1TQPA

Crystal structure of a. fulgidus rio2 serine protein kinase bound to atp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
282
structure length
269
Chain Sequence
b'MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal Structure of A. fulgidus Rio2 Defines a New Family of Serine Protein Kinases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
total genus 86
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tqpA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1tqpA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1tqpA02
3Q5IA 3PJ3A 2K4JA 2W84A 4HVGA 3ZMVA 3V8KA 2QM3A 2ZKZA 2R3MA 1D3YA 5E7RA 3C4WA 3MBLA 5DBXA 4E4XA 3FMQA 1YG2A 1OKYA 3KVXA 4L46A 3PLSA 4O0SA 4GYGA 2QC6A 4HQMA 1B59A 5CSPA 3OS3A 3GFMA 4D55A 4O6LA 4CG9A 5E1XA 3NW6A 4MTDA 3ORLA 4PY1A 3K1PA 3TZMA 1Y57A 3RWQA 1IAWA 3V8LA 3C4CA 3I7BA 2GZWA 3CPCA 3QPTA 4YBJA 3F8FA 4M66A 1BIBA 2Z3YA 2QOIA 2WO6A 2H6DA 3QPHA 4DG0E 1M7NA 1OECA 3DXQA 4GJ3A 2WMXA 4UZHA 4YR8A 5ANJA 4EJTA 3QQLA 4RJ8A 1QMZA 4OTPA 2CN8A 1K2PA 1ZYCA 4HYSA 4LOOA 4QMNA 4H39A 1SYKA 4RA4A 4FSRA 4MVFA 3GVAA 1LNWA 2R3LA 5AAFA 3MEXA 1O6KA 3OBJA 2PUUA 4FVQA 3QRIA 5FXSA 5KMMA 5L2IA 4DH8A 3WF5A 3KREA 4CEGA 3G15A 1YFHA 4DFXE 3PWDA 1DAWA 2OO8X 4EJOA 1KSWA 5T68A 4I5CA 3VO3A 3TL8A 3LMHA 3FYJX 3LM0A 2BPMA 2NNYA 3MY5A 4AW0A 1BN5A 2CFXA 3ZSGA 5C9CA 3S3IA 2XNBA 3G0EA 4TKSA 3R7OA 4WX9A 4B4LA 4F9CA 4O0YA 1ZMVA 3V8TA 3WBLA 3UBDA 2HXQA 2YITA 2WEIA 2VWIA 4BRXA 1CTPE 4CTBA 5A4LA 1WVWA 4M8TA 4QTCA 3VW6A 2F7XE 1YLFA 5CEPA 2VGPA 3MQ0A 4FTOA 2C6EA 2BCJA 4OLIA 4ACGA 5EQPA 3FC2A 3KMWA 2LF8A 3DBDA 4QP6A 2MA3A 1CMKE 1LEWA 4TTHB 2IT0A 4E20A 2OJGA 2A4LA 5FTQA 4YTFA 1I5ZA 5TOZA 3EYGA 5KMKA 1W7PD 3CC6A 2BE5F 1IASA 4G3GA 2BRHA 5KMNA 5D7AA 3SVVA 3PQKA 3ZOSA 2L4MA 2A07F 1SMHA 2JZYA 1FGIA 4EEVA 1Y6BA 3PTGA 4ANOA 2VV9A 5I9UA 1UHMA 4JOAA 1OIYA 4FTMA 2HELA 4MWIA 4LRKA 4QO9A 4MHAA 5BPDA 3GENA 5K5RA 2YDKA 4KABA 3R0TA 1MDMA 5CSVA 3FJQE 4H58A 2FYSA 4DE4A 2AUHA 5AIPA 4CCBA 3Q2JA 2VODA 2PE1A 1BI8A 1K6OA 1XD7A 2NP8A 4EH5A 3E3VA 5K5OA 4ENMA 3BU3A 2JFMA 5DNRA 4YTCA 5ETAA 3A7GA 1E17A 2DT5A 3GCUA 3RCDA 4GUBA 3LHJA 3V4GA 4QWQA 3HAMA 5CENA 4U5JA 1JKKA 4RB1A 1W7PB 4LB5A 1YDTE 4IVCA 4OUCA 1Q8UA 2O2UA 4S33A 4DGOA 4DLJA 2G9WA 1F9NA 1PUEE 1YS6A 4BCGA 4E26A 5LBQA 2QQ7A 2PE0A 4MQ2A 1M7QA 5KMLA 5BMSA 5E8UA 3N4TA 3JSPA 1J7KA 2WQMA 2XK9A 4NM7A 3LXKA 4KWPA 3MWUA 1L8TA 3CPBA 5F94A 4PPBA 4MQ1A 4U79A 5A46A 3U4UA 3QKKA 4AP7A 1FVTA 4F9WA 2R3NA 4FNWA 2WD1A 5HCZA 2DO7A 2H96A 4FKLA 4RVLA 2Z7QA 2VTQA 4FV6A 1CGPA 3BYVA 3TQNA 4MNEB 1U5TC 3DKGA 1PYXA 1OGUA 2B7AA 3KL8A 4NSTA 2XUUA 2Z7SA 3BQCA 3KULA 2OJIA 5M06A 3ZRKA 3LQRA 5FEDA 4WNPA 3ZH8A 5HLGA 1BUHA 3NUSA 1RQQA 4AN9A 4B99A 4FEWA 2GNGA 3F2NA 2P6TA 3AC1A 3OEZA 4BCJA 4EOQA 4BH9A 4C34A 2ZJ2A 5E91A 1MQBA 4PF4A 2OH0E 3FI2A 3VF9A 4KN4X 2HKOA 3ANRA 2XNNA 2QOHA 1J1BA 3G9LX 4CT1A 2RFNA 4LG0B 1Q4LA 3COKA 4KA3A 5FEQA 1OKVA 4YTIA 3EYIA 3FHIA 5E18F 1O3SA 5AM7A 2WTDA 5ANOA 3I54A 3MPAA 4A5MA 4AIHA 4OTGA 3IWZA 2W1HA 4IB5A 4ZZDA 3EN9A 4EL9A 2YM7A 2JAVA 4KRCA 1MRVA 2GS6A 2QLUA 5DE2A 3ORIA 4TPTA 5ETFA 3GC9A 3NIZA 2VE9A 4R3CA 1ZH5A 4XUFA 3ULQB 3R7YA 3M1EA 4RBLA 5EOBA 2WQBA 3OCSA 4BKYA 2YCQA 3D2IA 4EONA 2GNLA 3R8UA 1H9GA 4LMNA 4C36A 1W83A 3TNQB 5JRQA 4F63A 1Q97A 4FEUA 2H09A 1JSUA 1BM9A 3GU6A 4F7SA 4UN0C 4FOBA 3HRUA 2W1ZA 4MD9E 2IW9A 4S32A 3D5LA 4D4RA 4QMLA 1OL7A 3VS0A 4IZ7A 4D2WA 1PXOA 2WMSA 2VONA 3KP5A 5HVKA 1JQHA 1JGSA 5FQDC 4RQVA 3SHFA 3QZFA 5EDQA 1I27A 4L3PA 4OW8A 2ZBKA 4JG6A 2FBKA 4II5A 2VTMA 5CVUA 1MZBA 3R8ZA 4WG5A 3DDPA 2LDUA 3SD0A 5J5TA 3CQEA 3ODYX 3DZOA 4J53A 3KK8A 2C68A 4RB0A 3QQHA 5AV0A 2WU6A 1OM1A 2VGOA 3FZOA 2C3JA 2K7LA 5HTCA 2R3QA 3Q5FA 1HKTA 4I24A 3RPSA 4U43A 4ON0A 3IS5A 3VS2A 4OIOF 5HBJA 2V7OA 5IT9K 1P4WA 1GJOA 2OG8A 3VBWA 2O3FA 1IN8A 4L9NA 3DV3A 4OAVB 3WYYA 3GQIA 3G9NA 3KXGA 4WG4A 1UA2A 1V1KA 2IA2A 4BL1A 4DEIA 5FG8A 5EFQA 2GQSA 1UU3A 4WIHA 4D4VA 5JFXA 2JAMA 3Q4ZA 2J4ZA 4DBNA 2DK5A 2UZEA 3FKLA 3HMNA 1LQ1A 5C03A 2EV0A 4C4IA 3LXLA 5HNIX 3W8LA 3FXQA 3DKFA 2I0VA 3LA7A 5HDKA 2OQGA 3BJAA 2BFXA 1H01A 4IAIA 5KE0A 4I4EA 4PNIA 1XSVA 6PAXA 4HW0A 3OOGA 4YJSA 4HJOA 2PEXA 4Y72A 4S05A 2BDJA 4MD7E 2O8XA 4MXAA 4TYGA 3P08A 1HBXG 5JFSA 5EEHA 4M84A 4CMTA 3DBQA 2XV4S 2RGVA 4RB2C 5ANEA 4E8AA 5AV2A 3SC1A 5M07A 3MZHA 2IJMA 2C0OA 4JAIA 3DJ6A 5BOXA 4OOIA 4K2RA 3ORXA 4HBLA 4XG7A 4D4SA 4UBAA 2PZIA 3QYWA 3SW7A 1WBSA 1IRFA 1X3UA 4EKLA 5BQTA 1CKIA 3G33A 3GX4X 3ZO1A 3HOTA 4CMOA 2FE3A 5EOLA 4G9RA 4IX5A 4NM5A 4XH6A 4Q5HA 1FP1D 3TV7A 3W55A 4AVPA 5AUXA 3Q6UA 1ZMWA 4O2ZA 5I9WA 4BGQA 5KZ0A 4RX8A 3OWLA 4XRLA 4FSWA 5HVQC 2GNHA 1HXDA 2XAQA 3NMUF 1UKIA 3BHHA 4NW6A 2W85A 1FPQA 4X3FA 2HIWA 3Q4UA 1YHWA 3DU8A 5JGBA 5E9EA 3QCYA 3MH3A 4TRLA 3RHXA 2OAZA 3S1HA 3L9NA 2WTEA 2EJRA 1Z9XA 3CCNA 5HQ0A 4FTKA 3LM5A 1MJAA 3CE3A 2A3SA 4DFBA 1TTYA 4B9DA 5H8EA 3VUDA 4HYHA 1R78A 3ACKA 1KWPA 3MH0A 1QBJA 2XGXA 1KU9A 2M5WA 1XH8A 3LJ1A 3G5DA 4XG9A 4FZAB 4GUEA 4BQAA 5AUUA 5IQFA 2VWZA 4QMQA 2FNPA 2IA1A 4D0WA 3QTQA 2GXBA 4RLLA 4D1SA 3KCCA 1ZRZA 3TEIA 2VZ6A 5K4JA 5M4UA 3QU6A 3OW4A 4G9CA 