1TQPA

Crystal structure of a. fulgidus rio2 serine protein kinase bound to atp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
282
structure length
269
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of A. fulgidus Rio2 Defines a New Family of Serine Protein Kinases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
molecule keywords conserved hypothetical protein
total genus 86
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tqpA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1tqpA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1tqpA02
5AUVA 5JK3A 3LFBA 3ZCLA 3I59B 3P1AA 4D1SA 5CEPA 2PULA 2CLQA 2Y6OA 5DEWA 1BI3A 4N6ZA 5J7BA 2R3LA 4F9BA 3R7UA 2XMYA 2PG4A 3OCTA 1PXKA 4DG0E 5FDXA 3ERED 4F1OA 2VOOA 3HMPA 3T9IA 1YXSA 5TF9A 3ZMUA 1MP8A 4ETSA 4I93A 4WBBB 2ETKA 2WMRA 4UXQA 2XK3A 3R9DA 1IW7F 3CQWA 3SQNA 4FV1A 5HDNA 3R7GA 3ATTA 3KU2A 1OYWA 3GC7A 4N9IA 2W85A 5EEHA 3NR9A 4M66A 2VTOA 3GC9A 1XQZA 3KZYA 4C2WA 5IUGA 4RWKA 3ZS5A 1KOAA 4U41A 1Q8ZA 3DQWA 4WA9A 3GZ6A 2UXXA 5EYCA 3QP6A 5KBQA 3RMFA 4FUXA 5KHWA 4HF0A 4KIKB 5IEYA 2CGPA 2W4JA 1SFUA 1UCRA 5BPIA 2XIGA 2I7QA 1B6AA 4LK0F 5E8ZA 2ZV8A 4D5HA 2ERZE 1YXXA 3P5KA 4NCTA 4GGGA 4DT9A 1WBPA 4DQ2A 2RFNA 4IAKA 1MKMA 5AP6A 4HVIA 1YHWA 2R3HA 2BZHB 3DXQA 3ZONA 2XK4A 1Q8TA 3E8CA 4ZYGA 4S33A 3ID6C 3WZJA 5D4RA 2YLEA 3L8XA 5EM8A 4L9TA 1WVXA 3CEKA 3RPQA 3QD2B 1R7JA 2FSWA 1FLIA 2VTAA 4F70A 2YACA 4D9UA 2GQSA 1Z57A 5AP4A 1LUFA 3E8DA 2JIIA 1D3YA 5EKOA 3TDUC 4BYYA 3QXPA 2Z8CA 1WAKA 1WQ2A 4V05A 5LMKC 3C0HA 3IKVA 3KL8A 2KULA 3ZLYA 4WNMA 2PVRA 2R0IA 2BCJA 4ZSLA 3O51A 1BM9A 4MEDA 3GUDA 3VS3A 5LMBA 2IZUA 3MS9A 4OMZA 3ZBXA 2H27A 4A9YA 4XP0A 2FRHA 1U78A 2E9OA 4K18A 3CUOA 1RQQA 1WMKA 4AW5A 2IVUA 2CNVA 2EB7A 2UW3A 3VAPA 1BN5A 4ESJA 5CJ9A 1H0WA 4KSQA 1BC7C 2FBHA 1R5GA 4APPA 5BUJA 1XGNA 4EHEA 4HYIA 3E6MA 3OWKA 3UE4A 5CXHA 4HOKA 5DGZA 3KMWA 1PXMA 4GFMA 2O61A 2QOHA 3UNJA 4OIOF 2BZJA 2L4MA 3ZHPC 3CO7C 2JLDA 2VTHA 4K6ZA 4HVSA 3VUTA 4G3EA 2O2UA 5DOSA 5K9IA 2XIYA 3CS9A 4NFMA 1SFEA 2ONLC 1WBSA 2ERKA 3F21A 2QHNA 3SVVA 2HDCA 5AX3A 1SVEA 4EUUA 4GJ3A 1RE8A 3IL2A 2WMAA 3SV0A 3C4WA 4EHZA 4IC8A 2UW5A 1STZA 3LCKA 3HAMA 3OW3A 4TWOA 4HW7A 5E1ZB 3NYXA 4H3PA 4BDAA 3RCJA 4QMUA 5D8KB 3R02A 3S2PA 1ZYLA 1Q8YA 1K78B 3HV6A 5CU6A 3COAC 2Q83A 1URCA 4NB5A 2W1EA 4ZYHA 3LA3A 3C50A 2VO7A 2X4FA 3OUNB 4HYHA 2VWZA 2PQ8A 4RGSA 3EQDA 4PTCA 3RPOA 1UFMA 2KRFA 3GFJA 3HMNA 5HVKA 3ZEPA 3BWFA 1H0VA 5HGIA 2A69F 3H30A 5CQUA 2PVNA 5BVKA 3NWWA 5IUIA 2XNEA 4C8BA 5AR8A 3NAYA 2BRGA 3T3UA 3KULA 3MYGA 4NIFA 3POZA 1KOBA 3NAXA 4CFFA 2GFCA 2JDTA 3LAPA 3TKUA 4RRVA 3FKOA 3OUKA 2JBOA 4I02A 3KXMA 5AAEA 2DAOA 3P0MA 4HJOA 4ZXTA 1I44A 3VHEA 4CTBA 1IAHA 4Q5EA 4AW2A 1HCLA 4F1TA 2FGIA 4OTGA 4ZY5A 2C5YA 3T1BA 4KRCA 5HS9A 3MWUA 3LIJA 3GC0A 4G3DA 2ZNZA 2BHEA 4Y5HA 1PMUA 4UV9A 5AMNA 1J7IA 1LJ9A 3FQSA 3PG1A 4DH7A 4BFMA 2STTA 4PDPA 3Q9SA 4L3JA 2R9SA 5E17F 4O6LA 4BHNA 3DV8A 2NAZA 1HCKA 1JQHA 1Y8YA 5D11A 4FZDB 5EQPA 2XNMA 3OOGA 3F8NA 4EOPA 5GNKA 2OO8X 2EB2A 2BAJA 3HKOA 4PDKA 2IRFG 3FZSA 4JBQA 1TBXA 1ZYSA 3BKBA 4KICA 1WFCA 2VWXA 3NGAA 3ORPA 4X21A 4G7OF 1SVHA 1W7PA 3UBDA 1B1BA 2TDXA 3W1FA 1WZYA 3NUUA 3MH3A 4IQ6A 4KIGA 2PZRA 3VS5A 1X3UA 4U5JA 4J8MA 5KZIA 1QGPA 2G7UA 2R64A 4WKQA 5H8BA 1UKHA 4RC3A 3G2FA 5AP2A 2JFLA 1GXPA 3W2RA 1H1WA 2UVXA 2FSMX 4D2PA 4E6DA 4ZP5A 4NM3A 5KZ0A 2QHMA 3OP5A 3BROA 2QKRA 4EC9A 4RAYA 3IOPA 3C4CA 3VVHA 4UVBA 3AMBA 4TYHB 2VWUA 1OL5A 1IAWA 5J6XA 4CNHA 2IN6A 3VS7A 3KXNA 3ZZWA 3QX4A 2HTSA 2X7GA 2O3FA 2Y7JA 3S4QA 3R2YA 3KXHA 3CY3A 1PYEA 3PLSA 3NW7A 3BY6A 3U51A 2X39A 2IVVA 1Z05A 3LOKA 1SAXA 1PXPA 1S8NA 3BWJA 4M72A 2QOQA 3DXNA 5J7HA 3VQUA 2UZWE 5AUXA 2Z60A 3CC6A 2RN7A 5L2WA 3L8VA 3N9XA 4F0FA 2VO6A 1P6RA 2XM8A 3N4VA 4GKIA 5HBJA 2WMXA 3TQNA 1G3SA 3THBA 4OU0A 2E1CA 4IADA 4NSTA 5IA4A 4JDHA 2FOKA 2K4JA 3VOEA 3LMGA 3BYUA 3GGFA 4BCFA 3F8FA 3OWPA 4BCNA 4BDGA 1UHWA 3R71A 3QU0A 3OG7A 5JFWA 4YTCA 3IW6A 1BC8C 1O3RA 3E3PA 2F2UA 2D45A 1IF1A 4AE9A 2VTLA 1F1ZA 4MQ1A 4L5IA 4WG3A 4QYFA 4CTCA 4YLJA 1SYKA 3G6HA 4JIAA 5FTGA 1E2XA 3KVXA 4USDA 3OVVA 4LOOA 5JGAA 3EZVA 5DLSA 1S7AA 3VBXA 3ACKA 3JXWA 5CAVA 3QPTA 3EN7A 1SMHA 1A9UA 1YYVA 2X81A 3QTXA 3R9HA 2WD1A 3KLNA 5J9ZA 4Y73A 2XAJA 3C7QA 4I92A 5HU3A 5J5TA 4D5KA 4OAUC 2FB8A 3R7YA 4D0XA 1OYYA 2COMA 3VFZA 1FVVA 3ELJA 3I79A 1SZMA 3UO6A 5DRBA 2Y8OA 3CE3A 4E20A 4YZCA 1R22A 1JXSA 5AP5A 1ZOGA 2VTQA 4P9UA 3W10A 4QLCU 4FV3A 3RAHA 4ZSJA 4BYJA 4M6XA 5BPDA 1B38A 4H58A 4QQ5A 4XSXF 1JKTA 4BCIA 1ODDA 2JZYA 4AWIA 5E8WA 3COMA 5BYLA 4XG6A 2MC3A 4L18B 1H4LA 4K0YA 4U7DA 4JG8A 3FLSA 1FX7A 1T0FA 3SA0A 4KDPA 4KUMA 2WQEA 5HX6A 3C0GA 2PZYA 4Q48A 3ZTXA 4FX4A 4QMSA 2GQGA 1OYIA 3DK7A 4WHZA 5DD8A 4ZK5A 2X0GA 3Q5FA 2IT0A 4QYHA 4R1VA 4FV4A 3R73A 5K5OA 4JLCA 1XWSA 4R7BA 3G5DA 3PG3A 3DY7A 2E9PA 1MQ4A 1GOLA 4FKIA 4GVJA 3WILA 4TY1A 4A7CA 3R1SA 4ZIMA 5C8MA 3RK5A 2P5KA 3LZBA 5ITAA 4WX9A 1O6KA 3QGWA 3KGAA 4IWQA 4G6DA 2VN9A 3P9IA 3ZO3A 2DQLA 4O82A 1J2XA 1Z9XA 3H9OA 2J6MA 4AIHA 2FSOX 2HXLA 5JH6A 3ZPLA 1XN7A 3QQUA 4R3CA 4LG0A 1R1WA 2E7WA 2G2IA 1I6XA 5IA5A 3WE3A 4LM5A 