1TQPA

Crystal structure of a. fulgidus rio2 serine protein kinase bound to atp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
282
structure length
269
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords conserved hypothetical protein
publication title Crystal Structure of A. fulgidus Rio2 Defines a New Family of Serine Protein Kinases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
total genus 86
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tqpA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1tqpA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1tqpA02
4RAYA 3WBLA 3H9RA 3UO5A 4NIFA 2KIFA 4YFXF 4AWXB 1IA9A 5CYIA 4XHKB 3MFRA 2BZHB 4K33A 3PXFA 3OWLA 5CEOA 3HMPA 4RS8A 2QR7A 1Q8YA 4ZIMA 2FEZA 2YERA 4AW2A 4QTEA 1J75A 1J7LA 4USFA 1ZG1A 3JSPA 2YU3A 4UV8A 3LIJA 4L9TA 4NKAA 2HCKA 3ZOSA 3AC4A 2VX1A 2YWPA 4EC8A 4NHJA 5E1ZB 3O3KA 2E1CA 2QU6A 3EYIA 1QPDA 3ZMUA 3HVCA 4M68A 1TBXA 2C6EA 2W5BA 3FZRA 2JDSA 4BKYA 5F64A 2HZ4A 5J1VA 5HLPA 4NEUA 2PVHA 4JAIA 5HQ0A 4U5JA 2VBWA 4WRGA 5KCVA 3U4WA 3RP9A 2Y4PA 3Q52A 5KK1A 3RCDA 1HCKA 3HKOA 4TNBA 5T68A 1SD7A 3OXZA 5E20A 3IW5A 2HAKA 5L8LA 3SQNA 5E8IA 5AP6A 3V8SA 1XH4A 4JBOA 3P1AA 3GCVA 3KY2A 3KP6A 3ENHA 4NW6A 2ZFWA 2ITTA 3W8LA 2ITOA 3OOGA 2C6MA 3VUDA 4M6YA 3QU3A 2NRAC 4MTAA 3P9JA 3GQIA 3KEOA 4JAJA 3GENA 5JFSA 3FV8A 4H39A 2WC2A 3CTHA 3QP5A 2I7QA 4RVMA 4RIXB 1FGKA 2HKXA 1Z57A 5DLSA 3FSKA 4F6UA 1HQCA 4O7TA 2VODA 4D1XA 4PMPA 3TNWA 2VTNA 4FI1A 2DQRA 2VU3A 4Z7GA 5AUTA 5M51A 4YSJA 1YOJA 4XP2A 3EZRA 1J1BA 4EYMA 4PDYA 4PTCA 5JRQA 3KF4A 2CKPA 4UMQA 5IT9K 3E93A 3IDCA 3UGCA 2FVDA 3I81A 1O3TA 4FV2A 2C0IA 2O6GE 5DUIA 1YYVA 3WE4A 4C37A 3PQKA 2W99B 1XDSA 4FV9A 4ZSEA 2FMLA 2MBFA 3VUIA 1MRUA 3R7UA 2YCQA 3QTUA 3GU7A 5D12A 3GBZA 4ACMA 4BHNA 4BI2A 4FYNA 3TV6A 5D6FA 5EOLA 1OIYA 4JLCA 4BHPA 1PYEA 2WTIA 2H9VA 4CYIA 5KZ0A 5FM3A 2GNLA 2ZMEB 3BWJA 4U9AA 2R3GA 3KB7A 4Z2YA 3FXWA 4D0WA 2F7ZE 3QGWA 5E1EA 1YWNA 4LLNA 2D1VA 2IW9A 1PDNC 5FFZA 1R3CA 4YMJA 2VOOA 4IF4A 3F66A 3OT8A 4RJ5A 4KIQA 1PXMA 2RG6A 4ACDA 4AW1A 4M8TA 4I24A 1UVRA 5FD6A 4CZUA 3KXNA 3FI8A 4ZZLA 1REKA 5CF4A 4TKSA 1TNSA 3NS9A 4X2NA 2PVFA 4MEDA 3UIUA 3MY0A 3NYOA 3W2OA 3IW4A 3KVXA 4IC8A 4GXOA 4Q9SA 5CF8A 2HR3A 3L1SA 2WEIA 4R7IA 1EH7A 2QO9A 3LLTA 3W6JB 3I5NA 3R2BA 3PE2A 3PY3A 3FC2A 3PXRA 2WIPA 2YZAA 4FA2A 4JDJA 2VTOA 4OBQA 5K5RA 4XV2A 1J3HA 4ESJA 1NVRA 3QQUA 4OBOA 4F70A 1URWA 3ZZEA 1YWRA 4CGZA 1KQ9A 2PY3A 4RIYA 4DH8A 4CYDA 4BCKA 4FSZA 2YM5A 3RPQA 3TZ9A 1PW2A 2OXXA 5FEEA 3OXTA 4I4EA 4PV0A 2BRBA 3JS2A 4RC2A 2C5VA 3MFKA 3FMNA 5TR6A 1OKRA 4LMNA 1NT2A 2HWPA 3RINA 5LBQA 3CP9A 3E64A 2LF8A 3DAEA 4YJRA 3ALOA 3W1FA 1PXLA 1GAGA 4TT7A 2XNBA 2NRUA 2VWUA 2QOKA 4QP7A 1LPUA 2R5TA 3F2RA 2WTKC 3RVGA 4EV0A 3PJ2A 4CFFA 4Y15A 2XNNA 2Y4IC 3FHZA 2XYUA 5J8CA 1QPCA 1K9AA 2YIXA 3RAKA 3EQFA 2A6EF 3FMQA 4CCBA 3UZTA 2YLEA 1M52A 2Z7LA 2GS2A 2BIYA 2XZSA 3NIZA 1PMNA 2R7DA 3POZA 3PA5A 4OIQF 3FKNA 3OMVA 1BL6A 5HVKA 2C3LA 3HECA 4F0GA 4LUDA 2K86A 4R6VA 3E6BA 4UMRA 5HX8A 3TJCA 4L9JA 3WU1B 3LJ1A 3RYPA 5HOOA 3L9NA 2QM3A 2C4GA 3NW6A 3OCSA 4X6QC 1NA7A 5E92A 3HMOA 2OXYA 2X7OA 3HV4A 1R0EA 3ODZX 5LXMA 4GRBA 2JDRA 4A0ZA 1B59A 3DFAA 4FTIA 2J0LA 3NNUA 5E8TA 1BMKA 5FLFA 3QLGA 4QPAA 3EQLF 5DG5A 3DXJF 3QTRA 3BCEA 3KEXA 1RDQE 3ZTXA 2R3JA 3GU5A 5TOZA 1UCRA 3O8PA 1UWJA 4YPSA 4RJ6A 2WGJA 2GWRA 2MLKA 3G2FA 5AIKA 3KRJA 3ZH8A 3G90X 2CPKE 3J81K 1W84A 1ZLJA 3BROA 4GO1A 5BNJA 4R8HA 2CSOA 2FB8A 2HK5A 5D11A 3NEUA 4EJTA 4EH8A 3W2CA 4IW0A 3I0OA 4WUNA 3BQRA 4C35A 3KREA 3DT1A 4D1SA 3CTJA 1XSVA 3QQJA 2GHGA 4L5IA 1WCCA 3FXXA 4ASXA 5L8JA 3PWYA 4L9IA 4AA4A 4HGSA 1KQ8A 3KC3A 2Q2EA 2FSOX 3ZSHA 3C4EA 2BAKA 2XM8A 2M8EA 1R36A 5BVNA 4IZYA 4R78A 4GYIA 2BTRA 2QQAA 3NUUA 4EZ5A 1V0PA 2EFOA 2YN8A 3GT8A 3Q32A 4ZTLA 3S0OA 4I5CA 5FB2A 4OTWA 2PJPA 3BYMA 4RGUA 1YOMA 5HIDA 1USTA 3P7AA 4YJPA 1I1GA 2Z7QA 2JKMA 1GZ8A 3CC6A 5EW8A 4L43A 4O2PA 1Z6TA 3RPSA 5K4JA 2CFXA 1Q8TA 1FY7A 3ORXA 4RZVA 2ETHA 2WIHA 3NYNA 4C58A 1MD0A 3DLSA 3DQXA 3VHKA 4LGDA 1OITA 1YXSA 2VTIA 2HYGD 4H36A 4EOKA 5FRIA 4RG0A 5C01A 4KKHA 3IPHA 5EDQA 4BQAA 5LMBA 2W5HA 3GVUA 3FX3A 1FOKA 3BGPA 4LGWA 5ILVA 2RVCA 4I6FA 5FWKK 2E9NA 3QCYA 4UWBA 5HGIA 4LG0A 2CYYA 3KP4A 4YZMA 2WQMA 3GNIB 5EM6A 2QQ9A 3F5XA 2F57A 3W10A 4HVDA 4L53A 3H4JA 1U3EM 1S9JA 2PEXA 5CAQA 1BBYA 4QMYA 1A04A 5A6OA 2JBOA 3H0YA 3BRBA 4H1MA 4LUEA 2HZNA 3LJ0A 3SGCA 4BIBA 3IK3A 3ZSIA 4EWHA 4ALVA 3QQFA 4NUSA 4DG2E 2PVNA 3UPXA 2DQ7X 4IADA 4HYEA 4ZH4F 2J0IA 4K9YA 2HDCA 4Y72A 5HVQC 4JQ8A 4O7LA 4QQ5A 4QT1A 5C8NA 4KN7X 3TG1A 4QOXA 1QMZA 3IS5A 2G9XA 2GHLA 3R30A 3TV4A 2CGUA 3WZJA 3MN3A 4MHGA 2C68A 1JBPE 4GMYA 4ANSA 1NW1A 3K2ZA 2O0YA 4M69B 4PGHA 3HHGA 3T9TA 4PTGA 5HOAA 3ZO2A 4EI4A 3ZSGA 4MXCA 4Y5HA 4D28A 3GC8A 4JDIA 4P90A 2IW5A 5FLXK 5E8GA 3DP7A 3PSCA 4YTHA 3KE2A 3MSSA 4GK4A 4OT6A 4U41A 4FGRA 3FI3A 4MCVA 4LGGA 5IF1A 4AOTA 4L0ZB 1JSVA 5AX3A 1YHVA 2XH5A 2PI0A 3A4PA 1AGWA 2ITWA 4AT4A 2EFPA 5HCXA 3CJGA 4AG8A 2JRTA 3RK5A 5HKMA 1KOAA 4E4LA 3TKHA 4L3PA 5L4QA 3CPCA 4O7SA 4CZYB 5A4LA 3ATTA 4QTAA 3QPTA 4FNYA 3QGYA 2CCHA 5JMSA 1WRJA 2W57A 