4J8NA 5HTBA 3O23A 4O0XA 2JPBA 3ZMTA 3EIDA 3LFCA 3F2AA 4O2PA 4N0SA 1WWXA 2EB3A 1BKXA 5HGIA 3ZFXA 4E6DA 2UZUE 2PVHA 3RJCA 5IQBA 5E8GA 2J50A 4NM0A 3MVLA 5J7BA 4MXOA 4MHGA 4E1ZA 3QALE 1LEZA 2YACA 3A7IA 1K78B 5IKWA 5HE1A 2L02A 5DT4A 4CZYB 1XCVA 3CR0A 4KT5C 3QUPA 2VX0A 3SXYA 2JSCA 1KOBA 5D6FA 1PMEA 1DPRA 4BI0A 3Q9XA 4V0GB 4L42A 4NJDA 2VBZA 5HE3A 2I0EA 2RSVA 2CNVA 1AOYA 2W9FB 3QGWA 3LA3A 3ZRMA 1P2AA 2RVCA 5M51A 3CBLA 3NUPA 2ETHA 4QQTA 3QTSA 3PXYA 2RQPA 2ADUA 4QMWA 4I01A 2QBYA 1PXJA 2V1XA 1IAHA 2GU8A 3SG8A 3CXWA 3PVWA 4J96A 4L9TA 3TJCA 1Y8YA 4Q48A 3KFWX 3VS4A 3JW4A 1XKKA 5E1EA 2QNJA 3I5UA 4G6OA 4ZH4F 4YIIA 2QD9A 2XAFA 2FSOX 5FB2A 3PY0A 4JG7A 4USFA 5L2SA 3DCVA 1SVHA 3T3UA 5DCMA 1QGPA 1FYKA 4P9UA 3L8XA 4L9IA 4DLIA 2CKEA 5BYLA 1YI6A 4UWYA 3R8VA 3WODF 3BE2A 3W2CA 3QX4A 3QZIA 3OWPA 4PDOA 1FNNA 3ULIA 2X7FA 3TZ8A 3NYNA 1PDNC 4APPA 2HOEA 3NEWA 4C4JA 5IU2A 3R83A 5HCXA 1ULYA 3MPMA 1IA9A 2HWOA 2Y9QA 4PQNA 4GO1A 1KGSA 1O3QA 1RUOA 4IADA 2K02A 4QMSA 4UY9A 2WWYA 3NWWA 5J79A 4TY1A 3TV4A 2ZV7A 2PG4A 4YURA 1VJYA 2OZ6A 3O71A 3EQCA 3RZFA 2A69F 2H34A 5LQFA 1QL6A 1U4DA 3F61A 2ZM1A 3RK7A 4BCKA 3LQ3A 5IQCA 4PDKA 4F7NA 4G16A 1PXKA 4EYMA 3ZONA 5TJJA 1SD6A 1HOWA 3CS9A 4CFVA 4O7YA 4DEDA 2GNJA 3TV6A 2X8IA 2HFHA 5CEQA 3SQNA 2EA4A 2J0JA 3UP7A 1ZY5A 5M57A 4RT7A 4ZOGA 5HI2A 1PKGA 1FMOE 2C5NA 5DMZA 3FM3A 3FC1X 5FRIA 2E9UA 4YJNA 4ASZA 4IHSA 3R8MA 3FUPA 4FKTA 1LVAA 4CSVA 3GBZA 4IMYA 1FYMA 3TZ7A 2HYGD 4PDSA 2OBPA 3KRXA 3Q5ZA 4GFGA 4ASXA 1STCE 2XAGA 4O7TA 2W25A 4RC3A 3K69A 5LHGA 3NUXA 4RPVA 3ORPA 4R8QA 1YDSE 5FFZA 3WE3A 4QQ5A 3RWPA 3SW4A 5L3EA 3QQFA 4K8AA 2BVAA 3ORTA 4G94A 1U59A 4CHUA 3P9IA 2GHLA 5EW8A 4KIOA 1V0BA 3GFIA 3AC3A 2YABA 1FBSA 1Q62A 4FVRA 3ZUVA 4H05A 4C62A 4E5BA 1DDNA 3WIKA 3HMPA 4HGEA 5D9HA 2VX1A 3GXOA 3ELKA 4MF1A 5IZFA 3W16A 4FKWA 4QYGA 3NNXA 2GS7A 4FX0A 4FT5A 4FTAA 2X7GA 4X3FC 2XK7A 3QP5A 3DBFA 2EWAA 3KZYA 2R64A 4KKEA 4A9YA 2OFVA 2RKUA 2HXLA 3R28A 4OTIA 4L43A 5KVRA 2R0IA 1E1XA 2WEVA 3OZ6A 3BHYA 2K86A 4ZYDA 4C33A 4FIIA 1MP8A 1KE5A 4BI1A 1JKLA 2YISA 1W98A 1GZOA 3NW5A 1HW1A 4HCVA 4YZCA 4UEUA 3LFNA 3PFQA 4CMUA 3DLSA 1EH6A 2ERKA 4FG8A 4GK4A 3Q96A 4M9SA 2IW5A 3EFLA 2B4SB 3NS9A 2HZNA 5CWZA 4HZRA 4IJAA 3WARA 1AD5A 4FIHA 4RX9A 3GXLA 1TQPA 3FXUA 1YW7A 1OL2A 3CLOA 3W6JB 2PWLA 2CCIA 4PMMA 4CXFA 5GZ8A 3E7VA 4BDEA 1TW3A 4OT6A 4O22A 3FWQA 5BVDA 5AWMA 4MXZA 3U9GA 3BX5A 4XOZA 5D8KB 3PRFA 3GI3A 3TI1A 1SNUA 4D9UA 1R36A 4G5PA 3AGMA 1XR1A 3L9LA 4KAOA 3TWJA 2WAJA 2UZBA 1IZ1A 3HRSA 3RM6A 3AC4A 2PFBA 1LEBA 2OU2A 4IC8A 1BIAA 3VS5A 3OBGA 5JFRA 3ZLXA 2UZNA 1LPUA 4UB7A 2PVYA 1C0WA 4ZSGA 3GLXA 3F72A 1ZY4A 2QZ8A 1BI7A 4BCPA 4I6FA 2O6GE 3WG9A 5D8LB 5CQWA 1Y6AA 4IAFA 4DNCA 1ZREA 4KRDA 4YNOA 4LK1F 3S95A 4M73A 5ICPA 1P92A 3OUNB 5CU4A 2XEYA 3DXNA 2M1BA 3QYZA 3V3VA 1P14A 2MH9A 3HA8A 3DP7A 4F99A 5FDPA 4RZVA 3RTRA 1YXTA 4W4XA 2GIVA 3M8FA 4F7LA 3R30A 2UW0A 2ITPA 2OKRA 3QTWA 2XJ1A 3NLBA 2OFUA 4BFMA 4HYUA 4NU1A 1WQ2A 3FXZA 4XV1A 2VXZA 4H0EA 4F9AA 4O84A 4NTSA 3VOEA 3OHTA 4IVDA 4O1OA 2X6DA 5LARA 4G9YA 1XMKA 2Y7JA 3FXWA 3P79A 4FSYA 2C6LA 5F1ZA 2J5OA 4P4CA 3EZVA 3UPZA 2QI8A 4WSQA 4KMUX 5BPIA 3Q52A 1IW7F 2QOLA 4B8XA 2B9IA 4KS7A 4ZZOA 2Z8CA 3E5QA 5HLHA 2DPDA 3OFMA 4JR7A 1SM2A 5EHOA 4M15A 3MN3A 1Q3WA 3FWEA 4XCUA 5FDXA 4PTCA 4P7EA 3EYHA 4QYHA 4CYDA 4JNWA 4EK3A 3ZLYA 4I0RA 2C4GA 4RWIA 4FTQA 3R71A 4KB8A 4C3PA 4L53A 2ITNA 3IOKA 3KN6A 4M71A 1QNTA 5J9YA 3NRVA 3SRVB 2QUFA 3KRLA 4FKGA 1FLIA 3E8NA 4H3PA 5DUIA 1B9MA 1A9UA 3WYXA 2UZLA 2Z60A 3OD6X 5FM3A 5AMNA 3HHHA 4FT8A 3J80Z 1U54B 1REJA 1IRGA 4TW9A 4MXXA 3GU7A 2NO3A 4EM2A 4FV9A 4IM0A 4ZJJA 2CG4A 5EYDA 2PLYA 2X8EA 1DI9A 4IVNA 2UZTA 2XRUA 4E73A 3FMLA 3KGAA 4LG0A 3RDIA 3VBYA 2CW0F 4KNBA 2H9VA 3TO9A 1OL6A 2E2BA 2NNNA 1HCLA 4BTFA 5GHVA 4R77A 4KMFA 5AV3A 2E7WA 3FLWA 4XLVA 2GFSA 2PVJA 2YIRA 3MY0A 1S3JA 3BU5A 5H8BA 3I1AA 3LFQA 4EZ3A 1T39A 4YPDA 2KIUA 3FAAA 4L45A 5AP2A 4BDHA 5DN3A 2VO7A 4HF0A 3GC8A 3LAUA 2VWXA 3Q04A 3TNWA 5CVJA 5L3FA 5JEBA 3FL5A 3JVSA 4Z3VA 4AACA 5KMIA 2X0GA 5HESA 4BKZA 2R4BA 2P0CA 4WT6A 3HKOA 1B39A 3EB0A 4ACCA 2R2PA 3ZMSA 2XKCA 4U81A 3FX3A 3VS6A 1Z5MA 3CD8A 1RI7A 4QPAA 4HNFA 4PV0A 2HWVA 2QVOA 4RIXB 3ZMDA 4CQEA 4PX6A 4M97A 4ACHA 5DYMA 3GOPA 5CF6A 1YOMA 4U0WA 2QG5A 4UV9A 4PGGA 2ZMEB 3ET7A 3O50A 4JDJA 4JR3A 5CASA 3SXRA 3QQGA 3QLGA 4R1YA 1IN5A 4M9ZA 3QUDA 4UWCA 2GS2A 4LLLA 3ZU7A 4IM2A 3R8LA 1EV7A 5T6KA 3IDCA 4ZJVA 2XNOA 3D7TA 1IR3A 2P8TA 2OD5A 3F3VA 3VUTA 1W0XC 2VWBA 4RJ6A 4E3CA 3FI3A 4AU8A 4RGJA 2XIRA 2DI3A 2HOGA 3BKBA 3A62A 5IH6A 5EM8A 4YBKA 4EH9A 2QOQA 3FMHA 3O2MA 3D5UA 3UYTA 2JT1A 4RSSA 3R63A 3MTFA 4BYJA 1SD7A 3I53A 3MFTA 2DPUA 2WZJA 1W8CA 3E5AA 4HX7A 2DFIA 2PULA 2RNJA 5FP5A 2M8EA 4KFCA 3FE3A 4EBVA 1H4LA 2HR3A 3FQHA 4RFZA 2W0JA 5AEPA 3F8MA 1RE8A 4WBOA 2WTWA 4QQCA 4CZUA 4AN2A 1D8JA 3IW4A 3EFJA 3A7HA 3RPQA 3R22A 1BX6A 3OCBA 2B9JA 3QC9A 5L3BA 1RW8A 4DEBA 4I98B 2VTIA 2YX7A 2PZ5A 1OUYA 4TYHB 3NNWA 2PY3A 4BDCA 1K3AA 4M6YA 2VTAA 3ECOA 5FLXZ 4GW8A 2R7FA 2YDIA 3WE8A 5F20A 3CP9A 1ZGJA 2E9NA 2V55A 3FMKA 1P4XA 3GFLA 2I6LA 3R02A 4FGRA 2DWBA 4HF1A 5CAVA 5L8LA 2KJCA 