4QYHA 3SRVB 3R6XA 3UP2A 1KOAA 4A9UA 5J7BA 3PVGA 3FLNC 4FTLA 5JFVA 3QCQA 5L4QA 4K11A 2NRUA 2DWBA 2VNWA 3DZOA 4EYMA 2W1HA 5ETIA 5T68A 4BRXA 1YXSA 3UPXA 1DS5A 1Q3WA 4E1ZA 1GZ8A 4OBQA 4WIHA 5IEXA 1M17A 2Y4IB 5EQEA 3AMAA 3R9RA 4GFOA 3GFWA 5CF6A 4RJ5A 3RK7A 4WRGA 1ZOGA 2UW8A 4JAJA 4X3FB 4GT3A 2PWLA 4GG5A 3CEKA 4FE2A 4AFEA 2QOBA 5IQBA 2WTKC 4YTIA 4QTDA 2YLEA 5IEVA 2XEYA 4QMUA 5DPVA 3C5UA 2YISA 1GZOA 5BYYA 4U43A 3C4CA 3FMMA 3IOPA 5D41A 3UIMA 3W16A 4YMJA 5L2TA 2J7TA 3EFLA 4U8ZA 4AZFA 4YLJA 5E92A 3U51A 3R2BA 2XZSA 4BDKA 4C34A 4W9XA 3DKCA 1KE7A 4I0SA 5CU2A 3VBTA 5M4IA 3AC4A 1CKPA 2JKMA 3PUPA 3WZUA 3ORXA 3WZKA 5GJGA 2GS2A 3GU8A 4GUEA 4D58A 5C4KA 4JNWA 5AUVA 2HZ4A 3ORIA 5AR7A 4GRBA 5CSXA 2XK4A 4NSTA 4BKYA 4YJOA 4M7IA 4IEBA 2XNMA 2LGCA 2VTPA 3PP0A 2DUVA 4ZSGA 5A4CA 3Q04A 4BCFA 5KHXA 3OWPA 1L3RE 2YCSA 3FZOA 4IB5A 3R9HA 5L6PA 3MVMA 4FG8A 1Y6BA 2GNIA 2QQ7A 2ZYBA 3FZRA 2GDOA 1F3MC 2PVNA 3PFQA 4RA5A 3F5XA 3O8TA 5E7RA 1WAKA 4GFMA 2WTWA 4YO6A 4PPBA 1CM8A 3ZCLA 3NCGA 5TOZA 4YJVA 4DBNA 3EN9A 3F3TA 4E6CA 3MGYA 4QTAA 4R7HA 2EXMA 2WMBA 4NIFA 5FP5A 3TIYA 4U0IA 5I9ZA 5CU3A 4FT3A 2QU5A 3VF8A 4E7WA 2P3GX 5IEYA 2ZV8A 4CMTA 1Q8UA 4DGMA 3ULZA 2UZOA 1W7HA 5EI8A 3Q9WA 4IJPA 3MFRA 1H1RA 4KRDA 3UNKA 5E8SA 2YFXA 3FPQA 1XR1A 5AJQA 3CGOA 4AACA 2UVYA 2RSVA 2Y0AA 3C7QA 4FX3A 3FL4A 3IG7A 5FTQA 2I7QA 3DBQA 2ZV7A 3NCZA 2OZOA 4C38A 2YDIA 3QWKA 4C0TA 5LWNA 5J87A 4EBVA 5LCKA 3SHEA 3DLSA 4XS2A 4FVQA 3D83A 4E4MA 2J90A 3EKNA 2YWPA 3HRFA 3MVLA 3VS1A 4DC2A 2Z8CA 3KU2A 3ODYX 4RWJA 4NM5A 5LVPA 4HOKA 3SC1A 4B0GA 4FSTA 4BWXA 2ONLC 1U59A 3NIEA 3TNHA 2W7XA 3ZOSA 4DGOA 2JKOA 4I5PA 4M0YA 3EQBA 3FAAA 4MNEB 4YJSA 4DFZE 2CMWA 4AN3A 4FV5A 3OROA 1TQMA 1Y57A 4AOTA 4AU8A 4OR5A 4ZZOA 3FJQE 3OBJA 3G51A 4NIFB 3Q5ZA 1NW1A 1OBGA 3CP9A 4UWCA 4EH7A 2ITZA 4DCAA 5CTPA 4I6QA 5HE1A 4Y85A 1H1QA 2BRMA 2XYUA 3G0EA 4KABA 4QTBA 4BZOA 4IADA 4EOKA 2FUMA 5AEPA 5M06A 5LMAA 5DA3A 4F1OA 2JDOA 4FODA 3O8UA 4XOZA 2GU8A 3OUNB 4L3PA 2HY0A 4WNOA 4O7NA 3HDNA 5KBRA 5HOAA 4FTTA 4YZDA 4NW6A 5D7AA 3BYUA 3IK3A 4TXCA 1BKXA 2XKEA 3VO3A 3DXQA 1MQBA 2O2UA 3HVCA 2JDSA 2OFUA 2VWWA 3WYXA 3ZEPA 1PMEA 5BX0A 2XA4A 2QU6A 4IB0A 4E6DA 4WT6A 2YDKA 2JAVA 4BDJA 1OBDA 3FE3A 3BIZA 4L53A 5LMKA 4FG7A 2WO6A 5FEQA 4XMOA 3ZZEA 3CKWA 1BMKA 2UZBA 2W5AA 5AP3A 2W4OA 4ACGA 3GNIB 3KRXA 3R8VA 4UMPA 1ERKA 3VJOA 4CFWA 4F6WA 5DIAA 3L1SA 3UVRA 4TTHB 3ZRKA 2EXCX 3COHA 2E2BA 