1GOLA

Coordinates of rat map kinase erk2 with an arginine mutation at position 52
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
357
structure length
357
Chain Sequence
AAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIRKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXTRACELLULAR REGULATED KINASE 2
publication title Mutation of position 52 in ERK2 creates a nonproductive binding mode for adenosine 5'-triphosphate.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 110
structure length 357
sequence length 357
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 1996-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1golA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1golA01
4NT4A 2XNOA 1YI3A 1H1PA 3NSZA 4LI5A 4BDIA 4C4EA 5HO7A 4EI4A 5KMJA 1YXXA 4BGQA 4NKSA 1PW2A 4USFA 5I9WA 4FE2A 2BIKB 2OIQA 3P23A 2BFYA 5AR7A 4I0TA 4RWLA 3VHKA 5I9VA 2XIZA 4FT3A 2CNUA 2F7EE 1GAGA 1P4OA 3ZDIA 4FIIA 3ALOA 3CLYA 2YWVA 3TTIA 5KE0A 2OZAB 2CKOA 3LZBA 1KE8A 3AC1A 3DK6A 4IBMA 3QD3A 3QRTA 4BCQA 3QTXA 3EQRA 4XH6A 5IDNA 1RW8A 4EK6A 1XWSA 3UIBA 3QGYA 5IQIA 3FMKA 4FEQA 2WEIA 3U55A 1U54B 4G1WA 4XCUA 2WELA 3DKCA 5HORA 1G8AA 2PPQA 2WMTA 3I0QA 4DGNA 4L46A 3RPOA 2EU9A 3HVCA 3DS6A 4GEOA 3VW6A 5JFXA 5LXMA 2VTNA 5I3RA 2YWPA 5EKNA 1R0EA 5HLPA 2J90A 4KBAA 1H26A 1WVYA 2OU7A 4FR4A 3UNJA 3QCSA 4AFJA 2X81A 2YLEA 4EOSA 4GMYA 3D5XA 4IC8A 4IM2A 1H0WA 4ZSLA 3B8RA 3PE1A 4EUUA 5DT3A 4LMUA 1ATPE 5KHWA 2VTAA 4ZTMA 5IQGA 5EW3A 4U44A 5DG5A 3TN8A 2R3MA 5EQYA 4RIYA 3C4EA 2W9FB 3NW6A 3ZEWA 3DAEA 4NTSA 3CQEA 2JDRA 4AOTA 2UW0A 4BDAA 4TN6A 3KKVA 4MWHA 4U6RA 3UBDA 2I6LA 3L9NA 4Y5QA 1EH4A 3PVWA 4L42A 3BIZA 3NEWA 3PRFA 3ZUTA 4S2ZA 4U80A 3OWLA 1R39A 2OK1A 1OBGA 5IQFA 1OIYA 3FZ1A 3H9RA 3QUEA 4C3RA 2PMIA 3A8XA 2BKZA 4PX6A 4Y73A 4QO9A 3T3UA 2W1HA 4RQKA 5B2MA 3SC1A 4E6CA 5E8YA 3VS6A 4B7TA 5BMMA 4RSSA 3EYHA 3AGMA 4FKWA 3OP5A 4M69B 1Y8YA 4BTMA 3Q4TA 1XH8A 1Z57A 1M17A 2E9NA 4HPUE 3S95A 3DGKA 4HVIA 2OJGA 4D1ZA 2NNWB 4O81A 2VV9A 3CXWA 5JGBA 4F9BA 1IRKA 5M55A 2GHGA 4HCUA 4CSVA 3FI3A 3R8UA 3O7LB 4O21A 5CSHA 4DF3A 2XJ1A 3KRLA 4H1JA 1XR1A 4NK9A 2GHMA 4C2WA 3GENA 4GVJA 3O50A 5KHXA 4D2PA 3QTSA 4IAYA 4BDGA 4FODA 5IEVA 1S9JA 3BEAA 4FNYA 2J6MA 4KSPA 5CT0A 5LMKA 1J3HA 5EQEA 3MH0A 1WBSA 3MPTA 3HP2A 4L01A 5FDXA 3NYVA 5ANGA 5AV0A 4AN9A 5KX8A 1TVOA 4C58A 2QG7A 1JNKA 3EKKA 4RWIA 2J0MB 4FTQA 4FV6A 4BCJA 3I7CA 4I23A 4BWXA 1U59A 4A4OA 2CLQA 4KIQA 3R8ZA 3ZS5A 2XZSA 4FT0A 4B0GA 3OOMA 3C7QA 4TKSA 2W1GA 5KUPA 3HMMA 5J7HA 2H9VA 5JRQA 5KMKA 1OPLA 4BCIA 1O9UA 2RL5A 2WB8A 2OJ9A 3VNTA 4B8LA 3OEFX 5BUJA 2RFSA 5H3QA 4D9UA 3DBCA 3I79A 4BR3A 4GV1A 4EQCA 3D7TA 2W7XA 1M2QA 3NNWA 3ZCLA 4YTFA 3I7BA 4O7SA 1OKWA 4TTHB 5D41A 4F7LA 1PHKA 4H05A 5GJGA 4YJRA 3LM5A 3TIZA 5HLWA 2VNYA 1RQQA 3NAYA 4R5YA 5AIKA 4NL0A 1WMKA 3QQKA 3R1QA 4C3PA 4MQ2A 5D12A 4UMPA 5AA8A 5DI1A 5GIOE 3F7ZA 2QKWB 4K8AA 1G3NA 4BF2A 4EYJA 2ONLC 3CCNA 3HLLA 2WTIA 4JDKA 5CEIA 5C8KA 3EKNA 1H1QA 4BDHA 5K4JA 5BMSA 4D9TA 4ERWA 5K4IA 4YZMA 4MXXA 3TV4A 2EB3A 3B8QA 3CD8A 1Q8YA 2BCJA 2QR7A 4FTMA 4YZNA 3Q4ZA 2JAMA 2BZKB 3L8SA 3MA3A 4NCTA 4TNBA 5EW8A 3ZC5A 2OZOA 3DBDA 4C38A 4RLLA 3FMLA 3LHJA 4EK4A 1IAJA 4RIXB 5DYJA 5IU2A 4IVCA 4ZMEA 1OPKA 3EJ1A 3E64A 3ZO1A 3TV7A 3SQQA 3SKCA 2PMLX 3ANQA 1AGWA 1UNGA 1TQIA 2P33A 2R3GA 5DNRA 4E3CA 3F3TA 3UVQA 4JLCA 4QYFA 4Q5HA 2VX1A 3R9DA 2WMUA 4DTBA 2J0IA 2WQNA 3QTRA 4WHZA 3C0IA 4X2NA 4B8MA 4BFMA 4A4XA 2BVAA 3L8VA 4TYHA 4DEHA 2YDKA 4BI1A 4E5BA 2ZJWA 2XB7A 4HNFA 4KIKB 5DN3A 4DC2A 4RA4A 3QYWA 2BHHA 2W1DA 1CKJA 3CQWA 3VS7A 1HCLA 3AGLA 4JVGA 5HVKA 3N4TA 2UZOA 1PXIA 4JRVA 1WBTA 4FEWA 5HE3A 3R7VA 5HD4A 1JWHA 4USDA 5EOLA 2QOOA 4I94A 3PWYA 4EOJA 4C61A 3I0OA 5IQBA 3PDTA 1QPJA 4GT5A 2QOLA 2UZNA 5CF6A 1BLXA 2GS6A 4RBLA 4FSNA 2KTYA 4U97A 3VBXA 3LXKA 2HZ0A 4LGHA 4QMLA 3G15A 4E26A 4X2FA 4RRVA 2PE1A 2C30A 4U3YA 3QTQA 3P0MA 2J0KA 1QPEA 1YXSA 4BWPA 3R9NA 4L3JA 4ZAUA 3ULIA 4FL3A 3Q32A 3HZTA 3R2BA 3BLQA 3DK7A 3EQHA 3CJGA 4WSYA 1M14A 5HBHA 2X7OA 3ZM4A 4D0XA 4FNZA 3SVVA 1ZY4A 1U46A 3MH1A 2QOIA 4DGOA 5M53A 5CSXA 2OW3A 4QP1A 5CQWA 2FSTX 1CKPA 4FNWA 4ACMA 3TKHA 3KN6A 1CKIA 3PJCA 2VNWA 1APME 3U4WA 3FZOA 4TWCA 2C0OA 3WZKA 5CVHA 3NPCA 1U4DA 3BU6A 5HD7A 4IB5A 3PA4A 2WZJA 4GUBA 2ITUA 2Y4IC 3TTJA 4O0YA 4RZWA 2RF9A 3PVUA 4PUZA 3RPYA 3VBVA 4HNIA 2H34A 2XUUA 2VX3A 2CN5A 1URWA 3NCZA 3QFVA 2O65A 4YLLA 2WQMA 3DZQA 5FD2A 1RDQE 3LFBA 4NM5A 1KOAA 2X1NA 4F6SA 4U45A 1U54A 2R3FA 4L45A 2GQGA 3KXMA 4BZDA 4DBNA 4RPVA 4YJTA 3W33A 5IF1A 1OL1A 4EQUA 3LOKA 4DGGA 3FAAA 3HMIA 4YJOA 4V0GB 4QPMA 4BHNA 3W10A 5D7VA 2H6DA 4QP6A 3CGFA 4BCPA 4U41A 2PMNX 3MPAA 5EG3A 2R3QA 4O22A 3ZU7A 4EH7A 4QYEA 3F69A 2A0CX 2VRXA 4RFZA 3HAVA 3V3VA 3FHIA 3AD4A 4AZVA 2WAJA 4E93A 2GNJA 4FK3A 1OL6A 2VTHA 4I6HA 2WTKC 4QQJA 3HV4A 1CMKE 4JDHA 4OTGA 5EHOA 5ANOA 5BUEA 3TDVA 2GS2A 2ZYBA 4Q5EA 4YZDA 1MRUA 2VTOA 2OF2A 1JSVA 2ZM1A 3EN9A 4FZAB 4F4PA 1NW1A 5IEYA 3P7AA 3A62A 3Q6UA 2PMOX 4BBFA 5BVNA 4AACA 1ND4A 4E4MA 4C4FA 4D1SA 3K2LA 3MFSA 3UGCA 5M4IA 4F9AA 3TUCA 2XM8A 4R3PA 2B9FA 3CY3A 1OECA 1YVJA 2Z60A 4ORKA 2YDIA 2BROA 2I0HA 2W17A 