3ZQ7A 1ZY4A 2R3NA 1I44A 3J80K 3R1YA 4IX3A 4EHGA 2VGOA 5JZNA 4KNYA 2PQ8A 1PKDA 5ACBC 4GW8A 3HOTA 2OFVA 4ANQA 5FXSA 5E18F 2CLXA 3QYZA 3TDVA 4OT5A 2LDUA 4LOQA 2PE1A 2XYNA 3P78A 3ZYAA 1G3TA 3PA3A 4HVSA 4BWXA 5JH6A 3CGFA 3I0QA 5CEPA 3K9TA 3O23A 1SMYF 4L00A 4AZFA 2R3LA 2E9UA 4FUYA 1B9NA 5FTGA 3GLXA 4C33A 2BKZA 2HOGA 3E8EA 4USEA 2YACA 3OOMA 2ZYBA 1P4OA 3G3ZA 2R0IA 3KQ7A 3LFFA 4RLLA 3FM3A 4DCAA 4KMUX 3WZKA 1XN7A 4MBIA 2MH9A 3TO7A 3VUMA 4AIJA 3UBDA 5AAEA 4DTBA 2KJCA 3PZHA 4KIFA 5DCMA 3AT2A 3NQOA 2XVDA 2OO8X 5HLNA 3KFWX 5M06A 4E6QA 1PJKA 1T39A 3PG1A 3CO7C 4O7WA 3MIAA 4O0RA 2YDIA 2IA2A 4BHBA 2QOFA 1UV5A 1YI4A 3ET7A 1KU7A 2DPDA 3R8LA 2QNJA 2GMXA 5DEQA 3EN4A 4L01A 3KK9A 2P33A 3JAMK 4AZEA 2GFSA 3MW1A 4FX0A 2C5NA 3TKUA 2DO7A 1FSHA 3GCUA 2CDZA 1O57A 2Y8OA 3QQKA 1L3LA 4P7EA 5CI6A 4G17A 3DK6A 1LEWA 4FE2A 4EOJA 2EVAA 5DN3A 1X3UA 3REOA 4QNYA 3OVVA 3UG2A 4ZSJA 1UFMA 3QFVA 5M4IA 1UKIA 2JFLA 3CKXA 2WU6A 4O6JA 4NH1A 1TQMA 2FU4A 1J0RA 4ITIA 5E8YA 3QXOA 5DI1A 2RSVA 2WMUA 4HX4A 5BUJA 4KWPA 4QYYA 3G5DA 3SZPA 3ECHA 3E6CC 2XK8A 1FMOE 2HFHA 4I7HA 3AXWA 2LGCA 5IQEA 3KP3A 3F3WA 2B0LA 4E20A 2BRHA 3N4TA 1P4AA 5IQCA 4IH8A 3DV3A 1H8FA 1MDMA 4XG6A 2O8YA 5EI8A 2EV5A 4EHEA 3MY5A 2M87A 5IQGA 2ITVA 5I5ZA 5FUTA 4ENNA 3JW4A 4BIEA 4BICA 3U9NA 3QTZA 3AMAA 3VUGA 1YI6A 4GU9A 4ZYEA 2GNHA 1XH8A 3DFCB 4E73A 3WE8A 1R1UA 1QCFA 2XKCA 2O3FA 3ZUVA 4ARKA 3LMGA 5M08A 4A5NA 4OTHA 3TKIA 2DFIA 3MB7A 1U54A 4DGGA 5EYDA 4U97A 5J95A 4ACCA 3W2RA 3LXPA 4EOSA 3QD4A 3ML6A 1W98A 3NCGA 4BBEA 3FMJA 2XK6A 3TUBA 3NZ0A 4DFLA 3PRFA 3PLSA 3U9GA 4JT3A 5CZHA 5KHWA 3TNQB 2M1BA 5HLGA 4RX7A 3V5TA 1PMVA 4IBMA 3UYSA 1TKIA 4X2FA 2RFNA 5D8LB 1BI7A 4PP7A 1RNLA 4LOOA 5ETIA 5E91A 4F1MA 4WBOA 1WBNA 3T3UA 1YOLA 5EYCA 1TQPA 2EV6A 4DGMA 1Q8WA 2ITNA 1Y91A 1TTYA 4B0GA 4AOIA 4TWPA 2CSNA 3T1BA 4PQNA 1WI9A 1QPMA 3D4QA 4GKIA 1MRVA 4PTEA 4GG7A 4TYIA 5BMMA 4M12A 3C7JA 4IB1A 5LGUA 4YURA 3BLQA 3SAYA 2B9IA 2WV0A 3TDZC 5LARA 5BMSA 4AX8A 1YWVA 3Q9XA 2WTCA 4BCNA 4NFMA 1H07A 2YISA 1U2WA 1L0OC 2O3PA 1Q41A 3QD2B 4YIIA 4V01A 3K54A 2IPXA 2V1UA 2QD9A 1ZN2A 4X2KA 3LKMA 3N4UA 4M9XA 3G0EA 2YR2A 5K5XA 2WOUA 5J1WA 4QMTA 1H1PA 3DV8A 3RTPA 3CJFA 3FEGA 4KKGA 4KBKA 3TV7A 4G16A 1W5TA 1XGMA 2ITUA 5L3AA 1YXXA 1K78A 2C3IB 2VO7A 3F3XA 3R8VA 4V05A 1WBPA 5I4NA 1D3YA 3C9WA 4FL1A 4BZNA 5J7BA 3W2PA 1PXJA 3ZEWA 4QPMA 3PJ1A 5K9IA 2W1HA 5AV2A 3Q4CA 3IW6A 1KE8A 2UZUE 4L9NA 4U0YA 2GNIA 2Z3YA 4FV6A 5BYLA 4I23A 3LFCA 3HUGA 4XCUA 4QP8A 1KE5A 4HW0A 2ONLA 4KD1A 1MQBA 4CMTA 5HICA 4GG5A 4FICA 1MZBA 4HV6A 4GUEA 5FXRA 3VS7A 2OH0E 3P7CA 4EK6A 3U8WA 4O96A 4PNKA 3TUCA 3CLOA 2GPHA 4OTDA 3W8QA 2J50A 2P2HA 2F5EA 1E1XA 3VBWA 4HW7A 3LFDA 5E8SA 4GKHA 3RDIA 5HX6A 2VN9A 4WUAA 3EQCA 1U5TC 4M73A 4FVRA 5F9EA 1CGPA 2A4LA 1WQ2A 5CU2A 2JC6A 3FAAA 2P0CA 5D5XB 3RM7A 3EUHA 5AUWA 2DBBA 3KRXA 3GVAA 2UZDA 2YM7A 5L3FA 5HE0A 4R77A 2ZJWA 3TIYA 4KBAA 4BF2A 4H0EA 3F9NA 2IT0A 2IWIA 4PDPA 4BHZA 4YO4A 5CWZA 3R8UA 1ZHFA 3CDHA 5CNOA 4CLIA 2VX3A 4AN9A 3EFKA 3HIFA 3O71A 5L3DA 4DEGA 5BPDA 1REPC 3QQLA 5I9XA 2BPMA 5IA1A 2XKDA 1OIRA 3G0FA 3R7OA 5CAVA 2Q0OA 3I4PA 4CZZA 1QO0D 1R7JA 3PXQA 4FTTA 1G3WA 4R7BA 3NNVA 3BWGA 5J9YA 3TUDA 1IAJA 5J9ZA 1HW5A 2B0QA 1R58A 4QP1A 4NIFB 4FSUA 4ZJIA 4G7OF 3SRVA 5HE1A 1XHAA 4RAZA 2V22A 5DIAA 4F9AA 4C7TA 2GZWA 1OPKA 1Q3DA 2C0OA 3AD6A 4C34A 4UXLA 5AEPA 1TVOA 2HZ0A 2ERZE 2GXGA 4ESBA 2PFBA 1CSNA 3I0TA 3RZBA 3DKWA 4HPUE 4FTKA 2B1PA 2YM4A 2BMCA 4FIGA 3ZM4A 4O27B 2PE0A 4TYGA 5K5OA 4BDGA 3R2YA 1JLUE 3ZBXA 3FZ1A 3F3TA 3ORTA 2JEDA 4WNPA 1HKTA 4U43A 4CV9A 4BC6A 3WYYA 3W18A 4S33A 4WSQA 5CQUA 3HOSA 1JKSA 2JFMA 3M8EA 3VULA 2I0HA 3NRMA 4ENXA 3N4VA 4FUXA 1LEAA 2ZV8A 2PTKA 4IZAA 3RWPA 1QZYA 4L7FA 4DEIA 3IQ7A 3GW2A 4EOOA 1GIHA 4XUFA 4APPA 3WZEA 3FQHA 2JKQA 2W1ZA 5LHGA 2D45A 4J7BA 3ELJA 2ZV2A 3O17A 4FIHA 4RVLA 2ZDTA 3DBDA 3TO6A 3MTLA 2DK8A 4UWYA 4J95A 4BGGA 1XCBA 4UEUA 3QA8A 4OIRF 3PFQA 3BDDA 1JKTA 3I6UA 1ZRZA 3NRVA 1Y6AA 2BVAA 4M66A 5IQHA 2I0YA 4QMMA 4KUMA 3HAVA 2QOQA 3DNDA 4XX9A 3DCVA 2IZTA 3MB6A 3F8NA 2I6LA 3KN5A 1GOLA 3MQ0A 3R8MA 5FGMA 2YIRA 5EYMA 5AM6A 3VS2A 5CEKA 3A4OX 1I6XA 3NUPA 3RAIA 1CMKE 4JBQA 1PMEA 1F9NA 2G1TA 2ITZA 2DAOA 2Z33A 4WT6A 2PUUA 3JSOA 1SAXA 4W8EA 3M7GA 4BN1A 1U46A 1OPJA 5L6OA 1ZYDA 4YLJA 4HQMA 2X6DA 1BI3A 3BBTB 4UVCA 3DTCA 2PUNA 4CFXA 5DT4A 2GSFA 3BE2A 4E4NA 2GU8A 4D55A 3F22A 3HMNA 5EK7A 5JHUA 4JIKA 2R64A 2YDKA 3F2NA 3PG3A 3T8RA 3QD0A 2G2IA 3I6WA 1VR2A 4HVGA 5H6RA 3QRFF 5AV4A 2YAKA 2OKRA 5D6EA 3GUDA 4I4FA 2WMVA 3QTSA 4AN3A 2UXNA 3F21A 1WMKA 3C4WA 2UW4A 3F8MA 4KSQA 4L7SA 2PMUA 1DPRA 2Y6MA 2OZAA 3SG9A 5KVRA 3H3ZA 2XP2A 2HTJA 3C4ZA 4BWKA 3NAXA 5LMKA 1OKWA 5DT3A 4CG9A 4KA4A 1ZZLA 4YHJA 1B6AA 3CY2A 1DI8A 2J4ZA 4CZTA 3O8TA 1VYWA 1JGSA 3QTQA 4TL0A 4L52A 5FFXA 4YHFA 3IO7A 3VEPA 3HTUA 1FPQA 2Q0BA 2LSOA 3TOBA 4RIYB 1D8KA 2WQEA 4DH1A 4G31A 3GFLA 4A12A 2H09A 4EUUA 1ONVA 4XEYA 4IZ5A 2OW3A 5DRBA 5JK3A 4KDPA 2XNPA 2IO6A 1XR1A 2YEXA 4BWPA 3V8KA 3EOCA 2JIUA 4FZFB 4B99A 3IW8A 2XBJA 5EQEA 3LCSA 2OG8A 5ICPA 5HDGA 2XAHA 4QP6A 4X3JA 4PDSA 3I5UA 4IAZA 1J9IA 1RJBA 3QRUA 3I59A 4IC7A 4Q5EA 3DKCA 4A9TA 