1TQPA

Crystal structure of a. fulgidus rio2 serine protein kinase bound to atp
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
282
structure length
269
Chain Sequence
MNIAELYGKMGKHSWRIMDAIFKNLWDYEYVPLQLISSHARIGEEKARNILKYLSDLRVVQNRQKDYEGSTFTFIGLSLYSLHRLVRSGKVDAIGKLMGEGKESAVFNCYSEKFGECVVKFHKVKVKEHFSVLAIRSARNEFRALQKLQGLAVPKVYAWEGNAVLMELIDAKELYRVRVENPDEVLDMILEEVAKFYHRGIVHGDLSQYNVLVSEEGIWIIDFPQSVEVGEEGWREILERDVRNIITYFSRTYRTEKDINSAIDRILQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of A. fulgidus Rio2 Defines a New Family of Serine Protein Kinases
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Ribosome
molecule keywords conserved hypothetical protein
total genus 86
structure length 269
sequence length 282
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2004-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01163 RIO1 RIO1 family
A PF09202 Rio2_N Rio2, N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1tqpA01
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1tqpA03
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1tqpA02
3VN9A 3GCVA 5CVRA 5TOZA 1J59A 3DZOA 1FX7A 4ZZMA 4ZJVA 2JKMA 2XH5A 1S6LA 2O65A 4M14A 1PXPA 4QMYA 4ZSEA 2JBOA 4FNYA 1JVPP 4QNYA 3VW6A 4H0EA 1OIUA 4BCIA 2AYPA 4QP3A 3A99A 1LEZA 4K9YA 2BKZA 4B09A 3EETA 4AT3A 3G9LX 1YWRA 1ZLJA 2E2BA 5KHXA 2XKEA 2YAKA 4BAYA 4HA8A 5C8KA 5A2QZ 1M7QA 2QOQA 3ZO3A 4K2RA 5ANJA 3QRUA 2IPXA 3QKKA 4RB3C 1JKLA 2QQ9A 1MQ4A 3G6HA 3G33A 4G6NA 1BI7A 4Z7GA 4D2RA 3IW4A 3V7CA 3UOKA 3MA6A 2RL5A 2EXCX 4BHCA 4BL1A 4QTCA 5FBNC 1H9GA 5HVJA 1OI9A 3MFKA 4G5JA 3LLTA 1T38A 4DG2E 3F69A 4O22A 4UHTA 4FOCA 5GINE 4M9ZA 4QQTA 3NUYA 3Q4ZA 4IF4A 5G1XA 3AC8A 5E8ZA 2XGXA 4KT5C 3VRZA 3LJ2A 4BHZA 5ETCA 2XYNA 3CQEA 3QCYA 2WO6A 3I5ZA 3E8EA 1FVVA 3HYIA 4RGJA 1OKZA 3VAPA 3K54A 4AWIA 4O3MA 4UMPA 3R7OA 2W4JA 4M15A 4ENJA 3FM5A 4IB1A 2C30A 3ORTA 1ZRCA 5JZNA 4QMNA 4I01A 1KU7A 2QI8A 3R0JA 4ZYHA 3H3ZA 2XKOA 3ORZA 1G5SA 1Z1DA 3IGOA 4IVAA 4B7TA 3UQCA 5GZ9A 3MVJA 3CUQC 1YQAA 2P0CA 4OR5A 3S4QA 4HYIA 3E97A 2WOTA 3VFZA 3T8RA 5KK1A 3RCDA 4FIHA 3NRMA 4MHGA 3TXOA 1OUKA 5HU3A 4YC6A 2R3PA 4U79A 5LVLA 5AX3A 2M30A 4M12A 2DFIA 3L00A 5E7RA 4JL9A 5JT2A 2FEZA 3AMBA 3ZLYA 4K1BA 2WTKB 4BKZA 3GXLA 3ENMA 4DFBA 5EDRA 4P96A 4BCKA 3HMIA 2WXVA 1Q4LA 4O82A 4M69A 3DPKA 3FLZA 2QO7A 4DFYA 1CM8A 2EV5A 4GCJA 1WCCA 5AMNA 1RJBA 3UMXA 3LA7A 3AT3A 3QP6A 5L6PA 1BI0A 4FV9A 5ERIA 1AGWA 2WTJA 3F7ZA 3PSBA 2R3GA 2RDPA 4LOPA 3IGGA 5DCMB 4DFXE 4E4XA 4IW0A 3S95A 3Q96A 2XEZA 3HMOA 4C61A 4P55A 3G90X 5CVUA 4WD5A 5E8IA 3OY1A 3R8ZA 3CUQB 1IAJA 3WGIA 3F3WA 5ACKA 3D9VA 3R73A 3RHKA 2YIQA 3FPQA 1ZMVA 4ZLOA 5CNNA 3IWFA 2W1ZA 1M17A 4NWMA 2ZFWA 4D2WA 4DAWA 3FLYA 1H00A 5E1EA 5D5VB 1YXSA 3C4CA 3UIUA 3IW7A 4IBMA 3QA8A 4HX8A 4R3CA 1F0QA 4KIBA 2EU9A 2YM5A 2EFQA 3E5QA 3HHGA 