1TQPA

Crystal structure of a. fulgidus rio2 serine protein kinase bound to atp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
282
structure length
269
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal Structure of A. fulgidus Rio2 Defines a New Family of Serine Protein Kinases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
total genus 86
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tqpA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1tqpA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1tqpA02
3NVKI 3MWMA 5FG8A 3NW6A 2QI8A 3MBLA 1URWA 5DYJA 4BDAA 3RPVA 3VS0A 1OBGA 3HRTA 2QO7A 2W1DA 3IW5A 4EOQA 4GK3A 4NJDA 3SOAA 3A7GA 5DVRA 1PYEA 5FXRA 4D0PA 4IH8A 2OIBA 5ACKA 5DCMB 4DINA 3CGOA 4K8AA 4O7ZA 4CV8A 3IONA 5JK3A 1R1WA 5EEHA 1URCA 2C5VA 1J1CA 3KMUA 3UNKA 4JQEA 4U40A 1XD7A 2YCQA 4XRLA 1S7AA 4WNKA 4BZDA 3IK3A 5BVEA 3WE3A 3EL8A 1T38A 5I5ZA 5HLPA 5HOAA 3FX3A 4ACHA 1V3FA 4RA4A 3TNIA 2YX7A 3QZHA 3QD3A 3RNIA 1DM2A 5D5WB 3HX4A 3ZLWA 1JKKA 4O6JA 2GHLA 4BCIA 2JRTA 1ZH5A 2OICA 5F20A 2HWPA 3ACKA 3QTRA 3V51A 4ESJA 1IRKA 4EYJA 4D4SA 5L2WA 1U46A 4L9TA 3SHFA 1ZYJA 4ZTNA 2WOUA 3FYJX 3LPBA 3NQOA 4EGYA 1I1SA 2OZOA 4R1YA 4IEBA 3QTWA 3RZFA 5IEYA 1AWCA 4KIGA 2MBFA 3ATSA 4S33A 2YM7A 4ZSAA 3NAXA 3KF7A 5ERIA 4KIPA 1JNKA 2ONLC 1QZZA 1OYWA 3FBVA 4UV8A 4MD7E 4DG2E 3PIYA 3DXNA 2R3PA 2PE2A 5CU2A 5D12A 2ITOA 1XBCA 4YC3A 4M69A 2XIGA 4YUQA 1ZWSA 3ZO1A 5HU9A 4U0IA 1Q1HA 6PAXA 3QU0A 3QQFA 1GNGA 1O3TA 2V62A 4LQMA 3MB7A 2OXXA 4X7QA 2JKQA 3MH3A 2R3HA 4CFFA 2W7XA 2QBYA 5HVQC 3VUMA 2I0YA 2CKPA 3CUOA 3W18A 3E6MA 3FLSA 5AUZA 4F6WA 1ZMWA 4WO5A 1D8JA 3LFDA 3VBXA 4UVAA 3TKIA 2ZMEB 4YNEA 2C3LA 3FMJA 3NR9A 3PFIA 1J9IA 2W1IA 3PIXA 1VR2A 1H27A 1LQ1A 1DPUA 2G9WA 3HECA 1UV5A 4FV8A 2YM3A 4FSUA 4QP4A 5GZ9A 4HAMA 4LRJA 3COAC 1YQJA 4WXCA 3OVVA 4Q48A 4CZZA 2EWNA 4E70A 3EYYA 3O51A 2L54A 2X2MA 1OUYA 2UZBA 3ERKA 3KEOA 4O7LA 1XGMA 2P7VB 1H1PA 1GY3A 4F08A 4JLCA 3WIKA 1O9UA 4JR3A 2VO7A 4BDIA 3DNDA 1DAWA 5ANGA 3OP5A 5AA8A 3B02A 4QMXA 3RK9A 1Q8UA 1R36A 2VTOA 2OJ9A 1H9TA 5AONA 3U6JA 1TQPA 3GBZA 4GU6A 4RX9A 3QTUA 3UP7A 3F2RA 1LDDA 4FKSA 4OIPF 2M87A 4ACCA 2WQOA 1ZAOA 1T6SA 4FSMA 4ALUA 5E1SA 3U54A 4O0UA 3G6HA 4EHVA 3Q9XA 5B7VA 4CYDA 4NW6A 1FYKA 2WQMA 5J8FA 3PJ2A 4Q9ZA 4ONAA 1TLHB 4U80A 2RNJA 3AT2A 3NGAA 5IEVA 3QP6A 2PK9A 1O6KA 5IA4A 3P78A 4S34A 3S95A 4DFBA 4TT7A 3WILA 1WSUA 2R3IA 3FXRA 3Q96A 2V6CA 3OFMA 4BYIA 3GYHX 3PZHA 1SMYF 3C18A 2QR8A 4ALVA 4I6HA 3POZA 4IIRA 4ITIA 2PVHA 5FP6A 3EOCA 5KZIA 4GRBA 4DH5A 3AMBA 3QOPA 2XAFA 5FD6A 3F9NA 1GJOA 4G17A 1QQIA 4AZFA 3DXPA 4LG0B 2R3LA 1MZBA 4DN5A 2W9ZB 4HPTE 4FL1A 4C57A 3K2LA 4EOMA 4K0YA 3R7GA 3CJFA 3UIMA 2XKFA 3QLFA 3SOCA 2UZWE 5A4QA 1E17A 3MESA 5AR8A 5CVIA 5ACBC 4AW2A 3TZMA 3SG8A 2PU8A 2HW6A 3QALE 2ETHA 2CKQA 2AYPA 3NUAA 4IF4A 4OTGA 4EOOA 1OECA 3FAAA 2ZCWA 1HQCA 4L00A 4DH3A 2VOPA 4J1RA 2VNYA 4RAYA 1JVPP 2A68F 3RAIA 1IN4A 1Z7UA 2DW4A 2WTEA 4JX7A 4X3JA 4AS0A 4U42A 4EUUA 5KUPA 3GCPA 4R8HA 3QRJA 4GFOA 4IB3A 5BNJA 5EOBA 5KHWA 3U6HA 1IG1A 4OBQA 3KRRA 3ZONA 4C4GA 3HMOA 3MH1A 2BFYA 1PW2A 3RKBA 4GU9A 1YWRA 4L68A 4QYEA 5EKOA 2KTYA 4UV9A 4RGXA 5C8NA 3MV5A 5D5VB 2AUHA 3R8PA 3DKGA 5KMKA 3AXWA 3W2PA 4MQ1A 4D58A 5L2IA 4QTBA 4FTRA 4GUEA 2FXAA 4I01A 2XKDA 2F5CA 3C7JA 3LXLA 1ZMUA 3TEIA 1RI7A 2XA4A 4R7BA 4PDKA 3VRYA 3GB2A 4BDDA 3AC1A 5K0XA 4QPMA 3MVMA 4LMUA 4YR8A 1ZLKA 5C9CA 3GNIB 4X2JA 4K6ZA 3FMMA 3HDMA 4BCNA 3N4UA 5BMSA 3R22A 4CTCA 4Z16A 4TN6A 4XV9A 3OT8A 2HYFA 1XH5A 4YJVA 3TWJA 3U51A 1WBVA 2R3NA 1KSWA 4YLJA 3S2PA 3QXPA 3VQUA 4ZMEA 3Q9ZA 3I58A 2W4KA 4Z9LA 5BS6A 4NYEA 3R1SA 5AIRA 1YHVA 3N4MA 2HWVA 3P7NA 2JIUA 2JFLA 3UE4A 3NPCA 2WU6A 4F6UA 3F82A 3BPRA 4BCFA 2YM6A 3EB0A 4WRGA 4FTAA 2B0QA 5DDGA 4QRCA 4IWOA 5AUVA 2M30A 4KA4A 3RPQA 4AZWA 3EWHA 5CYVA 3PP0A 4LRMA 2HTSA 3NYVA 3PXYA 2UW8A 1G4DA 2VWBA 1STCE 1ON1A 2XJ1A 3V5WA 3PE2A 5CF5A 5M08A 3AAFA 1UU8A 1OKZA 3PY1A 3BPXA 4TNDA 4EJTA 3BDDA 3LAJA 3D0SA 4PMSA 1BIAA 4XP3A 1T2KA 3DY7A 4G5JA 3ZMZA 2Z99A 4H3QA 2QENA 1DI8A 3UVQA 2VOOA 1IRFA 3FXXA 4HBLA 4M0YA 2O3PA 4JT3A 2XUBA 4IACA 4BCGA 3BV3A 2OD5A 4E73A 3E8EA 3QQUA 3MY1A 5D11A 1D5VA 1R00A 5EKNA 2C1AA 4CV9A 4MQ9F 3DAEA 3V01A 3GXLA 3T1BA 4V0GA 2V5QA 4ENYA 4I5PA 4IQ6A 1KU7A 3UQCA 1OL6A 2DFIA 4A4LA 3IOPA 1BL7A 5EHLA 2YM5A 1PKGA 3HUCA 2R2PA 5CT7A 4YHFA 2R3QA 1S6LA 2FYSA 1YLFA 4UY9A 2P2IA 2G2IA 5L3DA 3DBCA 1MDMA 1ZG3A 1MJAA 4B8LA 3AOXA 2L3DA 4UYNA 5HVYA 4E7WA 3O8PA 4QMZA 4LJZF 1DPRA 2P5LC 3WGGA 1G8SA 3N51A 2WB8A 4MCVA 4ZSJA 4IM3A 5D5UB 2V1XA 4A7CA 3GUBA 3C4FA 1OGUA 1KU2A 5IMEA 3R61A 3J81K 5E20A 1X3UA 4BY9E 3C0GA 3PVWA 5ILSA 2BDFA 4DTKA 3SG9A 4FKTA 3EFWA 3UODA 4F64A 4PTEA 4XG2A 2VE9A 1O6LA 1OZ1A 5I9WA 5IU2A 1F9NA 2PPQA 2PVFA 5CF6A 3OG7A 4JXFA 4LOQA 5FD5A 1FYMA 3TQNA 3E64A 3D83A 5JR3A 5HIDA 3I64A 3OUKA 1VYWA 3DT1A 4ANQA 3P4KA 3DZOA 3I5ZA 5D8KB 4G3GA 2NYXA 3FYKX 3NYNA 4ZSGA 5HBJA 3BROA 1YXUA 3OEFX 4CFUA 5LWMA 1YOMA 3FKOA 4FTTA 1YWVA 4HOBA 3R01A 3V5QA 2BIYA 4XX9A 4BWXA 4HGLA 4FT5A 2GMXA 3RVGA 2FQ3A 3E93A 3CCNA 4QNAA 3PRFA 4I6BA 5E1XA 3EN6A 4J53A 1X8BA 5F64A 