3HV5A 4X6QC 2PZ5A 3JY9A 3MTFA 3SDJA 4WNMA 4U7ZA 3QKMA 3P1AA 4ZTNA 3ZO4A 4E8AA 1CM8A 4M69A 4K1BA 3NUNA 3RHXA 3EB0A 2CKQA 4CMOA 3COKA 1E1VA 2I0YA 5L2QA 5GINE 5JMSA 4D4RA 3OZ6A 5CZIA 2HZ4A 3H9OA 3DBEA 3U51A 4I0RA 3V6RA 5IQEA 4KRCA 2WD1A 4WG5A 3W18A 2DWBA 1REKA 3W2QA 3W2CA 5CAUA 2VGPA 3ZHPC 3OC1A 3IGGA 2JITA 3NX8A 3PXZA 4FEUA 4ZLOA 1WFCA 4UXLA 3TJCA 3UE4A 2YM3A 3R28A 5J7BA 3D9VA 2BALA 2HENA 2Z2WA 3EFJA 4I3ZA 2R3LA 4ZOGA 2UZLA 4YHJA 2Z7SA 4A07A 5BYLA 3CC6A 3WI6A 5F94A 1K2PA 3C51A 4LMNA 2J5EA 2YN8A 3R7IA 2X6DA 3FI4A 3D5WA 4KUJA 5LARA 4G3CA 1JSTA 4JQ8A 3DBFA 3Q52A 4EC9A 2ZV7A 3R00A 5E90A 5K0XA 3PUPA 2BRGA 1L8TA 1TQPA 3IQ7A 4GU6A 3BYUA 4DINA 4AW2A 4LM5A 1AD5A 2VTPA 3IECA 4DFLA 5KMOA 3OUNB 4DH7A 3Q9WA 4ITIA 4PQNA 2C3IB 3T9TA 3PLAE 3E7OA 2GPHA 4BGGA 3NRMA 4M8TA 3MY1A 3QALE 2IW6A 5IEXA 3IK3A 2XYUA 3DB8A 3SOCA 5CAPA 2YIWA 4KKGA 2IJMA 3OBGA 3TDWA 4S31A 1RJBA 1R3CA 3EFWA 3ORPA 2GTNA 3UYSA 3VUTA 4WOVA 4AA5A 3F9NA 4FMQA 3O51A 2R2PA 5AP4A 4X2JA 1Q5KA 3FYJX 2XEYA 2HY81 1NY3A 2PZYA 3GCVA 4DH3A 3FKNA 3OVVA 4F0GA 3NMUF 2X8IA 4WT6A 5KNJA 2X2KA 5CI7A 3SW7A 2C3JA 1JKTA 2E9PA 5HIDA 4BY9E 3ERKA 3I6UA 3I6WA 4QNAA 5FUTA 4F99A 3R1SA 4JQEA 4Y85A 4KKEA 4UB7A 4LGDA 5F1ZA 3R7OA 2XRUA 3TUBA 4K11A 2E2BA 3WYYA 1Y57A 4HZRA 3EQGA 3ZXTA 4CQEA 5B2KA 4EEVA 3AMYA 3AC8A 4RIXA 2R0UA 2VUWA 3VBQA 3P86A 2VWIA 4F9WA 2Y4IB 4G6OA 3BWFA 3IOPA 4Z7HA 1ZMWA 2GFSA 3KC3A 5LVNA 2FSOX 1BI8A 1Q61A 1JVPP 2XIYA 2XKEA 3FJQE 4KS7A 1H1WA 4YLKA 3RWPA 2UW3A 4DEIA 3BHTA 1UWHA 4FV5A 1YHWA 3D94A 3FZTA 2UZWE 4TT7A 3KFAA 3DQWA 4ZSAA 4XRJA 2XK6A 3OF0A 4CYIA 5IISA 1ZMUA 3R9RA 5JRSA 2GNFA 3PFQA 1XH4A 2WOUA 1GZNA 3IO7A 4KIKA 4BDCA 4EOMA 3CTJA 4XBRA 3RZBA 4FTRA 3W8LA 2E9VA 4Z3VA 2IVSA 4O96A 3WARA 3LXNA 4IAAA 2OH0E 3ZZWA 4IWQA 3A7IA 3RK7A 5AUZA 1PJKA 4JBQA 5CVFA 2G2IA 5JH6A 3LMGA 2QCSA 4BB4A 5E8WA 2WTKB 3ZEPA 1WCCA 5CU3A 5HNBA 3DB6A 3TM0A 1Q97A 3F61A 4MD8E 4YJSA 5CAQA 4MXAA 4DGLC 1FGKA 3MDYA 3GC8A 1REJA 2B1PA 5ANKA 2VTTA 2W5AA 3N51A 3O8PA 3BI6A 3WZJA 3T3VA 3MVJA 4D2RA 5E92A 1H4LA 3JVSA 3TL8A 3BGZA 4PF4A 4JNWA 4YZCA 4ZLYA 2XVDA 5DR9A 3FMEA 1PXLA 5EFQA 2PL0A 4HGSA 4JBVA 1XJDA 2WMRA 3MB7A 4L9IA 1CSNA 4H39A 3ZMMA 2WO6A 2ETMA 4L68A 1H00A 3GU5A 2JIVA 4M67A 5AR8A 2OFUA 1YWNA 3RNYA 2R3NA 2HZNA 4LQMA 4FTLA 5FG8A 5AAFA 3OMVA 4E73A 4CD0A 3LJ1A 2R3PA 4O0TA 4DEEA 3FLYA 4GKHA 2VWXA 3O71A 3LFSA 5LMAA 5M4FA 3Q2MA 4IANA 4AN2A 1UU8A 3QGWA 4ID7A 4E5AX 1YHSA 3G33A 3RTPA 4AZWA 5HU3A 5IQAA 4WUNA 1OL2A 1QL6A 4N70A 4J98A 4YSMA 3SAYA 4CQGA 3C4WA 3LFFA 3R01A 5L8JA 2CGUA 3C0HA 3KRRA 5E8ZA 4D0WA 5CEQA 5IA4A 5IMXA 3OHTA 4OTQA 2YA9A 3UO6A 4ITJA 2BZIB 4RX5A 2XKDA 3LFNA 3AD5A 3CGOA 3OWJA 1WBWA 5H8BA 5J87A 3RPVA 1XH6A 4L53A 4X3FC 1KOBA 3OW3A 4W9XA 1JKKA 5CVGA 4I1ZA 3QTIA 2I0VA 3LQ8A 4V0GA 4ZZMA 4BI0A 5DT4A 5EM8A 3KREA 3LCSA 2FUMA 4ANQA 3AOXA 4YTHA 2HXLA 4DCEA 4C4JA 2PVNA 4LGGA 4Y95A 5J5TA 3HNGA 4RJ8A 4XYFA 4O91A 3F2AA 3FV8A 4YJPA 4NFNA 4H3QA 1WBOA 3GI3A 2FA2A 4PV0A 3OCBA 4HZSA 2C4GA 3RKBA 4AW0A 4C4HA 4R8QA 1T46A 3QTWA 2PWLA 5HE0A 1K3AA 1WBNA 1XH9A 1YWRA 2BDFA 3DTWA 4CRSA 4YMJA 3L8PA 5AP7A 3I5NA 4FVRA 3ZLWA 4MBJA 2WPAA 3OTUA 2V5QA 4FYNA 1P5EA 4NW6A 5DGZA 3RK9A 4I5PA 4FTIA 4DTAA 3BHVA 5HBEA 5AP6A 2XK3A 5C03A 4QMYA 1Q4LA 2JDTA 2DS1A 2GMXA 4GCJA 3VS4A 3F5PA 3V6SA 2PZIA 2ONLA 4FV2A 4DEDA 4FV0A 4HVGA 3G0FA 4S30A 1XHAA 4IB0A 4R1VA 4JJRA 4BDDA 3EOCA 3GU8A 3EQFA 5AWMA 3F3UA 2XNBA 3QQJA 4LFIA 5HBJA 4F7SA 4GSBA 2P55A 5HESA 3VAPA 2BRHA 4JX7A 3ZUVA 3ZUUA 4RIWB 2V7OA 1LEWA 2WMSA 2IZSA 2XCKA 2ZV2A 1VYZA 3ZYAA 4EWQA 4UMUA 4EONA 1XO2B 3DOGA 3EQDA 4KSQA 4CFXA 4IWPA 3WE8A 4YO4A 3PSCA 1UKIA 4EJ7A 1KUTA 2HAKA 2YM5A 1MP8A 2W4KA 4KKHA 1OL5A 3DKGA 4TPTA 3FZSA 2QNJA 2RFEA 3UIXA 1MQBA 1MQ4A 3EQCA 3KQ7A 4NIFB 4S32A 2Q83A 1PXNA 2I1MA 4EOKA 4CFWA 4C36A 3LVPA 3UO5A 1YXVA 4BBMA 1J7UA 2PSQA 3M2WA 3E63A 2YM6A 2OXDA 3W55A 5AIRA 4YHTA 1FOTA 3QTZA 3FZRA 5FTOA 1OGUA 3K3JA 5EI2A 2R7IA 2HIWA 4I22A 4P5QA 5HCXA 4F65A 4FG8A 2CNQA 3H4JA 3MFUA 1OKYA 4GU9A 4O0UA 5DBXA 4BWKA 3F82A 2ZB0A 3BV2A 4FVQA 3U9CA 4YP8A 2Q0BA 1RE8A 3FL5A 3GUBA 4AE6A 3HX4A 2AUHA 4NJDA 3KVWA 4RJ5A 3SXFA 3KMMA 3P4KA 4DH5A 2YIRA 5FXRA 5HQ0A 4CFFA 3GT8A 5DLSA 4ALUA 2X9EA 3HRFA 3U54A 3F3WA 5I9UA 5CX9A 1FBNA 4IWOA 2IO6A 2YCQA 1W83A 4RX7A 5E8SA 4NH1A 2J2IB 3FXXA 4IAFA 4DFXE 3EWHA 4GFGA 4QP8A 4XUFA 3K5UA 1FVRA 1XKKA 3OD6X 4OBPA 1ZLTA 4MBLA 5T6KA 3ATSA 2O5KA 4GVAA 4PTCA 5CF5A 1Q41A 2V7AA 2PVYA 3LFDA 3DLSA 4AU8A 2BRNA 1PMVA 4CFNA 3FYKX 4BCOA 5CU6A 2R7BA 3QCXA 2BPMA 4EOPA 5LCKA 1CTPE 4PMSA 3PG3A 4L43A 4XEYA 4JAJA 5DR6A 3R8PA 3W16A 4DFYA 1Y6AA 4EK5A 3FSFA 4R3RA 4RJ3A 4J8MA 4TWOA 1H0VA 3C5UA 4G2FA 4V04A 5DT0A 1URCA 3R22A 3DK3A 2IZRA 3DAJA 3VUKA 4LL5A 2WNTA 4C2VA 3IW6A 2VO7A 1FPUA 4L00A 2XNMA 3D4QA 3FBVA 4FG9A 4R6VA 2I40A 4TYJA 2IZUA 3RAHA 4M66A 4U79A 2HCKA 4L3LA 3GCUA 4W4YA 4NZWB 4BL1A 4IAIA 4TXCA 4X3FB 4AOJA 1W82A 3JXWA 3OT3A 3AT2A 2PE2A 1P4FA 3OXIA 3W32A 4X7QA 2IN6A 1DAWA 3LCKA 3VJOA 4K33A 5CTPA 2XNEA 3RZFA 1PXJA 5IH4A 3QCQA 4L8MA 3OWKA 2ITQA 4L3PA 4RJ7A 4JX3A 4BCFA 3S0OA 4RX9A 3UOLA 2X7FA 2XMYA 4DLIA 4EH4A 1P14A 4X3JA 2UW4A 1H1RA 5AX9A 