3OXTA 4HNIA 3IHUA 1Z1DA 4U8ZA 5IQIA 2ETMA 3JR1A 1GIHA 2A6EF 3ML6A 4MEXF 5FP6A 1H0MA 3ZLWA 3IG7A 3CUQB 4IAYA 4I6BA 3EOCA 4O81A 4X6QC 5CT7A 4OIQF 3BLHA 4K9YA 2STTA 2R3PA 4R7IA 3UZRA 4G34A 4TWOA 4CLJA 4NJ3A 4GCVA 2GTMA 4AXAA 1RUNA 5GZAA 2D1HA 4AIKA 5L8JA 3CY3A 4JK1X 3MIYA 1H1QA 5JZJA 3EKKA 2PVFA 1B6CB 2VNWA 3Q9WA 3AT4A 5L6PA 4IZ5A 2PVKA 5IA2A 5DD8A 2C6MA 2BZKB 4O3MA 4J97A 3V5LA 2CSOA 3FZRA 3CJFA 4C02A 3E8CA 1R0EA 3GOKA 3ITZA 1S29A 3PSDA 3VQHA 4EHGA 1JVPP 3ATSA 3FMSA 4MH7A 1KYZA 5L2WA 3AQVA 2CO5A 3PUPA 1I6XA 4HDUA 5ICEA 4M12A 4DGGA 1J5YA 2UW7A 4CGAA 4ZXTA 4BHZA 3PY3A 4F0IA 3KEQA 2C6DA 5E8YA 3NX8A 4TWCA 5HE2A 4FV1A 2ITWA 4RX5A 2J51A 4ENKA 5CNNA 4EGYA 1XBAA 4Y5QA 1XWSA 4KIBA 2YM3A 4KUMA 2PZPA 3R01A 1OZ1A 3C4EA 3LCKA 2DQ7X 3AD6A 3SLSA 3KU2A 2V7AA 4H36A 5F4NA 3K1MA 3HRMA 1S7OA 3VHEA 3K54A 1STZA 4C35A 5CXZA 1KE8A 3NQOA 4IXPA 5FTGA 1FYLA 3QXOA 1UFMA 3G73A 3UO6A 5LEJA 3PZHA 2PQ8A 3B8QA 4DFLA 3C3WA 4RIWA 5GJDA 3L09A 3R8PA 3PXKA 3MGYA 1B1BA 1OITA 4X0MA 4D28A 2R3IA 2RV8A 2FGIA 3RPUA 4F0GA 1XGNA 4ANQA 4FKQA 4X3JA 4U0IA 2HY81 3P23A 3PJ2A 3SZPA 4V0GA 4WXCA 3PJ8A 3UG2A 4P9FA 2ISYA 4G7ZF 3CGFA 2B1PA 4I0AA 4N9IA 5TF9A 4X2KA 4I3ZA 2V0DA 3RPYA 5D12A 3MYGA 4LI5A 4LGGA 4D5HA 3GUBA 2W1FA 1OBDA 1ATPE 4R7HA 4FV7A 3V8SA 4O27B 3I0TA 2QQ9A 1XJDA 4EH7A 4BCQA 5J9ZA 3UNZA 4AX8A 4ZMFA 4LL5A 4DH1A 2XIKA 3LFFA 4HGSA 2XK4A 5AM6A 1YW9A 4QTDA 2PMUA 5F95A 3DKOA 2VWVA 5C8KA 2ZV2A 4GK3A 1Z9CA 4FIFA 5EW9A 4M7IA 2VD5A 1ZG3A 3GQLA 4TL0A 2X81A 2XRNA 2O61A 4WUAA 2UW4A 3MDYA 1CKPA 4O91A 3MS9A 2W5HA 3L8VA 4E6QA 4EYJA 4IBMA 4BTMA 4EOMA 1JLUE 1T0FA 5EHYA 3V8WA 4YJOA 1ZGAA 4O6EA 3D5VA 3PIYA 4F08A 3O51A 2AYPA 3VRZA 3RIRA 4D1ZA 4CDGA 3E6DA 4WNMA 4E4NA 3CDHA 1G5SA 1ZOGA 4H1JA 1B38A 2FU4A 3ECHA 2FSWA 2PMOX 4K33A 4EJVA 3O7LD 3AD5A 3N4UA 4F70A 3PA4A 2GWRA 3RNYA 5DD4A 4OINF 4I94A 2VOOA 3ENMA 1YOLA 4BWKA 5E20A 4DEAA 3F9NA 3KXHA 1ZG1A 2XVDA 2Q2EA 1P4AA 5J8IA 4BBEA 2R3RA 3MVJA 4PNKA 4I23A 3A4OX 3DEUA 3QXPA 3SFZA 3QQJA 5EW3A 2BHEA 2G2FA 4WBBB 4F7ZA 3TUBA 5CF5A 4P55A 3OCGA 5AJQA 3DQXA 5HG8A 4YIFA 4O82A 3WI6A 5DRBA 1FVRA 5BQ0A 5CAPA 1W5SA 3O7LB 2R3HA 3W1FA 3UOHA 3KRWA 5A4CA 2XH5A 5G1XA 2P55A 2CKPA 3ZFYA 3Q60A 2GHGA 3HX4A 2QENA 4WKQA 4FEQA 2BR1A 2OZAB 4QMTA 5HG5A 3ZXZA 4F7JA 4R3PA 2B0LA 4I5PA 2Z7LA 3H0ZA 4NL0A 2VU3A 5E4HA 2C1BA 5HG9A 5KBRA 4O7NA 4U3YA 4C38A 3QA0A 2QVSE 3TOAA 2WQEA 2PMLX 3KE2A 3DXJF 4V01A 2VO6A 1OPLA 3ZZWA 3UDBA 1FVVA 4UYAA 4WNKA 1UV5A 3EUHA 1Q8ZA 2FA2A 2OJJA 3B73A 4QTAA 4DA5A 2E1NA 5ACKA 3R4KA 5AIQA 2NRYA 4RA5A 3IWFA 3TDZC 1SD4A 2IP2A 2CLQA 4KIKB 3FQSA 3W2OA 5CT0A 3DOGA 2WHBA 4UNOA 4QMPA 1ZN2A 1ZOHA 3BZ3A 4UMQA 5LVLA 4EJ7A 1URWA 3LWFA 2F4JA 2F5EA 2JTVA 3E88A 2JIUA 3QX2A 2NNWB 3SKCA 2J0IA 5M44A 3NCZA 4HDVA 3PRIA 2CYYA 2K4BA 3M2WA 3JTHA 2C5XA 5T3QA 5HIDA 4OTWA 3F22A 3L8PA 1RJBA 3BYSA 1I09A 2X2MA 3T0YA 3RYRA 1A06A 4GV1A 3PXQA 3BIZA 2G2IA 2XCKA 1UKHA 4WRGA 4ZS4A 3JSOA 3FZTA 3WE2A 4XP0A 4YNEA 2RN7A 4XLIA 5JQ8A 3OXIA 3POOA 3MPTA 3R2YA 5JT2A 2Q0NA 5K4IA 4GRBA 4G17A 4BDFA 2HW7A 4U42A 3KMUA 2VAGA 4AZFA 2HW6A 4XG8A 4DITA 4AZEA 1RDQE 3ZMZA 5A14A 2OBJA 3IDBA 4C2WA 3IC7A 3OP5A 3DAEA 2J6MA 5CQUA 5TO8A 4QTEA 3PG1A 5IT9Z 5KX8A 4QYFA 3WU1B 1AQ1A 4QP2A 3SOAA 3PLAE 1GXQA 3ULZA 1P2FA 4HVSA 5D5VB 2DUVA 2GHMA 1GHCA 5FEEA 3OT3A 4C58A 3ZMMA 5BVKA 1T6SA 1SFEA 2QCSA 2EA2A 4EK5A 3CTJA 2R9SA 4YJQA 3PE1A 2YAAA 4DEEA 3WIGA 1BL7A 5I5ZA 2CGWA 3DTWA 1WBPA 4ALWA 3G0FA 3KP7A 4FG9A 1UHWA 4IX3A 5H8GA 1OYWA 4HYEA 3KP3A 4BCNA 2EXEA 5CU0A 1XH9A 1CKJA 5KMOA 4L9VA 1W84A 3PXRA 4AT5A 4LB6B 4RB3C 5AAEA 3KLNA 3V04A 1JBPE 3DFGA 3W10A 3GF2A 5BMZA 4EC8A 4OIRF 3QL8A 1Q61A 4AZTA 3DA6A 4BDAA 5IEVA 4OT5A 4H1MA 3OY1A 2XUBA 3R73A 3D0EA 5LXMA 3TIYA 3HV6A 4IX4A 4AGUA 4JQFA 3K3JA 3WGGA 1ZMUA 2EU9A 3HTSB 4ORKA 5LEKA 3VUGA 4DFNA 3Q53A 5HKMA 2WV0A 2EFPA 4KN7X 4ANNA 3Q9SA 4YTHA 3ZTXA 4M14A 4IANA 5HVYA 2KTYA 2TDXA 3SRVA 3H4JA 4FIJA 4JQ8A 5ETIA 2BEOA 4WF2A 5A6NA 5HBHA 4BY9E 4IW0A 4EK8A 4U45A 5BVOA 3WZDA 1BMKA 3DTCA 4PP7A 3V7SA 2PE2A 5B2MA 2WIPA 1YO5C 1U54A 4MNUA 1H9TA 4XLNF 1ZYJA 3TJDA 3AG9A 5LVMA 2NRUA 1T98A 1GIJA 2Q0OA 4RIYB 5IPJA 1FBNA 5FD6A 2WXVA 3ZM9A 4S31A 2XROA 3Q4CA 4GSBA 4P5ZA 3EN4A 3EQFA 2FSTX 1NXKA 4N6YA 2ACJA 5LRSA 4ZLYA 2FQ3A 2UZOA 3QLFA 2IZSA 2O64A 4FV8A 2JFLA 5IA3A 5L3DA 4EORA 4IWDA 5DLSA 4N0BA 5D4RA 4BVUA 4TNBA 1U8RA 3PPJA 3BELA 3E3BX 2IVUA 4IZYA 4IH8A 4EQQA 2BZJA 4U44A 4HGLA 3S4QA 3ZLSA 5ANKA 2W1IA 3C9WA 3DNDA 4S30A 2I7QA 1UNHA 2E9OA 4JJRA 3SAYA 2EUFB 3IGGA 2C30A 4CFWA 3QF9A 4TN6A 2F49A 3PA5A 2QOCA 2ZYBA 4BHCA 2XP2A 3TO6A 4MK0A 4W8EA 4MQVA 2JDSA 4KYWA 4NKSA 4RIXA 3UQFA 5JI6A 4RFMA 5A2QK 3LXNA 5D7VA 2VTRA 4FTIA 5LLQA 5BVEA 1ZYRF 3OTUA 4O0VA 4AN3A 1R1TA 2ZMEA 2DBBA 2V1UA 4FF8A 3AC8A 3VW8A 2LGCA 4OTQA 3O8TA 5GJGA 3WZKA 3MI9A 4GIHA 2ETRA 1PF8A 2Y6OA 5AUZA 4ACMA 2C5OA 4Y46A 4IRHA 2R3GA 3OY3A 5DHJA 3U6JA 3WTSC 4EQUA 5BUIA 4FKJA 2FH9A 3VODA 4A2UA 4JBPA 3KZZA 3ZUTA 2Q83A 4W4VA 3AMAA 3ROCA 4NKAA 4A9TA 2MBFA 3KA0A 3HGKA 3G51A 2UW3A 4HQEA 1U5TA 4L7SA 3L9PA 4YHFA 4C4HA 2UW6A 1B4AA 2P5VA 3BJ6A 3C7JA 3IKTA 2WGJA 3R0JA 2GA1A 3EFKA 