4EJWA 3F5GA 1EV7A 3PG3A 3UTOA 2F7XE 3AGMA 4ETSA 3DNEA 4BGHA 1KYZA 2UZKA 2YIQA 3ZZEA 4L43A 4PX6A 4JRNA 1G3SA 2YIRA 2HZNA 2HXLA 2XAQA 3QZIA 3R8LA 4G16A 4AG8A 4B09A 4XLIA 2XAJA 2ACJA 4M73A 5GJDA 4L45A 2X2KA 5KNJA 2X0LA 2QURA 1FP1D 3DK3A 4FE2A 3HRSA 2F5FA 4RIYB 2HZTA 3SA0A 1JSUA 3AC8A 2CN5A 3ORMA 5A9UA 4FTCA 2YERA 4CKJA 4IX6A 5DD8A 3VAPA 3FZPA 2V7OA 4D1SA 1TTYA 3CE3A 3QCYA 3BLRA 4CCUA 3L09A 5K5QA 2PE0A 3GU4A 4ZLZA 3RDIA 3H0ZA 1HW5A 5CAQA 1H0VA 5K0KA 4DT9A 1B9MA 3NRVA 4EJUA 5EQEA 4U9AA 2G1TA 4I6FA 5DG5A 5HG7A 3VBQA 3KRLA 1KQ0A 3WF9A 1Z05A 3PXZA 4EC9A 5M09A 4R3CA 4LOOA 2PY3A 2XUUA 4PQNA 3NMUF 2IPQX 3NIEA 1UU9A 3G0EA 3IGGA 5E92A 3A62A 5ANOA 1MRVA 4D2RA 5CLPA 3TKUA 4RGJA 2HQNA 4UWCA 5CALA 5BYYA 4O0WA 5ANKA 3PFQA 5ICEA 4RIWB 3LA2A 4F4PA 4U44A 2EU9A 4OT6A 4L53A 5DR2A 5ICCA 3QGWA 3TTIA 2VGPA 4M14A 3F7WA 1FBQA 3NEUA 2R3GA 3L8SA 4DH8A 2OO8X 5FFXA 2EB2A 3VS6A 2XYUA 3OC1A 2ZM1A 1QGPA 4U8ZA 3FMEA 1YXSA 3MTFA 3WE8A 4CXAA 2LAVA 3R7EA 4MWHA 3W32A 4ZYHA 3Q32A 5K9IA 4X21A 1R22A 3E6DA 3KLOA 2UVYA 1UWJA 3JW4A 2GU8A 2B4SB 3P9KA 4XG8A 3V7RA 5M4CA 4O7RA 2FSOX 5CEPA 2FBHA 3CBLA 4FZAB 3CDHA 2DPUA 3BY6A 3O7LB 5FEQA 4NL0A 4XSZF 1JKTA 4N0SA 3MIAA 1YXVA 4G6QA 4UMQA 1H9GA 2J6MA 4O3MA 3LFSA 1LEBA 4YFXF 2BCJA 5D6EA 3OCBA 4W4XA 4XOZA 2BAJA 2OJIA 4WD5A 2RFEA 2VWVA 2DQRA 2QO2A 4FTIA 5A4EA 2YLFA 3QX4A 4MKCA 2V79A 3FDNA 4MAOA 5HTBA 3GCQA 4EOKA 4BNCA 3W10A 3M1SA 2YIXA 5BQ0A 4AGDA 1FLIA 2OIQA 4BDGA 2PVLA 3UP2A 5ETFA 3J80K 5LHIA 2K86A 1R7JA 2P5VA 4KYWA 4CZUA 3A61A 3F3XA 3SFZA 2I6LA 5CENA 4DFYA 1W8CA 1Q8TA 3DK7A 3R83A 4L9IA 4ZZNA 4OOIA 3G5DA 3LFAA 4O38A 2X7OA 4CFMA 3ISPA 4RQVA 3HV6A 1J59A 4XMOA 4F0IA 4EH4A 3QCSA 3VIDA 4QQTA 1JHFA 5FP5A 5DGZA 3EZVA 3VUIA 1M2PA 2GA2A 3GO5A 2I1MA 2V1DA 3L1SA 2VTJA 4EK6A 2WU7A 5DBXA 3VW8A 3C4ZA 4C3RA 4ASEA 3TOAA 4BKZA 3W1FA 2GXBA 4M15A 1OIUA 4KN4X 2HXQA 4H3PA 2VBZA 3C5UA 2A61A 1NXKA 3GFWA 2Y9QA 4O0TA 5IKWA 3DQXA 3FZOA 4DGLC 4IM0A 2ITQA 5JMSA 2V22A 3KXNA 2LF7A 5KHXA 4Y95A 3KFWX 5LGNA 3HRMA 3RGFA 5IQHA 3GC7A 3ECHA 3S0OA 3CKWA 3Q4ZA 5I9YA 1RIOH 5HNIX 2EFOA 5E1WA 5HI2A 3TDWA 3QU6A 5HX6A 2GWRA 4ACGA 2JKKA 5E8WA 4UMRA 3EQDA 3MTLA 3RI4A 4OUCA 4EL9A 3FI3A 4BCKA 5L2SA 2OKRA 5JI6A 3UOJA 4EJNA 3FQEA 5L6OA 2W1CA 2XS0A 2WWYA 4HF0A 3SV0A 4GIHA 4QP6A 1HCLA 4E6QA 3RPUA 4OMZA 1GIJA 4CFNA 2IRFG 4EKLA 3RHKA 4F7SA 2CJMA 2VWIA 3GOPA 3V8WA 1WCCA 1GVJA 4CKRA 5FD2A 2ESHA 5HG9A 4AD9A 2XIKA 5EYCA 4YC6A 1SD6A 1JAMA 3ZN0A 2GFSA 1EH7A 3LCDA 3WZDA 4AN2A 5A6NA 1WVWA 4C4FA 1Q4LA 4AF3A 1RJBA 4P2KA 5L8JA 2C6OA 4N6ZA 4YTHA 2PLYA 5HS7A 4TKSA 1UNLA 5HLIA 2YIWA 1K78A 2MH9A 2GQSA 4FSYA 5EM7A 5CS6A 3RALA 2F2CB 4QWQA 3ZOSA 4F7ZA 4RFZA 2JAMA 4C34A 1FNNA 2IVTA 5G6VA 3BBWA 2I7QA 4EQUA 3KP6A 4C61A 1MGTA 3S4QA 4ESFA 3RWQA 5LQFA 4Y46A 4EV0A 1H26A 2C3JA 3UG1A 4GMYA 2KKOA 2X2LA 4QYGA 2P5KA 3TO9A 1GAGA 2JDVA 3FZSA 5HU3A 3R1NA 4FL2A 2XEYA 4I98B 3HVCA 3WTXC 3VS1A 3R63A 4KA3A 1IF1A 1ZZLA 4FBXA 2F7ZE 3EQPA 4C2WA 4IAKA 1PMUA 2PWLA 4UMPA 3F6OA 3I4PA 4F7NA 3Q60A 2E9NA 5HE2A 3VHKA 1FPUA 1XR1A 2R7DA 4MTAA 2LKPA 4IW0A 3O71A 1M2QA 3VS5A 4EMSA 3ENMA 4JX3A 2UW9A 4CT2A 4W9WA 2EXEA 1QPMA 1O7FA 1R5HA 1UCRA 3TNPC 4HYEA 4TYIA 1U5TA 2HY81 1RUOA 3V5TA 3OWJA 3HUBA 3F6VA 3BP8A 1WKMA 4HVDA 3F8MA 4YURA 1H1QA 1C0WA 4L5JA 5LRSA 4ZMFA 4X3FB 5ICGA 5FM3A 5AJQA 2C6EA 2WMUA 2UZDA 2ITTA 3DBQA 3HSFA 2GNIA 4DLIA 4X2FA 2OXDA 5AP2A 2NAZA 3HSRA 4UWBA 4PP7A 3SXYA 5TE0A 2C0IA 5DV5A 2VTTA 3R7OA 2XJ0A 5IQDA 2VTLA 2ETKA 4M9ZA 2V1UA 4EH8A 3A99A 4RQKA 4TZRA 3LFBA 5J9YA 1RE8A 2OK1A 1KUTA 4A07A 4WG5A 4Z7GA 3E6BA 1XH6A 5AV3A 1IAHA 1KE9A 2XNMA 1ZMVA 4NIFB 2PULA 2EK5A 4MXCA 1Q8YA 4KIOA 1DI9A 1OPCA 3II5A 3ZM9A 3O17A 3ZMDA 3AG9A 5M57A 2OW3A 3KRJA 5B2MA 2QOLA 1YI4A 4XBRA 5BPIA 4HX8A 2P33A 5CT0A 5CAVA 4AXAA 1LJ9A 3ZS5A 3D5UA 4O7WA 4XHKB 1OYYA 2WMTA 1ERKA 2EUFB 4CICA 3QRIA 1CTPE 4L01A 1SNXA 2F49A 4XS2A 3JR1A 1ZG1A 5T6KA 2BR1A 5DR6A 1PMEA 1V0OA 2ZFWA 3WE4A 2YISA 4QTDA 5CAOA 1BMKA 2FU4A 2VX0A 4FG8A 2RN7A 3V8KA 4F9AA 3N97A 5IT9K 4XSXF 4YFKF 4WIHA 2WQEA 4RGSA 4YBJA 3PSDA 2ZAZA 4FIEA 3L9PA 3AMYA 1P14A 4M9SA 4BBMA 5HDGA 1ODDA 5CSVA 3VO3A 4A6DA 1YXTA 3VBTA 4WF2A 3NEWA 5FDXA 4JQ7A 1P4XA 4J71A 3PE1A 5JZNA 3VS7A 5JGAA 1IN7A 4J99A 4XG6A 5E8YA 3R8UA 2QVSE 4ZSEA 3F8BA 1W7PA 4AIHA 3V5PA 2PJPA 4Q2AA 5L4QA 2I0HA 2C1BA 2FF4A 4NM0A 5IG1A 4L18B 4YFNF 1ZY5A 4HCTA 2R9SA 1G3WA 3ZDUA 3ZMTA 4P5ZA 4CRSA 4M68A 2BGCA 2UVXA 3D7ZA 3ZBXA 5LVNA 2UZUE 2Z5UA 3LLAA 1ZXEA 2VE8A 2A2AA 3WOWA 3DXQA 2H09A 1MQBA 5LVPA 3KK8A 3COHA 5GHVA 3ZEPA 3R8VA 2YCSA 4YMJA 3PPKA 4KIBA 3Q9SA 4EH5A 4YG2F 3VFZA 3F8FA 5HO8A 4KBAA 2XIXA 4U0VA 5BMMA 5HLNA 4O0VA 3ID6C 3C1DA 1K3AA 2B9HA 2JTVA 3AD6A 3IW8A 4L3JA 3MQ0A 3IW7A 2QHNA 3I7CA 2QOQA 3LCOA 5K5XA 3VS3A 4L44A 2XNEA 1FVTA 3EFLA 5JFXA 4PY1A 4E6AA 3EKNA 4IZAA 3RM6A 3TXOA 1IR3A 5LGTA 3SC1A 5E8GA 3G15A 2YDKA 3CEKA 4Y85A 2VTHA 2JPBA 3LWFA 4OINF 2CFXA 2QHMA 3CR0A 2JFMA 3QPTA 4FR4A 4KICA 2QOHA 3V8LA 3EHAA 3LJ0A 3VUTA 4XP2A 4A9SA 4HCVA 2VWYA 2HZIA 2O2UA 4F1MA 5IISA 2QZ8A 2W25A 4GGGA 4AT4A 1SVHA 4NW5A 4XG4A 2C6DA 4TYEA 5HE1A 4S31A 4QNYA 3TO6A 1PXPA 4CFVA 