3DJ5A 4J8MA 4X2KA 1QPCA 3RAHA 3F8MA 1YW9A 4EZ7A 2ETRA 3OXTA 2CGXA 1M2PA 1Q1HA 4PDYA 5IQFA 1KU3A 1W7PD 2F2EA 4Y17A 3UO6A 4G16A 4XYFA 2CNQA 1ZZ2A 4ZZNA 4WNPA 2CDZA 2QHNA 4C4EA 2X9FA 4H3QA 1GIIA 3EKKA 5EM7A 3UOJA 3PY3A 2G2IA 4J8NA 2IP2A 4M9SA 3EWHA 2KJCA 5AEPA 2V0DA 5TE0A 3LMIA 2Q8KA 5JFRA 4AW0A 1ZYCA 3W8QA 3EUHA 2B1PA 5CF5A 1OKVA 3F23A 5C4KA 4EOPA 4FKIA 2GSFA 5HE0A 4JVGA 4FTNA 3QTSA 3UC3A 4L9JA 4E6AA 2PYWA 1LDJA 3ACJA 3ZOSA 4F99A 1XDUA 3EYGA 2GPHA 3ECOA 2J90A 3QPTA 2WNTA 3QQJA 1OVEA 4ONAA 4PMSA 2XK6A 1FMOE 2UZBA 4GFGA 5CU2A 4KS7A 5TKDA 2G9WA 4HDUA 4GU6A 3D83A 2BFXA 4XLVA 4LG0A 3UE4A 2RFNA 3IW8A 3D5LA 3MH0A 2XCHA 2VBWA 5CS6A 3LQ5A 3PLSA 2X0GA 4EH4A 2VD5A 3GEQA 4J7BA 4UY9A 4RJ6A 4PZJA 4R7BA 5HGIA 3FZOA 2EV0A 3QU3A 3RKYA 3FJQE 1M2RA 1HW2A 3GZ5A 2PZYA 4N6ZA 2PMIA 4RQVA 3WTXC 3IPHA 5E90A 2X8DA 2QG5A 1W7PB 4QRCA 5CSWA 1HOWA 3Q4CA 4YHJA 3E3PA 4RA5A 3RNYA 4I5CA 1Q3DA 4PL5A 2UW8A 2ZMCA 5HDNA 1J7LA 4U0WA 2ETKA 2WKMA 1W8CA 3RJCA 3VBXA 3KVXA 1LPUA 4Q5HA 5ICCA 2WMSA 3B8RA 3I0OA 1G3NA 3DXJF 3HIFA 5LVOA 2BRBA 3N51A 4U7DA 1SAXA 1DI8A 5K0XA 2P4WA 3VBWA 1FC3A 1IG1A 4RVMA 5J5TA 2A4LA 3DBQA 4NFMA 4UWBA 1XHAA 2BDJA 3PP1A 2J0LA 4K2EA 5E8TA 5IUIA 3DFCB 2P8TA 3HP2A 1Z9XA 1H4LA 3DOGA 3IHUA 4ZTSA 2JGZA 4NU1A 5D7VA 2XK4A 3KL8A 1FP1D 4HZFA 2F7XE 1FOTA 3UP2A 3U8WA 5KBRA 3GUDA 1D8JA 3F5XA 4TYHA 1UHWA 4O6EA 2R3HA 3FYJX 2ZCWA 3KFWX 3EQRA 2GHGA 4FIFA 2VBZA 2B54A 5BMSA 3BEGA 5AR7A 1BI1A 3KN5A 4G6DA 1WFCA 2PMOX 3LXPA 5E1SA 4CG9A 2BTSA 2NP8A 4NIFB 4K18A 4MVFA 3TDWA 2C6YA 5E8WA 4O38A 3BELA 4MWIA 2XCKA 5FD6A 4D0PA 2WMQA 4BDEA 1YWNA 4XEYA 5JGBA 2OIBA 2C5VA 2XM9A 1JKSA 1IN5A 3EN7A 3VS0A 4U0IA 3V8SA 1XBAA 3OD6X 2OQGA 3GU5A 4Q47A 4ZK5A 4AGDA 4AP7A 5KVRA 5DT4A 2X39A 1IEPA 5T6KA 1Q97A 2W25A 5HOAA 3TQNA 1R39A 3ETAA 3WI6A 4O7NA 2P6TA 4PX6A 3V5LA 2FOKA 2WC2A 5JFSA 4NQWA 4L3PA 4JJRA 1IN7A 3RDIA 1T2KA 4L44A 3F7WA 4I09A 1OMIA 2JDTA 3LPBA 3RK5A 2IWIA 3CD3A 5FGKA 3CKXA 4FNZA 5BYLA 3NPCA 3NSZA 5M4UA 4C4HA 4D55A 1R1WA 2F9GA 2ZVAA 2Z7LA 3ECHA 5F1RA 3GUBA 4AWXB 2B52A 3F3VA 4RC3A 2O3PA 5A4TA 5LVPA 4EHZA 4DFLA 3BHTA 2PFBA 3PY1A 3ABUA 3Q9YA 3GU7A 3KRRA 4QMOA 4NKSA 4CFFA 2VWBA 4EOJA 4JIAA 3QTZA 3FMDA 3LFKA 4BYYA 4BRXA 2V1UA 2D1VA 3BZ6A 3E8CA 3WZUA 4DF3A 4KN4X 4DG3E 2P6SA 1UNHA 2UVZA 4FKJA 1U2WA 4ZZOA 4QYYA 4QLCU 2JKOA 4L8MA 5CENA 3FMSA 2V1DA 2MLKA 4U45A 1UKHA 4C37A 4A4XA 2BZHB 5CVIA 4BI2A 4YPSA 4XX9A 3W2CA 3TKUA 2CWEA 3IL2A 3NUXA 2NRYA 3LHJA 4FIGA 1STZA 5BYZA 2BKKA 2M8EA 2XVCA 3KK9A 4RQKA 4QPSA 4EH7A 2K4BA 4RAYA 2BHHA 5D11A 2C68A 2RQPA 2V79A 2W99B 4FUYA 4E4MA 5BMZA 4MD7E 1UNGA 3HL7A 3G51A 3BROA 1A04A 4F7SA 4G3FA 2XAHA 2PK9A 4FTJA 1LEWA 3R02A 4BBMA 3UOHA 3P7CA 4A12A 5FBOA 5FWKK 1IAHA 3KQ7A 3L7WA 4R8QA 1PP7U 2JBPA 3MPMA 4D2PA 3FHZA 2R9SA 2REIA 4QP7A 3DK7A 5C8MA 4CLIA 4JDJA 5CAQA 4FSQA 2VTAA 3O51A 4IAIA 