3NPCA 4LGHA 2Z99A 3RAKA 2UWMA 3R1YA 2V9VA 3G3ZA 4YJTA 2QKWB 4MXCA 3VUMA 3VBXA 1O7LA 4X2FA 1J91A 2X4FA 2A1AB 1J59A 3D9VA 1R00A 1LP4A 4Q5SF 4JDHA 1RNLA 4ZY6A 3HRTA 1GNGA 3FQEA 5I3OA 1KQ8A 3F3XA 1UNLA 2YM4A 3OW3A 4TYHA 5FM2A 1XBCA 4N9HA 4FOCA 1JKSA 2JDRA 5CAOA 4I21A 4QMYA 5BYYA 1WCCA 1YXVA 4Y15A 5FXQA 5CANA 3VUKA 4O6JA 4DGLC 3PSBA 3R6SA 1MGTA 2UVZA 3H9OA 3R9DA 2YDJA 2F5FA 5D5XB 2RL5A 5GIOE 3V7CA 5BVWA 3CKWA 4TNDA 4ZY4A 2ZXJA 4EOPA 3LCDA 3Q3BA 2ELHA 5IQHA 2NS0A 4QT1A 1G3WA 4PPCA 4FUYA 4EH8A 4ALVA 1FY7A 3PPKA 2BILB 1Z57A 4FV0A 2C3IB 1OPJA 5BS6A 5DIAA 4D2SA 1BOAA 5CLSA 2VBWA 4K2EA 5M56A 2QOKA 2FUMA 3ORNA 4WNOA 3NEUA 1D5VA 5JFWA 2W4JA 2BRNA 4HCUA 4C3RA 4GU9A 4BCFA 4ID7A 3F5PA 3BGPA 3ABUA 3DJ5A 2H94A 2QQAA 2HEOA 1M52A 5AP6A 3ZUUA 4QMXA 1FWZA 2PVRA 4ZSJA 4GT5A 5FD5A 1EH8A 2H27A 4DH7A 1XH7A 4DG2E 4M74A 1VZOA 3ZEPA 4RZWA 4L5JA 4W8DA 5AR5A 4TYEA 1GOLA 1HKSA 2BMCA 4S04A 4F1MA 2PBIA 3GUDA 3ZXTA 5LVPA 4HX8A 2W1CA 1XDSA 3PPZA 5HICA 1JXSA 2PVLA 3C4XA 3R1SA 4O7RA 4C4EA 3C1XA 3DK3A 2E9PA 4AS0A 5IA4A 4O0TA 3LFBA 3U54A 1WAKA 4IM3A 1VTNC 4NM3A 3FPQA 4B8LA 5JVTA 2OU7A 2CCHA 3QA8A 5AP3A 2WMRA 4A9SA 3FPMA 4YSJA 4EOKA 1BI0A 3J7AO 4BHPA 4I09A 1O3TA 2YCSA 3ROYA 4NWMA 3LZBA 3KP2A 1O9UA 3E8EA 2VO0A 2JKOA 1TNSA 1YDRE 2J2IB 4JX3A 5L3GA 3HUCA 3VJNA 2FA5A 3FMJA 2XBAA 1JSTA 5FBOA 4FX4A 3TCPA 3KF4A 5AP0A 2C5VA 2CGPA 2JITA 3GU4A 3QTIA 4AOJA 3TN8A 4YFKF 3I60A 1XGSA 3KEXA 2XS0A 5HO6A 3F8NA 1F0QA 2EXMA 4LV8A 1TW2A 1IXSB 1R0PA 4DN5A 4IJPA 3JTGA 3UMWA 4AFJA 5CVFA 1MDMB 4A12A 2XMYA 1WBVA 4CD0A 4YHTA 3UOLA 5AIKA 5EQEA 3LOKA 4GXOA 2YFXA 4D2VA 1U5QA 5HO7A 5JHUA 3VBVA 5L4QA 2V62A 3TIZA 2ITTA 3NAXA 1FC3A 4CZZA 5LCKA 3VUHA 4U3ZA 1U46A 5IMXA 2XIXA 3AT2A 2A68F 3R61A 1JNKA 4GFMA 5D10A 3OWJA 1YI4A 2ZDTA 3QUEA 3BGZA 4NTTA 5HD7A 4F6WA 5BUJA 4GFOA 3FY2A 4EKKA 2OICA 5CEMA 1O6YA 3V51A 1YW2A 4IAKA 4XBFA 3CLYA 3FZVA 2MH2A 3U4WA 4X2JA 5AR4A 1NA7A 5EDPA 3TUDA 2HKXA 5LJJA 2IPXA 4Q47A 2OH4A 4ANSA 3NUUA 2F5CA 4CGZA 1I1SA 4ITHA 4BGGA 2YIQA 4QP9A 3H9RA 1SMTA 2E9VA 1I1GA 1J0RA 5CZIA 4BDKA 3GC7A 4J7BA 4J52A 3WTTC 2JGZA 2P5KA 1DP7P 4DHFA 1LR4A 4ENNA 2XK3A 2GDOA 1YS7A 3NUYA 3I4BA 4A0YA 2E1CA 1NVQA 4XG3A 3O3KA 4RGXA 1L3RE 2QR8A 2X0LA 4YO6A 4AGDA 4G31A 5M09A 5CVRA 3LFKA 2YM8A 5HOAA 3G90X 3EETA 4X2GA 2I0YA 4MCVA 4JBOA 3UOKA 5IEYA 4IRGA 1O57A 3RAIA 5KUPA 1USTA 2FOKA 1OL5A 4XG4A 4YG2F 3WZJA 3W8QA 1YOJA 3JY0A 4UALA 4FKUA 1ZLKA 3A8XA 4DBXA 3BV2A 3ZYAA 1QCFA 4F9YA 2OZAA 2EWNA 5KCVA 3DB8A 3TM0A 3MVHA 4FMQA 3E6CC 4DCAA 5L6OA 3Q32A 3CUQC 5HX6A 1ZLTA 4NQWA 3MWMA 2HTSA 4IDVA 5LGNA 4Y5HA 3F6XA 3D14A 4DQ2A 1FP2A 2ZB0A 2XJ0A 1Y0UA 2KRFA 3ZCLA 3U9CA 2M87A 1MUOA 5CJ9A 2EK5A 3EN7A 2BZIB 2J0KA 1G3TA 5CI7A 2EXCX 4W9WA 4KIKA 4EZ5A 3FV8A 4LUDA 5CS6A 4M6XA 4A6DA 2YM5A 3FI8A 3VRYA 2IVTA 5CLPA 4ZTSA 3BY6A 4PCQA 4Q4ZF 2B9HA 4TXCA 5IMEA 3ZEWA 2IRFG 4FL2A 2MLKA 3HMMA 2XM8A 5DDGA 4CKIA 3A4PA 5C1QB 3HIFA 3ISPA 2JBOA 3I81A 3OVVA 4XRFA 1ZARA 4PMPA 5KK1A 3QRJA 4L9JA 1UU9A 3NZ0A 4A06A 5BMMA 2VX3A 5IUHA 4UMTA 2JPCA 2WPAA 1Q5KA 2P3GX 4PZJA 1RZ4A 3HP5A 5HEZA 2JDOA 4DH5A 5DG5A 5C8MA 1KQ9A 2X2LA 5B2KA 3D15A 4WUNA 2V1DA 1Z05A 4F1OA 3ZSIA 3K1NA 4LMUA 3QRFF 1R7JA 5IA0A 4BDGA 5HLNA 2BFYA 2VTHA 3GEQA 3I59B 1XMAA 1DUXC 2YZLA 3RPVA 3CIKA 4RJ5A 1J3HA 4FZFB 4EQMA 3PXFA 3LLTA 3DPKA 2J0MB 5M4IA 3BP8A 3QGYA 4CFXA 3PIXA 2O0YA 3FSKA 4L7FA 2BGCA 3TT0A 3LJ0A 3OT8A 4XEYA 4U80A 4EOOA 2G2HA 3COAC 4DFZE 5DEYA 3IW7A 1G3NA 5HLIA 5CAQA 2JBPA 1FSHA 3UG1A 4BAYA 3KETA 2OZOA 5GINE 2CLXA 3ZC6A 4DAWA 4EHVA 2PYWA 3RHKA 4NHJA 1SFXA 2PZYA 4ZEGA 2W1GA 2QURA 2R3JA 3E3PA 5ILUA 4EBWA 1XH5A 3CTQA 1IRKA 5IQDA 1IAJA 5E8TA 3FBVA 3FMEA 2HZ4A 5CU3A 3VWAA 4O83A 1OMWA 3ATTA 3COIA 3AAFA 4GK2A 5IDPA 5FUTA 4AAAA 4ZTLA 3DS6A 2GPHA 3QKMA 4L8MA 5D5WB 4IJ9A 5GZ9A 2QHMA 3I6WA 3RPRA 4JL9A 1J7IA 3WTYC 1FPUA 5CX9A 3CEKA 4UVBA 4FT7A 5E8IA 5HG7A 3HRBA 4FIGA 2IW8A 2PJPA 4EH4A 3LQQA 2KKOA 5AIRA 4ZYHA 5HU3A 5JH6A 3DJ7A 2ZB1A 3WTVC 3MCZA 5DR6A 3PY1A 3NYVA 3QTRA 3NYOA 4FSUA 4DT9A 5IH5A 3EFWA 5J8CA 4GYIA 5J8FA 4N4SA 1PXIA 3II5A 2AXLA 5K5QA 3AT3A 3NW7A 4QP1A 2G7HA 3ENHA 4JIAA 3R00A 5DFPA 5TE0A 3RP9A 3GP0A 4PRJA 5G6VA 3P7AA 2FBHA 3UIMA 2ZM3A 1M2RA 2QR7A 4ZAUA 1F5QA 4IIRA 3UQCA 3UZTA 2I40A 2RFEA 4DFYA 5GJFA 3BJOA 3N9XA 2Y4PA 3TTIA 2ONLA 1NT2A 1KQ0A 2UZKA 5JR3A 5CEIA 2BKKA 3ROUA 5F6FA 2XNEA 5E92A 3BLRA 3KEOA 4F9BA 4FKIA 5CVVA 4L67A 2ESHA 2C5YA 5K0KA 3BWFA 4JI9A 4FA2A 2HK5A 1TNTA 5TKDA 4O0UA 2STWA 1IN4A 4NFNA 3U8WA 5HORA 1YQAA 1F4KA 4YZ9A 5E90A 3I5NA 4FNZA 3HA6A 2R3FA 4LK0F 5A4EA 4DCEA 1UU8A 4CZTA 1QZZA 5ILSA 3RCJA 2B52A 3G6GA 4OU0A 4WA9A 4XSZF 4HLYA 2NRAC 3LQ8A 4E5AX 4DTBA 5CF8A 3WE4A 2FBIA 4BZNA 4FT9A 4TWPA 4NB5A 2XIYA 3KXXA 3F5GA 5DYJA 3GB2A 2XHKA 1SAXA 4QMZA 3I71A 2RIOA 1G6NA 2XBJA 2YEXA 1PXMA 3RGFA 4Y95A 3KXNA 1XQZA 2XA4A 3R7EA 5J95A 2VN2A 3EL7A 3ZO2A 2A6HF 5ETCA 2DU9A 2P5LC 4UHTA 5D6EA 2F5DA 2XRWA 2PTKA 2ETKA 4EK6A 4RMZA 2QODA 4LRJA 3O8PA 4DH3A 4IQ6A 4OAUC 3P78A 1SMYF 2OJFE 3R2BA 4WCGA 4U0VA 5I4NA 2CSNA 2RC4A 3W32A 3BE9A 4ZTMA 3AC5A 4QMVA 3VULA 4A07A 3O96A 2OIQA 4XOYA 3TACA 4UVAA 4L5IA 4EVIA 