3UOHA 4TYGA 2WXVA 3I81A 2C30A 1YQAA 2RGVA 3HV3A 1Q62A 4I7HA 4HNFA 3TUBA 4LFIA 3CO6C 5FB2A 5AAGA 2HDCA 2XKCA 4NB5A 5FDPA 1S9IA 1ZOGA 2STWA 2IW6A 3ZH8A 2Z7QA 3WTSC 3QTQA 4RIYA 3OXZA 4I21A 4KDPA 1IN6A 3QL8A 4TW9A 4CFXA 3FI2A 3ZSHA 5ANIA 5JN2A 4O7SA 2J0MB 1ZLJA 2QCSA 4FSRA 2Z02A 4I5MA 5LCKA 4I09A 2F5DA 5CJ9A 3QCXA 3DAJA 3DCVA 3FWQA 1FVVA 2EV5A 3ZTXA 5DT3A 3F8NA 4NM7A 4EM0B 4M13A 3J80Z 2ZV7A 1S29A 3CKXA 3WF6A 3KVXA 2DQ7X 4MGRA 3EDPA 3KREA 4MNUA 4FKLA 3R9HA 2CLXA 1S8NA 5IF1A 3ORXA 1PXLA 3REOA 4ANBA 4IVNA 5DN3A 3SW4A 1YDRE 2XNBA 1TW2A 3Q5ZA 5ANDA 5F1ZA 5HDNA 3QC9A 3ECOA 5CSWA 3PDTA 5B0XA 4PPBA 3MA6A 3QD4A 2J5EA 2P2HA 2UW7A 2K4JA 4ZJVA 4YTIA 1W98A 1VYZA 1PXOA 4MX9A 4E8AA 3I0QA 4RIWA 2VN9A 5AAFA 2ETMA 3AC5A 1R58A 4FZ6A 3THBA 2VWZA 3GFMA 3KCFA 2R3FA 3MAJA 3G9NA 3H9FA 3FMHA 1ZYCA 3LIJA 4C3PA 3LSTA 3E7OA 2IT0A 4QMMA 4LM5A 4BCQA 2E9VA 3DKFA 4A12A 3ZSGA 1NY3A 4XG3A 2YR2A 2PSQA 2ERZE 3M7GA 4GCVA 3F22A 1KE8A 5DE2A 3MGYA 3G73A 3RAHA 4EH9A 2Z33A 5E8ZA 4E4LA 4LOPA 4L8MA 4ERKA 1GXQA 3DPLC 3DK6A 3OOMA 1O3SA 2XIRA 5CVJA 2E1NA 5E8IA 1ATPE 4UMTA 5M4UA 2JBPA 5E90A 3FMNA 4CYJA 3DKWA 4ZS4A 3R04A 2YM4A 4UB7A 4ASNA 2ZV8A 1ON2A 1L0OC 3K3IA 2ZNYA 3QWJA 2HZ4A 3B8QA 4RGRA 2WIHA 2J90A 2BFXA 3VS2A 2QLZA 2X81A 4DG0E 3ZMVA 1QO0D 5DOSA 3ALOA 4MF1A 1FWZA 1B9NA 2CKEA 3DPKA 1VEBA 3NX8A 4FSQA 1Q8ZA 2WTKC 1IXSB 5FEEA 4JG6A 2J4ZA 2ERKA 2IA1A 4MEXF 2CDZA 3UYSA 3OW4A 4O1OA 3PG1A 4FG9A 3NYOA 3LXKA 1ZYLA 5HTCA 4YIFA 4QTEA 1WFCA 3DBDA 3OY1A 3MIYA 4GFGA 4DEAA 5BVOA 2JDTA 2YA9A 3F3ZA 2YITA 4IBMA 4QOXA 4BI0A 1OIQA 2O65A 2PZIA 2NNWB 2B9JA 2OQGA 2W05A 2VT2A 3BX5A 3ANRA 3F72A 5J5TA 1HSJA 3S3IA 5EOLA 4A6EA 3ENHA 3O3KA 5AP1A 3C4XA 3RKWA 3CPBA 2GIVA 3P0MA 1BI3A 4XYFA 4OTRA 4B4LA 4Y8DA 2EB3A 3ABTA 4JOAA 3TV6A 3UBDA 4JQFA 4FV3A 4HLYA 3TT0A 2OJJA 3IO7A 1TKIA 1BI1A 3UIXA 3GLXA 4TWNA 4RZWA 2XNNA 3CS9A 4CKIA 4PDPA 2HS5A 3M42A 1UB9A 3WU1B 1WRJA 4M72A 3WBLA 5ITAA 2YPRA 1YW8A 3PXFA 3TZ9A 2VTQA 3VN9A 4DFZE 4GG7A 2C6YA 4DGMA 4RJ4A 1UU3A 4U3YA 4WSQA 3FLYA 4BB4A 2CHLA 2FH9A 3BLHA 3KRWA 5AV2A 2KJCA 3OBGA 3GVUA 3KCKA 5HS9A 3ZC6A 3GW2A 1SFXA 2OZ6A 3GVAA 5DYMA 2YFXA 3K5UA 3NNVA 3GC9A 1PY5A 1A06A 4WHZA 2X1NA 2UW5A 3FJQE 5FTOA 3LKMA 4PDYA 2Y0AA 3QKMA 4P5QA 1LNWA 3TTJA 2VD5A 1FX7A 3ZRKA 3ZRMA 4C4EA 5CI6A 4UVCA 2HTJA 5HHWA 5M56A 3DKCA 3OHTA 3DV8A 3C4CA 4D2PA 3HKOA 3W2CA 1P4WA 1AGWA 1R0PA 3B8RA 1RQQA 3W8QA 4D4YA 1CKPA 2OXYA 3BJAA 4IHPA 4QTCA 4CTBA 2W1FA 1W7HA 5GJFA 1XGOA 3EN4A 1LR4A 4ZK5A 3K5VA 5ILVA 2XKPA 4HX4A 4IHSA 2VRXA 3MVLA 4AA5A 4PGGA 2RKUA 3D9VA 4M97A 3PJ3A 4AW0A 2G2FA 4X6QC 2I0VA 4USEA 3NUXA 2CNUA 1UKIA 4C4IA 4LL0A 4FVRA 2L4MA 3WIGA 5HE0A 2J0JA 3CJGA 4I02A 4AW1A 4TYHB 2WHBA 2W5BA 4FMQA 3TIYA 4RB3C 3QQHA 4EZ7A 5JSMA 2H34A 5HORA 2ZV9A 3O8UA 2EFNA 1J7IA 4E1ZA 2DPDA 1HBXG 4FGRA 1W7PD 2ZM3A 1Q8WA 5IQCA 3BRBA 4BCJA 4UV0A 1OPLA 2PG4A 5JHUA 2WMXA 5FLFA 4IWPA 5EW8A 2JEDA 4OIRF 2KIUA 3BLQA 5IQIA 4CFWA 3L00A 5DUIA 4QQJA 3ZO2A 4BH9A 3LFQA 4F99A 3ZEWA 4U7ZA 4AWXB 1JSVA 2IPXA 2H94A 3I71A 3I0TA 3DB8A 4ENJA 1M2RA 3JAMK 2QODA 3FHZA 3FMQA 4BIEA 5D6FA 1K79A 4ZEGA 1HW2A 3IKAA 4HVHA 4NKAA 3PA4A 4B6LA 3WU0A 2MH2A 4I4EA 2Z3YA 4II5A 2ZJWA 4U7BA 1WBPA 3NVMB 4L9NA 1IASA 5JKGA 3N9XA 4O5VA 4YJSA 4IC7A 3F5XA 1P92A 4EORA 2YJSA 4NT4A 3VUKA 4HZFA 2XF0A 4IAFA 2J0IA 3QRFF 4EWHA 4RPVA 3E8DA 3HLLA 2YCRA 1KE7A 4G9CA 1GOLA 1K9AA 4GEOA 5D5XB 3BGZA 5IDPA 3VBYA 1IA9A 2GS7A 4X2NA 3TNQB 4FV2A 1MRYA 5CF8A 4JG8A 4RLKA 4QMTA 1FGKA 1H4LA 3I1AA 3KETA 4FTNA 4I0RA 2XM9A 3F3WA 4E6DA 4U97A 3EQHA 4Y15A 5BOXA 5AR3A 1OL7A 5LGUA 5M44A 1PXKA 2ZB0A 4O6LA 4QMOA 1PUEE 2J5OA 3PQKA 2DBBA 2VWWA 2AC5A 3RM7A 1SZMA 3I53A 3R2BA 2FBKA 2TDXA 2JAVA 3LQ8A 4FC0A 3R7IA 5K4JA 3C13A 2BZIB 3HTSB 4UXLA 4GCJA 4USFA 5HCYA 1KOBA 3T3UA 4G6NA 4NFMA 3OWLA 4KNBA 2YU3A 5C4KA 3UDBA 2YCFA 3ITZA 3MPAA 3QTSA 1XH8A 4FTQA 2VTPA 4OGRA 3GWZA 3MWUA 4IAYA 2IW5A 5K1YA 3PIZA 3KXHA 2XROA 4YZMA 1YS6A 2WOTA 1PF8A 4BICA 4PGHA 5EI6A 4XLPF 3OTUA 5EDPA 2A4LA 1BBYA 2EXCX 2F4JA 2CO5A 5BVNA 4S04A 3WE2A 4I20A 4EOPA 4IE9A 3WF5A 3TIZA 4DH7A 1RNLA 3HA8A 3LW0A 3P23A 4LL5A 2X6EA 2QG7A 1KOAA 4BHZA 3COMA 1H1WA 3LHJA 4YPDA 3AD4A 3NAYA 2YABA 3BU6A 3GCUA 2REIA 3RKYA 1H1SA 1USTA 3H3ZA 3E5XA 2XYNA 4DFNA 4XV1A 4P55A 5AUWA 3R30A 1KV1A 1WBSA 2DQLA 3JSOA 3CUQC 3ULQB 5TJJA 3A8XA 3UC4A 4MQVA 3P5KA 4UUVA 3ZUVA 5LVLA 3SX9A 1U54B 2ZMCA 3F2AA 2C69A 4XV3A 1PXNA 4FYNA 3LA7A 4XBFA 5DT4A 4ZTQA 4DBNA 3RWPA 3ODZX 2EFWA 2D1VA 3PPJA 1XCBA 2KULA 1ZRZA 4FVPA 1UFMA 4YTFA 3PY3A 4AZVA 3KK9A 3MVJA 4TYJA 4IX4A 3DJ5A 5HOOA 2R3SA 5KMLA 3AMAA 2NRAC 4G2FA 4NEUA 4DCAA 5LEKA 5E8SA 3NNXA 2FRHA 3ZO4A 2QUFA 1FMOE 3JTHA 2Y4IC 4GUBA 3EQBA 4G3FA 4EK4A 2QQAA 5KMMA 3PWDA 5KBQA 2IW8A 3KC3A 4HYHA 2WNTA 3BQCA 1U5TC 1PXMA 4G3DA 4D0WA 1LVAA 4E3CA 1IUYA 2F9GA 4RX5A 3DBEA 4EYMA 4QYFA 4EJ7A 5CEMA 4DYMA 3K69A 2DU9A 1OR7A 5CZHA 3LFNA 4BDEA 3MDYA 5CSPA 4ZXTA 2BALA 3FZ1A 3KL8A 3E7VA 3FLNC 3L9NA 1A04A 5EG3A 3IHUA 3GU6A 4YLKA 5A3XA 5HTIA 4FV7A 5IZFA 2RKHA 2GQGA 1FY7A 1J5YA 2UZNA 1UA2A 5H2UA 3HRCA 4GK2A 4V04A 2VX3A 5EQPA 4UALA 3LFCA 4F1OA 2WD1A 2ONLA 5I3RA 2X7FA 