3FI2A 2X6EA 3HMPA 4AXAA 3JUHA 1ZYDA 3QRKA 3KRWA 3WF7A 2R3RA 4ZTQA 4ITHA 4EH8A 5C4KA 2IW8A 1KV2A 3PA5A 3QLFA 1LR4A 3JR1A 3NUSA 3HYHA 3UZTA 3LW0A 3FL4A 4A7CA 5A54A 4QQCA 3R7UA 2OH4A 1UWJA 2R3JA 3TWJA 4PWNA 5FP5A 4A9UA 2ZOQA 5AR4A 3N4UA 3ETAA 2ZM4A 3R83A 4CMTA 4ALVA 1XH5A 2YCFA 5LVPA 4I21A 3DJ5A 4KAOA 4A9TA 2J0LA 3BQRA 5L8KA 5HGIA 1FQ1B 4IX3A 4XG2A 5JGAA 4GJ3A 2QLQA 2VZ6A 3ZONA 1A06A 2ETRA 2B55A 4JBOA 5AP2A 5FRIA 3WZEA 4I5HA 3TV6A 4ACCA 1MUOA 4CFVA 1DI8A 5J79A 5DEWA 4O84A 1JLUE 3CD3A 3KXGA 2JKQA 1M7QA 3G5DA 3KN5A 4HYUA 4WBBB 4AGWA 4YURA 1QPCA 2X4ZA 4YUQA 4M7IA 3D7ZA 1IEPA 1H07A 4XG7A 4LRJA 1NA7A 2VWVA 4BCGA 3MIAA 3PXQA 5T68A 4A9SA 5HLNA 4DEBA 4YC3A 4QTCA 4QYYA 3W8QA 5L6PA 4CT1A 4I6QA 5FLFA 2YM4A 3QA0A 4H1MA 2YEXA 5FXSA 3G90X 4FBXA 5HE2A 4LRMA 3NIEA 2J51A 1YOMA 3E7VA 2EUFB 3BWJA 1O6LA 2NRUA 4MVFA 3A7FA 2P3GX 4WKQA 5CENA 2VTMA 3OWPA 3FSKA 3UQGA 3CKXA 4F08A 4FOCA 3GNIB 3VS1A 4ZTRA 4K77A 4IX5A 3RM6A 4FT5A 2Y8OA 4BZNA 2B7AA 5HOAA 3R7GA 2QD9A 2C6DA 3Q6WA 4O7VA 2VWWA 4NWMA 3ZRMA 4XRLA 3LMIA 4BDFA 1DS5A 2PVMA 4Y8DA 1DAYA 2B9HA 5E1EA 3V51A 1M7NA 3MPMA 3JYAA 3WF5A 1PRYA 2DQ7X 1TKIA 4WNOA 4FSTA 2X7GA 3TIYA 3DXPA 1Q8UA 3IPHA 4JG6A 2GNIA 3NVKI 4MXZA 4FTTA 5CALA 5HX6A 4BBEA 4XNEA 4X6RA 5KKRC 4NU1A 1H08A 2G1TA 2PVKA 3ORXA 4FKIA 4IEBA 5FTQA 2QR8A 3AC2A 3VUHA 4DFUA 3LJ0A 3FKOA 3P5KA 4AA4A 2BZHB 2X39A 4EQMA 3PIYA 5EK7A 3QQUA 4MCVA 2OLCA 1AQ1A 5H8EA 1H8FA 3UIMA 1SYKA 4J52A 4FKUA 2QKRA 4RVKA 3ORKA 4F1TA 3KL8A 4EYMA 3TACA 2OJIA 5IH6A 4IVBA 5AR5A 5DR2A 5ETAA 4E6AA 4DN5A 4BZOA 3AC5A 5L2SA 3ID6C 5A3XA 3PSDA 2WGJA 4ONAA 2ZB1A 4IDVA 4MXYA 3W1FA 4EZ7A 4RIWA 4GFOA 5HZNA 3D14A 5AR2A 1PMUA 3EZRA 4FIGA 2PE0A 2UUEA 3FZPA 4O0XA 4QMSA 4DG0E 3UODA 4FTKA 3ZRKA 1J1CA 1PYXA 4OTRA 3A7JA 4DEGA 2LAVA 2YIYA 4J53A 4ZS0A 1OBDA 4L7FA 3GVUA 3PP1A 3ZBFA 1UU7A 4CZYB 2JBOA 3HRBA 3VC4A 3V8TA 2XKFA 3KXXA 3PWDA 3ZZEA 5J9ZA 5CAVA 3ZSHA 4LUDA 1GNGA 2PVRA 4F70A 1DI9A 4CEGA 3C4CA 4IZAA 1YDSE 2PHKA 2Z7RA 3H0YA 4HCTA 3VULA 4E4XA 4I24A 5D11A 4AWIA 3L1SA 2XJ0A 4ZEGA 2W5BA 5E9EA 2B9JA 3DTCA 5CI6A 5I0BA 3TNQB 2WHBA 4E4LA 5J95A 3F3VA 4O83A 4PL3A 5DVRA 4O6EA 4F1OA 2UZEA 3L8XA 2SRCA 4KB8A 4GRBA 2Y6OA 3NS9A 3MY5A 4O7ZA 4FZFB 2BDWA 3KA0A 1XH7A 5IUHA 5J9YA 5C26A 3RAIA 5AV1A 3FC2A 4KWPA 2J5FA 1W0XC 2YITA 3BGPA 4IW0A 4LOQA 5IZFA 5CNNA 2IG7A 4Z7GA 3FWQA 3QRJA 4ZIMA 3MJ1A 4RA5A 1VJYA 3ROCA 3N9XA 5FP6A 4ENXA 3BCEA 2X2LA 4KABA 1BKXA 2FSLX 4QMZA 4BKZA 4CKJA 4TYIA 4XMOA 5B7VA 1WVXA 4A9YA 4UWYA 3EQPA 2W1IA 4HOKA 5TKDA 4KA3A 1JKLA 3B2WA 3GQLA 4X0MA 1VYWA 3BYVA 4FKTA 5CY3A 5FEQA 3VJNA 2WIHA 4AQCA 4GJ2A 5AUTA 4XHKB 3UVPA 3DPKA 4HVSA 2ITXA 2JEDA 2WXVA 3SRVB 2BAQA 4GYIA 5GZAA 4ACDA 4RMZA 4AA0A 4OR5A 1Y8GA 2OJJA 2Y7JA 2OZAA 4IAKA 2R3OA 4U40A 4YTIA 4BIEA 2F2CB 2C6OA 2HW7A 3BELA 4HPTE 4B6LA 3I60A 3RWQA 5IMEA 4O0WA 2C47A 3TKUA 3ZBXA 4CTBA 4M15A 3PA3A 3IGOA 4FUYA 2JKKA 1XBCA 2W1ZA 2X0GA 3C0GA 5AMNA 4D2WA 5I4NA 4ZJVA 1A48A 5AFVA 4IADA 3KULB 4I93A 3C13A 4FEVA 3RGFA 4HGTA 4U42A 3F6XA 4C3FA 1KWPA 4RJ6A 5M09A 1JQHA 2HOGA 4NM7A 4PTEA 4XV3A 4PDYA 3F66A 1IASA 3G9LX 5E7RA 3R7EA 4D2VA 3LXLA 2R3KA 4Y72A 4UWBA 5EM7A 4X3FA 3BBTB 3QX4A 3HV7A 3BRBA 3LFEA 2Y4PA 3B2TA 4JXFA 4FKRA 4B99A 4BIDA 2BUJA 3E93A 3RCJA 3V5TA 4AX8A 1VEBA 4C35A 2H96A 3IDCA 4ZS4A 2G15A 3R04A 1KE6A 4PPBA 5I5ZA 3E8NA 3LXPA 4O7YA 4M68A 1JSUA 4R78A 1IA9A 2FH9A 2ITOA 4JDJA 5AM6A 2GS7A 3NWWA 2VTRA 5HHWA 3SW4A 3H3CA 3PRIA 4J7BA 4S34A 3FQEA 4O7LA 1U5QA 4FK6A 4HYHA 4Q2AA 3RCDA 5EM5A 4X21A 1KE7A 4GG7A 1OUKA 3O0GA 4Z55A 3AG9A 4IHPA 2W0JA 5A14A 5KKRB 4N57A 1ERKA 4H3BA 2WMWA 4MNFA 4O27B 4RZVA 1W7HA 2GSFA 4NW5A 2WQOA 5G1XA 4QMUA 4ZZNA 3MYGA 2XYNA 3KK8A 4E6DA 2C6TA 4N6ZA 4Z9LA 1T45A 4R7BA 3AXWA 5HU9A 4FIFA 3TCPA 5CU2A 3HECA 3LFQA 2WMVA 2Z02A 4OBQA 4WSQA 4QP9A 4MHAA 4AZFA 5BYYA 5FM3A 4KIOA 2HZIA 2XCHA 3PVBA 3QQFA 4OTFA 4MF1A 2C1AA 3F3ZA 5CU0A 1OB3A 5JFWA 5E4HA 4FI1A 5BQ0A 2R64A 5M08A 2OJFE 2P0CA 3OY1A 4H3PA 3QQHA 4EH3A 3LFAA 5AJQA 3ZRLA 4XBUA 2XK8A 3Q4UA 5EM6A 3VS5A 2J9MA 4D4SA 2UVYA 2CLXA 3C4ZA 3F88A 4ANOA 5I3OA 3QXOA 1Q99A 4FOBA 4C4GA 3ENMA 3JY0A 5M44A 2O3PA 3NGAA 3E92A 3GBZA 3F5GA 2OBJA 3I5ZA 4CLJA 1YOLA 5H9BA 2YHVA 3S3IA 1YKRA 1LEZA 4YO6A 4LV8A 4PNIA 1TQMA 3DY7A 2BAKA 2ZDTA 3NW7A 4G3GA 2BRMA 4MYGA 4OT6A 4P2KA 4Q9SA 3AMAA 5E8TA 2BTSA 3PYYA 5C9CA 5B2LA 3TUDA 4RC2A 5HNIX 1BX6A 1OMWA 1VZOA 2YJRA 3QYZA 4XP0A 2OIDA 3WOWA 3CE3A 2VGOA 4X2GA 4OAUC 2XNGA 5DMZA 4NM3A 2JDOA 4XV1A 4CGAA 4PY1A 3BPRA 3O7LD 3QLGA 5LWNA 3LE6A 4IC7A 3PJ1A 2WU7A 2QOKA 5EDQA 4IM3A 3NW5A 5E8UA 3ZSIA 4BGHA 3PSBA 2Y9QA 5DFPA 5AUVA 2GQSA 4FV3A 4G3EA 4MAOA 4R7IA 2J0JA 5CXZA 4RG0A 1PMEA 4FKJA 5L6WL 5JEBA 5GZ8A 1Z9XA 2YFXA 4BTJA 1HOWA 1PXOA 4FTNA 3KRJA 3CIKA 4AT4A 1Q8TA 4I6FA 5HTCA 4II5A 2G9XA 1UA2A 3BE2A 5J8IA 3F5XA 3VWAA 5CEKA 5LVLA 2WU6A 3MV5A 5HG7A 5DE2A 3RI1A 4LYNA 3W2OA 4OTPA 4YLJA 3UO4A 3VN9A 2CGWA 3KEXA 3TZ7A 2PK9A 2YM7A 3FHRA 1HCKA 2RSVA 3OXTA 4QMTA 4JT3A 4TZRA 4BKYA 3G6HA 1VR2A 2RG5A 4FNXA 2XF0A 4BN1A 4NCTC 3CPCA 2XP2A 4G31A 4YPDA 3EN4A 3SXRA 1SMHA 2R4BA 4AZSA 1OITA 5CT7A 2JIUA 2R3HA 2V55A 3R02A 2C69A 4JQ7A 5IQHA 3BHHA 3UDBA 