4CQGA 4ZYGA 4HA8A 4BIEA 5CYIA 2HCKA 2XB7A 2Z33A 3QHRA 1FZPB 3F5UA 1A04A 1ZWSA 3QD0A 4RJ3A 4CG8A 3CJNA 4JS8A 5EQYA 1WVYA 2UW9A 3ZBFA 1Q24A 1ON1A 2G9XA 3PXZA 1OKZA 2QBYB 2P33A 4PL3A 1ZRFA 3NUNA 2H6BA 4P2KA 2W57A 4O7SA 3GU8A 2HQNA 3QZHA 4FTJA 5LGTA 2JEDA 3I0QA 3L9MA 5EKOA 4G6NA 4M9XA 2A0CX 3P9CA 4Z7HA 2XCHA 4HVIA 3EQGA 4CT2A 4TT7A 5BX0A 4IF4A 5DCMB 4L68A 1K7AA 2FB8A 4O7VA 4DYMA 2O3PA 3SQQA 5HIEA 4R3RA 5IT3A 5F9EA 4C57A 2LNBA 3TDVA 5DUKA 4C59A 1FMKA 2B54A 3T8OA 3ZO3A 2GTNA 3U1DA 4B09A 5AONA 3R1QA 3C7QA 5HHWA 4WHZA 2UV2A 4BI2A 2WMUA 2IVSA 5ITAA 1ZYDA 4FT3A 3MV5A 3KN5A 2W7XA 5EDRA 1H1WA 3C4FA 2JKKA 2ZV8A 2Q0BA 1H8FA 4RGSA 3A2CA 1BBYA 3BQRA 2XF0A 1MD0A 4GGGA 4JX7A 4W9XA 4WSYA 4XSXF 3VN9A 2QOOA 1GIIA 4D4YA 2Z9OA 4MKCA 4Z2YA 4YJPA 4LOQA 3DK6A 4ZLOA 4FSZA 3UGCA 2ACXA 3F66A 3VB2A 4OTDA 1OYYA 3T8RA 5HLPA 2OA4A 3M1SA 5K3YA 4O0RA 1AGWA 4XLPF 1XSXA 3HYHA 3MA3A 2P2HA 5J5SA 2C6YA 2XIZA 2YN8A 3GCPA 4EHZA 2JKQA 3FY0A 2HTJA 3RI1A 2O03A 3V01A 4A4LA 4ZLZA 4J98A 1Q8YA 4AA5A 1JAMA 4IHPA 3UQGA 4B7TA 4GT3A 5HDNA 1FOKA 3P0MA 2GA2A 3I7CA 5CI6A 2YA9A 2GMXA 5IISA 5LWNA 3ID6C 4BWPA 3AGLA 2VTLA 4XBUA 5BVNA 2XAHA 4DEHA 1ZYSA 4AWIA 2O63A 4QRCA 3WF6A 1KV2A 4ZTNA 1JHHA 5EKNA 4PTGA 4QYYA 3O17A 3F6OA 3AC2A 3EQPA 1KA8A 3GNIB 1CF7B 2Y0MA 4F0FA 1HQCA 3BV3A 5HNGA 1OIUA 4XV9A 5D1JA 2X7OA 4HX4A 4LLGF 2C3LA 3F69A 4TZRA 3J81K 3K5UA 3WGIA 1PJKA 4ESFA 4FUXA 1K9AA 1P5EA 2Z2WA 4FKVA 4FV4A 2ONLC 4O38A 2XYUA 4U41A 1H26A 2WTKB 3GGFA 1H0VA 2YAKA 4IX6A 1QPDA 2W06A 1FX7A 3UVPA 3OF0A 1ONVA 1QPCA 5E8VA 3RBWA 4XJ0A 4PDYA 4DTAA 3EL8A 3P4KA 3LKMA 4ASEA 5FD2A 4B0GA 1J7UA 5HTIA 3HV4A 1USSA 4KIGA 3DT1A 4Q2AA 5L3AA 3TKHA 3UOJA 3LW0A 3IQ7A 4DFUA 2P4WA 4A9RA 5DEQA 3TUCA 2BTRA 4XP2A 1B9NA 1I44A 3RKBA 1OKRA 4K6ZA 4R6VA 4KKHA 4W4YA 5J6XA 2WMBA 4KBAA 1WZYA 2A5YB 4XYFA 2XKFA 4C4GA 1J2XA 3G6HA 3F8CA 3F2RA 3IW6A 4ZZMA 4ZTRA 4EH6A 2BRGA 2MC3A 2F2UA 5CTPA 1OR7A 3F21A 4WOVA 2X9FA 3QRKA 4U88A 2UUEA 1BLXA 2X1NA 3A61A 2UVXA 4J1RA 2ITXA 1ZZ2A 4QPMA 3H30A 2GSFA 3BPXA 5ICCA 4I41A 3S2WA 3IO7A 3NNVA 4IXAA 2WTIA 2WFYA 4CFFA 4IC7A 2QLZA 3MESA 1JKTA 2BBYA 2ZNZA 2WTCA 2W1EA 4ZK5A 3DAJA 3EQHA 3E93A 3SXSA 2P4IA 5AAGA 2ISZA 3NNUA 3L2CA 5K5XA 1W7PA 2W4OA 2ITZA 4USEA 1JOWB 5C4KA 3TNIA 4B6LA 3GEZA 4HPUE 2H6CA 2VN9A 3P1AA 1FQ1B 2LAVA 3ZFMA 3VS7A 4MD8E 4FICA 3QD4A 4GVAA 3ZO4A 3F23A 3DXPA 5HO8A 3DV8A 3TDUC 3PVBA 3N4MA 2OF2A 4DINA 3JVRA 3BBWA 4OGRA 4EMSA 3F3WA 5AUTA 4IVAA 2W05A 3QTUA 4A4XA 3VF8A 2DYLA 5IG1A 4NK9A 4IWPA 3S00A 2BDFA 4FKPA 2X4ZA 2OWBA 2C0IA 4IAAA 4OTRA 3EHAA 4ESJA 3KQ7A 2CNUA 5DPVA 2CGXA 4R79A 2CMWA 2OXDA 4MNEA 3HRCA 2FRHA 3C1DA 1U78A 3KXZA 4U97A 4Y8DA 3EWHA 1ZLJA 4UX9A 5KKRB 3RPOA 2I1MA 4EJWA 3BRBA 3VHKA 4GKIA 3FDNA 1YWVA 3L8SA 3BU6A 1V4RA 5LHHA 4O1PA 3QTZA 3D0SA 3PIZA 4WG3A 1TQMA 3L9FA 4U40A 4C8BA 4IHTA 3HTUA 5DGZA 1HCKA 5ACBC 1YHVA 5JKGA 3LMGA 3PJ1A 3MJ1A 3QAME 4ZMEA 4WXDA 5E1SA 3WZUA 4FL3A 3BWGA 4MF0A 2VNYA 2IO6A 2O65A 4FV3A 5M08A 3IOPA 4NYEA 3KP4A 1GY3A 3DB6A 1IEPA 4EM1A 4FEVA 3UNKA 4USDA 3HHGA 4FZ7A 5IEXA 3JY9A 1ZAOA 4E7WA 4O7LA 3OMVA 3KY2A 1EH7A 3ZN0A 3WILA 3GFEA 4AA4A 3UIBA 4GMYA 4M68A 4BDDA 4HZFA 4CRLA 2VWUA 1LDDA 2WQNA 2UXXA 1GZNA 4CYIA 3VIDA 4LL0A 4FEXA 1T2KA 4ZP5A 4J71A 4ZTHA 2PZRA 2NYXA 2GCDA 1UWJA 5ANGA 1OMIA 5ANIA 3LCSA 4U6RA 2IVVA 2NAZA 2PN6A 2BTSA 4QNAA 5I3RA 4BKJA 2DK8A 1PHKA 1W7HA 5JMSA 4IEBA 1PMVA 3HSEA 5LVOA 2L54A 4EH3A 4BF2A 3C0GA 3NDMA 3EZRA 5ILVA 5LCJA 3DFAA 3CTAA 4M0ZA 4ENXA 2R7DA 5CVHA 3DDQA 4XV3A 4JBVA 2PI0A 2OF4A 5M4FA 2PVNA 3UC3A 4YJRA 2MD5A 4FT0A 3DY7A 1QPMA 2L01A 1WMKA 5IH4A 1AWCA 4EOIA 3EQRA 3EN5A 3ZQ7A 4BIBA 1BI2A 2W1DA 3W18A 5FO5A 3AXWA 4CYJA 4IB3A 3RVGA 4AGCA 1OPCA 3QCSA 2BDWA 3IK3A 2JDTA 1UCRA 4LLNA 3U2RA 3P5KA 1YI3A 4NIFB 4J95A 5HBEA 1XDUA 3Q9YA 5K1YA 3E6MA 4HVDA 3DAKA 3JAMK 4G7OF 2B55A 3GVUA 2XVCA 1Z91A 3KRJA 4F64A 1YKRA 4IWOA 4OMZA 3VNTA 2PMHA 1R1UA 3PP1A 4FV2A 5A2QZ 4RWKA 3NIEA 2ZDUA 2QONA 3CGOA 1H1SA 3MA6A 4G3DA 5FTOA 3D7TB 5J87A 2LKPA 3RAWA 3HV7A 2YJRA 3H10A 3ACJA 2UZDA 5HCYA 1KV1A 4XS2A 5AP7A 4EWQA 3I59A 1ON2A 4OBOA 4EQCA 4L0YB 1T38A 4ZYEA 4L0ZB 2Z02A 4GKHA 5KHWA 4F1TA 4G3CA 4G1WA 3DKCA 2OIBA 5JZNA 4BGHA 4B8MA 3T1BA 4DGNA 2JD5A 1F1ZA 5BYZA 5H2UA 2VUWA 4PUZA 3O6BB 1UB9A 4JDKA 3HAVA 4QD6A 3NCGA 4FE2A 2Y6MA 3V5JA 3HLLA 3W2QA 2C6KA 4IACA 4ETSA 4KS8A 4EZ7A 4UWBA 3ORZA 1PP7U 3BHTA 2V6CA 4CTCA 4H3BA 3S2PA 4E70A 5HE0A 2B53A 1QPJA 1G3YA 3HVCA 2X4HA 4YO4A 3I5ZA 2OI4X 1GXPA 3RYPA 1ZZLA 5I9YA 4RWJA 1R58A 1OL1A 4NZWB 2HS5A 2VBXA 4PGHA 3ZMUA 2QLQA 2BRMA 4KBKA 4TV7A 3B2TA 3FL4A 4LD5A 1R22A 1YTYA 2BIKB 2YERA 4FTUA 3W6KB 4Y83A 3C0HA 5JGAA 1FGKA 2RFSA 3T5XA 5E1ZB 4P90A 5IUGA 3NYXA 5JK3A 3THBA 5DRDA 4FR4A 2PSQA 1KE6A 3I79A 4I92A 3ZDUA 1APME 3FHZA 3M9AA 3BBTB 4FL1A 5HS7A 4HCTA 4AWXB 3MFKA 1WRJA 2EB7A 1GZKA 4U7DA 1FT9A 3TTJA 3BZ6A 1YHSA 3AMBA 4R5SA 5D41A 4O96A 4BB4A 1XBBA 2ZMCA 1UVRA 4GU6A 3F8BA 3QRTA 1UWHA 2F7ZE 1V0PA 2R3OA 5D5UB 3VQUA 3SA0A 4MTEA 1SD5A 2XKEA 5CZHA 4FK6A 3EN6A 4F6UA 4FIEA 2AS5F 2BHHA 2OSCA 3QZGA 3BHUA 1ND4A 3FF5A 2DLLA 5AP1A 4PWNA 3FM5A 3FKNA 2M45A 1PKDA 4XG2A 4UMRA 