4AGUA 4EKLA 3QQGA 1Y6AA 5AX9A 4AZWA 3I58A 4KWPA 2PPQA 2PMOX 1YKRA 2VO0A 5GJFA 2CWEA 3MCZA 1U5RA 5LWMA 5FB2A 2IW5A 3VBVA 3O2PE 5HU9A 4PNKA 4C3RA 4EKKA 2R3GA 4ZZNA 1KE5A 3EOCA 5C03A 4KMUX 4CV8A 4GU6A 4IM2A 4Z55A 2RV8A 1IN4A 5DR9A 2QO7A 3VC4A 5BQ0A 5DUIA 3UNKA 3UIUA 3G90X 5EW9A 1IEPA 3MESA 3E6BA 4IFCA 4E1ZA 3TN8A 4W8DA 4AE6A 3BP8A 2D1VA 3EQPA 4BXUA 4I94A 1ZXEA 2QU6A 3DBQA 4FEUA 5D5VB 3TZ9A 4A5MA 3PVBA 5H6QA 2CO5A 1L3LA 3GBZA 2CQKA 4GV1A 3OT8A 5EM6A 1USSA 3BEAA 2RC4A 5KUPA 4QPMA 5C01A 4DA5A 4IW0A 1EH8A 3F7WA 4G34A 5ERIA 4GK2A 3OOPA 1A04A 5AM6A 5DPVA 1H0MA 3HUBA 2XM9A 3FC2A 1FPUA 4J96A 3R83A 1M7NA 1K6OA 2J5FA 3HTUA 1H01A 3SQQA 3ZUUA 3TNQB 2JEDA 4ANMA 5CVHA 3MEXA 3WI6A 2CKOA 1PXIA 3AT4A 3E8NA 4AN3A 2VXZA 4CCUA 1V0BA 3WF8A 1UU9A 4QRCA 4BDJA 4N9HA 4GW8A 4MF1A 3LHJA 5CF6A 2W57A 2HY0A 1JWHA 2JKMA 5DEYA 3U55A 4YJNA 3KF7A 3GXLA 2FUMA 4O7SA 1R0EA 2YWVA 3ZC6A 4TPTA 4YC3A 3UZPA 1RI7A 4F9AA 4AT4A 2OXYA 3KVWA 3E5AA 3D2IA 5HTIA 3FLQA 1J5YA 4IVNA 4CYJA 2Z7SA 2ELHA 2XK6A 2ZMEB 4XX9A 5M44A 3A7JA 4DH1A 2LF8A 1MJBA 1PDNC 5CS6A 4TYEA 3HSFA 4FSMA 3NYVA 2GHLA 4QT1A 5TR6A 5BVWA 4J99A 3BU6A 1T46A 3SW4A 5FO5A 4DF3A 4AG8A 3C18A 4MWHA 2FBKA 4PP7A 1IASA 2QONA 3OT3A 3UMWA 4NYEA 1ON1A 5CT7A 4QTEA 5BMZA 5TE0A 2CGWA 3P9KA 1ZYDA 2FMYA 3Q9ZA 3HECA 3FBVA 3D7TB 4CD0A 3GU6A 3RAIA 3I64A 2KTYA 3TL8A 4ITHA 2HY81 5IMXA 4PPAA 4NIFB 2ISYA 5CVIA 4UEUA 2P55A 5LWNA 3KRLA 4AN2A 5IH6A 3UC4A 3UP7A 3W8LA 2ACXA 2UW0A 4I3ZA 1QMZA 1OL1A 4IVAA 3CPCA 4IXAA 1OIQA 4XBUA 4QMQA 3SOAA 4KBKA 3LSTA 3VB2A 5GZAA 1AQ1A 4EBWA 4ONAA 4IRHA 1SMTA 3JR1A 2OFVA 4YTFA 4D2RA 2KJCA 3F2NA 3QCQA 4Q9SA 4HCTA 3ZO4A 4C35A 2P4IA 1ONVA 5AUWA 3KK8A 2V79A 2BDFA 4I0SA 4C59A 3CJNA 4QMZA 3T8RA 5JHUA 5HVQC 1DAWA 5ED4A 4HCVA 4NJ3A 1IAJA 2P7CB 5DCMA 2QENA 4KAOA 4OBOA 3EIDA 1D8JA 4KYWA 3D15A 3NW6A 2ZOQA 3L09A 4J97A 1ZGAA 3KRRA 2XIZA 1YHVA 2WTKB 3D14A 4CGZA 3RWQA 4FZ7A 4FZ6A 5L2TA 2ZV2A 2W4OA 4YZDA 3RKXA 5HTCA 5L8LA 2M45A 3RAWA 1MJ9A 4LRJA 1V3FA 4ASDA 4FSUA 2UZVA 4I24A 4KBCA 1KU7A 4TT7A 4A6DA 1P4FA 4A06A 4QMTA 5IQHA 3HV4A 3TCPA 3B8QA 2HEOA 1AWCA 5GIPE 5E1XA 1FQ1B 4GJ2A 4S04A 3T0YA 2W1HA 4FG7A 4EOKA 2YX7A 4HGEA 2QOIA 5G1XA 4IACA 3ZXTA 1A06A 4BZNA 2BRMA 4O0SA 4EONA 1B39A 3FYJX 4G31A 3FSKA 2DLLA 2CN5A 4EH7A 3R0TA 5HE1A 2JRTA 3GENA 3IDCA 3Q5IA 3N4TA 1ZWSA 4BBEA 2NRYA 3F5XA 4E4NA 2VX3A 3E5UA 4LGGA 2QD9A 3KY2A 3QQHA 4FK6A 3ZC5A 4XV3A 1W0XC 4ANNA 4RFMA 2J2IB 3KQ7A 3ZMMA 4RFYA 3LJ0A 3QAME 4JQ7A 4JDJA 4EH6A 4XG7A 2M87A 4L01A 2WTDA 3DQXA 3F6OA 2D2WA 2IVTA 2PUNA 5EK7A 4FL1A 2GWRA 2DBBA 3TXOA 4MXYA 3H10A 4O7TA 2EK5A 3PTGA 5LCJA 5HVJA 5DFPA 5LGTA 4AFJA 3F6XA 4OR5A 3VS4A 4RGRA 3V7CA 4ITIA 2BKZA 4AD9A 5DCMB 3PZEA 3QZGA 2EFOA 3PXZA 4KIKA 2XJ1A 1U46A 3PFQA 1NVSA 4FV6A 1G6NA 3ZEWA 2J5EA 3CTJA 3C1DA 3CO6C 3L9NA 2UV2A 3FPQA 3R60A 4W9XA 1ZOEA 5T68A 3K54A 4FNYA 4XV1A 5CEIA 3IS5A 5J5SA 2QLQA 3EKKA 4JR3A 4KD1A 3RPYA 2ESMA 5KCVA 4IZAA 2XJ0A 4I22A 3W18A 4RJ5A 4IRGA 4WG4A 5HI2A 2YM5A 4EHGA 3DQVC 4DG3E 4S32A 4CZYB 2JITA 2C69A 4PY1A 4EJUA 3BZ6A 4CQEA 3EYHA 3PJ8A 3RNYA 2JAVA 2HWOA 3K9TA 2VTJA 3EL8A 3HRCA 4BCOA 3LAJA 5CSVA 4WT6A 2QQ7A 3DAKA 2ITOA 2P6TA 5FQDC 5HG7A 3U4UA 2X6DA 3S2WA 4DGGA 4GT3A 3BQCA 1S29A 2VWYA 3IO7A 4QWQA 2B52A 5D7VA 4JAJA 4CV9A 4RQKA 3FHIA 5DT3A 2WC2A 4R79A 3ORIA 2HQRA 3QYZA 4CMUA 4DT8A 4FK3A 5CY3A 1J0RA 1YI4A 3QGYA 4CFXA 3ATSA 4PPBA 5CVUA 4WG5A 4IZ7A 5E8YA 1FINA 2JGZA 2H6DA 4F9CA 2CSNA 3DTCA 3GEZA 2VAGA 4BCQA 2YCQA 3HYHA 3QYWA 1IN6A 4Q4ZF 4PNIA 4LJZF 3C4EA 3DPLC 1LDDA 4CRLA 3HA6A 2B54A 2RL5A 4UUVA 4EWHA 4RWLA 3W6KB 3CKXA 4IX6A 4L53A 2C6KA 1XH4A 3RPVA 4KIQA 3HMOA 4ENXA 5JQ8A 3RTPA 2GA1A 2CGUA 4IF4A 3ZLSA 3UOHA 3PWDA 4G6NA 3FJQE 5D12A 1UNLA 3KE2A 3BBTB 2BE5F 4XRLA 4DBNA 3F5PA 1OKYA 3S0OA 1XBBA 3QQLA 5ETIA 5J9LA 4YG2F 3ODYX 2PMIA 1F3MC 3ODZX 4Q9ZA 3ITZA 5A2QZ 2QI8A 3BGPA 4FI1A 3PXYA 2P3GX 5DD4A 3CCNA 3D9VA 2FYSA 2GHMA 1QPMA 2GSFA 1VJYA 2E2BA 2QWWA 2RF9A 1XGMA 5AA8A 3VEPA 3QALE 2CHLA 5FUTA 2D1HA 4FSYA 1Y0UA 4U6RA 4E6CA 3DAJA 2CW0F 3GLXA 2PYWA 3ROUA 3NMUF 4HZRA 3N51A 5FTQA 1PKDA 4RVKA 3ZMSA 5JZJA 2IZSA 2QM3A 1MUOA 1R0PA 3RKYA 4ZOGA 2IZTA 2W9ZB 2PE1A 5DRDA 3KKVA 5E18F 4XH6A 3WTYC 5LEKA 2GS2A 4FT9A 4JRNA 4JG6A 4K8AA 3ABTA 2W84A 3H9FA 3Q4CA 3D5LA 3CTHA 5K5QA 1SNUA 2W5BA 5CU4A 3DBEA 1KWPA 2V0DA 4X3FA 4M73A 2XF0A 4K1BA 1M2RA 4ZLOA 3QTSA 1HW1A 3HRMA 3UVPA 3TZ7A 5AP1A 2ZAZA 3WF9A 4PL5A 4WWCA 1UV5A 5LARA 4RGUA 5L3DA 2UZTA 4FC0A 4Y72A 3I6UA 1YS6A 4EEVA 4YHFA 3G9NA 2WGJA 4E4MA 4YJTA 5M06A 4DH8A 1JKLA 3CGFA 5JN2A 4EZ5A 3EMGA 1VTNC 3UNZA 2QYOA 2R7FA 2B7AA 3O50A 2EXCX 5A4LA 5JI6A 4ZTSA 2A3SA 3RJCA 1ZGJA 3LFKA 4M13A 1Q8UA 1OPJA 3HYIA 1LR4A 4U97A 5IG1A 2HK5A 1XH6A 3BHHA 5EHYA 3IECA 2P2IA 3F3UA 3LMIA 4MCVA 4YFNF 4FTOA 4LG4A 3LAUA 5IUHA 3LQ5A 2HZNA 4M69A 5HESA 3UQGA 1O3QA 3Q04A 4JR7A 4IRIA 4X2GA 3VS1A 3NUYA 4XLIA 2JT1A 3KULB 3KEOA 1W84A 4OT6A 4HLXA 4QO9A 1K9AA 1TTYA 4MKCA 4E5WA 3RCDA 3J81K 2BIKB 4CYIA 2H94A 3PRIA 4UZHA 3WU0A 2YAKA 2YWPA 1REJA 5HIBA 2DK5A 4RB3C 2V62A 2JKKA 3EJ1A 3QKKA 2XKPA 1L3RE 2LNBA 5L3BA 3HRFA 4I6FA 3N4MA 3DK3A 2NNNA 1E9HA 5E9EA 3O7LB 