4BYJA 5TT7A 3FC1X 3NYOA 4TYGA 1ZRZA 5AAGA 3R30A 2WTWA 2IVTA 1FGIA 1KE5A 2C6LA 4KNBA 3TNIA 4ACHA 4CV9A 5IUGA 3M11A 4U3ZA 3QWJA 3FEGA 2QHMA 4RLKA 4CYJA 4DYMA 3SA0A 2XEZA 4OBOA 1ZYSA 3OCGA 4GT3A 2C5VA 3HL7A 2XH5A 4ASDA 4M13A 4H36A 2B9IA 3COIA 1OKVA 3EQIA 3A2CA 2J7TA 5AR3A 2GNHA 2QQ7A 3GFEA 4CFUA 2BAJA 4E20A 2ZM3A 3A8WA 4ZK5A 3FMHA 3E8EA 3DA6A 2YM8A 2R3IA 5AUYA 4EL9A 3RMFA 2CJMA 3UVRA 3CKWA 1E1XA 2HYYA 4RIYB 5EQPA 4I92A 1FVTA 2WEVA 2JLDA 4RQVA 4UMQA 5F95A 4PP9A 1PMNA 3A99A 4ANMA 2AC3A 2C6KA 3CJFA 4BDKA 2FB8A 4EH6A 5L2WA 4IH8A 3U9NA 3GGFA 4P4CA 1XBBA 1M2RA 1Q8WA 4MWIA 4TRLA 2GTMA 3BYSA 3MVLA 4G5PA 4O38A 2QODA 4WG4A 3POZA 3W2SA 4O2PA 4ACGA 1GZOA 4Y46A 5AADA 4BHZA 3GXLA 2NRYA 5CLPA 5CANA 2YZAA 3C4FA 4EH9A 2W99B 2FO0A 2J50A 2UZUE 2WTDA 1WZYA 4CKRA 5FEEA 3DFAA 3P79A 3CSVA 4OLIA 5IG1A 4UX9A 5AV3A 2HELA 3P08A 5FBOA 2QOBA 5ACBC 4CG8A 3DBQA 3HDNA 3WBLA 2O0UA 4QMPA 4RIOA 3SRVA 4AT5A 2NO3A 4A4LA 2X9FA 3WYXA 3P78A 4RX8A 2X8DA 2YAKA 3A7HA 3TNWA 3KMWA 2LGCA 4IJPA 4V01A 2OXYA 4DHFA 4U8ZA 4CV8A 3O23A 2FYSA 5ANDA 3UTOA 3BHYA 4FT9A 5EHYA 1V0BA 5FXQA 1NVSA 4O7NA 3E5AA 3C4XA 4O0VA 3TXOA 3LIJA 2H8HA 3KULA 4F09A 1J91A 2AYPA 3LM0A 3OT8A 4NKAA 4ZY6A 1UKHA 2F2UA 2ITYA 4ZTSA 1KE9A 2VTIA 4UYNA 1F3MC 3DQXA 5JK3A 5HVJA 2CKEA 2OO8X 4MX9A 4O2ZA 1YWVA 2IPXA 5L6OA 5DIAA 2UVXA 4ARKA 2GFCA 3FMJA 4FV7A 5EKOA 4AS0A 3UYTA 4FKOA 4F0IA 4K0YA 4AP7A 2ZMDA 2VWYA 3ZLXA 4QMOA 4FSWA 4BCMA 3FY2A 3FKLA 4XG6A 2JGZA 3CS9A 4HGEA 4UYAA 4G17A 2GQRA 2PUPA 4HCVA 2Z7LA 3R8LA 4QMMA 2OGVA 3EZVA 3RK5A 1YRPA 5EI8A 4IE9A 5HICA 3NCGA 3PPJA 3Q9ZA 3LQ5A 4APPA 3BLRA 3IW7A 4MXOA 1PY5A 3PXFA 2B4SB 3EN5A 3UNKA 4DTKA 2ZVAA 3MGYA 4WRGA 5AP3A 3CEKA 4JIAA 4WO5A 3TG1A 1ZMVA 2BHEA 3QL8A 3NNUA 3Q04A 4G16A 2YACA 4F64A 3TZ8A 2XRWA 4ZY5A 3ITZA 3FXWA 2QO2A 3HV6A 3KVXA 3ORIA 1YQJA 4W9WA 3E87A 4U43A 3HMOA 5KMMA 3COMA 4XV9A 2YIXA 5A9UA 5M07A 4WUAA 4ZSEA 3QCYA 4O6LA 1Q3DA 4PL5A 2JD5A 4K18A 5EDPA 4EKKA 3QTUA 4GK3A 4IB3A 5J9LA 5HO8A 2J4ZA 4J99A 3AC4A 4IZ7A 2ERKA 3VUIA 4BKJA 3Q9XA 3QXPA 3THBA 4C02A 1QPDA 3QU0A 3VUGA 4YGAA 5BYZA 3Q9YA 2QOFA 3M1SA 5DH3A 2IVUA 1M52A 5J5SA 2JKMA 3V5LA 3ORZA 4G9CA 5CSWA 4IWDA 4M0ZA 4NSTA 5F9EA 2QO9A 2OI4X 4C57A 4D2SA 2G2HA 3FLSA 2C6IA 5C8NA 4C62A 4O7WA 3D5UA 3GOPA 3HUBA 2F57A 5GJFA 3FLWA 3LQ3A 3OOGA 3RVGA 5KBRA 2OF4A 2XBJA 3D2KA 4J1RA 4C7TA 3FMDA 5EDRA 5AUWA 4ZP5A 3UG1A 3NUXA 1V1KA 4AZEA 4TNDA 2PVJA 3GQIA 3NYXA 3NZ0A 4FYOA 4RC3A 3VUMA 4D55A 4ZLZA 3SHEA 3QD2B 4FF8A 4R5SA 3DT1A 4YBKA 1R1WA 4OTHA 4AG8A 1GJOA 3Q2JA 3OROA 2O64A 4OW8A 5BVEA 4JR7A 2OSCA 5AUXA 4L6QA 3VF9A 1Q8ZA 3EN6A 3GU6A 3O8TA 3QKLA 4ZSJA 1G8SA 2WQBA 2X2MA 3AD6A 3ACKA 3S1HA 3EMGA 3RBWA 3UNZA 4QTEA 4BCKA 2UZVA 4G9RA 4CVAA 2VWUA 3SG8A 4DE4A 3HAMA 2JAVA 3QZFA 5A4TA 3R1YA 2UW5A 3GCSA 3IDBA 4WNPA 4E6QA 3V04A 3R63A 3MBLA 5GZ9A 1YDRE 5D10A 2XK9A 1UVRA 2RG6A 3QUPA 2VO6A 3NAXA 2B54A 3VO3A 1H24A 3VS2A 4FICA 3MIYA 4RVMA 4EOOA 4CG9A 5BVKA 3DNDA 1Z5MA 2OICA 5CF8A 3G51A 5LVMA 4E5WA 4J8NA 4HGLA 4UY9A 1UV5A 2I0EA 4QMNA 4F63A 3QHWA 5IA3A 4ZXTA 4RWKA 4U5JA 4ZZOA 3LKMA 4FGRA 2C1BA 4QT1A 2WOTA 4O82A 2CGVA 3ORNA 3IW8A 4OT5A 4R7HA 1JBPE 2A4LA 2Z7QA 3DLZA 3ENHA 5DPVA 4HJOA 3NLBA 5HX8A 4I5CA 3DNEA 2XBAA 3SD0A 1Q62A 4CZTA 5E1SA 3MN3A 4JG7A 3OCSA 5KCVA 4F9CA 3WIGA 2YABA 4AZTA 3IS5A 3DKOA 4N6YA 3DV3A 1ZOGA 4LOOA 5HIEA 1BUHA 4WBOA 4CXAA 5EYKA 2CHLA 4DEAA 5M51A 4XG3A 2VWBA 1YI4A 2YLFA 3L9PA 5IDPA 1KSWA 4IVDA 2DUVA 3WZUA 4CT2A 2BRBA 3ALNA 4KD1A 5TR6A 5ITAA 4QD6A 5A4LA 1G5SA 4BVUA 5DRBA 4NFMA 4DG3E 4DT8A 4KINA 3WIKA 5TO8A 4GYGA 4PRJA 2CCHA 2BR1A 3ET7A 1B6CB 3QZGA 3DJ6A 4XS2A 4USEA 5LQFA 5HIBA 4EZ5A 5M4UA 2W06A 3O17A 5JKGA 3LFCA 2JBPA 4FZDB 5I9YA 2RFDA 3MWUA 3EFKA 4C0TA 2C6MA 4QMWA 5F20A 3VBWA 1GY3A 1CDKA 3IOKA 5AX3A 4FSZA 5FWKK 3QHRA 5AAEA 3ANRA 3W2RA 2VO0A 4JG8A 4P5ZA 5ETCA 2E9UA 1H01A 2PTKA 4A9RA 4HW7A 4UZHA 4KBCA 2OWBA 4UALA 4FEXA 5ETFA 4I0SA 4W8DA 4UMRA 2VU3A 3SG9A 4IAZA 5GIPE 4JI9A 1JPAA 4LUEA 3T8OA 4GK4A 3VS0A 5CSVA 4DT9A 4XG8A 4MBIA 3LCDA 4JS8A 1GIHA 2VTLA 3K54A 1W84A 4YSJA 2IZTA 1FMKA 3GC9A 5A6NA 3BU5A 1SM2A 2VX0A 3MW1A 3QZIA 4TY1A 3NDMA 4DBXA 5IA0A 1PF8A 4FV1A 2R5TA 4LOPA 3HDMA 5EHLA 3PPZA 1R78A 3PJ8A 2YZLA 3EFLA 5K5NA 3Q53A 2ACXA 3JVRA 4BTKA 2XIKA 3KK9A 4F6UA 3CTHA 1IG1A 1ZYCA 3SX9A 3ULZA 2CGXA 4GS6A 3JS2A 3BKBA 5CAOA 3ZFXA 3G2FA 4JL9A 5HO6A 4ZY4A 4OUCA 3AC3A 4FSRA 3CY2A 4GK2A 5CQUA 3RHKA 4AOIA 3H9FA 5K9IA 2BKKA 4FV9A 4MNEB 5ETIA 3VHEA 1WBPA 4EK8A 2AC5A 3H0ZA 4BDBA 4MD9E 3G0EA 1NVQA 2XNPA 4FTCA 2CSNA 4LV5A 2QOHA 1STCE 4R3CA 4UV0A 1BI7A 2QC6A 4KBKA 3GCPA 4F7JA 3O2MA 4ENYA 2VN9A 4J95A 3NR9A 3BYMA 3NYNA 5BVWA 1R0PA 4QPAA 1ZY5A 3OY3A 4QQTA 3ZDUA 4DFBA 1IAHA 3MVHA 5JSMA 2PZPA 2C0TA 4FIHA 5CEMA 5D1JA 3H10A 4DFNA 3ZXZA 4CCUA 4EOQA 1OPJA 2CKPA 3E8CA 2BFXA 5FEDA 5JZNA 2UW9A 4BI2A 4CLIA 5LCJA 4W4VA 1OIRA 3OBJA 2QOQA 4Y83A 4G3FA 4AGUA 1ZOEA 4EOIA 4QMXA 3LMHA 2O63A 3FE3A 2W96B 3PVGA 1OVEA 4FX3A 3QUDA 2UVZA 1ZYJA 4FV8A 2C5OA 4FKVA 2PYWA 2Q0NA 4UEUA 4FZ7A 2HXQA 4GW8A 2B52A 4I5MA 3NNVA 4O1PA 5FM2A 4IX4A 4NEUA 3QZHA 4F9YA 1QMZA 4J97A 2ITWA 2W1CA 2BILB 3IONA 4TYEA 3KXHA 5K5XA 3P7BA 