1TQPA

Crystal structure of a. fulgidus rio2 serine protein kinase bound to atp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
282
structure length
269
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of A. fulgidus Rio2 Defines a New Family of Serine Protein Kinases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
molecule keywords conserved hypothetical protein
total genus 86
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tqpA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1tqpA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1tqpA02
4OUCA 3UIBA 3ZM4A 4LK1F 1YI6A 2YCSA 2K86A 3I59B 3SGCA 3UVPA 1XB4A 4HQEA 2CDZA 3I5ZA 4QQ5A 4P96A 4I23A 3KEOA 1IR3A 3F2AA 1GOLA 3Q04A 3IW7A 2W1EA 3VW8A 3AXWA 3KETA 1MQ4A 4JDJA 2LGCA 4UMUA 2HWVA 3CEKA 3VBQA 2QO9A 4FKUA 3IO7A 2CFXA 3HA8A 3OG7A 2EFWA 5LMKA 5CU6A 2VTHA 4TKSA 5AAEA 1U78A 5I9VA 3LXLA 2R3MA 5F95A 5EDPA 5JKGA 3WU1B 4YUQA 1AWCA 2WMSA 3R61A 5H8BA 5JQ8A 1DS5A 4RIWB 3CD3A 4RFZA 5DNRA 5ANOA 3QCXA 3E93A 3FHRA 3ZO3A 2PUUA 4BN1A 4N57A 4IXPA 2EVAA 5DBXA 3VBXA 3EKNA 3I6WA 3KP4A 4FEQA 5FDPA 4I02A 3K5UA 4NEUA 4FKTA 1BI0A 3KN6A 4BDGA 3R7VA 2R3LA 3TCPA 2UW4A 4IWQA 1URCA 2RG5A 4QQTA 2G01A 5D6EA 3ORZA 4JBVA 3TJCA 4DA5A 3VW6A 3UDBA 2VTNA 3O7LD 5K4JA 3L7WA 5AR8A 3I0OA 3LFSA 1XBBA 3ABUA 3E3PA 3NNWA 5E8YA 3PJ2A 3QUPA 3U6HA 4LRKA 5L8KA 4RFYA 3G5DA 3E7VA 3GNIB 4R5YA 1Y6AA 2Q2EA 2WMTA 3WTSC 3QF9A 2ITZA 4O2ZA 3PQJA 4NW6A 5E18F 4Z3VA 1R0PA 1XQZA 3RAKA 4RLKA 3LFDA 3BU5A 2A69F 3VUGA 3UYTA 2STWA 4QMUA 4BY9E 3WTXC 3CUQA 4D2WA 3AG9A 1JSTA 1REKA 5C26A 5J8FA 3EQDA 2ITQA 1R1VA 5J9LA 4O0TA 3ZXZA 2QODA 4NM3A 2CSNA 4IM2A 4WBOA 1DPUA 4B4LA 3QQJA 4M13A 2J9MA 1W82A 2J0JA 4KRDA 2F2UA 2UW6A 4KUMA 4I0AA 4ZSGA 4ZYEA 3OS3A 3RTPA 3T3VA 3R30A 3U51A 2F5FA 3RPQA 2ITTA 3OW3A 2QLZA 3QKKA 5E8IA 3AC8A 5T68A 2BRMA 1HW5A 1WBNA 2BYVE 2BFYA 1IN4A 2WTDA 5ICGA 4BHZA 2RDPA 3GP0A 4FGBA 3VS3A 1MJAA 3UP7A 4O83A 1BKXA 3ECHA 4MNEB 5J95A 4CQGA 3IKTA 3ZBXA 1GZOA 1U5QA 1ZGAA 2NRUA 1WFCA 1MZBA 2WNTA 4GS6A 4QYEA 3SHEA 4BYYA 4G6LA 4CFNA 3VNTA 4U7BA 2BIKB 3MB6A 5AP0A 2CHLA 5BMSA 1WBVA 4FX4A 4LLGF 2BALA 4LGWA 4FTOA 1ZG1A 4N0SA 4YO6A 2X81A 5LVNA 5D5XB 2BZKB 2R3OA 2WMAA 3IS5A 3G0FA 1H25A 3VVHA 2HR3A 3TZ9A 2O0UA 4O22A 1P4WA 4EBWA 2PFBA 5HIDA 4UWYA 3AD6A 4DEGA 2OGVA 4ON0A 4QP8A 3DOGA 2JIVA 5FBOA 3LA2A 4NK9A 3I4PA 4QP4A 1G8AA 4FX3A 4DG2E 3W32A 3HDMA 3ZRLA 4R7BA 1PYEA 4N9IA 4WHZA 2PY3A 5HI2A 4YHFA 4CNHA 2XJ2A 3BE9A 3WTZA 2OFUA 2HZ4A 2D45A 5EHOA 5BUEA 1W0XC 2YDKA 3ZU7A 3SW7A 4EUUA 2WOTA 3E5UA 5F1ZA 4I5MA 2ZMDA 2MLKA 4C4HA 3W10A 3GCSA 2EJRA 2PE1A 5EKOA 3ZSGA 2HTJA 1O3TA 4EJWA 3DV3A 5AP3A 1NY3A 3PRFA 3OWKA 2CCIA 2OKRA 4WRGA 2PE0A 3F82A 3F2RA 4A7CA 2ZMEA 5HG7A 1T0FA 2OJ9A 2PUIA 1QL6A 2VTRA 3OUKA 4P2KA 3LQ8A 2VBZA 3RCDA 1WVXA 4IW0A 2HOGA 2XYUA 2IW8A 4F4PA 3PSDA 6PAXA 2FE3A 3VUDA 2VWWA 1USTA 1KYZA 3MAJA 2IJLA 4XP2A 5CSHA 5CXZA 2EFOA 5D8KB 4NWMA 3OT8A 5AONA 4MQ1A 2XZSA 4E8AA 4P90A 3O2MA 3F5UA 1Z1DA 3QTZA 4EJOA 2WGJA 4RS8A 5FXRA 4HDUA 1VZOA 2C6OA 4XG2A 1UNGA 1K9AA 2DO7A 4F09A 5B2MA 3MVMA 1XMAA 3B2TA 1R5HA 2JPCA 4AGCA 5AP2A 4ZP5A 1R0EA 2CJMA 2E9PA 3MB7A 3FMNA 1OB3A 3DDQA 2P3GX 4WF2A 4NM5A 3DK3A 2JD5A 3P0MA 1JHHA 2CN5A 4S34A 4MHGA 5TKDA 3QRFF 2XRWA 4LG4A 3ZDUA 5I9WA 1AOYA 4BDBA 4BQAA 4HV5A 4YHJA 2P4WA 2WZJA 2ZNZA 4FKWA 3JTHA 4GK4A 1VTNC 4HW7A 2OJIA 2HDCA 3V8TA 4ZLZA 3HMIA 2OXDA 1JWHA 4X0MA 2UW0A 1QNTA 2RN7A 4HNFA 4DTKA 3VODA 3CGFA 5AUTA 3W2QA 2R3NA 3QZIA 3J80Z 4C4EA 3F8NA 4AX8A 4TNBA 3F3XA 2M1BA 3Q9YA 4PMPA 3QD2B 1KE7A 3NIZA 3N4TA 2XK4A 4EI4A 5TRDA 3PIXA 2HKXA 2GSFA 3S2WA 5C1QB 1KV2A 4MCVA 5BVWA 4GV1A 3FQEA 3ZFMA 3L00A 2CCHA 5M51A 3EZVA 4N6YA 4I24A 2HIWA 3BHVA 3LXNA 3A4PA 4E93A 1CKPA 3ZRMA 1FOTA 1MKMA 3CJGA 4ASDA 2IW9A 2WXVA 4RVKA 1KOBA 3RPOA 2VWXA 1ODDA 4YPDA 1H1PA 2WQMA 3IPHA 3MH3A 3TXOA 4BHBA 3MVJA 3EB0A 3F2NA 4KD1A 3WI6A 3UYSA 4QWQA 2W4KA 3REOA 4QP1A 5HLIA 3M2WA 2D1HA 5F4NA 2MD5A 1DAYA 1XJDA 2IT0A 4RIOA 1IN8A 4R78A 3FM3A 4D55A 1GZNA 5HO6A 5M08A 4D1XA 3LZBA 5DGZA 4C3PA 2FSMX 2ZYBA 4ZTQA 1OGUA 2J0MB 1BN5A 2A3SA 3PA5A 2IVTA 2G7HA 1JKTA 4AIKA 2RFEA 3DK7A 5EDQA 1VJYA 3K5VA 2OZAB 2CNQA 1YDRE 4LV5A 4FBXA 2HZ0A 3R7IA 4FTJA 1FBUA 4E73A 4GMYA 5FO5A 4QOXA 4CICA 4ZJVA 3KP2A 3UQGA 5D5VB 2ZV8A 2W5BA 4NIFB 2WMQA 4NM0A 3UZTA 2XCKA 2L4AA 4G5PA 3QZHA 3Q6WA 4C35A 4C57A 3D5UA 3HRFA 1H27A 5EQEA 4EGYA 3QC9A 5K5RA 3LQ5A 2L02A 3R7OA 3WE3A 4G6QA 3EL7A 5AUVA 4OBQA 3FLSA 4L53A 3KULB 2UZKA 4DE4A 4R1HA 4HF2A 3V4GA 2JAMA 2G9WA 3PXFA 5EK7A 4IVAA 5BVDA 3WGHA 3CO6C 1R1UA 4PL3A 4ENNA 4PMTA 2P0CA 3EQRA 2PBIA 4K8AA 4XCUA 2GS6A 2BHHA 4CKJA 5HCZA 4EK4A 2GQRA 3QTWA 4IDVA 4QT1A 3FSFA 1MJ9A 3E6MA 5AFVA 4YIIA 2UVZA 3HEGA 3VULA 4Q9SA 3RMFA 4E6DA 3U9GA 4BI2A 3DBCA 3F66A 1Z7UA 4XP0A 2F7EE 4M8TA 4BGQA 4EJNA 5HO8A 3I0TA 4PWNA 4AG8A 4DCEA 4APPA 4KKHA 3DLZA 2H6DA 2C6DA 4BWPA 3PE2A 3GX4X 2YCRA 3KKVA 3IW5A 4HYHA 2HYFA 1XSXA 2DWBA 1LQ1A 4F08A 1P4FA 4EORA 3Q60A 4K77A 2XAFA 1XGMA 3TDWA 3K1NA 4PTCA 5CEPA 2B0LA 1FBSA 4ZTLA 1LJ9A 4BCQA 2A07F 3FZRA 3OCTA 4D0XA 3VEPA 1Q5KA 3OV8A 4EZ3A 1KE9A 2LKPA 