3OCBA 3D2IA 5CENA 4FSRA 4FKPA 1U6GA 5HD4A 4EJOA 4DH7A 3BP8A 4QYHA 3L09A 3BJ6A 2VTAA 1AD5A 1KU9A 4XG7A 3ZUTA 3TNPC 4CT2A 3PSBA 5DD8A 3C1XA 2VZ6A 4M7IA 4ALWA 4UV0A 3JVSA 4DFUA 5M44A 4RB1A 4IMYA 4GT5A 2VD5A 3QHRA 4GCVA 4F0FA 4QTDA 4QP9A 4C8BA 2B55A 1XMAA 3R0JA 3EDPA 4RZWA 2A19B 4MD7E 2OJJA 4NFNA 2PZ5A 4QTCA 4XLVA 3W2QA 4R8QA 5BYYA 2RDPA 2CO5A 2BALA 2JAVA 4D9UA 2XNOA 5JZJA 2X0LA 1XBAA 3FYJX 4J96A 3C5IA 1OVEA 1Y57A 3NMUF 3I60A 3C5UA 4FSWA 4ON0A 4HDVA 4IX4A 5H8EA 1KE9A 5FO5A 4IVAA 4O91A 3UZRA 3V5LA 2PG4A 2DPUA 2KULA 3OC1A 1I27A 5ICEA 1IF1A 1GZOA 5FBOA 3DFGA 1FBUA 4BCIA 4HOKA 3UTOA 4KS7A 4KUJA 3SOAA 1FVVA 4CV8A 5CNNA 2FNAA 4A6DA 3S3IA 4W8DA 3PTGA 4N9IA 2WTJA 3OG7A 5HG5A 1QQIA 4D0PA 4O6EA 3GF2A 1YXUA 4YTIA 4XG3A 1OKVA 2C3JA 5C4LA 4TYEA 3RYRA 5H3QA 4WBBB 3WTXC 1VZOA 4MXAA 1G3NA 3LE6A 5CT7A 3M42A 3UOLA 3TWJA 4AFJA 3ZCLA 2VT2A 1LEBA 4HYIA 3NDMA 3HA8A 3V7RA 4BI1A 3JPVA 1NVSA 5DRDA 3MY1A 2VWBA 3NYXA 4N0SA 4YZBA 1XCVA 1FSEA 5D41A 1LJ9A 2GNFA 4C36A 3DA6A 3N9XA 1LQ1A 2V6CA 3O8UA 4P9FA 2WZJA 3DBQA 4DTKA 4MHAA 1VJYA 2W17A 1SFEA 2W1CA 1H0VA 3PPKA 5A9UA 2G2FA 3D5VA 4IDTA 1FINA 4CCUA 4HZFA 1ZXEA 3UG1A 3WYXA 1SNUA 4G6LA 3TZ8A 4YGAA 2L01A 3IRRA 2X4ZA 3ZMMA 2P5KA 2CGWA 3R6SA 5C8KA 4G2FA 2X9FA 4IFCA 3M11A 2QLQA 5HO6A 4LG0B 1PYXA 3G9LX 2DS1A 3UJGA 2WXVA 2WTEA 2L54A 4G9RA 4S2ZA 2R3SA 4MVFA 4ZY4A 3UNKA 3TTJA 5LVNA 5DR9A 4BR3A 2BTSA 2GXBA 3CO6C 1MP8A 4O86A 4LRMA 4RRVA 4A9RA 4IVBA 4XOZA 2DW4A 5HHWA 4IANA 1GNGA 1ZYSA 2OU2A 3CKWA 3RI4A 3NVKI 4QP4A 3II5A 1W83A 4A0XA 2CMWA 1DI9A 3FC1X 3F7ZA 4HYUA 2UZBA 3FLZA 4EGZA 1WBSA 1XQZA 3F6VA 3GCPA 2UW6A 4UB7A 3ZO1A 1Z5MA 3HNGA 2OIBA 4G7HF 4UVBA 1IRFA 3KK8A 4E26A 1LDDA 1OMWA 3S1HA 2FSLX 1H9GA 4ZMEA 1W7PD 3IKAA 3ETAA 5I9YA 1NXKA 1G4DA 4LLGF 3S2WA 5EKNA 4DT8A 3GU8A 4U7DA 3ZRKA 4FODA 2GFCA 1ZARA 4FOBA 4ANBA 2MC3A 2G9WA 2F2UA 2RFEA 4EBVA 5I0BA 3TGNA 2B53A 3ZBFA 3GFJA 5CAPA 4XLNF 3V5WA 4ZXTA 1JVPP 4GFMA 5F94A 4ZYHA 3KXMA 4Z7HA 4FEUA 3B02A 2KJBA 4GK3A 2XM9A 4G6OA 4ITHA 2XAJA 4DE4A 4RC3A 3BGZA 4O7YA 1J5YA 4FGBA 5DYMA 4HX8A 4EONA 4RGJA 2A27A 4FL3A 5CLSA 1ZH5A 4A9UA 2W25A 2VN2A 4DQ2A 4DITA 3MVJA 2C30A 5IQDA 3AMYA 5E8UA 2DTRA 3TNHA 1V1KA 5CXHA 5BVEA 4ENMA 3I53A 1BIBA 3HSEA 2VONA 3IOKA 2P55A 3V04A 3S00A 3KRRA 2UZKA 3G73A 2UZWE 2R3HA 4CNHA 2GCDA 1FT9A 1ZRDA 2O61A 3RKBA 4MXZA 2QZ8A 1WFCA 3R63A 3F61A 4IWQA 3S95A 4IAIA 2W9ZB 1JOWB 2E7XA 4HQEA 1BC7C 3DAKA 4D5KA 1ULYA 3BJOA 4FTMA 2Z8CA 4P5ZA 3EIDA 3VHEA 2Y6OA 4I0TA 4YZNA 2BDFA 3ZXTA 2ZV7A 3LJ2A 1JPAA 4AXAA 5LGTA 3KXZA 5M4UA 2FSMX 3DXPA 4FIIA 5DCMB 5IT9Z 4Q9ZA 3E62A 1ZYCA 2XEZA 3PZEA 5FGKA 4OU0A 2X39A 5IA5A 3ORPA 2H96A 2A2AA 3KU2A 4RB3C 5HIBA 3OY1A 4W4XA 2VWIA 2TDXA 4R5SA 4D0XA 1OL6A 1PMUA 4U42A 5BMZA 1YW8A 4F9BA 3MCZA 3I1AA 5HG8A 4AD9A 1H1SA 4YTFA 4FZ6A 4WO5A 3QUEA 2UZTA 3E5QA 4ZOGA 4MQ1A 2YFXA 3Q9VA 4CICA 3H10A 3QX2A 2XUUA 3F88A 3TEIA 4UMTA 1BI1A 1IAWA 2RC4A 3D5LA 2VTTA 2VUWA 4E5AX 3ID6C 2W1GA 2F2CB 3CGOA 3C1DA 3EL8A 5KE0A 3QHWA 4AW0A 4AA0A 3I58A 5AADA 4EQMA 4AN2A 4EORA 3WTWC 3TQNA 4DTAA 1UHMA 5AP4A 4HZSA 4EBWA 3UODA 2AC3A 4L42A 4AUAA 2PZPA 5JGBA 1OL5A 3LA2A 2XKEA 1Q61A 2YCSA 3Q2JA 4TNDA 1LVAA 2GIVA 2GS6A 3GXLA 2VBYA 4FV4A 3OW3A 1BUHA 4EM0B 3ABTA 1XDUA 1YW7A 3IOPA 1TW2A 2V7OA 4WSYA 3SXSA 3FXQA 1FGIA 3K5VA 2OXDA 4CFUA 4LM5A 1MDMB 3OXIA 3C4FA 4N6ZA 3REPA 5CVUA 3E7VA 3UP2A 3QZFA 3R28A 1IN4A 1UNLA 3ZXZA 5FDXA 4N57A 3F2AA 4D2RA 5KBRA 2C5YA 1W5SA 4M0ZA 2M45A 4KN4X 5A4TA 2FRHA 4KAOA 5AR3A 4KIKA 3SW4A 2CWEA 4XBFA 3Q6WA 4H3PA 1FOTA 2EWAA 4DG0E 4BFMA 2XIGA 2HGCA 4BDJA 4OW8A 4L3LA 3KN6A 4PMSA 3GC7A 1U54B 5EYKA 5DGZA 1UA2A 5HNBA 4DLJA 5HS9A 3K3JA 1H4LA 4I0RA 3R1NA 4FKJA 1V3FA 4BB4A 2WQNA 4M14A 3PJ3A 1FQ1B 5ANGA 4B6LA 3THBA 2BFXA 3KXXA 5HNGA 4PWNA 5EHYA 1SNXA 3GO5A 4ZMFA 2WMWA 5HBJA 4J98A 1XH7A 2LKPA 3FF5A 2F5CA 3GX4X 4FV0A 2PVRA 3PXZA 3GEZA 3B2TA 4TWOA 3WTSC 4Z3VA 4EQQA 3ZPLA 3BHYA 4LK0F 4E5WA 2FA2A 3ROUA 4YBKA 3F5UA 2ESNA 4GIIA 1MJ9A 4TYHA 4EHZA 5GJDA 1XH6A 4LI5A 4CG8A 1Q99A 2CW0F 2F5DA 3DK7A 3DJ7A 4NM5A 1FBNA 4I1ZA 4RFZA 4EKKA 2FO0A 4EKLA 2OJ9A 3OV8A 4FTAA 1BLXA 1RQQA 1KUTA 4NKSA 5ITAA 1GIIA 2QCSA 2ZMCA 5HEZA 3Q4TA 4C3RA 3GU6A 3C51A 2JGZA 2BV6A 4IX5A 3F8CA 4BL1A 3QRJA 2JT1A 2BRGA 2K4JA 3E8DA 2O0UA 2OIDA 5EEHA 5CTPA 4MAOA 4A6EA 4IHTA 5HE3A 1OECA 3ANRA 4PL3A 1VTNC 4DFNA 5HZNA 5BQTA 2F7XE 2IJMA 5IT3A 4K2EA 3P7BA 5AP7A 4IB5A 3FMMA 3QTWA 4YC3A 3R8ZA 4YIFA 2P6TA 3RAHA 2OZUA 1K78B 2C5XA 1JSTA 5CQWA 1HSJA 2Z9OA 2XK9A 3OW4A 2IP2A 4UY9A 5JGDA 1JKLA 2C6OA 3RKXA 2IVVA 2I1MA 4ASDA 3AD5A 3R7EA 3J81Z 4GV1A 4F65A 4TW9A 2XIYA 4XYFA 4NCTC 5CXZA 4EQCA 5JR3A 2GNJA 3RHKA 3DZQA 2XAQA 1DM2A 2YLFA 3QWKA 4MK0A 3SC1A 5E8VA 5T3QA 2BE5F 5D7AA 1PP8F 2UW3A 2E2BA 4ZY5A 3PVWA 2XMYA 3DQVC 3TCPA 3LLAA 4B4LA 1JHFA 4YG2F 1TLHB 2EV0A 2YM3A 3PY1A 1P14A 3QTXA 3TTIA 4AGDA 1G6NA 5HI2A 4U88A 3O96A 4FT0A 4FTNA 1T45A 4IM3A 3VWAA 4I01A 2L02A 2A1AB 2VNWA 2QU5A 4PP9A 2L4AA 3O2PE 1J7IA 2WU7A 2OJIA 3SLSA 4YLLA 2A69F 4PNIA 4UALA 4AZWA 4CLJA 1WVYA 2E9OA 4BTKA 4E93A 2XJ1A 4UZHA 3ELKA 5IKWA 4GK2A 2J51A 1REJA 1CKJA 1ZMUA 4D58A 5ILUA 5J79A 3T5XA 4LFUA 