1Q99A 4BR3A 4KIQA 2R3SA 4EV0A 3DFCB 3K9TA 1M14A 3BEGA 2C1AA 3BCEA 1KE9A 4TWNA 3T3VA 4AF3A 3D94A 4NW5A 2FXAA 2ITUA 2X6EA 4JIKA 3U51A 3H92A 2YU3A 2JKMA 3R1NA 2FSMX 3FLYA 2P2IA 1IN6A 4YFNF 3RALA 1WBNA 2XK8A 1SVGA 4O5VA 5IDNA 2QYOA 2V22A 3CKXA 4MYGA 3ZM4A 3DGKA 1E9HA 1WVXA 3ZPLA 1OI9A 2DS1A 3UO5A 1V0OA 5A9UA 3DQWA 4WRSA 1K78A 1Z6TA 4RGRA 3QP6A 3VJOA 4P5OA 1J75A 1H25A 3ERKA 5EM7A 3RKXA 4JQ7A 2QO7A 4RIWB 4D2PA 2YWPA 4U0YA 2EFNA 1O6LA 3T8TA 2RFDA 1TLHB 4ZSLA 4EUUA 2D1VA 3D7ZA 4G7HF 1PMUA 4YU2A 1H07A 3FLZA 4ENYA 4PL5A 4C4FA 4A0ZA 4HAMA 2J9MA 4I0BA 3WF9A 5B0XA 3ALOA 4ZTQA 4YLJA 5FLFA 1LEAA 4AGWA 4C0TA 2C6IA 3OROA 1UU7A 3KCKA 2VC1A 4ALUA 3EQIA 1Q8TA 3R0AA 3UYSA 3QKLA 2G7UA 4AD9A 4G3FA 2W17A 2XZSA 5HU9A 2WNTA 3GCVA 1Z7UA 4AE6A 3VEPA 2A19B 2SRCA 3A7JA 4M13A 3DPLC 5ED4A 5CVGA 2FNAA 4AIJA 2KJBA 4YUQA 3ZRLA 1U2WA 5KBQA 1YXSA 4ZSAA 4AZWA 1TBXA 3HEGA 3PA3A 5AP4A 3SHEA 1WKMA 3UIUA 3ERED 4FHTA 4JBQA 3LLAA 5EI6A 4D2RA 2OIDA 3FMDA 2DTRA 2R3KA 5B2LA 2D2WA 1H0WA 3C51A 4FKOA 3F88A 4BYIA 5B7VA 3DNEA 4C3FA 3NRMA 1G8AA 2G15A 1Q3DA 4HOKA 4BTKA 2YIYA 2YIXA 5DH3A 3M42A 3UMXA 5DWRA 3UJGA 4NFMA 5C8NA 1V3FA 3GC0A 4FTLA 3MVMA 4IDTA 4P96A 2YWVA 5A6OA 3EDPA 2PUIA 2F2CB 3V8JA 1PW2A 4GH2A 5LGUA 3HMOA 4ANMA 1IA8A 4K1BA 4NUSA 4FTCA 1NW1A 1BC8C 1OBGA 4RS8A 3D5WA 3ZHPC 5IA5A 3CTHA 3ZS5A 2YPRA 1KU7A 4EGZA 2GAUA 5FFXA 2WMTA 2HENA 2PPQA 1R23A 4EOJA 4M69B 3F7WA 1VR2A 3F7ZA 1QZYA 1YXXA 2YLFA 5LHIA 3E7OA 2QHNA 5C01A 1M2PA 3UIXA 4RFYA 1UNGA 2ZVAA 3VBQA 2VTTA 2XNGA 4KIFA 4X2NA 2XJ2A 2ZV9A 4ASDA 3KP6A 1WFCA 4GJ2A 4A4OA 2JDVA 2ZCWA 2M30A 3AOXA 4BYYA 1ZRCA 3AMYA 3FXRA 2WTJA 5E8SA 4KA4A 4FC0A 3AD4A 2Y8OA 3WTUC 1IF1A 1Y91A 3BI6A 1NVSA 4QQJA 3W2RA 3CJGA 3UODA 4E4MA 3F3UA 4LUEA 1ZRDA 4BIDA 2VWYA 4HZSA 5IQEA 5K0XA 3FKOA 3Q9VA 1CF7A 3CO7C 4HYIA 4MBIA 3E64A 1TVOA 5EYKA 5L6WL 3VAPA 4YLLA 4OBQA 2JIIA 4RVTA 4AFEA 1DAYA 3SZTA 3HNGA 5A54A 2BAQA 2GFCA 2C6OA 3WU0A 1IUYA 2UZWE 4NCTA 1PRYA 5CY3A 2ZOQA 2RG5A 4JBAA 3PG3A 1H1PA 2J7TA 1L3LA 2RDPA 5LMAA 5EG3A 2X8DA 3M11A 2O0UA 1ZOEA 2D45A 3SGCA 4WO5A 2YSRA 2IZUA 1M2QA 2HGCA 3CQUA 4FSTA 3A8WA 5L2QA 5DOSA 4MQ9F 5A3XA 2Z5UA 3MAJA 4DG3E 1WBTA 3UTOA 3V5QA 4ZJIA 2QQBA 1BYGA 2IN6A 5CU2A 3N4VA 5KNJA 3FMNA 3IGOA 4U7BA 5HNBA 3UO4A 1G4DA 4MEDA 4I2OA 4ARKA 2WKMA 4WWCA 4GEOA 4L3LA 2YCFA 3BHVA 3ANQA 3U6HA 3R9RA 2XNMA 2FMYA 4NEUA 2OQRA 1U5RA 1PXLA 1REPC 2GNIA 3HV3A 1PMNA 3A99A 2W24A 3WF8A 3LXPA 5ERIA 4L18B 3GT8A 3BROA 1LDKB 4LQMA 3IW5A 3MJ2A 4FG7A 3BGQA 1SVEA 5TRDA 3ZN1A 1X8BA 2GQGA 3EH9A 1QPEA 3BOQA 5AUVA 1O7FA 2H8HA 2Y4IB 4CVAA 4V04A 4G8XA 5IQAA 3OEFX 4CKJA 2C0TA 4CCUA 2RG6A 4GT4A 4WD5A 4G6LA 2REIA 1OYIA 1YQJA 2WOTA 3H0YA 4N70A 4YLKA 4L6QA 3HZTA 3IKAA 3PE2A 3F3TA 5C26A 1G3SA 5CF4A 2JRTA 1XGMA 1PXPA 4QMUA 3RMFA 5EI2A 2VTNA 4IRIA 2GQRA 4YHJA 4UXNA 2VTPA 2PL0A 1JHFA 4FZ6A 2XASA 3KFAA 3LFSA 3TKIA 1JWHA 1LJ9A 3MB6A 5M55A 2QU5A 2CGVA 2WB8A 4LJZF 3PQJA 3F3ZA 3C0IA 4C61A 1XHAA 2I0HA 2QU6A 3P86A 5M4CA 5E8ZA 4RJ7A 2AC5A 1CDKA 3GFJA 5HZNA 4BXUA 4FI1A 4ITJA 2DQRA 2CDZA 4FKRA 3D5XA 5LWMA 4RG0A 1OKWA 3IONA 2HYFA 5AUYA 2DQLA 1CM8A 5D4SA 4D1XA 4UUVA 4YJVA 3MFRA 3ALNA 1YW8A 3IW8A 3WTZA 4FGBA 4YZBA 5KMJA 4YZMA 4HF2A 3HRFA 3D83A 3SX9A 3LFEA 3PWYA 3C50A 4MXYA 3POZA 2C47A 4FK3A 3RTPA 2DAOA 3RM7A 3LJ2A 3RAHA 4AZVA 2WC2A 1PY5A 4ACDA 4KSPA 4XBRA 1FBQA 3R9HA 4XHKB 1NVRA 4RVMA 4X7QA 3VVHA 3IL2A 4M0YA 4BZOA 3W2PA 3V5WA 2ZFWA 2F57A 4Q5EA 3OC1A 3OWKA 1TKIA 3D4QA 3WZEA 4RC2A 5H6RA 4QPSA 4YSMA 5AR3A 4ANBA 4L52A 3R04A 3WGHA 3RKWA 4JAJA 4LFIA 3OG7A 3V6RA 1HSJA 4WXHA 3TG1A 2AC3A 4YMJA 3A60A 3HV5A 5FXRA 4C7TA 2O5KA 3JS2A 2JLDA 4A7CA 3QD2B 1O3RA 5EYCA 4BDBA 3U87A 3PVUA 3F82A 3P7BA 4MGRA 3I0OA 4P5QA 3QC4A 3LAPA 4W4WA 2O8YA 4J99A 2ESNA 3FEGA 3O8UA 1BL6A 4N57A 4C37A 3QOPA 3B02A 5LOHA 3R9OA 2YLEA 4HLXA 4EWHA 4XG6A 3R7VA 3HP2A 3PFIA 1P4FA 2BUJA 4ERKA 4AT3A 3F5XA 4KUJA 1MKMA 3FXXA 4D0XA 3K2LA 1Q41A 1S9JA 1Q8WA 2HAKA 3DF8A 1HW2A 2HZTA 5LMKA 3Q4TA 2PVMA 4IAZA 3BWJA 3GZ5A 3EJ1A 2IZRA 3F6VA 5FBNC 3BYOA 2R7IA 3ORKA 5DV5A 2EFOA 3B2WA 4X6RA 4K0YA 4IB1A 4EK4A 2RKHA 2IJLA 3DBCA 2K27A 4J8MA 2UVYA 4NCTC 3VFZA 3IDPA 4ERWA 3PP0A 5GNKA 5L8KA 4D58A 2WTKC 4QMMA 2NPQA 4O0WA 3L7WA 1CSNA 2EV6A 5E8XA 5GIPE 3NVMB 4RJ4A 5E17F 5BPYA 1Q1HA 2ZJWA 4XV2A 4AG8A 1DPUA 2J5EA 3ZBXA 4NIFA 2XKPA 2BZHB 3GYHX 1WBOA 2XNPA 4R5YA 3UNJA 2HWPA 4FODA 2VT3A 3HDNA 3JUHA 3MFSA 2B9FA 1OPKA 4YC3A 3VC4A 2CJMA 5AFVA 3LE6A 3TNPC 1H00A 4FZDB 5HD4A 4Z16A 4LM5A 1NY3A 4DF3A 4BCHA 3HDMA 4EJNA 2C69A 2YCRA 4BICA 4ESBA 1YIOA 1PP8F 1S9IA 4TYJA 5ANDA 1XH4A 3C5IA 2WMQA 4DGMA 5J1WA 4BWXA 1YXUA 3R7IA 2VTSA 1JSVA 3ZDIA 3QFVA 5L3CA 5HVJA 3TKUA 1U5TB 2PMIA 4KSQA 2OXXA 5CSWA 1GAGA 1DI8A 3EQDA 4YZDA 2YZAA 3QCQA 3V7RA 4JRNA 4MX9A 4XRJA 3R9NA 3GZ6A 2QKRA 2XEZA 3PZEA 3PDTA 4KICA 3KKVA 3WTWC 2A61A 2J5PA 4MWHA 4LG4A 1OUKA 1U6GA 4AE9A 4S2ZA 3CO6C 5CALA 4I93A 4I0SA 3VS1A 4O21A 4HGTA 4RRVA 5EHLA 4BHNA 3L00A 4I5MA 3LQ5A 4ENJA 4EOSA 2R7BA 4YZNA 5CU6A 1LDJA 2J0LA 3JYAA 2EV5A 2FMLA 2YX4A 3ODZX 5F64A 4EHEA 3QQKA 4NH1A 3EKNA 3KK9A 2X2KA 3BYMA 5LRRA 4QOXA 3MZYA 5J9LA 4X21A 2ZO4A 