2XV4S 4ZJIA 5A4CA 4FNZA 2ACXA 3D5LA 4KIKA 4RX7A 4IADA 2E2BA 2XRNA 4IWQA 4FKRA 3U55A 3DOGA 3ULZA 3I0OA 1XSXA 3E5UA 4ZS0A 5J8CA 2R7BA 2IZSA 4R7HA 1FYLA 2B7AA 3KZZA 3CLYA 3LXNA 2HKXA 3HTUA 4FIJA 2O03A 1H25A 3SXFA 1XBBA 3QX2A 2EA4A 5E18F 4ACDA 5AR5A 4D28A 5H8BA 1FBSA 3SHEA 3D5XA 1CF7B 2BRNA 1Y57A 3E8CA 1B6AA 2I0EA 4IPAA 4LUDA 1SNUA 4A9UA 5CVVA 4FK6A 2FMYA 3FUPA 4ZY6A 5IUIA 3EQCA 2W5AA 3GX4X 3KEXA 3POOA 4HF2A 2XHKA 2RQPA 1ZRFA 1PMNA 1V0BA 3ZC5A 1GZ8A 5CQUA 3FHIA 5J6XA 5ICPA 2R3RA 3ZM4A 2X0GA 4IDTA 4RFMA 4JDJA 2EXMA 5AFVA 2W17A 2STTA 2OF4A 4I3ZA 1NW1A 5T68A 3U9NA 1O3QA 2ZJ2A 4H05A 5LARA 2HENA 3HOTA 4LFUA 4P90A 1O3RA 4FF8A 3HRUA 3UMWA 1U8RA 4ZYEA 3GOKA 4FSTA 4NTTA 1E2XA 3DFGA 4B9DA 1STZA 3I4BA 2EV0A 5C8MA 3GF2A 3ELJA 3UZPA 2YAKA 4EBVA 4ACMA 3DXJF 3LLTA 3ZFMA 1KYWA 1K6OA 3SQQA 3RBWA 1REJA 2O6GE 4TRLA 4FIHA 3EQRA 5BMZA 1JSTA 3PJ8A 4NJ3A 3DTWA 3K1MA 2JDSA 3QCQA 4EVIA 5IEXA 1FSHA 3OCTA 1LEWA 3WF8A 2WMSA 1XN7A 5J5SA 2B54A 2CGPA 4OTPA 2JDRA 5GIPE 4AOIA 1OMWA 4LV5A 3F6XA 4TL0A 4GO1A 3WF7A 2ZO4A 4O6EA 2GNHA 4EOLA 2VTMA 2EVAA 4QMQA 3FPMA 2HK5A 4ZTHA 2GTMA 4L7SA 1W4MA 4BXUA 2YM8A 5CSXA 4K77A 3PVUA 3ORTA 3M2WA 1YW2A 4WNOA 3IL2A 4IANA 3ODYX 3G6GA 1JBPE 2BE5F 1MKMA 2HELA 4MF0A 4MQ2A 1TNSA 2Y7JA 3F66A 5AR2A 3TZ7A 5DR9A 2MLKA 1H24A 4FSNA 3V8TA 3DGKA 2BDJA 2SRCA 3ATTA 4J95A 3F69A 5LWNA 4ZLYA 4B99A 3AC3A 5G1XA 2CMWA 4FKQA 4AU8A 1J7KA 2VBWA 4J97A 2BKKA 4LK1F 1OVEA 5BQTA 3ZHPC 2J0KA 5EM5A 2VX1A 2YZAA 4O0SA 1QPEA 2VO3A 4AQCA 3GQLA 4O83A 4WKQA 5JRSA 1J3HA 4I0BA 3IDPA 4EZ5A 1FPQA 1Q99A 4BVUA 2O61A 3ROUA 4JR7A 5FEDA 3QD2B 1REKA 3GCSA 3HAVA 5ETAA 3H9OA 4BIBA 4JDHA 2BAQA 3DDPA 5B2KA 2UW3A 2VTSA 3WZKA 4BDCA 4E5AX 5CASA 3UC3A 5KZ0A 5KX8A 3CTAA 4YPSA 4DH1A 4HQEA 4IWDA 3S00A 5D10A 3RAKA 4M69B 2J2IB 1HKTA 4YZDA 2XNOA 3RNYA 5HBEA 2FO0A 2YLEA 3UIBA 4YJOA 4EH7A 3TNWA 3LQ5A 1YWNA 2W4JA 5BYZA 3T3VA 3W8LA 5DCFA 1H07A 3FQSA 4X2KA 1ZREA 4IX3A 3HZTA 3ZCLA 2PHKA 3LAUA 5KE0A 4R5SA 1MD0A 2YWPA 4MK0A 4BHBA 1XGSA 1Q24A 4O7VA 3FMDA 5JVTA 4Q5HA 3HOSA 1BYGA 3EYHA 3JAMZ 4RLLA 4IXPA 4TWPA 4MYGA 2W99B 2XCKA 1U59A 2BMCA 1UNGA 1K2PA 3O6BB 2PMNX 1F3MC 4LGGA 3AGLA 5H8EA 1VZOA 3OWKA 2VU3A 2DO7A 4PPAA 1DDNA 3FHRA 4G5PA 3QQGA 4JRVA 2I40A 2A19B 2XGXA 4RMZA 4ZP5A 4FX0A 1VTNC 1MJBA 4HLXA 2P6SA 5AP0A 4QMYA 3NUSA 3JPVA 1UVRA 2NRYA 4CCBA 1G6NA 1V1KA 4DG3E 5H6RA 4LK0F 3BYMA 4MHGA 3IKTA 1QMZA 1XBAA 1OBDA 3HP2A 1B39A 5AWMA 3VS4A 3NS9A 3I60A 3P9CA 3ZYAA 5HVKA 4FODA 4IJ9A 4HV5A 1FC3A 4CLIA 4EQQA 2NS0A 2FE3A 4BFMA 4FYOA 4WCGA 4C8BA 4KT5C 5CEQA 3V7SA 5A2QK 3LCTA 3NDMA 4BZOA 2QOBA 3SVVA 3C3WA 3QRUA 1V0PA 1ONVA 4DT8A 3LXPA 3IQ7A 2CW0F 1XB4A 3GI3A 1APME 2GNGA 3PRIA 4HQMA 3R9RA 3EUHA 3ZUUA 4CYIA 4JG7A 4HW0A 2PI0A 4QPAA 2Q2EA 3A7JA 3MB6A 1HCKA 4RFYA 2X8EA 5FBOA 3GFIA 4IX5A 2Q0BA 3BE9A 3Q04A 4N6YA 1QL6A 1HOWA 3K1NA 1JE8A 3QKLA 3GENA 4OTHA 5AP4A 4A9YA 3JS2A 2PQ8A 1L3RE 3GGFA 1U5RA 1M17A 4ON0A 3CLOA 1JXSA 4N70A 2WGJA 4WT6A 3A7IA 2IA0A 3V6RA 3FPQA 3VWAA 2FBIA 4C02A 3E8NA 4FNWA 5EYDA 2UW4A 3RIRA 3HP5A 2MC3A 2IA2A 1REPC 3KEQA 3DQWA 1OL5A 2B52A 2ELHA 3IOKA 2PVRA 3KZYA 2OGVA 3HV5A 3A2CA 5CU6A 3JUHA 3M8FA 3BV2A 2WAJA 3MFTA 2CCHA 4I0AA 2PEXA 5CX9A 4C58A 3T9TA 4WSYA 5JZJA 3MZYA 2ITWA 4L0ZB 4L42A 1SVEA 2WELA 2OIDA 4EM1A 3WTUC 1I6XA 4MBIA 3VJOA 4I23A 4L67A 2HZ0A 5L2QA 4DEIA 2HWOA 4K9YA 2JKOA 1ZZ2A 1TQMA 4LD5A 3NWWA 3QFVA 3FXZA 3F5PA 1I5ZA 4XLVA 3BZ6A 2ZOQA 3NLBA 4R78A 3T5XA 3N4VA 1NVRA 3HV7A 4FIGA 4M9XA 4EK3A 3HEGA 2V7AA 2PMLX 4MWIA 4EHZA 4PV0A 5LEJA 3VNTA 2A27A 2OFVA 4IAAA 5AUXA 2Y6MA 3ZLYA 4AN9A 2O0YA 1O7LA 3VUGA 4YJQA 2CGWA 5C1QB 3UYTA 4JJRA 1ZN2A 1SVGA 1J7UA 4AACA 1NT2A 5ICFA 1WI9A 5HO7A 3ZU7A 1YO5C 4OAUC 3QPHA 4QMUA 1MQ4A 4R3RA 3E3BX 3W16A 3FV8A 4OMYA 4JVGA 2W1EA 3DFAA 4IJAA 3F8CA 4FT0A 4DFLA 5KKRC 3UZRA 3NUNA 2A6EF 2X9EA 4AOTA 3R6SA 4YJRA 4C3FA 5CNOA 3TJCA 5AP7A 2W96B 5HCXA 2VZ6A 3DKOA 2D1HA 4Y83A 2QOFA 1FOKA 4W4VA 2O63A 4FKGA 3Q9WA 5HLHA 1TNTA 5EDRA 4RIXB 4LI5A 3R7VA 3ZQ7A 3CQUA 5IUHA 5AIKA 5JFWA 4W4WA 3UQGA 4K1BA 3U6IA 2PUUA 4ZZMA 4O0YA 3PZEA 3OOPA 3LM5A 4MH7A 2ITVA 2P0CA 2C47A 2Q0OA 5FXSA 3T9IA 4H0EA 1FMKA 4HZSA 3H4JA 4KWPA 1EH4A 4HGTA 3OD6X 2NNYA 2RF9A 1W5SA 4PNKA 4WWCA 4MEYF 4BHCA 1H08A 3UO4A 3A60A 4YP8A 2WTJA 4F65A 5C03A 2HY0A 3Q4TA 2CN8A 4CSVA 2RGPA 3V7CA 4ZAUA 5J1VA 4BTMA 2O8XA 4ENKA 4WK8F 4R6VA 2OLCA 4J8MA 3DBFA 2XKOA 4CMUA 1IN8A 1Y8YA 3BEGA 3A4PA 4BBFA 2GHGA 2X4FA 1WZYA 2GA1A 4QMLA 5LHHA 5KVRA 3H3CA 4F09A 4BDBA 4KAOA 4BHPA 5A4TA 3DF8A 2OAZA 3S2WA 3FI8A 2W1ZA 5ANJA 2WTIA 5EH0A 2LF8A 4G34A 5DUKA 2VWUA 2OH4A 1OKWA 1ZGJA 1H01A 3WTTC 5J9LA 4P4CA 1YS7A 5L3CA 2VTAA 4IAZA 3ZDIA 1OPKA 4J98A 2R5TA 3D7TB 4V0GB 4PCQA 4RJ3A 1U2WA 5E8TA 3RINA 3DFCB 1OKRA 4TV7A 1BC7C 3FZRA 4R79A 4FGBA 2X8IA 4LGDA 1BC8C 5FXQA 1OM1A 4H3BA 4BHNA 1YDSE 3E3PA 2WPAA 1UHWA 3BWJA 5KBRA 2ISZA 2H8HA 4XG9A 3P86A 3BU3A 4OW8A 2QLQA 1MDMB 3IRRA 4KIQA 3BEAA 4R7IA 4DTAA 3MH0A 2HOEA 3HIFA 5FGMA 3UOKA 4AZSA 4LG4A 3BKBA 1Q41A 3ROYA 1UWHA 2Z8CA 4V05A 3FWEA 5LJJA 4XEYA 2R3OA 3RCDA 3U2RA 1BIBA 1LP4A 4FV0A 2XIZA 2G01A 4NCTA 4DA5A 4CZYB 3S1HA 5TKDA 