2PUUA 2P2IA 2UW7A 1I44A 3NNXA 2UW6A 4WNKA 4C37A 2HW6A 2PUIA 5C4LA 3LLTA 3GU7A 3II5A 3DDQA 4HYIA 4O0RA 4XG4A 3UOHA 3AMBA 4F0FA 5J1VA 4ASEA 1P2AA 3AT4A 2UZBA 3VBYA 3ZO2A 5HVYA 4WIHA 3VBTA 5IA2A 5EYMA 5LOHA 1NT2A 1UNHA 5BPYA 2WTVA 4D4YA 4EBWA 1XQZA 3C9WA 3LAUA 4GIIA 4NTTA 3RP9A 4BCNA 4TL0A 4ZTLA 2UV2A 3VRYA 2UZTA 3FLQA 2B0QA 4YZBA 4QPSA 1GOLA 5BNJA 1YOJA 4E7WA 2W9ZB 2C68A 4AF3A 3QC9A 2C5XA 4W8EA 3KMUA 4NYEA 4O7TA 5IA5A 4C8BA 1QCFA 4NIFA 4RT7A 3HMNA 5CU4A 2YIQA 5JFSA 2ITVA 4GH2A 3QF9A 5KO1A 3G9NA 3ZOSA 2FSMX 4I4FA 4J96A 3A4PA 3IG7A 5T3QA 5C8MA 4FA2A 1PKGA 1OZ1A 3U87A 4CTCA 4M97A 4K6ZA 1XBAA 4QTAA 3TZMA 4D4VA 3V5JA 5BVOA 3R71A 4ASXA 2CCIA 4L44A 3PIXA 1Y6BA 1WVWA 4FL1A 3QQGA 4G6LA 4FC0A 2UW8A 3KCFA 3KRXA 2ITPA 4HVDA 2F49A 2ZV8A 1OM1A 3UOKA 4OGRA 4DH8A 5JQ8A 2BDJA 3RINA 3RNIA 3N4VA 5L8LA 4GUEA 2EVAA 4XJ0A 5H8GA 2F7XE 2Y6MA 3HA6A 4MKCA 4YTCA 3OW4A 3S00A 4I20A 4EJNA 2RFNA 3R21A 4D58A 5JQ5A 2FGIA 2YISA 3BBWA 2WTCA 2C6EA 1OL7A 2G01A 2QG5A 3FLNC 4AFEA 1MRVA 2XNNA 4XG9A 3Q60A 4D5HA 3ZLYA 4DGMA 3VQHA 4QTBA 5M06A 4EORA 2QOCA 2RIOA 3C50A 4IFCA 4QYHA 4XV2A 2IW9A 5AP1A 1BMKA 4QOXA 3GC0A 3EIDA 4FTUA 2W4JA 2GNGA 3I1AA 4PNKA 5HTBA 1UNLA 3D5VA 4JOAA 1W98A 3OFMA 4M84A 5LVOA 2JIIA 3PJ2A 3QRUA 4C59A 1B38A 3WZDA 4TW9A 4JRNA 3KGAA 5C1QB 3ROYA 1ZYLA 2DYLA 5H2UA 1YXUA 1NXKA 5KZIA 5HCZA 4RWJA 2PVFA 3UMXA 4WA9A 4IZ5A 4P90A 4IZYA 4XX9A 3DZOA 4DAWA 1GZ8A 3PIZA 4FTJA 4IXPA 3ZFMA 1J1BA 2BMCA 3QKKA 4P7EA 2OIBA 3DJ7A 3FPMA 3KU2A 5KZ0A 3ZFYA 3FPQA 4QP3A 4EHVA 4H58A 2Z8CA 3U8WA 5TOZA 4CFMA 3IKAA 1UU3A 1L3RE 1B39A 2A2AA 3OEZA 5EI6A 4G34A 2ZDUA 2C5NA 3OS3A 3TKIA 3MS9A 2IWIA 3U4UA 3MJ2A 2R9SA 3QAME 3I81A 2W5HA 2GHLA 3FDNA 4QTDA 3NIZA 5BVFA 5IPJA 2OFVA 3POOA 3EQBA 3MESA 4BICA 4FVPA 5HTIA 4EH5A 4MF0A 4G6NA 3R6XA 3R9HA 3LPBA 3EL8A 3WF8A 2F4JA 5DHJA 2VD5A 4FKPA 4FIEA 3NVMB 5JZJA 4PTGA 4ZMFA 3UZPA 4EHZA 2PU8A 3HV3A 3CR0A 3P9JA 4D2TA 5CEPA 4YHFA 5ANEA 5CF4A 2XS0A 4QMQA 1DM2A 4EHEA 4I4EA 4PMTA 3QD4A 5E8VA 3PY0A 5HKMA 2C5YA 3ELJA 1PXMA 5CSPA 1JKSA 3KY2A 3PXRA 3S2PA 4AUAA 2JDVA 4G3DA 1ZOHA 3VRZA 4YJQA 5FQDC 4B9DA 1H27A 3UP7A 4BCHA 2EWAA 2ITZA 3KF7A 3JPVA 2WMBA 1BYGA 1FMOE 1SVEA 1OIQA 4UWCA 3EN7A 3R73A 4JBPA 4UN0C 3RAWA 5D9HA 5BX0A 4AGCA 5L2IA 4XLIA 3SV0A 2ESMA 4XP2A 2EXCX 3AQVA 3UC3A 3UQFA 3OUKA 5J1WA 1SNUA 4R1YA 4AW1A 3FMNA 4DITA 5E91A 5LMKC 4NM0A 3QWKA 2E9OA 4YJVA 2ETKA 2NP8A 4YNOA 3V8SA 5A4EA 4EC8A 5ICPA 5L3AA 4EK3A 3DKFA 5EW9A 3MI9A 2WIPA 3A60A 4UZDA 4YNEA 3TI1A 3GC7A 5A6OA 4YR8A 3UJGA 4MNEA 2XIXA 2G2FA 4ZJIA 4OTDA 2RKUA 4JDIA 4TWNA 1OIUA 3TEIA 4GKIA 3BEGA 4O86A 4DA5A 3F2RA 4RC4A 3VF8A 3K5VA 4N0SA 4AE9A 3UZRA 3LLAA 5HEZA 3DAKA 2GCDA 3QQLA 4FT7A 4L67A 4MXCA 5HG8A 4DCAA 3R2YA 4QQ5A 2JDSA 1X8BA 2YJSA 3COHA 4K2RA 4IJ9A 3UG2A 3WF6A 3NUUA 4AGDA 3D0EA 4IB1A 3OG7A 4FGBA 5IA1A 3FQHA 3TNPC 1J7LA 5DRDA 4FL2A 3I4BA 2HWOA 2BIYA 2EXEA 3A7GA 4C4IA 4FKSA 3FI8A 4C34A 4TWPA 3E62A 3VIDA 4ZTHA 3O8UA 1W8CA 4AN3A 3ORTA 4AW5A 3CP9A 2JC6A 5AEPA 4XLVA 3QA8A 3U6HA 4YC8A 5HG9A 3R8VA 3PTGA 4IVAA 2XKCA 4D28A 3G6GA 4ERKA 2WMQA 3C5IA 5CNOA 3ZH8A 4ANBA 3KXZA 5C27A 3DXQA 3PG1A 2CMWA 3LJ2A 4YJNA 2WKMA 2HWPA 1H28A 4ANLA 4FSUA 5BUIA 4BIBA 2QVSE 2XK4A 3D2IA 3EL7A 1YXTA 1E9HA 4F1MA 2UZDA 3OCTA 4FUXA 4U9AA 4MK0A 2V62A 4JR3A 1K9AA 4EBVA 1OI9A 3SGCA 3BU3A 3E8DA 1SZMA 2YCSA 4NJ3A 3GFWA 4OTIA 3Q5IA 4OTWA 3RPRA 4AAAA 3Q3BA 4FSYA 4YJUA 5IQCA 1OKZA 2QURA 5HE1A 3PY1A 2ITTA 2CN8A 1GIJA 2P4IA 4FTOA 4GG5A 4ZSGA 3KXNA 2PVLA 1J7IA 2W1FA 1I09A 2A27A 2NPQA 2QI8A 1PYEA 2VTQA 3F2NA 3A4OX 3Q5ZA 4FSQA 3GOKA 4G5JA 3DXNA 4FZ6A 2GU8A 4BYIA 1WAKA 4MD7E 5M57A 2YCRA 5KMLA 5FTGA 4IACA 1KV1A 4M12A 1F5QA 3HP5A 1SVHA 3MB6A 2C3KA 3NUPA 4FKQA 3WF9A 4MH7A 2BZJA 4GT4A 4IFGA 3KF4A 3ZC6A 1BL6A 2WMAA 2GDOA 3R7YA 3ZM9A 3Q96A 1V0PA 2V0DA 4F7NA 5EH0A 3LCOA 4CRLA 3E88A 4V05A 4MTAA 3ZLSA 3FY0A 2W4OA 2PZRA 3VVHA 2WQEA 3V5WA 1LP4A 3BYOA 2C0IA 1ZARA 3ACJA 5CXHA 1YW2A 2YDJA 3FMMA 5EYDA 4ALWA 4PMMA 3MFRA 4YC6A 4QMVA 4QRCA 4RVTA 3DFCB 3QBNA 4N4SA 4C33A 3OXZA 5C01A 3BHUA 1U5RA 3UPXA 5JGDA 2QU5A 4IIRA 3PXKA 3R1NA 4PPAA 4PDPA 5JN2A 4U0IA 1ZXEA 3SLSA 3LCTA 3CPBA 4FV4A 3GU4A 4PL4A 4A06A 4YU2A 2F9GA 2XA4A 4O7RA 3UPZA 4RGJA 3O96A 3PZHA 4O0SA 4ANNA 5BVDA 3BX5A 3IDPA 3ORLA 5M4CA 5DOSA 2QO7A 3M42A 1SNXA 4EUTA 3TT0A 4W4XA 3SXSA 4D5KA 1IA8A 4L7SA 4WRSA 4X2KA 3IW4A 5HCYA 5IH5A 4BDEA 4M14A 5DWRA 3ZO3A 4CMUA 2P2HA 3A61A 2BTRA 4UXQA 3QX2A 5ANIA 1YHVA 2HK5A 3QC4A 3TNHA 2PUNA 3RPSA 2EB2A 1OUYA 4E4NA 1JOWB 1GZKA 3UIUA 2IVVA 4F6WA 4PP7A 2X8EA 2YAAA 5KBQA 2XIRA 3VS3A 1ZAOA 3MH3A 4IMYA 4XP3A 5DEYA 3EYGA 3R9OA 3UC4A 2R0IA 2W05A 5A4QA 3Q4CA 4WD5A 1SVGA 3ZSGA 2WFYA 2XJ2A 4FSMA 1FINA 4KS8A 5HI2A 1PXPA 4PPCA 4RJ4A 2XM9A 1M2PA 4BC6A 4Y5HA 3NUYA 5IUIA 5I9ZA 3R8MA 3H30A 4R77A 2VTJA 4ANSA 1LPUA 5LJJA 1GIIA 4EKLA 4FTAA 5AV2A 2JFMA 3E3PA 3MY0A 3MTLA 4GFMA 4PMPA 3U6JA 5M56A 3UP2A 4JAIA 1Y91A 3PP0A 3V5QA 4FKGA 4UBAA 5K3YA 1V0OA 1LUFA 3ZTXA 1YDTE 2B53A 3D15A 3RJCA 2V22A 4UMTA 3NUAA 3FQSA 2VWZA 3MA6A 4CZUA 3UQCA 1H25A 4B4LA 2PULA 2FVDA 2F7ZE 5LMBA 2QU6A 1MRYA 3HRCA 5AV4A 4FIJA 3F7WA 3QRIA 5ANJA 3HGKA 1Q24A 4CCBA 