3K3JA 2YDJA 3CP9A 3IC7A 1X8BA 3BU5A 5EOBA 2GZWA 2V7AA 4ZY6A 1YXTA 2BFYA 5G6VA 1XGSA 4MD7E 1O3TA 4CLIA 5DA3A 3S1HA 2BAKA 5CEOA 4IAYA 4DFZE 3HX4A 3E64A 5B7VA 1C0WA 4L8MA 3U54A 2OBPA 5C8KA 4YIIA 3LXPA 2B9IA 4HNFA 4CEGA 4OTIA 4G17A 1TW3A 4I5HA 2ADUA 2EU9A 3D83A 2FSTX 4FBXA 4YTHA 3ECOA 3QRUA 1ERKA 5AIRA 3PJCA 2Y4IB 5LMKA 2UZBA 3BLHA 4AA0A 3DLSA 4CZZA 4FTJA 2UZLA 2FU4A 3TGNA 4LLNA 3PIYA 2E1NA 2VTRA 4QNYA 1JSUA 4RVMA 2OA4A 4EOSA 5HLHA 1EH7A 4I41A 3ZDIA 2VGPA 3WARA 3AC1A 4EK4A 4TL0A 3WZDA 3LMHA 3VBYA 1J59A 2V9VA 4QP4A 3ZH8A 4UHTA 3LQRA 4I5PA 3A4OX 1S7OA 4GG5A 4I5MA 1FP1D 3SOCA 3K1NA 3NNUA 5LJJA 2H6CA 3KMUA 3VHKA 3UO4A 3GVUA 4PGGA 4PWNA 5HBEA 1FYKA 4R8HA 1TLHB 5BS6A 4G3GA 4BIBA 3R1NA 3L9FA 3VRZA 1GZ8A 2J0LA 2AXLA 2K27A 3SC1A 2NNYA 4S30A 3P9JA 1Z6TA 5JGBA 3B02A 3KXGA 2EV5A 4F99A 2YDKA 2BMCA 4O6JA 3G3ZA 4A4OA 3GCUA 3TNWA 4IB5A 2YZLA 4H39A 2G2FA 2C6YA 4FTLA 2DWBA 5I3RA 4ENJA 3P79A 3PP1A 4TV7A 4CXFA 3DKCA 1W7PB 5HE0A 3W2CA 3PE2A 5DH3A 5FP5A 3RINA 2XUUA 1CGPA 1OMWA 3NEUA 1Q61A 4R5SA 3PP0A 2JIVA 2XP2A 3D7TA 2QOKA 4Y13A 3EFWA 3WGHA 2R3NA 3JY0A 3I71A 1UU7A 4HV6A 1J7KA 5K4JA 4BH9A 3NUNA 1SFXA 3J81Z 3FSFA 4A0YA 2AYPA 5FWKK 4PX6A 3FMRA 1RNLA 2NRUA 2JDSA 4P5OA 3DOGA 4DG2E 4YJVA 4GEOA 3GWZA 3A62A 2UZNA 5J79A 3BJOA 2VD5A 4NM5A 5FGMA 4FSNA 4FKLA 2UZEA 4DGMA 3IRRA 3ENHA 3UG2A 1OR7A 3VIDA 2A1AB 2CMWA 3EQRA 4NFNA 3GOKA 1FZPB 4GCJA 4Y17A 3W2OA 3DP7A 4EQQA 1XBAA 5CSPA 5T6KA 4CMTA 4PMSA 2W4KA 4KNYA 3HSRA 5LHHA 3IWFA 4WNKA 4LFIA 1MJAA 5ILUA 1H1PA 4PUZA 5AP3A 1CTPE 4H3QA 4XP3A 4L6QA 4MWIA 2OJIA 4LMNA 3TI1A 5AV0A 3F7ZA 3R2BA 3QF9A 2QOLA 3TIYA 4X7QA 3EQBA 3QC9A 3V5QA 4M97A 1DS5A 5TJJA 4H1MA 2PLYA 4MXXA 4CG9A 2O65A 2J50A 4FSRA 3UIBA 3E8EA 4AZTA 3NYNA 3P23A 1B4AA 4XYFA 3QCSA 4IEBA 2GXGA 5H8GA 4G7ZF 3ORZA 2HR3A 3D5UA 5H2UA 1CMKE 5HLIA 1ZMUA 1GIJA 1K3AA 3U6JA 1BMKA 5HG9A 5BQTA 2W1DA 3KP3A 1WBOA 2HYGD 4O91A 4O96A 3WTVC 4M9SA 4B8LA 4EK6A 1WCCA 4MD9E 2ZMEA 3LFCA 5AWMA 2G2HA 5A4QA 3G33A 4PL4A 4M12A 5L2SA 2WHBA 1S6LA 2P0CA 4USEA 2OU7A 5GIOE 3PA4A 3E5QA 3RWPA 4FEXA 4GO1A 4WXDA 1Q97A 2QLZA 5HIEA 3LQ8A 1PUEE 1FYLA 4O7WA 4FKTA 4IAAA 4HF2A 3VUIA 2PY3A 4RJ6A 4YLLA 5FDPA 1OPCA 3MA3A 4OIRF 4QTCA 3DAEA 4WUNA 2C3KA 3OXZA 3TEIA 1FOTA 3FZ1A 2WIPA 3ORTA 3M8EA 4O5VA 5KVRA 2H34A 4EJ7A 4YNOA 4U0YA 3EN6A 2XNGA 5EYMA 5AV2A 4FV9A 4FNWA 1VZOA 5ETFA 1KQ0A 1J1CA 5M4CA 3ZOSA 4U8ZA 3FI8A 2GTMA 4RIOA 5IA3A 4FG8A 4QPSA 3QTRA 4Q5HA 5IQEA 3CIKA 1GY3A 3CLOA 4JIKA 3ZU7A 3O8PA 5EG3A 4BDKA 2J51A 1F9NA 1M17A 4GRBA 3FL4A 5FEDA 4AZFA 4EGZA 1XDUA 1WBWA 1IZ1A 1YFHA 4JXFA 1KV1A 3PLAE 3NNWA 3MW1A 2IPXA 3RPUA 5DHJA 5IDNA 5F6FA 3BHUA 3V8SA 1LEBA 4LB6B 2BRHA 4AA4A 2NNWB 5E8TA 1YW9A 2VONA 3SZTA 3R8UA 4RB1A 1AGWA 1R00A 4CSVA 3ZUVA 3EN5A 1OBDA 4X3JA 4YPSA 4DINA 1G3WA 2C6EA 5DR6A 4K9YA 4G8XA 3QOPA 2GIVA 3QTQA 5F1RA 3MAJA 4D4VA 2EA2A 2CCHA 2R0UA 1KQ8A 1OKVA 5TKDA 2YIYA 4NCTC 4AT5A 3WE8A 2XZSA 2JD5A 4UVAA 4F7ZA 3Q6UA 4BKJA 3MBLA 3F8BA 1XCBA 4TWNA 5AR7A 4KKHA 1H8FA 3AC4A 3KCKA 4YJOA 2FA5A 1FVRA 4W4WA 2XAQA 1AOYA 3QZIA 4ID7A 4I4FA 2OJJA 2P33A 3RHXA 1Q8WA 4CO8A 4IFGA 3RIRA 4PZJA 4ANQA 1BI0A 1NA7A 3TT0A 4EM2A 2HZTA 4JVGA 1FWZA 1YXUA 2W1IA 4E26A 2L01A 5IMEA 3WZUA 3NSZA 3D94A 2B0LA 4MXOA 5L6OA 3UP2A 4FV0A 5FD6A 3VBTA 5HNGA 3R61A 2WIHA 3FC1X 3RPRA 3NCGA 5GJGA 4UMRA 2HENA 2W1FA 5HVYA 1UKIA 4RA4A 2GQRA 4X2NA 5F94A 3KEQA 2FVDA 2PZ5A 5M55A 4I01A 4QMPA 5IA1A 4CKIA 4CLJA 2A27A 5AR3A 1IA9A 4YO4A 4GFGA 3A8WA 3ELKA 2BVAA 4WBOA 4NZWB 1HKQA 3ENMA 4Z3VA 3OWJA 2A6HF 3V8JA 5IT9K 4H05A 5DG5A 1BOAA 1IA8A 4UWYA 4J52A 3DNEA 3HHHA 3R1QA 2EFQA 2GNIA 4XOZA 1P2FA 4LD5A 4M9XA 5E8GA 4BDIA 2GNJA 3PJ2A 3EQHA 4EMSA 4RLLA 3WODF 3FXZA 3UZRA 2ZM1A 3GI3A 2OF2A 2VZ6A 4CT2A 5HD4A 2G9XA 3PVWA 1XMKA 2ESHA 2PHKA 4ENMA 4M67A 3Q9WA 1FVTA 4L3PA 1FBSA 2WELA 5LVMA 5A6OA 1GZKA 1YW8A 3NEWA 4RT7A 1K79A 2JPCA 3NRMA 3PXFA 4W4XA 4LGWA 3E88A 2XNOA 1FGKA 2B9JA 5L2QA 4L9JA 1YOMA 3R00A 1YW7A 4QMMA 3IG7A 5CF8A 4RPVA 3I7CA 5E92A 4FGBA 2WTKC 2C1AA 3VUHA 3IDBA 5EQEA 3FZVA 2EXEA 4CFMA 4O83A 3SD0A 1XH8A 3QQKA 3ZO2A 2YEXA 3I54A 2XGXA 2RNJA 4ZYEA 1GVJA 1Q3WA 3HDMA 4BF2A 3DKOA 5IISA 4ZTMA 1JHHA 1LQ1A 5L4QA 2IW6A 3V8LA 2DI3A 1E1XA 3P7BA 4PRJA 2GS6A 5JFVA 2PBIA 4GKHA 5CANA 1FMOE 3QHWA 2J90A 4FL3A 2NS0A 3KP5A 2C6MA 3LCDA 3CUQC 2J0JA 3COIA 4BTFA 4IHSA 4RSSA 3F61A 3BJ6A 1I1GA 3E7OA 2AS5F 3WE4A 3R8LA 2XIXA 3AAFA 3LLTA 3Q3BA 1BBYA 3GC8A 1YI6A 4F4PA 4EOLA 4R1HA 1Y57A 2IJLA 5J1WA 2Q8KA 3REPA 4EOOA 2EFPA 2PVFA 2OW3A 2EWNA 1W83A 2VTMA 4I7HA 5E8XA 4ASEA 1PXLA 5ETCA 3CJFA 3RM6A 3R7IA 2K4BA 4N0SA 2Z2WA 5H6RA 5FD5A 3SGCA 4LL0A 4G6QA 4DTKA 1DI9A 4HV5A 4YZMA 1W4MA 3FM3A 2C0OA 4I6QA 4C4IA 3BYMA 4FTAA 3D5VA 2IA0A 3OS3A 1REKA 3ZMTA 4XRJA 4USFA 1R5HA 1MRVA 3GVAA 4EOIA 1O7FA 2YCRA 4FKGA 4YPDA 3W2PA 3E3BX 5FTOA 4ESFA 4FV8A 3PPZA 3ZDUA 2ITZA 2G15A 2VBZA 3QAHA 4CXAA 3OEZA 3HL7A 5LXMA 3DFCB 2CJMA 1HSTA 3K1PA 3DZQA 3K0LA 4NEUA 2BZKB 2VX0A 4FNZA 4OTPA 3HZTA 3K2ZA 5JT2A 3MN3A 4CG8A 3UOKA 2CCIA 4HGTA 2PE2A 1ZG5A 2R2PA 2QO2A 2G1TA 3E6CC 3R8MA 4BZOA 1FSEA 4BCGA 4HPTE 4EZ3A 3C4XA 2QOFA 2JFMA 2IA2A 3NCZA 3KREA 