4ITHA 1FINA 4DTAA 3R60A 2UW7A 4GK3A 4WO5A 2WO6A 2ZV7A 2G15A 4BCNA 3OOPA 2K4BA 4XX9A 5EM6A 1D8JA 3RAIA 4CKIA 5J9ZA 5A6NA 5ANIA 4EWQA 5D5UB 3VIDA 5DFPA 3RYPA 4F9CA 4OTGA 2QWWA 5AV3A 4AA4A 4CFFA 4L44A 4FNYA 4I5CA 3G0EA 4ZY5A 3Q32A 2OZ6A 3OUNB 2H6BA 1GIIA 4GEOA 2XUBA 4MWIA 3IHUA 3GCUA 4AE9A 4PGHA 3OCBA 2OWBA 4AN2A 2PZIA 3ZO1A 3HRUA 3F23A 1CSNA 1X8BA 3PJ3A 2VV9A 4F0FA 4M68A 3E7OA 1PKGA 4NKAA 3UNKA 3TJDA 2OF4A 3QA8A 5J7BA 3DZOA 1ZOGA 4ACDA 1SNXA 3R1NA 2MBFA 3BYVA 2Z60A 1YVJA 3F6XA 2PYWA 3BEGA 4D9TA 4Y8DA 4KMUX 2W5HA 2HFHA 3TDUC 2YM3A 4J95A 4F0GA 2G2HA 2C0IA 1P92A 3P7NA 3RBWA 3RNIA 4TYEA 5FLXK 5GIPE 2GQQA 3VRZA 5HNBA 4PMSA 2YM6A 3FI8A 5L3GA 1I5ZA 1CKIA 4JOAA 2YIQA 3HMMA 2BTRA 3OF0A 4CKRA 4LLLA 2B52A 2C5NA 5HG8A 4DN5A 1O6LA 4I93A 3QALE 4CFXA 3L2CA 1WBSA 4CZYB 2GXGA 3P5KA 1TW3A 4YFNF 3F8FA 4QYHA 4IB5A 3KFAA 2PL0A 3PDTA 4KNBA 2B54A 5JFRA 3ZPLA 1ZZ2A 5T6KA 2XKCA 2VN2A 1Q3DA 5CENA 2OW3A 4IRGA 1YQJA 1V1KA 4I2OA 3QCSA 2ITNA 3HECA 3LQRA 2XRUA 4BRXA 3PLSA 5KKRC 5BVNA 1KQ0A 3PYYA 2JTVA 5BYZA 1YI3A 3EQGA 3VUHA 3RPUA 3QKLA 3H9FA 3BBWA 4HYUA 4KABA 4GG5A 1OMIA 2V0DA 5FDXA 4BCPA 4E6CA 4CRLA 1FWZA 3SXRA 4QMOA 5IDNA 4FTNA 3ZHPC 3FYJX 4RZWA 3EQCA 2A4LA 5CALA 3TNQB 2NAZA 3FHZA 4LL0A 3BWJA 4XG7A 1XD7A 4UVBA 1S6LA 4UXQA 4AT4A 4IB1A 5JSMA 4EGZA 2HY0A 3VOEA 2PVHA 2ZM1A 2EWAA 4MEYF 5E1ZB 2O63A 4ANNA 3C4XA 4EVIA 4RWKA 5HE1A 3M42A 1TW2A 5IISA 3I5NA 4CFUA 5GINE 5EHYA 4CFWA 4AE6A 2YJRA 4EOLA 5KZIA 3POZA 1ZAOA 5HEZA 2R3IA 4N0BA 1IN7A 5AWMA 2YR2A 3V5PA 3BRBA 3VO3A 2VC0A 2GPHA 2A6EF 3R6SA 3ZZWA 4F1TA 3UG1A 3BPXA 1UKIA 5L8JA 4IDTA 4ZK5A 3KN5A 4PTGA 1J7LA 4I6BA 3KLNA 4YC3A 5D4SA 3WOWA 5L6PA 4P7EA 1RQQA 5GZ9A 1W5SA 4F7JA 1P14A 1YFHA 1Q99A 5KCVA 3QU6A 3GU8A 4H3BA 1Z05A 2X4FA 3EN9A 3OCGA 2L54A 4F64A 3GVAA 5HDGA 2CN8A 3DFCB 4LMUA 3W55A 1HW1A 5BPDA 4FE2A 5HDNA 2QG5A 4PL4A 2PULA 3V7CA 5IA4A 4BIDA 3LXPA 3PPZA 2Y8OA 4FHTA 3C3WA 4NHJA 2J0LA 5EYKA 3VF8A 3DKFA 5IMXA 4XLNF 3DA6A 3GXOA 3HSFA 4S2ZA 4HZFA 4M84A 2VAGA 3C0GA 2CKQA 4FKLA 2QHNA 2VTPA 5LVLA 2ONLA 4G9YA 4RGRA 4EM0B 3MZYA 1Q62A 1ZYDA 1H26A 2A0CX 4ZTSA 2XH5A 3R2YA 3ZMVA 2WIHA 3EQHA 3OWLA 3JAMK 4CFMA 5HKMA 2PVYA 1JSUA 4U79A 5A4TA 1LDKB 1F5TA 1YOLA 4BKYA 5L8LA 4YLLA 3ULQB 3C9WA 4O7VA 3P23A 2Y4IB 4KIFA 3KK8A 5E4HA 2QKWB 3I58A 3TV4A 4TRLA 4QMLA 1OZ1A 3B2WA 4V0GA 1UU7A 2XVCA 3HRSA 4EK6A 4RG0A 4LFIA 4LMNA 3L9MA 1HOWA 5ILVA 5EFQA 4GRBA 3W6JB 4CGAA 4WSYA 4IAFA 4IFGA 1KA8A 4MNUA 4J52A 2BAKA 1EH7A 3GF2A 1JVPP 2CGWA 4BF2A 2ZJ2A 4OAUC 3O71A 4L9IA 4CCBA 1MP8A 5CEMA 3S2PA 4IB3A 4FKVA 5CF5A 5CF6A 4HYEA 1BC8C 1GXQA 3SOAA 5HVKA 4RGJA 2RC4A 5JEBA 3OT3A 1R7JA 2HZNA 3RM6A 2R7BA 4O0YA 3R8LA 2BZHB 5HLPA 3DBDA 2ZCWA 2E1CA 1BI8A 1OBDA 3P08A 4RIWA 4XYFA 3WGGA 2HAKA 4QP6A 1M2PA 5B2LA 3ZLSA 5TO8A 4OIOF 3JS2A 3GCQA 3VQHA 4EJVA 2QCSA 3TO9A 3R73A 3M9AA 3T8TA 1XSVA 1P2AA 5AX3A 4L3PA 4YJPA 4C7TA 3N4MA 4BCKA 2Q8KA 2NNYA 3D7ZA 5CEIA 1R78A 4EWHA 1YDTE 5KX8A 1BL7A 2ZM4A 4JR7A 3V04A 2OJFE 1SAXA 4CV9A 5CAPA 2WQBA 3MSSA 3MY5A 5DN3A 4DG3E 3F8CA 2VGOA 1KE5A 4JQ8A 4X2FA 3BEAA 4YLKA 3M1EA 1P6RA 5K1YA 4DH3A 1FQ1B 2DFIA 3OHTA 4DT8A 4OTWA 2I40A 3K2ZA 1LR4A 1B59A 4JDKA 5ETFA 2UVYA 3MPMA 3QLGA 4F7ZA 3UZPA 4L42A 1LB2A 5CF8A 4B09A 5AA8A 4U97A 4DT9A 4YC8A 4FV8A 2FXAA 3IKAA 2C6YA 3PXYA 2E9VA 5J87A 2C47A 3WGIA 2VBWA 4E1ZA 4FT5A 5J79A 3OZ6A 3VWAA 1S7AA 4AWIA 4FTRA 3C0HA 3E6DA 5A2QK 2OF2A 3A7FA 3AAFA 4IMYA 1J75A 5AV0A 3VBYA 4G3FA 3D7TA 3P9KA 4IIRA 2RL5A 1G8SA 4R3PA 2WU7A 1YOMA 4KMFA 4D0PA 5DT3A 2CNVA 2QVSE 4GT5A 3IWZA 4MEXF 1S9IA 3OVVA 2KJBA 2XAGA 3F3VA 4ACMA 1ZWSA 3BI6A 5E8SA 1QGPA 3HLLA 4O27B 2AS5F 3R8MA 1ATPE 2I0VA 3KU2A 1K79A 4OLIA 3DAEA 2HELA 2AC5A 3UC3A 3I60A 2G2FA 4QP2A 2C3JA 2VWBA 3UQFA 1LDJA 1Q61A 3BELA 3I71A 1OI9A 4ZY6A 5EEGA 3W8QA 2VTAA 2W7XA 3ECOA 4KSQA 3DXNA 2Y0MA 4TL0A 3BHTA 4CVAA 3DFAA 1HKTA 4OT6A 2X0GA 3BLHA 4JAIA 1XDSA 3QOPA 3WF9A 3Q9VA 1GVJA 4BHNA 5FTGA 2C3LA 3PVBA 4Q5HA 4YTIA 5J9YA 1QQIA 1Z5MA 5HD4A 2O65A 5I9UA 3PG1A 4FG7A 3NNUA 5IH6A 2VT2A 2R3GA 4O0VA 4D2TA 2UZBA 3HNGA 3NLBA 1IAJA 4YJQA 2NP8A 4HPUE 3QPHA 2W1HA 5HESA 1IAHA 3E6BA 4FTMA 3GUBA 4FX0A 4O91A 3Q9XA 2ISZA 3EFJA 4RC4A 5DT4A 2ONLC 2VD5A 1E2XA 3FJQE 3RAHA 3KXGA 3SHFA 1WZYA 3T1BA 5AJQA 4NFMA 5J5TA 4RIYA 1Q8UA 3ORXA 5C03A 5JRQA 1PXIA 2HWOA 3MWMA 5FG8A 4AT5A 2QU6A 3RK7A 5CAVA 2Q0OA 3D4QA 4Z55A 2GU8A 2YZAA 3W16A 1GZ8A 2GHMA 4EKKA 2JITA 2E2BA 4IAZA 1SVEA 3RPSA 5K4IA 4O81A 5AP4A 3WIGA 2PMIA 4CXFA 3T9TA 4WRSA 2K27A 3RI1A 5HS7A 3H0ZA 4U81A 3KGAA 3T3UA 5GJDA 3FLYA 4I4EA 3REPA 4DLJA 4E4XA 5BQTA 3HOTA 3SDJA 5DA3A 1SD5A 2BZIB 4OR5A 3F5XA 2RG6A 1ZREA 3OY3A 3MESA 5LJJA 4R8HA 5HLGA 2V5QA 1MRYA 3R83A 1YXXA 3PXKA 2JKQA 1IUYA 1OKWA 3WE8A 2VTTA 4EHGA 4ANBA 5DR6A 3ML6A 3A7IA 2EV5A 2FEZA 3BHYA 2BROA 2C30A 2WTWA 2YEXA 3LCSA 4P4CA 2EK5A 2VTLA 4FUYA 4RB2C 4FIHA 4IVBA 5FGKA 1W98A 3AD5A 3WODF 4TYJA 1UA2A 2W24A 5EG3A 2XRNA 4F9WA 2V7AA 2BILB 3RPRA 4F63A 3J7AO 2E9NA 3VC4A 2HXLA 4O96A 2VNWA 4E3CA 3RTRA 1W84A 2LNBA 4BCGA 4XRFA 2SRCA 4GU6A 2P6TA 3DJ5A 4HX8A 4FG8A 5IDPA 5KMKA 3E64A 3UJGA 3FI2A 4O0WA 5C27A 3W2RA 3TDZC 4H1MA 5DLSA 4KBKA 