2ITQA 4LYNA 4RAYA 5I9VA 5DA3A 5IUIA 3K2ZA 3E8DA 4RWLA 2UZVA 3CUQA 1OIRA 3KCFA 4IB0A 1FOTA 3E97A 5HIBA 5H20A 4IZAA 3COHA 4G5JA 1FSEA 1XCBA 3FMMA 3OTVA 4UMUA 4E6AA 3I64A 5CYVA 2XAJA 4LV5A 3K5VA 5AP5A 3C18A 3DKWA 2MLGA 5HLWA 4EH2A 1PXNA 2PK9A 3QBNA 3E6BA 4A5NA 3LFAA 3FLNC 4EUTA 4EJUA 3IECA 4F65A 2VOPA 2L4AA 2OJ9A 2P7VB 4UXLA 1R39A 3IKVA 5JFVA 5KKRC 4QMOA 1U3EM 4MAOA 1W4MA 3L1SA 2FVDA 2CKQA 4N6ZA 2CKOA 2COMA 2C6TA 3BPRA 4AZSA 3TNHA 2WMAA 3HYIA 2WOUA 4FX3A 2BV6A 3FZ1A 4ITIA 4GVJA 1IXRC 1MJBA 1IG1A 3J81Z 3QD3A 4U9AA 4BC6A 3RK9A 1MRUA 4IVBA 3UE4A 1P4OA 4CFUA 4KDPA 1OB3A 3G2FA 3V5PA 1WBWA 5AR8A 1H28A 3E92A 4FVPA 4JQEA 4RVKA 3KC3A 4U7ZA 4I4FA 1REKA 3KMMA 5EEGA 3ABTA 3H3ZA 3DLZA 4OTFA 4OIPF 1G8SA 4L01A 4IWQA 2WTVA 4GG7A 3Q9ZA 5L2TA 3FZPA 5ICFA 4RX7A 5CNOA 3HUGA 4AQCA 2HDCA 2QOFA 5TR6A 2QOBA 4PDPA 3FLQA 4K18A 3RKYA 4BNCA 2YM6A 4ZY5A 3PYYA 4ONAA 5CSXA 4RLKA 3KXMA 5E8WA 3BLQA 4V05A 3BYUA 5LMKC 4D0PA 4E5WA 3QU0A 3TGNA 1P6RA 2XYNA 4CV9A 5DR2A 4MNFA 4FBXA 5JQ5A 4BCMA 3H3UA 4XP3A 3HSRA 3COMA 1ERKA 4Y73A 1MRYA 3KRRA 3MY1A 3PSCA 4KKGA 3TXOA 4R8HA 5DI1A 1J1CA 3D2KA 5CSHA 3R60A 4LFUA 5HS9A 3EMGA 4RQKA 4I02A 4DEGA 4UZDA 4AT4A 3K0LA 3P7NA 4M3QA 5HDGA 1B6AA 4QP3A 5CEKA 1YVJA 4M72A 3RZBA 3HSFA 4JLCA 4YP8A 3SG9A 3V6SA 2IVMA 4LGDA 4CNHA 1ODDA 3NGAA 4I0TA 1HKQA 2OGVA 3UZPA 2J90A 1URCA 2XKOA 2KIFA 5DT3A 1TQIA 3JPVA 3EQLF 4PP9A 3OOPA 3NSZA 3MH2A 1EH4A 4LGWA 3NAYA 2BAJA 4BZDA 3QRUA 3RJPA 5EYMA 2WIHA 1VYWA 4QLCU 2ITVA 3LIJA 4D2TA 3MW1A 1ZG5A 2PMNX 5KZIA 1Z6RA 5AA9A 2W99B 1IXCA 4NT4A 1NHAA 5J1VA 2CNQA 1T46A 3I58A 1A48A 4FNYA 1H1RA 4HW7A 5AR7A 1XN7A 4FTRA 4CXAA 3GCSA 1GZ8A 5KHXA 4BCIA 5AUWA 3GCQA 1ZHFA 2VC0A 4FSNA 1YWRA 1VYZA 5AR2A 4I7HA 3OCTA 1BI3A 2QG7A 2QWWA 3TKYA 3P9JA 3H3CA 2R0UA 2HY0A 5DEWA 3KULB 4E93A 4R1HA 1QQIA 2EFWA 2Y75A 3KF7A 2IW6A 4FNXA 4MTAA 4L3JA 2PUPA 3CD3A 4RAZA 3OV8A 3R7UA 4FV5A 2XK6A 1KE7A 2IWIA 5I9ZA 2WU7A 4C2VA 1Y8GA 4ZSEA 3U9NA 1LB2A 3QWJA 2P6SA 5E1WA 4A0XA 1MQ4A 2ESMA 4Z7GA 1QO0D 2ITOA 2HZ0A 4PMTA 1DS5A 4ANLA 4I5HA 4M69A 4JVGA 2HYYA 4YFXF 3LCTA 3WF7A 4BBMA 3FI4A 3W33A 3B8RA 2W96B 5EI8A 4PTEA 5DCFA 4XMOA 4FSMA 1H08A 4Y13A 1PYEA 2LSOA 3FSFA 5CXHA 2FF4A 2IA0A 2C3KA 2GXGA 4G2FA 1GVJA 1K79A 2F7EE 2Y0AA 4E6CA 3C13A 3OXZA 2UW8A 4ASNA 4IE9A 5BNJA 4HV5A 3K3IA 4QP7A 1R3CA 2VRXA 4Y17A 3P9KA 4MBLA 1BC7C 4RGUA 4BCOA 4FKSA 3WOWA 5AX9A 5LVNA 4XX9A 3ZSHA 1KU2A 3CSVA 3ELJA 2XKDA 1MJ9A 5EM5A 1W5TA 5CEOA 2F2EA 3FLSA 1FBUA 3DBEA 4MBJA 3LVPA 1E2XA 3E63A 5C27A 2G01A 2V5QA 3QWKA 5LMBA 2ZAZA 2X39A 2LF7A 4CV8A 4EC9A 3VUIA 2OLCA 3KB7A 4KINA 4WK8F 4GG5A 4HPTE 2X9EA 2OK1A 2ITYA 4FSQA 2A27A 3I6UA 3GU5A 4I22A 1LUFA 2KIMA 2B0QA 3GO5A 2QO9A 4YC6A 4BHBA 4KNYA 1XSDA 5HS8A 4LMYA 3CUOA 3OOMA 5JSMA 2WQOA 3R21A 4YGAA 4FYOA 4E4LA 4G6QA 4AW5A 3Q2MA 3E5XA 4ZS0A 3PVGA 3HMIA 4UV8A 4ZZLA 4I1ZA 3HECA 4O7WA 5I9XA 3QQUA 5H9BA 3JAMZ 1KU3A 3QTXA 5IF1A 5BVFA 3Q6WA 4Y85A 4LRMA 1YYVA 4S34A 1J9IA 3VBTA 4HOBA 5C4LA 3ZP5A 1XGOA 3R7GA 2BALA 5BUEA 3JXWA 4UVCA 5HOOA 3P7CA 4QTBA 3KLOA 4R1VA 3OUKA 2RGPA 2QO2A 1R5HA 4DC2A 3TO7A 2W5AA 3BEAA 3TZ9A 4AOIA 4I6QA 4JT3A 2G1TA 4O7ZA 2PU8A 4BBFA 4IFCA 1KYWA 5JRSA 3ZZEA 3DPTA 2BKZA 4GL9A 5AA8A 2EVAA 4CFNA 2XM9A 3IRQA 2BRBA 4F4PA 3LMIA 1D8KA 3FYKX 3S0OA 3VS3A 4GS6A 3DQVC 2VTJA 4KIPA 1JE8A 5JGDA 2VO3A 4CFMA 2JIVA 3LCOA 2VE8A 4Q9SA 1F3MC 1R1WA 5F1RA 1H24A 3MSSA 4YPSA 1W82A 5M53A 2P7CB 4H3QA 3DZQA 4D9TA 4YC8A 4OBPA 4CICA 2YIWA 2BIYA 4LOPA 3CY2A 4I20A 3UC4A 4PPAA 3ORMA 1M17A 3SXFA 4RC4A 2GNFA 5J7HA 5ICGA 2XIGA 5FGMA 3RI4A 1XO2B 3MFUA 4Z9LA 2PUNA 3QHWA 3U55A 2YR2A 2CWEA 1SFUA 2ZNYA 1E1VA 3UVQA 4PL4A 5AV1A 3EQBA 2BYVE 4APCA 3REOA 3FZSA 2FEZA 4QYEA 5K5NA 3N51A 1XB4A 2FSLX 4XNEA 2F9GA 3A7FA 4A6EA 4DT8A 3FMRA 3J80K 3REPA 4AA0A 4X3FB 4IFGA 5HX8A 4UYNA 4JXFA 1VEBA 3T9TA 4R7BA 3DK7A 4OR5A 3SDJA 4EM0B 4K11A 3BDDA 4AUAA 5FWKK 3RK5A 1HSTA 3ETAA 5CVIA 3GW2A 1WI9A 4EOLA 5H3QA 2Z7RA 5EH0A 4AW2A 1S7AA 3NVKI 1OVEA 2OW3A 4JRVA 4RIYA 5KO1A 2E7XA 4UV0A 3MB7A 5EK7A 2BROA 1HW5A 5AADA 3MH1A 3O0GA 2KULA 5K9IA 4AW1A 4PMSA 4QNYA 2ZMDA 3GFWA 3I4PA 4BN1A 4R78A 3MTLA 1KUTA 2R5TA 3U6IA 5CAUA 3IRRA 4BDJA 1SNXA 1KOAA 4RIOA 3UVRA 2GQQA 2W9ZB 5IQGA 2IZTA 3HUBA 4BDIA 2WMVA 2CPKE 3N97A 4CLIA 4DTKA 3SV0A 2EB2A 2J5FA 4QP4A 2VT2A 2YJSA 3NUAA 5D11A 1JPAA 2L3DA 4L00A 2UXNA 4ZZNA 4YJUA 4FTNA 4FTTA 4EI4A 3EYYA 3GWZA 5JN2A 4IPAA 2V79A 3NR9A 3WTXC 4HVHA 1H27A 3R6XA 1J7LA 1ZYLA 1BI1A 1OIQA 1R5GA 4I6HA 1T45A 2FO0A 4GCJA 3O2PE 4AOTA 4F6SA 3M7GA 2IPQX 1S6LA 4KD1A 4BTJA 4MEYF 3ZC5A 2A2AA 2IG7A 2W5BA 4GIIA 5AV4A 1YRPA 1XH6A 3W2SA 3T9IA 2CN5A 2VBYA 3V5TA 4OTHA 3FHRA 3E5UA 2CGUA 3UPXA 3LFDA 5TT7A 1S8NA 1BJAA 1F5TA 2VWWA 4M67A 4K77A 3RNIA 2Y48A 5FGKA 3C4ZA 3CQWA 3IPHA 4CKRA 1RIOH 4UMPA 2OXYA 2W4KA 1R1VA 4L44A 4G3EA 5DT0A 3M8EA 2UW5A 2ZM4A 2JC6A 3UP2A 2CQKA 5IA1A 5H6QA 2WELA 2BAKA 3E87A 2WMWA 4HV6A 4O86A 2EFQA 1IN7A 2OZUA 4FYNA 3PJCA 3LSTA 2RF9A 3C5UA 4G6DA 2Q8KA 5DR9A 5EM6A 5AX3A 1SZMA 3TOBA 1YWNA 3QCXA 2YHVA 4KBCA 2HZIA 3E62A 2DW4A 3MIAA 3QU3A 4UXQA 3H9FA 2VTOA 4JDIA 3RINA 3HOSA 4A9UA 3LAJA 5DVRA 3LPBA 3SOCA 4Q9ZA 2ERZE 4QP8A 1L0OC 5I0BA 4CO8A 1DM2A 4OMYA 2HQRA 4ZIMA 1FINA 4TYIA 4D5KA 2PHKA 4CRSA 3QAHA 4JG8A 4F09A 3LA2A 5A4TA 2Y4IC 4Z55A 3TDWA 3HL7A 3KVWA 5FLXK 5A4QA 1ZXEA 2CHLA 3BPVA 1WSUA