5FGKA 3EHAA 4AT3A 2CPKE 3CQUA 3DDPA 1O6KA 2ERZE 3W2PA 5EYCA 1IR3A 3PLSA 3BLHA 5DA3A 2OKRA 3D7TB 5AA9A 2GNLA 4YPSA 3VQUA 4J71A 3ODYX 3UMWA 5FDPA 2ITNA 4BTFA 5EOBA 3C1XA 4GL9A 4O1OA 2KULA 3UOJA 2ZV9A 4NUSA 4KRDA 5I9XA 3RM7A 2A19B 3VUDA 5LWMA 3FUPA 5GHVA 4QP4A 3ATTA 5G6VA 2JFLA 4U81A 2W1EA 2O2UA 1ZZLA 5AM7A 2QONA 2QLUA 3ORMA 1YI6A 3AT3A 5AP0A 1ZWSA 1JAMA 2CDZA 2O8YA 3E3BX 3P7CA 4XOYA 4I41A 4QP2A 4DLJA 2OG8A 3KB7A 3PE2A 3BE9A 5GNKA 4I6BA 4KIPA 3F5UA 3MSSA 4LG4A 5IQDA 1BL7A 3GB2A 5JFVA 3HEGA 1UU9A 2EXMA 1WBVA 4QYGA 5HNGA 5ACKA 5HG5A 4FG7A 4D1XA 1A9UA 1F0QA 3CTQA 2RGPA 3EH9A 3R0TA 5K0KA 1ZZ2A 2VTSA 4RFMA 4EH2A 3BZ3A 2VAGA 3RALA 1Q3WA 2WMXA 3SOAA 1PXKA 3WILA 2XK7A 4XOZA 3GEQA 3BV3A 3L9MA 3V01A 4LRKA 3L9LA 4YZ9A 4Z16A 5A46A 5AUUA 2JKOA 2ZAZA 2YERA 3S4QA 1S9IA 5A4CA 3GCQA 4BRXA 2OXXA 3TJDA 4DH1A 4HVHA 5B0XA 3V8WA 3U6IA 4Q9ZA 3WE4A 3VW8A 2REIA 2HY0A 3BGQA 3CBLA 3FLZA 4IDTA 4W4WA 4TYHB 3HUCA 4DFZE 5KMNA 3D83A 1FVVA 2C3LA 3PXYA 3MVMA 4ASZA 4RFYA 5FBNC 5TE0A 4M3QA 3PPKA 3QD0A 3ODZX 4PDSA 3FXZA 4EOLA 1O6YA 3PJ3A 3V5PA 4EWHA 5D7AA 3RAKA 4EHGA 4S33A 3REPA 4E1ZA 4WG3A 5AP5A 5CEOA 2CNVA 5TF9A 5CASA 5IKWA 3BQCA 3T9IA 2PY3A 4YBJA 1H1SA 4DG2E 3PZEA 4HYSA 3TZ9A 4MEDA 4QP7A 4IQ6A 5CZHA 5F4NA 4IM0A 2PVHA 4LL0A 5CYIA 4CKIA 4JIKA 2WTJA 5L4QA 3IW5A 5CS6A 5JT2A 2I7QA 4K9YA 4L52A 5CWZA 5E8XA 3K3IA 3MFTA 3KCKA 4RVLA 5GJDA 4BDJA 3HA8A 5L2TA 4ZJJA 3HKOA 3DCVA 4GIHA 4IX6A 4M0YA 4PDOA 4QNYA 2A1AB 5KMIA 1PKDA 2VO3A 4EZ3A 2ZMCA 3OTVA 4MQ1A 3DU8A 4FKLA 4APCA 3PY3A 4CNHA 1NVRA 3MH2A 2Y0AA 4OAVB 3GP0A 2X4FA 2QHNA
chains in the Genus database with same CATH superfamily
4NT4A 2XNOA 1YI3A 1H1PA 3NSZA 4LI5A 4BDIA 4C4EA 5HO7A 4EI4A 5KMJA 1YXXA 4BGQA 4NKSA 1PW2A 4USFA 5I9WA 4FE2A 2BIKB 2OIQA 3P23A 2BFYA 5AR7A 4I0TA 4RWLA 3VHKA 5I9VA 2XIZA 4FT3A 2CNUA 2F7EE 1GAGA 1P4OA 3ZDIA 4FIIA 3ALOA 3CLYA 2YWVA 3TTIA 5KE0A 2OZAB 2CKOA 3LZBA 1KE8A 3AC1A 3DK6A 4IBMA 3QD3A 3QRTA 4BCQA 3QTXA 3EQRA 4XH6A 5IDNA 1RW8A 4EK6A 1XWSA 3UIBA 3QGYA 5IQIA 3FMKA 4FEQA 2WEIA 3U55A 1U54B 4G1WA 4XCUA 2WELA 3DKCA 5HORA 1G8AA 2PPQA 2WMTA 3I0QA 4DGNA 4L46A 3RPOA 2EU9A 3HVCA 3DS6A 4GEOA 3VW6A 5JFXA 5LXMA 2VTNA 5I3RA 2YWPA 5EKNA 1R0EA 5HLPA 2J90A 4KBAA 1H26A 1WVYA 2OU7A 4FR4A 3UNJA 3QCSA 4AFJA 2X81A 2YLEA 4EOSA 4GMYA 3D5XA 4IC8A 4IM2A 1H0WA 4ZSLA 3B8RA 3PE1A 4EUUA 5DT3A 4LMUA 1ATPE 5KHWA 2VTAA 4ZTMA 5IQGA 5EW3A 4U44A 5DG5A 3TN8A 2R3MA 5EQYA 4RIYA 3C4EA 2W9FB 3NW6A 3ZEWA 4O4BB 3DAEA 4NTSA 3CQEA 2JDRA 4AOTA 2UW0A 4BDAA 4TN6A 3KKVA 4MWHA 4U6RA 3UBDA 2I6LA 3L9NA 4Y5QA 1EH4A 3PVWA 4L42A 3BIZA 3NEWA 3PRFA 3ZUTA 4S2ZA 4U80A 3OWLA 1R39A 2OK1A 1OBGA 5IQFA 1OIYA 3FZ1A 3H9RA 3QUEA 4C3RA 2PMIA 3A8XA 2BKZA 4PX6A 4Y73A 3W0QA 4QO9A 3T3UA 2W1HA 4RQKA 5B2MA 3SC1A 4E6CA 5E8YA 3VS6A 4B7TA 5BMMA 4RSSA 3EYHA 3AGMA 4FKWA 3OP5A 4M69B 1Y8YA 4BTMA 3Q4TA 1XH8A 1Z57A 1M17A 2E9NA 4HPUE 3S95A 3DGKA 4HVIA 2OJGA 4D1ZA 2NNWB 4O81A 2VV9A 3CXWA 5JGBA 4F9BA 1IRKA 5M55A 2GHGA 4HCUA 4CSVA 3FI3A 3R8UA 3O7LB 4AXEA 4O21A 5CSHA 4DF3A 2XJ1A 3KRLA 4H1JA 1XR1A 4NK9A 2GHMA 4C2WA 3GENA 4GVJA 3O50A 5KHXA 4D2PA 3QTSA 4IAYA 4BDGA 4FODA 5IEVA 1S9JA 3BEAA 4FNYA 2J6MA 4KSPA 5CT0A 5LMKA 1J3HA 5EQEA 3MH0A 1WBSA 3MPTA 3HP2A 4L01A 5FDXA 3NYVA 5ANGA 5AV0A 4AN9A 5KX8A 1TVOA 4C58A 2QG7A 1JNKA 3EKKA 4RWIA 2J0MB 4FTQA 4FV6A 4BCJA 3I7CA 4I23A 4BWXA 1U59A 4A4OA 2CLQA 4KIQA 3R8ZA 3ZS5A 2XZSA 4FT0A 4B0GA 3OOMA 3C7QA 4TKSA 2W1GA 5KUPA 3HMMA 5J7HA 2H9VA 5JRQA 5KMKA 1OPLA 4BCIA 1O9UA 2RL5A 5BV3A 2WB8A 2OJ9A 3VNTA 4B8LA 3OEFX 5BUJA 2RFSA 5H3QA 4D9UA 3DBCA 3I79A 4BR3A 4GV1A 4EQCA 3D7TA 2W7XA 1M2QA 3NNWA 3ZCLA 4YTFA 3I7BA 4O7SA 1OKWA 4TTHB 5D41A 4F7LA 1PHKA 4H05A 5GJGA 4YJRA 3LM5A 3TIZA 5HLWA 2VNYA 1RQQA 3NAYA 4R5YA 5AIKA 4NL0A 1WMKA 3QQKA 3R1QA 1VLRA 4C3PA 4MQ2A 5D12A 4UMPA 5AA8A 5DI1A 5GIOE 3F7ZA 2QKWB 4K8AA 1G3NA 4BF2A 4EYJA 2ONLC 3CCNA 3HLLA 2WTIA 4JDKA 5CEIA 5C8KA 3EKNA 1H1QA 4BDHA 5K4JA 5BMSA 4D9TA 4ERWA 5K4IA 4YZMA 4MXXA 3TV4A 2EB3A 3B8QA 3CD8A 3W0RA 1Q8YA 2BCJA 2QR7A 4FTMA 4YZNA 3Q4ZA 2JAMA 2BZKB 3L8SA 3MA3A 4NCTA 4TNBA 5EW8A 3ZC5A 2OZOA 2AEGA 3DBDA 4C38A 4RLLA 3FMLA 3LHJA 4EK4A 1IAJA 4RIXB 5DYJA 5IU2A 4IVCA 4ZMEA 1OPKA 3EJ1A 3E64A 3ZO1A 3TV7A 3SQQA 3SKCA 2PMLX 3ANQA 1AGWA 1UNGA 1TQIA 2P33A 2R3GA 5DNRA 4E3CA 3F3TA 3UVQA 4JLCA 4QYFA 4Q5HA 2VX1A 3R9DA 2WMUA 4DTBA 2J0IA 2WQNA 3QTRA 4WHZA 3C0IA 4X2NA 4B8MA 1TZDA 4BFMA 4A4XA 3BL9A 2BVAA 3L8VA 4TYHA 4DEHA 4F78A 2YDKA 4BI1A 4E5BA 2ZJWA 2XB7A 4HNFA 4KIKB 5DN3A 4DC2A 4RA4A 3QYWA 2BHHA 2W1DA 1CKJA 3CQWA 3VS7A 1HCLA 3AGLA 4JVGA 5HVKA 3N4TA 2UZOA 1PXIA 4JRVA 1WBTA 4FEWA 5HE3A 3R7VA 5HD4A 3UDZA 1JWHA 4USDA 5EOLA 2QOOA 4I94A 3PWYA 4EOJA 4C61A 3I0OA 5IQBA 3PDTA 1QPJA 4GT5A 2QOLA 2UZNA 5CF6A 1BLXA 2GS6A 4RBLA 4FSNA 2KTYA 4U97A 3VBXA 3LXKA 2HZ0A 4LGHA 4QMLA 3G15A 4E26A 4X2FA 4RRVA 2PE1A 2C30A 4U3YA 3QTQA 3P0MA 2J0KA 1QPEA 1YXSA 4BWPA 3R9NA 1ST4A 4L3JA 4ZAUA 3ULIA 4FL3A 3Q32A 3HZTA 3R2BA 4JMQA 3BLQA 3DK7A 3EQHA 3CJGA 4WSYA 1M14A 5HBHA 2X7OA 3ZM4A 4D0XA 4FNZA 3SVVA 1ZY4A 1U46A 3MH1A 2QOIA 4DGOA 5M53A 5CSXA 2OW3A 4QP1A 5CQWA 2FSTX 1CKPA 4FNWA 4ACMA 3TKHA 3KN6A 