4N57A 2QKWB 5EK7A 1Q62A 4Z16A 3HDMA 4KINA 2JBOA 3COKA 4CFFA 4RIYA 3E5AA 2X6EA 4TYJA 2FYSA 2RKUA 4A9YA 1TVOA 4GK2A 3RZBA 3VHKA 1YOMA 3DDPA 4FVPA 5H8GA 3IS5A 4U45A 4DYMA 4LGGA 4TWOA 4IAKA 4O2ZA 4TYHA 3BQRA 1PJKA 1QL6A 3MPMA 3O0GA 4L7SA 1CKJA 4EUTA 5JN2A 1OM1A 4HVGA 4BGGA 3UIXA 3MESA 1H0VA 3LCTA 4ZSLA 1CMKE 4CT1A 4DH1A 3PZEA 5KX8A 4KSQA 5LARA 4CG9A 3FMNA 4OTHA 4NKAA 4KWPA 4ZY5A 3R28A 4I22A 3UNZA 4S34A 5EHYA 4J98A 3MVHA 5GJFA 3WF9A 2V5QA 4F4PA 1Q41A 4L44A 3EN7A 3HV5A 4N6YA 3SOCA 3NYNA 2XUUA 3CCNA 2X9EA 2OU7A 3R7UA 5AAEA 4KIPA 4NJDA 5EM7A 5CU4A 4WG5A 5EYKA 3NR9A 2JIVA 3HA8A 4I92A 4ZSEA 5IPJA 3KXHA 2WU7A 2I0VA 5LXMA 3Q5IA 1PF8A 3E7OA 5IZFA 1LR4A 4RIYB 4IDVA 2VUWA 4D0WA 3OCTA 5CEIA 4ZLZA 5ICPA 3PDTA 4MD7E 4USDA 2R3PA 5HIBA 4EORA 3IGOA 2IW6A 1IA8A 1ZOEA 1U5RA 3E7VA 3B8QA 2X9FA 3QLFA 4PRJA 2C1BA 2YM6A 5AWMA 4BGQA 1UU9A 4HCTA 4Z55A 3OUKA 1OL2A 1Q99A 3CQWA 4BDCA 3CD8A 1KV1A 4M14A 4I24A 3EJ1A 4IQ6A 4IANA 4QQJA 4WA9A 4D0XA 5IMXA 4TYHB 3ZLYA 2H6DA 4KIQA 4CLIA 3GCSA 4ERKA 3S3IA 3LVPA 3CTJA 3EQCA 1PMUA 5HVYA 2FH9A 4XG2A 4IWDA 4MXXA 1GOLA 4FTIA 4EWHA 4G6LA 5IA4A 3S0OA 3LHJA 2GHGA 2VGPA 1WBWA 1ZMUA 2X0GA 1PXIA 4XEYA 2XNGA 5D7VA 5AMNA 4BCJA 3MPAA 2YERA 3OXIA 3RPSA 3ALOA 3ZBFA 2QHNA 4CZUA 2I0EA 2YJSA 4FTQA 2XNEA 2GS7A 3KK9A 4AAAA 3LJ0A 4JQ7A 3Q52A 2R7BA 4ENYA 4H3PA 3DV3A 3A60A 2FSLX 4KS7A 2IW9A 5J9YA 1QMZA 4C36A 3FLZA 4BTJA 3SKCA 4M12A 1ZRZA 5HX8A 3H9RA 5AM7A 5AR5A 4WUAA 4AW1A 1U4DA 3PJ1A 3BEAA 4I5HA 4GIIA 4O0VA 3E8DA 4ZLYA 4OT5A 3ZFXA 2PE0A 2WTCA 4MF1A 3QZGA 3EH9A 2HENA 1OMWA 4RJ8A 5F20A 4O21A 3BQCA 3GVUA 4DTBA 5DHJA 1UU3A 3VNTA 4FKWA 4BR3A 4FV8A 2BMCA 1Q3DA 2QG7A 2XIRA 3MTFA 1ZLTA 4L8MA 5DBXA 3VS2A 1PY5A 5KNJA 4O82A 2C6EA 4YLKA 5A3XA 1UNGA 4RLKA 2QO9A 3ZSIA 1BUHA 4FV6A 4YZ9A 4CYIA 3W55A 1KWPA 4NM0A 3QTRA 5CEMA 4MBJA 3BKBA 3IECA 3HP2A 4QMLA 2FVDA 2WQEA 5FG8A 3D0EA 1R3CA 3BE9A 4MD9E 4TYGA 4YJQA 2JEDA 4LOPA 3TV4A 4U7ZA 4D1SA 4G5PA 3M2WA 3IW7A 4FA2A 2ITQA 5FXRA 5HE3A 2BTSA 2WMSA 3DJ5A 5CQUA 4FSQA 1IA9A 2YIXA 2J9MA 5AUZA 3F5PA 5IA5A 1W0XC 2X1NA 2Z7LA 4C4FA 2ZJWA 4ALVA 5AV1A 2FSOX 2IVUA 2HZ0A 4G31A 2GMXA 4BHNA 2JKKA 1PXKA 4DG3E 2W1GA 3AMYA 4D9UA 3DJ6A 2GHLA 1E1VA 2UZWE 3MI9A 2YIRA 3H30A 4L3LA 3QHWA 4FGRA 3KF7A 2BZJA 4PMSA 3VBXA 2LAVA 2I0YA 3C13A 5IA1A 3DBCA 4ITJA 1B39A 3MYGA 3BCEA 2VTQA 4BIBA 1VJYA 2VWIA 2QI8A 3V5JA 4XP3A 5HNGA 4S32A 4HYIA 5IUHA 3FXWA 4RJ6A 4C02A 