1XBCA 4L44A 4CTBA 2CNUA 4EMSA 2B9HA 5JN2A 4WXDA 1SD4A 3E92A 1ODDA 4JX7A 1QL6A 5HBHA 5AMNA 4IDVA 3W6KB 5D5WB 2C3KA 2ESHA 3KCKA 1KA8A 2X2LA 3L8SA 4HOBA 3VFZA 4NT4A 2K7LA 3GQLA 3FSFA 3GZ6A 3KF7A 3SRVB 4IB3A 3DU8A 4JQEA 4ZZMA 3MVLA 5BPYA 4QD6A 3ZMVA 3UOHA 2OK1A 3N97A 3FI4A 5M53A 1XO2B 4EQUA 5E1SA 3OROA 3IDBA 4I0SA 3HX4A 4I92A 4HBLA 2ZAZA 1G5SA 2NNNA 5HO8A 2Z5UA 3WODF 4RBLA 4O3MA 2R3KA 4XP3A 4F1OA 4RIWA 3VF9A 4PUZA 4Y5QA 5CSXA 2RV8A 3ZMZA 3LXKA 4U3YA 3HMIA 3V7CA 4O1OA 5CSVA 5CVVA 3RPYA 4FZAB 5L3BA 5DHJA 3A8WA 2E9PA 2CCIA 3HYHA 1ZMVA 5HORA 3T8OA 1K3AA 5FLXZ 2R7BA 2YAAA 4E6DA 4NW5A 2YWVA 4I0BA 2EU9A 5CSHA 2NS0A 1YVJA 3DZOA 4KABA 2XRUA 3ZC6A 4MXYA 5M09A 4DT9A 3UIXA 1SM2A 5I9VA 5LQFA 1Z9XA 3VUTA 3FMHA 1L3RE 3BU3A 2OH4A 1P92A 3HRMA 3GCSA 1IUYA 4FTUA 2EA2A 1EH8A 2CN8A 4C2VA 2PN6A 5H8BA 2BR1A 4P9UA 4DGLC 5FP5A 3KULA 4JBVA 1BI8A 1FBQA 3J80Z 3PY0A 5CVGA 4BTMA 5DYJA 1OKZA 3QLFA 4L9VA 4YP8A 4I6HA 1MRYA 3HTSB 4UN0C 2FBHA 2FBKA 3PIZA 2H34A 1GHCA 3BV2A 3OEFX 3Q9ZA 3V6RA 5I9UA 3PFIA 3RJPA 5HS8A 3EKNA 3R7VA 1R5HA 4MH7A 4KMFA 1PXKA 3LHJA 1G3SA 2AC5A 1O6YA 5FTQA 2A07F 4Y46A 3FLWA 1S29A 4FTLA 4ZP5A 4KIBA 2PULA 3GFMA 4NQWA 1XBBA 4NM0A 4AQCA 4F6SA 5A54A 4RGRA 1O9UA 5D1JA 2QENA 2HW7A 4YC6A 3P79A 3C50A 5IG1A 3EZVA 2YM8A 3R4KA 5E4HA 3RAWA 3U1DA 4XBUA 5CSWA 4H05A 1ZAOA 2GNGA 1KQ0A 4RC4A 4ONAA 3UYTA 1MUOA 2P6SA 3V4GA 3F6OA 2PMOX 2XIZA 3QBNA 4K6ZA 3E87A 4O21A 1B6CB 4G7ZF 3WIKA 5A4CA 3FHIA 3LFQA 3PJCA 2WMAA 1U78A 2XEYA 3AC1A 1P4XA 5BUEA 5LVOA 5L2TA 5AM7A 2G7HA 4F9WA 2V62A 3OCGA 4YJUA 1KU3A 2OAZA 2ITYA 3UIMA 4O82A 3HYIA 1IN6A 5KKRB 1ZOGA 3JAMZ 1WVWA 1UKHA 4C38A 4BCGA 4NM3A 3ZRLA 4XS2A 2OZAB 4EM1A 5D5VB 2X2MA 1ZLTA 3V5QA 3BU5A 4Q4ZF 1OIUA 1P6RA 1H28A 3SVVA 3UMWA 4RWJA 1GZKA 3D5UA 5M4FA 3QF9A 3BZ6A 4XRLA 2F2EA 4I3ZA 4JXFA 2A0CX 3GWZA 1M2QA 4PZJA 3I7BA 1WWXA 4D2WA 4AZSA 4J99A 3A62A 4MD9E 4R3RA 1RZ4A 3CQUA 4R79A 4CSVA 1K7AA 5CX9A 1XSXA 5IISA 4TTHB 3BX5A 4QMVA 5DMZA 3FPQA 4D2PA 2KRFA 1H08A 4G5PA 2QQBA 1SVEA 1IZ1A 3O7LD 4J53A 2VO3A 1OIQA 2ZKZA 3E3BX 3DLZA 4XRJA 5DVRA 4X3FC 2YIYA 3VN9A 5I3RA 1CKIA 4EH2A 4FKIA 3R0AA 3QRKA 3LFSA 3I59B 3ORNA 1AQ1A 2IVTA 3ZLXA 5AUVA 1XKKA 3GU4A 3ALNA 3AT4A 1O7LA 2O64A 4BAYA 4MTDA 4DCEA 3WF7A 3AMBA 3CTAA 4R7HA 4R1YA 3KFAA 4FSYA 3UZPA 2X1NA 3HSFA 4KICA 3Q4UA 3PE1A 4C57A 3VBYA 4N0BA 3PVGA 2JDOA 1H00A 5F6FA 4RX8A 2HXQA 2UZOA 3MFUA 4OOIA 2XKFA 2R3FA 4FT9A 3PXKA 4PGGA 4RGSA 2VO0A 4S32A 3COKA 4JVGA 4YNOA 5KMNA 2NAZA 4PPBA 4P55A 5JT2A 5DCFA 5JRSA 3KZYA 4WK8F 4BRXA 3TN8A 4J8NA 3HGKA 1OUKA 2OBPA 2K27A 4BCOA 5A2QK 5DA3A 2O65A 5H8GA 4S30A 3RK9A 4GSBA 5FM2A 4GVAA 3ABUA 2QHMA 4U8ZA 2XNGA 3KMMA 1IASA 5LJJA 2ERKA 1LNWA 4O81A 3WTTC 4P2KA 5JEBA 2W1DA 1SFXA 4FR4A 4AGUA 2X8DA 3ZUUA 4JIAA 4FT8A 3T8TA 2WKMA 3LFNA 2WMRA 2RFDA 1E9HA 4YBJA 3EQHA 1B38A 4FEWA 3IL2A 5E8XA 5ANDA 5KHXA 4KIGA 3FWQA 3ZHPC 2J5FA 3ZS5A 4DFZE 1MGTA 3OFMA 3I5ZA 3O7LB 3UMXA 4FKQA 3TZ7A 1ERKA 3QWJA 2RQPA 4CYJA 3QCSA 4EJNA 2XKPA 2XA4A 4LYNA 4CDGA 2C0TA 1J2XA 4GEOA 3VAPA 1KOBA 2ADUA 1S7OA 3KZZA 4L5JA 1C0WA 1PF8A 3LM0A 1L8TA 5FD2A 3LXLA 2PK9A 3EHAA 3G15A 4QP2A 3P08A 4BGQA 1M7NA 3GFIA 2V0DA 1E17A 3V8WA 4W9WA 1BN5A 5C8MA 3HDMA 3Q5FA 1XGOA 3CXWA 3KLNA 3PWDA 4LL5A 2FE3A 3Q5ZA 2O5KA 2VWWA 4HLYA 4JRVA 2UZEA 3R9NA 3H92A 4KT5C 4ID7A 5HNIX 4FTCA 5J8FA 4FNXA 3IDPA 5CAOA 5DUKA 4G6NA 4A07A 4G9CA 1PP7U 2I0EA 2UW9A 4PX6A 3OD6X 5IUHA 2AUHA 2LNBA 4NU1A 2EFNA 1WBWA 4G94A 3UVRA 1JHHA 1NY3A 3WARA 1YW9A 3B73A 5CANA 4AVPA 4I5HA 2RKUA 4C4GA 2PYWA 1GZNA 4DN5A 5HBEA 1R5GA 4A4XA 2J90A 4UMUA 2P7CB 1H1QA 4OTGA 2Z60A 1YIOA 3WF5A 4Z55A 5D8KB 3PPZA 5CEMA 3E7OA 3GCQA 3D7ZA 3HRTA 1HCLA 5M57A 3HLLA 3BOQA 2VT3A 5BVKA 2HZIA 1Z9CA 4FL2A 2EUFB 2BEOA 2STTA 3AOXA 4OTQA 1R22A 4W4YA 4WRSA 3DKGA 4NJ3A 4RB0A 2KTYA 3DPKA 4XG2A 4CQEA 3HEGA 4FTOA 2UW8A 4HYSA 1ZYRF 3DF8A 4V0GB 1OYIA 3MZHA 2WPAA 2JITA 4YO6A 1K6OA 4MKCA 2PVKA 4BCQA 3QCXA 2XAGA 4ZSGA 4AZVA 5K0XA 4V04A 5DBXA 2HELA 3B2WA 3JTGA 1UU3A 4C4HA 3IONA 2JD5A 1OL7A 4M9ZA 5AV0A 1FVRA 4CQGA 2EJRA 4M15A 3QOPA 3ZMDA 3C3WA 2IA1A 5ANOA 4E7WA 4G3EA 4OTRA 3FXRA 4RLKA 4U44A 1DP7P 4ANNA 5EG3A 4NL0A 1SMHA 2VTQA 5ETFA 1IN8A 2QHNA 5KUPA 4HLXA 1KE6A 1OPLA 4MGRA 4FV5A 1W7HA 3AAFA 1F1ZA 2H6DA 4JG6A 4ACHA 1Z05A 2WAJA 4Q48A 4EH5A 2IPQX 3BQCA 2ACJA 3HV5A 3SA0A 2ZNZA 2PLYA 2K4BA 1HXDA 4EC9A 3DGKA 1ZRCA 2HZTA 4ZSLA 4EH4A 2WMTA 3UP7A 4C0TA 4DEDA 3QP6A 4YJOA 4YLKA 3D5WA 2IJLA 4L68A 3K5UA 2JBPA 3QU0A 2QOCA 3R9OA 4IE9A 4FSMA 1J91A 2HQNA 3Q6UA 1ZMWA 3TO9A 5IQAA 3OUNB 3R0TA 4CKJA 1SZMA 5ETCA 4BDFA 1SVGA 1BYGA 3L9FA 4OIOF 3NIEA 3IC7A 3PP1A 1JKKA 2VWVA 4FV3A 2A5YB 3TJDA 1YG2A 3C7QA 3U6JA 4IXPA 1PY5A 1STZA 5IH5A 5BPIA 3SW7A 1IW7F 2R2PA 3D15A 5J87A 3LZBA 3RPUA 3FLYA 4PCQA 2X2KA 2FSWA 4G34A 3VJNA 4QMQA 1ZGAA 4IZ7A 2XHKA 1KSWA 1OBDA 4DFBA 1FNNA 3MVHA 5DNRA 5IH4A 3D7TA 2WMSA 3WE3A 1EH6A 3Q9WA 4TYJA 3LPBA 4RA5A 3SXYA 3HP2A 3CE3A 2FMYA 3F8FA 4O38A 5AP5A 4C3FA 4G6DA 4EEVA 5DE2A 3EQDA 3EYGA 2Z7SA 4EH9A 2REIA 5IUGA 3I71A 1JAMA 1VYZA 2DK5A 5CU3A 2YJSA 4FKTA 2JLDA 2LF7A 3V01A 3QZGA 3QALE 2XBAA 4KRDA 3PYYA 3F5PA 4U80A 4OR5A 3KEQA 