1TQPA

Crystal structure of a. fulgidus rio2 serine protein kinase bound to atp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
282
structure length
269
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords conserved hypothetical protein
publication title Crystal Structure of A. fulgidus Rio2 Defines a New Family of Serine Protein Kinases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 86
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tqpA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1tqpA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1tqpA02
3CIKA 5TO8A 2VC1A 3S3IA 5H8EA 3PXFA 3BROA 3MV5A 3GCQA 2V6CA 2P0CA 4G7ZF 4X2JA 3UYTA 2OA4A 4IHSA 3EQBA 4KKGA 4IX4A 2O2UA 4OGRA 3FZVA 1PMUA 3KA0A 1LVAA 3RALA 3U51A 4O0RA 2OJFE 1GXQA 1FVTA 2A07F 2VZ6A 1M7QA 1RI7A 4GT4A 5J8IA 3R7GA 4O21A 3WG9A 4EV0A 5L2QA 4B8MA 5D12A 1P6RA 2XNMA 2QU6A 2XBAA 2RFDA 4ZP5A 4IAIA 3KCKA 5C8NA 3MN3A 3ORZA 2OW3A 2BHHA 3RK5A 3FZRA 3ZLWA 2UZWE 2XJ1A 4XG2A 4CNHA 1K3AA 3E3BX 1ULYA 2WMAA 3S00A 2OBPA 2VWYA 2J0MB 2X9FA 4Q2AA 4ASNA 4NKSA 5LGNA 2XBJA 3HZTA 5CQUA 1RNLA 3AOXA 2UZOA 3I64A 2DAOA 1P4FA 3Q2MA 5AWMA 4EK8A 1XHAA 4ASZA 4Z2YA 1RIOH 3DV8A 2HEOA 2IN6A 5L3BA 3V5QA 2QVOA 4A9RA 3BELA 2RKHA 1R78A 5BVOA 2PPQA 2JKKA 3KP3A 3EYGA 5CVIA 1SD4A 1ZYSA 5CAVA 3TZ9A 3G0FA 4EORA 3PPZA 5TR6A 3LFAA 1LR4A 4RA4A 5HNBA 2GNLA 3FHIA 3DXJF 3VQHA 1WFCA 2VBWA 4BDEA 3H4JA 3GOPA 2F2EA 4RJ8A 5F9EA 4TW9A 3R4KA 3ROYA 5FTQA 1BIBA 4M66A 2UW8A 5J8CA 2R3LA 2P7CB 2XF0A 5AEPA 2WTIA 4DG0E 4ENMA 1T39A 1MQ4A 3Q9WA 4CCBA 4WCGA 1FZPB 4O6EA 5KMKA 4M0YA 5FD2A 2D45A 1S7OA 4AACA 5CVRA 3IW7A 1AQ1A 4I23A 1YXTA 2ITXA 4QPAA 1FPUA 2CGWA 2C0OA 4EH3A 4XSZF 3MJ2A 1XGOA 3I59A 2XMYA 1IZ1A 3VS7A 4BIBA 3AC8A 1ON2A 3FXWA 5CSPA 3SZTA 4NKAA 3OD6X 1UCRA 2P55A 2F7XE 2UW5A 3WU1B 4QMWA 3MVMA 1EH6A 1BL6A 4DGLC 3Q5IA 4PZJA 2HCKA 2UVYA 2WD1A 3LAJA 4CVAA 1FMOE 1P92A 2OG8A 2I0EA 5KMLA 4K9YA 3ZMVA 1ZLKA 3NYVA 3SOCA 2DBBA 2YJSA 3ZO2A 3SXYA 3FKNA 5FGKA 3EH9A 4BKJA 3UC4A 4YUQA 4MTAA 5EEGA 3QA0A 2FU4A 2WNTA 3PVGA 2FBIA 3D5XA 2CW0F 2YPRA 4KKHA 1TKIA 4AN3A 2WFYA 1XB4A 1U54B 3QTRA 3BPVA 2WTCA 1IN8A 5KVRA 2OK1A 4JBAA 3UZRA 4DITA 4F7SA 3ORKA 3AMBA 2JD5A 4FICA 3E7VA 5DDGA 1CKJA 5FP5A 2PTKA 5HGIA 3QX4A 4AA4A 5KNJA 1IN6A 4C3FA 2VNWA 4WKQA 4CFXA 4O91A 1F5TA 3DTCA 5I9WA 4YLLA 4EJOA 4KBAA 5IEVA 3DBDA 3EQIA 5AV0A 2V55A 4CYJA 2MH2A 1Q62A 5BVWA 3TNWA 4XRFA 2UZBA 5KMNA 4YJVA 2Z8CA 3QUPA 3VS2A 4BZNA 1UVRA 5AAFA 3TZ8A 3AD6A 2QOIA 3L7WA 3P7CA 1UNLA 3TWJA 4XLVA 4A06A 2W0JA 1UHMA 1J1CA 2E2BA 3CY3A 4O0XA 1OL7A 5DG5A 4UN0C 3GO5A 4FV4A 4D2PA 3RKYA 4HOBA 1OKVA 4ZOGA 3R6SA 1VJYA 5I9YA 3R0JA 1OL1A 5A4CA 3ROUA 2ITOA 2CKPA 3ZP5A 2YM3A 4NFMA 5BYLA 2C6YA 1V1KA 3DEUA 3HRSA 2XZSA 3AGLA 4C34A 3QAME 3UMXA 4O0SA 3VBQA 3D15A 2ZV9A 4GG5A 3FF5A 3ZN1A 4IFCA 2ESMA 4FZ6A 4QYHA 5DR2A 5L2SA 2PMHA 1A06A 2WMBA 4C36A 1SNUA 3E6CC 4FT5A 3SLSA 4LUEA 3COIA 3QKMA 4FTCA 3CXWA 4QMZA 2LDUA 2IZRA 4M73A 5CZIA 3CPCA 4MQ2A 4QP2A 3MFUA 4YMJA 5HCXA 3LHJA 5JT2A 4HW0A 3RKWA 5E90A 2X4FA 1LB2A 3WTYC 1ZXEA 2HY81 3MH1A 5EOBA 3UMWA 3DB8A 4EKLA 3WZEA 3F61A 3DDPA 4JBVA 3BE2A 3VBYA 1FSEA 3KRXA 5F95A 5DT4A 4KMUX 3EQHA 4DNCA 3C13A 4RIXA 2QKRA 2YA9A 4QWQA 3C4WA 4AE9A 4KAOA 2OH0E 3DCVA 2X7OA 1ND4A 5DPVA 5A4TA 3ABUA 1KQ8A 2PVNA 3MA3A 4L3JA 2DWBA 5BYZA 3V8LA 3K54A 4BL1A 5JFVA 1OIQA 4LI5A 5JFWA 2O0UA 5DV5A 1YFHA 4NTSA 4GFOA 4M71A 4CYIA 2P5VA 5A14A 4E73A 4R3RA 5EKOA 4HLYA 2VO0A 1TQPA 3ZONA 4IHTA 1Y91A 3LA2A 1XGNA 4DH3A 5HS7A 5LCJA 4KT5C 2D1VA 3LOKA 2QQBA 4O3MA 5CU4A 5HDGA 3OTVA 1MZBA 3FHRA 5JH6A 4I0BA 4OAVB 3W6KB 1D5VA 5HIBA 2E9VA 1LNWA 4RB2C 5AA8A 1I27A 3KP5A 4FSUA 3H3UA 1ZZ2A 1IRFA 4DCEA 3KB7A 4FV6A 3VEPA 1O57A 1JOWB 2ETHA 5LRSA 3K1MA 5C8KA 3BX5A 5L2IA 5IG1A 5DEWA 5LVOA 2P5LC 3LE6A 5IA3A 3JXWA 3J80K 1J59A 4DF3A 3I79A 2J0JA 4FT3A 4RVMA 5ANKA 2R3MA 4UXNA 1BUHA 5FFZA 4AA0A 3MESA 3EKNA 2GMXA 4OTQA 4ZTSA 3PG3A 3HGKA 1EV7A 4AW0A 1HKQA 3OXZA 3RM6A 2ZMDA 4ALVA 4QLCU 3KLOA 5DUKA 4RVLA 5EM6A 4KIBA 1UA2A 4WK8F 2WMVA 3BU5A 3AT4A 4F1MA 5KK1A 5GJFA 1YXUA 4GSBA 5DEYA 2J6MA 2MBFA 4LMUA 1UB9A 4FL3A 3CO7C 1JBPE 3TG1A 2ERKA 4FTIA 4DTBA 4QP3A 3CD8A 2W17A 1QQIA 2HXLA 4HYUA 4EJUA 1SD6A 3JSPA 2HZ4A 4J53A 1GZOA 3TIZA 1MJBA 4CZTA 2Q83A 3OT3A 4PWNA 2G2FA 4GU9A 2Y6OA 5LHHA 2WMTA 2EXMA 3I5UA 4C33A 1JSVA 4FV8A 4N6YA 4HBLA 3WODF 4HJOA 1WBOA 3LCSA 3BPRA 4IX6A 5IF1A 2CPKE 3KEQA 1Y8GA 1P2FA 2P4WA 5DEQA 1H0VA 2PHKA 2ZDUA 3ALNA 2XKOA 3PJ1A 1REJA 4DC2A 5KMJA 4R77A 3BYOA 3TL8A 2DQRA 2IZSA 3A4PA 1FVVA 3QAHA 4EOMA 1DPRA 5FD6A 3OUKA 3OY1A 2YACA 1OL5A 4F64A 3L8PA 3KCCA 5DVRA 5BVNA 3QTQA 2HTSA 4AGDA 4Y17A 3J81K 4RX9A 3BHUA 3R21A 3REPA 3DF8A 3N9XA 4AGUA 2FMYA 4J95A 4OT6A 3SVVA 3NW7A 5EI6A 4OTDA 2OD5A 4ENKA 1K7AA 1XD7A 3UP7A 1T98A 2REIA 1J7LA 3R61A 3ZUUA 3HL7A 3A60A 4TYHA 3U87A 3C5UA 5ETIA 3QD3A 4CCUA 4BBFA 4ZYDA 2XIZA 2W99B 5LHIA 3C0HA 4S05A 3GCPA 4IZAA 3FLYA 4LLLA 3E5QA 4GG7A 4QMSA 3NW5A 1ODDA 4BYJA 3K3JA 2I7QA 3FEGA 2F57A 1APME 4FEQA 2CJMA 1BI0A 3HKOA 2UXXA 4QP4A 4EWQA 3H30A 4JG7A 4FE2A 3I59B 3LCKA 4BWPA 4Z7HA 4HW7A 4M15A 4DHFA 