3R7YA 3ZONA 1BOAA 3TEIA 3WTYC 1AOYA 4I4EA 4X3FA 4A0XA 5IQBA 3ZSHA 1P2FA 4WX9A 3E5UA 1GZ8A 3L8PA 4CG8A 3WE3A 3TACA 4O0TA 2HKXA 3IW6A 3F3ZA 3QRFF 2GS2A 4WNOA 1PXNA 2YITA 5CEOA 2STTA 5KMNA 4K11A 4I98B 3F8BA 1FPQA 3AOXA 4AT5A 4RJ5A 5HO6A 1CF7A 2JDVA 4H58A 4ZTNA 1EH4A 4DTAA 3G73A 2Z02A 3WU1B 4A4LA 4YTIA 5LGUA 4G3EA 1ZXEA 4F65A 3VS2A 1P92A 3HV5A 3OT8A 3RKWA 1FT9A 4XV2A 4FV1A 3DB6A 4UVCA 3DGKA 5F4NA 5M4FA 4LMUA 2CYYA 5BUJA 1RQQA 3PG3A 1TTYA 3Q53A 3R0TA 3ZYAA 2ITTA 4IX4A 4DH8A 4EH9A 3R7IA 3FI4A 3ZN1A 2YM8A 2X4ZA 3ORPA 4S04A 2Z2WA 4MCVA 4G9RA 3PZHA 3LLAA 1M14A 3O3KA 2CLXA 2NRUA 3O7LB 4BB4A 4QT1A 3OXZA 5A4EA 3QZIA 4ACDA 5ITAA 4XV1A 1B6AA 3FQHA 3QRJA 1H28A 3JTGA 5CSVA 1UU7A 4C2WA 2QODA 3DKCA 2VX3A 4U6RA 3QA0A 1IF1A 5AAEA 2GNJA 4PP7A 2R3OA 2W1HA 4HYHA 4RMZA 5ILUA 1JNKA 2W1FA 4EM2A 2XP2A 4FSYA 1USTA 4U44A 3BYSA 4CLJA 2GHMA 4AA0A 2XKCA 4A4OA 4A9RA 5M51A 4YNEA 3Q2MA 4NM7A 4G8XA 3H92A 4CFVA 1F1ZA 1ON2A 4IHPA 4ZTHA 4JRVA 3S3IA 4FC0A 4ZS4A 3BWFA 2Y4PA 4GU9A 4EOKA 3F5PA 2E9NA 2R7DA 4BIBA 3QWKA 3FZSA 2BHEA 4CFWA 1R3CA 3BHVA 3KMWA 4BCNA 5FQDC 2VTMA 5M56A 5HOOA 2BRNA 3LXNA 3H3CA 2R3JA 3VJOA 3COAC 3WBLA 4IZ7A 3LE6A 3FC1X 2RGVA 3NNVA 5H3QA 3TI1A 4EWQA 1IR3A 5FD5A 4IPAA 2CQKA 5L3GA 3F5UA 3H3UA 2OJIA 4K6ZA 4DBNA 1NT2A 3NUAA 4EJ7A 1DPUA 4RG0A 2UZEA 2VWYA 4CGAA 3LA3A 4I6FA 1XH5A 2VT2A 2YCFA 4F7JA 3BV2A 4GJ3A 4TWNA 3KP4A 4UVAA 5JVTA 4Y46A 2GHLA 2HWOA 1ZYSA 2DTRA 1ZARA 3OT3A 2IZSA 4EKKA 2WMTA 5L6WL 3GXOA 2P7CB 1WRJA 3KXMA 5ANKA 3QBNA 3ZLXA 4KUMA 3KMMA 1W98A 3F2NA 1KOBA 3JW4A 4O81A 2E1NA 4HPTE 3IECA 5HLNA 2VT3A 3HKOA 1B4AA 2DI3A 3G15A 3MQ0A 2X8IA 1J5YA 3UGCA 4FI1A 3AD5A 5JFXA 1HKQA 3I59A 5J95A 5HBHA 1YS7A 4ENNA 5HORA 3DBEA 1GZNA 3E87A 2QOIA 4Y85A 3LZBA 3LFEA 1NXKA 3P9KA 3VS1A 3E8DA 1ZAOA 3R22A 3W18A 1XGMA 3VUDA 2CN5A 4C33A 1GIJA 2G9XA 3ZUUA 3ZUVA 2EB7A 3ORIA 2ZXJA 3P86A 1Q8WA 4ZSLA 4IVDA 3Q6WA 4UV8A 1TLHB 5ANOA 2W05A 3RPOA 3MB6A 4DBXA 3WYYA 4I6HA 3QU0A 4FZAB 3TUBA 4KIKA 5H6QA 4HGEA 5KNJA 5LBQA 4OW8A 1PMVA 3TUDA 3DDPA 1APME 2H9VA 3V5QA 4WXHA 4HW0A 4FOBA 3FKLA 1BBYA 5K0KA 1O3TA 2UVXA 2ZV8A 4RFZA 3VUIA 1P4OA 3JY0A 5C26A 3RYRA 2D45A 2IT0A 4FEWA 3R6XA 4OTIA 1QZYA 4AACA 4D58A 5AV4A 2WELA 3QX2A 5GJGA 4YG2F 3J7AO 4Q4ZF 4KNYA 5FRIA 4EJWA 1ZH5A 3S2PA 2W1EA 4L3JA 4EH5A 3ZMUA 4I92A 1ZN2A 2XK9A 3F9NA 2YWPA 1FWZA 4LGDA 2YR2A 4LB5A 3B2WA 3PVGA 4QMMA 4FTKA 4CKJA 2F2CB 4BDDA 1GIHA 3D5VA 4GT5A 1MQBA 4KBCA 3LQQA 1YQJA 4KINA 2B9HA 1WAKA 5CXZA 4RIWB 4EMSA 5DA3A 3UBDA 2XNEA 3ELKA 4YPDA 1WVYA 1RDQE 3LFSA 5CZHA 5CSXA 1R5HA 1LUFA 4QMVA 3ZP5A 5F20A 4GUEA 4F6UA 4O7VA 1NVQA 3PG1A 3BP8A 3D5XA 4PGHA 3M8EA 4A06A 2HYFA 2ONLA 2BGCA 4W9XA 1SD4A 1YI6A 3QTRA 3QC9A 3FF5A 5EM6A 1XGOA 4XLIA 4GMYA 3VHEA 2GQRA 3QTUA 4AS0A 4L45A 4Y95A 3GCQA 1H0WA 5AV1A 4FV5A 2VWIA 4IB5A 4NM5A 2JFLA 3ZHPC 4NW5A 2JZYA 1YI3A 3EN5A 2WQOA 