3HMNA 4OTDA 5EW3A 4EC8A 5TOZA 1XH7A 3WZJA 3RAWA 2HYYA 5I4NA 3RPOA 4HYUA 1PJKA 4JQ8A 2LDUA 4M7IA 1M14A 2VXZA 1IA8A 2MA3A 4A4OA 2YDJA 5M53A 3JY0A 5CVRA 3TV4A 2Z2WA 4FA2A 4U0WA 3OT3A 5F6FA 3RKXA 1WBNA 4PL3A 2FNPA 3HAMA 2UZLA 4CEGA 5DCMA 3K2ZA 2WTWA 4RVLA 4D1ZA 4V01A 3UQFA 4FEQA 4Y5HA 3PUPA 2WTKB 5ETCA 2CGUA 5BPDA 3CXWA 5C8KA 3TJDA 2BV6A 2UZEA 4I1ZA 3PQJA 3KXMA 2HKOA 3C4EA 2UXNA 4O82A 3J7AO 4QO9A 2F57A 1CF7A 4AIJA 3BHHA 1B1BA 2PUNA 4OLIA 3KE2A 4AGWA 4LYNA 2YIYA 3CD3A 4RIOA 2J5FA 5J8IA 1Y0UA 4DC2A 3Q53A 2YEXA 4QT1A 4C38A 3L8VA 2WO6A 4EH2A 3EQIA 5DFPA 3N4TA 3HL7A 4DCEA 2ITPA 3ORKA 4BRXA 3HMPA 3GT8A 5DD4A 2ISYA 4HA8A 2J0LA 1JHHA 1XMKA 4GKHA 5I9XA 3D4QA 3G2FA 4H39A 1W0XC 2EFPA 2XMYA 2VWXA 3FMLA 3WTWC 4ZH4F 3UJGA 2WMQA 2OQRA 2B1PA 3FY2A 3WARA 2VN2A 4ZLOA 3CQEA 4FT7A 3VB2A 4NHJA 3NSZA 2ZNZA 4UWYA 1PXJA 4N57A 2BTSA 3UNZA 3UNJA 2KRFA 4AFEA 2OA4A 4NH1A 4FSZA 1I1GA 1J91A 3B73A 5JT2A 3W6KB 3RTRA 3ROCA 5I9UA 1H28A 4G7ZF 3IC7A 1YTYA 3GZ5A 4M84A 4UX9A 2IVUA 3L8PA 4JDIA 2IVMA 4O96A 1ND4A 3OEZA 2H6DA 4WRSA 5C4LA 2QG5A 3WYXA 4EK8A 4HW7A 4FV6A 3QKKA 2XAGA 5C26A 1ZRDA 3OWPA 5HS8A 5CY3A 2BDWA 2G15A 4LLGF 2JZYA 4I22A 1IW7F 3UPZA 2O3FA 2M5WA 1FGIA 4BAYA 4FX4A 1Y6BA 4YBKA 4HF1A 3ORPA 5F1RA 2OZAB 3C50A 3ALNA 3REPA 3FXWA 2PZRA 3PXKA 3CQWA 3W6JB 2FA5A 3MH2A 4CMTA 1T46A 2ZMEA 1MRUA 5LMKC 3R7YA 4D2TA 2P6TA 2WV0A 3R73A 4FNXA 5IQEA 3WGIA 1XDSA 4XP0A 3DQVC 4FKVA 4FT8A 3BYUA 1NA7A 3L9LA 2HAKA 4FTJA 4FOCA 2IVSA 3OW3A 4BCPA 4KN7X 3TKHA 1R23A 1WVYA 4QP1A 4BTJA 4RVMA 2L4AA 1SD5A 2C3IB 3DJ6A 4NU1A 4P7EA 3TDZC 3E5AA 5FO5A 2IN6A 3WZUA 5IDNA 4H36A 4Y72A 4I0TA 5A2QZ 5AP3A 2C6IA 3RMFA 3BYSA 2EV6A 4BWKA 5HNBA 2DLLA 5J95A 2OBJA 4FIFA 4N0BA 3D5WA 3P9JA 4CDGA 3MY0A 5E17F 2UW6A 4AGCA 4WBBB 1SAXA 2ZYBA 5FTGA 3NW5A 5GIOE 1O6YA 1S3JA 1J0RA 1BI2A 3WG9A 1KQ9A 4GV1A 3WI6A 3MVHA 4QYHA 3F5UA 1PP8F 2RC4A 2VBXA 3TM0A 3IS5A 3JYAA 3MS9A 2RVCA 4RWKA 5CLSA 1JOWB 5CF4A 4GK4A 3FZTA 3MZHA 4I92A 2PZ5A 3UO5A 4PMTA 4D5HA 3CPCA 5HNGA 5AR4A 3U4UA 4KKEA 4Q5SF 3QZGA 2OJFE 4EBWA 3MEXA 4JDKA 4EH6A 4P9UA 5ANEA 5C01A 4D2VA 2ZMDA 4NQWA 4A0YA 1QZYA 4I41A 3F88A 4N9IA 4LG0A 3KMMA 3TKYA 1XHAA 3R2YA 2KJBA 4PZJA 3PA5A 3BJ6A 2XP2A 2B53A 2W57A 3NUUA 4MNFA 4G8XA 3C1XA 4OTFA 4RC2A 2J50A 2VO0A 5HBHA 3EETA 4AE6A 1Z9XA 5CXZA 2UWMA 3T0YA 4DQ2A 1YOJA 1WBWA 5DNRA 3KCCA 4FEXA 2CKOA 1R0EA 2X39A 2W9FB 5KMIA 4I93A 3I79A 5KMOA 4D4VA 1JLUE 3CO7C 4QP7A 4DLJA 2FNAA 3RJCA 2XKEA 3TUCA 2K7LA 4D5KA 3V04A 3MA3A 3QTXA 4MVFA 3D5VA 2QVOA 4FOBA 2IZRA 2G9XA 3EQGA 4E93A 3VUHA 3M9AA 5K5RA 4RT7A 4U43A 5AM7A 4EUTA 4GS6A 4JAIA 5M55A 3JXWA 4XH6A 1Z6RA 4MD9E 3SLSA 1BOAA 4Z3VA 2WTDA 3ZBFA 4FUXA 1IXRC 5IUGA 1YYVA 2WMWA 2K02A 1NVQA 4AFJA 1PKDA 4Z7HA 3E6CC 2OI4X 2OWBA 3FY0A 2QO9A 1D3YA 3ZO3A 4AN3A 5AADA 4AA4A 2RSVA 5DH3A 1J7LA 2Y0MA 1FINA 2O0UA 4MNEB 4L9VA 2VO6A 3F2NA 3W2RA 3GXOA 4S05A 4BI2A 3VRZA 4D4RA 3G90X 4CO8A 4UXQA 4QTAA 3R7UA 4FV5A 5EM6A 4UN0C 2OU2A 4XJ0A 2FMLA 3GCVA 2IG7A 4C36A 5DRDA 1K78B 2JDOA 4GYGA 1NHAA 3OS3A 4ZSLA 4TWOA 5FLXK 1JPAA 2XEZA 3EFJA 1FBNA 3HA6A 3EQFA 5BUEA 3CUQB 3J81Z 3LQ3A 3RPSA 2JT1A 3D15A 4YGAA 2LSOA 5AUYA 3DJ7A 5DWRA 4OAVB 2A3SA 4LB5A 4B7TA 2QYOA 4FTUA 2OFUA 4DE4A 3QRTA 1KWPA 3FEGA 3GUDA 3VJNA 3ORNA 2G7UA 4MXYA 2EB7A 3D2KA 3TDVA 1AD5A 2WMVA 4BKYA 2YZLA 4A4XA 4FV1A 3R8ZA 2XK7A 1Q3WA 1BI7A 3U87A 4AVPA 4XBUA 2AXLA 4K2EA 2JLDA 4GFMA 1ZOHA 4JI9A 5M07A 4Y13A 2OZUA 2XIYA 3CY2A 4G3EA 3QYWA 2B0LA 4XOYA 4U81A 2Y75A 2BHEA 2RFDA 4BN1A 3PWYA 3DEUA 4R3PA 2VNWA 2W0JA 2D2WA 4PL5A 4FNYA 3WGHA 3PYYA 4G7OF 2M45A 2GNLA 4UXNA 1E9HA 2PVMA 3RYPA 2Y4IB 3D94A 1O57A 2WEVA 3QF9A 5L3BA 2BROA 3VOEA 4AT3A 4F0FA 2J7TA 5IA0A 1XDUA 2DT5A 1L3LA 3H9RA 3RK7A 4WX9A 5TO8A 1U78A 1IAWA 1U5TB 3GC0A 1Z91A 4KSPA 1S9JA 3KVWA 2WFYA 4HGEA 2PBIA 4U6RA 2WQBA 5LBQA 3D0EA 2CCIA 2ZDUA 4HNIA 3HV4A 4PMPA 1XGNA 4MBLA 4RJ8A 4ANOA 1B4AA 3ACJA 2WMRA 2PUPA 5AM6A 4ZY5A 4OTQA 3UVRA 4AW5A 3LQQA 4MTEA 4RIXA 2CWEA 3FSFA 3BWFA 4HVSA 4W4YA 5J7BA 1GHCA 5IH4A 4F9YA 5EHYA 4R8QA 3OCGA 3NCZA 3VC4A 4O7NA 3CIKA 1Y6AA 4Q9SA 5IH6A 5HD4A 2Z7SA 4IJPA 1H00A 1B6CB 4PL4A 4L46A 2AS5F 4KKGA 1XSDA 1P6RA 2XBAA 1Q97A 3QLGA 5EYKA 4KUMA 3BGQA 2OJGA 2BUJA 2YJRA 1LDKB 4KINA 1SD4A 2OG8A 4RRVA 2BIKB 1R3CA 2CPKE 2PZPA 3TO7A 5HG5A 4UHTA 4N9HA 3LMHA 3QHWA 4NK9A 4E5WA 1U6GA 2W85A 3TOBA 2IJMA 2H9VA 2C5XA 1PMVA 2PUIA 5DA3A 3BZ3A 2COMA 4DEGA 1JKLA 2W84A 1H1RA 1BM9A 3CTJA 5CU3A 1XQZA 2C0TA 4NM3A 4O27B 2WC2A 5CXHA 3MPTA 1FVRA 3LJ2A 1SFUA 3G33A 1DUXC 4FZFB 2DUVA 3U1DA 2IJLA 4YHTA 3SRVB 5L8KA 1XSVA 2VC0A 3V4GA 4JBPA 3MFKA 3A7FA 2ITXA 3ANQA 2WTVA 3O0GA 2X6DA 3ET7A 4YSJA 3O50A 4EKKA 3PLSA 4I4FA 3WODF 5LMBA 4O2PA 5H3QA 3RI1A 3D7TA 3QTIA 3LMGA 4BKJA 5EQYA 2L01A 2XVCA 2GCDA 1YKRA 1K7AA 1R1UA 1LUFA 4F9WA 3OV8A 4IRIA 2XNGA 1W7PB 3RHXA 1XMAA 5F95A 2OU7A 4BWPA 3NYXA 2CGXA 4EHGA 3F21A 2NNNA 5JQ8A 2QQ9A 1U5QA 1SM2A 4KBCA 1I27A 5F9EA 1F5QA 2YHVA 3GFJA 5IQGA 4WUAA 5BX0A 5GZ8A 1DS5A 2YSRA 4D9TA 3FM5A 2XK4A 3AT4A 4EJOA 2CSOA 4IZYA 4ASXA 2HCKA 3PY0A 3PSBA 4UZDA 1R39A 1UHMA 2QD9A 2QQ7A 4QPSA 3BELA 4ZIMA 4EEVA 3BHUA 4GW8A 3BGPA 2QWWA 