3OFMA 1V0PA 4IBMA 1YDSE 1U3EM 2VZ6A 2VO7A 3ZEWA 4HZRA 1WRJA 4IM3A 4B8XA 3MTFA 4P5QA 3EN5A 1UWHA 3RGFA 5M56A 4XV3A 2W17A 4L7SA 3TNWA 1ND4A 3RHXA 1KU9A 2I1MA 2PZYA 4DGLC 1OYYA 4FIIA 5BMMA 3VBTA 1I1GA 3CP9A 1SNUA 2V55A 3L8VA 2BKZA 2OSCA 3E87A 2XCHA 5BS6A 3IKVA 3P4KA 2PZ5A 5CANA 5AUWA 2C5XA 3EQIA 1X3UA 3FQSA 4ONAA 4AN9A 4XG9A 4W4YA 1PXJA 3WZUA 4RLLA 4MXCA 4ID7A 1YHWA 3AMAA 4BDDA 3KXXA 3D7TB 4DBNA 2ZXJA 4O6EA 4YSJA 3ZLXA 5CAQA 5JFXA 4ESBA 2RQPA 1Y91A 2GIVA 4FEVA 3DZQA 4CTCA 4TXCA 2PVNA 2IRFG 5L2IA 2PSQA 5A6OA 4M9SA 5JQ5A 4QQJA 1A04A 4BH9A 4WCGA 4IJAA 4R6VA 5EHLA 2GNHA 4FT9A 3NYOA 2WTJA 5KMMA 2VUWA 1LUFA 4ZSEA 3F5PA 5LHGA 1JKKA 5IKWA 1YIOA 5EYMA 1JNKA 5HDKA 3K54A 3A8WA 3FV8A 2YLFA 4DTBA 3IECA 5ANGA 4YJNA 4JBPA 1H0WA 3AMYA 1YWRA 3SXFA 3QXOA 3GEZA 4FI1A 4ZXTA 4U3ZA 2ZM3A 2Y48A 1JGSA 4YZDA 4JLCA 4IHTA 1Y0UA 4FV6A 3LFAA 2VONA 2A61A 2QOKA 3QTXA 1H4LA 3TQNA 3Q4CA 5HLHA 2QQAA 4MXZA 1SYKA 3DKWA 5CZIA 4GFOA 2KIUA 4MBJA 3BU3A 3CTJA 2OK1A 4NH1A 1T98A 1UFMA 3ETAA 3ZMUA 1OMWA 1XH4A 4HV6A 2R3FA 3DNEA 4G2FA 4F9YA 3JY0A 4PTEA 5I3RA 1DPRA 2W1CA 2XNNA 5ITAA 1S9JA 3BKBA 3EL8A 5B0XA 4O82A 4RC3A 1YYVA 4XOZA 4GU9A 4Y85A 3HRCA 5DD8A 2F2CB 4BDFA 4EOJA 4L43A 4MTDA 2RFDA 1YW9A 2X7OA 4FL3A 2X7GA 5LXMA 4WG4A 5B7VA 2BPMA 3F6OA 3TOAA 5CVUA 3A7GA 5E7RA 3JUHA 4IH8A 3MFUA 3L8PA 4Y17A 3G3ZA 5IA3A 4GIHA 3R04A 2F2EA 4R1YA 1ZH5A 3A99A 2BRGA 4BGHA 4ZZDA 1B38A 1RW8A 3FL5A 2R7FA 1FVVA 4A07A 4GKIA 1YW7A 5LVOA 2B9FA 2IA1A 4IXAA 2OH0E 5B2KA 1UU9A 3NCGA 2J7TA 4ZLOA 2AYPA 2VX3A 3FUPA 4B9DA 1IA9A 4LB5A 4IZYA 5DEQA 2PVLA 4Y72A 3BZ3A 3D2KA 3J81Z 3QQLA 4GH2A 3CIKA 4C8BA 4KIKB 5HS9A 2HQRA 5E8VA 4EZ5A 3KXZA 2EU9A 4PP9A 2OH4A 4LI5A 5FM2A 1OYIA 5KK1A 4FT3A 3VUMA 2K7LA 5LGUA 2OI4X 2VOOA 3F21A 3RIRA 2X7FA 1W7HA 4FICA 4C02A 2YA9A 3KREA 1A48A 5J1WA 5HZNA 4Y5HA 2UW3A 2PMUA 5ANKA 2QZ8A 3RPVA 5BOXA 3DKCA 5DIAA 3DXQA 2ZNYA 4J7BA 4L7FA 4DGNA 2F5CA 4L45A 3EZRA 5DRDA 4WNOA 3BWFA 1M14A 3E5XA 1STCE 4WBBB 2LDUA 3A8XA 4FTTA 1F4KA 3V5TA 2XS0A 5AM7A 3OMVA 2HWPA 4EOMA 2FUMA 1UU3A 4QMQA 4GJ3A 4JRNA 4EJUA 4IC7A 1UWJA 1TQPA 1OITA 4RRVA 5C8KA 4NFNA 1S3JA 1A06A 2ZVAA 3KP3A 3GW2A 2XKPA 5FLXZ 2BVAA 3BY6A 4EK3A 3UPXA 3Q5IA 4FGRA 1OKYA 2WV0A 5L3EA 2YHVA 4EYJA 4FODA 2LAVA 5J6XA 1J1BA 1R39A 4DINA 3TZMA 1UV5A 1YO5C 5GJGA 4J99A 1UNHA 4MXXA 4U0IA 2D1VA 2RVCA 2RIOA 2XNGA 3CY2A 3ZLWA 2G9XA 3LMGA 5FP6A 3W2OA 2J5EA 4BGGA 4WNMA 3ERKA 4KFCA 2CG4A 2VWYA 5F1RA 5EQYA 4D4VA 4EQMA 3HVCA 4FT7A 2OFVA 5DOSA 5E1SA 4C58A 1L8TA 3O17A 3O6BB 5ICPA 2BGCA 2PG4A 2FNPA 1WBWA 4BDKA 5AP1A 1MQBA 4Z16A 3PY1A 3QRJA 1OL1A 1AD5A 5KUPA 2OBPA 4YJUA 5T3QA 3ZONA 3TUCA 3V8WA 3PFIA 4NL0A 3N51A 3EFWA 3G90X 4CT1A 4IWDA 5IQAA 3EH9A 3ULZA 3GB2A 1VR2A 3O50A 4A5MA 4UALA 4YFKF 2XP2A 3BJ6A 3RK9A 2W25A 2ZJWA 4FMQA 4BTFA 4A4XA 1JHFA 3EETA 1P4OA 1Q24A 3LJ2A 4XSXF 5AIPA 3KK9A 4L9VA 4A9UA 2VE8A 3ZUUA 2BAQA 5D7AA 2W05A 4FSYA 5ILSA 3MV5A 2IJMA 4GL9A 4KN4X 4YR8A 3E88A 4FOBA 1TLHB 3WZDA 5JVTA 2NNWB 4JDIA 3LW0A 3UG2A 4L5IA 4QTEA 4ESJA 2B9JA 4FIGA 1ZARA 1IF1A 4DFZE 3PIYA 2R3JA 4QYYA 3GQLA 2YM4A 5IQCA 4GUBA 2STTA 2R7DA 3BV3A 1SVGA 5EQPA 2VTMA 4BI0A 4GVJA 3VBVA 3O51A 2XBJA 5DT0A 4FK6A 3JPVA 4RGSA 3LFQA 1H1WA 3FE3A 4O84A 4O5VA 4DFUA 2RGVA 2WELA 4USDA 4CSVA 5IT3A 4G3CA 2E7WA 5CVRA 2C6EA 4X3FC 2PK9A 3COIA 2NNNA 5HTIA 3GCPA 4UMQA 1OVEA 4LGHA 1YG2A 4FZ7A 5J8CA 3SZTA 3L09A 4DH7A 4A9TA 5AEPA 3V3VA 5CLPA 4ASXA 3VS1A 1BL6A 4IRHA 2YWVA 4UBAA 4JG8A 1MRUA 2JIUA 2P8TA 4HOBA 4JG6A 3WF7A 3A7JA 3AC2A 3R7YA 3KRWA 1V3FA 3FMLA 4BR3A 3NUSA 3HSEA 1GJOA 5BYYA 5CF4A 1DI8A 1BJAA 4CQEA 4EH7A 4C3FA 5CLSA 4S32A 2OZAA 4II5A 4QPMA 4ANSA 3LCTA 1O6KA 3O23A 2FBIA 4LRJA 5IA2A 3NAXA 3OEZA 3I4BA 3D2IA 3R7GA 4E26A 4FVQA 1FPQA 3S00A 2KIFA 3QZGA 2P55A 1UHMA 4O7YA 3N4UA 2D2WA 5LEKA 2PU8A 4O7NA 3C0IA 1I27A 1HKSA 4M67A 3BCEA 2FRHA 1U59A 3A7HA 3RNYA 4I20A 4PNKA 2W9ZB 5A4LA 4XV9A 1RUNA 2DS1A 5CX9A 4ANQA 5E8GA 1IN6A 4N4SA 3CUQC 1FBQA 4ZTHA 4XRLA 2DQRA 4B6LA 1G5SA 4I7HA 4YU2A 3HP5A 4FV2A 3RP9A 1U54B 4D9UA 5KMIA 3AT3A 3FMEA 5HG5A 4KS8A 2X9FA 3CBLA 5ANEA 5CS6A 3FMKA 3D5LA 1GXPA 5F94A 2VE9A 4NYEA 3DLSA 3RI4A 2ZAZA 5IQFA 4KRCA 4HQMA 4I3ZA 5L3CA 1RDQE 2WQNA 3KB7A 3E63A 2ZDUA 1R23A 1IRKA 3BLQA 1Q1HA 4TV7A 1KU2A 4FKQA 3TKYA 1XBCA 4RB0A 2QOCA 3ODZX 3VS2A 2VWVA 3LCOA 2PMOX 4WA9A 4RQKA 2QO7A 5CEKA 4FTAA 2OQGA 4BYIA 4ESFA 5CVFA 3MCZA 3ATSA 2VO0A 2XV4S 4EOKA 1PP7U 5LLQA 3OW4A 4NU1A 1YI4A 3TKHA 4ZAUA 4U45A 2FOKA 4IX4A 2JBOA 1K7AA 3QD4A 3IONA 2W85A 5HE3A 1TVOA 5D4RA 3U6IA 4KSPA 3FXXA 3WF5A 3PVGA 4AZVA 4QPSA 2P6SA 1YHVA 3T8OA 4U0VA 1OUYA 2PUPA 2JKKA 2YIXA 3TNPC 1BI3A 2ITYA 3BZ6A 1OPCA 1P2FA 1XCVA 2BFXA 3D83A 2NRAC 1O7FA 5HX8A 1IN5A 3CQUA 4XV1A 5ERIA 4YZ9A 3GVUA 1ZLTA 4O0RA 3ENMA 5FRIA 4C37A 3BU6A 4TY1A 5EYCA 1XGSA 3FLNC 3P86A 1I09A 3F72A 4GYGA 4CYDA 4CHUA 5IUHA 3TACA 5DEWA 3CC6A 4FTIA 5DR9A 2V1XA 3FLWA 2XUUA 4U43A 4ZYDA 5LCKA 4J8NA 5AADA 3VS5A 3CQWA 1BLXA 2V6CA 4I0TA 2P2IA 1AGWA 2M5WA 1AQ1A 3GC9A 3FI3A 3AGMA 2H96A 1PXNA 4Y5QA 2YIWA 3U54A 3RYRA 2UZOA 3V7RA 2QBYA 2J4ZA 1F5QA 2Z9OA 5IEVA 4YSMA 4L00A 3IW8A 3I6UA 4FL1A 5BVFA 2QOIA 