1L0OC 4OTRA 4MHGA 4FT3A 4KRDA 3MIYA 3FYKX 3BRBA 3GYHX 4BHPA 4GUBA 4CHUA 2GDOA 3QFVA 3MA6A 5JVTA 3D0EA 3DBCA 3REOA 3IK3A 3ORNA 1BKXA 5IQIA 5HLWA 1PRYA 3JTGA 1FBUA 4O7ZA 4E7WA 3U87A 2MA3A 3D5WA 4YHJA 3HUCA 3P7AA 2VTTA 4JQ8A 3ZZEA 2CGVA 4C4JA 4G3FA 4MNUA 3PJ1A 3DXJF 2GPHA 4D1ZA 5HCXA 1BL7A 1F5QA 2R3SA 2YISA 5M4IA 5EEGA 3AC3A 1BLXA 4GT4A 4PMMA 4FTKA 4ZJJA 3FXQA 4C57A 4IJPA 4AZEA 5DNRA 4KA4A 3O71A 4LUDA 4WSYA 4AOIA 4ZTQA 4M0ZA 2GQQA 3KN5A 1QO0D 4FX0A 1HKTA 3PSCA 4ENYA 2VRXA 1YWVA 1BI2A 3S3IA 4QP2A 4KMFA 3ANQA 3KC3A 4D2WA 3RI1A 5K4IA 1DDNA 3HGKA 4CGAA 5EI6A 4L9IA 2F9GA 4JS8A 3MDYA 2WTJA 5AUZA 3K5VA 2W1GA 2VWIA 4HZFA 4FEVA 3T5XA 1OB3A 2Z3YA 3KRJA 3TZ8A 2GU8A 5JRSA 1P4WA 1Y91A 4YUQA 2Y9QA 5I9YA 1LDJA 3BLRA 5FBOA 2CKPA 3O23A 2EV6A 3GP0A 2ZVAA 3VJOA 5I9XA 4NW5A 2RFDA 1ZAOA 1H26A 4FSWA 3F5UA 4GVAA 3NVKI 4EUTA 5FM2A 4UN0C 1HW2A 4CFUA 1YDSE 5E1EA 5GHVA 4JBVA 5GZ9A 4FTIA 1GNGA 1YXVA 4B09A 1R78A 3A7IA 3PQKA 3MZHA 4L9VA 1KU3A 3Q60A 4XG4A 4ANOA 3CKWA 3KFWX 4IZ5A 1VYWA 4U3YA 5AV3A 4DEEA 4AS0A 2X2LA 3JS2A 3T3VA 1M52A 2Y4IC 5DT0A 3VF9A 1I5ZA 2X0LA 2XK9A 5FG8A 4N4SA 2YJRA 3TNIA 5FRIA 1G3NA 3OROA 2WNTA 4JQFA 2RFSA 2DFIA 4MQ9F 3ZN1A 3WF6A 4IDTA 3JVRA 1QNTA 4HYEA 1HQCA 1KSWA 1R58A 5IA0A 1ZOHA 5EOLA 3BBWA 3UYTA 4RLKA 4NJDA 2X7OA 4U44A 4F7LA 2IPQX 3QLGA 4MK0A 2O64A 3EKNA 1Q5KA 4XG9A 1CKPA 1IRKA 1M2QA 4EJVA 4BR3A 3WIKA 4GSBA 2HTJA 2XNNA 1XJDA 4A2UA 3C5IA 3R30A 4IJAA 3Q4TA 5KMOA 4YBKA 5EI8A 2JDOA 3BYVA 4XJ0A 1NXKA 4BCPA 4E8AA 4C34A 4YJRA 2I0YA 4GG7A 2ZCWA 1PXJA 3EFJA 4RA5A 4TRLA 2F2EA 2A07F 3PA5A 3PPKA 3WGGA 1UWJA 2A19B 4NH1A 3UO5A 3F3XA 3VUDA 5JEBA 1ZG1A 5BVDA 5HX8A 3TKHA 3HEGA 3W2SA 4FVPA 3JTHA 5F64A 4QP8A 2XK8A 1FMKA 2AC3A 4A9UA 3KA0A 1ZHFA 4BWXA 3DKGA 3WZKA 5LRRA 4YC8A 1T98A 1MZBA 4AAAA 3V6RA 1SD5A 2VT3A 3DF8A 3CXWA 4ZMEA 4ZAUA 3V5TA 3P7CA 4WNOA 4B8MA 1JE8A 1H9GA 3EL7A 2OJGA 2YM7A 3HA8A 3FI2A 4O0WA 4YP8A 3FXWA 2Z33A 5AIQA 4FEQA 2RFEA 3M9AA 1FOKA 3A7FA 3ZXZA 3V6SA 2JTVA 2OK1A 4R3PA 4S05A 4FE2A 5A9UA 3W16A 4F63A 3H0ZA 4JBOA 2YIRA 1H07A 4JG7A 4DFYA 2YM8A 2OWBA 3FMKA 2P7VB 2HYFA 4PP9A 1IRFA 4IB1A 4I09A 4OW8A 1YDRE 3CGOA 2ETHA 3SRVA 2STWA 2YLFA 4MBLA 1QBJA 3SFZA 3AMAA 3BX5A 4YZ9A 4BWKA 5ICFA 3EHAA 2W24A 3L9PA 5I4NA 2PUUA 3QUEA 2EJRA 3WTWC 3SG9A 5LVPA 4FEWA 5KBRA 1ZMVA 4I21A 4QMVA 3VS0A 3BIZA 4Y95A 5EYKA 5CVJA 2FEZA 2V55A 4DEIA 2OICA 3POOA 4FV7A 4AACA 5EHOA 5CVRA 3MTLA 5AAFA 4IB0A 1E1VA 3L1SA 2A61A 5BPYA 4MBJA 1NVRA 5HD7A 4AP7A 4IWDA 3MFSA 5LRSA 3MPMA 2PUIA 2BRBA 1JSVA 1JLUE 4L45A 2I40A 3EYIA 1P4AA 3R6SA 3LW0A 2WU7A 5CWZA 3UQFA 1Z9CA 5DI1A 2HW6A 3VO3A 3QP5A 2PTKA 2VTSA 2B9HA 3A99A 4RWIA 2EA4A 2YCFA 1ZLJA 1H25A 1SD7A 2SRCA 4FKSA 4FTMA 3TUDA 4B99A 1OITA 4BDHA 3PJ3A 3PQJA 5D6FA 4DCEA 3ZMVA 4WRSA 4I23A 1NW1A 3EQIA 1XSVA 5CALA 1Z6RA 5JFRA 2XRNA 3EH9A 3WZEA 3ZRMA 4OTQA 3ECHA 1Z5MA 2M5WA 2IW9A 3COKA 4X2JA 4DH3A 1SD4A 4AX8A 2QUFA 4M84A 4G9CA 2VOPA 4MXZA 2BRNA 5FBNC 4DFLA 1MGTA 1FY7A 4EJWA 5HS7A 4WNPA 4L42A 2ACJA 3U6HA 3GCSA 4BI2A 4ZSGA 2C5VA 4FVQA 4E3CA 3BE2A 4UMPA 2OZUA 2RG6A 4XLNF 4O84A 4I98B 3FUPA 4Y15A 1XGOA 3TACA 2C5XA 4U0VA 4EJOA 3PZHA 4FYOA 4U9AA 4Y46A 3E5XA 2EB3A 2QO9A 4JBPA 3F2AA 4BIDA 2Y6MA 2PUPA 3ZM4A 2OU2A 4FSTA 2XYNA 3ZSGA 1GXQA 3BHTA 3TZMA 4TNBA 5I5ZA 4U7ZA 4X6RA 4LMUA 4UY9A 4CZTA 3CUQB 2B55A 4R7IA 4E70A 3R9OA 2XH5A 2DQRA 4CZUA 1XB4A 4BHCA 1ZZ2A 3LE6A 2I0EA 4C2VA 4UBAA 4X2FA 2XK7A 1RIOH 2L3DA 4P90A 3NNXA 3R1YA 4ZJIA 3FMMA 3IHUA 2B9FA 5GZ8A 4MTDA 4DLJA 3WTSC 4IPAA 3PWYA 2FE3A 4PDSA 1SVGA 2OIDA 2M8EA 3UMXA 4C4FA 5K5NA 2BBYA 2W5AA 5KKRB 2R3KA 2E7XA 3HVCA 1P4OA 3CLYA 4Z16A 4FA2A 2WOTA 2OD5A 5J8FA 4O0XA 4FTRA 1JVPP 4R8QA 2GCDA 3OXTA 4L68A 2XS0A 3IW8A 4W9WA 4BL1A 3TM0A 5J95A 1VR2A 3HRTA 5AV1A 2P6SA 2VX1A 3DTWA 3QD3A 4R7HA 5JFSA 2I0VA 2PK9A 3ABUA 5AUUA 3H3UA 2RDPA 3JW4A 2C4GA 3CY2A 4AGWA 4YU2A 4BB4A 4OBQA 5DE2A 2FXAA 2PVMA 4FKVA 4YJPA 1JSTA 5BMMA 3TWJA 4FT8A 2WOUA 2PSQA 3I81A 4AF3A 4O81A 1WWXA 4RAZA 2GNHA 3VJNA 5HCYA 3RBWA 1I1SA 4J8NA 1S9IA 4RX5A 4RMZA 3GX4X 4DEGA 3VUGA 4EL9A 3FZRA 2QBYB 3NDMA 1LPUA 2RKUA 4ZTLA 2EFNA 5CNOA 3HNGA 4ZS0A 1B9MA 1U2WA 2NP8A 5KMNA 3H4JA 5HLPA 4FTCA 5CASA 2K02A 3AQVA 5L8KA 4KKGA 4D2SA 5CNNA 2VC1A 2QVOA 2XIKA 5HG5A 3OBGA 5IEVA 3GB2A 6PAXA 4IVBA 3S00A 3FWEA 4KS7A 4JK1X 3I53A 4O7RA 2VGOA 4FR4A 2UZOA 3VODA 3F9NA 2UW4A 4XG3A 5EDRA 4O2ZA 3BELA 5FEQA 3QRFF 1PJKA 1XHAA 4NHJA 4PPCA 5EHLA 3CD8A 5J87A 5BNJA 3VBWA 5LVNA 5JMSA 3BU3A 4YR8A 2ZXJA 1KGSA 2C3IB 4BBMA 2K7LA 3EWHA 2CG4A 3FMNA 2AUHA 1OL2A 3GFEA 1PW2A 5B2KA 5C1QB 2OFUA 4FMQA 4ZSEA 4UX9A 2BHHA 3QHRA 4ENNA 4WOVA 4I6BA 3OY1A 2CGXA 1RDQE 4FGRA 1XDSA 5K5XA 4QMXA 3W6JB 2H8HA 4A9TA 4ALWA 1QPCA 2BV6A 2ISZA 3ZSHA 3R0JA 3K5UA 2L02A 1QPJA 4ORKA 1MDMA 5AUTA 2VTIA 5CXZA 1CF7A 2HW7A 4HW0A 3FLNC 4MEYF 2OIQA 3II5A 4U79A 4JX7A 3PPJA 4HF1A 4DEDA 1EV7A 1FYMA 3OWLA 5M07A 4LRMA 1XH9A 1GAGA 4D2VA 3SDJA 5HORA 5TT7A 4ASXA 4EORA 4OIQF 1JGSA 4ANLA 4HZSA 4PTGA 3MY1A 5LQFA 2M30A 5HEZA 4L0ZB 4BCMA 4IH8A 4CVAA 4CFWA 1U59A 4HPUE 5HS8A 5HNBA 4RIWB 4LK1F 1LDKB 2AC5A 3MH2A 3QQJA 1W98A 4TW9A 4G6LA 2OJ9A 4C38A 4O7LA 