1CKIA 3PJCA 2VNWA 1APME 3U4WA 3FZOA 4TWCA 2C0OA 3WZKA 5CVHA 3NPCA 1U4DA 3BU6A 5HD7A 4IB5A 3PA4A 2WZJA 4GUBA 2ITUA 2Y4IC 3TTJA 4O0YA 4RZWA 2RF9A 3PVUA 4PUZA 3RPYA 3VBVA 4HNIA 2H34A 2XUUA 2VX3A 2CN5A 1URWA 3NCZA 3QFVA 2O65A 4YLLA 2WQMA 3DZQA 5FD2A 1RDQE 3LFBA 4NM5A 1KOAA 2X1NA 4F6SA 4U45A 1U54A 2R3FA 4L45A 2GQGA 3KXMA 4BZDA 4DBNA 4RPVA 4YJTA 3W33A 5IF1A 1OL1A 4EQUA 3LOKA 4DGGA 3FAAA 3HMIA 4YJOA 4V0GB 4QPMA 4BHNA 3W10A 5D7VA 2H6DA 4QP6A 3CGFA 4BCPA 4U41A 2PMNX 3MPAA 5EG3A 2R3QA 4O22A 3ZU7A 4EH7A 4QYEA 3F69A 2A0CX 2VRXA 4RFZA 3HAVA 3V3VA 3FHIA 3AD4A 4AZVA 2WAJA 4E93A 2GNJA 4FK3A 1OL6A 2VTHA 4I6HA 2WTKC 4QQJA 3HV4A 1CMKE 2XAOA 4BJJB 4JDHA 4OTGA 5EHOA 5ANOA 5BUEA 3TDVA 2GS2A 2ZYBA 4Q5EA 4YZDA 1MRUA 2VTOA 3BL7A 2OF2A 1JSVA 2ZM1A 3EN9A 4FZAB 4F4PA 1NW1A 5IEYA 3P7AA 3A62A 3Q6UA 2PMOX 4BBFA 5BVNA 4AACA 1ND4A 4E4MA 4C4FA 4D1SA 3W0OA 3K2LA 3MFSA 3UGCA 5M4IA 4F9AA 3TUCA 2XM8A 4R3PA 2B9FA 3CY3A 1OECA 1YVJA 2Z60A 4ORKA 2YDIA 2BROA 2I0HA 2W17A 3HV5A 4X6QC 2PZ5A 3JY9A 3MTFA 3SDJA 4WNMA 4U7ZA 3QKMA 3P1AA 4ZTNA 3ZO4A 4E8AA 1CM8A 4M69A 4K1BA 3NUNA 3RHXA 3EB0A 2CKQA 4CMOA 3COKA 1E1VA 2I0YA 5L2QA 5GINE 5JMSA 4D4RA 3OZ6A 5CZIA 2HZ4A 3H9OA 3DBEA 3U51A 4I0RA 3V6RA 3W0MA 5IQEA 4KRCA 2WD1A 4WG5A 3W18A 2DWBA 1REKA 3W2QA 3W2CA 5CAUA 2VGPA 3ZHPC 3OC1A 3IGGA 2JITA 3NX8A 3PXZA 4FEUA 4ZLOA 1WFCA 4UXLA 3TJCA 3UE4A 2YM3A 3R28A 5J7BA 3D9VA 2BALA 2HENA 2Z2WA 3EFJA 4I3ZA 2R3LA 4ZOGA 2UZLA 4YHJA 2Z7SA 4A07A 5BYLA 3CC6A 3WI6A 5F94A 1K2PA 3C51A 4LMNA 2J5EA 2YN8A 3R7IA 2X6DA 3FI4A 3D5WA 4DHIB 4KUJA 5LARA 4G3CA 1JSTA 4JQ8A 3DBFA 3Q52A 4EC9A 2ZV7A 3R00A 5E90A 5K0XA 3PUPA 2BRGA 1L8TA 1TQPA 3IQ7A 4GU6A 3BYUA 4DINA 4AW2A 4LM5A 1XMMA 1AD5A 2VTPA 3IECA 4DFLA 5KMOA 3OUNB 4DH7A 3Q9WA 4ITIA 4PQNA 2C3IB 3T9TA 3PLAE 3E7OA 2GPHA 4BGGA 3NRMA 4M8TA 3MY1A 3QALE 2IW6A 5IEXA 3IK3A 2XYUA 3DB8A 3SOCA 5CAPA 2YIWA 4KKGA 2IJMA 3OBGA 2IEWA 3TDWA 4S31A 1RJBA 1R3CA 3EFWA 3ORPA 2GTNA 3UYSA 3VUTA 4WOVA 4AA5A 3F9NA 4FMQA 3O51A 2R2PA 5AP4A 4X2JA 1Q5KA 3FYJX 2XEYA 2HY81 1NY3A 2PZYA 3GCVA 4DH3A 3FKNA 3OVVA 4F0GA 3NMUF 2X8IA 4WT6A 5KNJA 2X2KA 5CI7A 3SW7A 2C3JA 1JKTA 2E9PA 5HIDA 4BY9E 3ERKA 3I6UA 3I6WA 4QNAA 5FUTA 4F99A 3R1SA 4JQEA 4Y85A 4KKEA 4UB7A 4LGDA 5F1ZA 3R7OA 2XRUA 3TUBA 4K11A 1OGYA 2E2BA 3WYYA 1Y57A 4HZRA 3EQGA 3ZXTA 4CQEA 5B2KA 4EEVA 3AMYA 3AC8A 4RIXA 2R0UA 2VUWA 3VBQA 3P86A 2VWIA 4F9WA 2Y4IB 4G6OA 3BWFA 3IOPA 4Z7HA 1ZMWA 2GFSA 3KC3A 5LVNA 2FSOX 1BI8A 2XANA 1Q61A 1JVPP 2XIYA 2XKEA 3FJQE 4KS7A 1H1WA 4YLKA 3RWPA 2UW3A 4DEIA 3BHTA 1UWHA 4FV5A 1YHWA 3D94A 3FZTA 2UZWE 4TT7A 3KFAA 3DQWA 4ZSAA 4XRJA 2XK6A 3OF0A 4CYIA 5IISA 1ZMUA 3R9RA 5JRSA 2GNFA 3PFQA 1XH4A 2WOUA 1GZNA 3IO7A 4KIKA 4BDCA 4EOMA 3CTJA 4XBRA 2XAMA 3RZBA 4FTRA 3W8LA 2E9VA 4Z3VA 2IVSA 4O96A 3WARA 3LXNA 4IAAA 2OH0E 3AKKA 3ZZWA 4IWQA 3A7IA 3RK7A 5AUZA 1PJKA 4JBQA 5CVFA 2G2IA 5JH6A 3LMGA 2QCSA 2X0OA 4BB4A 5E8WA 2WTKB 3ZEPA 1WCCA 5CU3A 5HNBA 3DB6A 3TM0A 1Q97A 3F61A 4MD8E 4YJSA 5CAQA 4MXAA 4DGLC 1FGKA 3MDYA 3GC8A 1REJA 2B1PA 5ANKA 2VTTA 2W5AA 3N51A 3O8PA 3BI6A 3WZJA 3T3VA 3MVJA 4D2RA 5E92A 1H4LA 4FJVA 3JVSA 3TL8A 3BGZA 4PF4A 4JNWA 4YZCA 4ZLYA 2XVDA 5DR9A 3FMEA 1PXLA 5EFQA 2PL0A 4HGSA 4JBVA 4DHJA 1XJDA 2WMRA 3MB7A 4L9IA 1CSNA 4H39A 3ZMMA 2WO6A 2ETMA 4L68A 1H00A 3GU5A 2JIVA 4M67A 5AR8A 2OFUA 1YWNA 3RNYA 2R3NA 2HZNA 4LQMA 4FTLA 5FG8A 5AAFA 3OMVA 4E73A 4CD0A 3LJ1A 2R3PA 4O0TA 4DEEA 3FLYA 4GKHA 2VWXA 3O71A 3LFSA 5LMAA 3TMOA 5M4FA 3Q2MA 4IANA 4AN2A 1UU8A 3QGWA 4ID7A 4E5AX 1YHSA 3G33A 3RTPA 4AZWA 5HU3A 5IQAA 4WUNA 1OL2A 1QL6A 4N70A 4J98A 4YSMA 3SAYA 4CQGA 3C4WA 3LFFA 3R01A 5L8JA 2CGUA 3C0HA 3KRRA 5E8ZA 4D0WA 5CEQA 5IA4A 5IMXA 3OHTA 4OTQA 2YA9A 3UO6A 4ITJA 2BZIB 4RX5A 2XKDA 3LFNA 3AD5A 3CGOA 3OWJA 1WBWA 5H8BA 5J87A 3RPVA 1XH6A 4L53A 4X3FC 1KOBA 3OW3A 4W9XA 1JKKA 5CVGA 4I1ZA 3QTIA 2I0VA 3LQ8A 4V0GA 4ZZMA 4BI0A 5DT4A 5EM8A 3KREA 3LCSA 2FUMA 4ANQA 3AOXA 4YTHA 2HXLA 4DCEA 3O5AA 4C4JA 2PVNA 4LGGA 4Y95A 5J5TA 3HNGA 4RJ8A 2AQXA 4XYFA 4O91A 3F2AA 3FV8A 4YJPA 4NFNA 4H3QA 1WBOA 3GI3A 2FA2A 4PV0A 3OCBA 4HZSA 2C4GA 3RKBA 4AW0A 4C4HA 4R8QA 1T46A 3QTWA 4BJJA 2PWLA 5HE0A 1K3AA 1WBNA 1XH9A 1YWRA 2BDFA 3DTWA 4CRSA 4YMJA 3L8PA 5AP7A 3I5NA 4FVRA 3ZLWA 4MBJA 2WPAA 3OTUA 4DDGA 2V5QA 4FYNA 1P5EA 4NW6A 5DGZA 3RK9A 4I5PA 4FTIA 4DTAA 3BHVA 5HBEA 5AP6A 2XK3A 5C03A 4QMYA 1Q4LA 2JDTA 4O4FA 2DS1A 2GMXA 4GCJA 3VS4A 3F5PA 3V6SA 2PZIA 2ONLA 4FV2A 4DEDA 4FV0A 4HVGA 3W0PA 3G0FA 4S30A 1XHAA 4IB0A 4R1VA 4JJRA 4BDDA 3EOCA 3GU8A 3EQFA 5AWMA 3F3UA 2XNBA 3QQJA 4LFIA 5HBJA 4F7SA 4GSBA 2P55A 5HESA 3VAPA 2BRHA 4JX7A 3ZUVA 3ZUUA 4RIWB 2V7OA 1LEWA 2WMSA 2IZSA 2XCKA 2ZV2A 1VYZA 3ZYAA 4EWQA 4UMUA 4QEBA 4EONA 1XO2B 4O4DA 3DOGA 4LV7A 3EQDA 4KSQA 4CFXA 4IWPA 3WE8A 4YO4A 3PSCA 1UKIA 4EJ7A 1KUTA 2HAKA 2YM5A 1MP8A 2W4KA 4KKHA 1OL5A 3DKGA 4TPTA 3FZSA 2QNJA 2RFEA 3UIXA 1MQBA 1MQ4A 3EQCA 3KQ7A 4NIFB 4S32A 2Q83A 1PXNA 2I1MA 4EOKA 4CFWA 4C36A 3LVPA 3UO5A 1YXVA 4BBMA 1J7UA 2PSQA 3M2WA 3E63A 2YM6A 2OXDA 3W55A 5AIRA 4YHTA 1FOTA 3QTZA 3FZRA 5FTOA 1OGUA 3K3JA 5EI2A 2R7IA 2HIWA 4I22A 4P5QA 5HCXA 4F65A 4FG8A 2CNQA 3H4JA 3MFUA 1OKYA 