3AG9A 3LMIA 2ISZA 4I93A 3RNIA 4D2SA 3P9IA 3AC2A 4C4JA 3ENMA 3R1QA 2C69A 4TRLA 1BOAA 3V7SA 2RFSA 3V6SA 2RIOA 2YA9A 3AC5A 4G1WA 3FM5A 3FDNA 4KSPA 1JSUA 3BHVA 4HAMA 4LFIA 1W82A 5GNKA 3Q60A 2J5OA 1XGSA 3U55A 3UQCA 2PZIA 3FY0A 2QI8A 5D5UB 3R6XA 2HWVA 2WHBA 4EH7A 2X4HA 2JKOA 3UQFA 2ITPA 3OWJA 1LDJA 4MNUA 5GZ9A 2A61A 2PMIA 2UZVA 1IRGA 2WEVA 3MV5A 3PUPA 3AGMA 3DAJA 3R71A 4LG4A 5HU3A 4I02A 5IDPA 4ZJVA 3EFJA 4EOQA 5IEVA 4XSXF 4KIKB 3ZFYA 3FZOA 4BTJA 2FNPA 3VRZA 1SD6A 3FMDA 3TT0A 3Q9YA 3EFLA 1URCA 4ANLA 5JVTA 1Z7UA 1VEBA 2NNWB 3E5AA 3P7NA 4IAKA 2CN5A 3C0HA 3MA3A 4LGHA 4RFMA 4WF2A 3VS6A 4GYGA 3L9LA 3COAC 3NUSA 4DEEA 4ZTHA 2ETMA 5JGAA 4FZ7A 1GIJA 4MTEA 2OGVA 5CALA 3WI6A 5BQ0A 1ATPE 3PDTA 4KIOA 5J7HA 1TNTA 3RM6A 1PXOA 4E4MA 2GQSA 3QX4A 4FKLA 4DA5A 3BHHA 2VRXA 3OTUA 4MXXA 3ODYX 3OZ6A 2XS0A 3ROYA 4F6WA 3G51A 5BVDA 2QVOA 1S9IA 3RIRA 2GHMA 5T6KA 4D5HA 4FMQA 5LEJA 4GVJA 5HIEA 3FLQA 4GJ2A 3C4CA 2COMA 4U79A 2PSQA 3VW6A 3P9KA 3LFBA 3HL7A 1R23A 1FWZA 3MAJA 3QC4A 4P96A 3SXRA 3QC9A 4XG4A 5ANIA 4A0YA 1LEZA 4R5YA 4L45A 1CDKA 3TDUC 3RALA 4RWIA 2B4SB 5DEWA 4GFOA 4TYHB 4XMOA 3SDJA 4XV9A 1OGUA 2H6CA 4ZSAA 4IAAA 1IAHA 5JSMA 4EGYA 4EK4A 5EFQA 3ZDIA 1A9UA 5CVRA 1BKXA 4UX9A 2WD1A 2IW8A 3KETA 5LMAA 1YS6A 1R78A 4F4PA 2XNMA 3NUYA 1J59A 1IRKA 4JR7A 1W0XC 1FP1D 4ZTRA 5G6VA 4U81A 2YIWA 1HW1A 4Y17A 4QMZA 3C0IA 2VC1A 5EKOA 4FKWA 4CFNA 4YNEA 3M9AA 4RIOA 1BI0A 3LCKA 5KMJA 2YIQA 4FYOA 3A7FA 3LFKA 3EQRA 5IUIA 4ITJA 2FBIA 4DEAA 2DYLA 4FX4A 2J0JA 4J1RA 4YJQA 5IU2A 3ZO3A 5HTIA 3FMKA 3P9CA 4R1VA 4WCGA 1UHWA 3B8QA 4L8MA 3VQHA 4ANOA 1PXNA 1NVQA 4JBPA 5L8KA 3H3CA 3QXPA 3U51A 3VIDA 4JJRA 5AP2A 2G7UA 3OBJA 4LLLA 3CUOA 3OUKA 4FKOA 3W55A 3E3VA 3UNJA 3TDWA 3FZSA 3K3IA 4O0TA 3C4XA 4RX9A 3LAPA 1AOYA 4PL4A 2KKOA 5HD7A 3VJOA 4DC2A 4FT7A 2HKOA 4AW5A 3LOKA 2P5LC 3E3PA 1P2AA 2OD5A 1PHKA 4X3FA 5LGNA 5LVPA 4MEXF 5HE2A 4WKQA 4DGOA 4J71A 2XNEA 4GL9A 3JY9A 2R3QA 4O0UA 2HY0A 3QU6A 3A7HA 2ZNYA 4HGLA 3FY2A 1CF7A 4AGCA 4ZTSA 4ZLZA 3Q3BA 5BUIA 3IWFA 4HCVA 2UVXA 3JYAA 2ZMDA 2GQGA 3R9RA 5FXQA 3RGFA 2PU8A 4L18B 1G8SA 3QAME 3VB2A 1OZ1A 2CHLA 3ZLSA 2XIRA 2VC0A 3DDQA 5L2QA 1OL1A 2C1AA 3CD3A 4IACA 4XSZF 2B9JA 2ESMA 4NJDA 5CVHA 2VTMA 1T38A 2NNYA 3TIZA 5HLWA 2WB8A 5B7VA 4F08A 5L3CA 1Y0UA 4M72A 3IWZA 2PMLX 4EJ7A 3LXNA 3FL4A 1IN7A 5A14A 3F3UA 2UVZA 4IM2A 2J5PA 2V79A 1H01A 2ELHA 3D83A 4PY1A 2V55A 2VBXA 4O7ZA 4H3BA 1KYZA 4FBXA 5EDRA 4BKZA 3TACA 2VX0A 5CZIA 1U5RA 5J8IA 3IGGA 2GQRA 2OQRA 2R4BA 3O0GA 1ZOEA 2EB3A 3MGYA 1FVTA 1XD7A 4RA4A 2C6IA 4C62A 2YCFA 1GY3A 2Z99A 4LV8A 5IH6A 1I09A 3NEWA 4U7BA 1B39A 3S4QA 2X6EA 1D8JA 2YSRA 3JR1A 1R1VA 3COIA 2FUMA 2W5AA 2WTVA 2QLUA 3AD4A 4EK8A 3EMGA 1P4WA 4RIWB 4Q2AA 1ZY5A 2JSCA 4MXOA 1ZG3A 2XK7A 3WF6A 4JOAA 4FEVA 4CFWA 3CUQC 4U6RA 3M1SA 4QPSA 2BRMA 3MTFA 2WMBA 4MD8E 4YZDA 4S34A 4U7ZA 3BHTA 4MQ9F 2R3IA 3KMWA 4CVAA 2DWBA 4YFNF 2NO3A 3E5UA 5FQDC 5HCZA 4A9YA 3R7YA 3DBCA 2R9SA 2CGVA 2VTSA 1DS5A 1YS7A 4GT3A 4K11A 3GP0A 4DEBA 5D4RA 1S3JA 4CFVA 5J5TA 3LQQA 2ONLC 3EB0A 3TKYA 3ZU7A 4PL5A 2IVUA 2HWOA 2X7GA 4S31A 1HSTA 1FZPB 3KULB 4Q5SF 4IAFA 4MNEA 1R1WA 3K2LA 3QD3A 3IGOA 4IFGA 3RPVA 2KIUA 4F1TA 3BBWA 2ZXJA 4EOIA 4G3FA 4I6QA 3GB2A 3OWPA 3GOPA 3E8CA 4BDKA 4C59A 3ATSA 5HTCA 4O7RA 3O2MA 5CVJA 3GEQA 3GOKA 4OUCA 5KNJA 1Y8YA 4FHTA 2P7VB 1LR4A 3FI2A 5LHHA 4AAAA 1T46A 5JKGA 4IWPA 4NZWB 4L6QA 3UVPA 5CF6A 1YQJA 4DINA 1E1VA 3LCDA 4C4IA 4BH9A 5EW9A 5JFXA 5TT7A 5D7VA 2OBJA 2QOBA 5E8WA 1YHWA 2P3GX 4TN6A 4RJ7A 4LV5A 2VGPA 4HA8A 2GA1A 2H8HA 4O22A 4FKUA 3DBFA 3FLNC 2EWNA 3T3VA 2DU9A 5AIQA 5GJGA 4AIHA 4QMUA 2IN6A 3BYSA 3Q5IA 1YLFA 2JAMA 2V1XA 4BYIA 3VBTA 5LLQA 3QTIA 3NYVA 3LQ8A 2P2IA 3UOJA 4YZCA 3COMA 4YR8A 1YKRA 3KRWA 3DY7A 4LJZF 3EKKA 3FUPA 3L8XA 1XMKA 4BVUA 3K69A 1WBVA 3NX8A 4RQVA 4G9YA 1ZYJA 5G1XA 4E6CA 2Y0MA 4I2OA 5GIPE 5LHIA 1ZLKA 3MJ2A 3ISPA 3ZC5A 4UBAA 3GI3A 3Q2MA 5KMIA 5TRDA 2C1BA 3Q96A 4EZ3A 3U9CA 4OINF 4O6LA 3O6BB 3A2CA 4CT1A 1OKYA 2B54A 3DJ6A 3P0MA 1ZREA 3BLHA 3WZDA 4Z16A 1LP4A 4J52A 3F6XA 3LW0A 4EYJA 4ENYA 3D9VA 4F7ZA 3PQJA 4DFYA 2A68F 5IA3A 4G3CA 3CCNA 5M07A 1Y8GA 1H25A 4F9CA 4JR3A 5HVYA 4QQCA 2HXLA 5J6XA 3IHUA 3DB6A 4D2VA 1P5EA 3VBVA 2QOLA 2W9FB 4QMLA 1LDKB 5A46A 3A99A 3FBVA 4Y83A 5CF5A 3L9MA 4F09A 2GS7A 2XGXA 1A06A 1FLIA 3BI6A 5AR4A 3HV6A 4S04A 2R3RA 1ON2A 4HF2A 4ZYDA 4KS8A 3LQ3A 3EQBA 5E8ZA 3IG7A 1WVXA 3DPTA 3BEAA 1OI9A 3QCQA 2W4JA 3PLAE 2GAUA 4Y85A 5C03A 4H3QA 3W33A 3O50A 3NLBA 2MH2A 2XIKA 3C18A 3F3ZA 4QNAA 4EVIA 5IQFA 4M97A 3E6DA 1O3RA 3QAHA 4XOYA 1YTYA 1HOWA 3CR0A 3BZ3A 1R00A 2Y9QA 3DXQA 4XJ0A 3BV3A 1YW2A 2HIWA 2OQGA 4PDKA 3HRUA 1MJBA 5K3YA 4BBFA 2OICA 3MZYA 3D0SA 3CQEA 2PZYA 4F7JA 2YABA 3EYHA 2BKKA 2W1IA 4WA9A 3U4UA 3UO4A 2BFYA 4UXQA 3KCFA 2W96B 5K1YA 3VRYA 3KA0A 3WE2A 2YX7A 4EM2A 2RGPA 3FWEA 3VS3A 4JDHA 4C4FA 3R61A 5HU9A 4UVAA 4UUVA 2ZM1A 3PSDA 4O83A 2BHHA 2V7AA 3OEZA 3OOPA 4KIPA 3NUXA 1XB4A 2P4WA 2OU7A 4XG8A 1PRYA 4ZLOA 1USSA 4I09A 4U40A 3VC4A 2UUEA 2HS5A 2F49A 4QQJA 5DPVA 5KKRC 3QRTA 4ZLYA 4CTCA 4A5MA 4QTBA 2C6KA 4AACA 4M0YA 3S2PA 2XAFA 5LMKC 2ZV9A 1UU7A 1PKGA 2F7EE 1O6LA 3MESA 3BPRA 