1JHFA 2CKEA 1T2KA 2HWPA 4HYUA 4G5JA 4ZY4A 2V1UA 3OHTA 5CSWA 5FLXK 2G7HA 3RM7A 2Q0OA 4Y8DA 4M74A 1JPAA 5KMKA 1T6SA 1MRUA 5CEMA 1ND4A 3MFUA 1WBTA 4IWOA 4DFBA 5IEXA 5IQAA 3M42A 4TNDA 1R1UA 3LWFA 2UW6A 2VE9A 2XBAA 2XKEA 3F72A 4M3QA 5HO7A 1BI1A 1S3JA 3JAMZ 2YM3A 2GFSA 1PHKA 1UHMA 1O9UA 5HOAA 4IC7A 2ZNYA 5HHWA 4WD5A 2UXNA 2VBWA 3U9CA 2IA1A 3ROCA 3H3CA 3ZMDA 4J53A 2WFYA 3LLAA 3FMLA 5J8CA 4DHFA 5M09A 2KIMA 3G9LX 2HQNA 3FQHA 2YCSA 4OBPA 4GK3A 4EBVA 2HCKA 4G7HF 5L3EA 2XCKA 3UTOA 4YURA 1YW2A 4BGHA 1LB2A 3MVMA 1OPKA 3EYYA 2UW8A 2V7OA 4DLIA 3IPHA 5ILSA 1KQ9A 4MGRA 4FTQA 5BVFA 1KU9A 4HDUA 4QQCA 3RHKA 4GL9A 4BAYA 2RGVA 4EM0B 3GU5A 5E20A 4BTMA 1RZ4A 5BVEA 4C62A 4A6EA 3U2RA 2QG5A 3RNIA 4UV0A 4CMOA 5KMJA 2Z5UA 4NW6A 4YTIA 4PV0A 3KB7A 2RVCA 3V8TA 3OC1A 4GCVA 3ZFXA 3F5GA 1Q41A 2YAAA 2GAUA 4OOIA 3I0OA 2VUWA 3BWGA 3FMDA 3GFWA 1R39A 4WF2A 4QYYA 4D4YA 3NUAA 4L9NA 2ITTA 3QZHA 3G0EA 3UQCA 4G3CA 4JQEA 5I3OA 2OZOA 4M6YA 3ERKA 2PVKA 2Q0NA 1YTYA 4XOYA 5CENA 1OBGA 4WUAA 2X2KA 2HWVA 2ZJ2A 2RG5A 2BALA 4X3FC 4RVTA 3I5UA 2ZM4A 3I6WA 2C5OA 4FKJA 2QURA 3ALOA 5HQ0A 3CTQA 3T8OA 3OOMA 4V04A 3AC8A 1U5TB 4PGHA 4MEXF 4RC2A 1JKSA 1KUTA 4F6UA 3FY0A 3BJAA 4U81A 2QVSE 1JKKA 1Y6BA 4IB3A 3ULQB 4LOPA 2JC6A 2O03A 3RI4A 1R1VA 4F0IA 1QZZA 4I2OA 3PVUA 4KN7X 5K3YA 4M68A 5L3GA 5D6EA 3CQUA 1P92A 2OJFE 3UODA 3MWMA 2ZDUA 4I1ZA 3Q5ZA 3O7LD 3TUCA 1XCVA 2WWYA 2ZB1A 1YWNA 3A7HA 1KYZA 3NLBA 5CU2A 4NTSA 1PP8F 3WE2A 2C3LA 4FIHA 4O27B 4AIKA 3R0AA 2WMWA 3C5UA 4MHAA 4F1MA 2P5LC 2X8IA 2WKMA 4DEHA 1O6YA 4TYJA 3GU4A 5KHXA 2Q2EA 4DTAA 5EH0A 3OD6X 4HAMA 3HV7A 4IHPA 3IGOA 3OF0A 3OCBA 4PMTA 4E4XA 3ORLA 3R21A 2PWLA 2UUEA 5F95A 5E1SA 3V5LA 5H8EA 5FM3A 4FX3A 3C3WA 1IXRC 3Q52A 3RVGA 3QWJA 4U42A 2OI4X 3V4GA 4O2PA 3PY1A 5B0XA 3E3VA 3DDPA 3DB8A 3C9WA 2FF4A 2IO6A 5L3AA 1SM2A 2C6TA 3GXOA 3PXKA 4NUSA 2CLXA 3MVLA 2ITPA 4L00A 4B9DA 2VV9A 2F49A 3MJ2A 4X3FB 4PQNA 4KABA 4N0BA 5IH5A 1OM1A 4U43A 3I0QA 3LJ1A 4HGSA 5ACKA 3J7AO 4KB8A 3PY0A 3R7OA 2ZFWA 2XJ2A 3MI9A 2HKOA 3IONA 4C3PA 4RZVA 2WV0A 5LLQA 4BCHA 2QZ8A 4FVRA 4YNEA 4FODA 4EH2A 4QNAA 2B0QA 2BYVE 1OZ1A 3R6XA 4AWXB 2W0JA 3ZFMA 3GCQA 4X2KA 4D55A 1V0OA 4CICA 2HS5A 2C68A 5F1ZA 2MBFA 2W7XA 3I1AA 3F3WA 4ZEGA 1XBCA 1WKMA 5C4KA 2DO7A 4B0GA 3FMJA 2ZB0A 5DV5A 2BPMA 5D5UB 1ZYJA 3L8SA 3MPTA 3ZLWA 2KIFA 3BCEA 5DVRA 4FNXA 3CJGA 3HV3A 2DU9A 5IQDA 5AJQA 2QKWB 1LNWA 4EH4A 4QQTA 4WK8F 3O96A 3E62A 4UWBA 3KF4A 3SG8A 2XROA 3DA6A 2F4JA 3KP2A 1KE6A 3BLQA 4S34A 5FXRA 2ITVA 4L3LA 3ZFYA 4UYAA 4JDIA 3GU8A 2O0UA 5HO6A 3B2WA 1TNSA 4PCQA 4X0MA 1DPUA 4UB7A 4YGAA 4H0EA 2P2HA 4CT1A 4V01A 5C8NA 3QZFA 2R7IA 4EK3A 4MNEB 3R9RA 3ULZA 1ZYCA 1DPRA 4HDVA 4O1PA 1APME 2R3OA 2WTIA 3FMHA 4JNWA 3L2CA 2UVYA 2WU6A 4BBFA 3SZPA 2QC6A 2WXVA 3QCYA 5I0BA 4N57A 1DAYA 3W33A 2IVSA 1F4KA 2CSOA 3P9CA 1IXCA 3FKNA 4HX4A 3GUBA 4LLGF 5BUEA 4G94A 4IX3A 2RQPA 2WMSA 1SMYF 1U8RA 2BIYA 5E1WA 4AXAA 3WF5A 3E87A 3KZZA 5CAPA 4FT0A 2CNUA 2WTCA 2F5CA 2GTNA 3DDQA 2HKXA 4F9YA 3NIEA 4A0ZA 3BZ3A 2QCSA 4RJ4A 1D5VA 1QPDA 2WTEA 4KIOA 1U5QA 2BDWA 3DB6A 3OCSA 1EH6A 4IVDA 4QP3A 3BDDA 4BDEA 3DJ5A 3A8XA 3NUXA 1G8SA 5K0KA 5CVGA 4MX9A 3QU3A 4ERKA 1U54B 4K11A 1XH5A 5BOXA 3E6DA 2XRWA 5BVNA 2FSLX 2WMBA 2XNPA 3UIXA 4V0GB 4ACCA 1Q99A 1OI9A 4L52A 3FEGA 3PDTA 3JSOA 3VUKA 4RX7A 4DBXA 2XKOA 3FY2A 5LGUA 1T39A 4IXPA 3KN6A 3WBLA 5GINE 5A4TA 5AV4A 4RWJA 1HXDA 4YZNA 5FLXZ 5ACBC 3OTUA 2OZ6A 1OIYA 2IWIA 2J5OA 5CF5A 2R3RA 3MVHA 1W7PD 2XEYA 4BDCA 3M1SA 3QRIA 3LM0A 3K3IA 4LGHA 3QL8A 4L5JA 4FICA 3M7GA 3PSDA 1G8AA 4LGDA 1U4DA 3BV3A 4TYIA 3QWKA 5EDPA 4DH5A 3KCCA 1Q3DA 5HG8A 4LLLA 1J1BA 1Q24A 4OT5A 3D2KA 3ZRKA 3EDPA 2F7EE 1YO5C 4J71A 4EH9A 2ZV9A 4QTAA 4F7JA 2PN6A 3G73A 2J7TA 4V0GA 2H9VA 4L7SA 3BYSA 2PMUA 4ZS4A 3RALA 4BN1A 3DCVA 5EM5A 3EQGA 1OKZA 3UGCA 3U9GA 4K77A 4H36A 4UWCA 4ITJA 3TV4A 4IE9A 2O6GE 4EV0A 4AZVA 3UJGA 5LOHA 1OL7A 2Z9OA 4F08A 4ZZMA 4BHBA 4DC2A 4NM0A 5KE0A 3LFFA 5AADA 5CF4A 2UW9A 1WI9A 3PFIA 4K33A 5HKMA 3RAKA 3EN4A 3KEXA 2JBPA 2QQ9A 3DZOA 3N4UA 5EKNA 5M51A 3LFAA 4ENKA 3EB0A 2Y0AA 3FF5A 3VRYA 2RIOA 3NRVA 1FPQA 5M56A 4R1YA 1ZRFA 5DN3A 2G9WA 4R3RA 1T38A 4WSQA 4U7BA 3CQEA 3LFEA 3OW4A 5HCZA 2C47A 4OAVB 1VEBA 4BKYA 3C13A 1YDTE 4YO6A 3BPVA 3CTAA 3NQOA 4KIPA 1NVQA 4RJ8A 4C4HA 2A0CX 3QRJA 3V7RA 2UW7A 1R23A 3VW8A 2XB7A 4D1XA 3GNIB 4P4CA 5AAGA 2HXQA 1YVJA 4EQMA 3FKLA 2DK8A 3EETA 2DPUA 3DEUA 1GZNA 4BCJA 3IWZA 3KP7A 3M2WA 4XP2A 4OINF 2HAKA 4KS8A 5DYJA 4ZTNA 3V7SA 2JKQA 4DYMA 3H92A 1H1RA 3FPMA 1J91A 2WMVA 1URWA 4W4VA 5EDQA 4XBRA 5LMAA 5JSMA 4EJNA 3UZTA 1ZY5A 5IA2A 3DFAA 1XD7A 1DUXC 4OTHA 1OPLA 2OXXA 4U88A 3MQ0A 1ZG3A 2F5FA 3O8UA 4DFXE 4EGYA 4ANSA 4BI0A 4DITA 4C3FA 5KKRC 3ULIA 1U3EM 3HDNA 4BWPA 1IN5A 1LEZA 4R78A 1XR1A 5C4LA 4QP7A 4W4YA 1PYXA 4NK9A 3CPBA 3VS2A 3OFMA 4MQ2A 3EN9A 5BUIA 3SX9A 4GFOA 4AIJA 3JY9A 1KE8A 5AIKA 2E9NA 4RIXB 2JDVA 2BAQA 5LBQA 4ZYDA 1RW8A 4NU1A 2IW8A 3GU7A 3W55A 4F0GA 1ZN2A 2CNQA 4BNCA 1H9TA 5D8LB 3ALNA 1H1SA 4EJTA 5ICPA 3O17A 3GFLA 2JIUA 5BVOA 1YWRA 3UDBA 5CTPA 5F4NA 3PY3A 2F5EA 2FBIA 2KIUA 3QCXA 1FNNA 1XO2B 1BJAA 3B8RA 1ZH5A 2OH0E 3O2MA 4ALVA 4RG0A 1FGIA 