5KMLA 3ERKA 5HNIX 2EXEA 1PXLA 3SV0A 2G2FA 4G17A 2WGJA 4BC6A 4CFUA 5FBNC 4DEBA 3C0GA 5GIPE 4H58A 4J95A 4UN0C 2RFNA 3LM5A 2CGUA 5KMOA 2PMOX 5DG5A 4FIIA 5HI2A 3QYWA 5B2KA 3B8RA 4FSNA 2RGPA 4HNIA 4U5JA 3MN3A 4RX5A 3LXKA 5LMKC 4FGBA 2PVMA 3OG7A 4BYJA 1VYZA 3NUNA 3NVKI 4I41A 1V0BA 1ND4A 3F82A 4E6QA 2UZEA 4EOOA 3VHEA 4PTEA 3VIDA 3MPTA 4PTGA 1KE8A 3E8EA 4I3ZA 4QPMA 2F49A 3REPA 3DPKA 3MB6A 2ZDTA 3GOPA 4QO9A 4CKIA 4WBOA 3TKUA 4FTCA 2R5TA 5CEKA 1CKIA 5C26A 1ZMVA 4K33A 4LV5A 3Q6UA 4IAAA 4BI2A 1REJA 3BYMA 4W9WA 4BVUA 5DR6A 3FXXA 3EWHA 3U6IA 4GJ3A 5CVFA 3KGAA 3GQLA 1BL6A 3I79A 1M2PA 2W5BA 3I6UA 3R30A 4QP4A 2G2IA 4JRNA 3HP5A 2ETMA 3R8LA 3MDYA 3H3CA 4OUCA 1J3HA 4QMMA 4XG8A
chains in the Genus database with same CATH superfamily
5K5XA 2BDFA 4PMMA 5GNKA 2IZRA 4LOQA 3T3VA 5L8KA 3A4PA 5CYIA 5JFXA 2B55A 3KCFA 4M69A 5FRIA 5M55A 1JQHA 4UX9A 3RPVA 2R9SA 3LQ5A 3NUXA 4PDPA 4BDFA 4D1XA 4W4VA 4EOSA 4UYAA 2WQOA 2YITA 4IC8A 5JT2A 4FV0A 4FKSA 1GZKA 4RRVA 3ZH8A 2X0PA 4O7ZA 2ITPA 4D2PA 3TMOA 1RJBA 3S2PA 4C35A 4X3JA 3OWKA 4DN5A 3U54A 2C47A 2WAJA 5G6VA 2WPAA 4CTBA 3ZBXA 4MX9A 3QTSA 1V0PA 4QP6A 4RA4A 4FMQA 4G5JA 3AC3A 3P0MA 4MTAA 4PNIA 3W2OA 2YZAA 4F6UA 4AWIA 5CNNA 2UW9A 3D2IA 3VUHA 4F0IA 4CVAA 3VUIA 2YABA 2A2AA 5D10A 4ID7A 4C8BA 2R3GA 4C4HA 2XCKA 2IO6A 3KRWA 4FNXA 3ZO2A 4AN9A 2YLFA 4U79A 3R7VA 4YP8A 5JSMA 3D5VA 3QYZA 4IWOA 3CQUA 3Q32A 4RX7A 3RCJA 3RWPA 4AGWA 1W82A 2GTMA 3ZLWA 4ANNA 4X6RA 3HX4A 1SZMA 4U44A 1T45A 2R4BA 2ITVA 5CASA 3A4OX 3DBDA 4FSYA 2ZOQA 1XH4A 3OVVA 3KXMA 3RPYA 5BYLA 3LCKA 5EFQA 1JKLA 2CDZA 3V8SA 3Q4ZA 3EQFA 3MH2A 3UO5A 4RSSA 2ZB0A 3TDWA 4FZFB 1OKVA 4HJOA 4EJNA 5LVOA 5M4CA 2CSNA 3FZ1A 4TNDA 3UYTA 1M52A 2WHBA 1PXMA 3P08A 4EQMA 4YBJA 1TFFA 2H96A 4PTCA 5GZ9A 4ZZMA 4D5HA 3WILA 3ACKA 2WTKB 2W9ZB 4ZLOA 5CF8A 3R0TA 2RG6A 3N4TA 4U81A 4CFMA 2UW7A 4CFVA 1JKTA 4BCKA 2QOCA 2YM8A 5HLPA 4AZVA 1Y8YA 3JXWA 4I1ZA 5EOBA 5E8VA 4C57A 4O7SA 4K8AA 2CN5A 4XH6A 4EQUA 5IU2A 2OF2A 2WTDA 1IAHA 4ZMFA 5I5ZA 3ZUUA 3N4UA 2RFSA 3NS9A 4PPAA 5J1WA 4B8LA 2VWXA 1BX6A 4G3CA 4CTCA 5JQ5A 3ATSA 2BTRA 2A19B 4DFUA 2B54A 4ORKA 5CF5A 5A54A 3EZRA 5A4EA 4RJ3A 4OT6A 3R21A 1ZZ2A 3P9JA 3MS9A 3A62A 1KE9A 1YHSA 3OOGA 4N6ZA 1P4FA 3V3VA 3BPRA 3Q3BA 3ZLSA 3S1HA 2R3KA 3A7IA 3GEQA 3DLZA 4MD8E 3HUBA 4O96A 3VN9A 4E73A 1GIIA 3SLSA 1GJOA 3F3WA 1HCKA 4LV8A 5EI2A 1UWHA 5IA0A 2DQ7X 4NK9A 2C5NA 2NP8A 4YTFA 3SG8A 5CAVA 