1S6LA 2XK3A 4FIFA 1YDSE 4KRCA 3BHUA 4EOLA 4J97A 4D4SA 2GQQA 3ULZA 2I40A 4EWQA 5EM8A 3R73A 2QVSE 3A7JA 1Z1DA 1U4DA 4MYGA 3G9NA 5F4NA 2HW6A 4JK1X 2IG7A 1RI7A 3WIGA 4QP3A 4WHZA 5L2IA 1MKMA 5J9LA 5KMOA 4FK3A 4L46A 5B0XA 4OTPA 1IXCA 3WGHA 3Q4ZA 1IXRC 3MEXA 6PAXA 5CVIA 3BWFA 2D2WA 3ROCA 2O2UA 4BDDA 2WMXA 2FYSA 3WTVC 2JKKA 3CQWA 5KMLA 3BLRA 3FHRA 1LB2A 2PVJA 4BGHA 4OAVB 2OI4X 1NHAA 2AYPA 2W05A 3LCTA 2ETRA 5ANKA 3E6MA 4RVKA 3HV3A 3ACKA 4CMOA 3R9DA 5EQYA 3NWWA 2WMQA 1QBJA 4BDCA 3IKTA 4JX3A 4ZS0A 4IHPA 2Q0NA 4HGEA 2BDJA 4MWIA 4FSTA 3D2KA 1QZZA 1V0OA 1W7PA 3R21A 3VOEA 2L4MA 1YFHA 5DR6A 1H27A 4I22A 3A8XA 4UYNA 3UQGA 1A48A 4FVPA 4M84A 2XCHA 4N70A 4XLIA 3SXFA 2ZDUA 4O84A 2DLLA 4O2ZA 4FKRA 4IJ9A 4A7CA 3U2RA 3ORKA 4DLIA 1QPJA 4N6YA 3VVHA 4I41A 3OCTA 4O0YA 5GIOE 4IRGA 3LMHA 3DXNA 1X8BA 5CU6A 3MH3A 4AGWA 3V5JA 3UNZA 1S7AA 3LFAA 2UWMA 5BVFA 4CMUA 1P2FA 4IVCA 2FH9A 3H3UA 2CKQA 2PZRA 3PVBA 1OUYA 3FQEA 2AS5F 4LL0A 2KIMA 3SV0A 5HO7A 1YDTE 2K02A 3QYWA 2BDWA 5AP3A 2O8XA 3F8BA 4EJUA 3DOGA 5E17F 1SVHA 3E88A 3IW7A 3RKYA 1H0MA 2F9GA 1FPUA 2VTLA 3NCZA 4IVDA 4ZTQA 3QKKA 4WXHA 4EJWA 4KB8A 3PXYA 4ZTMA 2FXAA 2PBIA 4UXNA 1T98A 5KMKA 2VE8A 3H9OA 2VO6A 4HJOA 2X8IA 3KRLA 1OM1A 3WU0A 5AFVA 1BC8C 4FT3A 2YITA 2X7FA 2JIIA 4LQMA 3ZMSA 4QMNA 3F3VA 4TXCA 5LOHA 3UPZA 3AC3A 5A4QA 2UV2A 2E1NA 2ZM4A 1K2PA 3EQGA 4BI0A 2UW0A 4IM0A 5AX9A 4P5OA 5FG8A 2EB2A 4BDAA 1H26A 4D2TA 3OY3A 3QA0A 1RUOA 1BIAA 5GINE 3VNTA 1BX6A 1IA8A 3MPTA 2BROA 4WG4A 4JQ7A 5CT0A 4D4VA 4A4OA 2Y48A 5CI7A 4K2RA 4AIKA 2IZSA 4E3CA 1B1BA 3MVMA 4B7TA 3KVWA 4BCMA 4JG7A 4FF8A 2E7WA 1WAKA 5B2KA 4U45A 3ZN0A 5AR5A 1XH9A 4B09A 3LFEA 5EEGA 3W16A 5ERIA 2SRCA 2B52A 2UW5A 3CEKA 3FZVA 4N4SA 4L3JA 3FLSA 4O5VA 2C5OA 5B2MA 2PVLA 4BHCA 1U5TA 1H0WA 3EWHA 1OYWA 4DBNA 3FL5A 1MQ4A 3SZTA 3ZO4A 2CKOA 4MEYF 2W84A 2QBYA 3DQWA 3EETA 2CNVA 4Z9LA 5TJJA 3DDPA 4YZ9A 4JG8A 4CKRA 3NUAA 5M55A 3RI1A 4PPAA 5E1XA 5LVLA 3L2CA 2HEOA 2XVCA 3PPJA 4PMTA 1OR7A 4O0WA 5AP0A 1M17A 5I9WA 1UNGA 4QMPA 5AWMA 4AWIA 4I20A 3FMEA 5C26A 3FZTA 2OZ6A 1UU8A 2A6HF 4ASEA 1Q5KA 2BHEA 2NPQA 3MI9A 3D7TB 5FTOA 1ZG5A 3ZLYA 2JDTA 1BM9A 3NSZA 4FSQA 4XV1A 2XV4S 4BY9E 2ZJ2A 2XKOA 2VTPA 4XP0A 4CRLA 1Z6RA 2OJFE 4OLIA 3LA7A 3V5PA 3Q53A 5EI6A 4QMSA 4I6BA 2VV9A 4Y8DA 4F63A 3R7GA 4QO9A 4RWLA 1Q1HA 3HRCA 5D9HA 3BYOA 3K1MA 2W0JA 1KE7A 5ILSA 2PVMA 4FTRA 4G5JA 4CO8A 3CUQA 2Z02A 4OTFA 4QQTA 4PDOA 3ORZA 5JFRA 1AWCA 1OB3A 4WD5A 2GTNA 4E6AA 3TOAA 3F72A 4B9DA 5LRSA 2ZB1A 5EM7A 3HDNA 2YM6A 3ERKA 2Z2WA 4XNEA 3M8FA 2WELA 5CVFA 4K77A 5DT0A 4KINA 3OT3A 3R60A 4CGAA 3HZTA 4O7VA 3GFEA 3L8VA 5HLHA 1S8NA 3VUKA 3A7IA 4ZK5A 3NGAA 5CS6A 4L0YB 4EOPA 4CKIA 4YHTA 3DKOA 3UVQA 5DWRA 3DS6A 5IZFA 1DDNA 1XH5A 3ORMA 1R39A 4WOVA 4W4WA 4U0WA 3DJ5A 3GXOA 4I98B 4CRSA 2QKRA 4AT5A 4IJPA 4GU6A 4JDKA 4ZYGA 2ZBKA 1XGNA 4BCPA 1Q8ZA 1CM8A 2Z7RA 1PXIA 3BEGA 2OLCA 1ZYLA 1OPCA 5JI6A 5E7RA 4YSMA 3HMMA 4H1JA 2W85A 3BELA 3LSTA 1JNKA 4EOMA 4DGNA 2RN7A 4FIJA 3ZEPA 3M1EA 3U6HA 1JWHA 3E8NA 4BXUA 3R9HA 5CJ9A 2W4KA 3F82A 3RKWA 4W9XA 3A7GA 3SOCA 2CGXA 3IKVA 4LK1F 4GJ3A 1KWPA 5M4CA 4MBLA 3BIZA 1F4KA 4CXAA 4IX6A 2R3OA 5LCKA 2VWXA 1OMIA 3UOKA 2ZB0A 4H58A 5EW3A 2R7FA 5AV3A 4YTCA 3Q9SA 5ED4A 5D10A 5KBQA 5HS7A 3ZONA 1ZGJA 2XROA 4O1PA 5FEDA 4UYAA 4I0AA 4LB5A 2UZLA 2G01A 4I5MA 3ERED 3RK7A 3FMSA 2VOPA 3CTQA 3ZRMA 4L67A 1P4FA 1IN5A 2CGPA 3OP5A 3L00A 2YJRA 4RGXA 1J1CA 5EHLA 5FBNC 3F69A 5EM5A 4X21A 4LRKA 3VODA 1RIOH 1SMTA 5H9BA 4AOJA 3MJ1A 4FKSA 3JVRA 2BYVE 2W4OA 4E5BA 5A6NA 2QONA 4RB2C 2ITQA 5A2QZ 1BL7A 3R04A 4PPCA 4IRIA 3K1NA 1XJDA 3U87A 2RKHA 2XK4A 3GUBA 5AONA 4J8MA 3KP2A 2XASA 1JE8A 4XV3A 2D1HA 5L6WL 2QUFA 4OIPF 2ETKA 3UE4A 1QGPA 3QUPA 4QMWA 1F5QA 1WSUA 3EFWA 3MBLA 4GS6A 4QLCU 5ICGA 4RVTA 4DNCA 3V8JA 4XH6A 4D1ZA 4IXAA 2J9MA 4M9SA 3MWUA 3EQPA 3LWFA 2J2IB 5CY3A 2W7XA 4B8LA 3ZN1A 2CQKA 2RNJA 3G6HA 3QQGA 3DKFA 3SKCA 5DEYA 3BKBA 4XG9A 2WTDA 4IQ6A 2M5WA 2F5FA 1B4AA 3BYUA 5AJQA 5E1WA 3FKOA 1FX7A 4OMYA 3MYGA 3NAYA 4RIXA 3JY0A 5B2LA 2QYOA 1WKMA 4YPDA 3DB8A 4WIHA 2FGIA 4X3FB 2C6LA 2UZNA 1XSDA 3NNWA 3RWQA 2PL0A 4EK3A 4IIRA 3B8RA 1SD5A 4RMZA 4C4EA 4BDBA 4DH5A 4RX5A 1ZZ2A 3QZIA 2PUIA 2XF0A 3D0EA 5DDGA 3KGAA 1M7QA 2OZOA 3UDBA 2XRNA 3SHFA 2WO6A 4ENKA 5LEKA 2ZOQA 4BZOA 3CIKA 5HDNA 1CF7B 2HY81 4YJSA 4RJ4A 4BTFA 3F23A 2WTKB 4MQ2A 4DF3A 3RPRA 3TM0A 2J5EA 4HGTA 2P8TA 3TNIA 4NSTA 2Y4IB 3MS9A 2QOIA 3U6IA 5BS6A 4C2WA 3MFSA 3G33A 4S05A 2JPBA 2EA4A 3R02A 4FG7A 5H2UA 2PPQA 3KLOA 3SFZA 3NW5A 2LAVA 4GIHA 1STCE 3EH9A 2PE2A 3TI1A 2H94A 1H1WA 2HQRA 4Y13A 5LRRA 4AE9A 1JQHA 2YDJA 5F95A 3OHTA 2Y7JA 2ZMEA 3PP0A 3V3VA 5AIRA 3CLYA 4M3QA 5CASA 1KU2A 4LD5A 1H9TA 3BPVA 1OBGA 2PMNX 4WG3A 3H30A 4LOPA 5EOBA 5L6PA 1Q62A 1ZWSA 3ZLWA 1H1RA 2HENA 4X2JA 4CFMA 2QC6A 3CSVA 3VBQA 1RW8A 1DPUA 4FG8A 3CS9A 1Z91A 4WX9A 3RJCA 3QPHA 3SG8A 1GJOA 3SHEA 3QKMA 5AUYA 4AFEA 3UC3A 5IA4A 4BNCA 3R1SA 5F1ZA 3WILA 2QG5A 2I0VA 3MWMA 4F7LA 3FQSA 4UV9A 5C4KA 2EXMA 4APCA 4IHSA 2OFUA 3LAUA 4HNIA 5ANJA 4MF1A 2P5VA 3GZ5A 4FZDB 5H20A 3FXZA 3CJNA 3HV7A 3ULQB 3ECOA 5CU0A 4BIDA 4IAYA 3ZFMA 3AQVA 1O6KA 3O51A 4DBXA 5EQPA 4ETSA 