3FHRA 4EOQA 2F57A 3V51A 3IW5A 1OKRA 1PXOA 5L2IA 2GHGA 2YHVA 2NPQA 3E97A 4ZZDA 2H6BA 4P5ZA 3TNHA 2ITXA 1SNXA 1W82A 3SXFA 2V1XA 4CKRA 5K5RA 1IR3A 3GQIA 4F7NA 4I0BA 4C36A 4O1OA 4RIYA 3WTTC 2HYYA 4F6SA 2VODA 3MGYA 5HDGA 3ORKA 2XAHA 1W5TA 2CFXA 5IQCA 3QXOA 4TZRA 1E17A 4S2ZA 5CX9A 2MD5A 2VU3A 3DPKA 2CDZA 4IAIA 2BGCA 4GU9A 2XCHA 1P4XA 5ANKA 4I6HA 2B1PA 4FIGA 3GF2A 2YDIA 4R6VA 4BC6A 4IZYA 4DAWA 3AC5A 3V5WA 2YM4A 2PVYA 4A4LA 4AGDA 1IN7A 3NYOA 5AM7A 1J9IA 4W8EA 1PKGA 3QA8A 3F8MA 3EFLA 1BL6A 4AU8A 4ZLZA 2J0IA 4F7SA 2W06A 4KUJA 3OBJA 2OGVA 5E91A 4QMYA 1NY3A 4GXOA 4QQJA 5B2LA 3H9RA 2YIXA 5FFZA 3FZOA 3DLZA 4RX9A 1Q4LA 1IN8A 3FV8A 2ITQA 5FXSA 3NUSA 4XNEA 4U45A 2A5YB 4I0TA 1IRGA 4M0YA 4OTFA 2X9EA 3KP6A 3M11A 4JT3A 1F5TA 1W8CA 3V8KA 5FFXA 2XASA 4KA3A 2Y0MA 4IIRA 3K69A 5LHIA 1OIRA 3IRQA 3V04A 3HHGA 3LPBA 3MY0A 2O8XA 3SLSA 2YN8A 3F8CA 5BYZA 4FKRA 2VWBA 5KMMA 3WOWA 4KT5C 4GYIA 4BGQA 4NTTA 4XBFA 3TUBA 3M8FA 2KKOA 1WVYA 4OTWA 4EK5A 2YERA 4E6QA 1GIHA 3QD0A 3KXZA 4L43A 4QYGA 3L8PA 1PMVA 2BDJA 4I4EA 2OLCA 4PF4A 4UXLA 1O3SA 4CDGA 4L44A 5M08A 3OEFX 4O6EA 1YLFA 2ZO4A 3HMMA 2L54A 2YU3A 2QOOA 2W99B 5HE3A 1D8KA 3NS9A 4YLKA 3VN9A 2CN8A 4IDVA 2PVLA 2C5NA 4M8TA 5D5WB 3AT2A 1FBQA 4UVCA 1JOWB 5FD2A 2ETRA 1XSXA 2W1CA 1BIAA 1JAMA 4EH5A 4ESBA 4LG0B 3BGQA 5CAQA 4IAFA 2RGPA 3PIXA 2W05A 4HNIA 4YFKF 4CRSA 2HELA 3TOBA 3HIFA 3HRBA 1U6GA 4P55A 3WGIA 4UZDA 3GZ5A 3QTWA 2B4SB 2X6EA 1UU8A 3ROYA 4FYNA 4UMUA 5CU0A 4RVLA 3KK9A 4C4GA 4FIIA 2DYLA 1G3TA 1GHCA 2VN2A 4XRFA 3I4BA 3QA0A 2YX4A 3NIZA 3GEQA 5T3QA 2ZYBA 1YS7A 5DCFA 4IHTA 4I5CA 4HBLA 1M2PA 2VNYA 5E8VA 5TO8A 1O57A 5A4EA 1FC3A 2HZIA 4O86A 2GXBA 1PP7U 4RGXA 2DW4A 4G6OA 4I20A 3SW7A 1XSDA 5DYMA 4QMNA 1L8TA 4P5QA 4MNEA 3Q4UA 5IT3A 3ZN0A 2MH2A 5C9CA 1PF8A 5CEKA 2BTRA 5JZNA 4AQCA 4NL0A 2OQGA 3F3ZA 4LV8A 3BEGA 1WVWA 4D4SA 4NM7A 4BRXA 4E93A 3VUMA 2VC0A 1G4DA 4QMOA 3F66A 4FG9A 1W5SA 4AFEA 4E73A 5CLSA 3LCSA 5L6PA 3F88A 4EHVA 3HOSA 3I0TA 3UIMA 4FIEA 4O0YA 3FI3A 5M4UA 1STCE 2FA2A 2VBXA 3EQLF 4E6AA 5HOOA 3NX8A 5AP7A 3R22A 2X2MA 4DE4A 2Y4PA 4QTDA 2R3JA 5DR2A 4AUAA 4YFXF 4MXAA 2LKPA 4BICA 5CQWA 1USTA 5EQYA 1XKKA 5HICA 3UVQA 3ORXA 3TOAA 5CZHA 2JPBA 2Z02A 3R63A 4EQUA 4O38A 3HOTA 3MIAA 4EQCA 1J75A 4JRVA 5I9ZA 4RC4A 3JVSA 4GS6A 3FMEA 2VT2A 4QTBA 3VS6A 2BEOA 4L46A 5F9EA 4KFCA 4YMJA 3ZP5A 5LHGA 4AW1A 3PXRA 2DS1A 4II5A 3ETAA 3GOPA 2R7BA 1ZRCA 5JKGA 2XYUA 1EH4A 4HGLA 3FXRA 4MAOA 1DP7P 3RK9A 1CF7B 4D4RA 2XBJA 1YRPA 3W8QA 3R01A 2R3PA 1MQBA 4UNOA 3DBFA 5HZNA 3BPXA 5IQGA 1JNKA 4OUCA 1OVEA 5K0XA 3C51A 4BGGA 2ONLA 3FLWA 4DNCA 5H20A 4MTAA 1H00A 2HZ4A 4PDYA 3E7VA 4N6YA 3RP9A 3V8WA 4QYEA 2HOGA 4J1RA 4IM0A 2G01A 2O8YA 3A60A 2BFXA 3C0IA 1OUYA 3D4QA 2QU5A 5ICEA 3E92A 2PU8A 2XEZA 4QMWA 3FWQA 2OF4A 3BQRA 3HRSA 4I0RA 4QPAA 1M14A 2PE0A 3IOKA 3PE1A 3FMSA 4YHTA 5L3CA 3NPCA 2ZMCA 4S31A 2Z7QA 4IX4A 2XVCA 1H28A 4EYMA 3QPHA 1J3HA 1W7HA 5H3QA 4XMOA 4ASZA 2WMUA 3JYAA 4AOTA 3J80K 4DN5A 4RJ3A 1LEWA 1UVRA 4FUYA 5A46A 4WXHA 3L9MA 1UNGA 2PEXA 3HLLA 4DFNA 4BQAA 3V01A 2V1DA 5AONA 1FT9A 3RK7A 2J9MA 3UOLA 4JAIA 2C3JA 3IW4A 5AIPA 5LGNA 1UB9A 4FIFA 3AC2A 1FSHA 1OECA 2IZRA 1RJBA 3VF8A 4C61A 4A0XA 3DFGA 3FE3A 4LMYA 4U3ZA 3KETA 3WTXC 1CKJA 3SXYA 2YJSA 1V4RA 2GNGA 5ANEA 4O7NA 2CYYA 3P08A 2P8TA 3PRFA 5KNJA 3H0YA 3I60A 4D28A 4HVHA 4A4XA 1GZOA 4FT7A 4XLPF 4RB2C 4HX8A 4UMTA 1YOJA 1HW5A 2QOCA 3VW6A 3TV6A 3JAMK 2OZAA 1QPEA 4EZ7A 1UA2A 2WB8A 5E8IA 1V1KA 3I5NA 4E5BA 3TJCA 3Q2JA 3Q4ZA 4TWCA 1ZYRF 2XKDA 2PMLX 3R8ZA 2YZAA 4MD8E 3QKMA 3TIZA 2EXMA 3FL5A 3EYGA 3MSSA 3NW5A 5EI2A 4DEAA 3F3TA 4Z2YA 2A6EF 3F22A 2FO0A 4D0WA 4APCA 3P7NA 2BR1A 5ETAA 2ZDTA 4ZLYA 1P14A 4MYGA 3VBQA 2VBYA 1ZLTA 5ANOA 1B6CB 1SD6A 2OIBA 4ZSAA 3R28A 1R3CA 1XH7A 2O3PA 3BV2A 3ISPA 3Q53A 4LI5A 4QP1A 5FGKA 4XCUA 4BCKA 1H1QA 4Y83A 3K2LA 3LXLA 3P4KA 4LUEA 5IKWA 4B7TA 5A2QK 3QX2A 4RIWA 4FTUA 1JBPE 5ANGA 3AD4A 3B73A 4Q5SF 4BDFA 4J95A 3SAYA 3HUGA 1OUKA 3Q2MA 3RJPA 2FNPA 3TO6A 4O3MA 2YA9A 1M7QA 3QUPA 2W17A 1Q62A 3ML6A 2BROA 3DPTA 3EFKA 2QQAA 4KIBA 3TV7A 1ZREA 3MH1A 5CAOA 4ACMA 4XV9A 3T8TA 3RDIA 1QQIA 3OZ6A 4CKJA 4A12A 1NT2A 4MBIA 3MV5A 3DJ6A 1TQIA 4F9WA 5DWRA 1KV2A 4EM1A 3GCPA 1FBNA 2PVHA 4D0PA 1GJOA 4FKUA 4TXCA 5J9YA 5IH4A 5C27A 4B6LA 3I7BA 3R7VA 2EWAA 1J7LA 1O7LA 4IBMA 5EW3A 4FT5A 4KINA 4IMYA 3G51A 4RFZA 4R77A 4BTJA 3ORMA 4ERWA 2ZV7A 2LAVA 3D5XA 5KMIA 2OZAB 5CVFA 5ICCA 2C0TA 3KXXA 3WG9A 4BIEA 4YC6A 2VTNA 5DIAA 3F23A 1HOWA 4PDOA 3TDWA 2NYXA 4BYIA 2WAJA 4FIJA 4OMYA 3KRWA 4FKWA 5FEEA 2VO3A 5DDGA 3MB7A 3UVRA 2UVZA 3PIZA 3QU6A 4LV5A 5HBHA 2YITA 4ON0A 4UYNA 4P9FA 1RUOA 4RIXA 3FXXA 2EUFB 2DUVA 4D2TA 4ZTRA 2HFHA 2XIRA 5L8JA 2ITNA 2X1NA 4X6QC 5DEQA 5LEJA 2PZPA 3LXNA 3MY5A 4D58A 4O22A 3TDVA 4EVIA 1G5SA 2QR8A 4E5AX 5L6WL 3W32A 3SXRA 4YZBA 1YHSA 1UWHA 4KBAA 3U1DA 1H27A 3DNDA 3AXWA 4ACGA 4HQEA 3MJ1A 3R7EA 4BI1A 3HP5A 4FTTA 1Z7UA 2O5KA 5I9VA 2Z7LA 2P5VA 4O0VA 2F5DA 5AR2A 1F0QA 3C1XA 2M1BA 2FQ3A 5A3XA 2WMTA 3A4PA 3UC3A 2R4BA 3COHA 4TYGA 1WSUA 5CI6A 2HGCA 2BTSA 4LQMA 3LJ2A 2F7ZE 3BOQA 2GNFA 3PVGA 1ZRZA 3EQFA 5D9HA 2C30A 2ITYA 5E8UA 2ZM3A 2ITWA 2YFXA 