3SHFA 4ANOA 4FTOA 1PDNC 4WA9A 2XIYA 4EJTA 4UN0C 3L9NA 2FBIA 4TXCA 2F7EE 5IMEA 2O61A 3BQCA 3BBWA 3QAHA 5CYVA 3BZ3A 1ON1A 2OXYA 3CC6A 4DE4A 2QLQA 1FYMA 1P5EA 3C3WA 2Z7RA 3O96A 5JR3A 5A54A 5IEVA 1W82A 2HR3A 2IZTA 4DEEA 5EI2A 1BI2A 1ZZLA 3QTIA 3QTQA 3P9JA 2WMBA 3DXQA 4U5JA 2MH2A 2D1HA 4NCTC 3B02A 3RPYA 3DPTA 4YJTA 5HTBA 3KN6A 3V6SA 2DS1A 4AIJA 3PRIA 3COMA 2DK8A 1XH6A 2XHKA 3MS9A 4W4VA 2ZV7A 1B9MA 2DQ7X 1PF8A 4UMRA 5LHHA 5AUZA 3HX4A 2IJMA 3SLSA 4MNEA 3W2SA 5LGTA 2EFPA 4CGZA 3OOPA 1XMKA 3E92A 1G8AA 4DN5A 1H8FA 3GB2A 2OK1A 1KQ0A 4QYGA 4KBAA 4QMSA 3ZMTA 2NS0A 1PXJA 4DCAA 5AIPA 4IAYA 2YCQA 3HOTA 4IX5A 5KMOA 3JTHA 4FKVA 4FICA 4O7WA 3C4EA 2UW4A 3DAJA 4BTMA 5CQWA 2FF4A 3C4XA 4E3CA 3VS6A 3FLQA 3HSRA 3VUKA 4EHVA 3L9PA 2R3RA 3U4WA 2XUUA 4PDOA 3BPRA 5FB2A 3T3UA 4MTAA 1IASA 2X7GA 4XG9A 4GVJA 3QZHA 2Z60A 4HGLA 4HX7A 3SZPA 4NT4A 1RNLA 4E73A 4EWHA 3ULZA 4JBOA 2W24A 4IJAA 1LB2A 1FYLA 3SOCA 1J2XA 3QZFA 5DR2A 4UYAA 3TJDA 1VZOA 5DOSA 3C4ZA 1JKTA 3KVWA 5AP6A 2OZUA 4JX3A 4FEUA 4BIDA 4E26A 4IX3A 4H36A 3VF9A 1OKYA 1G4DA 4BCMA 5KX8A 3F61A 4D1SA 3HMNA 4YBKA 2PQ8A 2WIHA 4EH8A 2H6CA 4R3RA 4ZJIA 3IC7A 4WO5A 2C6DA 3KEOA 4EJVA 3HTSB 3DBFA 4LGGA 3LQ8A 2J2IB 2QR7A 1V0BA 3C0HA 1OPLA 3D0SA 3UVPA 3QZGA 3V8JA 1ODDA 4F9BA 3U9CA 2MA3A 1XMAA 5FTQA 2NNNA 5HCXA 3GP0A 3FZ1A 2EA2A 2ITQA 5M4IA 3R8VA 3FX3A 2PVFA 3A8WA 2XAJA 4I5MA 4G3DA 4QO9A 1OECA 1SFEA 1A06A 5K3YA 4BKJA 5L2IA 4DEIA 1F9NA 1YO5C 1KSWA 4E20A 4JR7A 2VWUA 4O7RA 5FFZA 4JR3A 3L8VA 4BHNA 3LJ0A 4L9NA 5BPYA 1O6LA 3BJAA 3KP2A 2H09A 4M74A 3AQVA 3SQNA 1W5TA 4HQMA 2GNHA 3N9XA 2C6LA 5E8YA 3CDHA 3VQHA 2QZ8A 3KP3A 2PUPA 2RVCA 5CSHA 3KRJA 4FSZA 3ZU7A 3R1QA 2XYUA 2XNPA 3I79A 4C8BA 1BKXA 1OKWA 3WTWC 2VNYA 4X3JA 4G7HF 2PVNA 2RG6A 4EHEA 3KF7A 1BL7A 2I40A 1WKMA 2I7QA 3JR1A 3SG8A 5AP2A 4D2TA 4YSMA 4USDA 2PVYA 1FINA 4I22A 5L8LA 3ZC5A 4RPVA 1PXIA 3RGFA 5KMMA 5BQ0A 4PTEA 4LUEA 4FG9A 5D8LB 3MGYA 3D0EA 3EQIA 3GCUA 1NW1A 4TN6A 4HDVA 4FV2A 5BVKA 4HV5A 2W0JA 5A3XA 2BZIB 1Z9CA 3I60A 4UXNA 3VEPA 3GU4A 3SRVA 5HESA 4H3PA 5CQUA 4A6DA 4BTKA 2DQRA 3BE9A 1PHKA 4GGGA 3L8SA 4O0YA 4DHFA 2WHBA 4IM0A 3K3IA 2VE9A 5BNJA 2VU3A 5TJJA 5HO7A 2VO6A 4C0TA 4CYDA 4GG5A 4C4IA 5HVQC 4DINA 4TNDA 2WEVA 2WIPA 4O1OA 2QU6A 4CQGA 4BDBA 4QMUA 3SXYA 3HRMA 4LV5A 5F94A 4YU2A 2OH0E 5IA0A 5AJQA 5L4QA 3R6SA 3QPHA 3PA5A 1MJBA 1TQPA 1V4RA 4F1MA 4TYIA 3NMUF 2ZB1A 4IAAA 1QZZA 2ZM1A 3P7NA 2UUEA 3OOMA 3TN8A 4UZDA 3W2RA 4O91A 3OG7A 5E92A 3R9RA 4RGUA 2X8EA 3L9FA 4FV0A 3PZEA 3R8MA 3LAPA 3EYYA 3THBA 3WF5A 3T5XA 4XBFA 3OEFX 2YLEA 2HELA 2F4JA 1ZGAA 1Q8UA 2BIYA 2R3NA 2FBHA 3EKNA 3S00A 4W4YA 2FMYA 3EB0A 3FM3A 4J53A 4G6QA 5FUTA 2YX7A 3BGQA 4KFCA 3DFAA 2ISYA 3TO6A 1REJA 1TNTA 3KXNA 1CMKE 3LW0A 1XGNA 2Y48A 4GIIA 3ZMZA 3DCVA 4DNCA 5L2QA 2YM3A 4NTSA 3MFUA 4FTQA 5C1QB 3V7SA 1YTYA 4JAIA 3WGHA 2YA9A 2QO9A 4JQ7A 