3NNXA 4F6WA 4TWOA 5HCZA 4B8XA 2HZIA 5D7AA 5B0XA 4CXAA 4LD5A 2PE0A 2XGXA 5IDNA 3A7IA 5JZNA 3M42A 3FZ1A 2IA0A 1UWHA 2PZRA 3EQGA 3F3XA 4HYIA 3RAHA 4FTAA 4AVPA 5M57A 4QO9A 4JBQA 4DLIA 2A68F 4BGQA 3MWUA 5ETCA 4A9YA 2A3SA 2CGVA 5BX0A 5E8ZA 3R7OA 2OI4X 2KIMA 2QODA 3ELKA 4A5NA 4UWCA 3ANRA 1FT9A 2E9OA 2O8XA 2OZOA 1SVHA 1Z9XA 5ANGA 4L42A 2V7AA 3TNPC 3AC2A 4HNIA 3ZTXA 3FLZA 3PP1A 2CSNA 3DK6A 4FIIA 5CVGA 5L6WL 1O7FA 3DKFA 5KMMA 3DBEA 3RYPA 5AR2A 4P55A 5G6VA 2BZJA 4QPSA 4EJNA 3E6DA 4GXOA 3ML6A 4G7HF 2YWPA 2YZAA 3PZEA 2HYGD 4HPUE 4G3DA 3BQRA 4KD1A 1F4KA 1BI1A 4DLJA 4IDTA 1UHWA 3BHYA 1PXIA 2DI3A 5IQCA 1B9NA 3HNGA 2CLQA 4IHPA 2XAQA 4TXCA 1BI2A 2YIYA 5DRDA 4P5ZA 1UU7A 5D5WB 5E8VA 3E8CA 3RMFA 3GEQA 3RAIA 4L6QA 3HMMA 2QOQA 3GNIB 4QQ5A 4IC7A 2GIVA 5CYIA 2M8EA 1YQJA 2CCIA 2UV2A 2GA1A 4TTHB 2W4KA 4EOKA 3KF7A 3QQFA 4Y83A 4F1OA 5HLNA 4FGRA 1FBUA 5J6XA 3VFZA 3QP6A 4BDBA 1CKPA 2ETMA 3MS9A 1VR2A 3R7VA 4FEVA 5AUYA 2EXEA 4XV1A 4Y13A 2XCKA 3R2YA 4MKCA 3DPKA 1M17A 3ZRKA 1J9IA 2PY3A 4L7FA 3KK9A 5EQYA 4DFXE 3QQJA 2HOEA 2MLKA 4HLXA 2AUHA 2Z3YA 3QF9A 3V6RA 4LRMA 4FSNA 2VWVA 1CKIA 3F5XA 4OAUC 1TLHB 3QL8A 4FX0A 3IL2A 1Q8ZA 4MBIA 4NM0A 3UIMA 2X81A 3OWKA 4G34A 3HRCA 3TZ7A 3NRVA 4GJ3A 4XNEA 1HOWA 4MBJA 2R3NA 5CAQA 6PAXA 3G90X 3LCDA 1KU3A 2WC2A 4CYDA 3VVHA 3RPSA 4CT2A 4AAAA 2GNIA 3VHEA 4GYIA 4AD9A 2J0IA 1WBNA 4GFGA 3BYVA 3ZMSA 2YISA 2O61A 3CLYA 1W98A 1KE6A 1JLUE 5CNOA 4GO1A 2HFHA 4PL4A 4XUFA 3EWHA 4AT4A 3F3UA 3EN9A 3OFMA 4X3JA 1NVSA 2WOTA 3LXLA 3LAUA 3F8CA 5LMKA 3RK7A 4YP8A 3C18A 3IWFA 2G1TA 3Q9YA 1IASA 4RIXB 3TJDA 1TQMA 2XUUA 3RCDA 3Q53A 4D0WA 1Z1DA 3R7EA 4BKZA 5D5UB 1RE8A 5C1QB 3BJOA 4P9UA 2PZ5A 3V7SA 3QRTA 3IK3A 2H27A 2GZWA 2QOFA 2XIKA 5HBEA 4MXOA 3P23A 4ETSA 3HRFA 4P96A 3R1SA 4XRLA 4WNKA 4KYWA 3HIFA 5CXZA 3OXTA 3W18A 1UU9A 1UKHA 3SA0A 3BJAA 4XMOA 3KFAA 2G2IA 1ZRFA 4G5PA 2ZO4A 2FXAA 3H9RA 5EM7A 4G1WA 3T9IA 3E7OA 4M68A 3OWPA 3A62A 4AW5A 2NRUA 3IRRA 5IT9Z 4FG7A 3T3UA 4EOSA 2G7UA 5A6NA 3D4QA 3FXRA 4O0TA 3QQHA 3FMMA 4F63A 2YITA 5M07A 2R0IA 3ORPA 2F5EA 5DBXA 2QOOA 4BQAA 3PA3A 2LAVA 3VF8A 3ZDIA 4XYFA 1BC7C 1FBNA 4OIQF 4HVSA 2UZTA 4I3ZA 3WF9A 2ESNA 4IAFA 1JKTA 4YJUA 3BY6A 2F4JA 5AIPA 3R1YA 4BBMA 2QCSA 2YJRA 4LOQA 2C68A 3HMOA 1UNGA 4E3CA 3R8LA 2W1DA 2X8IA 3FLNC 2Y7JA 3WYYA 4N6ZA 3PJ3A 3DZQA 1OI9A 5CENA 5C8MA 4PDPA 2YR2A 2ITVA 4E7WA 4WNMA 4LG4A 4ARKA 2KTYA 3RPQA 3VB2A 5J79A 1I5ZA 5EYDA 2GFCA 3CUQA 4QMOA 2W1IA 4GU6A 3SFZA 2QO9A 3GXOA 1YXVA 2WO6A 4P5OA 4BAYA 2XAFA 4UMTA 1U78A 2JPCA 4MTEA 3LLAA 3VS5A 4F4PA 4FSTA 5M09A 2BPMA 2OKRA 3DQVC 4CZUA 1U6GA 4HZRA 1O3SA 4EMSA 4RJ5A 4XV3A 4OBQA 5JQ8A 2NRAC 3ZZWA 2BZKB 4MQVA 3FKOA 4FODA 5ITAA 4PMSA 3KN6A 3EFJA 5A6OA 4CZYB 4GCVA 1SFEA 2QG5A 2X2KA 3DQXA 3QC9A 4C7TA 5ETFA 1YXXA 3K1NA 4LFIA 2IVSA 3OOPA 3ZFYA 1NW1A 5F94A 2HKXA 4AZSA 4Z16A 2A0CX 4W8DA 4FTKA 5CEQA 3L8VA 4X3FA 3K1PA 3Q9VA 5CF5A 3WF5A 3PZHA 1KE5A 4KINA 5DCMA 4DH8A 5D4RA 4GK4A 3MFRA 3TGNA 4IF4A 5JGBA 1PHKA 2A69F 1H25A 1IA9A 3GC8A 4UWBA 5AADA 5CEPA 3VHKA 4HV5A 3KULA 4IJPA 5HOOA 4Y5QA 3I53A 5CJ9A 3COMA 3PA4A 3TKIA 1UU3A 3OOMA 2JRTA 4MF1A 4CKIA 4HF1A 4RJ6A 2R3RA 1E2XA 5AV4A 2OGVA 1PXJA 4BI2A 1L3RE 4XX9A 5CAUA 1MDMB 2YABA 5BVDA 3NNUA 1FBSA 4BCIA 2GNFA 1T0FA 2HZTA 1PKDA 2XA4A 5JMSA 3QUDA 5KCVA 4LM5A 1HCLA 3QOPA 3EFKA 4ZZNA 2PVFA 5BMSA 1QPDA 3OC1A 4IB1A 5E8TA 4WXHA 3Q9ZA 4DCAA 3NDMA 3BYSA 4OTGA 3TO6A 4TYHB 1ZARA 3EETA 1I09A 3ISPA 3TKHA 4N4SA 3OV8A 4PGGA 4BVUA 1FMKA 3EL7A 4BCHA 4EQQA 4HX7A 4H05A 1YI6A 4DH1A 2EUFB 1B4AA 3CQUA 1H26A 3ODYX 3C1XA 2Q8KA 5KE0A 2B9JA 2Y0AA 1ZYJA 4MYGA 4FTTA 4R8HA 4DG2E 4MD8E 4CMOA 3OCBA 4USDA 1Q3DA 4IRHA 5IUHA 2PN6A 2W9ZB 4PDSA 4RGXA 4YHFA 3WGGA 3BIZA 5DH3A 3RHKA 4BTFA 3OG7A 4AF3A 2IW5A 1Z9CA 3KKVA 3TTIA 1OL6A 2LKPA 4KIOA 2J5OA 2I0VA 4E8AA 2NO3A 4WUAA 3FMRA 3ODZX 2ONLA 4FOBA 5FUTA 4I0SA 3HUGA 4WSYA 4Y46A 4GK3A 4QMQA 5FLFA 1O6KA 1GZNA 3PY0A 4O7TA 4OTFA 1X3UA 5ICEA 3QQLA 2F7EE 5FBOA 4NL0A 3K69A 3O2MA 4G6QA 2M30A 3NCGA 1W7HA 1I6XA 1DPUA 5EYCA 3RPOA 4I01A 5D11A 3WILA 1Q8UA 3WI6A 3ELJA 5FQDC 4E20A 4QMMA 3KL8A 5I3RA 3QZGA 2ZYBA 4XLNF 5LGTA 4DN5A 5C03A 1G4DA 2FBHA 3AC4A 4C8BA 3R00A 4H1MA 4MWHA 4EQUA 2WZJA 4LJZF 4QMVA 2R3QA 4K8AA 4O38A 4FGBA 2GAUA 4AXAA 4IXPA 3G33A 5BS6A 2CCHA 4UY9A 4KIGA 3AGMA 3L9FA 4F7NA 2JTVA 1Z91A 4KSQA 4XOZA 1ZY4A 3GQIA 4O5VA 3VULA 3IPHA 3V6SA 4O96A 4PF4A 2WMQA 5B2LA 5JVTA 5JHUA 2PMIA 1JVPP 5E1XA 4CSVA 1L3LA 5E91A 4B6LA 2XHKA 1ZREA 3R28A 3BYUA 4A4OA 5ICFA 2GCDA 4GMYA 5AV2A 5IEYA 2UW3A 1CTPE 3W32A 2WEIA 2UXNA 5LEKA 5L2WA 5CASA 2UZDA 5A4EA 5ILVA 4IXAA 2VTOA 4PMMA 3HRMA 5D41A 5K1YA 3TNQB 4W4XA 3EHAA 2A2AA 2K27A 3ANQA 3FMJA 4F70A 3F66A 4ENNA 2Y4IB 4GL9A 1M52A 3NUPA 2GPHA 3F6OA 3BPXA 5DR6A 4OMZA 3IECA 3RNYA 5J5SA 3F88A 1PY5A 1J1BA 3F3WA 4U9AA 2E9UA 2VWWA 5JRSA 4JIAA 3W2RA 4FEXA 2YIWA 2ZDTA 5I4NA 1H0MA 2B55A 2RIOA 3MVJA 2WELA 3EUHA 3O8UA 4LK1F 3OT8A 5D6FA 1IUYA 4YLKA 4WUNA 4BCQA 5M4FA 2O0YA 2VGPA 3V04A 4WOVA 4EH9A 3QLFA 3VW8A 1G3TA 3ULIA 5E4HA 3LM5A 2ZMCA 4MQ9F 2M87A 3ORMA 3BHVA 4R1YA 4FSRA 5C01A 4GUBA 4FKJA 3R8MA 2QLQA 4ANBA 3TUDA 3RAWA 3GU4A 3KP4A 