1PMNA 1BI8A 3QTZA 2C6OA 4HCUA 1HSJA 4AN9A 3EUHA 3GO5A 2WO6A 3LM5A 3TNPC 3KLOA 5KX8A 5ICGA 4A07A 4JDKA 3VWAA 2X4HA 3MFTA 4FF8A 3LFNA 4ZMFA 2R3FA 4R5YA 5A54A 3IQ7A 3ET7A 4GYGA 1OGUA 4RQVA 3OY3A 1B59A 5DT4A 3O3KA 4TYHA 3GQLA 2FH9A 3BI6A 2XRUA 4GUEA 3U9NA 1Z1DA 5I9UA 5CYVA 3FI4A 4NKSA 4HVDA 4BKZA 5HE2A 2W5HA 4CQGA 4GMYA 2QBYA 4EK8A 3ZMZA 3NUPA 3FX3A 5C26A 5B2MA 4DGLC 3DKWA 3LXKA 2WZJA 3Q96A 4MH7A 1DM2A 4LOQA 1LEAA 4M71A 5DUKA 3TO9A 2DPDA 2UZDA 2ZBKA 3Q6WA 2PI0A 5CVVA 4EI4A 3PXQA 3HTSB 3BGZA 3QLFA 4ZJVA 2ETMA 4O0TA 3WYXA 5CAUA 3L00A 4OGRA 3JPVA 1ON2A 3B2TA 3F3VA 3TKIA 4HOBA 1YOLA 4ACHA 3NNVA 4CCBA 4P7EA 5HLGA 5LVLA 4MF0A 3M1EA 5E7RA 4BZDA 5CLPA 5JR3A 4ZZLA 4C7TA 4WXCA 3TDZC 3AOXA 4XS2A 4G5PA 4Q47A 1QL6A 3G6GA 3PA3A 2F7XE 1ZZLA 4FSZA 4KIFA 2R7DA 5BYYA 4Z7GA 3HV5A 2LDUA 2MH9A 4KN4X 1OL6A 1OIUA 4G2FA 1REPC 2YM6A 4M14A 5CEQA 1B9NA 4UALA 4XLVA 3MVJA 3ZLXA 2BKKA 1FP2A 2B53A 3DGKA 4C58A 1A48A 5D7AA 5KO1A 2RKHA 2XUBA 4Y5QA 1TNTA 2JAMA 5IZFA 5M53A 4O7YA 5AFVA 1AD5A 4IAZA 4RBLA 2QOBA 3FDNA 4IWPA 5AEPA 2DT5A 1I09A 2C0IA 3HMIA 1YQJA 3FAAA 4TTHB 5KMLA 2XAGA 2R5TA 3CD3A 3RKBA 5HIDA 4DFUA 2YIWA 4LL5A 2EFWA 3C4FA 5GJDA 3D0SA 3A61A 5LVOA 3C7JA 2V5QA 3LKMA 4A9SA 1U54A 1K78A 1DI8A 4C37A 2C6DA 2OG8A 2J0KA 3ZQ7A 1WRJA 4D9TA 4XEYA 3U8WA 4FL2A 5IDPA 3OV8A 1U5TA 3KCFA 5D10A 1ZLKA 3DJ7A 3BHYA 5CSHA 2GNLA 1LP4A 3IKAA 2XHKA 2BILB 1Z91A 2IJMA 3OCGA 4RJ7A 1QZYA 3DS6A 4ASNA 4KKEA 4B8XA 3QTIA 1P5EA 4OLIA 3P78A 3U4WA 2DTRA 3AD6A 4EH8A 3UOJA 4AOJA 5EM7A 2OQRA 1I27A 5FXQA 1K2PA 3SXSA 2MLGA 4QOXA 3QTUA 3ZRLA 2YPRA 4P96A 3UPXA 3DXPA 4RS8A 4FV2A 5JFXA 3SRVB 3EZRA 1ZMWA 3BPRA 4FHTA 1RUNA 2Y48A 2WMQA 5DMZA 3LCTA 5AA9A 3CR0A 3OTVA 3TKYA 4LRKA 5A6NA 1WBVA 5E4HA 4RB0A 3I4PA 1XMAA 3D7ZA 4FOCA 3SKCA 4MXCA 2WQNA 5CSXA 2OAZA 4OTDA 3WTZA 2WEIA 4P2KA 3A7GA 3ZUTA 3MPAA 1U5TC 3FLZA 5IF1A 4E4LA 5H9BA 3ZSIA 4YIFA 4CFVA 3R8VA 3FQEA 4YSJA 4U0WA 2YSRA 3AGLA 3WYYA 3Q32A 3GFMA 3F82A 4G9YA 2OH4A 4AT3A 3FXUA 2Z99A 3PUPA 4Z7HA 4F6WA 4C33A 3UG1A 1PY5A 5F20A 5JQ5A 2P4WA 4TWPA 2MLKA 4J98A 5D4SA 4K2RA 1IG1A 3V5JA 5K1YA 3HSEA 2UWMA 1YIOA 4U0IA 3QD4A 4JL9A 2YIQA 2VNWA 1CKIA 4RX8A 4IANA 4LB5A 3RGFA 1KYWA 3HP2A 3ZM9A 2X8EA 2CPKE 2WQBA 2JDRA 4L7FA 4WO5A 4AA5A 1J7UA 4RIYB 4K2EA 2I0HA 3TTIA 4QP9A 5J1VA 2WQMA 4NQWA 3HRUA 4PTEA 1H24A 4A5NA 2A4LA 4WIHA 3GW2A 1LVAA 2WTWA 4XG8A 3P86A 3J80Z 2H96A 4O7VA 1NHAA 1TQPA 1ZY4A 4XUFA 1HKSA 2XAFA 3FLYA 3DV3A 4RGJA 4KNBA 3NVMB 4G1WA 1UU3A 3TTJA 3Q9XA 4ARKA 1Q1HA 3DU8A 2ZKZA 1OMIA 3ZYAA 4IJ9A 1KU2A 2O0YA 3AD5A 3WF7A 4C0TA 4BY9E 1ULYA 2WTVA 3T9TA 2EVAA 3E93A 4M7IA 1ZARA 2YABA 4HVGA 3MH0A 2OSCA 3LA2A 4Y85A 3MFRA 3Q9VA 2LGCA 3ZBFA 3RZBA 4ANBA 2C6LA 1V0PA 3I59A 3LA7A 4FOBA 2E9VA 3O8TA 4BDBA 2E9UA 3BE9A 3ZO1A 4F09A 4EC8A 5M57A 3U6IA 4CFNA 4MVFA 5HLNA 3F69A 5EFQA 3CSVA 2VWWA 4UXNA 4EWQA 2HZ0A 2OXDA 3RZFA 4NT4A 2C1BA 5J8IA 4L0YB 3GFIA 3OMVA 3IDPA 5CYIA 2X9FA 5IQBA 4U80A 5AR4A 3Q9YA 2A2AA 3SHFA 1T45A 1ZRDA 4EOMA 4H1JA 4EH3A 2WQOA 3AGMA 2Y75A 5JRQA 5HO8A 4AZSA 2J5PA 2JSCA 3RPSA 5IU2A 1CSNA 2R3QA 2W1ZA 5ANIA 3IKTA 1R36A 4YSMA 4ZTHA 3RYRA 3EQCA 2IG7A 3QRTA 4Z9LA 3LVPA 4M15A 2XVDA 5A4CA 4YJQA 4FTNA 4JJRA 3AT3A 1KA8A 2V22A 4JI9A 4C02A 2QODA 2QLUA 5HDKA 2F2CB 4M9ZA 3BHVA 2XKFA 4NKAA 3IW7A 5D1JA 4QP6A 4O21A 3N97A 2OBJA 1PMEA 4XHKB 2QR7A 1YQAA 2UZKA 4J7BA 2FMLA 5EYDA 4L67A 5ANJA 2PL0A 5CT0A 3V5PA 3K1MA 3R04A 3ANRA 3RYPA 4HLYA 4BHZA 4ZH4F 2A68F 5E90A 4HA8A 3A2CA 3AG9A 3UYSA 4HX7A 4PL3A 2XA4A 2X7FA 5AP0A 5IT9Z 4TN6A 5AR5A 4F65A 5A14A 2W9FB 2LSOA 1G3YA 4UMQA 2BUJA 3JSPA 3TJDA 5DBXA 3R8PA 4FV5A 3F6VA 4FKQA 3L7WA 3C4ZA 2WPAA 3DK6A 1BIBA 2PJPA 2PVJA 5BMSA 4TKSA 2VE8A 3G15A 2QQBA 2PMNX 4MQVA 3RTRA 1VYZA 4FKPA 5KK1A 4FKOA 5AUYA 2W96B 4GK4A 5CI7A 4AW0A 4DGOA 5I9WA 2PMHA 3LCOA 1TVOA 2Z7RA 3CBLA 4BTKA 4HQMA 1S9JA 2O63A 1BI7A 5CU3A 5E8SA 5IPJA 4DEBA 1YI3A 4GH2A 1Y8GA 2H09A 3R4KA 4AVPA 3MFKA 3NZ0A 2C6IA 2X8DA 3QRKA 2XKCA 2JKOA 2ZJWA 5M4FA 2XNBA 2R3IA 2VTPA 2VWVA 3DT1A 3FMQA 3I5ZA 3S95A 4IX5A 1QCFA 2ESNA 4M69B 2V6CA 3V3VA 3WIGA 2WEVA 4I0AA 4LFUA 3QBNA 4YJSA 3MTFA 5CZIA 2J4ZA 3FM5A 4LYNA 1KE9A 5L3FA 4C4EA 4GIIA 2KJBA 1CDKA 2GS7A 2K86A 2W25A 4DCAA 5TRDA 4AGCA 2FNAA 3GT8A 4BDDA 3CUQA 3VNTA 4O0UA 4WCGA 3H3ZA 4MTEA 1UNHA 2X4ZA 4F64A 5JGDA 3DKFA 3VULA 3LQ3A 3GCVA 3MZYA 2PZIA 3KRXA 5IQFA 3RKWA 4GIHA 3O0GA 2PFBA 3QC4A 1TKIA 4EYJA 2BZIB 1TW2A 4XV2A 2HIWA 4A9RA 3LFDA 2QNJA 4U40A 1BYGA 4ALUA 5LCKA 4G16A 4IVCA 5D41A 2OKRA 3JUHA 5BX0A 3OXIA 4EOJA 1IXSB 3BYOA 4FZAB 1TQMA 3KMMA 3VQHA 4GT5A 3WTUC 4ACDA 1MD0A 4FZFB 4UV8A 4QD6A 2RSVA 2NO3A 2CKQA 3HAVA 3PSBA 2Q0BA 1P2AA 4JBAA 4XG2A 4PMPA 1MDMB 2I1MA 3KFAA 5HTBA 4JOAA 4BVUA 4N70A 4ZZOA 4DGNA 3E63A 5FP6A 5ILVA 1GIIA 4QMLA 1OKWA 3LFSA 4YBJA 2J0MB 5TOZA 5EW8A 1HBXG 1KE7A 2GA2A 1R1TA 2UZUE 3QQFA 4RZWA 3IGGA 5ANDA 2XV4S 3FZTA 3CDHA 3WU1B 4HYSA 4KSPA 2YR2A 4WRGA 1CM8A 3PYYA 3F2RA 4JX3A 2ITUA 1H08A 2EV0A 2R3MA 3MB6A 4YJUA 3QUDA 1IUYA 3FZPA 2IVMA 4FSQA 1MRYA 2L4AA 2REIA 2I6LA 1K7AA 3TG1A 3G0FA 2ZMDA 2DQ7X 3W2QA 3UPZA 1BX6A 4G9RA 2LF7A 1WBNA 2QG7A 4B4LA 2IP2A 3TO7A 4NWMA 4IM3A 4H3BA 3LFQA 4MNFA 3R9NA 1ATPE 5D5XB 1O6LA 1PXNA 2NRAC 4DTBA 2HOEA 3LQQA 1BUHA 3O6BB 1YG2A 4OIPF 3KP4A 3DBDA 3AMYA 3FHZA 3ACJA 3L9LA 4Q2AA 3SHEA 2GMXA 4CYDA 5FLFA 5HNIX 3QKLA 4XSZF 4O0RA