chains in the Genus database with same CATH superfamily
3Q5IA 4XKWA 3PJ3A 1I3QJ 2K4JA 2W84A 4HVGA 3ZMVA 3V8KA 2QM3A 2ZKZA 2R3MA 1D3YA 5E7RA 3C4WA 3MBLA 5DBXA 2YU9J 4E4XA 2W82A 3FMQA 1YG2A 1OKYA 1Z0XA 2NVYJ 3KVXA 4L46A 5GPAA 2LY9A 3PLSA 4O0SA 4GYGA 3L2VA 2QC6A 4HQMA 1B59A 2EZLA 5CSPA 3OS3A 3GFMA 4D55A 4O6LA 4CG9A 5E1XA 3NW6A 3W2WA 3UR3C 4MTDA 3S93A 3ORLA 4PY1A 3K1PA 3TZMA 1Y57A 3RWQA 1IAWA 3V8LA 3C4CA 3I7BA 2GZWA 4MFEA 3SYTA 3CPCA 3QPTA 3DPUA 2DXIA 4YBJA 3F8FA 2PJRA 4M66A 1BIBA 2DMTA 2Z3YA 2QOIA 2WO6A 3VYUB 1WJ5A 2H6DA 3QPHA 4DG0E 1M7NA 1OECA 3DXQA 4GJ3A 1HOMA 2WMXA 4F55A 4UZHA 4YR8A 5ANJA 4EJTA 3QQLA 4RJ8A 1QMZA 4OTPA 2CN8A 1K2PA 1ZYCA 4HYSA 3H0DA 4LOOA 4QMNA 4H39A 1SYKA 4RA4A 4FSRA 3HXLA 4MVFA 3GVAA 1LNWA 2R3LA 5AAFA 1FEXA 3MEXA 1GV5A 1O6KA 3OBJA 2PUUA 4FVQA 3S1MJ 3QRIA 5FXSA 5KMMA 5L2IA 4DH8A 3WF5A 3KREA 4CEGA 3G15A 1YFHA 4DFXE 1Z21A 3PWDA 1R6RA 1SFKA 1DAWA 2OO8X 4EJOA 2VKDA 1KSWA 5T68A 4I5CA 2R7SA 3VO3A 3TL8A 3LMHA 3IAM2 1FTZA 1ZKGA 1AKHB 3FYJX 3LM0A 2BPMA 2NNYA 3MY5A 4AW0A 1BN5A 2CFXA 3ZSGA 5C9CA 3S3IA 2XNBA 3G0EA 4TKSA 3R7OA 4WX9A 4B4LA 4F9CA 4O0YA 2VXDA 1ZMVA 3V8TA 3WBLA 3UBDA 1LVKA 2HXQA 2YITA 2WEIA 3PNVA 2VWIA 4BRXA 1CTPE 2HU9A 2V9KA 4CTBA 1YE9A 5A4LA 1WVWA 4M8TA 4QTCA 3VW6A 2F7XE 1YLFA 1WHUA 2OV7A 5CEPA 3ZQLA 2K9SA 2VGPA 3MQ0A 4FTOA 2C6EA 4BXFA 2W1OA 4IOAF 2BCJA 4OLIA 4ACGA 5EQPA 3FC2A 1JKRC 3KMWA 4M3FA 2LF8A 3DBDA 4QP6A 2O8KA 1MH4A 2MA3A 1CMKE 1LEWA 4TTHB 1RR7A 2IT0A 4E20A 4E7LA 2OJGA 2A4LA 1VQOI 3FDYA 5FTQA 4YTFA 3ZQHA 1I5ZA 5TOZA 3EYGA 5KMKA 1W7PD 5E79C 2BE5F 1IASA 3CC6A 4G3GA 2BRHA 5KMNA 5D7AA 3SVVA 3PQKA 3ZOSA 2L4MA 2A07F 3ASNH 4OAZA 1SMHA 1XMXA 2LH9A 2JZYA 1FGIA 4EEVA 1Y6BA 3PTGA 4ANOA 2VV9A 5I9UA 1UHMA 4JOAA 1OIYA 4FTMA 2HELA 4MWIA 4LRKA 4QO9A 4MHAA 2LFBA 5BPDA 3GENA 1YJ9I 5K5RA 2YDKA 4EEFG 2KMUA 4KABA 4I6ZA 3R0TA 1MDMA 5CSVA 3FJQE 4H58A 2FYSA 4DE4A 2AUHA 5AIPA 1FMVA 4CCBA 2HVQA 3Q2JA 2VODA 3GTKJ 2PE1A 1BI8A 3CCMI 1K6OA 1XD7A 4D5FA 2NP8A 4EH5A 3E3VA 5K5OA 4ENMA 1T95A 3BU3A 2JFMA 5DNRA 4YTCA 5ETAA 3A7GA 1E17A 2DT5A 3GCUA 3RCDA 4GUBA 4P1WA 3LHJA 3V4GA 4QWQA 3HAMA 1MNDA 4U5JA 5CENA 1JKKA 4RB1A 1W7PB 4LB5A 1YDTE 2KRHA 4UB8C 4IVCA 4OUCA 2A05A 1Q8UA 2O2UA 4S33A 4DGOA 4DLJA 2G9WA 1F9NA 1PUEE 1YS6A 4BCGA 4E26A 5LBQA 3RKQA 2QQ7A 2PE0A 2L9NA 4MQ2A 3BTCA 1M7QA 5KMLA 5BMSA 5E8UA 3N4TA 3JSPA 1J7KA 2WQMA 2XK9A 4NM7A 3LXKA 4KWPA 3VPRA 4KISA 1V5FA 3MWUA 1L8TA 3CPBA 2K3PA 1MH3A 1PVEA 5F94A 3HC7A 2V9PA 4PPBA 4MQ1A 4U79A 5A46A 3U4UA 3QKKA 4AP7A 2BHZA 1FVTA 4F9WA 2R3NA 4FNWA 2WD1A 5HCZA 4XICA 4IHXA 2JA2A 5IYDJ 2DO7A 2H96A 4FKLA 5C4XJ 4RVLA 2Z7QA 2VTQA 3GTJJ 4FV6A 1CGPA 3BYVA 3TQNA 4MNEB 1U5TC 3DKGA 1PYXA 1OGUA 2B7AA 3KL8A 4NSTA 4C9YA 2XUUA 2Z7SA 3BQCA 3KULA 2OJIA 4BACA 5M06A 3ZRKA 1TZLA 1WGXA 3LQRA 5FEDA 4WNPA 3ZH8A 5HLGA 1BUHA 3NUSA 1RQQA 4AN9A 4B99A 4FEWA 2GNGA 3F2NA 2P6TA 3AC1A 3OEZA 4BCJA 4EOQA 4BH9A 4IX7A 2DFHA 4C34A 2ZJ2A 5E91A 2L9SA 1MQBA 1IDYA 4PF4A 2OH0E 3FI2A 3VF9A 4KN4X 4AYBA 2HKOA 3ANRA 2XNNA 2QOHA 3DU6A 1J1BA 3G9LX 4RAGA 4CT1A 3OS2A 2RFNA 4LG0B 4XMYA 3BQZA 1Q4LA 3COKA 4KA3A 5FEQA 1OKVA 4YTIA 3EYIA 4W1UA 3FHIA 2XSDC 5E18F 2JVHA 1O3SA 5AM7A 2WTDA 5ANOA 3OY9A 3I54A 3MPAA 4A5MA 4AIHA 4OTGA 2V4JC 3IWZA 2W1HA 1IC8A 4IB5A 2IS2A 4ZZDA 3EN9A 4FASD 1XPXA 4EL9A 3B6CA 2YM7A 2JAVA 4KRCA 1MRVA 2GS6A 2QLUA 5DE2A 3ORIA 4TPTA 5ETFA 3GC9A 3NIZA 2VQLA 2VE9A 4R3CA 3W3CA 3PSIA 1ZH5A 5E3OA 4XUFA 3ULQB 3R7YA 3M1EA 3F9KA 2V6EA 3NFFB 4RBLA 5EOBA 3MKWB 2WQBA 3OCSA 3HGYA 4BKYA 2YCQA 3D2IA 4EONA 2GNLA 3R8UA 1H9GA 3ZXSA 4LMNA 4C36A 1W83A 3TNQB 3QQAA 5JRQA 2EILH 2LY2A 4F63A 3FIWA 1Q97A 4FEUA 2H09A 1JSUA 1BM9A 3GU6A 4F7SA 4UN0C 4FOBA 1X1CA 3HRUA 2D5VA 2W1ZA 4MD9E 2IW9A 1WJBA 2KRCA 4S32A 3D5LA 1UG2A 4D4RA 4QMLA 1OL7A 3VS0A 4IZ7A 4BJ5C 5IPAA 4D2WA 1PXOA 2WMSA 2VONA 3KP5A 5HVKA 1JQHA 4BBRJ 3FBNB 1JGSA 1GLNA 5FQDC 4RQVA 3SHFA 3QZFA 4XK4A 5EDQA 1I27A 4L3PA 4OW8A 2ZBKA 4JG6A 3GTLJ 4E7HA 3CCYA 2FBKA 4II5A 2K9QA 1MBEA 2VTMA 5CVUA 2V26A 1MZBA 3R8ZA 4WG5A 3DDPA 2LDUA 2R7VA 1ETQA 3SD0A 5J5TA 3CQEA 3ODYX 3DZOA 4J53A 3KK8A 2C68A 4RB0A 3QQHA 5AV0A 4IHVA 3M3YJ 2WU6A 1OM1A 2VGOA 3FZOA 2C3JA 2K7LA 4IHWA 5HTCA 2R3QA 3Q5FA 1HKTA 4I24A 3RPSA 4U43A 4ON0A 3IS5A 3VS2A 4OIOF 5HBJA 2V7OA 5IT9K 3JRDA 1P4WA 1GJOA 1ERDA 2OG8A 3VBWA 2O3FA 1IN8A 2BOLA 4L9NA 3DV3A 2X48A 2CV2A 4OAVB 2JN6A 5EF6A 3WYYA 3GQIA 3G9NA 3KXGA 4WG4A 1UA2A 3G2BA 1V1KA 2IA2A 4BL1A 4DEIA 5FG8A 5EFQA 2GQSA 1UU3A 4WIHA 1G8XA 4D4VA 5IY5H 4YIRX 5JFXA 2JAMA 3Q4ZA 2J4ZA 4DBNA 2DK5A 3DLLF 2UZEA 3FKLA 3HMNA 1IJWC 1BW5A 1LQ1A 5C03A 2EV0A 4C4IA 3LXLA 5HNIX 3W8LA 5GAEJ 3FXQA 2M4KA 3DKFA 2I0VA 3LA7A 2OQGA 5HDKA 3BJAA 2BFXA 1H01A 3VYRB 4IAIA 5KE0A 4I4EA 4PNIA 1XSVA 4II3A 6PAXA 4HW0A 3OOGA 4YJSA 4BJTA 4HJOA 2PEXA 4Y72A 4S05A 2BDJA 1TWFJ 1XMMA 4MD7E 2O8XA 1ITYA 4MXAA 4XLAA 4BBSJ 4CYCB 4TYGA 5CQGA 3P08A 1HBXG 5JFSA 5EEHA 4M84A 2LKSA 4CMTA