4KIKA 4RLLA 2VTIA 3FXUA 2AYPA 3EZVA 3R8UA 3OHTA 2VTRA 3ZXZA 4L5IA 4RJ7A 4G9YA 3M8EA 5AP6A 1JE8A 4IWPA 4ZXTA 1U8RA 4IADA 4LV5A 5IQGA 4M69B 3LCOA 2COMA 1B9MA 4E93A 4ZMEA 1FVRA 1T46A 2R7FA 2RGPA 4YJPA 4D2WA 2QZ8A 5BQTA 1IEPA 4BIEA 2LF7A 1ZMWA 4RVKA 3WOWA 3CJGA 4GVAA 1HCKA 2YM8A 4DEEA 4D9TA 2B7AA 4HX4A 4MX9A 2NP8A 2W24A 2P6SA 2EWAA 2HW7A 2C1AA 3MZHA 3CPBA 2XS0A 1BI3A 3IONA 4EOPA 4ZJJA 4C38A 3CJNA 2GDOA 3ZS5A 5L8LA 3ZBXA 5CYVA 3QCYA 4QP6A 2V22A 3ZC5A 4ONAA 3R01A 3I6UA 5JRQA 5AP2A 4DH5A 3LLTA 4HF0A 4AQCA 2QI8A 2VC0A 2B52A 3IKAA 1EH8A 3F8MA 3Q6WA 4FTQA 5K5NA 4B99A 4PDKA 4MEDA 2Y4IC 3V7CA 1XH9A 2PSQA 3LFBA 2VXZA 5AR3A 2ZV7A 4BYIA 3FZSA 4DFYA 4EZ7A 2WV0A 4ZZDA 4I24A 1URCA 3QQKA 5K9IA 4RC4A 4RPVA 5JK3A 1PXMA 3AG9A 3IDPA 4CFVA 5LWMA 4D28A 2F7ZE 4LL5A 3LQ5A 3LCTA 3SG8A 3DS6A 1I44A 2YWVA 5EKNA 5BYYA 4DFZE 1BMKA 4CGAA 4IH8A 2CDZA 4MXCA 5M53A 3P86A 4F7JA 4EOOA 5HTIA 1Q5KA 5I5ZA 3NYOA 4NU1A 4P90A 3CUQB 1WBTA 1XH6A 2X8EA 4D4VA 3VUHA 4XG4A 4M74A 4YJNA 3F5UA 2K4JA 4KDPA 4RAYA 3MFKA 4ENJA 2HOGA 4FV0A 1WVWA 5HLPA 4ZH4F 2EFNA 5FP6A 1U4DA 1TBXA 2VO6A 3B02A 4EOQA 5IQFA 5HLIA 3KP2A 5CT7A 3NUUA 1Q8TA 5LMKC 4N9IA 1B6AA 3HV7A 3QTWA 1OL2A 4ACDA 2OBJA 4D2TA 5HCYA 4V04A 4IZ5A 1SNXA 3SXFA 4YZDA 5I9UA 4M67A 3M9AA 2BALA 3DPLC 3WTWC 3OW4A 4YNOA 2UVXA 1ZRZA 3PY1A 2VNYA 1AWCA 4JQ8A 3QU0A 4UVCA 2QLZA 3FMSA 4YTCA 2X8DA 2ITQA 1I1SA 2BAKA 1HW1A 5L3FA 3UYSA 1SZMA 3CC6A 2JSCA 1WMKA 3UIUA 3FZPA 3O17A 3GZ6A 3RAKA 2QOLA 4JRVA 4X3FB 1XBBA 4C62A 3BEAA 4MVFA 2C5YA 5AA9A 4FKOA 5DCMB 3H0YA 3N4VA 1GOLA 1O6YA 2RG6A 4LQMA 4RG0A 3F5GA 1XMKA 3MH0A 3KULB 3ZFXA 4QQJA 4OBOA 4FYNA 2VTNA 4I20A 5EI8A 4O82A 3U54A 3LXPA 1Y0UA 4QMXA 4HZSA 1R3CA 2WB8A 3NIEA 1R1WA 3UE4A 3R9NA 5CU0A 3UODA 4U43A 4A6EA 4MNEA 4YBKA 2XIYA 4CTCA 5JEBA 4CHUA 3MIYA 1L8TA 3FMEA 4ZIMA 3P4KA 2R7BA 3PSCA 3L8SA 1P14A 4HGTA 3E64A 3WU0A 3WTXC 3O2PE 4IFGA 3OTUA 3JAMZ 5AAEA 3OUNB 2IVVA 4Y8DA 4G94A 1R0EA 4MXYA 3S1HA 4NWMA 1Y6BA 1ZOEA 4H58A 4ZSAA 1R58A 2PMOX 2CNUA 2C69A 3V5PA 4IMYA 1URWA 4I41A 2Z9OA 4K2RA 2BZIB 2XIGA 3PSBA 4MAOA 3PWYA 3CUQC 3WE8A 5CALA 3GUDA 4EGZA 4FKSA 5T3QA 4E5WA 1H9TA 2C3LA 1XCBA 4NM7A 5D8LB 4FV7A 2XYNA 2CKEA 4OU0A 3OEFX 2PL0A 2YCRA 5FLXZ 3RKXA 1G6NA 3KP7A 2RC4A 3RM7A 5KKRC 3LQRA 3GFLA 4BGGA 2CFXA 2ZNZA 3CD3A 2SRCA 3ZBFA 4EUTA 4XG8A 4IB0A 4UHTA 2R3OA 3HTUA 2GQRA 2F5FA 4R79A 3BV2A 1KOAA 4HCVA 5HG8A 4LMYA 2Y75A 3C0IA 2R64A 3LSTA 3D0EA 4RB1A 4FIHA 1YTYA 5J7HA 2JBOA 1G8AA 1MQBA 4YZMA 3H9OA 5AFVA 4DEIA 4M9ZA 4PQNA 4BCGA 2VTPA 3ZLXA 3IQ7A 5CEMA 2R3JA 1ZYRF 5M4CA 1QPMA 2V9VA 4X3FC 2X0GA 4IZYA 4IM2A 5EI2A 2OLCA 3C5IA 4EVIA 2XNBA 4BWKA 1GVJA 5HKMA 2UUEA 3GU6A 3V7RA 5H20A 5FO5A 1QGPA 3QZIA 2W96B 3KRJA 1GAGA 4U80A 4NIFA 2Z7LA 5DOSA 2Q0BA 4Q47A 4AT3A 1BN5A 2Z5UA 4FNYA 3ZEPA 1ZGJA 2VWBA 3HYHA 4NQWA 4O7LA 4M6YA 5AP5A 3CDHA 1OKWA 1ZYDA 2MH9A 2W1FA 2J90A 3O0GA 3F69A 4JIKA 3H0ZA 5HTCA 1PW2A 3LPBA 5F20A 3DPTA 4XG3A 3RTRA 4W8EA 3KMMA 1SFUA 5LQFA 2R7DA 4F08A 2XK3A 5GNKA 2YU3A 3VWAA 4H1JA 4ANQA 5FM3A 3F8FA 4FHTA 3TUCA 4FC0A 2F2UA 4UMUA 2YLFA 3BWGA 3HAMA 3KLNA 4CV9A 1IRGA 3HA6A 4FF8A 2QWWA 4FTJA 5FEDA 5DRBA 1Q61A 4O0UA 1OKRA 2JDVA 1CMKE 3E63A 3NNVA 1OPCA 5KBRA 1H0WA 4ZTRA 4U79A 3U9CA 1FP1D 2W4JA 4FNXA 3IW5A 3BJ6A 1SAXA 2WEVA 3O7LD 4X6RA 3G3ZA 5K5XA 3T5XA 4FVRA 5CSHA 3FM3A 3EMGA 2ZV8A 1R39A 3KXXA 3TKUA 1KE9A 3HP2A 4UMRA 5M51A 1XSXA 2EFOA 4XP3A 2LNBA 4M13A 1GIIA 5AR4A 2CGXA 2PUIA 4S33A 1FY7A 4YC6A 5AM6A 4AOTA 4AZFA 1DAWA 3CUOA 5M56A 3KETA 2QR8A 4X2NA 2KJBA 4D1XA 2DK8A 5J1VA 1V3FA 3ZC6A 5GZ9A 2ONLC 4O81A 3R9DA 4MH7A 1G3SA 2FSOX 2BCJA 3IKVA 1KV2A 5AR8A 4YPSA 1R0PA 5JR3A 1YW9A 3QD4A 3PG1A 3OS3A 2KKOA 3PXKA 5JKGA 4IAZA 2AXLA 3IOKA 1WVXA 5CZHA 2XB7A 4OIOF 5H3QA 3GCVA 5F4NA 4QMUA 2XJ2A 4FKRA 3ZU7A 4BCMA 4JI9A 2JAVA 4WHZA 3RDIA 2BE5F 3V5JA 1JQHA 4FNZA 4DEHA 1KE7A 3F8NA 4MQ1A 3IG7A 4RGSA 4R78A 5CU2A 2ZM1A 1REKA 2HDCA 3W10A 3QWJA 2AC3A 2VRXA 3O96A 4RQVA 5CF6A 2OH4A 4TZRA 3KRWA 4BR3A 3EQRA 3L00A 1FOKA 2PZIA 2XNEA 4HVHA 5E8GA 3F5PA 4RLKA 4F9WA 1YI3A 3TTJA 3PFIA 3OVVA 2CNQA 1RJBA 3PXRA 4PP7A 4PUZA 4E1ZA 4QMTA 4ZS0A 3DAKA 5KHXA 2FYSA 3A7FA 5E17F 4UVBA 4KABA 1W8CA 4ESJA 4EK4A 3LFKA 2IZUA 2BTRA 3F3VA 3KRRA 1TNTA 4ZYGA 3QCXA 4I21A 3NUXA 4F6SA 1CGPA 1A9UA 3O8PA 4QP7A 4WWCA 3QBNA 3RINA 4XP0A 2GXBA 1OYYA 4NM5A 4TRLA 3MTLA 4DFUA 4EM2A 5BUJA 1HW5A 2E9PA 3FC2A 4L8MA 4IWOA 4RX7A 2O63A 3F7ZA 3L9NA 4S04A 2WQOA 4I0RA 5CEIA 5A3XA 2GS2A 3GFEA 4F9YA 4J97A 5K0XA 4RRVA 2QUFA 4EJ7A 5K0KA 3SX9A 2X4HA 3OXIA 2QM3A 3E5XA 3HX4A 4KICA 4V05A 4AS0A 2F9GA 1E17A 4OTRA 3FYKX 2FMLA 3SV0A 4FKVA 4O0VA 3OMVA 3ORTA 4AZVA 2W5BA 4TYIA 3I4BA 4PL5A 3HOSA 2X4ZA 4NM3A 4KSPA 4V0GB 3D5UA 3E92A 3R0TA 4BHNA 5LCKA 4I5PA 5M55A 5JGAA 3V8WA 3BBWA 3C50A 3C9WA 3PLSA 5AX9A 4HVGA 4RX8A 4IX3A 4O7NA 1ZZLA 4HYEA 5I9ZA 1PP7U 2A4LA 4D4RA 4FL1A 3MAJA 1YHVA 4FX4A 3MCZA 3SQNA 1USTA 4GGGA 2WKMA 4UUVA 3W8LA 4OTIA 3CKXA 4TYJA 2HKOA 4FT7A 5CEOA 1LEBA 2ITUA 1XGSA 3O7LB 4EH6A 2PVYA 3RZBA 1YKRA 2BBYA 4MXAA 2L54A 2YM5A 2RSVA 4PDYA 2QOHA 4YJSA 4K77A 3VAPA 2EA2A 3CJFA 3KXZA 3ZRMA 3LWFA 1F3MC 3K5UA 4QMPA 4R7HA 3BDDA 