3BOQA 4M71A 4GT4A 2Z7RA 2BVAA 1OYIA 5JGDA 2UZTA 3FSKA 1UNHA 4EONA 4GVAA 3IKVA 4NZWB 1UU7A 4PRJA 4H1MA 4RB2C 4PUZA 4M6YA 1AQ1A 1A9UA 3ZFXA 2E7XA 4UEUA 3G9LX 3GP0A 3ZLSA 1CM8A 3W2QA 3RPYA 4LMYA 1ZHFA 2PE1A 2XRUA 3QUDA 3KXZA 1SMTA 3PPZA 1P2AA 5A46A 1KE5A 4B0GA 5F94A 4ENMA 2UXXA 3PVGA 4BGQA 2M8EA 5HE3A 5FBNC 3BBTB 1IZ1A 3BI6A 4LRKA 2BBYA 1OPJA 1B38A 4KIFA 2W24A 4KFCA 2F7EE 4HVGA 5AEPA 3GZ6A 1R1TA 2P4IA 3FL5A 3V6SA 4FT3A 1Y8GA 4XLNF 1F4KA 2QOIA 2WMAA 3BQRA 4ZTSA 4L3PA 3FKNA 3FMSA 1XJDA 3DLSA 3COIA 4GT5A 3R6XA 2WTCA 5E1ZB 3HNGA 4WXHA 4O84A 3KXGA 3CGFA 2YX4A 1BLXA 4O22A 4X6RA 1QPCA 4FTLA 4U7DA 3ZP5A 4Y73A 4YTCA 1FBUA 1ZG5A 2EA2A 4KRDA 5L3FA 3I7BA 5CEIA 2OF2A 4KSQA 4CXFA 4WA9A 3ORZA 2IP2A 4PDSA 1ZLTA 3VODA 5BVKA 5EDQA 1Q61A 5FGKA 4HJOA 2E7WA 3DPTA 3TGNA 3HGKA 1SMHA 1XH9A 4QP8A 1G3NA 4LGHA 3FZVA 4S32A 4PPCA 3E92A 3SKCA 1FZPB 2QR7A 4YIIA 3OF0A 1M52A 2IW9A 3V3VA 4O7TA 2C3KA 1EH6A 1H0MA 4FTMA 3P7CA 3KB7A 2Y48A 4L0YB 4X0MA 3D14A 4D1XA 2JITA 3Q9YA 4IDVA 4BQAA 5IT3A 3DDQA 4IZ5A 5AAEA 4HDVA 2MLGA 3H3UA 3MW1A 2ZDTA 5IA2A 1VJYA 3Q3BA 4H1JA 4FVQA 1TVOA 4O7YA 3EYIA 1V4RA 2BILB 2WQNA 4JBAA 4O91A 2P55A 1CMKE 4L9JA 3ULIA 1MP8A 4WNPA 2OZAA 2ETRA 3IG7A 4HDUA 4F1TA 4FKJA 4ZZDA 4PF4A 5JFSA 1JGSA 3NZ0A 2E9PA 4JIAA 5D41A 3HYIA 3ZRLA 4B8XA 3L9MA 1XH4A 1TW3A 4WUNA 2FSWA 2W06A 1I44A 2O8YA 2Q8KA 5DRBA 2XB7A 2XM8A 5I3OA 5DHJA 1IN5A 5GJGA 3T8TA 4DEDA 4YLLA 5LXMA 1T0FA 4HPUE 4NCTC 4AGUA 4QQ5A 4IVCA 5DEWA 4GG5A 4YJUA 1BN5A 4A0ZA 3U9GA 1PYXA 4FUYA 2UW0A 2FUMA 4QP9A 3LE6A 3VF8A 3GFLA 1P5EA 2ESNA 3ZSIA 2GQRA 4C62A 5TR6A 4LUEA 4L5IA 3ZMSA 3B2TA 4H58A 2A0CX 4RVKA 3W2OA 4C2VA 1YW7A 3VULA 4J7BA 3ELKA 4U0YA 4P9FA 4MEDA 5L2TA 4AP7A 2JIIA 3BHVA 3RTPA 4IFGA 3HSEA 3R9OA 5HLWA 5HIBA 3R00A 5CWZA 2CGVA 4F0GA 3G51A 3FLQA 2QQBA 1XCVA 2KIMA 3IPHA 1HKQA 3Q5IA 3R0JA 3TZ8A 3R1QA 4F7LA 4YZNA 5FTQA 1BUHA 1PHKA 3GC8A 1H0WA 1OL1A 1YHSA 5D7VA 4MXZA 3EQLF 4Q4ZF 3LAPA 1R78A 3MFUA 5JQ5A 4AE9A 4FKWA 2FSLX 5L6PA 3DLZA 3F7ZA 3V5JA 1QBJA 3R1YA 4F70A 1A48A 3CP9A 3KFAA 4OT5A 3NRMA 4X2GA 5CU0A 5AUTA 4M67A 3HMIA 3I5NA 2RFSA 4IRHA 1J2XA 5EW9A 3AC2A 3UMXA 4AUAA 4Z55A 2A1AB 1IEPA 4E26A 4D9UA 3F61A 4QMWA 4C0TA 1QCFA 1Q3DA 1FQ1B 5FLXZ 4IB1A 3V5LA 4C4JA 3EN5A 4F6SA 1XWSA 1PXIA 1JQHA 2R3JA 4HX7A 2VODA 3MJ1A 3FLZA 3ORIA 3QXOA 4IB5A 3P79A 4FTOA 2Z7LA 3W33A 4CZTA 5M06A 4AZTA 2HQRA 4PMMA 2BZJA 3KKVA 3SAYA 4C37A 1BKXA 4CGAA 1RZ4A 2Z60A 3KLNA 3QU3A 3BWGA 4IHTA 5HCZA 4LLNA 1IRGA 5CQWA 5AX3A 3GEQA 2DK8A 1WMKA 3L7WA 3KU2A 3F3VA 5IQFA 2PMHA 1GZOA 5AIQA 4UYAA 4DEBA 5TF9A 2LGCA 3JSPA 4E20A 3ZXTA 4CQEA 3FE3A 3GFEA 3R02A 4KBKA 4IC8A 3QUEA 4BCOA 4GIIA 3F3TA 5CVHA 5IT9Z 5HIEA 5F4NA 4FG7A 4GYIA 2RV8A 1OIRA 4M12A 1YI3A 3TV7A 5I0BA 3OBJA 5EHOA 5KKRB 5IA3A 4BGGA 4EZ3A 4FEUA 2QU5A 4JBVA 3P08A 2Y8OA 5CVGA 1BL6A 3UOLA 3Q9VA 1YG2A 3G0FA 1H8FA 5E9EA 5JEBA 4RX8A 4KMFA 1KV2A 5CTPA 4CRLA 4L3LA 3A4OX 4JL9A 5H20A 5J87A 2P7CB 2G2HA 3SGCA 2BYVE 4ORKA 4MNEA 3Q4CA 3HRBA 4U3ZA 1FSEA 4EQMA 1ZYSA 4X3FA 4K11A 4RBLA 3SZPA 3ZZWA 3T8RA 2YACA 1CKJA 4BL1A 2IZTA 1ZYRF 2E1CA 3E5QA 2CLQA 4EQCA 4A9TA 3LFEA 5DEQA 4RJ5A 3QHRA 5JGBA 4FTKA 4WBOA 5KCVA 3CUQA 3OOGA 3U9CA 4ESBA 4XRJA 3SD0A 1R1VA 3ZPLA 1FOTA 3KQ7A 2DTRA 5D8LB 2QOCA 1RUNA 1DP7P 4NIFA 1UKHA 1W84A 3MFSA 4PTGA 3QBNA 3UGCA 4KD1A 4S2ZA 1PDNC 3QUPA 4UNOA 5IPJA 5IMXA 4DEEA 5L3GA 5AV1A 5HGIA 1EH8A 3BHYA 5EK7A 4QMVA 4OU0A 1WVXA 5IA5A 4AWIA 4IM2A 5L3AA 3HHGA 3KY2A 1LDJA 3BYVA 3LM0A 3KULB 4RVTA 2A5YB 3O2PE 3DA6A 5J79A 5L8LA 4RAZA 2V55A 5ETIA 2VV9A 3VW6A 4QYYA 5J1WA 3AC4A 4EOSA 4QMNA 2KIFA 5AR7A 2RDPA 4MTDA 2W1GA 4ASDA 4E4NA 3OCSA 2C6MA 2HGCA 3MPMA 2X9FA 3GU5A 1OITA 3OROA 4MXXA 3C7QA 3P9IA 3ETAA 2ITZA 3PXQA 4C35A 3FL4A 5LRRA 4BF2A 3OY3A 5DT0A 2C5NA 3RK5A 4YU2A 3AT3A 2WIPA 4M8TA 2FSMX 3CY3A 4OTWA 3SXRA 4G6DA 1RW8A 2FB8A 2HOGA 5CZIA 1KU3A 4W9XA 3QP5A 1YXXA 2BZKB 4EHEA 5TRDA 3QZFA 2NP8A 3QWKA 4EH3A 5LHGA 4BDFA 4J52A 4FZDB 3BPVA 3OTVA 4APPA 4ZJJA 4KS8A 2OSCA 2PZYA 3FC1X 4BCHA 4K2RA 3OUNB 4O81A 4ZOGA 3E87A 5LOHA 1D8KA 3R9DA 5BVDA 3E62A 3SW7A 3RJPA 4QP2A 1Z6TA 1U3EM 3NUPA 2VGOA 3IW4A 1MUOA 2R0IA 3I54A 1GXPA 3ZMMA 1WQ2A 4YJNA 3K54A 4A06A 4ZY4A 5LVOA 4BCMA 4O21A 4TNBA 3KP4A 4UVBA 4KNYA 3PLAE 1KA8A 2W5HA 4M6XA 4Q5EA 2CNQA 2PVYA 1ZARA 2BRMA 4CMOA 4P96A 3BU5A 4FSWA 1P4AA 2FA2A 5EI8A 2VT3A 1ZRCA 4ZZLA 4R77A 5HG8A 3VBWA 3OZ6A 3QQLA 4HZRA 4FEVA 4GVJA 3SRVA 3NCGA 2PMIA 3O7LD 1OUKA 3EZRA 1XKKA 2HFHA 3C9WA 4R5YA 4YO4A 4BYYA 4LV8A 3KF4A 4CGZA 2Z9OA 3LA3A 3EN7A 3R0TA 4W8DA 4YC8A 1OKYA 4G6OA 5AA9A 2CQKA 5CU4A 3MI9A 5ED4A 3VBVA 1XO2B 4F9BA 2BEOA 4G94A 2BRBA 2A07F 3TL8A 2R3MA 4JIKA 1OKVA 2C6TA 4O0XA 3TN8A 4XV2A 4BDHA 2C5OA 3LZBA 2XK9A 3BE2A 5EEGA 3O23A 3I6UA 3I59B 3FMRA 4B8MA 3T8OA 2XNPA 4LLLA 4JNWA 5DIAA 4FV9A 1L8TA 5EM8A 3PVBA 2HYGD 5HESA 3UIUA 3FF5A 2C6KA 2DS1A 2VAGA 2QC6A 2FSTX 1P4FA 5AUUA 4RG0A 4XUFA 5LLQA 3UZTA 4ITJA 4G1WA 3H92A 4QP3A 3RPRA 2NO3A 4KUJA 1QPJA 4RJ7A 4ANMA 5J7HA 2J9MA 2GHMA 3KRXA 4NTSA 3GU8A 4DGNA 1M7QA 2UV2A 2LNBA 3O8TA 4MBJA 3SZTA 3HYHA 4WXDA 5CSHA 4E5BA 5JRQA 3QD0A 3Q52A 4RWIA 3NUYA 4FEWA 2GPHA 4ARKA 