3H9OA 1M2RA 3TIYA 2WMBA 4ANOA 2VN9A 2X8EA 5ETAA 1EH6A 1NT2A 1OL7A 4RPVA 3O2PE 4G94A 3SA0A 3FM5A 2WU6A 3Q9WA 4RBLA 3FQHA 1HQCA 4GCJA 2VX0A 4I6FA 3F8MA 3QU3A 5AIQA 3F88A 2C6LA 2IVMA 4P5ZA 3RALA 4LGDA 1ZHFA 4JXFA 3BYUA 1JBPE 1FVTA 3HV3A 4UB7A 1S29A 4UX9A 4MWHA 4DF3A 2ESMA 2F7XE 3ORIA 5A4CA 3LAUA 3KLOA 4CG9A 4KKEA 5E8TA 1MD0A 2VODA 4F6SA 2TDXA 4X6QC 3CY3A 2QUFA 5HBJA 4DG0E 3QD0A 3PVUA 4FSUA 3TZ7A 2YIYA 4F99A 1B6AA 3WF8A 3BLRA 3U87A 4KN7X 1G6NA 4HVIA 2JFMA 4KAOA 3TEIA 3I5UA 1K3AA 1F9NA 4M9XA 2QQBA 4JBAA 4WOVA 1OKVA 3R0TA 2OJJA 5CEQA 4JX3A 3OOMA 4D1SA 3KXNA 2F49A 2VWZA 1BIBA 4F65A 3ZQ7A 4L0YB 4H3PA 2YPRA 3LA7A 1RNLA 1ZMVA 1JPAA 2IZRA 3HX4A 4ARKA 2DTRA 4RSSA 4O7LA 4EBVA 2XEZA 3Q5ZA 4A9RA 4GT3A 4AAAA 5JN2A 5AR3A 5L2QA 5L6OA 3D15A 3I0QA 3MPTA 1KOAA 3GZ6A 3WTYC 4ASNA 3DT1A 3Q9ZA 3G9LX 4KKGA 4OGRA 3EYHA 3G9NA 3CKXA 3ABTA 5CJ9A 4MXYA 4AUAA 4L18B 4W8EA 3L8SA 2ZDTA 3PSCA 1UB9A 3Q2JA 3RCJA 2EV0A 4E6AA 1WSUA 3ACJA 2I7QA 4DH5A 5FEDA 2KTYA 2ITXA 3P78A 4AACA 4YLJA 3E92A 3QP5A 2O3PA 4NT4A 4Q9ZA 4O7RA 2XJ1A 2AC3A 3EQFA 2R9SA 4FV9A 3HHHA 4PP7A 4JT3A 3OOGA 5LRRA 3O8TA 2W5AA 4H3QA 2Z99A 2XIXA 3FZ1A 4EJ7A 4M72A 4CLJA 2UWMA 4A0ZA 1FGIA 1M2QA 4OTPA 4HDVA 4FEXA 3WE2A 2FA5A 3RPYA 3MVLA 3UODA 3UO5A 4BZDA 3BGPA 5LGNA 2MC3A 2WD1A 2Y75A 4XV2A 3E8CA 3BYOA 3LSTA 3D5XA 4I09A 3PY0A 2GQSA 4A5NA 2B9IA 3FPQA 2JDSA 3FDNA 4U5JA 5CAUA 4ZYGA 2WAJA 4ACCA 2GS2A 3U9CA 3F9NA 3R4KA 2QG7A 3K3JA 4U6RA 1PXLA 2ZB0A 3LXKA 4AFEA 4DEBA 2MLGA 2XAHA 3K2LA 4M15A 4ZTMA 1OECA 4R8QA 3HYIA 4IVDA 3RZBA 3RAWA 4IX6A 3CE3A 3TUDA 2R4BA 2VNYA 4W9WA 2YIRA 4X2JA 4RC2A 3ZRKA 2FH9A 3FXQA 2VOPA 4UMRA 3U6JA 4CFVA 4BXUA 1MDMB 2WMWA 2NO3A 5F6FA 2IA0A 3F69A 4FSWA 5KKRB 5DVRA 3KC3A 5E1XA 3MIAA 1ZYJA 4GGGA 3FF5A 3K69A 3GCVA 3LFEA 2UZLA 1Z6RA 4MX9A 2ZB1A 4PMMA 4M73A 4D4SA 4ITIA 1STZA 3MS9A 3A60A 3H10A 4RZVA 2ERZE 3PWDA 2Y6OA 5DE2A 2VWUA 3BYMA 3FMHA 1FC3A 4PDSA 4FV5A 2X0LA 2YX7A 1KQ9A 2UUEA 3NUUA 3QX2A 5CU2A 1R1WA 5I9YA 3SZPA 4QTBA 5IU2A 1YWVA 4CZZA 3PTGA 3I7CA 3DGKA 1ZLKA 4OOIA 3TL8A 2FNAA 3R21A 4KIBA 5IQEA 3NNXA 3QLFA 1OBGA 1Y8YA 4O1OA 4WG5A 1DUXC 3C7QA 4C33A 4BVUA 4LJZF 4J71A 2VBXA 4F9BA 2FSLX 4FTKA 3R28A 5FTQA 4LGGA 2C3KA 2B7AA 1WKMA 2GXBA 4EKLA 3P7AA 2YERA 1XR1A 1H00A 1G3SA 5JFSA 3Q4TA 1FYLA 4BBEA 3RWPA 4QPAA 4AW2A 4D4RA 3C4EA 4WXHA 3NZ0A 3V6RA 2OLCA 3HRMA 2XROA 4ZMEA 4EHVA 3MBLA 2GNFA 2C69A 3IK3A 5AV4A 3R01A 3AT2A 3MTLA 3QHRA 3ORPA 1XO2B 4BHPA 2KRFA 5FB2A 5BVKA 5IMEA 5J8IA 4L5JA 2BDJA 3Q4ZA 2RKHA 2DPDA 2H27A 3HRBA 1W8CA 2VRXA 3V5LA 4RX9A 3BGZA 3SLSA 3MJ2A 2Z2WA 1VYZA 3RVGA 2ESNA 2BAJA 1H1SA 1OPKA 2XNBA 3R71A 5TT7A 1GIJA 3V8KA 5CU0A 3ANRA 4ALUA 4LOPA 2B1PA 3NVMB 3FMRA 4CCUA 4ZZOA 3KY2A 4ZIMA 2XYNA 2WEVA 3NW7A 4LMYA 3WYXA 4ZJJA 4FIJA 2BEOA 3D0EA 2QR7A 3VN9A 2HW7A 4K9YA 4AOIA 3GXLA 2ISYA 4F7SA 1EH4A 3UOKA 1ZZLA 1K2PA 3M8EA 3HRTA 2WHBA 3DPLC 5E17F 2QKRA 5TJJA 2ZMCA 3EKKA 3NEWA 4HX7A 3OY1A 3HV6A 5HVQC 5LARA 3EDPA 2ETMA 2P5LC 1U5TB 1UU8A 1YS6A 4KDPA 4AN3A 5JI6A 3AMBA 4IAKA 3MYGA 5EOBA 4I01A 1U6GA 3GWZA 2PE2A 2CQKA 3O7LB 5M4IA 3TG1A 1U46A 3ZSHA 4ZTNA 5HIEA 4U9AA 3RM7A 4AZEA 3V5JA 2XAQA 4NUSA 3C51A 3S3IA 2IZTA 4XLIA 3CKWA 1UHWA 1I44A 3UIUA 2YLEA 1T46A 4H0EA 4FUXA 2CSOA 3LHJA 5AIRA 5IPJA 3OTVA 2WQEA 2CLQA 2Y4PA 5FP5A 3ZOSA 2XA4A 1M52A 3KXMA 1U5RA 3FMJA 1R3CA 5AP6A 4KIOA 3QGYA 3OROA 1ON1A 3HIFA 5D41A 4DFLA 3S4QA 3OXZA 4QP9A 2OU7A 5E8WA 2NS0A 4Q2AA 4XEYA 1Q8YA 3NW6A 2B53A 4J53A 1H1QA 3MQ0A 1FZPB 2YITA 2OA4A 5L3FA 3M7GA 4DGGA 4IVCA 4BBMA 4P9FA 4O6LA 3CR0A 5J5SA 4IFCA 2Z33A 2E9UA 3VUIA 2CLXA 4Y13A 4I0RA 3OWJA 3KXHA 3KULA 2CGUA 3BX5A 3GZ5A 2ITPA 2ITWA 2XASA 4KYWA 2GNJA 3BP8A 4HGLA 3NYNA 3KRJA 1Z9CA 4Y73A 2GAUA 4FSRA 1A9UA 1FMOE 4BDCA 1L3RE 4IAYA 4AIJA 5A4QA 3H3CA 3HDNA 3WZEA 4NSTA 4BBFA 4UYNA 3V01A 3H3UA 1YQAA 4DCAA 4R1VA 1DAWA 4ZOGA 3HMNA 3FMQA 2QYOA 4PDYA 2HEOA 4HVHA 2XGXA 1XWSA 5GHVA 1IXCA 5J1VA 4J97A 3BROA 2HENA 3VQUA 3Q96A 1QPMA 3R1QA 4HYSA 4YZBA 5AR2A 3MVHA 1B4AA 2RKUA 3B8RA 3WYYA 2O03A 2O61A 1IRGA 4H58A 3CLYA 4LQMA 2V9VA 5FEQA 4UZHA 3ZFYA 3LIJA 1ZN2A 4BCFA 2B4SB 3BQRA 5IZFA 3C4WA 3MIYA 3KEQA 4APCA 5L2SA 3SKCA 4O3MA 2YU3A 4Z9LA 2ZKZA 3GC0A 1MJBA 1H0VA 4JVGA 5CVVA 3ZYAA 5GZAA 2CGPA 3O3KA 1O57A 4BDHA 2NPQA 4HJOA 4MK0A 3TIZA 5JFWA 2FBKA 3DAJA 3ZH8A 2CGXA 4I0BA 4G8XA 4QD6A 3DCVA 1KSWA 1NXKA 3QXPA 4FV4A 3UOLA 1ZY5A 2H8HA 4CEGA 3EOCA 4EH6A 3W2PA 3ZMMA 4QMNA 4TTHB 4FC0A 1BI1A 2A27A 4QMWA 2Y9QA 4NIFA 4DH8A 2BKKA 2PMHA 4CDGA 5E20A 4USEA 2CGVA 1PMUA 3I59A 3PWYA 4PX6A 3KQ7A 5BX0A 4KBCA 3FMSA 4RA5A 4KIQA 4ZSJA 4MBLA 4I22A 1LDDA 3RINA 3BDDA 4HBLA 3TKIA 3SQQA 4FNXA 2UXXA 4QMPA 5H6RA 2IA2A 2RGPA 1R00A 5KNJA 3PJ1A 4FKIA 4RB1A 3DV8A 5DCFA 3ZS5A 4HVDA 5F64A 1U54A 4IZ7A 1IXSB 4OIPF 4L46A 3PSBA 3M1SA 5IQGA 4FIEA 4DC2A 2J6MA 1SD7A 3V5QA 4TYIA 1GZKA 2FB8A 1YKRA 5EI6A 3AQVA 5BNJA 3NUXA 2CPKE 3C7JA 4UEUA 2XHKA 3MFTA 5HBHA 1OIRA 5ETIA 3GFJA 3HA6A 4KUJA 2I0HA 4WKQA 3LFFA 3ELKA 4NB5A 1W7PA 3ORLA 2LF8A 4O6JA 5EH0A 4UHTA 3FXWA 2C0TA 3W18A 4O38A 2PVKA 4OTHA 4L52A 5LMAA 4FT0A 5FUTA 3GQIA 3K3IA 5DUIA 3GFWA 4YJOA 4C4IA 4RJ8A 3GT8A 5AAFA 