2NNWB 3F8BA 4BWXA 1XDSA 3NUAA 4YFNF 3KREA 2JIIA 3QTZA 4CFFA 2W25A 1J75A 4CT1A 1IF1A 3VO3A 1JKLA 1W4MA 4HV6A 3PQKA 3MQ0A 3ECOA 3N4MA 4U41A 3UOHA 3JTGA 2C1BA 4WBOA 4FEUA 4DAWA 4L9IA 2R3KA 3O8TA 3R9HA 5DR9A 4CLIA 4M12A 2OZ6A 4PL3A 3WARA 3F6VA 4A07A 2O65A 5HICA 4KN7X 4PGHA 3SZPA 4XBUA 4X0MA 4RWKA 5KZIA 4J96A 3TO9A 2JITA 3BZ3A 4YO6A 3LQ3A 4U81A 2P8TA 4JX3A 2IW9A 2OO8X 5AUZA 1P4XA 1Q24A 3HRTA 1SYKA 5L6PA 1JNKA 2J5PA 3KEOA 2W1CA 1G8SA 4UZHA 4BH9A 1YQAA 3KXGA 4E4XA 1EH7A 4GUEA 5AAGA 4A6DA 2JFMA 2WTWA 5CSWA 4UBAA 5D1JA 4CQGA 3P1AA 3EB0A 3SW7A 3DFAA 2PBIA 4H3PA 3ATSA 4BC6A 4MD7E 3SXRA 1IXRC 4MNEB 4X2FA 3PXYA 5CSVA 3MY5A 3BI6A 3BZ6A 2XYUA 4JJRA 2JIUA 4XLIA 3EJ1A 2PWLA 4O6JA 2HZNA 3PIZA 3LIJA 3R02A 3ATTA 2G7HA 3ORNA 4FMQA 3QHRA 5LRRA 4QYFA 3FV8A 1XH5A 3F7WA 3POOA 3LFEA 4E4LA 3E88A 4HVDA 3QGYA 4FVQA 4BTJA 5L3AA 5EHLA 1R22A 2CSOA 2VT2A 4ZYEA 4R7IA 3R8VA 5IA2A 3GC0A 4AN2A 4KRCA 1QNTA 3ZYAA 3EFWA 4P2KA 5AR5A 2DU9A 1K79A 3QU6A 4TPTA 5BPDA 3GC7A 4R8QA 3AQVA 4EHVA 2WAJA 1OM1A 2UW4A 4AZTA 1Q99A 5EDPA 1FX7A 2W05A 5JGDA 3FMLA 4FSYA 4W9XA 3UTOA 4DT9A 2XK7A 3RI1A 2XVDA 3LW0A 3RJPA 5CU6A 2HGCA 2Q2EA 3LMIA 2BTSA 3POZA 2R3HA 2ETRA 3UNJA 4RMZA 3AC5A 3JY0A 4KBCA 3R7UA 4UX9A 4L44A 5IKWA 3OW3A 4YJTA 3BHHA 2YDKA 3CTHA 5BPIA 1BM9A 1FNNA 3A7JA 1K78A 3TUBA 2H8HA 1FINA 4YFXF 2OZAA 3TQNA 5CS6A 5HNIX 4KMFA 4G6DA 3F82A 1LPUA 4PPBA 4NIFB 4P7EA 3FUPA 4QTAA 3K2LA 3EQDA 5F64A 3DZOA 5DYMA 2WOUA 2WTJA 3SG9A 4KRDA 4DE4A 3G6HA 2L02A 2A27A 2W5HA 3JVSA 1B59A 2CKQA 4FKQA 4QP1A 4KA3A 3FY2A 4G3CA 3SOAA 3E3PA 2VWZA 5KMOA 3SQQA 3NNWA 3GXLA 5AUXA 4C3PA 4U42A 5K5OA 4LG0B 5C26A 3C0GA 1YRPA 2Y0MA 4EQCA 2VTTA 5JQ5A 2EB7A 4ACMA 3GUBA 4YC3A 3FMDA 5DWRA 3ZSHA 4ASEA 3WE4A 2JT1A 4GKHA 3ETAA 1IN5A 2BZHB 4NCTA 1P2AA 2X6EA 3FE3A 2PI0A 4NTTA 4GV1A 4IPAA 2R5TA 3PP0A 3DLSA 3ZCLA 4XLPF 3R9OA 1XBAA 2BAJA 4BDFA 5GZ8A 1XR1A 5JN2A 4O7YA 2HS5A 3P5KA 4FUXA 3PYYA 2ZAZA 4A7CA 3IGOA 4RFZA 5ILSA 5L6OA 2XAGA 3FWQA 1J7IA 3ZSGA 3S95A 4U7DA 5EM5A 4GS6A 2Z7RA 4DG3E 4OIRF 1GJOA 4K1BA 3NMUF 2E7WA 4QTBA 2YIXA 3EFLA 1S29A 4CRSA 1QO0D 3UOKA 4RFMA 3RWPA 3CQWA 2NYXA 1L0OC 2PMNX 2ZOQA 4L00A 2PG4A 4XV9A 3DB6A 4FK6A 4CFNA 3R63A 3UZTA 2XM8A 4S31A 3B8QA 3QQUA 1AOYA 2Y4PA 4X21A 1O6LA 3BOQA 1MP8A 4HQEA 4L67A 3FI4A 3BGPA 4ZTMA 3CTAA 4YZ9A 1OYIA 3PXQA 4GH2A 2ITWA 4YO4A 4TN6A 1O3TA 3GB2A 5J5TA 2WU6A 4N0BA 3NQOA 1PF8A 4FSMA 4J8NA 3KY2A 4R6VA 2IP2A 1KYWA 4NJ3A 2XAJA 4OT5A 2JDOA 3DFCB 2PVHA 3Q4ZA 5CVHA 2RQPA 2ZXJA 1K2PA 2BEOA 2UZNA 2XJ0A 4U3YA 5HU3A 3ERED 1R23A 3HECA 3ZO3A 3E8DA 1J2XA 1R36A 4FA2A 3RNIA 3HHHA 3E6BA 4HAMA 4FKLA 5IA4A 5BPYA 1H8FA 1NVQA 2YM7A 3PSDA 3VUGA 4R3PA 2CN5A 5E9EA 3NUSA 3V5WA 1OB3A 2PUNA 3KXHA 3MFSA 1Q1HA 1IG1A 5HORA 3D5LA 4FKIA 4KN4X 1QBJA 3E6MA 4CTBA 3OCSA 4Q48A 5KZ0A 2ITPA 3BE9A 5ETAA 3PRIA 5A9UA 4FZFB 4FTOA 1WRJA 2QU5A 4F1TA 2QQ7A 2J5EA 4FNWA 2X7FA 3VNTA 2EFQA 5L8JA 3DDQA 2BDJA 2J7TA 4EI4A 3I54A 4UV0A 4XOYA 2W7XA 3A61A 5AP7A 1NHAA 4EHZA 4L9JA 4J98A 1S6LA 1PP8F 2XKPA 4QP9A 3MFTA 3UG2A 3HSRA 3UOJA 3P9KA 4R5SA 4B9DA 4FVPA 3GWZA 2BILB 4MWIA 1OIYA 1PYXA 2C6EA 4IQ6A 3IW8A 4TYGA 1ZMVA 3SGCA 3AC1A 5CAPA 3BP8A 5IQAA 2VTHA 3W33A 5ED4A 3SRVA 3RPUA 4CEGA 3V4GA 4CFWA 1PUEE 3LKMA 3W1FA 1U59A 3RCJA 1OBDA 4RIOA 4HVIA 3S2WA 3UZPA 2LSOA 2C3IB 2YDJA 4R1VA 2RFEA 3O6BB 4MHAA 3O3KA 4L5JA 5BUIA 5D5XB 1R7JA 2VBXA 2OQGA 1MRUA 3QTUA 4ERKA 4WO5A 3KXMA 4DT8A 5E20A 5HX8A 4DH7A 5FXRA 4DQ2A 4BCOA 3DA6A 4YJOA 2XK4A 5C9CA 4AWIA 1CDKA 5BMMA 5HS8A 2V1UA 2PZYA 1FYMA 3FI3A 4J1RA 5A4QA 4WSQA 4ZJIA 4I0TA 4ACCA 5DIAA 2WIHA 4S32A 2HQNA 4C2VA 4B7TA 1SMTA 1H4LA 4BNCA 4G7OF 1DDNA 2BFYA 4BDKA 3UPZA 3D83A 4RGJA 2UVZA 2C0IA 4AGWA 5DYJA 4G8XA 4G6NA 2QC6A 2VE8A 2CGPA 3F72A 3T8RA 2CQKA 2KRFA 1SD5A 2GXGA 2EB2A 2FSWA 2JGZA 4DBNA 1PMVA 4S34A 4ZJVA 4K18A 4UVAA 2QHNA 1F1ZA 1FOTA 4LV8A 4F0IA 4IAAA 4H0EA 4AFEA 4Y85A 2CHLA 2P7VB 3VS0A 2GSFA 4APPA 2OJJA 2ZV2A 3DKOA 4EH8A 3MH2A 3JUHA 4WRGA 2X39A 2DT5A 3KZZA 2Y8OA 1LEZA 4U0IA 2ESHA 4NH1A 3G5DA 3FL5A 4BDDA 3LXKA 4FV1A 4D0XA 4APCA 4LOOA 1J0RA 3ZOSA 3NWWA 4RGRA 3ZXTA 4CZZA 2KIUA 4PX6A 5EG3A 2I0YA 3RI4A 2WMUA 3V8KA 3RYRA 4D0PA 4CICA 2WMRA 4WG3A 4UZDA 5TF9A 5BVKA 3H9FA 3DQWA 5CVVA 3UOLA 3GCSA 3M8FA 2FRHA 4ZTHA 2Y48A 3JVRA 4CG9A 4B0GA 4NSTA 2VBYA 5HZNA 4I7HA 3KQ7A 2Q0OA 2UW0A 4U6RA 3DXQA 4G3EA 5HD7A 2O8YA 3UDBA 2B9FA 1MDMA 4XHKB 4LB5A 2VN2A 2J9MA 3B2WA 4OUCA 3KC3A 5E7RA 4D58A 2Z02A 3QFVA 2DFIA 1JGSA 3FWEA 2HYYA 1KQ0A 3QRFF 3GU7A 3H10A 5EH0A 4QTDA 2PQ8A 4Q4ZF 1H1RA 1FQ1B 4LYNA 3ZMUA 4PMTA 1VEBA 4JDIA 3F22A 4F7ZA 2UZVA 3DP7A 1W5SA 3GW2A 3G2FA 5FRIA 2FE3A 2IVTA 5L2TA 2ERZE 3I6WA 4BHZA 4ZZMA 4RAZA 3QZHA 1E1VA 3R8ZA 1JXSA 3GYHX 3PFQA 3VUTA 2VE9A 2C6MA 4Y72A 4ZS4A 3I4PA 4JNWA 5DE2A 4C35A 3QKKA 3HOTA 2QBYA 4TWCA 2PE2A 4J99A 1HW2A 1ATPE 5FEEA 2E1CA 4BI1A 1NT2A 4ENYA 2E7XA 3FMQA 3RZFA 4MXXA 3QD2B 3CKWA 4RIWA 2AS5F 2X7GA 4FG8A 4G9RA 1J3HA 3WF7A 3TO7A 4FV2A 2PLYA 2BMCA 1TNSA 1Z5MA 3IRQA 1MD0A 3S2PA 2FOKA 3WE3A 3AT3A 4EBVA 4XJ0A 2EK5A 4RIYA 1DI8A 5IQHA 5IMXA 4FBXA 3WIGA 4KIFA 1K78B 2Z99A 3ZMMA 3T8TA 2OZAB 3DY7A 5A54A 4EM0B 2IZTA 4Z7GA 