5KZIA 1APME 2OJFE 3GC9A 3NWWA 4H1MA 4FKTA 4EOQA 4DCEA 5HVKA 4ARKA 3OP5A 3QX2A 5I9UA 1W2FA 2C30A 3VBQA 4FTAA 5JQ8A 3FY2A 2C69A 3QC4A 1SVEA 4EK5A 3AMBA 1OGYA 4AT5A 2WNTA 4U3YA 3TV6A 4UMTA 3OOMA 3SDJA 1DI9A 4N0SA 1OIYA 4K77A 5AP5A 5L2WA 2VTTA 3I0QA 4X21A 3HZTA 3FHIA 3U4WA 3MB7A 3GC8A 3RI1A 4EK8A 5A9UA 3P79A 4KNBA 4PNKA 3PWDA 1H26A 2ACXA 3EFJA 2FO0A 4DEEA 5JRSA 4ZMEA 4P7EA 5L2IA 4XOYA 3OTUA 4JVGA 1H07A 5AP6A 4DGGA 3NEWA 3KF4A 1URCA 4JDIA 3GU7A 4DGNA 3P86A 2WTVA 1M2RA 4O2PA 4MKCA 2XALA 3QQGA 4PMTA 4CXAA 4ACHA 4YTCA 3FXZA 3FZSA 5E9EA 3D5WA 4QDVA 3FMHA 3O2MA 3G33A 5C9CA 4EZ5A 4X2JA 2OJJA 3GU4A 3L9MA 4EEVA 1J7LA 2AEGA 3DAKA 3IDCA 4MYGA 4LG4A 5J79A 1E1XA 1OI9A 4FTUA 4TY1A 1W83A 3CQEA 2F7XE 5K4JA 2C6OA 4L42A 4O7LA 2YAAA 1SNUA 3BU5A 4KIKA 3JVSA 4XUFA 4YPDA 3N9XA 3NYVA 2VTSA 3DK7A 5HKMA 3L8SA 3BBTB 3A7GA 1CDKA 3DTCA 4W8DA 5CQWA 5AM6A 2QO7A 3ZUVA 4C62A 4F7NA 2YM3A 4F9CA 2OFVA 2V7AA 1H01A 3QXOA 4FIGA 1WBPA 3U6HA 2X39A 3UZRA 2RIOA 3EYGA 2PVKA 4GUBA 3EQHA 4GIHA 3HV4A 4L68A 3IOKA 2IZSA 5HESA 5K3YA 5I3OA 5LOHA 2P0CA 1FQ1B 2GPHA 2JFMA 1YWRA 3BX5A 3AXWA 3ZDUA 4F63A 4V01A 5LVNA 3PXFA 2C6LA 1ZYJA 3KN5A 3TM0A 2W1DA 3FKOA 5HGIA 2HIWA 3BU3A 5T3QA 4BBFA 2BPMA 4MUQA 3U4UA 2HXQA 4ZTHA 5CF4A 2W4KA 4IVDA 2WD1A 4O81A 4OGRA 4U97A 5DGZA 4FJVA 3LLAA 2PTKA 4R3CA 2JIUA 5HE2A 3WE8A 4QPSA 4AUAA 4JS8A 3HV6A 5AX9A 4DHFA 2PULA 2WZJA 4FV4A 3DKOA 4GT4A 3F5GA 4K6ZA 4R7IA 3WOWA 3B2TA 1OKZA 2E9NA 3PXRA 4UMQA 5CENA 5HBJA 4KIKB 4Z7HA 4U9AA 4I21A 2ZM3A 4D2WA 3ZLXA 3PG1A 4GW8A 5C8MA 3AGLA 4CV9A 3OEFX 1SVHA 3BE2A 4EWQA 3BZ3A 4QP8A 3PYYA 2I40A 2X4ZA 1ATPE 4W4YA 2VWVA 4LMUA 3PVWA 4J71A 3R1QA 5BVDA 2XJ2A 3GUBA 3PY3A 4X2NA 4RZVA 5HNBA 3Q4UA 1Q24A 4NCTA 4KBAA 4L43A 4O0WA 4MNFA 4EH8A 2XMYA 3CGFA 3FHRA 3RBWA 2XK7A 3ENMA 3R9DA 2B4SB 4IM3A 4YNOA 2IWIA 2JGZA 2F2UA 3JS2A 4F70A 4X2FA 3CKXA 4EI4A 4BTFA 3MWUA 5LCJA 4J52A 1OZ1A 5EDPA 4TN6A 3ZM4A 4QMOA 5KBQA 2IZUA 1ZYLA 3AOXA 3BHHA 3KEXA 5IF1A 3TXOA 3W2QA 2XIYA 3BWFA 3R7OA 3II5A 3VW8A 5KMMA 3DB8A 4HNFA 4YZCA 3UGCA 2OXXA 2XM8A 3OS3A 3F69A 3LJ2A 4MXZA 5L2QA 4B6LA 4RWIA 4QNAA 3Q60A 3Q9YA 3QZIA 1S9IA 4G1WA 4F7SA 4P2KA 1SMHA 2JDVA 1YXXA 2CPKE 2GQRA 4LGDA 4B99A 2UZDA 4X0MA 1YHWA 2PVJA 5C1QB 2EVAA 1P4OA 2R3IA 3QQLA 5D12A 4K18A 5E1SA 5DVRA 1V1KA 4BCMA 4O0TA 5EQYA 2VO7A 4PWNA 4H3QA 3EQPA 2X2MA 3LFDA 4M97A 4AW5A 3DXNA 5IUIA 4BB4A 3KL8A 4W8EA 3OHTA 2A4LA 5DEWA 5AFVA 