4TL0A 1XSVA 1V3FA 4FT7A 5IQGA 4ZSGA 4CFUA 3C0IA 4WG5A 1XDSA 4I0AA 4JK1X 3HHHA 3QD4A 4UUVA 2JAMA 5AP1A 4KICA 5DEYA 5FD2A 3A4OX 4QQCA 4BICA 4C59A 3PVWA 4YHFA 4EH6A 4EJUA 5D7AA 4TWPA 2RKHA 4IM3A 3UZRA 3KRLA 4ALUA 2XEYA 4P90A 4EUUA 4AGUA 4I0BA 4KAOA 4RAZA 3C4FA 5FLXZ 2B9JA 3TCPA 5IDNA 3NVMB 3NEWA 4JDIA 4M3QA 2ERZE 2GFCA 2BAJA 4W9WA 2GWRA 2FSWA 5M06A 3SV0A 1E2XA 5HS9A 1CF7B 3GFLA 4IAKA 1T46A 3BKBA 4FE2A 1XCBA 3JUHA 4ZIMA 2YIWA 4JLCA 5IH5A 3O0GA 4E5BA 4W8EA 3DBDA 3QOPA 3MY5A 4L6QA 3BYMA 4OU0A 1X8BA 3JSPA 1G3YA 4U3ZA 3GQIA 3SGCA 1FBNA 4F6SA 1YDSE 3FI3A 5F64A 3NDMA 3PPKA 4ANBA 3I5NA 3LM5A 2M45A 4M6YA 5E8SA 2PBIA 3O8TA 1DAYA 4TKSA 4RWIA 3GU6A 3WF6A 3ZBFA 2C6EA 3BPVA 4F9WA 3WTTC 4N9HA 2QUFA 3FWQA 4ITIA 3K1PA 2RV8A 2JDOA 2C3LA 4O2ZA 4FT8A 1UVRA 5I5ZA 5HX6A 1L3RE 5DRDA 2XB7A 2UW6A 4BQAA 2J0KA 2M1BA 2A61A 5M44A 3DA6A 3TO9A 3U51A 4AE6A 1TW2A 3D4QA 3O8UA 4YSJA 4ZMEA 2HFHA 4H1JA 3FL4A 4RGSA 4WOVA 1IXSB 3ENHA 2KULA 2PZ5A 2FBKA 3QC4A 2HW7A 3V01A 4HAMA 2XAQA 2VTSA 5C01A 2BBYA 1FP2A 4CKRA 4R78A 3QUEA 3GVUA 1LVAA 1T0FA 4MTEA 2QQAA 4EBVA 1LQ1A 1J3HA 1DAWA 3NW6A 3C18A 5FG8A 4EH3A 3KXZA 4I0SA 4HV6A 3B8QA 4FODA 1Q99A 1WBVA 2GQGA 5EKOA 1U5TC 2RNJA 3UQFA 1Q61A 5CVGA 1Z57A 3I7BA 4F70A 5FFXA 1SFUA 1H26A 3SHEA 4XLPF 2OU2A 4PPBA 4YFKF 5A14A 4MQ2A 3RM7A 4D9UA 3KLOA 3WU0A 2OJ9A 2EXMA 4ZY6A 3W8LA 5IA2A 4EK3A 3TKHA 3ZMVA 3A7JA 5EHOA 4TW9A 3Q9VA 2VTIA 4P9UA 2Z3YA 3FSFA 4HZRA 1EH8A 5DE2A 3LCTA 2G1TA 4IVCA 1FVTA 5KHWA 2Y6OA 4WNMA 2F5EA 3OXIA 4HF1A 3HTUA 5IMXA 4NL0A 5TR6A 2OF2A 3MJ2A 2BALA 4XRLA 4WXDA 2J4ZA 2PMHA 4CO8A 3QYZA 1W7HA 2X2MA 2WV0A 3GI3A 3QALE 4LG0B 1YDRE 1UCRA 1HSTA 3FL5A 4RIOA 2GFSA 4CTBA 4OTHA 3E6MA 5KUPA 4H05A 1BJAA 2DUVA 2OFUA 1ZRZA 2OU7A 4MXAA 3CSVA 1OUYA 1JWHA 1MRUA 3W16A 4IWOA 4BDKA 3EZVA 3MJ1A 3M9AA 2DLLA 3EMGA 1U59A 5K5NA 5LVNA 2FYSA 2VC0A 3VB2A 4PL3A 3HYHA 3HA6A 2XRNA 2IG7A 3R1SA 5J8FA 4Z2YA 1SNXA 1U5RA 5E1ZB 2A68F 2YM6A 4NZWB 3LJ1A 3MWUA 3B73A 2HZ4A 4ITHA 4NJ3A 3DQWA 4I6BA 4DG0E 3TV7A 4FMQA 3OP5A 4EC8A 2ITNA 5EYKA 4ZOGA 5AV3A 1ZY4A 3UOLA 4Q5EA 1O7FA 5HTIA 2BUJA 4AXAA 4FSTA 3CCNA 1HW5A 3UQGA 3JYAA 1T39A 2C1BA 1PXLA 3ZO4A 1SD5A 4TRLA 1B6CB 4O0UA 2ZYBA 3QCXA 2IPQX 5H20A 2V5QA 4ZJJA 2PEXA 2RIOA 4O6JA 2OJGA 4EZ3A 2AC5A 3MFTA 2CSOA 3FMKA 3AC1A 4AW5A 2X4FA 3IK3A 1UV5A 4JG8A 1K9AA 3FXZA 1O57A 3RK9A 3CQUA 4DTBA 3FV8A 3UJGA 3CTAA 3GT8A 4YBJA 5IQDA 3Q9XA 4L9TA 3PE1A 2YIXA 4BY9E 5LWMA 3CPBA 4U41A 4F0GA 2XNMA 4XSZF 4II5A 2ELHA 5EEHA 3DJ6A 4CRLA 1WQ2A 2ZKZA 4D5KA 4CHUA 3MB7A 3GC0A 1VJYA 5AM6A 5CANA 3U9NA 3ERED 4R77A 3ULQB 3V5WA 4BF2A 4W4XA 3F88A 5AX9A 2OWBA 2VTJA 4MX9A 4I3ZA 2YM4A 3LAJA 2QYOA 2YHVA 4YZMA 2ERKA 2HZNA 1WBWA 1OMWA 3M2WA 5HDKA 3U6IA 1M7NA 3TIZA 2Z5UA 3ZLSA 5DFPA 4HVSA 4L7FA 3TTJA 3HECA 3FY2A 5I9VA 5ICGA 4MNUA 3T0YA 3TV6A 2LKPA 2R3SA 3QF9A 4I5PA 3F3TA 3NYNA 1Y57A 