1G4DA 1WBOA 3C5UA 1FP2A 3I1AA 2J5OA 2R3RA 2XIYA 3C4CA 4PPAA 2I0YA 4IJ9A 2PLYA 4XBRA 3P1AA 4BICA 1BI7A 4B0GA 3GLXA 4CGZA 3CTHA 3SX9A 3KRXA 5E8XA 5M4CA 4G7OF 1W5TA 1XGOA 3G73A 4J98A 3UO4A 4DFBA 3VS0A 1O6YA 1JOWB 4ENKA 3AGLA 1GAGA 1H24A 4RVMA 4D5KA 2O3FA 3ISPA 4F1OA 2EB7A 4FTCA 3LFCA 3QU0A 2CNUA 1WI9A 3FKLA 4EK8A 3VJOA 1E1VA 1Z6TA 4OINF 1JLUE 5C01A 1LEWA 5TE0A 2DPUA 4WG3A 2W0JA 2CKPA 4G7ZF 1Q8TA 3UNJA 3JR1A 3S0OA 3JW4A 3TO7A 3TNHA 3DXJF 3HZTA 1QO0D 3FXZA 4IC8A 5D10A 3PZHA 5CWZA 3MN3A 2RSVA 4HF1A 4MYGA 3W8LA 4OMZA 2W1DA 2R2PA 4I21A 4ACHA 4UY9A 2IN6A 3BQCA 5HGIA 2ITOA 1FMKA 3OEFX 4MQVA 1XGNA 2OU2A 4U80A 5E90A 3FKOA 4IWOA 4MNEA 4O0UA 1QPJA 1OL2A 2GMXA 1URWA 1C0WA 3SC1A 5K5OA 5EM7A 5LOHA 3TNIA 5AV1A 4IZAA 4F6UA 1P4XA 4RIYB 4IE9A 3P9CA 3POOA 4HNIA 3BWGA 2WQOA 4ITJA 5D12A 2VC1A 2QQ9A 5IQHA 3HHGA 4E20A 4DFYA 2PVRA 1U5TA 1W7PD 2X4HA 2EB2A 2QLQA 1Q8WA 2HGCA 1FSHA 4XH6A 4JRVA 3RJCA 1GY3A 3PXZA 1WBPA 2BV6A 1YLFA 2GDOA 3GFLA 4CD0A 2YCQA 2UZEA 5CSPA 3LQQA 4QNAA 1Q4LA 4I5PA 3R2BA 2GTMA 3NCZA 2QVOA 3NQOA 3QBNA 2XB7A 3BJAA 2FO0A 5JGBA 2XNPA 4MH7A 4UYAA 1LPUA 3DJ7A 5F9EA 3LQ3A 3TOBA 3QX4A 2R0UA 3UPZA 5DH3A 3KZYA 3KCFA 2XKDA 2XIKA 1ZOHA 4XUFA 5CT0A 2HZIA 3DF8A 2YCFA 4ACGA 4O7TA 1CDKA 2F5EA 4RJ5A 3ZMTA 2ERKA 5I9ZA 3SG9A 2UV2A 4I4FA 4BB4A 5BPIA 3QD3A 1PXPA 1Q97A 3GBZA 1XDUA 3KF4A 3EN4A 3A61A 3FZVA 2F9GA 1RE8A 4CT2A 4DHFA 4TN6A 5CNOA 4C0TA 4YHTA 5KZ0A 3KCCA 4MQ9F 3LAPA 5ICFA 3CJFA 3R22A 4R7HA 4GUEA 4TPTA 5KHWA 3OC1A 3W1FA 4GFMA 1PXKA 2EXEA 3QCYA 2P7CB 3I54A 4NW5A 3FZOA 5JZNA 2F5DA 3DJ6A 2GNLA 1MUOA 4RWLA 5IUIA 4M0YA 4QQCA 3A4OX 1NW1A 4EOQA 5HS8A 4AZWA 4FK3A 5AMNA 4FZDB 2WMUA 3TTJA 4U42A 3VRYA 4FZFB 3CUQB 5DHJA 4E5WA 3PY3A 3ZN1A 4I5HA 2QLUA 5FGMA 4XSZF 2JDOA 1H07A 1PMNA 5K0KA 4L9NA 3T9IA 5HNIX 3NR9A 2WIPA 4DGOA 5L6WL 5HD7A 2IW5A 3JXWA 5DV5A 2AUHA 1ZYRF 2YN8A 3GU4A 1B9NA 3L9FA 2EFQA 4GVAA 4PNIA 3ORNA 3KE2A 4KIGA 4RMZA 4YTFA 5AR7A 5LBQA 5I5ZA 4DFNA 5JHUA 2IVSA 4OBOA 1V0OA 3CXWA 3VFZA 2RFSA 5BPYA 4XOYA 5EYDA 3EQLF 2QONA 2ZMEB 1NVQA 4RX5A 3EMGA 4WX9A 3ZFXA 3ZO2A 1S7OA 4GXOA 2YACA 4NJ3A 1S8NA 2O5KA 2WEIA 1LEAA 4CTBA 4CYJA 3MA3A 2BMCA 3NWWA 3TI1A 4RX8A 1B39A 3DKOA 4FA2A 4Q48A 3NX8A 5CASA 3M8FA 2EA2A 4FF8A 3COAC 3EWHA 3F7ZA 5CSXA 3V8SA 3V8JA 4XG6A 4Z7GA 1WMKA 5L4QA 3COKA 1T45A 4GCVA 3HMPA 4AU8A 4NM7A 4UXNA 4QP3A 4E5BA 4YFXF 4N6ZA 3MJ1A 5DWRA 3R8VA 5JH6A 1YW8A 2X1NA 4ZEGA 2A2AA 1PRYA 3NIEA 4EHEA 2Q0NA 2HW6A 3CS9A 3NEUA 4AT3A 2WTVA 2GNGA 3OCSA 3U1DA 2IZSA 4BWXA 3KRRA 2EV6A 1FGKA 2JAVA 4U0WA 4BCIA 1IEPA 3DP7A 2VTOA 4ALWA 3H9RA 4R3CA 3VUTA 4EEVA 3B8QA 5EW9A 1JQHA 4BAYA 3ELJA 2B0QA 5D8LB 4TZRA 1BOAA 3KMUA 4YTCA 3NS9A 5ANJA 1H9GA 3SW4A 4EMSA 2OD5A 4X3JA 2XK7A 2DQ7X 4BDIA 4U3YA 2ETKA 5L2WA 2X2MA 3E62A 1R22A 1QPEA 3T0YA 2J0IA 2ITVA 3CTAA 3M11A 4QRCA 1PUEE 4ZZMA 4G6NA 5TR6A 3P9JA 4RIXA 5K5XA 4YZNA 4EONA 1GIHA 5DYJA 4C61A 2QOFA 5ACKA 4LD5A 5IF1A 1L3LA 1PMEA 4A4LA 4QTDA 3KF7A 4OBPA 2ZFWA 2PEXA 4UWBA 1OKZA 5E1EA 3C5IA 2E9OA 4YZMA 4D2VA 2OXXA 3QFVA 3MDYA 5KMNA 4XRJA 2W06A 4IAIA 2W57A 4X7QA 2OIDA 5DR2A 3PXQA 3SG8A 4GO1A 3ZEPA 1Q41A 4G16A 3T8RA 3FLZA 2EXCX 4TT7A 3FBVA 2UW5A 3KMMA 1LNWA 2HOEA 4YO4A 3IDCA 3RKYA 3G6HA 2K4JA 3AT4A 3G15A 3LOKA 4P9UA 4KIKA 4KB8A 1HXDA 4AD9A 3DK6A 3GFIA 3FMMA 5LMBA 2W1IA 1FY7A 3QRTA 5HOOA 3BGQA 2ACXA 3MWUA 3QQGA 1SMTA 4FL2A 4G7HF 5IA1A 2EUFB 4J8MA 4O1PA 1OUKA 4HGSA 3QTSA 4G3DA 3HUGA 4QMMA 2ZV9A 2VX1A 4DGMA 4Q4ZF 4CV8A 1SZMA 5I3OA 5JT2A 3NUAA 3VHKA 2O8YA 2WTKC 5HX6A 5DCMB 3PUPA 2O6GE 3Q4UA 4HCVA 3ZC6A 3VJNA 2NRYA 5LQFA 2ZBKA 4CXAA 3TGNA 4X6RA 2O8XA 1ZOEA 3ORTA 4KT5C 4BTJA 4DAWA 1O3RA 3V7SA 2EXMA 4QTAA 4U88A 4DLIA 4I92A 2W1GA 1XMKA 2V79A 3JTGA 1IRFA 3IOKA 2X6EA 3NUNA 5DG5A 4E70A 3T5XA 1XN7A 3R9DA 2GTNA 4FOCA 3DPTA 5K5QA 4U7DA 1YXVA 3SQNA 3D14A 1LP4A 2W1FA 3IG7A 1T38A 4UMPA 1W83A 5HLWA 4HVSA 4LG0B 4AGWA 1KWPA 4QO9A 3UNZA 5CVJA 2QO2A 2DU9A 2Z7QA 4IM0A 3AC1A 4C4FA 2Y0AA 4EUTA 1U4DA 2FQ3A 2X8IA 4FKGA 4GSBA 4O0XA 3QGWA 1ZG5A 3ALOA 3U8WA 1YXUA 5CI7A 4ENMA 4KA3A 4BKZA 2YDJA 4QMVA 3FXUA 4L8MA 2J2IB 2DBBA 2PMNX 4OAVB 5KO1A 3QTIA 2DK8A 5TF9A 4M69A 1SFUA 4OTQA 4U8ZA 2OG8A 4WUNA 2DQLA 4FT8A 4EH8A 2L01A 3TV7A 3R8UA 1CM8A 5CTPA 4EC8A 4MGRA 1FLIA 2MH2A 4I94A 1O9UA 4AZTA 2XM9A 4FTUA 1U2WA 3HV4A 4IQ6A 3H0YA 2GZWA 3D5VA 3D5WA 4L6QA 4RVTA 2WKMA 2A5YB 2DW4A 3UOHA 3K0LA 1E9HA 4E6QA 3HOSA 5M44A 2XJ0A 4HCTA 5FEEA 2F57A 4IANA 4U7ZA 5HHWA 4U44A 3FYKX 2ETHA 4I41A 4RIXB 3KFWX 3VB2A 3SFZA 3OXIA 1QPDA 3FSKA 2JDVA 4PF4A 1OL6A 2OXYA 4A9YA 1G3TA 2F7ZE 2QNJA 3KMWA 5KMOA 1FPUA 4DFXE 1QCFA 1SVHA 5CY3A 5CU3A 1T39A 2Q83A 2WFYA 2IPXA 1ZMWA 2HXQA 4E4MA 1LEZA 3ZMZA 3UO6A 3VF9A 3IRRA 4UWCA 2QD9A 2VTJA 4Q5EA 2W96B 3R8ZA 2I0EA 4K11A 4Y46A 4CO8A 4HGTA 3ALNA 4HF0A 3FY0A 3G51A 4HLYA 1BM9A 1FSEA 3IDBA 5D9HA 2J0KA 4K18A 4YGAA 5K5NA 1F1ZA 4G34A 2W4JA 3ROYA 5AV2A 5FFZA 2GFCA 5H20A 2VXZA 3TDVA 2W99B 3RKBA 3E6CC 4BKJA 4XBFA 4KA4A 4PL5A 1SD6A 3FHIA 3RJPA 5BVEA 1D8KA 3DY7A 1OIQA 4EOSA 4WXDA 5G1XA 4BI1A 4G6OA 4AS0A 3MA6A 5KE0A 3EFKA 4OTDA 3ROCA 2C6IA 4DITA 5F20A 3E3VA 4I6HA 2H09A 3BE2A 3CGOA 4D2SA 4DEDA 