2X81A 2BRBA 1H1SA 2Y6MA 4M68A 2CNUA 4GU9A 4QT1A 3NUUA 5HHWA 2JAMA 2JD5A 4GK4A 4Y83A 3TJDA 4G16A 1S9JA 5L8JA 3BV3A 5IQCA 4ASDA 3KY2A 4TWCA 3TNWA 1OKYA 4CSVA 5H2UA 4JBPA 2OSCA 2VX3A 1FMKA 3CJFA 4ZTRA 1XKKA 3CE3A 5HG5A 1MUOA 1XH5A 1MQ4A 2IVSA 4PL4A 4QYGA 3WI6A 1Q97A 2VGOA 3G5DA 2F7EE 3P7CA 5EW9A 4QTEA 1E9HA 3E93A 5J5TA 4FKLA 3QZFA 2G15A 4KBKA 3W18A 4BN1A 4YO4A 4AP7A 3UODA 5LJJA 5FM3A 2XEZA 1A48A 4I0RA 2Q83A 3B2WA 3NRMA 5I4NA 2PUIA 3W0QA 5DNRA 4FEWA 4M13A 5AA8A 2O65A 2HYYA 2UW0A 2GNFA 3PWYA 3C51A 4NZWB 3F7WA 4XP2A 4DFNA 2XCHA 4FIHA 4AGDA 5F9EA 4WNPA 2UZUE 3CXWA 1ZWSA 3PE2A 4I94A 4KKGA 4MCVA 1B6CB 3D15A 3OBGA 4UALA 4A9RA 2R3QA 1VEBA 4O4CA 1UA2A 1B38A 3H0ZA 4EKKA 4PUZA 4NU1A 2WQNA 1DI8A 3UIBA 4IW0A 4PP7A 3OCSA 2WQMA 1FBNA 3SW7A 2ITOA 5TKDA 3CJGA 1PHKA 1XH6A 2GCDA 3CS9A 3KCKA 3O51A 3PE1A 3Q9ZA 3R01A 4QOXA 4TWPA 4JIAA 4XBRA 4BHZA 3ML1A 4YZNA 5DE2A 2YZLA 5HIDA 5D1JA 3PA5A 3RTPA 4FKGA 3VRYA 3OFMA 3UJGA 1TZDA 1MP8A 4UV0A 3TG1A 2ZVAA 3IW5A 3DU8A 4O38A 3VQHA 3OXTA 1UNLA 5HE0A 4DDIA 2CGVA 3T3UA 3QLGA 1R39A 3RCDA 4BKJA 5DWRA 4DG0E 3V5WA 1H0WA 1RE8A 5EHOA 3W0OA 1GY3A 2UW4A 4GYGA 4FVRA 5TO8A 3UQGA 1OKWA 2B1PA 2YCRA 1G8AA 3P23A 4EH2A 3HRBA 4NM3A 4RVKA 2G2HA 5IQDA 4ZIMA 2BZIB 5FDXA 2F4JA 1Q8ZA 3F3UA 2F2CB 4I6LA 4EQCA 4YURA 5G1XA 4R6VA 5HU9A 2GS6A 4ERWA 2J4ZA 3T9IA 1XJDA 4J8MA 3U6JA 3VWAA 2ZV2A 4ZJJA 3FYJX 3BEGA 3OT8A 5AV0A 5HU3A 2OGVA 3D5UA 3GU5A 4G9CA 2PSQA 3TEIA 5E8TA 1J7UA 2WELA 3PA3A 4IWQA 4CZYB 4EKLA 4DINA 4HVIA 4ZAUA 4H05A 2ERKA 2OH0E 4Y73A 4XG7A 3RGFA 3WE4A 4AOIA 2W06A 4YHFA 4CKRA 2UW5A 2IG7A 2YAKA 5GJDA 3AKLA 2CLQA 3R9OA 2GFCA 4FI1A 2XRWA 3UO4A 3UMWA 3QCXA 4RQVA 4BDEA 4EOJA 2JIIA 3G15A 3SOAA 3K5UA 4L52A 2IJMA 3FLSA 1JWHA 3OY3A 2OIBA 3W8QA 4ASXA 2XK6A 2W1IA 3TZ7A 1ZARA 5I3RA 4A9TA 4JG7A 1PXPA 4F78A 3OD6X 5FM2A 4RIWA 4I23A 5ACBC 4WUNA 3RAKA 2H9VA 4QMTA 3ID6C 3H9FA 5FBOA 2B52A 5IA2A 5IQIA 3R83A 1KUTA 3WYYA 3LLTA 3PA4A 3MJ1A 4YJPA 5H8EA 5BQ0A 4ZXTA 1HCLA 2VWZA 5HTCA 3DOGA 4ZS0A 3PSDA 5AUUA 3K2LA 2IEWA 4JXFA 5JFWA 2C5YA 3UNJA 2WTIA 4GV1A 4DGLC 5CAPA 1OL6A 2JDTA 3RALA 4UZHA 4KB8A 1JBPE 3QRIA 5CVGA 4YSMA 2P4IA 3LAUA 4FTKA 5EDQA 4MXOA 1K2PA 4KKHA 4FYNA 4K9YA 4FC0A 3UG2A 5M07A 4XJ0A 4F9AA 2W1EA 3K54A 2XM9A 2F9GA 3LMIA 3SQQA 3FC1X 2WIPA 3KB7A 4GSBA 3UVPA 2OBJA 2XVDA 2XK8A 4NCTC 1XQZA 2HY81 3GP0A 4D55A 1UU8A 4JIKA 3V5PA 4EOIA 4YC8A 4WO5A 3HUCA 1JKSA 4DH5A 1ZOHA 