3DKCA 3KXNA 3M7GA 3TDZC 4L9NA 4QRCA 2DPUA 2P33A 3Q04A 1Y57A 4J71A 4CFMA 3OOGA 4YBJA 1KU9A 3QRKA 4IAKA 4G3GA 2Z2WA 5AP4A 3TACA 3UIXA 2JAMA 2VBZA 4U7ZA 5CWZA 3K9TA 3DBCA 4P4CA 2DK5A 4L3PA 2VTJA 3LM0A 2G9XA 3LJ2A 1U5TA 1TTYA 2RV8A 5LOHA 1ONVA 3V5LA 4M14A 4IVCA 2WQBA 4A9SA 4BCPA 5J1WA 2IA2A 2C5VA 1RUNA 4Z55A 3LQQA 4FR4A 4YPDA 4MBLA 4IAYA 5BQ0A 3V51A 1YWRA 4IVBA 4RQKA 4YSJA 3BU3A 2HK5A 4ZMFA 3WTSC 3G6GA 3R60A 2YM4A 5ANIA 3NVKI 2RFNA 2J5FA 3JY9A 3PJ2A 3WZJA 4D4YA 4BDGA 2WPAA 2IA1A 4CFUA 2IVUA 2A6HF 4EH4A 4LLNA 1ZYLA 4QQTA 4IEBA 1YVJA 4QTEA 5FXSA 1G3NA 3OBGA 5J8FA 5F1ZA 1TW2A 4YJQA 4FSZA 3GFIA 2W84A 5HQ0A 3FL4A 4TWNA 1YHSA 5AR7A 4HA8A 3ITZA 3GFMA 5L8KA 3IOPA 1MKMA 3MPAA 5E92A 1T6SA 5HG7A 3L1SA 4MEYF 3F2AA 2FNPA 3W2SA 4FI1A 1XCVA 2QURA 4G9CA 2R3IA 4W4VA 5JI6A 5EDRA 1RW8A 4O7WA 4V01A 5M08A 1JSUA 1BIAA 3F2NA 4D1ZA 4OTHA 4QMYA 1GY3A 4EZ3A 4YZBA 2R7IA 2EVAA 1XWSA 3KVXA 1DS5A 4C61A 1ZHFA 2DTRA 2HELA 3F6XA 1SFXA 3R0AA 3W55A 1R1TA 1BJAA 4D5KA 3J80Z 4ZAUA 4D2VA 3FBVA 3H3CA 4U7BA 3Q96A 2IG7A 4AX8A 3K2ZA 2JDTA 2HWPA 1TW3A 1OBGA 4EJWA 1YIOA 1OPJA 4JL9A 4HCUA 1MJ9A 1IXSB 4BDHA 3TNHA 4ASDA 2PVJA 3BGZA 5HHWA 4MTDA 3UGCA 1D8JA 2R3FA 3EYHA 2IO6A 3FPQA 1TQIA 2W4OA 2HXQA 3U4UA 3NAYA 4GRBA 5IPJA 4ZTQA 1OITA 3K3IA 4CV8A 4DYMA 1H1QA 2GHGA 2A19B 2CNVA 3HP5A 4M69A 3DXPA 2VD5A 3I7CA 3VBWA 3QPTA 4TY1A 5C4KA 4M8TA 1GXPA 4WG4A 4NCTC 4PNKA 4D1SA 4EKKA 2HYFA 2XASA 2PVMA 3VS1A 3W2OA 4NYEA 1PMEA 3D2IA 4R1HA 1BOAA 2V79A 3NUNA 1WSUA 1GZKA 3I5ZA 3D5VA 4AU8A 2VWUA 3F3TA 3SXSA 2PK9A 3AMYA 3M11A 2WTKB 3R9RA 4D55A 4LOPA 4FIJA 3T8OA 2JZYA 1W5TA 3D7TA 3U6HA 3SHEA 1R1VA 5HVJA 1ZWSA 4QMLA 4FTNA 3G51A 2WXVA 2HAKA 2QG7A 3QLGA 4MF0A 2O03A 3UO6A 3K5VA 5HO7A 3SRVB 3QGWA 3KE2A 4NZWB 1S9JA 3G0EA 4IVNA 3E62A 3GX4X 1YI4A 5LVPA 3WGIA 1U46A 1LDJA 5L3DA 2BKZA 4NW5A 4ITJA 3WE2A 2WQMA 3EQLF 4TNDA 4ZZOA 4MGRA 2EXCX 3IW6A 1DUXC 5LWNA 4ANNA 3BV3A 3HMPA 3IGGA 4FTMA 5IZFA 3QXPA 4J7BA 4NEUA 3Q52A 4C2WA 3RPYA 5GJDA 3I0QA 4U8ZA 4HYHA 3J81Z 5IDPA 4LUDA 2FNAA 4PDOA 4YIIA 4RT7A 3O50A 2VODA 4FTLA 5HVYA 5IQDA 4LK0F 5EEHA 2XKDA 3NW6A 4PV0A 2GTMA 4RC3A 2B0LA 2PUPA 3N51A 4FIFA 2MC3A 2UZEA 4YNEA 3OWLA 5IA0A 2X6DA 1BI8A 2BFXA 3Q60A 1W83A 3W2PA 1WI9A 4A0ZA 3HSFA 5BVFA 2H34A 3UQGA 4C02A 1F0QA 3MIAA 4ON0A 4H3QA 1K9AA 1UU8A 4A4LA 1CM8A 2JC6A 1SM2A 2VN9A 3OEZA 2XM9A 4CKRA 5AIKA 1QPEA 3DGKA 2BKKA 4ERWA 4L52A 2CYYA 4DGGA 4EONA 4I6HA 4I92A 1HBXG 3CP9A 3FXZA 1S7AA 4I4EA 3UQFA 2QQ9A 5DT3A 5CVFA 4BB4A 3PIYA 4JQFA 3KK8A 5FTGA 2K4BA 3C7QA 4C57A 3QCSA 2V1XA 2WQNA 4G2FA 1H01A 4I02A 4O6LA 2X0LA 3N97A 3NEUA 1VYWA 4JX7A 1A48A 1PMNA 2V5QA 4AUAA 5I9XA 2VO3A 3MY1A 3CBLA 2CWEA 3U6IA 5E1SA 2P6TA 5BMZA 3A99A 4UV9A 2NNNA 4IM0A 3DNDA 2WTKC 3ZZEA 2C47A 4NFNA 4XRJA 3JS2A 2M5WA 3C1DA 3AD5A 3EIDA 4C59A 1PKGA 1J7UA 3BQCA 1ZY5A 5HVKA 3HMNA 4IW0A 3DBFA 3HUBA 3H92A 3WZUA 3MY0A 3RIRA 1HSTA 2P5KA 2BHEA 3MA6A 2C6OA 4F0FA 4DINA 3SHFA 1MGTA 2Z33A 4G5JA 3T0YA 5JFRA 4OTWA 4JK1X 3MW1A 1ZN2A 5HNGA 3VC4A 4M84A 3EDPA 4E6QA 4CGZA 4DGMA 1DI9A 2QKWB 2ETKA 1KWPA 3F2RA 3A2CA 4XEYA 4YR8A 5K4IA 1HKTA 3MEXA 1BLXA 5E18F 4I6QA 1EH4A 4PPCA 4C4JA 3FLQA 2STTA 3NPCA 2J0KA 5DA3A 5ANEA 3ZEWA 1ZG1A 2IT0A 3P9IA 4LRJA 3B2TA 1IN4A 5CF8A 3KFWX 3WIKA 3TOAA 2C0TA 4YZNA 2HTJA 4IE9A 3ZMTA 4L9TA 4ALWA 4EOIA 5IISA 1YDRE 3AD4A 1H08A 2K86A 4FYOA 4Q5SF 3NGAA 2GWRA 3FHZA 4M9SA 4HX8A 3R8PA 5HESA 4BI0A 4G6OA 2YX4A 4O2ZA 2FO0A 1J7KA 4NK9A 1Z57A 2YM6A 3QHWA 2QBYB 3FPMA 2XUBA 2V0DA 2QQAA 3BBTB 3GLXA 4BYYA 4FZ7A 4ESBA 3QP5A 4W9WA 3DTWA 4RIWB 2P4IA 3EZRA 4XH6A 2B9HA 3UC3A 4OOIA 1DAYA 2P2IA 4EK6A 2Y6MA 2XRUA 4FKPA 4FEWA 3NSZA 1OUYA 3QTXA 3R7YA 4RIYB 1V4RA 5IH5A 1XH7A 4DEGA 3E8NA 4L9VA 4DBXA 5HE2A 3E5AA 2ZFWA 1F5QA 1JHFA 2ZBKA 3M2WA 1V0OA 2BDFA 2UZLA 2DW4A 4RVTA 1HSJA 1FPQA 5DHJA 3VRYA 2YZLA 2G9WA 3TKYA 4FIGA 2IPQX 5EM8A 5LARA 3TI1A 1SMYF 5ICGA 2VWXA 2K02A 4CQEA 2PVRA 2GS7A 4IANA 3FKLA 5FD5A 1U5TB 2XNOA 3RK9A 5D5VB 4C4EA 3RPVA 4C4FA 2YCSA 4MEXF 2VOOA 5KO1A 4JDJA 3GCUA 2RNJA 4U5JA 4BHBA 4ANLA 1LP4A 2FGIA 3VUMA 3P9JA 4X6QC 2FH9A 3FXQA 3E8EA 4JAJA 5HE1A 2IPXA 4ANSA 3FJQE 4Q9SA 5E8YA 1PJKA 4IZ7A 5T68A 2BVAA 3GF2A 4ZLZA 3M1SA 5E8XA 3KF4A 3HSEA 3AXWA 3ECHA 2VTMA 3CO6C 2OF2A 4JQEA 4A4XA 4GW8A 3PA5A 2IVMA 3FZTA 2OJGA 4HF2A 3P78A 1VTNC 3IKTA 4GT3A 4JS8A 2ZNYA 3NIZA 4BIDA 3Q9SA 3C4XA 1QMZA 4I94A 4NHJA 3H3ZA 3GU5A 1H1SA 5KUPA 4EGYA 3T3VA 3FZOA 2DO7A 3J7AO 2OU7A 2RF9A 5LLQA 3BRBA 4QQCA 1S9IA 1NXKA 1NY3A 3II5A 2QO7A 4ZZLA 3FQSA 3BWFA 4YTHA 2YEXA 3TDUC 2C30A 1M2RA 5CXHA 5E8UA 2BUJA 4Q5HA 3RKBA 5A2QZ 1J5YA 4QYYA 2D1HA 3KZYA 2J51A 2W06A 3AMAA 3LFFA 4RWJA 3FX3A 3WYXA 4TL0A 4PMPA 2Y9QA 1G3YA 2JBPA 4D9UA 3QRIA 1OR7A 4G31A 4BGHA 2UZKA 1YW8A 3EOCA 2QR7A 3MPTA 5HLHA 5HE0A 5E8WA 5AIQA 2VTAA 5FM2A 3ERKA 1P5EA 2H09A 5IH6A 4A0YA 2WMSA 2L4AA 1MRVA 3RTPA 1FP2A 2IWIA 3QRJA 3QUEA 4QD6A 2PJPA 3TV7A 4D2RA 3VJNA 1T45A 3QPHA 4II5A 2X2MA 5IT9K 5DT0A 1HQCA 4PTEA 2PMLX 1Z7UA 3W16A 1BI7A 2JLDA 1D3YA 4XG6A 1FYKA 2BIYA 5DD4A 1U5TC 1XJDA 3O23A 3LFCA 4E6CA 2R0UA 3U6JA 3MPMA 5B2MA 3U9NA 4O2PA 5EW9A 3PRFA 5KBQA 1IAWA 3MVLA 4FKUA 