2R3SA 5L3BA 4RJ3A 4MTEA 3LFKA 2XVDA 3UE4A 3EQPA 3QA0A 3UTOA 4EL9A 3HL7A 5M4FA 4DH1A 3PP0A 1J59A 2P5KA 4GT4A 3W2CA 5DI1A 3E8NA 2GWRA 3FKNA 2OIBA 3TO6A 2VO3A 2M87A 3I64A 4XG4A 5H6QA 2WOUA 4X2NA 4GKHA 5K0XA 3II5A 3TV6A 4S33A 4JIKA 4FIFA 4FSNA 1HBXG 1ZRCA 3O8UA 3DBEA 5IH5A 5AX9A 4PPCA 1KUTA 1WBTA 2GHGA 4C4GA 1BIAA 4QNYA 3HKOA 1J7IA 5BQ0A 4RAZA 3B02A 4HOKA 5EI8A 4E5AX 4CZTA 1IW7F 2WTEA 4NKSA 3KA0A 5HU3A 2FMLA 4K1BA 4GJ2A 1KQ8A 4EC9A 3CJNA 3UVQA 3HTSB 4F7NA 4N9HA 4F70A 4CYIA 4C38A 3ULIA 3IGOA 4RA4A 3OD6X 5DEYA 3PE1A 4FTQA 4MF0A 1XSDA 3KP7A 2Z8CA 5M53A 4K33A 2XAJA 2XEYA 4F1MA 4WUAA 4M71A 1FYKA 3QTRA 1KU7A 2J50A 1USSA 4X3FB 2QOBA 4AW5A 1QMZA 1TQIA 4O7WA 4L67A 1EH8A 4X21A 2PPQA 3UBDA 4RGUA 5A14A 4DEAA 2UXNA 4G31A 3UVRA 1L0OC 3HUCA 4ZY4A 4JAJA 4G9CA 2VU3A 4FKPA 1ERKA 4IZ5A 2B55A 1TQMA 3QL8A 5GIOE 4AXAA 1BMKA 3NGAA 2V1DA 1V0BA 1D3YA 4YP8A 3PIZA 5E8UA 4FVRA 3ID6C 4PCQA 1U5TC 4JL9A 4NCTC 2ADUA 2BTSA 4C62A 1IAWA 4IADA 4MBIA 4QTCA 4AA0A 5A2QZ 3F3UA 1OPJA 5G6VA 3K1MA 2VTIA 3V8LA 5FD2A 3PFQA 2WTKB 1DDNA 2XF0A 1KU3A 3TN8A 3CDHA 4EOPA 2C0OA 3R0JA 5LVMA 2BRHA 3EFLA 1XH6A 3QQKA 2GCDA 2X4ZA 2EA4A 3WTWC 4M66A 4XHKB 2Y4IC 2YZLA 5A3XA 4YNOA 2YM7A 2UZNA 4Z2YA 4B8MA 1PJKA 3SAYA 3F6VA 4TWPA 3IRQA 1FOKA 2QOLA 1CF7A 2Z3YA 2XM8A 3KL8A 1BI2A 2WTCA 2FGIA 2Z7SA 3LPBA 4UV9A 2WC2A 1APME 2YWPA 3IW4A 4ENYA 3LKMA 2ZO4A 4O86A 2P7VB 5DCMA 3ZTXA 3WIKA 4LOQA 5L3DA 1TTYA 4HLXA 1MRVA 4WNPA 3BBTB 3ZMSA 4LUDA 2JSCA 3WZJA 3KVXA 4L9TA 5KBQA 1OPLA 2OICA 3V5WA 2HQNA 2XIRA 1K6OA 1G3NA 2R3QA 3FZPA 3VHEA 3ZMDA 3NPCA 4WK8F 2IW6A 3C1DA 3LM0A 4V0GB 3S95A 5AUZA 2HTSA 4FV7A 1XCBA 4XMOA 4DNCA 1PYXA 3Q2MA 2RV8A 5DMZA 3MPAA 2P5VA 4BNCA 4AZFA 5E8ZA 1T2KA 4RQVA 5CXHA 4CG8A 4ZH4F 1QZYA 4O2PA 4IHSA 2I6LA 2ZV2A 1R1TA 4B99A 2GHLA 1YS7A 4BCJA 1Z91A 1TNSA 3KZZA 2GA2A 4YBKA 2C6KA 3BYSA 4LL5A 4M9ZA 3W33A 1R36A 4H1JA 4QYGA 5JMSA 3DQVC 1M7QA 3QQHA 4ETSA 1ULYA 2HS5A 2IWIA 4L01A 3KCKA 2UW9A 2COMA 2J51A 5EEHA 3I7BA 1KYWA 2CKOA 3NUPA 2KJCA 4QMYA 4UV8A 3ORKA 4JG7A 5KMJA 4TYGA 4IACA 3ZO4A 5EM8A 4YNEA 2E1NA 3ZBFA 4IB0A 1TNTA 1DM2A 2Z7RA 3DBFA 4U41A 5KVRA 5A46A 2W4OA 3DEUA 3FAAA 4G1WA 2WWYA 2DI3A 3ZCLA 2J90A 4TNDA 4M14A 4AGDA 4BL1A 3JY9A 2OBJA 2V22A 1IZ1A 1NA7A 3GU6A 4BCMA 4JQFA 3NAYA 1SMYF 5CU4A 4BIEA 5HOAA 3P7CA 1EV7A 4D28A 3FXRA 3ZUTA 4RJ4A 4MD8E 2WMVA 4YMJA 2V7OA 2O0YA 2VT3A 4A2UA 3GYHX 3U9NA 2ESHA 3BJOA 3MW1A 4B7TA 4TW9A 5LGTA 5FTOA 5K3YA 2CKEA 4NZWB 3MH0A 4A4OA 5DPVA 2REIA 5H8GA 4WSQA 5ILUA 3E97A 5ICEA 3LMIA 1KE6A 3KVWA 2OQRA 4TWNA 4I6QA 3MY0A 4EV0A 3R1YA 3EIDA 4BCOA 2LF7A 2UZWE 5IQDA 2BZJA 4M3QA 5D11A 4FV0A 5ACBC 4E7WA 2BDWA 5EW8A 2ZOQA 3QQUA 2XIZA 5LWMA 3HP2A 3FY2A 4Y83A 4WNKA 1J2XA 2X39A 2XK8A 3FC1X 3NYVA 5HBEA 4MVFA 4CZUA 1JAMA 3BPRA 3C1XA 3R00A 5CSVA 1YW2A 3MZHA 2C68A 3IOPA 3DQXA 1UVRA 1K78B 3JVRA 5CZHA 3QRKA 2YJSA 4ORKA 1GHCA 4XG8A 2JEDA 5CQUA 2PMLX 5LWNA 3V51A 4ASEA 4U40A 2E7XA 3IGGA 2XNMA 4G17A 4LRMA 4M97A 5KMLA 4CMUA 1F0QA 3DS6A 4Y15A 4HCUA 1REPC 3NYXA 3JYAA 3F22A 4DEIA 4V01A 1IG1A 4HZSA 4FKSA 4GYIA 3C50A 4ERWA 1SD4A 3SXSA 5CEOA 2QM3A 4AOTA 4DBXA 1Z9XA 4A0YA 4EH3A 4I0SA 5FLFA 2WPAA 3UMXA 4V05A 5CVHA 2Z02A 2IVUA 4G6DA 3GEQA 4AOJA 5E92A 4ZZLA 4ZLYA 3CCNA 3OXTA 1ZYCA 4YG2F 1M7NA 1J5YA 4A6EA 1OL5A 3WTTC 1FX7A 1ZGJA 4ANLA 1SFEA 3EN6A 4FNZA 4YJSA 4IPAA 4UVAA 3HMOA 1V4RA 3LCKA 3F3WA 2XMYA 2JC6A 4WXCA 1J9IA 3PP1A 2H9VA 3JSOA 2OO8X 2YM8A 4NTTA 2JDTA 1J0RA 3HSRA 4L68A 2YM5A 3F8BA 4AVPA 2XNEA 3U55A 2CW0F 1T6SA 3NDMA 3PA4A 1R58A 4W9XA 3Q53A 1E17A 5FD6A 5I0BA 5EDRA 2XK3A 4I98B 5FXQA 4E4NA 1MGTA 1ZYSA 3ATTA 2V1UA 1CF7B 5GZ8A 1IXRC 2PI0A 2PVFA 2H34A 3PA3A 3MI9A 4L9JA 2A6HF 1TKIA 4BWKA 4R5SA 2G1TA 4RWJA 3A62A 5CQWA 4FG9A 4M0ZA 4MHAA 4KIPA 5ED4A 4CMTA 2HCKA 4H39A 5IA5A 4GIIA 2H6CA 1ZG3A 2R0IA 4LB6B 4LLNA 4FZAB 1RZ4A 4M69B 2Y6MA 3ET7A 3ZN0A 4WD5A 3D0SA 2YAAA 2C1BA 3SXYA 2GS7A 1H9TA 3QYZA 5J7HA 3LM5A 5C8NA 4O7ZA 1PKDA 4WWCA 5H3QA 5AP7A 2UVXA 4S31A 1YWNA 4EHZA 2FVDA 4ENXA 1M17A 4GW8A 5FD5A 3OBGA 3PVWA 4FZ6A 3EHAA 5A54A 2P33A 3ZUVA 2PZRA 3FLQA 3SD0A 3ZC5A 2BR1A 2C5YA 5E1WA 2JKOA 4K2EA 4UUVA 1DI9A 3P9IA 4IF4A 3CSVA 3TWJA 4PQNA 1O7LA 2FSOX 3PPKA 5IT9K 1J7UA 3MFRA 3LJ0A 5CNNA 1REJA 3AOXA 1WQ2A 1RUOA 5FBNC 4JQEA 2OZUA 1FYMA 4D2PA 4P55A 4DEHA 2LSOA 2YX4A 3R7UA 4FSTA 3C18A 3FL4A 3EN7A 1XH9A 4AF3A 1UKHA 4MTAA 4D1ZA 5E9EA 4EYMA 3UC4A 3THBA 4C3RA 3GENA 2YISA 4EJTA 3LFNA 5HVYA 1KGSA 3Q9SA 3F5GA 3E8DA 5FQDC 1U8RA 3LA3A 3QHWA 3ODYX 4FV1A 1WVWA 5D5WB 1FP1D 3U4UA 4BYJA 1PXOA 1HW2A 3RHKA 1B9MA 4ZYHA 5HORA 2Y7JA 5IQBA 2X8DA 3BHHA 4ZSAA 5JGAA 3DDPA 5L3AA 1PP8F 3R8PA 3QTUA 1H28A 2M45A 1XH8A 3H3ZA 1LVAA 4PPBA 5HTBA 2JT1A 4MNFA 3RZFA 1H0MA 3LJ1A 2MH9A 4ALVA 4RVLA 3AC4A 3FWQA 5AP5A 2ACJA 5KBRA 4QMTA 3QTQA 1FVRA 4ZS0A 3R9RA 4PDPA 4HA8A 2R3PA 3GOKA 1BUHA 4M7IA 1RIOH 3P7BA 4D5HA 4HVGA 2C3IB 3QRUA 5FM3A 4NTSA 3SOCA 2JDRA 1J7KA 3NSZA 3NUYA 1CMKE 4PY1A 4HGEA 3E8EA 4BIBA 1CKJA 4XBUA 4FV3A 2GA1A 2L3DA 4I1ZA 3D94A 5HG9A 3GC7A 4A12A 2BHEA 1YTYA 3EJ1A 1P4AA 4LYNA 4P5OA 4WIHA 5AIKA 3TTIA 2X6DA 2L4MA 4QLCU 4RB3C 2FYSA 4AGUA 3ERED 1JKLA 3ZDIA 