3EL7A 3F66A 1VZOA 3QTWA 5J9LA 4YTHA 5FUTA 2I1MA 4ENXA 4FSRA 4YJNA 4FK6A 2Z7QA 3CC6A 4MBIA 2BFYA 3GU6A 3ORTA 4KIOA 5EI6A 5EW8A 4EC8A 5DMZA 2C6MA 4YUQA 5EHLA 1Y8GA 3NAXA 4CGAA 1BYGA 2QONA 2I6LA 2B9HA 4FG9A 3ROYA 3GI3A 1LEWA 3G0FA 4UEUA 2XK3A 3QAME 4K1BA 4FZ6A 3UDZA 2QCSA 4IVBA 4NYEA 5E8ZA 3E87A 4E4XA 2XIZA 3F3ZA 2Y9QA 3VBYA 4C4JA 4ZZNA 1J7IA 3P7AA 1MRUA 3PVUA 3ZXZA 2C5XA 4IZ5A 1PKGA 5E8UA 4QYYA 3T9TA 2W17A 3C4ZA 4R78A 3ALNA 4EZ3A 5ANEA 2BILB 5C27A 4MWIA 2OH4A 4QQ5A 5CNOA 5GIOE 1DM2A 3R02A 2WMXA 3W2PA 3QTXA 5IUGA 4AXFA 3SG9A 2O5KA 3HLLA 5E8YA 2WU6A 4QMWA 2CGWA 4RBLA 2J5EA 4RJ4A 2P55A 5AA9A 4FT5A 2VO0A 4YLLA 4CQEA 2X8DA 5AIKA 3ULIA 2XAOA 2QR7A 5HORA 2ZM1A 2WOUA 4LRMA 5HO6A 2C1AA 4FKQA 4L46A 4EOPA 4HZRA 4U6RA 2OXYA 3AT4A 4FIEA 2WB8A 4TYEA 4E1ZA 2PVHA 5JGBA 4AE6A 3UZPA 4D4VA 5M53A 3O5AA 4FTMA 2BAJA 1REKA 2VTRA 3OCBA 3C4EA 4XYFA 3K3JA 5EH0A 2R3MA 4CEGA 3PXQA 5A6NA 3TUBA 4ZS4A 3MTLA 4QDEA 3R71A 3PJCA 4X2KA 2QOKA 3Q2MA 3QGYA 3CY2A 5EW3A 4Z3VA 4A9SA 4Q5EA 2WQBA 3PRIA 4LYNA 1WBNA 4S31A 4EZ7A 5I9XA 3MBLA 5I0BA 1FINA 4U3ZA 3SVVA 2XKFA 2RG5A 2R7IA 3MH0A 2PMIA 3HKOA 3UOLA 4TZRA 3UO6A 1SM2A 3VS7A 5F94A 2QR8A 3NLBA 1OIUA 4XLVA 2OK1A 3ZC6A 1YOJA 3QA0A 5BUEA 4EH5A 4IZ7A 3LCSA 2ZB1A 2NRYA 3P78A 4UXLA 3FLWA 4JL9A 5H3QA 1QPJA 3ZS5A 3P1AA 3SGCA 3DS6A 1R0EA 4BWKA 3HYHA 5A4TA 5HX6A 3C4WA 1AD5A 4L01A 3TTIA 5D11A 3MA3A 3UDSA 1Q61A 4U42A 2BHEA 1XH9A 3NUPA 3NUSA 1PYEA 2W4JA 3PLAE 3DFAA 3IQ7A 1FOTA 5IISA 2YCFA 3QQUA 1Q4LA 1QPCA 3W0PA 4GG7A 3KIOC 2OJIA 3QQFA 1UNHA 1VYWA 4YC3A 3PTGA 3IONA 4IM0A 4BJJB 1RDQE 4DTKA 4C4IA 1H8FA 5E1EA 4DHIB 2BALA 2W5HA 4G2FA 4OTQA 4DT9A 2VX1A 2V55A 5HCXA 4E4NA 5B2LA 3G9LX 3TUDA 2X8IA 5CI7A 2PZYA 1K3AA 2QLUA 4APCA 1JSTA 4RPVA 3TNPC 3FI2A 2UW3A 3R7GA 5M4FA 5JH6A 1FVVA 1UVRA 2EWAA 5ANDA 3C1XA 4KBCA 3DGKA 1FVRA 2YJRA 2GQGA 2PK9A 3RZFA 4D2SA 2ETKA 4QNYA 3PY1A 2CNVA 4JI9A 4FF8A 1O6LA 3M42A 4RFMA 3FDNA 4BL1A 3OWJA 1YQJA 3KFAA 3PPZA 3QTQA 1YOLA 1FVTA 3HMMA 1YWVA 3UBDA 3FMLA 2XIXA 5ETAA 3E62A 2JLDA 4WBBB 4CCUA 2P2IA 4FZDB 2BRNA 4BI1A 5J9ZA 1NVQA 3RM7A 3BGZA 3BYOA 3PPKA 3G90X 3P7BA 5K9IA 3LPBA 5FGKA 3MH3A 3V8WA 3NAYA 5CT7A 3EB0A 3FSFA 4W4XA 2YM5A 4AOJA 4ZJIA 2B9IA 4CNHA 1BLXA 4L67A 1OECA 4FKRA 4RFZA 1NA7A 5J8IA 4R3RA 4CFXA 4AFJA 4RMZA 2OZAA 4FV1A 4IMYA 4J99A 4RX8A 2BROA 3R1NA 5AUWA 4NW5A 3S4QA 4XX9A 2WTJA 5CLPA 4WOVA 5GINE 3QUDA 4OAUC 2V62A 3UC4A 4C61A 