3F7WA 4F64A 4QYFA 1T0FA 3DK3A 3QKLA 3FMLA 5EI2A 3LA3A 4E4XA 4FVQA 4G3GA 5AIPA 4R1HA 4JRNA 5GHVA 2H27A 4AS0A 2NRYA 3GFWA 1M14A 4C02A 1T6SA 4EH6A 3E63A 3MA6A 1MJAA 2X0GA 2E9VA 2VTJA 3IECA 1EH4A 1RUNA 2QG7A 4OMZA 3OBGA 1YXVA 3KXHA 3ACJA 4GFGA 4HF1A 1YXTA 4FEXA 1DAYA 3BE9A 4MNEB 4EH3A 1O3QA 4USDA 4X2GA 5C1QB 4OTIA 4NWMA 3E97A 4CHUA 3FJQE 5L2WA 1KYWA 5LCJA 2OSCA 3FXUA 4AE6A 1IR3A 4RJ3A 1QPEA 4RJ8A 4ZS4A 2RG5A 1YRPA 5ICFA 3D94A 4HCTA 2WNTA 5IQIA 3LCOA 5BOXA 4JQFA 5K5QA 4JS8A 2FSTX 3OS3A 4ESFA 3AC8A 3FMRA 5ANEA 5LWNA 2GDOA 1WBOA 2JZYA 4JNWA 4Q5HA 4WXCA 2CJMA 1BI2A 4RPVA 4GH2A 2WTWA 5L2SA 3D5XA 4FKGA 1O7FA 3P4KA 1HKSA 5D4SA 2R7IA 5AP1A 4ZZNA 5DFPA 2OIQA 4CXFA 2X8EA 5FD5A 4KFCA 3I4BA 2BRNA 3M2WA 3R22A 1UNHA 5C27A 4P5QA 3ZFXA 3LAJA 2HTSA 5IDNA 2R0UA 3ZZWA 3GC9A 4EZ7A 5GJFA 2C6DA 4IB0A 4AZTA 3CY3A 3PVUA 4FTJA 4FT5A 5HVJA 3ZMTA 4RQKA 3EYYA 3RCJA 3BY6A 1GXPA 2YX4A 5K4IA 3P5KA 3COHA 3KXGA 2RL5A 2H6BA 3EN9A 4ANMA 2YZLA 2G2HA 4YJVA 5AR2A 5ICCA 1Q24A 2VBZA 2M30A 4NM7A 4O0VA 4ORKA 1APME 2ACXA 2MLGA 2WQBA 4HCUA 1WBTA 3POOA 2VAGA 3RZFA 2FF4A 3PA4A 1DUXC 1QNTA 3J7AO 4YUQA 4MQVA 3T0YA 3I7CA 3ANQA 5AAGA 1IEPA 2FA5A 5HG7A 2QWWA 1Y6BA 4MF0A 4TV7A 4FKVA 4EL9A 3EL7A 1BJAA 2W1FA 4JBAA 5J5SA 4A2UA 4OAUC 4KYWA 3VBXA 4R3CA 2O63A 4ZAUA 4AF3A 2OJGA 1H24A 1E2XA 4M6XA 2Q83A 2JIVA 2WFYA 4EUTA 4B8MA 4AU8A 1M2PA 4PRJA 4HF0A 5KO1A 3E5XA 4FEQA 4A06A 4QMXA 5CAUA 3RPOA 3AGLA 4DFXE 2MD5A 2QO7A 4FV8A 3R00A 3A60A 3R8PA 3WTUC 3LM5A 5IMXA 2EFWA 3SQQA 3VO3A 3WOWA 3FE3A 3VUHA 2EK5A 2V1DA 3QUDA 2BIKB 4K8AA 4QRCA 3NPCA 1B9MA 2ITXA 3MH1A 4AT3A 3EJ1A 2CG4A 4HPTE 4WNMA 5CLPA 4TWNA 3CPBA 2YCRA 3RMFA 1EV7A 2DT5A 3ULIA 2BZIB 2MA3A 5F20A 5JFWA 2OF2A 2C47A 3WF8A 3G6GA 4XBRA 2R3PA 4FIEA 3GGFA 5IPJA 3EN5A 4V0GA 2Q8KA 4ZTNA 3I54A 3BU6A 3N51A 3WF9A 4IJAA 2R3MA 4RFYA 2QODA 4K1BA 5LVMA 2ZCWA 4KNBA 2XIXA 5AR7A 4NTTA 5TE0A 3A61A 4QMOA 3JXWA 2V5QA 4DEHA 4MX9A 4BYYA 4FNZA 2PMHA 2JTVA 4WWCA 2BUJA 2PWLA 1W4MA 3LVPA 5ACKA 2UXXA 4NYEA 1DAWA 1YO5C 2EB7A 3DPLC 2QQ7A 4M69A 4IPAA 3LQRA 5LWMA 4U3ZA 4HV5A 3IRQA 1JXSA 3WTYC 5HTBA 3K0LA 3K1PA 3MPMA 2ZVAA 2B7AA 1I5ZA 4A4LA 1Q8UA 2P4IA 2VTHA 4YU2A 5FDPA 4DHFA 4ACGA 4F7NA 2HOEA 4Y95A 5AUZA 1J7KA 2QURA 2O03A 4P4CA 2L3DA 3ZM9A 4K0YA 2VWYA 3QZHA 4DAWA 3QQHA 5AA8A 4FNWA 4TY1A 5C9CA 1J7UA 4TZRA 3H9FA 3QRIA 4BBMA 3UIBA 4KA3A 2PUPA 1OYYA 4ASNA 4GUBA 2CNQA 4MBJA 1HBXG 5FP6A 5KX8A 3LQ5A 3KP7A 5EHOA 2QOHA 4ZZOA 5JQ5A 4TWCA 2VTRA 2XRWA 5HDKA 2OWBA 2BGCA 4RT7A 4G8XA 2CKEA 3EQIA 3VS4A 5BYZA 1U5QA 5CEQA 2QLZA 1FMKA 4X7QA 2HYYA 3GC0A 4IEBA 3DTWA 3NUNA 4B8XA 4M71A 5JFVA 5KMMA 2ZO4A 5TF9A 1U59A 3H0ZA 2EXEA 4ALUA 3L7WA 2QKWB 4BCHA 4PF4A 2STWA 2Y75A 4NB5A 4A9SA 5BVOA 2IW6A 4M67A 4JL9A 3TZMA 2EFQA 2ZM3A 4EHVA 3HRFA 5CU4A 2WWYA 4UMPA 4RSSA 1M2RA 5AUUA 5AA9A 4KBCA 2VWZA 3U54A 1GXQA 3WG9A 4LRJA 1W7PB 2DUVA 3KKVA 1V4RA 4ZY6A 2NYXA 3CBLA 4G3DA 3NVMB 2ISYA 3HUCA 3ORLA 3VS1A 2JDVA 1Q97A 1IG1A 2JPCA 4AA5A 5L3GA 2HYFA 5BVWA 4JI9A 5GZAA 3FPMA 5H6QA 3DBEA 2PHKA 2YPRA 2RGVA 4DG3E 5K5NA 1Q4LA 4LB6B 2J0KA 4F9YA 5GZ8A 4FX3A 4FSNA 4M74A 5I9ZA 4ASZA 5IQBA 1XWSA 2UVYA 3QL8A 1PUEE 1IXSB 3HA6A 1FBSA 2IVMA 4E1ZA 5E9EA 3MFTA 4IWOA 3V51A 4XLPF 2J0MB 3HHHA 1YDRE 1U8RA 4I21A 5JQ8A 2IRFG 5IEYA 1KGSA 4QWQA 4UNOA 5I3OA 5AV1A 3SD0A 3VQUA 1R1TA 3WTZA 2QO2A 2GTMA 1FYLA 3ZP5A 2XUBA 1CKPA 5IA2A 4UZDA 2BBYA 3UC4A 5ETAA 4ZEGA 5IMEA 3OF0A 4ERKA 2DQLA 2BZJA 4FK6A 2RF9A 5AUXA 2FOKA 3HSRA 1YI3A 2BILB 4C61A 3FZPA 1ZRFA 4BCFA 3W32A 4U0IA 4X6RA 5HG9A 3T9IA 5CEIA 2G15A 1F5TA 4XRFA 1FC3A 4Y73A 3OWKA 2IZRA 4MNFA 3NR9A 3WZUA 2V9VA 3KCCA 2A3SA 1V0BA 1YQAA 3MDYA 4QYEA 3RHXA 4F7SA 4UWCA 1W8CA 4I5PA 2F4JA 4N9HA 2W06A 5BX0A 5TKDA 4M13A 4CD0A 4II5A 4NCTA 5DR2A 4MWHA 1T2KA 1HKQA 4IVNA 1RE8A 3KMUA 1WZYA 4EK5A 3N4MA 2WOTA 3FKLA 1FYMA 4ZJJA 4I94A 4E8AA 1SFUA 1TW3A 2X4FA 5A3XA 1ND4A 4D9TA 3I79A 1ZOHA 3C0GA 4CEGA 4OGRA 1TQIA 1FYKA 5EH0A 4ENJA 4G6QA 3VF8A 1UB9A 1R0PA 3OTVA 3PJ8A 2C6TA 1I1SA 4W4VA 4YC8A 2EXCX 3JUHA 4D4YA 3HRBA 4HX7A 4PMMA 4GCJA 4K18A 4HVHA 2BZKB 2X9EA 3R01A 4BYJA 4ERWA 1HW2A 2BAQA 2W24A 2UW7A 3PIYA 1ON1A 3ORIA 4TPTA 5FEQA 1U5TB 4EJVA 5E90A 3F5GA 4RWKA 3V8TA 5A4EA 1F3MC 2W1EA 3RTRA 2Y0AA 1K79A 4ZZDA 4BCJA 4OBPA 3GYHX 1UWHA 3VS0A 2QBYB 4YJNA 5IA0A 3VS5A 5EDPA 5DH3A 5IEXA 2QR8A 4WG5A 4FTQA 4GT4A 2AXLA 3P86A 3BJAA 3BPXA 4HYHA 4FV7A 3NNXA 4DH3A 3EN6A 2X81A 3WGGA 3I64A 4HDUA 4X0MA 3L9PA 3WGIA 3BGQA 4YJTA 3PRIA 2IA0A 4FC0A 3CD8A 2DI3A 3W2SA 4O0XA 4WNOA 3HUBA 3L8PA 3V8LA 2VE9A 2OF4A 1G3YA 2VNYA 4E70A 4HNFA 4C3PA 2BAJA 3RNYA 5HESA 1O3SA 2GA2A 4IWDA 2C6YA 3TXOA 2J6MA 2J7TA 3MH2A 3VW8A 5L3EA 2XB7A 4HZRA 4Q47A 4DYMA 3HP5A 3CUQB 2OA4A 5M56A 5DD4A 4BDHA 3R7IA 4BDIA 2XCKA 3MPAA 3DEUA 3NW7A 4F0IA 2FQ3A 2BCJA 3TL8A 3KL8A 3ITZA 3HRSA 4NK9A 3EN7A 4HVIA 3MIYA 4NTSA 4FG9A 5HCYA 1F0QA 3RBWA 2XJ0A 3ZDUA 4WNKA 4LMUA 4BKJA 5DOSA 4YFKF 3P23A 4FOCA 3FYKX 3KP5A 1KV2A 5KZIA 4U0VA 2IVSA 4LMYA 3AT3A 3R83A 1KV1A 5AAFA 4BZDA 1OL2A 2WQOA 4D4RA 5HLIA 4QYGA 1GVJA 3UO6A 3HAMA 5CYVA 4GGGA 4F99A 3MH0A 2YHVA 2CLQA 5K0KA 1CTPE 4KKEA 1G8AA 3Q04A 3JTHA 4BDEA 2B9FA 4IRHA 4UHTA 1UU9A 5AR8A 2PVYA 2NP8A 3PIXA 3D14A 2IZUA 1LUFA 5CSPA 5TO8A 2VXZA 1PXPA 3DNEA 4O0SA 1Q3WA 1SYKA 4FV1A 5DV5A 4O7NA 1D5VA 4AP7A 4R3PA 1YHSA 3C13A 2QOOA 3SX9A 3BYVA 2XJ2A 1FP2A 5F1RA