4I4FA 4XP3A 1GY3A 3ZSGA 3ZM4A 5AUWA 4X0MA 4FKPA 4A2UA 4O6LA 4EBWA 2WFYA 1T45A 2LNBA 3CJNA 4OOIA 4EC9A 1XKKA 4X3FB 2BILB 5CTPA 3BHHA 1YHVA 4IE9A 5CWZA 5HIBA 4L5JA 2YX4A 4GK4A 4LRKA 5KMIA 3C1DA 2HTSA 2WMRA 2MH9A 4UXLA 3IWZA 3OY3A 2Q2EA 4L9VA 3MIAA 5D6EA 2BVAA 4A5NA 5DCFA 4DA5A 2X0LA 2QOBA 4UXQA 2Z7QA 3ZS5A 5DDGA 5L2WA 4FKLA 5CNOA 5M57A 4FKGA 3AAFA 3O2MA 2VV9A 3MV5A 5H9BA 5D12A 3ANQA 3H9RA 5AWMA 5EHYA 3EQGA 4FSNA 3HNGA 4HPUE 4RVLA 1FLIA 3AT4A 4AT4A 3CXWA 2IZRA 2PVMA 3LQRA 4BVUA 5IA1A 3V7RA 4FL1A 3WF7A 3KE2A 2EWNA 5AR5A 4F08A 1FGIA 4MXYA 5HVYA 3Q5FA 3JSOA 3LCSA 4UYNA 3AMAA 5HG9A 3P7AA 1QPEA 1K6OA 4PWNA 1TQMA 3TM0A 3ORNA 1JSUA 3RZFA 1MRYA 1YHWA 3UVRA 3E6DA 4HCVA 3R7UA 4XJ0A 2UZKA 4IHTA 4U81A 3WIGA 3QQUA 4PP9A 3EOCA 4RB2C 5GJDA 4NW6A 4L7SA 3GGFA 3BOQA 2R7IA 4M97A 2ZM3A 1YW2A 4JRNA 1DDNA 3QQLA 2XMYA 3IQ7A 3FE3A 3HOSA 1KQ9A 1DM2A 5E8VA 3MDYA 3P1AA 4D4VA 3GNIB 3MVLA 3DPLC 1OYYA 2F49A 2PI0A 4DGOA 2C5XA 4XG4A 2YJRA 5A6OA 1B38A 5A46A 1OIRA 5HDGA 4FT9A 2J51A 4I02A 4NIFA 3AD6A 5DMZA 5L8JA 4B6LA 1ONVA 4JOAA 3TG1A 2QBYA 2HYYA 3P08A 4RGXA 1XWSA 2ZAZA 4PNIA 3SD0A 2V7AA 3GFWA 2CCIA 4ANLA 4PNKA 3PFIA 1D8KA 3NUUA 4PL4A 1WBTA 2MC3A 4DFNA 2JC6A 1HCLA 4DC2A 3QTWA 3WARA 3KB7A 4A9SA 1OIYA 1WBOA 3DXPA 2CW0F 4GT3A 4NEUA 2BROA 3MYGA 3MPTA 4G7ZF 2ZDUA 1OYWA 2CKEA 2HY81 4Y5HA 3SXSA 3TIYA 2QCSA 4HVIA 4A0YA 2PN6A 5JGAA 1OL2A 1UFMA 1KU2A 3HGKA 5EEGA 5E8XA 3CY3A 3PA4A 4IQ6A 2KIFA 4LI5A 5KKRB 1Y8GA 2CLQA 4MXOA 5KO1A 1QQIA 3HRFA 1ZG5A 1FOKA 2HK5A 4E6DA 4OTWA 4AVPA 2WTEA 2J50A 3CS9A 1PKDA 4ZYDA 3PE2A 4FHTA 3QRIA 5DIAA 5FGMA 3AGLA 5CVJA 4QQ5A 3T8OA 4FKTA 3DB8A 5BPDA 4G9CA 3R28A 3OC1A 2W84A 4BWXA 4F7NA 5BVNA 5DUKA 1R1UA 5ETFA 3LM0A 4RX7A 3H30A 1BL6A 1OZ1A 4CD0A 3BJ6A 5C27A 4J95A 1XJDA 4Y8DA 2YACA 2I6LA 4LRMA 4BXUA 2CGVA 3ZRKA 4OIRF 2WQNA 3C7JA 3NEUA 3OHTA 1YXVA 4FV3A 2GCDA 4OTPA 3BLQA 5L8KA 6PAXA 4WUAA 4O86A 2RFDA 5C03A 2V55A 4HCUA 4AA5A 3BEAA 5I4NA 2UVYA 3NYXA 4LLNA 3BCEA 5GZ8A 4ZTQA 1S3JA 3P78A 3TNPC 5LRSA 3QD3A 1BX6A 2E7XA 4RZVA 4ZLYA 1PXKA 1O6YA 2W57A 1XN7A 3T9IA 1XH8A 2GS7A 1JKKA 5AR8A 4PPAA 5DVRA 5JFWA 4F0IA 2C3JA 2HY0A 1PRYA 3DV8A 4IEBA 4O0WA 1LDKB 5LWNA 4ASZA 3PDTA 4FV8A 1Y6BA 3NWWA 5GNKA 3SXFA 3Q52A 1PMNA 4GSBA 5EKNA 2FO0A 4RA4A 2PJPA 4NSTA 4MQVA 1CKPA 4X21A 4FZFB 4RLLA 1PXMA 3DEUA 2X2LA 3LVPA 5A4CA 2W06A 4DH5A 2ZMEA 3HEGA 2WWYA 4HBLA 1OPCA 1WI9A 2QOOA 1ZY5A 4ZZLA 4IAZA 2ESMA 3CUOA 2JTVA 4A9YA 3SRVB 1ZYDA 5LQFA 1REKA 3QQHA 1H0VA 4ERWA 4Y5QA 4EOQA 5CAPA 3EHAA 5AA8A 4WF2A 4BDCA 2IW9A 4QOXA 3QQKA 4JBQA 4S33A 1R00A 4CICA 2FMLA 2XBAA 3ZMMA 1IUYA 3MZHA 2VC1A 4GFOA 4WXCA 4F64A 1YXTA 3VUMA 4C3PA 5E8UA 1OM1A 1LEBA 5CSPA 3U54A 3J81K 4FA2A 3W33A 5L2SA 5BMMA 2P5LC 1OR7A 3DFGA 3V8LA 2GAUA 4A9TA 4CTCA 4L42A 1O9UA 1XH4A 3N4UA 3JVRA 1FBQA 3I6UA 2WMXA 5HQ0A 1H07A 2A5YB 4X2NA 5EQPA 2UXNA 