chains in the Genus database with same CATH superfamily
5AUVA 2EZLA 3H9GA 5JK3A 3LFBA 4NC7A 3ZCLA 3I59B 3P1AA 4D1SA 5CEPA 2PULA 2CLQA 2Y6OA 5DEWA 1BI3A 4N6ZA 5J7BA 2R3LA 4F9BA 1N78A 2CJJA 3R7UA 2XMYA 2PG4A 3OCTA 1PXKA 4XRSA 4DG0E 5FDXA 3ERED 4F1OA 3HGYA 2IGMA 2VOOA 1SFOJ 3HMPA 3T9IA 1YXSA 2DT7B 5TF9A 3ZMUA 4JX5A 1MP8A 4ETSA 4IQ4A 4I93A 4WBBB 2ETKA 2WMRA 4UXQA 2XK3A 3R9DA 1IW7F 3CQWA 3WU2C 3SQNA 4FV1A 5HDNA 3R7GA 3ATTA 3KU2A 1OYWA 3GC7A 3RSNA 4N9IA 2W85A 5EEHA 3NR9A 4M66A 2VTOA 3GC9A 1XQZA 2E19A 3KZYA 4C2WA 5IUGA 4RWKA 3ZS5A 1KOAA 4QSHA 2L9VA 2VKHA 4U41A 1Q8ZA 3DQWA 4WA9A 3GZ6A 2UXXA 5EYCA 3QP6A 5KBQA 3WG7H 3RMFA 4FUXA 5KHWA 4HF0A 4KIKB 5IEYA 2CGPA 2W4JA 1SFUA 1UCRA 5BPIA 2XIGA 2I7QA 5BNGA 1B6AA 4LK0F 4AM3A 5E8ZA 2ZV8A 4D5HA 1LFBA 2HI3A 2ERZE 1YXXA 3F0CA 2EZKA 3P5KA 1J09A 4NCTA 4GGGA 4DT9A 5K7HA 1WBPA 4DQ2A 2RFNA 4IAKA 1MKMA 5AP6A 4HVIA 1YHWA 2R3HA 4C2TA 3S1MJ 4XOTA 2BZHB 3DXQA 3ZONA 2XK4A 3AL0C 1V5EA 1JKOC 1Q8TA 5EZGA 3E8CA 4ZYGA 4S33A 3ID6C 4A69C 3WZJA 5D4RA 2YLEA 3L8XA 5EM8A 4L9TA 1WVXA 3CEKA 3RPQA 3QD2B 1R7JA 1BJZA 2FSWA 1FLIA 2VTAA 4F70A 2XSJC 2YACA 4D9UA 2GQSA 1Z57A 5AP4A 1LUFA 1W36D 3OSGA 3E8DA 2JIIA 5C3EJ 1D3YA 5EKOA 3TDUC 3ABLH 4BYYA 3QXPA 2Z8CA 3AG2H 1WAKA 1WQ2A 4V05A 5LMKC 1YE9A 3C0HA 3IKVA 3KL8A 4AYBN 2KULA 3ZLYA 2VQHA 2PVRA 2R0IA 2BCJA 4WNMA 4ZSLA 3O51A 1BM9A 4MEDA 3GUDA 3VS3A 5LMBA 2IZUA 3MS9A 3FDYA 4OMZA 3ZBXA 3VYTB 2H27A 1E3OC 4A9YA 4XP0A 2FRHA 1U78A 2E9OA 1OCPA 4K18A 3CUOA 1RQQA 1WMKA 2K85A 4AW5A 2IVUA 2CNVA 2EB7A 2UW3A 3VAPA 1BN5A 4ESJA 5CJ9A 1K6YA 1H0WA 4KSQA 1BC7C 1K4SA 2FBHA 5EGOA 4E6KG 2LLKA 1K4TA 1R5GA 4APPA 5BUJA 1XGNA 4EHEA 4HYIA 3E6MA 3OWKA 3UE4A 5CXHA 4HOKA 5DGZA 5KAFC 1V5FA 1PXMA 3KMWA 4GFMA 2O61A 2QOHA 3UNJA 4OIOF 2BZJA 2L4MA 3ZHPC 3CO7C 2JLDA 5E3OA 2VTHA 4K6ZA 4HVSA 3VUTA 4G3EA 1HC8A 2O2UA 1RPWA 1MBJA 5DOSA 5K9IA 4XN0A 2XIYA 3K70C 3CS9A 4NFMA 1SFEA 2ONLC 1WBSA 2ERKA 3F21A 2QHNA 2IS1A 3BLAA 3OYHA 3SVVA 2HDCA 2XAOA 4HPQA 5AX3A 4II2A 1SVEA 4EUUA 4GJ3A 1RE8A 3IL2A 2WMAA 3SV0A 3ZOBA 3C4WA 4EHZA 4IC8A 2UW5A 2XB0X 1STZA 2MD0A 3LCKA 3HAMA 3OW3A 1E0EA 4TWOA 4HW7A 5E1ZB 3NYXA 4H3PA 4BDAA 3CCJI 3RCJA 4QMUA 5D8KB 3R02A 4PK4A 3S2PA 3PSIA 1ZYLA 1Q8YA 1K78B 2VXDA 2HQ5A 3HV6A 5CU6A 3COAC 2Q83A 1URCA 4NB5A 2W1EA 4ZYHA 1JGGA 3S1QJ 3S15J 3LA3A 3C50A 2VO7A 2X4FA 3OUNB 2YUSA 4HYHA 2VWZA 4AIDA 2PQ8A 3K10A 4RGSA 3EQDA 4PTCA 3RPOA 1UFMA 2KRFA 3GFJA 3HMNA 5HVKA 3ZEPA 3BWFA 4G6TB 1H0VA 5HGIA 2A69F 3H30A 5CQUA 4QEBA 2PVNA 5BVKA 3FKIJ 3NWWA 5IUIA 4BS9A 1NG7A 1SVLA 3MKLA 2XNEA 4C8BA 5AR8A 2KRHA 3NAYA 2BRGA 3T3UA 2MGQA 3KULA 3MYGA 4NIFA 3POZA 4ZJZA 1KOBA 3NAXA 4CFFA 1GDTA 2GFCA 2JDTA 1FMVA 3LAPA 3TKUA 4RRVA 3FKOA 3OUKA 2JBOA 4I02A 3KXMA 3PNVA 5AAEA 2DAOA 3P0MA 4RMNA 4HJOA 4ZXTA 1I44A 3VHEA 4CTBA 1IC8A 1IAHA 4Q5EA 4AW2A 1HCLA 4F1TA 2FGIA 4OTGA 4ZY5A 2C5YA 3T1BA 4KRCA 3LFUA 5HS9A 1Y0NA 4BQQA 3LIJA 3GC0A 3MWUA 4G3DA 2CV2A 2ZNZA 2BHEA 4Y5HA 2KISA 1PMUA 4UV9A 5AMNA 1J7IA 1LJ9A 3FQSA 3PG1A 4DH7A 3NAUA 4BFMA 2STTA 4PDPA 3Q9SA 4L3JA 2R9SA 4NQWB 5E17F 4O6LA 4BHNA 3DV8A 2NAZA 1HCKA 1JQHA 1Y8YA 5D11A 4FZDB 5EQPA 3ONQA 2XNMA 4KITB 4ITVA 3F8NA 3OOGA 4EOPA 2VJJA 2DFEA 5GNKA 2OO8X 2EB2A 2BAJA 3HKOA 4PDKA 4RLFA 2IRFG 1ENHA 3FZSA 4JBQA 1TBXA 1ZYSA 3BKBA 4KICA 2IGOA 1WFCA 2VWXA 3NGAA 3ORPA 2XPUA 1WJFA 4X21A 1ETXA 4G7OF 1SVHA 1W7PA 3GZNB 2XF6A 1H88C 3UBDA 1B1BA 2TDXA 3A01B 3W1FA 1WZYA 3NUUA 3AKJA 3MH3A 3DU5A 2E2HJ 4IQ6A 4KIGA 2LC2A 1OLTA 5FKLA 2PZRA 1ORKA 1WH5A 3VS5A 1X3UA 1W2DA 4U5JA 4J8MA 5KZIA 1QGPA 2G7UA 2R64A 4WKQA 5H8BA 1UKHA 4RC3A 3G2FA 5AP2A 2JFLA 1GXPA 3W2RA 1H1WA 2UVXA 3LSPA 2FSMX 4D2PA 4E6DA 4ZP5A 1PVEA 4NM3A 5KZ0A 2QHMA 3OP5A 2XF7A 3BROA 2QKRA 4EC9A 4RAYA 3IOPA 3C4CA 3VVHA 4UVBA 3AMBA 4TYHB 3CC2I 1OL5A 2VWUA 1IAWA 2VB6A 4LITA 5J6XA 4CNHA 2IN6A 3VS7A 3KXNA 1OCOH 3ZZWA 3QX4A 2HTSA 2X7GA 2O3FA 5EF6A 3PO3J 2Y7JA 3S2HJ 3S4QA 3R2YA 3KXHA 3CY3A 1PYEA 3PLSA 2KZVA 3NW7A 4FASD 3BY6A 2W1OA 3U51A 4BGDA 2X39A 2IVVA 1H8AC 1Z05A 3LOKA 1SAXA 1PXPA 1S8NA 3BWJA 4M72A 2QOQA 3DXNA 5J7HA 3VQUA 2UZWE 5AUXA 2Z60A 3CC6A 2RN7A 5L2WA 3L8VA 3QYBA 2ZJRF 3N9XA 4F0FA 2VO6A 1P6RA 2XM8A 3N4VA 4GKIA 3W0QA 5HBJA 2WMXA 3TQNA 1G3SA 3THBA 4OU0A 2E1CA 4IADA 4NSTA 4DHIB 2FUG2 4Y3OA 5IA4A 1UJ8A 4JDHA 3AL0B 2FOKA 2K4JA 3VOEA 4CSWA 2AXTC 3LMGA 3BYUA 3GGFA 4BCFA 3F8FA 4ZDPA 3HKZN 3OWPA 4ABZA 4BCNA 4BDGA 1R5ID 2NS7A 1UHWA 3R71A 2VJ4A 2R92J 3QU0A 3OG7A 2DA1A 4Y4RA 4YTCA 5JFWA 3IW6A 1BC8C 1ST4A 1O3RA 3PUFA 3E3PA 2F2UA 2D45A 1IF1A 4AE9A 2VTLA 1F1ZA 4MQ1A 4L5IA 4WG3A 4QYFA 4CTCA 4YLJA 1SYKA 3G6HA 2BY3A 4JIAA 5FTGA 1E2XA 3KVXA 4USDA 3OVVA 1D0XA 4LOOA 5JGAA 3EZVA 5DLSA 1S7AA 3VBXA 3ACKA 3JXWA 5CAVA 5F0CA 3QPTA 3EN7A 1SMHA 2LTPA 1A9UA 4BJJA 1YYVA 2X81A 3QTXA 3R9HA 2WD1A 1OCZH 3BQZA 3KLNA 3RQ4A 5J9ZA 4Y73A 2XAJA 2WAQA 3C7QA 4I92A 3H9QA 5HU3A 5J5TA 4D5KA 4OAUC 2FB8A 3R7YA 4D0XA 1OYYA 2COMA 2GLOA 3VFZA