4DFBA 4C3RA 3MFSA 3F9NA 1KSWA 4FBXA 1J91A 1PYXA 3DJ7A 5JGAA 5C8NA 4QYEA 2BVAA 3LJ1A 2XK9A 3Q4CA 1UKIA 4YZBA 3BHTA 3I5ZA 3BYSA 3HV7A 3KQ7A 4FTJA 2Z2WA 2ZMCA 2R3OA 2CNQA 2IVTA 3D4QA 4UB7A 4A7CA 1U5QA 5FLFA 4D9TA 3ENHA 3L9LA 3TDVA 1AGWA 4E5WA 5AR4A 4RWKA 4PF4A 2C6KA 3KXNA 4E5BA 1ST4A 5BVNA 1LP4A 1ZMWA 4C7TA 3U8WA 2E9PA 4I20A 4L00A 4O0RA 1VR2A 3AD5A 5K5NA 1XHAA 3UQFA 4AQKA 1IASA 4M0ZA 2VV9A 3TI1A 1P14A 2CKOA 3W1FA 5EKNA 4HYUA 5CSVA 4FKOA 3W2RA 2VTAA 3R8PA 3ELJA 4EJ7A 1BI7A 5BUJA 2GNGA 3C0HA 3RPRA 3NIZA 5M44A 4NTTA 3FI4A 3E3PA 4NUSA 2X6DA 2OZAB 3CIKA 4IDTA 4M8TA 5F4NA 4FICA 2C6DA 2H34A 2HCKA 3FC2A 3R73A 4RVMA 4IFGA 4BDDA 2QOFA 4DBXA 3KXZA 3JY9A 1H24A 4MK0A 1NVRA 4GYIA 4FTNA 5CS6A 3RAHA 1Q8YA 2QVSE 4AG8A 4IFCA 4CV8A 3NMUF 4ZTNA 4C4EA 4XV1A 5LQFA 3G9NA 3GFEA 4MH7A 4M69B 3TTJA 3ZONA 3OW4A 2VAGA 4EK6A 2OXDA 3KMWA 4DG2E 3QRTA 3EN4A 3W32A 3UPZA 4GS6A 4WD5A 4ONAA 1GNGA 4L6QA 4QP1A 1AQ1A 4Y5QA 3DTWA 4MQ1A 4Q2AA 1G5SA 1W98A 2R3FA 4AN2A 4D2VA 3PUFC 4FZ7A 3GCQA 3ANRA 1DAWA 4MXAA 4E4LA 4GJ2A 4HYHA 2QKRA 3FQHA 3QC9A 3DQXA 5J1VA 3EN6A 1JLUE 1G3NA 3FI3A 1R0PA 3DKFA 2J0MB 4RC3A 4ACDA 4F9YA 1WVXA 3QKKA 3CPBA 4FL2A 5KMKA 3HL7A 2OG8A 1OL7A 2XF0A 4RT7A 5FP6A 4EONA 4FEVA 5DLSA 4TPTA 3H0YA 4QMQA 1L8TA 2OLCA 4II5A 2CGXA 1ZAOA 5KZ0A 2YHVA 4BIEA 3CPCA 3BU6A 2HW7A 3HNGA 3UTOA 4C33A 4OTPA 4BBMA 4CMUA 4XV3A 3THBA 3TT0A 3R22A 3TJCA 5AUTA 2WEVA 5BMSA 4JQ8A 4IB3A 4PPCA 4XG6A 2X2LA 5GZAA 3RWQA 1NXKA 3ITZA 4ITHA 5IA3A 2R3LA 3NX8A 4GEOA 3UYSA 2EB3A 3PJ3A 3MIYA 4PV0A 5DH3A 2O0UA 5EG3A 5DT0A 4O1PA 4DAWA 4CFNA 5EOLA 3UVQA 4CLJA 1F5QA 2IZTA 3DCVA 4LRKA 5FD2A 3ZZWA 2VTMA 3GBZA 2CCIA 3WARA 4F0GA 4FKUA 1JOWB 2P33A 3FWQA 2E9UA 3QKMA 3QU0A 4ITIA 4DFYA 1G8SA 4LM5A 4RC4A 5JGDA 3LM0A 3IPHA 4BI0A 3V01A 3A7FA 4TRLA 4GKIA 1ZYDA 2C6IA 2QOQA 3OCGA 5FQDC 5DFPA 4F7JA 5HZNA 3FBVA 2OJ9A 3POZA 4FNWA 4FUXA 2H8HA 3GCUA 1QPEA 3ZRMA 1TQIA 2BAKA 3KXXA 4Y95A 3TV7A 1RQQA 3W2CA 2VRXA 4E8AA 2EB2A 3VS0A 3RK9A 3FL5A 4MAOA 3CTQA 5CAQA 3DBFA 4I5MA 5AR2A 1XWSA 4RFYA 4AS0A 1A9UA 1WMKA 2W9FB 4A4OA 1UWJA 3V51A 4GKHA 4IJ9A 4QQTA 2CKPA 3I60A 3TWJA 5CZHA 3KREA 4LI5A 4CG8A 5CZIA 2YCQA 2PMNX 5J5SA 3BI6A 4EHGA 3DT1A 2PZIA 3HA6A 3FMJA 3NYOA 3QBNA 1STCE 5AP7A 4ANLA 5CSPA 5ANGA 4CMOA 2X2KA 4YR8A 4R8QA 5FTOA 3KVWA 4DEAA 2IPXA 3H9OA 3DBEA 3LFAA 2XARA 2X4FA 4QRCA 4ZEGA 3RNIA 3V8TA 4I6HA 3JY0A 2ETRA 2G9XA 4OTRA 3E8CA 3S95A 3HECA 