2ITYA 4U45A 4APCA 3PXRA 4IZ7A 2F2UA 1LEZA 2XCHA 3W55A 3TDUC 5E8XA 4FICA 1GIIA 1OI9A 4CHUA 5CEKA 5HZNA 3R4KA 1GIHA 3CC6A 2X4HA 4XNEA 1ULYA 4BIDA 2PL0A 2HEOA 4ZTMA 4XCUA 2XH5A 4PNIA 1ZOEA 2DI3A 4IVAA 3UPXA 3QQJA 2PVKA 3EN9A 4IFCA 2OH0E 4CT1A 3FI4A 3QTZA 3NNWA 5D9HA 3ABUA 5CAUA 1KGSA 4MXOA 5AX9A 2QKWB 1E1VA 5K5OA 2PFBA 5HVJA 5LMAA 4D0XA 3RCJA 4KB8A 5H6QA 4N4SA 4YHJA 2EFQA 5CANA 1W82A 2ESMA 4KIKB 4IVBA 5JFRA 2FOKA 3R0AA 3CSVA 3IWZA 2JGZA 2QONA 5L6WL 2OBPA 5EYMA 3K0LA 2RFNA 1QNTA 4ITHA 5A54A 3RZBA 4IAIA 1KU9A 3HHHA 4L7FA 3V8JA 2GNFA 2X4ZA 1P2FA 4FX3A 1B59A 4S30A 4NM5A 3DAKA 4MXAA 3OXIA 1ZYDA 4Q47A 2ZB1A 5HQ0A 4EWQA 4AIKA 3KXXA 4JAJA 2Q83A 4TXCA 2R4BA 1F1ZA 3SQNA 4WG3A 5AV0A 3KP2A 2GQQA 2UUEA 4I5CA 2BTRA 3CTQA 1I09A 3BYOA 3U8WA 1T39A 4OBOA 3LCKA 3LJ1A 2VBYA 3DS6A 5GNKA 1IXCA 5D1JA 4R1HA 3QYZA 4CQGA 2R3KA 4YJTA 2AC3A 5AP5A 1W5TA 4KMUX 4QMSA 4RWLA 3HDNA 4BI1A 2DWBA 4EGZA 4R1VA 3IDBA 2UZOA 1LPUA 3KN5A 3VQHA 1Z1DA 2FVDA 2ITUA 4FL3A 2A6HF 4TPTA 2QKRA 3H30A 4Z2YA 4IB0A 5LCJA 2IVVA 2RIOA 1G8AA 2ZXJA 1YFHA 2GXGA 3O2MA 2IZUA 3F3UA 3CTHA 3R60A 2JSCA 4OIOF 3QA0A 3Q4UA 3L2CA 5IA1A 3TNHA 2XVDA 1J1BA 1WBOA 3WTVC 5EFQA 5CNNA 2VUWA 5A14A 4FT9A 1JKSA 1YDTE 2CG4A 2Y4PA 3UO6A 4CD0A 4RS8A 1CSNA 4ERWA 4O2ZA 4BBEA 3MSSA 3NIZA 5H8GA 2XJ2A 2XK6A 5FRIA 4JS8A 2WZJA 3JVRA 4ANSA 4K18A 2NPQA 4RSSA 3LFKA 4DEHA 4UBAA 5J9ZA 3IGOA 4RC3A 5JFVA 3K1PA 3EYGA 4QQCA 2QBYB 1KE6A 5L3EA 2O5KA 1T98A 2YDIA 3OXTA 3EH9A 3LVPA 4NKSA 5FUTA 3GU7A 5KMJA 4BTKA 1YI6A 2VC1A 5LVMA 5BYLA 1BX6A 1GZKA 2CSNA 3PSCA 4KABA 2RG5A 3KN6A 5A6OA 5M4IA 1AOYA 5EI2A 4FIIA 2HW7A 3DU8A 3L9FA 3LMIA 4C7TA 3KGAA 4CVAA 1E1XA 4AAAA 4F63A 2Q0NA 3BJOA 3MCZA 2QM3A 1G3YA 5E8UA 3WYYA 3I5UA 2H27A 4D2WA 4P5OA 3F23A 4M74A 5K5NA 3BCEA 5A4LA 3P1AA 3Q6UA 4WG4A 2ITNA 4BR3A 1YW9A 2D45A 5H9BA 3AD5A 2PVNA 2V9VA 4KKHA 2GAUA 5FFZA 3QA8A 2PMUA 2PMOX 2ADUA 3VUDA 1J75A 4HCUA 1OL2A 2F2EA 1SD7A 2BPMA 3CD8A 5DPVA 1RDQE 5IQAA 5BUJA 4C4HA 3KMWA 3P7AA 3ZUTA 5AIPA 1CKIA 3HUGA 2C5YA 1M7NA 4YZBA 5K4IA 2BRGA 1FT9A 3I6WA 3NW7A 4G31A 1S7OA 1G3TA 5DLSA 4U88A 4PTCA 2BHHA 3DV3A 1F5TA 1YOLA 1QPDA 1SYKA 2EJRA 4GL9A 4TYHA 5M51A 4ID7A 2X7GA 2JPCA 2GNJA 3IW6A 3V8SA 4QLCU 4A9RA 4ZZOA 1OB3A 3HMMA 4DAWA 4NSTA 4DTBA 5M4FA 2BAKA 4RC4A 3R8MA 4W8EA 3Q6WA 5D4RA 1LB2A 3TUDA 4EK5A 4DBXA 3Q2JA 3IECA 2GSFA 5HEZA 3B2WA 2WKMA 4TY1A 3FXUA 2XASA 5HDKA 4LB6B 4E6CA 4ZTLA 3FC2A 2B55A 4WOVA 4FKUA 1U4DA 2XAHA 1PP7U 2P3GX 3G3ZA 3TCPA 4D2SA 5GINE 3PP1A 4I6QA 2B9FA 4JBOA 2ZKZA 2RG6A 5BVWA 4IRGA 3UVPA 3HRFA 2JKMA 3UG2A 3JVSA 4A0XA 1YIOA 3TI1A 3DZQA 3MJ2A 4JK1X 1MJ9A 4I5HA 5I9ZA 2J51A 3OMVA 5E7RA 5AP6A 3A7HA 4FHTA 1HKSA 1YVJA 3BIZA 3C51A 3VHEA 1HW1A 4AT5A 2X8DA 3PA3A 2WEIA 1HXDA 4I2OA 1Z9CA 4F9CA 3U4WA 3RYRA 3KP5A 2Y6OA 2F5EA 2V0DA 4GT3A 4CG8A 5K3YA 3PJ1A 5HLGA 4NFNA 4ASZA 2UZVA 4QD6A 2MD5A 2JIVA 2A69F 3W2SA 2VTIA 3WZEA 4KRCA 4DGOA 4I0SA 3IDCA 1Y91A 4RB1A 5BPYA 3LFFA 4GH2A 5CEOA 4EJVA 1USSA 1W83A 3RP9A 3EMGA 3QC4A 3EIDA 2DYLA 3TACA 5HX8A 3GQIA 4IVDA 2DK5A 4BDKA 4L52A 4DGGA 4FV4A 2E9UA 3KP3A 4RB0A 2ZV2A 1HSTA 4KS7A 5BVFA 1PRYA 2CNVA 2XBJA 3SXSA 4A5MA 4FKPA 4M66A 4NUSA 4YZCA 5KMNA 4ZYDA 1IAJA 3JTGA 3COKA 3KULA 3E63A 3E97A 4RA5A 5FWKK 5JH6A 4U79A 1YRPA 4TWCA 2W1HA 4OR5A 4FI1A 4DF3A 4USDA 2R64A 2P8TA 2QOOA 3K3JA 4JBQA 5D7AA 4ENNA 4BYJA 2C6LA 2B9IA 1Q5KA 2GFCA 4D55A 3QAME 4G3CA 3QRKA 2O64A 5ILUA 3L8XA 5C27A 4G7HF 2XRWA 4FKOA 4PWNA 5E1EA 2VONA 5FQDC 4G9RA 3IWFA 3DTCA 2G7HA 3QQKA 4EM2A 4XG7A 2XZSA 1ZY4A 4BZNA 4AA0A 3R28A 3LQRA 5E91A 5KK1A 2WMBA 5E4HA 4E4XA 4PDOA 5CAPA 3O96A 4M3QA 3K9TA 5T3QA 2K27A 3WTZA 4MD8E 3WTYC 5DMZA 3E3VA 1Z57A 2XK3A 2BRHA 3C0HA 2L02A 3ORLA 1LEAA 2E9OA 4HYIA 4GKIA 5CYIA 4J8NA 2FGIA 3H10A 1U54A 3ZN1A 1Z5MA 4WNMA 2GZWA 4GSBA 2J5PA 3D2IA 1R5GA 3JY9A 2PVJA 3FKLA 1CDKA 1SFEA 1YHWA 4O1PA 4UZHA 4LGWA 2RL5A 1NVSA 4BC6A 5BUIA 3CJNA 2ZBKA 5D4SA 4HYSA 2PTKA 2EWAA 2NRUA 3FM3A 3EJ1A 4UMUA 2HIWA 3VVHA 2H6BA 5HO6A 4IMYA 4DFXE 3KA0A 4BTFA 4NWMA 3VEPA 4YZ9A 3MN3A 3LOKA 4ENXA 4CG9A 5CVFA 4ZTRA 4G9YA 3A8WA 3M11A 3ML6A 2VTNA 2R7IA 2YWVA 4OTIA 1P4OA 4YO6A 4M0ZA 1WBTA 2ZVAA 4HGSA 4X3FC 2R0UA 3EL7A 2ZM4A 2P4WA 1GZNA 4ANLA 4AZEA 3QGYA 5AMNA 1CGPA 3PJCA 4GJ2A 3Q5FA 4I24A 4Y17A 3EKKA 4OIQF 4YSMA 3ZFYA 3LCSA 2M1BA 3SDJA 2PYWA 2GS2A 3I59A 2C68A 4EOIA 4O0RA 3IRQA 2H96A 5E8VA 3TG1A 2H6CA 4HOKA 3E88A 1WWXA 4C33A 2IWIA 3FQHA 3AQVA 4Y5QA 1OIYA 3MYGA 4EI4A 4A2UA 2JBOA 2QU6A 4ALWA 3PTGA 1T45A 2XK8A 2BZHB 2C0OA 4J96A 4I94A 3R71A 3ERED 5B2LA 4LMNA 4PP9A 1BJAA 2YAAA 3C4WA 4DFUA 4IXAA 3EFKA 1F0QA 3BHTA 5HICA 3VF9A 3KP7A 3DB6A 3NNUA 4ZYGA 2JC6A 1FP2A 3C0IA 3M8EA 4E4MA 2UVZA 4K33A 3R21A 1OMIA 3C5IA 4TTHB 4FZ7A 3M1EA 4AX8A 2QOKA 1BI8A 5CI7A 2C4GA 1JWHA 4AOJA 2DAOA 3DP7A 2HR3A 3FLWA 2CYYA 4U41A 5DI1A 1ZGAA 4FKIA 3ZMUA 4MHAA 1G5SA 4F7JA 3H0YA 4RJ6A 2JD5A 4EOJA 5FM2A 3ZLXA 4OBPA 5IH5A 2BKZA 4RGUA 5AV4A 2GDOA 5KO1A 2K4BA 1KQ8A 2IO6A 4QMPA 5LMKA 5IQBA 4XRFA 4CNHA 5GZAA 4FK3A 4RWJA 5TT7A 4HV6A 4DNCA 2GS6A 4BDJA 5I9VA 4DITA 5HD7A 2YN8A 2FEZA 2QNJA 3QAHA 3ZXZA 5CVUA 4ANNA 3P7BA 4CLJA 1TQIA 5DEYA 4A5NA 5HKMA 4YNOA 1TBXA 4G6LA 4L6QA 2R7FA 3MY5A 4O86A 1DAYA 4C59A 4DHFA 2GTNA 1BI0A 4YJPA 2QLUA 4GJ3A 2VTRA 3R9NA 2PN6A 1WAKA 3FMKA 3FXQA 4HVIA 4RZVA 3MFRA 4U5JA 2W4OA 3Q2MA 4GXOA 3GEZA