4IX3A 3I79A 3PJ8A 1IASA 5DD4A 3HYHA 4KICA 4S04A 1K78A 2DT5A 2WMXA 4LG0A 5HLNA 3C4FA 3QWJA 2VWIA 3FEGA 4RWIA 5IH4A 3GUDA 1QZZA 1PXMA 2YABA 3LLAA 3GFMA 3H92A 2FA2A 3KP6A 1KV1A 2EFNA 1FNNA 5HVJA 5JZJA 4XLVA 4EZ7A 1YRPA 2A1AB 3K1PA 3DTCA 3EYGA 4OMYA 4OTRA 4O7SA 3W6KB 4A9SA 1ZRZA 2R64A 4TYHA 3F61A 2R3HA 4BDEA 4B8LA 1ZYLA 3VBWA 4JDHA 5AAGA 1NVRA 4BZOA 4GFGA 2JLDA 4PUZA 4X3FA 2JPBA 2ETRA 2QURA 3F3ZA 3KRLA 2BCJA 3LLTA 5I9XA 2X2KA 3DPKA 1WVYA 3WE4A 4AW0A 4C2VA 4EH9A 4KWPA 2XKOA 3MFSA 2BRNA 1WAKA 3FPMA 4MD9E 3RK5A 1UCRA 1JE8A 2BDFA 1NVSA 4IX5A 3PLAE 1G3WA 1ZY4A 2QC6A 1YXTA 2O64A 3OWPA 3FZTA 2QU5A 3RKWA 2CMWA 5CYIA 2OIQA 2BUJA 3QWKA 5IA0A 5ICCA 4AW1A 4X2GA 5KHXA 2W84A 5CT7A 2ELHA 3UIMA 2FF4A 3QUEA 4IJPA 3UQCA 5JGDA 4XJ0A 4EQQA 3KP5A 1H8FA 3R7EA 4V04A 3QCQA 4MKCA 4ENJA 3ZLYA 2XKFA 1ZRDA 1W7PB 3O96A 4C34A 1YOJA 3GOPA 4C59A 4PV0A 3GFEA 4NCTA 4AZSA 4D4YA 4J96A 1SM2A 5LCJA 3N97A 3GI3A 4HYIA 5IT9Z 3EYYA 1PHKA 3UGCA 1XHAA 5BUJA 2IP2A 5JK3A 4Q5SF 4ERKA 5CSWA 3R02A 2EB3A 3SRVB 5HU9A 2QR8A 4D0WA 4EH2A 4MQ2A 4IAAA 1PY5A 3DB8A 3IW6A 2C6MA 3FI4A 5FWKK 1FBNA 1I1SA 4FVPA 2CYYA 1ON2A 4O21A 4W4WA 2VO6A 4YJVA 4WT6A 5AA9A 4OW8A 3EYIA 5M4UA 4NQWA 4XG3A 5IG1A 3GO5A 5H8EA 3CQEA 2YAKA 4JJRA 2YDIA 2VTQA 5IEYA 1I6XA 1NHAA 3RDIA 4RJ6A 3HGKA 3PPJA 3R9NA 3QKMA 3WF6A 5DYMA 2JFLA 1DP7P 4YJTA 4ZSLA 3WBLA 1WCCA 1VEBA 2JKMA 2R5TA 4W4XA 1H01A 5AUXA 3COMA 5M06A 2K02A 5CYVA 3BHUA 3QAHA 3DXPA 3COHA 3JVSA 4L3LA 2GNIA 3IQ7A 3JAMZ 3J80K 5GJFA 3FX3A 3EQBA 3A2CA 4JR3A 5I4NA 3R6XA 1BC7C 3HTUA 4Z7HA 3LMHA 2XBAA 4FEUA 5FFXA 5HE2A 1E1XA 2PJPA 4HPTE 1PF8A 4F0IA 4FR4A 3WARA 4IEBA 4CLIA 1W4MA 1XBAA 2JZYA 2QQ7A 4BDJA 1Y57A 5IUGA 1B1BA 1PW2A 4A06A 3R1SA 2O2UA 3D9VA 2HKOA 5TOZA 4ASZA 4OU0A 3CTQA 2DLLA 4F9AA 3IDPA 1J91A 1SMHA 4YIFA 3HAVA 4UN0C 3TZ8A 3QZFA 1J1CA 2M30A 4M74A 1HCLA 3N4VA 5EI2A 2P2HA 4G5JA 5HQ0A 4EH4A 3L8XA 3FC2A 4ZJIA 2AXLA 2YFXA 3NNVA 4C36A 4F6WA 4XNEA 4O0SA 1QBJA 3VS4A 3C13A 2Z7LA 4BCHA 1BX6A 2JRTA 3CLOA 3PQKA 4KNYA 3QC4A 2X2LA 2C6TA 3ZM9A 2UW8A 3AC3A 1Y6BA 3BV2A 4CMOA 4IRIA 2HYGD 2PUNA 2RF9A 3L9LA 1KE8A 4FSQA 4FNWA 2IPQX 4BHCA 4K0YA 3VAPA 4PGGA 2R3KA 2QOHA 5AR4A 2PWLA 2CWEA 4E4LA 2B9HA 2W9FB 4K2RA 3G2FA 5AM6A 4BC6A 2HYYA 5CVIA 2HK5A 1MDMA 4UVCA 3NMUF 1FT9A 2ITUA 5L2TA 2UZDA 3QPTA 3U4WA 4YTHA 3CUOA 3PZEA 5A4EA 2R7IA 5M07A 5JFVA 5ETCA 5HCXA 4FTLA 4HAMA 5HICA 3NW5A 1F3MC 2DUVA 1O3QA 4OIRF 1G3YA 4FSMA 2XKEA 4UV0A 3ITZA 1YXSA 1Q8ZA 4YPSA 4QMZA 5HE0A 1PMVA 5HCYA 3VS7A 5D6FA 4BDAA 2H94A 3SRVA 1H1RA 5K9IA 3DAKA 2WTIA 4OIQF 3LWFA 3NRMA 3WTVC 3MH1A 1IA8A 3GU7A 4DEEA 3IL2A 4KS7A 2IZUA 2JGZA 2NYXA 5LHIA 2GQGA 4RX7A 2BRBA 3DQWA 1CTPE 4CRSA 3L1SA 3E5AA 3VUKA 4MXAA 3UMWA 3P79A 4G9RA 1ONVA 2QOOA 2FU4A 1OYWA 4EK5A 1JXSA 2JBPA 4XLPF 4TWOA 4PZJA 3IC7A 3Q3BA 4EM2A 2PTKA 4FKRA 4PRJA 3CO7C 3O8PA 4LK0F 3PXRA 4MF1A 5H9BA 3DTWA 4G3GA 3ENHA 2IG7A 3B73A 3VS6A 2RNJA 1Y8GA 1VYWA 3HUBA 3Q6UA 1SFXA 2X9EA 2RFNA 4RAYA 4FYOA 4R3RA 1CGPA 2BIYA 3AD4A 4BFMA 2XK6A 3LAJA 2IO6A 2WB8A 3I81A 4LUEA 3G33A 4TYHB 1OKRA 5BVOA 1BBYA 4MXOA 5DDGA 2UZUE 4F7LA 4RT7A 3QUDA 4ZTRA 5M57A 4UZDA 5HNGA 2PVJA 4FEWA 3PG3A 5LRSA 5D7VA 3DKGA 1HSJA 4M6XA 2HY81 5LMKC 2EFPA 2PZPA 4L0ZB 4RJ7A 5LHHA 4YZCA 5CAOA 4C2WA 2FMYA 4AP7A 2HZTA 3Q5FA 3DFGA 4UXLA 3ZSIA 4PDOA 3G6GA 1RI7A 3L9NA 3ZP5A 3MEXA 3OTUA 3AC5A 4NJDA 4R7IA 5CI6A 4OTFA 2JIIA 5M55A 2XIGA 5D1JA 3NRVA 3WG9A 4EQCA 3QQFA 1PDNC 3CPBA 4UNOA 1B6CB 4XP3A 1OR7A 2KKOA 3W2SA 3JSPA 4S05A 2Z5UA 4N70A 3SV0A 3BPVA 3WZKA 3F3TA 2V62A 4A6DA 4DQ2A 2UZTA 5HTCA 4YC6A 4KINA 5ANDA 4GK2A 5IQIA 2IVVA 3NVKI 3UZRA 3WILA 4LV8A 2FSWA 4QMSA 4JI9A 5C9CA 4ZS4A 2PN6A 1HSTA 4JX7A 4EM1A 3F7WA 4EH5A 3LCDA 3UIXA 4QYFA 4A0XA 1Z57A 5EKNA 3MFKA 2DAOA 4G3EA 2P4IA 5CVGA 3HV5A 3CPCA 4L3JA 4MAOA 4DYMA 2KULA 3PJCA 4YURA 3TT0A 2FBHA 1H08A 5JR3A 3TM0A 3DBQA 4JQ7A 3QRIA 3MY1A 1JKSA 5DRBA 4MD7E 2XK9A 3QAME 2DK5A 2G2IA 3R9HA 4M12A 1ZLJA 4XS2A 3E3BX 4AA5A 2DYLA 2PQ8A 4EQUA 4MEDA 5JRSA 5AUUA 3E5QA 4JNWA 4GG7A 3LVPA 5FXSA 2QOQA 2YSRA 1QPCA 3KEXA 4FYNA 3N9XA 4D2RA 4H36A 2GFSA 2QBYB 2F4JA 4W8DA 5A9UA 1Q3WA 3BIZA 3BOQA 1ZMUA 5EM5A 2PHKA 3FMDA 2W1ZA 1OM1A 4J1RA 3RWQA 3DU8A 3GU5A 4Q47A 3FWEA 1ZXEA 1TBXA 2M8EA 2EWNA 1O3SA 4H05A 1HKQA 4BZNA 4Y95A 3R63A 3K9TA 2BBYA 3GGFA 4LM5A 2PVMA 1GNGA 4AFJA 2Q0BA 4LOOA 5HO7A 3CD8A 2BE5F 4ZMFA 1WWXA 1HCKA 2OZOA 3ROUA 3RKXA 2A19B 3U2RA 4IWPA 4EOIA 1J3HA 4S30A 4JBQA 5C4LA 1RJBA 3DB6A 3OBJA 4RGXA 5BUIA 2CO5A 3WTUC 4HX4A 3O0GA 4OTIA 3LFBA 3S1HA 5DUKA 3GC8A 3H4JA 5BMZA 4TWCA 3ORMA 4FSZA 4FKOA 3ZXTA 4LFUA 4ZZNA 3L9PA 1R5GA 3SVVA 1LEBA 4OT5A 1D5VA 4C4JA 2OJGA 2WMRA 4USFA 4UMTA 4JBOA 3MGYA 5C8MA 3QP6A 4EOOA 2QI8A 4YBJA 5LVPA 4FKJA 3UOJA 5EOLA 4JK1X 4U0YA 4PDKA 3I53A 4BTKA 1YHSA 3TUBA 2VTSA 2XNOA 3J81K 4D58A 3UP2A 2QENA 2KIMA 3DNDA 3HV7A 4X2KA 1JSVA 3ZZEA 5E91A 4YJRA 4RFMA 5C4KA 3EUHA 2J5FA 3ACKA 2C1AA 4KBAA 4K6ZA 4JIAA 4W4VA 3V6SA 5LEJA 2UZVA 4QP7A 1XH7A 2C4GA 5EW3A 3ANQA 2QHMA 2C5OA 3WU0A 2J5PA 3HAMA 4BTMA 2FSTX 3R9OA 2OAZA 3LE6A 4AIHA 2G7UA 5BYLA 2A68F 4IVNA 1UNLA 3MH2A 5AR5A 2C5VA 2MA3A 4AQCA 4HW0A 4QMXA 5AUYA 4AWXB 5IEXA 3OP5A 5GNKA 3IWFA 4JS8A 3H30A 5H2UA 5M09A 1XKKA 4IHPA 1XH5A 3Q52A 1OIYA 1OIUA 2VBYA 4M6YA 1ZRFA 4ANMA 3FZSA 3TKUA 3R0AA 2VGPA 3PRIA 3C4ZA 4R77A 1P5EA 4R79A 1BYGA 5HIBA 3QYWA