4MHGA 2YCQA 1WBPA 2XK8A 1W7PA 5KMIA 4RB0A 3I60A 4I4FA 5ANDA 5AMNA 1UFMA 3COKA 3FM5A 4FKTA 4EH2A 4XBFA 4WBBB 4EHGA 1S3JA 4AN9A 4UWYA 2X9EA 4FUYA 4XG7A 1H28A 1OECA 3E5UA 4WD5A 5DNRA 4TV7A 4A9TA 3MVHA 4USEA 1YWVA 4ZSJA 2J50A 1I1GA 4HZFA 1PXOA 4RGUA 2IJMA 4ALUA 4EC8A 1Q97A 5IEXA 1OKZA 5FG8A 2WTEA 4L68A 4O7SA 5AX3A 3I7BA 3D7TB 3SAYA 4O84A 4A9UA 4B8LA 5EDQA 1LJ9A 2YX7A 2OXDA 2VUWA 4PRJA 2K7LA 3LA3A 4TWPA 2CN8A 5AJQA 5HDNA 1OYWA 4ZSEA 2QENA 4AP7A 4CRLA 2F5CA 3R1QA 5AM7A 4JXFA 2EJRA 3CQEA 2RG5A 5F1RA 4QOXA 1KGSA 2YLEA 2NS0A 2VT3A 2O5KA 4KS7A 3KVWA 2WTDA 3PVBA 1MRYA 4YGAA 1IN7A 4O83A 2O6GE 3ZMZA 2W1ZA 1BX6A 2VO7A 2Z60A 1YW2A 3VS3A 3PJCA 3IS5A 4RC2A 4ZLYA 4BZOA 2V1DA 1Y6AA 5DD8A 2OIBA 1JKSA 4V0GA 1B39A 5J87A 5HX6A 5ACKA 4I0AA 4K11A 4U97A 2ZM4A 5HE3A 4MK0A 4I5HA 5D9HA 2YFXA 4FZAB 1XSDA 4WG5A 5FEQA 2OZUA 4LMNA 3UVQA 5IUGA 5IU2A 3TXOA 4ASXA 3ALOA 2HR3A 4RWIA 4U0WA 5CLPA 4I22A 4BDIA 3VUKA 5T6KA 3IC7A 2ITNA 4RFYA 2H6CA 3PLAE 2DS1A 4GIHA 3U55A 2WGJA 4BTMA 5ERIA 3EYIA 1PXLA 1XN7A 3G9NA 4FIEA 3ZO4A 4QP8A 4I93A 3KP6A 3T1BA 1XH4A 4I09A 1RDQE 1W82A 3F3ZA 4AFJA 3GU8A 5TT7A 4U88A 3PIXA 3PVUA 4IWQA 3HLLA 2ISYA 3UVRA 3IWZA 3DJ5A 1GIHA 3EN7A 2GNJA 3D94A 2OAZA 3Q4TA 4JT3A 3OP5A 1H27A 3SKCA 3CSVA 3EL8A 1ZLJA 4EYMA 5ICCA 4KBKA 4LB6B 1YOLA 3R7IA 2QONA 3ULZA 2GHMA 5AV3A 4G16A 4CXFA 2RFSA 4G17A 4GK2A 2FUMA 5KX8A 1IR3A 4A0XA 2ISZA 2VU3A 1WKMA 2L4MA 2HQRA 3L2CA 5HG9A 3BU6A 1FSHA 3M1EA 3Q6UA 2OXXA 3CTJA 2YN8A 1WAKA 4F09A 3KMUA 5H8GA 1P4OA 3HV4A 3CE3A 5EOLA 3VBXA 2NAZA 3U9GA 4KFCA 4E5BA 2PUUA 5M4IA 2OSCA 4YIFA 2RDPA 3KEXA 3ID6C 1Q3WA 1V0BA 4W4WA 4DGNA 4X7QA 2LF8A 3MGYA 2ZB1A 4OINF 3HDNA 2YDIA 3NAXA 5DGZA 4JQ7A 1ERKA 3NRMA 5JFXA 4F65A 1OVEA 5L3EA 3MYGA 3VBVA 4RJ4A 5IQBA 4KA4A 3HUCA 2XRNA 3I81A 3UIBA 1NA7A 5EHYA 4QNYA 5AONA 4Q5EA 3FYJX 3REOA 1GNGA 1G3WA 5K5QA 1WBVA 1REPC 1V0PA 2X2LA 2IJLA 5CTPA 5D10A 4EH7A 2CMWA 3MH3A 2JDSA 5HBHA 4FT8A 4J8MA 2H6BA 3MBLA 1YS7A 4JOAA 1HXDA 1WVYA 4IX5A 5HS9A 3UP2A 5LMBA 2DYLA 2RL5A 3THBA 1W7PD 2XK6A 3A4OX 3R22A 3DKWA 1B1BA 4IB5A 3NVMB 4U45A 4X2KA 4U0YA 1WBSA 3OCTA 2HIWA 4CMUA 4KS8A 5AUTA 4BDCA 1PXNA 5TE0A 1OIUA 3PJ8A 3FXXA 4O27B 2VWIA 4QTCA 3NX8A 3QC4A 1S8NA 1G5SA 2P2HA 2XEZA 4GJ2A 4IWDA 4HOKA 5FWKK 4KIPA 4BF2A 1KQ9A 5IMEA 5EQEA 5DI1A 1FLIA 4UYAA 2UWMA 4ITIA 3MWMA 4YC8A 4QMNA 3GEZA 1FBQA 4EL9A 5I3OA 2QOCA 4C0TA 4L0YB 2BRHA 2V7OA 4MNFA 4DTAA 3UVPA 4IRGA 3P7NA 2QD9A 3BLQA 1WCCA 4WX9A 1KOBA 4F7LA 1Q8YA 1LQ1A 2NRYA 2GNHA 5A2QK 2BRNA 3P79A 4CDGA 4AIKA 3FI2A 1H24A 4HQMA 3RJCA 4EHEA 1QZZA 2EWNA 4RZVA 3LMHA 3EKKA 4IIRA 4AZEA 4LG0A 4O7VA 4NJDA 2B9IA 3A7HA 1T38A 3VS6A 4WA9A 1TVOA 4WNPA 3MZYA 4L3LA 5LBQA 4H39A 4BCNA 2FA5A 5FGMA 2C6TA 1ZRDA 3QXOA 3HAVA 4CG8A 2UW7A 3JTHA 4BCFA 4ZY5A 2LGCA 4BN1A 1M7NA 4ZY4A 3C3WA 3N4TA 4AZWA 3NCZA 3WF8A 5E1WA 5LHGA 4PNIA 1A04A 4Z3VA 2RGVA 5HO8A 5FDXA 2D2WA 4TT7A 1O9UA 1IAJA 3LA7A 4NUSA 2IRFG 2ZB0A 3LZBA 4YHTA 1IAHA 5CVJA 4FOCA 4O0WA 1ZG3A 1ZOGA 5K5RA 5AIRA 4IVDA 1IXCA 2XNPA 4ZLOA 2XKFA 3SD0A 3ZO1A 2C5NA 5EK7A 5HO6A 4D4SA 4ZSGA 2PFBA 3L9PA 5J7BA 5D4SA 2XRWA 3ULQB 3CS9A 1LDDA 2BV6A 5L3CA 4K33A 1F9NA 4YG2F 3GVUA 4E4NA 4CO8A 1UKIA 1X8BA 4BCJA 5CF4A 3Q3BA 2XH5A 4RSSA 3HMIA 3KRLA 4KB8A 3GP0A 3COAC 4E6DA 2KJCA 2YAKA 1XKKA 4OLIA 5HG5A 4X2GA 4P9FA 2R9SA 3ACJA 4FL2A 3W2CA 1OIRA 3TV6A 1CF7A 3TOBA 3Q4CA 4W4YA 2WMXA 3ORIA 2B4SB 5FDPA 2FSMX 3HVCA 3DXNA 3ZSIA 1LUFA 2RVCA 1XO2B 4JR7A 3I58A 5LVNA 3I0TA 1KE8A 1YWNA 3MJ1A 2WU7A 2W1HA 3MI9A 4U0VA 2WQEA 3NYNA 5HIEA 3WTVC 3ZM4A 1J91A 3AC3A 4EC9A 2BAQA 4G6LA 4WRSA 2GTNA 1STCE 4MCVA 4WXDA 1W7PB 5FTOA 5E1EA 3PY3A 3FSFA 5B7VA 4AWXB 5AP0A 4TKSA 1STZA 4YLJA 5H6QA 2M1BA 3K0LA 4CD0A 3CLOA 3CY2A 5J9YA 1U3EM 4EJTA 4ZK5A 3GQLA 1O3RA 3EQPA 4IM3A 2ZCWA 4HGLA 4K0YA 4BCKA 3LFNA 3VF9A 1H1PA 3DAEA 5BNJA 3ZUTA 2XKEA 4IACA 2RN7A 4EYJA 4DGOA 4MD9E 2Z7QA 3WZKA 1U5QA 3SC1A 2VONA 2BRBA 4IRIA 4BHCA 1R1UA 3HV3A 4YURA 5HLWA 5H6RA 2A1AB 4L18B 2ZKZA 3GI3A 3C4CA 2OF4A 3DK3A 3HYIA 3ZUVA 3G9LX 4RS8A 4O0YA 5HTBA 4Y95A 2B54A 4UB7A 4EM1A 1XQZA 5CLSA 5B2KA 2XIXA 4NT4A 4Y5HA 1BYGA 3Q5FA 3O51A 3FDNA 3S0OA 2HZ0A 2PYWA 2NPQA 4ACHA 5EYKA 4L43A 4IDVA 1BC8C 3L8XA 4H3BA 3DU8A 3LJ1A 3TZMA 3DJ7A 2GQGA 2XROA 4TNBA 3OWJA 1Q8WA 3NEWA 3ZM9A 3IHUA 3FMHA 2BGCA 2XP2A 4CKJA 4HDUA 5IA5A 2H6DA 4TYEA 1KUTA 5ILUA 1WBWA 3O71A 4FTRA 2I6LA 1UNHA 2ZJ2A 3CCNA 3KCFA 4I6BA 4YTIA 3LFSA 1U5RA 1H00A 3KMWA 1YOJA 4O22A 2WHBA 4EJVA 3ACKA 1Z6RA 2XEYA 3PQJA 4UNOA 3VUDA 4GFMA 1YLFA 2CO5A 2JKOA 1YG2A 3PE2A 3UPXA 2KIFA 5CT0A 2GQQA 2OXYA 3DOGA 4EWHA 3P7AA 3WF6A 3QA8A 3NS9A 5M44A 3ZQ7A 2QOBA 2F49A 5CAOA 4I5MA 1KU2A 1BKXA 4I6FA 2H96A 3PTGA 2XKCA 2JKMA 4EOLA 3E87A 3DAJA 2ITYA 3FLWA 5L3GA 5E8SA 1FC3A 2QOKA 3W2QA 4M3QA 4IB3A 2WMWA 3ORLA 5LMAA 3LJ0A 3TCPA 3Q4UA 4IVAA 4DEBA 3DK7A 4FG9A 4E4MA 2A5YB 4PTCA 3JAMK 2GQSA 4EQMA 5AUUA 1AD5A 2VTSA 1YDSE 4GYGA 1U2WA 4JBPA 4BTKA 1C0WA 2WTVA 5GIOE 2OQRA 4K6ZA 4C3RA 3CTQA 5DMZA 2OJ9A 4A2UA 3QZFA 5K4JA 3TDWA 4DFLA 2UW6A 1SD7A 2B53A 5M06A 2W85A 4MXZA 3Q2JA 2VAGA 2C5XA 3EN4A 3TJCA 1XBCA 4Y15A 2O3PA 4KNBA 4GT5A 2MA3A 2W9FB 4UMQA 1YS6A 