chains in the Genus database with same CATH superfamily
4RAYA 3WBLA 4CYCB 2IS2A 3H9RA 3UO5A 4NIFA 1ZELA 2KIFA 4YFXF 4AWXB 1IA9A 1T8IA 5CYIA 4XHKB 3MFRA 3V42A 3UDZA 2BZHB 4K33A 3PXFA 3OWLA 5CEOA 3HMPA 4RS8A 2LY9A 2QR7A 1Q8YA 4ZIMA 2FEZA 1ITYA 2YERA 2R7XA 4AW2A 4QTEA 1J75A 1J7LA 4USFA 1ZG1A 3JSPA 2YU3A 4UV8A 3LIJA 4L9TA 4NKAA 2HCKA 3ZOSA 3AC4A 2VX1A 2YWPA 3SZGA 4EC8A 4NHJA 2IS6A 5E1ZB 4DYRA 1QVUA 3O3KA 2E1CA 2QU6A 1ZR4A 3EYIA 1QPDA 4XMYA 3ZMUA 3HVCA 4M68A 1TBXA 2C6EA 2W5BA 3FZRA 5C4XJ 2JDSA 4BKYA 5F64A 2HZ4A 5J1VA 4QSHA 5HLPA 4NEUA 2PVHA 4JAIA 5HQ0A 4U5JA 2F4IA 2VBWA 4WRGA 1KZHA 5KCVA 3U4WA 2RNGA 3RP9A 2CMPA 4C9YA 2KL4A 2Y4PA 3Q52A 5KK1A 3RCDA 3AKLA 1HCKA 3HKOA 3SDGA 4TNBA 5T68A 1SD7A 3OXZA 5E20A 3IW5A 2HAKA 5L8LA 3WHBA 3SQNA 5E8IA 5AP6A 3V8SA 3S1MJ 1XH4A 4JBOA 3P1AA 3GCVA 3KY2A 2DA7A 3KP6A 3ENHA 4I6ZA 4NW6A 2ZFWA 2ITTA 3W8LA 2ITOA 3OOGA 1FMVA 2C6MA 3VUDA 4M6YA 3QU3A 2NRAC 4MTAA 3P9JA 3GQIA 5F27A 3KEOA 3UNGC 4JAJA 3K4MA 3GENA 5JFSA 1JUMA 3FV8A 4H39A 2WC2A 3HOWJ 3HKZA 3CTHA 3QP5A 4PFOA 2I7QA 4RVMA 2X6OA 4RIXB 1FGKA 4BJ6C 1FTZA 3H5RA 2HKXA 3QYBA 2JA5J 1Z57A 5DLSA 3FSKA 4F6UA 1HQCA 4O7TA 2VODA 4ZYAA 4D1XA 4PMPA 3TNWA 4B44A 2VTNA 4XK4A 4FI1A 2DQRA 2VU3A 4Z7GA 5AUTA 5M51A 1VQ8I 4YSJA 1YOJA 4XP2A 3D5SC 5FKLA 3EZRA 3F0CA 1J1BA 4EYMA 4PDYA 4PTCA 3VYUB 5JRQA 3KF4A 2CKPA 4UMQA 1H89C 5JLXA 5IT9K 3E93A 3F9KA 3IDCA 3UGCA 2FVDA 3I81A 3MVPA 3H9QA 1O3TA 4FV2A 2C0IA 2PX9A 2O6GE 4MUQA 5DUIA 1YYVA 3WE4A 4C37A 3PQKA 3DTEA 2W99B 3I3LA 3OYGA 1XDSA 5GAHJ 3IH2A 4FV9A 3CMMA 4ZSEA 2KT0A 2FMLA 3S1QJ 2MBFA 2E1MC 3VUIA 1MRUA 3R7UA 2YCQA 4PSXA 5IPAA 3QTUA 4Y3OA 3GU7A 5D12A 3GBZA 4ACMA 4BHNA 4BI2A 4FYNA 4E7JA 3TV6A 5D6FA 5EOLA 1OIYA 2NVXJ 4JLCA 2LD5A 4BHPA 1PYEA 2WTIA 5C3EJ 2H9VA 4CYIA 5KZ0A 3C2GA 5FM3A 2GNLA 4A3IJ 3BWJA 2ZMEB 4U9AA 1HCRA 2R3GA 1X3ZB 3KB7A 4Z2YA 2BY1A 4XICA 3FXWA 4D0WA 2F7ZE 3QGWA 5E1EA 2EQRA 1YWNA 4LLNA 5JLWA 2D1VA 2IW9A 1PDNC 5FFZA 1R3CA 4YMJA 3L2RA 4B47A 2VOOA 1QVTA 4IF4A 3F66A 3OT8A 4RJ5A 4KIQA 1PXMA 2RG6A 4ACDA 4AW1A 4M8TA 4I24A 1UVRA 5FD6A 4CZUA 3KXNA 3FI8A 4ZZLA 1REKA 5CF4A 4TKSA 1TNSA 2EZIA 3NS9A 4X2NA 2PVFA 4MEDA 3UIUA 3MY0A 3NYOA 3W2OA 3IW4A 3KVXA 4IC8A 4GXOA 4Q9SA 5CF8A 2HR3A 3L1SA 2WEIA 4R7IA 2LKSA 1EH7A 5TISC 2QO9A 3LLTA 3W6JB 3I5NA 3R2BA 1QRYA 3PE2A 3PY3A 3FC2A 3PXRA 2WIPA 2R7VA 2YZAA 4FA2A 4JDJA 5F0CA 2VTOA 4OBQA 5K5RA 1W2CA 2ZSIB 4OWRB 4XV2A 1J3HA 4ESJA 1NVRA 3QQUA 4OBOA 4F70A 1URWA 4LIVA 4BXFA 3ZZEA 1YWRA 2Q1ZB 4CGZA 1KQ9A 2PY3A 3S1NJ 4RIYA 4YELA 4DH8A 4CYDA 4BCKA 4FSZA 2YM5A 3RPQA 3Q3SA 5E3LA 3TZ9A 1PW2A 2OXXA 5FEEA 3OXTA 4I4EA 3A02A 4AXCA 4PV0A 2BRBA 4AXEA 3JS2A 4RC2A 1A6IA 2C5VA 3MFKA 2NS7A 3FMNA 5TR6A 1OKRA 1GV2A 4LMNA 1NT2A 2HWPA 4QPOA 3RINA 5LBQA 3CP9A 3E64A 2LF8A 3DAEA 1MNDA 1WHUA 3ALOA 4YJRA 3W1FA 1PXLA 4UUSB 1GAGA 3ZQFA 4TT7A 3DBHB 2XNBA 2NRUA 2VWUA 2QOKA 4QP7A 2R7OA 1LPUA 2R5TA 3F2RA 2WTKC 3RVGA 4EV0A 3PJ2A 1PUFA 4CFFA 4Y15A 2XNNA 2Y4IC 3FHZA 2DT6A 2XYUA 5J8CA 1X4OA 1QPCA 1K9AA 2YIXA 3RAKA 3EQFA 2A6EF 3FMQA 4CCBA 3UZTA 1H88C 2YLEA 1M52A 2Z7LA 4O4CA 2GS2A 2BIYA 2XZSA 3NIZA 1PMNA 2R7DA 4IL6C 3POZA 3PA5A 4OIQF 3FKNA 5HNFA 3OMVA 3BG7A 1BL6A 5HVKA 2C3LA 3HECA 4F0GA 4LUDA 1Z77A 3ONQA 2K86A 2Y9ZA 4R6VA 3E6BA 4UMRA 5HX8A 3TJCA 2JA7J 4L9JA 2KDOA 3WU1B 3LJ1A 2O5RA 3RYPA 5HOOA 3JR9A 3L9NA 2QM3A 2C4GA 3NW6A 3OCSA 4X6QC 1NA7A 5E92A 3HMOA 2OXYA 4BE2A 2X7OA 3HV4A 3OYMA 1R0EA 3ODZX 5LXMA 4GRBA 1D1BA 2JDRA 4A0ZA 1B59A 3DFAA 2TRTA 4FTIA 2J0LA 3NNUA 5E8TA 1BMKA 4QDVA 5FLFA 3ZQQA 3QLGA 4QPAA 3EQLF 5DG5A 3DXJF 3QTRA 3BCEA 3KEXA 1RDQE 3ZTXA 4JMQA 2R3JA 3GU5A 5TOZA 1UCRA 3O8PA 4M3FA 1UWJA 3LMMA 4YPSA 4RJ6A 4RBOA 2WGJA 2GWRA 2MLKA 3G2FA 5AIKA 3KRJA 2Y30A 3ZH8A 3G90X 2CPKE 3J81K 4Z6YA 4CA0A 1W84A 1ZLJA 3BROA 2ELKA 4GO1A 5BNJA 4R8HA 2CSOA 2FB8A 2HK5A 5D11A 3NEUA 1W5CC 4EJTA 4EH8A 3W2CA 4IW0A 3I0OA 4WUNA 3BQRA 4C35A 3KREA 3DT1A 4D1SA 3CTJA 1XSVA 3QQJA 2GHGA 4L5IA 1WCCA 4DW6A 1VF9A 4XQFA 3FXXA 4ASXA 2QA4I 5L8JA 1V54H 3PWYA 4L9IA 4AA4A 4HGSA 1KQ8A 3KC3A 2WB1A 2Q2EA 2FSOX 2Z16A 3ZSHA 3C4EA 2BAKA 2HOTA 4B43A 4FETA 2XM8A 3CP2A 2M8EA 1R36A 5BVNA 4IZYA 4R78A 4GYIA 2BTRA 2QQAA 3NUUA 4EZ5A 1LE8A 1V0PA 2EFOA 2YN8A 3GT8A 3Q32A 4ZTLA 3S0OA 4I5CA 5FB2A 4OTWA 2PJPA 3BYMA 4RGUA 1YOMA 5HIDA 1USTA 3P7AA 5B5EC 4YJPA 1I1GA 2Z7QA 2JKMA 1GZ8A 3CC6A 5EW8A 4L43A 4O2PA 1Z6TA 3PNYA 3RPSA 5K4JA 2CFXA 3JRCA 1Q8TA 1FY7A 4XKCA 3ORXA 4RZVA 2DMNA 1X1PA 2ETHA 2WIHA 3NYNA 4C58A 1MD0A 3DLSA 3DQXA 2K3FA 3VHKA 2R7ZJ 2R7WA 2MW8A 4LGDA 1OITA 1YXSA 2VTIA 2BXZA 2HYGD 4H36A 4EOKA 5FRIA 4RG0A 3BG3A 5C01A 4KKHA 3IPHA 5EDQA 4BQAA 5LMBA 2W5HA 3GVUA 1R71A 3FX3A 2HDWA 1FOKA 3BGPA 4LGWA 5ILVA 2RVCA 4I6FA 5FWKK 2E9NA 3QCYA 4UWBA 5HGIA 4LG0A 2CYYA 3KP4A 4YZMA 1YRNB 2WQMA 3GNIB 5EM6A 1K6YA 2IEWA 2QQ9A 3F5XA 2F57A 3SFIA 3W10A 4HVDA 4L53A 3H4JA 1U3EM 1S9JA 2PEXA 5CAQA 1BBYA 4QMYA 1A04A 5A6OA 2JBOA 3H0YA 4A3CJ