5HD4A 1F3MC 3LFQA 4CMTA 3ATSA 2R0UA 3ROYA 4MXZA 4IXAA 2HWPA 2EJRA 3BYUA 5CF8A 3MIYA 3TZ8A 1KQ8A 4L18B 1IRGA 1R0PA 3QRTA 3CJFA 4BDJA 1OYIA 3COKA 5J1WA 1ZYLA 3CKWA 3NUNA 2XK8A 4XP0A 3K0LA 1FYKA 1VYWA 2ZM4A 2OICA 2CGWA 4AZSA 1SD7A 4ZLZA 3BU6A 4MWHA 5AA9A 3E64A 2PVHA 3E5AA 4FNWA 3FMRA 2FSMX 1G3TA 5LHIA 2L4AA 3WZEA 4YUQA 3DZQA 2ZJ2A 3KETA 2UXXA 2M5WA 4J97A 3LCKA 4I6QA 4YZCA 4F9AA 3NUPA 1I5ZA 5HIDA 3EFWA 2RFEA 4LK0F 3LMGA 5L3AA 2BR1A 1Y91A 2XKDA 3S1HA 4AIHA 4KYWA 5BUEA 2XAGA 5HS8A 4QPMA 4MBJA 5ETIA 4Y72A 3HRBA 2R3LA 5D5XB 3SC1A 1L3LA 5L3DA 1PYEA 5LCJA 4S32A 3ZQ7A 4CNHA 4KIKB 4LRJA 2H8HA 4QWQA 3ZZEA 4WSQA 2NAZA 5E91A 4LL5A 4USFA 3G0EA 3HUGA 5FXQA 4ASXA 3HSFA 2X2KA 2O0UA 3O23A 5EYDA 3OFMA 2FB8A 3BQRA 3ZN0A 3O7LD 4E5AX 3QXOA 2QLZA 5J8IA 4M68A 3RPRA 4C35A 5AP5A 1D3YA 3JXWA 3TWJA 4RIYA 3VS7A 4AZFA 5ETAA 1Q8YA 1XO2B 5FXRA 4LQMA 4YMJA 5HG5A 5CEQA 2YN8A 4PV0A 2VBYA 4ARKA 4FV7A 4N6YA 2L54A 2PWLA 4UNOA 2XRUA 3OWKA 3DLZA 1XH7A 5H2UA 2PUNA 1KE6A 2VGOA 3E3VA 3RK7A 3UNKA 2EV6A 4MAOA 4YLKA 2Y8OA 4EI4A 3C4WA 1H24A 4EM1A 4YJPA 3NQOA 2WTDA 4X2JA 4E4NA 4OBOA 4F4PA 3I0QA 1BI3A 2OJJA 3PSCA 3P9CA 4C4GA 2XIKA 3GENA 1AWCA 2DT5A 4AD9A 2DO7A 3WTSC 5LCKA 1XH9A 4IJPA 2CG4A 4YURA 4EK4A 2W1GA 3PPJA 5J9LA 4O83A 2X4HA 1A9UA 2OI4X 2VWVA 2KJBA 5HLPA 4ENKA 4NJDA 2O3FA 4PCQA 4QYFA 3U9GA 3HUCA 2K7LA 3CGOA 4V0GB 3LSTA 1L8TA 3F8FA 4XHKB 2F2UA 2RN7A 3L09A 3HMMA 3K2ZA 3MVMA 4R6VA 4EONA 3VBVA 3PXZA 4ZP5A 4AF3A 3QYWA 1R58A 4YP8A 5HZNA 4G3CA 3UIXA 1OPKA 1H0MA 2KIMA 4YFNF 1W4MA 5I0BA 3H0YA 4TWCA 3RI1A 2W1IA 3V04A 1ZOHA 2BCJA 4FSWA 4IADA 3OBJA 5AM7A 4YGAA 3HRCA 4S30A 2WTVA 5HEZA 3V51A 4FKRA 3NIEA 5H6RA 4L9IA 1K78A 3TNIA 1XSXA 2HQNA 3F3XA 3C5UA 4GJ2A 4KKEA 3VIDA 1BM9A 4JQFA 4BTFA 2QM3A 2XK3A 3ZFYA 4OTQA 4ESBA 2OF4A 4Y73A 3VRYA 4ZXTA 2HENA 3E6CC 1H1RA 3MWMA 2UZUE 5IQHA 2PVKA 4EGYA 3UNZA 3VS3A 3QRKA 1IZ1A 2VTOA 3SW7A 3ZDIA 1GHCA 3R61A 4FX4A 2BMCA 4CZZA 4CXFA 1B39A 4GYIA 4J96A 5AAGA 4N0BA 5JKGA 4S05A 3COHA 2CCHA 2DW4A 3PTGA 3DBCA 3A62A 3SAYA 5GZAA 3TTIA 3C13A 4CT1A 3BWJA 5CEKA 3TDUC 4C4JA 2IO6A 5IEXA 1H25A 1S9IA 4BDHA 3HAMA 1KOAA 3OWLA 3WTZA 5IA3A 3E7VA 1P2AA 2O2UA 2UWMA 1USSA 3I54A 2Y0AA 2OGVA 4YHTA 5EOBA 3ZXZA 3OW4A 1J7UA 3H10A 2JDSA 1ZOGA 3VQUA 4FSRA 4YIFA 4Q9ZA 2WD1A 4P5OA 1BI8A 3A7IA 5BOXA 2FUMA 2R7FA 2V1XA 4W4WA 1PKGA 4EGZA 3EL7A 3OEZA 5IQIA 2VO7A 4DTKA 4JT3A 4N57A 2OLCA 4Z16A 5J87A 5CZIA 4X7QA 3IKAA 3I7CA 4TYGA 2KIUA 4XS2A 2PY3A 4APPA 4AIKA 4NFNA 1DP7P 4KIGA 4DGMA 4O7ZA 2QOFA 4FSUA 4LG4A 4BYIA 3ATTA 3HV4A 4ZTRA 3REOA 4I5HA 4FGBA 2HQRA 3Q9ZA 4ANMA 2QKRA 1J1CA 5CVVA 5CI7A 4IXPA 5CY3A 4GCVA 2B4SB 4V05A 2IN6A 4C36A 1YOMA 1REPC 3K5VA 3PXQA 4FTAA 4ACMA 4IDTA 5DNRA 5HIEA 4QPAA 2XKFA 4BCHA 4J99A 3CQWA 1OKRA 1O3QA 5LXMA 4ZEGA 3R1NA 3NNUA 4OTRA 4RB0A 1DUXC 4O0XA 3B2TA 4XBRA 3LFFA 1I1SA 2ITWA 5GHVA 5D10A 