5HOAA 4ZYHA 2HWVA 5FLXK 4HPTE 2ADUA 3HHGA 2CKOA 1OPKA 4LRKA 3TV4A 1O7LA 2GA2A 4M6XA 1KU7A 4QPMA 1R5GA 2VX1A 3BLHA 2EA4A 2EV5A 3RVGA 1QL6A 1SVEA 1ZLTA 3FI8A 2FA2A 1W0XC 4JG6A 3V8SA 3VODA 4F6UA 2C5OA 3FC1X 2HWOA 4OTPA 3TEIA 3ZRLA 4S2ZA 4XBRA 5H2UA 3JW4A 3A7GA 3GOKA 1OGUA 3ABTA 3NR9A 4XSXF 5HEZA 2QNJA 5HU9A 3BKBA 2F5DA 4FKWA 4JAIA 2OICA 2PZPA 2PVKA 4KKEA 2B0QA 3V5TA 4UXQA 5CSXA 3E3VA 5HDKA 1MJAA 2E1NA 4O1PA 3HDMA 5BOXA 2C6LA 4UYNA 4RWLA 1DM2A 4FT9A 2PULA 4IJAA 3E93A 5C4LA 1KSWA 4HDVA 2ACJA 3C4EA 1ON1A 4WIHA 1RZ4A 3VN9A 3ZN0A 1RUOA 5GZAA 5CNNA 4YSMA 2MD5A 4ZSLA 4DA5A 3L9LA 4OIPF 1DP7P 1VZOA 2W1GA 3EQCA 3PXZA 3GZ5A 4JLCA 2ZMEA 4R5YA 2IW8A 3ZLSA 1Z6TA 2H94A 1NVRA 1SVGA 2GU8A 2WIPA 4R3CA 2XV4S 4WF2A 1H1WA 3DBQA 4PY1A 2ZVAA 5J9ZA 4UV8A 3EN6A 2C3KA 5I0BA 5BVEA 2YERA 3AAFA 3W8QA 3QWKA 3HV5A 4YTFA 4BHPA 3OROA 3TN8A 3S4QA 2P3GX 1QPCA 4QT1A 4M0ZA 4S30A 1D8KA 3CGOA 3WZDA 1H07A 4BBEA 2L3DA 1OZ1A 5AV1A 4XG9A 4OMYA 2R3GA 2YCFA 3GENA 1Q4LA 2GS6A 4AW2A 2XVCA 4XS2A 4N57A 1CSNA 5J95A 5CI6A 2AC5A 2FSLX 1MUOA 1FYLA 4RBLA 5E1ZB 4H36A 5EQPA 2I1MA 2VTQA 4A5MA 4UMPA 1ZG5A 2BRGA 4EK3A 1OUKA 4HYSA 3C4FA 3NLBA 3P7BA 5CI7A 2VOPA 3KU2A 4EH5A 5TOZA 4QNAA 4LL0A 3CGFA 2OFVA 4DEAA 3U4WA 4XP2A 3EQFA 1R5HA 3C51A 3SW4A 3AT2A 5HBJA 2UZUE 3VS4A 1B38A 3P9CA 4I5CA 3LMGA 2YSRA 3F9NA 3LVPA 4CMTA 5DCFA 5ACBC 4E6AA 3BYMA 3DT1A 3UQCA 3QU3A 4RA5A 5GHVA 5H9BA 3EYYA 2JDRA 4ACGA 1YXSA 5JFSA 4IJ9A 3L09A 4N70A 2I0HA 3JR1A 3FMKA 4ANMA 3C4ZA 2QHMA 5BUEA 3LQ8A 5AUVA 3PDTA 2HY0A 2ITTA 3DNEA 3ZPLA 2FSTX 4K2EA 5GIPE 2CG4A 2PMUA 3VQUA 5EYMA 5CY3A 4PTGA 3VBTA 4M9XA 3D7ZA 5KKRB 2NNYA 5TKDA 5CX9A 4O7ZA 2QVSE 3QTSA 2JIVA 3PPJA 1GHCA 4USFA 1LEWA 4ID7A 5JSMA 1M14A 2CGUA 2BDWA 1YYVA 3IDBA 5CANA 4WXCA 4C4HA 3B8RA 3FMNA 2XCHA 5HLGA 3OF0A 1WZYA 4FZDB 4J52A 4BRXA 1KA8A 4F0GA 1FGIA 4U40A 3F21A 3R2BA 3GT8A 3RHXA 3GFWA 4KIQA 3DFGA 4FT0A 4ESFA 2BROA 4JR3A 4D2SA 1BBYA 4FK3A 2R4BA 3QQGA 3R6XA 5TRDA 4F9AA 3FY0A 4LGDA 1CF7B 5AP1A 2O64A 5EFQA 3DJ6A 2BR1A 3QKLA 4CLJA 3DLZA 4C37A 3GBZA 4NB5A 3QX2A 3A8XA 4BKYA 4HCTA 1WQ2A 4JBOA 2J2IB 1QCFA 4BXUA 5CVUA 4JDKA 3ORXA 1R00A 2FF4A 5J9LA 4XCUA 1VYZA 2I40A 3G73A 3TIYA 3TDVA 2A6EF 5EW3A 1YO5C 1HKSA 3I0OA 5EW8A 2R3SA 2QLUA 3HEGA 3UG1A 2Q0NA 2L01A 1PXKA 1Y8YA 3U1DA 4AW1A 3R04A 3ENMA 3MTFA 2PEXA 2OWBA 5IA1A 1ZMUA 1YDTE 3CR0A 4N9HA 5GJGA 2FEZA 5LJJA 1FWZA 3UNZA 2QYOA 3JYAA 4AE6A 4ZTNA 2CLXA 2W57A 5AUWA 3BGQA 1OMWA 2STWA 5DUIA 3GFJA 2BRMA 2OU2A 3HTSB 4KWPA 4NW6A 3R83A 1E9HA 1E1XA 3QYWA 5A46A 5L4QA 2J0LA 3R73A 3GC9A 5LXMA 2GHLA 2C6KA 4C4GA 4YZCA 4LLGF 3HRBA 3T9TA 3UNKA 4RB3C 3UJGA 5DFPA 4EOJA 4BDAA 4HNFA 3OZ6A 5D6EA 5HD4A 4F99A 1YW7A 4EK5A 3PPKA 5HIDA 2ZJWA 3KGAA 1OPLA 3A8WA 3MB7A 4F9BA 4DFNA 1KYZA 4L46A 2G15A 4FV9A 1IRKA 3VRZA 3WTZA 4L7SA 4YFKF 3HV6A 3RPRA 5GINE 2C4GA 4ENXA 1GZ8A 4FSWA 4ORKA 1PYEA 5FB2A 3UO5A 2XIRA 1LDKB 3PUPA 2ZM3A 4EUUA 2F2CB 1ZRCA 3C7JA 4OW8A 5LVLA 3QD0A 4PP9A 5IQEA 1B6CB 2FB8A 3QTIA 3LFQA 4U3ZA 3ZMDA 3RBWA 4L45A 2OIQA 3R71A 4BDJA 3I1AA 4OR5A 3FAAA 4PPAA 3BWJA 4M7IA 4M97A 5FBNC 3BHTA 3PE1A 4QYEA 1ZGAA 2QO2A 2JKQA 5C27A 3WBLA 2DQLA 1QZYA 4C4IA 3RP9A 3ZH8A 4D5HA 4LGWA 5F6FA 3U2RA 4G3FA 2PE1A 1Z05A 3HRUA 2VV9A 4U44A 4R7BA 4GEOA 4ITHA 2PU8A 1JPAA 3Q5ZA 1AGWA 3ET7A 4YU2A 2PVLA 4A12A 3ROCA 2M45A 1U54A 4EEVA 4FKGA 4O86A 2MLGA 4B4LA 4ZTLA 3WTUC 4M72A 2VTLA 4F9CA 5D7VA 2BIKB 2EU9A 3FLSA 3FQEA 4ZY6A 2VX3A 1IW7F 4AOIA 5D8KB 3LXNA 1RQQA 4I2OA 4KUJA 1WWXA 4BY9E 4UXLA 3V01A 4GKIA 2JPBA 3LFDA 3D14A 2C6IA 3P08A 3EN5A 5ANOA 1K6OA 4AA5A 4GCJA 3BLRA 2IW6A 2YHVA 3RGFA 4FTUA 3L9MA 1UV5A 4HGEA 5AP3A 4FSQA 2GFSA 4JG8A 3VUIA 4AOJA 3OCGA 3I71A 4DTKA 5TJJA 5IQIA 5LEJA 4L53A 1XGMA 4E70A 3Q9XA 4EBWA 1USSA 2YAAA 3U8WA 5KHWA 3WGHA 4AGCA 4LGHA 1ZYCA 5HI2A 2R3PA 1ZOHA 4BFMA 1XSVA 4ZEGA 3R1NA 3D0SA 3W6JB 2JEDA 4FV3A 2YIQA 2O3FA 2C6DA 5E8IA 1PRYA 4Q9ZA 4AT5A 3E97A 5IH4A 3NZ0A 4B09A 3FSKA 1LEAA 2W5AA 4RZWA 3VOEA 1M2QA 5EHOA 1JKKA 3DV3A 5G1XA 2FVDA 4GIIA 3ENHA 2VX0A 2W1EA 1YOMA 4UEUA 2EFWA 3IDCA 4HGSA 1UWJA 1PXPA 3I5NA 3B73A 2EV6A 4LGGA 3FQHA 3P0MA 2A61A 4JRNA 1OMIA 1IA8A 3D5WA 3ZDUA 4KIKB 1FGKA 1SMHA 4ANOA 3VW6A 3IW4A 2G2HA 3JPVA 4RJ3A 3JSOA 4O1OA 2ZMEB 5K3YA 4AG8A 5CEKA 2HW6A 2BYVE 2V62A 2G01A 4C58A 1XH8A 2OJIA 2XK9A 2J4ZA 5DN3A 2XAHA 3MDYA 1XDUA 1H9GA 1JSTA 5IUIA 1KV1A 1Q41A 4AIJA 3R30A 3GVAA 5HVQC 4YHJA 4IBMA 4BICA 1M2PA 4OBPA 2HENA 1P4AA 3GGFA 2ACXA 2DUVA 2XNGA 1OKYA 3NUYA 4E5AX 3ZLYA 5IT3A 1JWHA 5ICPA 5CU3A 4Y73A 3QCQA 4KNYA 2FQ3A 3UO4A 4WNOA 3V8JA 4O7RA 5FFXA 4E26A 5A4LA 2B1PA 3MSSA 3VIDA 2H9VA 4N0SA 2DLLA 4EZ5A 4JVGA 3N4UA 2XNNA 5JZJA 4Z9LA 1XMAA 2Z7SA 4I98B 3KN5A 1ZAOA 2E9NA 3BCEA 2ELHA 3VJOA 4L01A 4P5QA 3IO7A 1O3QA 1ZH5A 3OY3A 5FXQA 4KUMA 4DFBA 3QYZA 2VGOA 2EB3A 1JHHA 3PWDA 1GIJA 1JAMA 2YIRA 3LAPA 5M4UA 3SDJA 3ZFMA 1QPJA 4YJRA 4FX3A 3QRUA 4DEDA 2C3JA 2X1NA 3G15A 3HA8A 4LFUA 2KULA 2UW9A 3QALE 2OFUA 3Q32A 3D2KA 2JFLA 3TT0A 2FBKA 5LGUA 3WTTC 2R2PA 4GVJA 1YHWA 5LVMA 1BL7A 4IC8A 4RX5A 2DPDA 4QYGA 3PVWA 1P4WA 2EV0A 3ZHPC 4XV2A 4UALA 4MNUA 2OIDA 3OBJA 4BZDA 3D9VA 3MB6A 5I9VA 5H8BA 5DLSA 3NYXA 3DKGA 5ANJA 3V3VA 4AIHA 3TM0A 2TDXA 3COHA 2EFPA 4JDHA 3F23A 3BEGA 3CEKA 3V8TA 1T2KA 1PDNC 3TNIA 3RWQA 3UBDA 4PCQA 1W84A 2WWYA 4FV5A 2ITZA 2DQ7X 4I1ZA 2RKUA 4WT6A 2GNGA 4L0ZB 5CQWA