4GU9A 4O0UA 5DBXA 4BWKA 3F82A 2ZB0A 3BV2A 4FVQA 3U9CA 4YP8A 2Q0BA 1RE8A 3FL5A 3GUBA 4AE6A 3HX4A 2AUHA 4NJDA 3KVWA 4RJ5A 3SXFA 3KMMA 3P4KA 4DH5A 2YIRA 5FXRA 5HQ0A 4CFFA 3GT8A 5DLSA 4ALUA 2X9EA 3HRFA 3U54A 3F3WA 5I9UA 5CX9A 1FBNA 4IWOA 2IO6A 2YCQA 1W83A 4RX7A 5E8SA 4NH1A 2J2IB 3FXXA 4IAFA 4DFXE 3EWHA 4GFGA 4QP8A 4XUFA 3K5UA 1FVRA 1XKKA 3OD6X 4OBPA 1ZLTA 4MBLA 5T6KA 3ATSA 2O5KA 4GVAA 4PTCA 5CF5A 1Q41A 2V7AA 2PVYA 3LFDA 3DLSA 4AU8A 2BRNA 1PMVA 4CFNA 3FYKX 4BCOA 5CU6A 2R7BA 3QCXA 2BPMA 4EOPA 5LCKA 1CTPE 4PMSA 3PG3A 4L43A 4XEYA 4JAJA 5DR6A 3R8PA 3W16A 4DFYA 1Y6AA 4EK5A 3FSFA 4R3RA 4RJ3A 4J8MA 4TWOA 1H0VA 3C5UA 4G2FA 4V04A 5DT0A 1URCA 3R22A 3DK3A 2IZRA 3DAJA 3VUKA 4LL5A 2WNTA 4C2VA 3IW6A 2VO7A 1FPUA 4L00A 2XNMA 3D4QA 3FBVA 4FG9A 4R6VA 2I40A 4TYJA 1ST0A 2IZUA 3RAHA 4M66A 4U79A 2HCKA 4L3LA 3GCUA 4W4YA 4NZWB 4BL1A 4IAIA 4TXCA 4X3FB 4AOJA 1W82A 3JXWA 3OT3A 3AT2A 2PE2A 1P4FA 3OXIA 3W32A 4X7QA 2IN6A 1DAWA 3LCKA 3VJOA 4K33A 5CTPA 2XNEA 3RZFA 1PXJA 5IH4A 3QCQA 4L8MA 3OWKA 2ITQA 4L3PA 4RJ7A 4JX3A 4BCFA 3S0OA 4RX9A 3UOLA 2X7FA 2XMYA 4DLIA 4EH4A 4DHZA 1P14A 4X3JA 2UW4A 1H1RA 5AX9A 3FI2A 2X6EA 3HMPA 4AXAA 3JUHA 1ZYDA 3QRKA 3KRWA 3WF7A 2R3RA 4ZTQA 4ITHA 4EH8A 5C4KA 2IW8A 1KV2A 3PA5A 3QLFA 1LR4A 3JR1A 3NUSA 3HYHA 3UZTA 3LW0A 3FL4A 4A7CA 5A54A 4QQCA 3R7UA 2OH4A 1UWJA 2R3JA 3TWJA 4PWNA 5FP5A 4A9UA 2ZOQA 5AR4A 3N4UA 3ETAA 2ZM4A 3R83A 4CMTA 4ALVA 1XH5A 2YCFA 5LVPA 4I21A 3DJ5A 4KAOA 4A9TA 2J0LA 3BQRA 5L8KA 5HGIA 1FQ1B 4IX3A 4XG2A 5JGAA 4GJ3A 2QLQA 2VZ6A 3ZONA 1A06A 2ETRA 2B55A 4JBOA 5AP2A 5FRIA 3WZEA 4I5HA 3TV6A 4ACCA 1MUOA 4CFVA 1DI8A 5J79A 5DEWA 4O84A 1JLUE 3CD3A 3KXGA 2JKQA 1M7QA 3G5DA 3KN5A 4HYUA 4WBBB 4AGWA 4YURA 1QPCA 2X4ZA 4YUQA 4M7IA 3D7ZA 1IEPA 1H07A 4XG7A 4LRJA 1NA7A 2VWVA 4BCGA 3MIAA 3PXQA 5T68A 4A9SA 5HLNA 4DEBA 4YC3A 4QTCA 4QYYA 3W8QA 5L6PA 4CT1A 4I6QA 5FLFA 2YM4A 3QA0A 4H1MA 2YEXA 5FXSA 3G90X 4FBXA 5HE2A 4LRMA 3NIEA 2J51A 1YOMA 3E7VA 2EUFB 3BWJA 1O6LA 2NRUA 4MVFA 3A7FA 2P3GX 4WKQA 5CENA 2VTMA 3OWPA 3FSKA 3UQGA 3CKXA 4F08A 4FOCA 3GNIB 3VS1A 4ZTRA 4K77A 4IX5A 3RM6A 4FT5A 2Y8OA 4BZNA 2B7AA 5HOAA 3R7GA 2QD9A 2C6DA 3Q6WA 4O7VA 2VWWA 4NWMA 3ZRMA 4XRLA 3LMIA 4BDFA 1DS5A 2PVMA 4Y8DA 1DAYA 2B9HA 5E1EA 3V51A 4QDEA 1M7NA 3MPMA 3JYAA 3WF5A 1PRYA 2DQ7X 1TKIA 4WNOA 4FSTA 2X7GA 3TIYA 3DXPA 1Q8UA 3IPHA 4JG6A 2GNIA 3NVKI 4MXZA 4FTTA 5CALA 5HX6A 4BBEA 4XNEA 4X6RA 5KKRC 4NU1A 1H08A 2G1TA 2PVKA 3ORXA 4FKIA 4IEBA 5FTQA 2QR8A 3AC2A 3VUHA 4DFUA 3LJ0A 3FKOA 3P5KA 4AA4A 2BZHB 2X39A 4EQMA 3PIYA 5EK7A 3QQUA 4MCVA 2OLCA 1AQ1A 5H8EA 1H8FA 3UIMA 1SYKA 4J52A 4FKUA 2QKRA 4RVKA 3ORKA 4F1TA 3KL8A 4EYMA 3TACA 2OJIA 5IH6A 4DDIA 4IVBA 5AR5A 5DR2A 5ETAA 4E6AA 4DN5A 4BZOA 3AC5A 5L2SA 3ID6C 5A3XA 3PSDA 2WGJA 4ONAA 2ZB1A 4IDVA 4MXYA 3W1FA 4EZ7A 4RIWA 4GFOA 5HZNA 3D14A 5AR2A 2A98A 1PMUA 3EZRA 4FIGA 2PE0A 2UUEA 3FZPA 4O0XA 4QMSA 4DG0E 3UODA 4FTKA 3ZRKA 1J1CA 1PYXA 4OTRA 3A7JA 4DEGA 2LAVA 2YIYA 2IF8A 4J53A 4ZS0A 1OBDA 4L7FA 3GVUA 3PP1A 3ZBFA 1UU7A 4CZYB 2JBOA 3HRBA 3VC4A 3V8TA 2XKFA 3KXXA 3PWDA 3ZZEA 5J9ZA 5CAVA 3ZSHA 4LUDA 1GNGA 2PVRA 4F70A 1DI9A 4CEGA 3C4CA 4IZAA 1YDSE 2PHKA 2Z7RA 3H0YA 4HCTA 3VULA 4E4XA 4I24A 5D11A 4AWIA 3L1SA 2XJ0A 4FRFA 4ZEGA 2W5BA 5E9EA 2B9JA 3DTCA 5CI6A 5I0BA 3TNQB 2WHBA 4E4LA 5J95A 3F3VA 4O83A 4PL3A 5DVRA 4O6EA 4F1OA 2UZEA 3L8XA 2SRCA 4KB8A 4GRBA 2Y6OA 3NS9A 3MY5A 4O7ZA 4FZFB 2BDWA 3KA0A 3TYKA 1XH7A 5IUHA 5J9YA 5C26A 3RAIA 5AV1A 3FC2A 4KWPA 2J5FA 1W0XC 2YITA 3BGPA 4IW0A 4LOQA 5IZFA 5CNNA 2IG7A 4Z7GA 3FWQA 3QRJA 4ZIMA 3MJ1A 4RA5A 1VJYA 3ROCA 3N9XA 5FP6A 4ENXA 3PUFC 3BCEA 2X2LA 4KABA 1BKXA 2FSLX 4QMZA 4BKZA 4CKJA 4TYIA 4XMOA 5B7VA 1WVXA 4A9YA 4UWYA 3EQPA 2W1IA 4HOKA 5TKDA 4KA3A 1JKLA 3B2WA 3GQLA 4X0MA 1VYWA 3BYVA 4FKTA 5CY3A 5FEQA 3VJNA 2WIHA 4AQCA 4GJ2A 5AUTA 4XHKB 3UVPA 3DPKA 4HVSA 2ITXA 2JEDA 2WXVA 3SRVB 2BAQA 4GYIA 5GZAA 4ACDA 4RMZA 4AA0A 4OR5A 1Y8GA 2OJJA 2Y7JA 2OZAA 4IAKA 2R3OA 4U40A 4YTIA 4BIEA 2F2CB 2C6OA 2HW7A 3BELA 4HPTE 4B6LA 3I60A 3RWQA 5IMEA 4O0WA 2C47A 3TKUA 3ZBXA 4CTBA 4M15A 3PA3A 3IGOA 4FUYA 2JKKA 1XBCA 2W1ZA 2X0GA 3C0GA 5AMNA 4D2WA 5I4NA 4ZJVA 1A48A 5AFVA 4IADA 3KULB 4I93A 3C13A 4FEVA 3RGFA 4HGTA 4U42A 3F6XA 4C3FA 1KWPA 4RJ6A 5M09A 1JQHA 2HOGA 4NM7A 4PTEA 4XV3A 4PDYA 3F66A 1IASA 3G9LX 5E7RA 3R7EA 4D2VA 3LXLA 2R3KA 4Y72A 4UWBA 5EM7A 4X3FA 3BBTB 3QX4A 3HV7A 3BRBA 3LFEA 2Y4PA 3B2TA 4JXFA 4FKRA 4B99A 4BIDA 2BUJA 1TFFA 3E93A 3RCJA 3V5TA 4AX8A 1VEBA 4C35A 2H96A 3IDCA 4ZS4A 2G15A 3R04A 1KE6A 4PPBA 5I5ZA 3E8NA 3LXPA 4O7YA 4M68A 1JSUA 4R78A 1IA9A 2FH9A 2ITOA 4JDJA 5AM6A 2GS7A 3NWWA 2VTRA 5HHWA 3SW4A 3H3CA 3PRIA 4J7BA 4S34A 3FQEA 4O7LA 1U5QA 1W2FA 4FK6A 4HYHA 4Q2AA 3RCDA 5EM5A 4X21A 1KE7A 4GG7A 1OUKA 3O0GA 4Z55A 3AG9A 4IHPA 2W0JA 5A14A 5KKRB 4N57A 1ERKA 4H3BA 2WMWA 4MNFA 4O27B 4RZVA 1W7HA 2GSFA 4NW5A 2WQOA 5G1XA 4QMUA 4ZZNA 3MYGA 2XYNA 3KK8A 4E6DA 4O4EA 2C6TA 4N6ZA 4Z9LA 1T45A 4R7BA 3AXWA 5HU9A 4FIFA 3TCPA 5CU2A 3HECA 3LFQA 2WMVA 2Z02A 4OBQA 4WSQA 4QP9A 4MHAA 4AZFA 5BYYA 5FM3A 4KIOA 2HZIA 2XCHA 3PVBA 3QQFA 4OTFA 4MF1A 2C1AA 3F3ZA 5CU0A 1OB3A 5JFWA 5E4HA 4FI1A 5BQ0A 2R64A