chains in the Genus database with same CATH superfamily
3NVKI 3MWMA 5FG8A 3JRHA 5FKNA 3NW6A 2QI8A 3MBLA 1URWA 1RKTA 2PMZN 5DYJA 4BDAA 3RPVA 3VS0A 1OBGA 1XX5A 3HRTA 2QO7A 2W1DA 3IW5A 4EOQA 4GK3A 4NJDA 3SOAA 3A7GA 3BTIA 5DVRA 4UUSA 1PYEA 5FXRA 4D0PA 4IH8A 2OIBA 5ACKA 5DCMB 4DINA 3CGOA 4K8AA 4O7ZA 4CV8A 3IONA 5JK3A 1R1WA 5EEHA 1URCA 2C5VA 1D1BA 1J1CA 3KMUA 2K9QA 1CQTA 3UNKA 4JQEA 4U40A 1XD7A 2YCQA 4XRLA 1S7AA 4WNKA 2BY0A 4BZDA 1UG2A 3IK3A 5BVEA 3NWSA 3WE3A 3EL8A 1T38A 5I5ZA 5HLPA 5HOAA 3FX3A 4ACHA 1V3FA 1E3PA 4RA4A 3TNIA 2YX7A 3QZHA 3QD3A 3RNIA 1DM2A 5D5WB 4BUPA 3HX4A 3ZLWA 1JKKA 4O6JA 2GHLA 4BCIA 1QRYA 2NYAA 2JRTA 1OISA 1ZH5A 3VYRB 4I99C 1OR7C 2OICA 5F20A 2HWPA 3ACKA 3QTRA 3V51A 4ESJA 1IRKA 4EYJA 4D4SA 5L2WA 1U46A 4L9TA 3SHFA 2F4MB 3LSHA 1ZYJA 4ZTNA 2WOUA 3FYJX 3LPBA 3NQOA 4EGYA 1I1SA 2OZOA 1I3AA 4R1YA 4IEBA 3QTWA 3RZFA 5IEYA 1AWCA 4KIGA 4CCJA 2MBFA 3ATSA 4S33A 2YM7A 4ZSAA 4AXFA 3CC2I 3NAXA 3KF7A 5ERIA 4KIPA 1JNKA 3L2RA 2ONLC 1QZZA 1OYWA 3FBVA 4UV8A 4MD7E 4DG2E 2GM4A 3PIYA 4N4OB 3DXNA 1QPIA 1WJBA 2R3PA 2PE2A 5CU2A 5D12A 2ITOA 1XBCA 3K70C 4YC3A 4M69A 4BEHA 2XIGA 4YUQA 1ZWSA 3ZO1A 5HU9A 1A5JA 4U0IA 1Q1HA 6PAXA 3QU0A 1TT5B 3QQFA 1GNGA 1O3TA 3K2AA 2V62A 4LQMA 3MB7A 2OXXA 1N78A 3HL2A 4X7QA 3MH3A 2JKQA 2R3HA 2V26A 4CFFA 4KITB 3W3CA 2W7XA 4CYCB 2QBYA 5HVQC 3VUMA 2I0YA 2CKPA 3CUOA 3W18A 3E6MA 3FLSA 5AUZA 4F6WA 1ZMWA 4WO5A 1D8JA 3LFDA 3VBXA 2KL4A 1XS9A 1D5YA 4UVAA 1YITI 3TKIA 2ZMEB 4YNEA 2C3LA 3FMJA 3NR9A 3PFIA 1J9IA 2W1IA 3PIXA 1VR2A 4O4FA 1H27A 1LQ1A 3DTKA 1DPUA 2G9WA 1R4MB 3HECA 1JKQC 1UV5A 4FV8A 2YM3A 4FSUA 4QP4A 5GZ9A 4HAMA 1BW5A 4LRJA 3COAC 5FROA 4WXCA 1YQJA 3OVVA 2XPWA 4Q48A 4CZZA 2EWNA 4E70A 3EYYA 3O51A 2W4SA 3OYIA 2L54A 2X2MA 3H5AA 4FTHA 1TFFA 3FK6A 1OUYA 2UZBA 3ERKA 3KEOA 4O7LA 1XGMA 2P7VB 1H1PA 2DODA 1GY3A 4F08A 4JLCA 3WIKA 1JI8A 1O9UA 4JR3A 2VO7A 4BDIA 3DNDA 3OYFA 1DAWA 3DWLE 5ANGA 3OP5A 5AA8A 3I4MJ 3B02A 4QMXA 3FIWA 3RK9A 2QQ8A 1Q8UA 1R36A 2VTOA 4C2TA 2OJ9A 1H9TA 5AONA 3U6JA 1TQPA 3GBZA 4GU6A 4X0GA 4RX9A 3QTUA 2AXTC 4U87A 3UP7A 3F2RA 1LDDA 4FKSA 4OIPF 2M87A 4ACCA 2WQOA 2XGDA 1ZAOA 1T6SA 4FSMA 4ALUA 5E1SA 3U54A 4O0UA 3G6HA 4EHVA 3Q9XA 1OQYA 5B7VA 4CYDA 4NW6A 2EH3A 1FYKA 2WQMA 5J8FA 3PJ2A 4Q9ZA 4ONAA 1TLHB 4U80A 2RNJA 3AT2A 3NGAA 5IEVA 3QP6A 2PK9A 1O6KA 5IA4A 3P78A 2EPFA 4S34A 4E6KG 3S95A 2JVHA 4DFBA 4TT7A 3WILA 1WSUA 2R3IA 3FXRA 1NTCA 3Q96A 2V6CA 3OFMA 4BYIA 3GYHX 3PZHA 1SMYF 3C18A 2QR8A 4ALVA 4I6HA 3POZA 4IIRA 4ITIA 2PVHA 5FP6A 3EOCA 5KZIA 3W0QA 4GRBA 4DH5A 3AMBA 3QOPA 3AKJA 4NQWB 2XAFA 5FD6A 3F9NA 1GJOA 5FKLA 4G17A 1QQIA 4XLHA 1AKHA 4AZFA 3DXPA 3MN2A 4LG0B 3HOWJ 2R3LA 1MZBA 4DN5A 2W9ZB 4HPTE 2X9DA 4DDGA 4FL1A 4C57A 3JR9A 3K2LA 4EOMA 4K0YA 3R7GA 3CJFA 3UIMA 2XKFA 3QLFA 3SOCA 2UZWE 5A4QA 1E17A 1TZLA 3MESA 1VQ9I 5AR8A 5CVIA 2X0OA 5ACBC 4AW2A 1TWGJ 3TZMA 3SG8A 2PU8A 2HW6A 3QALE 2ETHA 2CKQA 4FE4A 2AYPA 2EIMH 3NUAA 3S3OA 4IF4A 1H8AC 4OTGA 4AXEA 4EOOA 3OYAA 1OECA 3FAAA 1X1DA 2ZCWA 1HQCA 4L00A 4DH3A 2VOPA 4J1RA 2XF5A 2VNYA 4RAYA 1JVPP 2A68F 3RAIA 2DJNA 1IN4A 1Z7UA 2DW4A 2WTEA 4JX7A 4X3JA 4AS0A 3BG7A 4U42A 4EUUA 5KUPA 2QGUA 4R8HA 3GCPA 3QRJA 4GFOA 4IB3A 5JLXA 5BNJA 5EOBA 5KHWA 3U6HA 1IG1A 4OBQA 1A6QA 3KRRA 3ZONA 4C4GA 3HMOA 3MH1A 2BFYA 1PW2A 3RKBA 4GU9A 5B1BH 1YWRA 3H9GA 2COBA 2R7VA 4L68A 4QYEA 3NWTA 5EKOA 2KTYA 1WJ5A 4UV9A 4RGXA 5C8NA 4ZJZA 3MV5A 3LL7A 3X2QH 5D5VB 2AUHA 3R8PA 3DKGA 5KMKA 3AXWA 3W2PA 4MQ1A 2ZSIB 4FRFA 4D58A 2KRHA 4QTBA 5L2IA 2E19A 4FTRA 4GUEA 2FXAA 4I01A 2XKDA 2F5CA 3C7JA 3LXLA 1WFXA 3A01B 1ZMUA 3TEIA 1RI7A 3BR3A 2XA4A 4R7BA 4PDKA 3VRYA 3GB2A 4BDDA 4FASD 3AC1A 5K0XA 4QPMA 3MVMA 4LMUA 4YR8A 1ZLKA 5C9CA 2LY9A 3GNIB 4KJZA 4X2JA 1UHSA 4K6ZA 3FMMA 3HDMA 4BCNA 2CW8A 3N4UA 5BMSA 3R22A 3V42A 1OCPA 4CTCA 1P9QC 4Z16A 4TN6A 4XV9A 2DDBA 3ABLH 2DFEA 2KRCA 2HYFA 3OT8A 1V5GA 3BCBA 4V2FA 1XH5A 4YJVA 3P5JA 2E1MB 3TWJA 3U51A 1WBVA 2R3NA 1KSWA 4YLJA 3S2PA 3QXPA 3VQUA 4ZMEA 3Q9ZA 3I58A 2W4KA 4Z9LA 5BS6A 4NYEA 3R1SA 5AIRA 1YHVA 3N4MA 2HWVA 3P7NA 2JIUA 2JFLA 3UE4A 3NPCA 2WU6A 1GV5A 4F6UA 3F82A 3BPRA 2HU9A 3SZGA 4BCFA 2YM6A 3EB0A 1BW6A 3KYLA 4WRGA 4FTAA 1JUSA 2B0QA 1XG1A 5DDGA 4QRCA 5CKTA 4IWOA 5AUVA 2M30A 4KA4A 3RPQA 3AL0C 4AZWA 4IZZA 3EWHA 5CYVA 3PP0A 4LRMA 2HTSA 3NYVA 3PXYA 2UW8A 2CUEA 5DM6F 1G4DA 2VWBA 3FXMA 1STCE 1ON1A 4ZC3A 2XJ1A 3S15J 3V5WA 3PE2A 5CF5A 1EJ9A 2VJIA 2AO9A 5M08A 3AAFA 1UU8A 1OKZA 3PY1A 3BPXA 1YJWI 4TNDA 4EJTA 3BDDA 3LAJA 3D0SA 4BKXA 1BIAA 1R4NB 3EPZA 4PMSA 4XP3A 1T2KA 4BE0A 2X1CA 3DY7A 4G5JA 4HEA2 3ZMZA 2Z99A 4H3QA 2QENA 3S1NJ 1DI8A 3UVQA 3OS1A 2VOOA 1IRFA 3W2VA 3FXXA 4HBLA 4M0YA 2O3PA 4JT3A 2XUBA 4IACA 1VQ4I 4BCGA 3LSRA 2OD5A 3BV3A 4E73A 3E8EA 3QQUA 1Y39A 3S17J 1VQNI 3H1CA 2CV1A 3MY1A 5D11A 3S2DJ 1D5VA 1R00A 2IGOA 5EKNA 3BR0A 2C1AA 4CV9A 4MQ9F 3DAEA 3V01A 3CP2A 3T1BA 3GXLA 4V0GA 2V5QA 1UMQA 4ENYA 4I5PA 4IQ6A 3CCMI 1KU7A 3UQCA 1OL6A