chains in the Genus database with same CATH superfamily
3CIKA 3GTOJ 5TO8A 2VC1A 3S3IA 5H8EA 3PXFA 3BROA 3MV5A 3GCQA 2V6CA 4A69C 2P0CA 4G7ZF 4X2JA 3UYTA 2OA4A 4IHSA 3EQBA 4KKGA 4IX4A 2O2UA 5HODA 4OGRA 4FETA 3FZVA 2JRMA 1PMUA 3KA0A 1LVAA 3RALA 4J19A 4N4OB 3U51A 4O0RA 2OJFE 1GXQA 4A93J 1FVTA 2A07F 3UDSA 2AQXA 2VZ6A 1M7QA 1W5CC 1RI7A 3U1KA 4GT4A 5TISC 5J8IA 3R7GA 4O21A 1IDZA 3WG9A 4EV0A 5L2QA 1WJFA 4B8MA 5D12A 1P6RA 2XNMA 2QU6A 2XBAA 2RFDA 4IAIA 4ZP5A 3KCKA 5C8NA 3MN3A 3ORZA 2OW3A 2BHHA 3RK5A 3FZRA 3GTQJ 3ZLWA 2UZWE 2XJ1A 3BZKA 4XG2A 4CNHA 2R7TA 1K3AA 3E3BX 1ULYA 3H9QA 2WMAA 2OBPA 3S00A 2XSDC 2VWYA 2J0MB 2LY2A 2X9FA 4Q2AA 4ASNA 4NKSA 5LGNA 2XBJA 4BDZA 3HZTA 5CQUA 1Z67A 1RNLA 3AOXA 2UZOA 3I64A 2DAOA 4BJ5C 1P4FA 2MSYA 3Q2MA 5AWMA 4EK8A 1XHAA 3Q0VA 4Z2YA 4ASZA 1RIOH 3BTLA 5E3OA 3DV8A 2HEOA 2IN6A 5L3BA 3V5QA 2QVOA 3QPLA 4A9RA 3BELA 2RKHA 1RC9A 1JKOC 1R78A 3ERMA 5BVOA 2PPQA 2JKKA 3ZOBA 2O5RA 3KP3A 3EYGA 1UELB 5CVIA 1R9TJ 2KZVA 1SD4A 1ZYSA 5CAVA 1LE8B 3TZ9A 3G0FA 4EORA 3PPZA 4M3FA 5TR6A 3LFAA 1LR4A 4RA4A 5HNBA 2GNLA 3FHIA 3DXJF 3VQHA 1WFCA 2VBWA 4BDEA 3H4JA 4M3DA 3GOPA 2F2EA 4RJ8A 5F9EA 4TW9A 3R4KA 3ROYA 3M8JA 5FTQA 1BIBA 4M66A 1YJWI 2UW8A 5J8CA 2R3LA 1IV6A 2P7CB 2XF0A 5AEPA 2F48A 2WTIA 4ENMA 4DG0E 1T39A 1MQ4A 3Q9WA 4CCBA 4WCGA 1FZPB 4O6EA 5KMKA 3H5AA 4D5CA 4M0YA 2R7OA 4NDLA 5FD2A 2D45A 3BG9A 1S7OA 4AACA 5CVRA 3IW7A 1AQ1A 4I23A 3BC8A 1YXTA 2ITXA 2DJNA 4QPAA 1FPUA 2CGWA 1Z77A 2C0OA 4EH3A 4XSZF 3IH2A 2MFZA 3MJ2A 4IQJA 1XGOA 3I59A 2XMYA 1IZ1A 3VS7A 4BIBA 3AC8A 1ON2A 3FXWA 5CSPA 1ORKA 3SZTA 4NKAA 3OD6X 1UCRA 5EF6A 2P55A 2F7XE 2UW5A 3WU1B 4QMWA 3MVMA 1AKHB 1EH6A 1BL6A 4DGLC 3Q5IA 4PZJA 3W0OA 2HCKA 4ITVA 2UVYA 2WD1A 3LAJA 4CVAA 1FMOE 1P92A 4OAYA 2OG8A 2I0EA 5KMLA 4K9YA 2CV2A 3ZMVA 1ZLKA 2H1KA 2JN6A 3NYVA 3CJRB 2DBBA 3SOCA 2YJSA 5KNLA 3ZO2A 3SXYA 1Y0NA 3FKNA 2ID3A 4NQWB 3OL3A 2NVYJ 5FGKA 3EH9A 4BKJA 3UC4A 4YUQA 4MTAA 5F27A 5C44J 5EEGA 3QA0A 2FU4A 2WNTA 3PVGA 2KDOA 2FBIA 3D5XA 2CW0F 2YPRA 4KKHA 1TKIA 4AN3A 2WFYA 1XB4A 1U54B 3QTRA 1MBEA 3BPVA 2WTCA 2QGUA 1IN8A 5KVRA 2OK1A 1BR4A 2CFOA 4JBAA 3UZRA 4XLAA 5IYCJ 4DITA 4F7SA 2LRDA 3ORKA 3AMBA 1SVMA 2JD5A 4FICA 3E7VA 5DDGA 1CKJA 5FP5A 2PTKA 5HGIA 1UG0A 3QX4A 4AA4A 5KNJA 1IN6A 4C3FA 2VNWA 4WKQA 4CFXA 4O91A 1F5TA 2XB0X 3JR9A 3DTCA 5I9WA 4YLLA 4EJOA 4KBAA 4RLFA 5IEVA 3DBDA 3EQIA 5AV0A 2V55A 3AL0B 4CYJA 4DDIA 3LSGA 2MW8A 2MH2A 1Q62A 5BVWA 3TNWA 4XRFA 2UZBA 5KMNA 2RNGA 4YJVA 3HJEA 2CQXA 2Z8CA 3QUPA 3VS2A 4BZNA 1UVRA 3WHCA 5AAFA 3TZ8A 3AD6A 3PNVA 2QOIA 2BHYA 3L7WA 3P7CA 1UNLA 3TWJA 4XLVA 4A06A 5IPAA 2W0JA 1UHMA 1J1CA 2E2BA 3CY3A 4O0XA 1OL7A 5DG5A 4UN0C 4RAGA 1MNEA 3GO5A 4HSTA 4FV4A 4D2PA 3RKYA 2ZXIA 4HOBA 3JCUC 1OKVA 3K7AJ 4ZOGA 3R6SA 1VJYA 5I9YA 3R0JA 1OL1A 3KIOC 3HBLA 3KEYA 5A4CA 3ROUA 2ITOA 5LD2C 2CKPA 3ZP5A 1TFFA 4C2UA 2YM3A 4NFMA 5BYLA 2C6YA 1V1KA 3W0QA 4IHYA 1OCZH 3DEUA 3HRSA 5KCMA 4I76A 2XZSA 3AGLA 4C34A 3UMXA 1DGRM 4O0SA 3VBQA 5FKLA 3D15A 5FLVA 2ZV9A 4GG5A 3FF5A 3ZN1A 4IFCA 2ESMA 4FZ6A 4QYHA 5DR2A 5L2SA 2L7MP 2PMHA 1RR8C 1A06A 4BU2A 2WMBA 4C36A 1SNUA 3E6CC 4FT5A 3SLSA 4LUEA 3COIA 3QKMA 4FTCA 3CXWA 4QMZA 2LDUA 2IZRA 4M73A 5CZIA 3CPCA 4MQ2A 4QP2A 3MFUA 4YMJA 5HCXA 3LHJA 5JT2A 4HW0A 3RKWA 5E90A 1TWCJ 2X4FA 2X1EA 1ZKGA 4AAYA 1LB2A 1XX5A 3WTYC 1ZXEA 3ABMH 3GTKJ 2HY81 3MH1A 5EOBA 3UMWA 3DB8A 1NH3A 4EKLA 3WZEA 3F61A 2CRGA 3DDPA 4JBVA 3BE2A 3VBYA 1FSEA 1NK2P 3KRXA 5F95A 5DT4A 4KMUX 3EQHA 2MG4A 4DNCA 3C13A 4RIXA 4PJMA 2QKRA 2YA9A 4QWQA 3C4WA 2CV1A 4AE9A 4KAOA 2OH0E 2OCEA 4ZYAA 3DCVA 2X7OA 1ND4A 5DPVA 5A4TA 3ABUA 1KQ8A 2PVNA 3MA3A 4L3JA 2DWBA 5BYZA 3V8LA 4HNVA 2VI6A 3K54A 4BL1A 5JFVA 1OIQA 4LI5A 5JFWA 3GLLA 2O0UA 5DV5A 1YFHA 4NTSA 4GFOA 3OYMA 3AL0C 2IS4A 4M71A 2LOOA 2ME0A 4CYIA 2P5VA 5A14A 4E73A 4AXEA 4R3RA 5EKOA 3PIOF 4HLYA 2VO0A 1TQPA 3ZONA 1VQPI 2XARA 4IHTA 1Y91A 3LA2A 2JA5J 1XGNA 4CUGA 4DH3A 5HS7A 2VJIA 5LCJA 4KT5C 2D1VA 3LOKA 2QQBA 4O3MA 5CU4A 2COBA 2AXTC 5HDGA 1MZBA 3OTVA 3FHRA 5JH6A 4I0BA 4OAVB 3W6KB 1D5VA 1EF4A 5HIBA 2E9VA 1LNWA 4RB2C 5AA8A 1I27A 3KP5A 1K4TA 4FSUA 3H3UA 1ZZ2A 1IRFA 4DCEA 3KB7A 4FV6A 3VEPA 1O57A 1JOWB 2ETHA 4XKVA 3JRHA 5LRSA 3K1MA 1ETOA 5C8KA 3BX5A 5M5WJ 5L2IA 5IG1A 5DEWA 5FKMA 5LVOA 3E1SA 2P5LC 1VFCA 3LE6A 5IA3A 3JXWA 3J80K 3BR3A 1J59A 2CUJA 4DF3A 3I79A 2J0JA 4FT3A 4RVMA 5ANKA 2R3MA 4UXNA 1BUHA 5FFZA 4AA0A 3MESA 3EKNA 2GMXA 4OTQA 4ZTSA 3PG3A 3HGKA 2EZKA 1EV7A 4AW0A 1HKQA 3OXZA 3QQAA 2B63J 3RM6A 2ZMDA 4ALVA 3H5NA 3ONQA 4QLCU 3ASNH 3KLOA 5DUKA 3HL2A 4RVLA 5EM6A 4KIBA 1UA2A 4WK8F 2WMVA 3BU5A 3AT4A 4PK4A 4F1MA 5KK1A 3FDYA 1QVTA 5GJFA 1SANA 1YXUA 4GSBA 1U0JA 5DEYA 2J6MA 2MBFA 4LMUA 1UB9A 4FL3A 3CO7C 2DMTA 1JBPE 1YX5A 3TG1A 2ERKA 4FTIA 4DTBA 4JYKA 4QP3A 3CD8A 2W17A 1QQIA 2HXLA 4HYUA 4EJUA 1SD6A 3JSPA 3S32A 2HZ4A 2XAUA 2DA2A 4J53A 4ANJA 1GZOA 3TIZA 1MJBA 4CZTA 2Q83A 4F93B 2L9VA 3DWLE 1IC8A 3OT3A 4PWNA 2G2FA