chains in the Genus database with same CATH superfamily
3UKGA 4OUCA 3UIBA 4RMNA 4QSHA 3ZM4A 4LK1F 1YI6A 4XKWA 2YCSA 2K86A 3I59B 3SGCA 3UVPA 1XB4A 4HQEA 2CDZA 3I5ZA 4QQ5A 4P96A 4I23A 1FTZA 3KEOA 1IR3A 1RKTA 3F2AA 1GUUA 1GOLA 3Q04A 1TC3C 2ZFUA 4G6TB 3IW7A 2W1EA 2B63J 3VW8A 3AXWA 3KETA 3BL7A 3HG9A 1MQ4A 4JDJA 5TGTA 2LGCA 4UMUA 2L9RA 2HWVA 3CEKA 3S3OA 3VBQA 4BJTA 2QO9A 4FKUA 3IO7A 2CFXA 3HA8A 3OG7A 2EFWA 5LMKA 5CU6A 2VTHA 4TKSA 3SEZA 5AAEA 1U78A 5I9VA 3LXLA 2R3MA 5F95A 5EDPA 5JKGA 4BXXJ 3WU1B 3OYLA 4YUQA 1AWCA 2WMSA 3R61A 5H8BA 5JQ8A 1DS5A 4RIWB 3CD3A 4RFZA 5DNRA 5ANOA 3QCXA 3E93A 3FHRA 3ZO3A 2VASA 2PUUA 3FXOA 4BN1A 4N57A 4IXPA 4DDGA 2EVAA 5DBXA 3VBXA 3EKNA 3I6WA 3KP4A 4FEQA 5FDPA 4I02A 1RKWA 3D5RC 3K5UA 4NEUA 1OCRH 4FKTA 3S93A 1BI0A 1FIPA 3KN6A 4BDGA 5F04A 1R5ID 3RPUD 3R7VA 2QEXI 2R3LA 3TCPA 2UW4A 4IWQA 1URCA 2RG5A 4QQTA 3CCLI 2G01A 4OAYA 2XB0X 5D6EA 3ORZA 2HQAA 4JBVA 3TJCA 4DA5A 3VW6A 3UDBA 1QHHD 2VTNA 3O7LD 1MBHA 5K4JA 3L7WA 5AR8A 2I10A 3I0OA 3LFSA 5F0HA 1XBBA 3ABUA 3BCAA 3E3PA 1OJLA 3NNWA 5E8YA 2EZHA 3PJ2A 3QUPA 3U6HA 4BXFA 4LRKA 5L8KA 3KIOA 4RFYA 3G5DA 3E7VA 3GNIB 1FIAA 4R5YA 4EEFG 1Y6AA 2Q2EA 2WMTA 3WTSC 3QF9A 2ITZA 4O2ZA 3PQJA 4E7LA 4NW6A 5E18F 4Z3VA 1R0PA 1XQZA 3RAKA 4RLKA 3LFDA 3BU5A 2A69F 2W48A 3CCYA 3E1SA 4NC7A 3VUGA 3UYTA 2STWA 4QMUA 4BY9E 3WTXC 3CUQA 4D2WA 3AG9A 1JSTA 1REKA 5C26A 5J8FA 3EQDA 2ITQA 1R1VA 5J9LA 4O0TA 3ZXZA 4UY8I 1WHUA 2QODA 4NM3A 2CSNA 2HDWA 4IM2A 1ETVA 4WBOA 1DPUA 4B4LA 3QQJA 4M13A 2J9MA 4LIVA 1W82A 1ZELA 2J0JA 4KRDA 2F2UA 2UW6A 4KUMA 2E1MB 4I0AA 4ZSGA 4ZYEA 1X58A 3OS3A 3RTPA 3T3VA 3R30A 4O4BB 3U51A 2F5FA 3RPQA 3J7YJ 2ITTA 3OW3A 2QLZA 3QKKA 5E8IA 2OJED 3AC8A 5T68A 2BRMA 2RNGA 1HW5A 3OYKA 1WBNA 2BYVE 2BFYA 1IN4A 4B44A 1PVEA 2WTDA 5ICGA 4BHZA 2RDPA 3GP0A 4FGBA 3VS3A 1MJAA 3UP7A 4O83A 1BKXA 3ECHA 4MNEB 5J95A 4CQGA 2IS6A 3IKTA 2HXIA 5LD2C 3CC2I 2R93J 1GZOA 3ZBXA 4DDIA 1U5QA 1ZGAA 2NRUA 1WFCA 1MZBA 2WNTA 4GS6A 4QYEA 3SHEA 2WAQN 4BYYA 1JJ8C 1OQYA 4N4OB 4G6LA 4CFNA 3VNTA 4U7BA 2BIKB 3TW7A 3MB6A 5AP0A 2CHLA 5BMSA 1WBVA 4FX4A 4LLGF 4D7NA 2BALA 4LGWA 4FTOA 1ZG1A 4N0SA 4YO6A 2X81A 5LVNA 5D5XB 2DFHA 2BZKB 2R3OA 2WMAA 3IS5A 3G0FA 1H25A 3VVHA 2HR3A 4PJJA 3TZ9A 2NVUB 2O0UA 4O22A 1P4WA 2ZSHB 2H8WA 1POGA 4EBWA 2PFBA 1AKHA 5HIDA 2DMNA 2DFFA 3IH3A 4UWYA 1OCZH 2W7NA 3AD6A 4DEGA 2OGVA 4ON0A 4QP8A 3AKZA 4BBRJ 3DOGA 2JIVA 3ASNH 5FBOA 3LA2A 4NK9A 3I4PA 4QP4A 1G8AA 4FX3A 4DG2E 3W32A 3HDMA 3ZRLA 1LE8A 4R7BA 1PYEA 4N9IA 4WHZA 2PY3A 5HI2A 4YHFA 4CNHA 3KYDB 2XJ2A 3BE9A 1RR7A 3WTZA 2OFUA 2HZ4A 2D45A 4DJAA 5EHOA 5BUEA 1JT0A 1QRYA 1W0XC 2YDKA 3ZU7A 3SW7A 3BZKA 4EUUA 4FJVA 2WOTA 3E5UA 5F1ZA 4I5MA 2ZMDA 2MLKA 4C4HA 3W10A 3GCSA 2XF5A 3GZNB 1IJWC 2EJRA 2PE1A 2HU9A 4PJMA 5EKOA 3ZSGA 2HTJA 1O3TA 4EJWA 1WCMJ 3DV3A 5AP3A 1NY3A 3PRFA 3AL0C 5KAIC 3OWKA 2CCIA 2OKRA 4WRGA 3NFGB 2PE0A 3F82A 2HPMA 3F2RA 4A7CA 2ZMEA 5HG7A 1T0FA 2OJ9A 2PUIA 1QPIA 1QL6A 2VTRA 3OUKA 4P2KA 3LQ8A 2VBZA 3RCDA 1WVXA 4IW0A 5IYBJ 2HOGA 2XYUA 2IW8A 4F4PA 3PSDA 2BY2A 6PAXA 2FE3A 3VUDA 2VWWA 1USTA 1KYZA 3MAJA 2IJLA 4XP2A 5CSHA 2DA1A 5CXZA 2EFOA 5D8KB 4NWMA 3OT8A 5AONA 4MQ1A 1BL0A 2XZSA 4P90A 4E8AA 3O2MA 3BC8A 3F5UA 1Z1DA 3QTZA 4EJOA 2WGJA 2M4KA 4RS8A 5FXRA 4HDUA 1VZOA 2C6OA 4XG2A 1UNGA 1K9AA 2KMUA 2DO7A 4F09A 2TCTA 2BY1A 2IGKA 5B2MA 3MVMA 1XMAA 3B2TA 4BU2A 1R5HA 2JPCA 2CQNA 2WAEA 4AGCA 5AP2A 2MGQA 5B3SH 4ZP5A 4Y3OA 1R0EA 2CJMA 2E9PA 3MB7A 3FMNA 1OB3A 3DDQA 2P3GX 4WF2A 1VFCA 4NM5A 3DK3A 5FRNA 5JLWA 3A1YA 2JD5A 4IHWA 3P0MA 1JHHA 2CN5A 4D9JA 4S34A 4MHGA 5TKDA 3QRFF 2XRWA 4LG4A 3ZDUA 5I9WA 1AOYA 2Q1ZB 1KONA 4BDBA 4BQAA 4HV5A 3PFYA 4YHJA 4B4CA 4C2MJ 2P4WA 2WZJA 4PFPA 2ZNZA 4FKWA 3JTHA 4GK4A 1VTNC 4HW7A 2OJIA 2HDCA 3V8TA 1XMLA 1WJBA 4ZLZA 3HMIA 2OXDA 1JWHA 4X0MA 2UW0A 1QNTA 1QHGA 2RN7A 4HNFA 4DTKA 3VODA 4BACA 3CGFA 5AUTA 2JQ7A 5E79C 3W2QA 2R3NA 3QZIA 3J80Z 4QDVA 4C4EA 3F8NA 4AX8A 4IHYA 1A36A 1MSEC 4TNBA 3F3XA 2M1BA 3Q9YA 4PMPA 1I39A 2AQEA 3QD2B 1KE7A 2LTPA 3NIZA 1EKEA 4QPOA 3N4TA 2XK4A 4EI4A 5TRDA 3PIXA 2HKXA 2GSFA 3S2WA 5C1QB 2M2EA 1KV2A 4MCVA 5BVWA 1SFOJ 4GV1A 3FQEA 3ZFMA 3L00A 2CCHA 5M51A 3EZVA 4N6YA 4I24A 2HIWA 3BHVA 3LXNA 3A4PA 4E93A 4LITA 1CKPA 3ZRMA 1FOTA 1MKMA 3CJGA 4ASDA 2IW9A 2WXVA 4RVKA 2VIXA 3KYLA 1KOBA 3RPOA 2KZVA 2VWXA 1ODDA 4YPDA 1H1PA 2WQMA 3IPHA 3CJQB 3MH3A 3TXOA 4BHBA 4E7KA 3MVJA 3EB0A 1TT5B 3F2NA 4KD1A 3WI6A 3UYSA 1W0TA 4QWQA 2W4KA 3REOA 4QP1A 5HLIA 1Y6IA 1QZEA 3DU6A 3M2WA 2D1HA 4DIQA 5F4NA 2MD5A 1DAYA 1XJDA 2IT0A 3CF5F 4RIOA 1IN8A 4R78A 3FM3A 4D55A 4MIMA 1GZNA 5HO6A 2OTJI 5M08A 4D1XA 3LZBA 5DGZA 4C3PA 2FSMX 2ZYBA 4ZTQA 1OGUA 2J0MB 1BN5A 2A3SA 1YI2I 3PA5A 3BG9A 2IVTA 3S32A 2G7HA 1JKTA 4AIKA 2RFEA 3DK7A 5EDQA 1VJYA 3K5VA 4PJ0C 2YS9A 2OZAB 2CNQA 1YDRE 4LV5A 4FBXA 3LSHA 2HZ0A 3R7IA 4FTJA 2TRTA 1FBUA 4E73A 4GMYA 4NDLA 5FO5A 4QOXA 4CICA 3A2KA 4ZJVA 3KP2A 3UQGA 5D5VB 2ZV8A 2W5BA 4NIFB