5C8KA 2BFXA 5IQFA 5TF9A 4RC2A 5LMBA 1K9AA 4O6LA 4AXDA 4BZNA 1CTPE 3MFUA 3L8XA 3O7LB 5HBEA 5AV4A 2F57A 3A7HA 3TCPA 3PIXA 3G2FA 5HG8A 2XP2A 2E9VA 5DI1A 4G3DA 2AYPA 1ZZLA 5L2SA 2DYLA 1M2QA 2HK5A 4OTWA 4IZAA 1OB3A 2CHLA 4E3CA 4E6AA 5E90A 3PJ2A 3RKBA 1BI8A 3O71A 2B0QA 5IDNA 2V7OA 4UMRA 1WVWA 3ACJA 2VWYA 3T8OA 2WMRA 3JUHA 1YXUA 4KS8A 5B2MA 5IDPA 4FUYA 3KULA 2FSMX 2PVRA 2BZKB 4F64A 2GFSA 5M09A 3VS6A 4M15A 3RNYA 2PZRA 4ZY6A 4GL9A 4MVFA 4CYJA 1OL1A 3DY7A 5JZJA 3OZ6A 1H00A 5BVOA 5LVMA 1GIHA 3LQ3A 2CKEA 3WZEA 2C3KA 4K2RA 5FEEA 4CQGA 3U55A 2QO2A 3LFSA 3RAWA 3F6XA 2BUJA 3AD6A 4HPTE 4NEUA 4RIOA 4CRLA 4ZOGA 3PRFA 3RHXA 3ORPA 3WZJA 3F88A 1OVEA 3GQIA 5J95A 3UOHA 4FZAB 1Z5MA 3IGGA 2HWOA 2VTIA 4X3FA 3QCSA 1GIJA 3VW6A 1R78A 2RFEA 3H10A 4QP7A 2W1ZA 2VTOA 4IAZA 2VWUA 4XRJA 4LUDA 1H27A 1PMNA 3IO7A 4G34A 3POOA 3HV3A 3IKAA 2ZMDA 4WHZA 4ALUA 1YI6A 4LDTA 4BY9E 3UC3A 4LUEA 5JZNA 3BELA 2PE2A 2UW6A 3I0OA 4UZDA 4U41A 3ZO3A 4GCJA 3BLHA 2VTLA 5GZ8A 4H1JA 5HLWA 4DEGA 3ZM9A 4N4SA 3DAJA 5CU0A 1HOWA 1OPKA 4XG3A 1ZYCA 3VQUA 4Z9LA 4O0UA 3QRJA 1T46A 5K4IA 2VD5A 3KULB 1X8BA 2OIQA 3R7EA 2O63A 1YI4A 3EFWA 3FQSA 3LFQA 3C4FA 4C59A 3O96A 3LFFA 4A06A 4MXYA 3E63A 3LFBA 2WMAA 3QWJA 5JFSA 3TACA 2PZPA 1OPJA 4B9DA 2UZNA 1WVYA 4RWLA 2PMLX 3NNUA 2B9JA 3MIAA 4QP3A 3VUTA 3ZU7A 2PVLA 5DT4A 5CAOA 2X7FA 5IQEA 3COMA 4XLIA 4GU6A 2R3HA 4PL5A 5HD4A 4HGEA 4AT3A 1XO2B 3QUEA 4ZSJA 2HZNA 3A8WA 3DDQA 4I93A 5EYMA 3OC1A 3QGWA 2OI4X 2YWVA 4ZP5A 1O6YA 4YPSA 1WBSA 3I7BA 2A98A 2HOGA 5CXHA 3FEGA 3VVHA 4HW7A 3COIA 3C4XA 4EK4A 4YU2A 4O7WA 4F9WA 1FGKA 2V22A 3KMMA 3ORZA 4QQCA 4AA0A 3KC3A 1TQPA 2CN8A 2J6MA 2RF9A 3DNDA 3VS4A 1J1CA 3RM6A 1SNXA 3ANQA 4CD0A 4EOMA 4O7TA 3RVGA 5L3AA 3FSKA 1I44A 5DN3A 4QP9A 4EBWA 4BTMA 2WEIA 5ETFA 2GSFA 5M4UA 1NY3A 1BL7A 4DLIA 3KN6A 3FUPA 2Y4PA 4RGJA 3UE4A 2PY3A 3L9NA 1KV2A 3WIGA 2PL0A 4JAIA 1JAMA 5HICA 3ZUTA 3MSSA 4DE4A 3FLQA 4F0FA 3HRCA 4OAVB 3CD3A 4LGHA 3IW4A 4K0YA 2RL5A 2PUNA 3PSBA 4IX4A 3LMHA 4FRFA 1IEPA 2J0JA 1JNKA 4ANBA 3NNWA 4OBPA 3ZFMA 4ASZA 4DEHA 3MFTA 3P5KA 4AXAA 5B0XA 4DITA 4F9BA 4DFLA 4MNEA 3QQJA 4I0TA 4KKEA 2YEXA 4E20A 1JKKA 4BKZA 2VTNA 3DK3A 3OEZA 1FMOE 2IVVA 4U80A 4OTGA 4O4BB 3I81A 4C2WA 5ANJA 3UOJA 3C0IA 1RW8A 3QD3A 2J50A 2FGIA 3BLQA 3PVBA 5A14A 4DHZA 3WIKA 5TT7A 3UQCA 3F61A 3R7YA 4MQ2A 4AXEA 2OICA 2ITWA 1KE5A 4JR7A 5JK3A 5HTIA 2BKKA 2PYWA 4DF3A 5B7VA 3EL8A 2XNPA 1M7NA 2VN9A