4DT9A 5HTCA 5M09A 5D9HA 3FI8A 2BAKA 4M67A 4E93A 2OH4A 4NB5A 1WMKA 3IDBA 2ITXA 4IIRA 5HHWA 2QD9A 2NYXA 3ZFXA 3V5JA 2ONLC 3MTFA 3FI2A 3TO7A 4J1RA 1FMKA 3OWJA 4X6RA 4EQUA 5J7HA 3QXPA 3PWYA 1ZREA 3CO6C 3R9NA 1KYWA 3GW2A 3G6GA 4BBEA 4ZTMA 3TDZC 5DBXA 4L01A 3ORKA 4BWPA 2GNGA 2AXLA 2ZBKA 2UZNA 2W4OA 4D4YA 4LGWA 2Q0BA 4FR4A 1R78A 3Q9WA 2L01A 1NA7A 5E9EA 3P0MA 3SXRA 3LA2A 3BI6A 4V0GA 2ISZA 2VNWA 5D4SA 4X2GA 2X9EA 4KA3A 1KE5A 2UZTA 3VBYA 4GUBA 4L5IA 4IC8A 5IH4A 3TUCA 2O64A 3M42A 3TL8A 4NTTA 5EQEA 3HV3A 3WGGA 4OTFA 4QMQA 4DEDA 4N0SA 4H1MA 1GAGA 2FNAA 3EQDA 5F1ZA 3GBZA 5EDPA 3WZDA 4E6CA 2BE5F 1HBXG 4RC2A 3ZO2A 3DQXA 2IVUA 5HNIX 4BIEA 2IRFG 5LOHA 2QR8A 1JQHA 3R01A 4ALWA 1U5TB 2A27A 3QCSA 1IXRC 5LVMA 3E7OA 2CPKE 1Z05A 4FYNA 2DPUA 2PHKA 4LOOA 1XBBA 5K1YA 3HRUA 3M11A 4M73A 3UODA 2L4MA 1JHFA 2HZ0A 4JG7A 4YO4A 4WUNA 4D1XA 1CTPE 3R7GA 1O3RA 4LGHA 3FEGA 3E63A 3U1DA 4FIIA 4EK6A 3TNWA 4JI9A 4F7ZA 1HSJA 3V8TA 3E8NA 3WF8A 4LFUA 3TJCA 4U7BA 5JSMA 4RIYB 4L0ZB 4CEGA 2HOGA 2IVTA 1IN8A 3KP6A 3FDNA 4OAUC 3QL8A 4YZ9A 5L3FA 2PSQA 2DAOA 2VOPA 2JPCA 1K79A 2UZWE 3ZM9A 3ZSIA 3ZZWA 2PULA 4B4LA 2O0YA 2OXXA 4YJUA 4B9DA 1KYZA 4IJ9A 3FLWA 2R7BA 4EV0A 4JBPA 3IKVA 2WZJA 5C8NA 4GVAA 2OZOA 2MBFA 1PMUA 5K5RA 3QX4A 3UP7A 1KA8A 4XSXF 3OCTA 4FSMA 2QC6A 3D2IA 2CJMA 4BTJA 1OGUA 4W8DA 5J5SA 5EW3A 4FZ6A 3R00A 3KXGA 2GU8A 3PYYA 1YW8A 3MAJA 4IZ5A 4DLJA 4FNXA 4WG3A 3A7HA 2VN2A 4ENYA 1TVOA 3QLFA 2VTHA 4DITA 3UYTA 3Q60A 2XJ1A 4MHAA 3EFLA 2YWVA 3RHXA 4LB6B 5AUTA 2HWVA 3DS6A 2D2WA 4IRHA 5BYYA 1RZ4A 3O50A 1ZMWA 5HLHA 1SFXA 1ERKA 4QTAA 2XIZA 3R7VA 4PMPA 4GKHA 2C3KA 3F6VA 3OTUA 3RWQA 4BDAA 5CU6A 4NM3A 3C1XA 2IW5A 1BIBA 3PJ1A 3OCSA 4ZS0A 3D7ZA 3CO7C 5A2QK 3TZMA 5CF6A 5JI6A 3LFDA 4OIPF 4XG7A 4RBLA 3HAVA 2YZLA 5DD4A 3A60A 3D7TB 4GG7A 3FMHA 4ESFA 3PIYA 2UW5A 2FVDA 4QP9A 3QD2B 4EOLA 3R4KA 2QHMA 1HKSA 5KZ0A 4CV8A 3CGFA 3FC2A 3UZTA 4YJVA 2CKQA 3Q5ZA 3E62A 5AIRA 5EHLA 4AN9A 2FNPA 3DJ7A 4OIOF 3RINA 3Q5IA 4BCFA 1BMKA 4IB3A 4D0XA 1MZBA 2BRGA 2YERA 4XNEA 2FRHA 3EDPA 3RBWA 3OCBA 3ODZX 2IW6A 3MESA 4RC4A 4FV6A 4G34A 2WTIA 3KREA 5B7VA 4M6XA 1ZWSA 4C57A 1YLFA 4CDGA 2OKRA 4I21A 3Q4TA 2W7XA 2JIUA 2XJ2A 3FLNC 4U8ZA 2P2HA 4ZYEA 3TNQB 3KRWA 2C6TA 3R1YA 2C0IA 4RS8A 4ZZDA 3WG9A 4YFXF 3TGNA 2ZV2A 4L46A 5ICFA 2Y6MA 4QMTA 3UNJA 1HXDA 4GV1A 4ACGA 3ZC6A 2EUFB 2ZDTA 2W1DA 1HQCA 1T6SA 3S2WA 1Z91A 3NCGA 3ZBXA 4WBBB 3WOWA 4HNFA 5FM3A 1OPJA 3VBTA 4G9YA 3UDBA 4F63A 2O8XA 2QENA 2IVSA 3EYHA 2E9VA 2GS6A 3M1SA 3QAME 3R2YA 1F4KA 3I4BA 4UALA 1JOWB 1LP4A 5JRSA 2R2PA 2XM8A 2G01A 2VTTA 2V9VA 2V22A 4EM0B 4QMPA 4FIEA 5D8KB 2YSRA 4O7LA 3F8NA 3IDCA 4WT6A 4OLIA 4CCBA 4O1PA 3MY0A 2R4BA 4LK1F 4MH7A 4OBPA 2YZAA 3NRVA 3K3JA 2PMLX 3MPAA 4IDVA 4AFJA 2ADUA 2JAVA 5JZJA 4LFIA 2C3IB 2W4KA 4RWJA 3W1FA 4NHJA 3K1MA 1P14A 3L1SA 2F5FA 3F72A 1M2QA 4Y83A 1SNUA 4R79A 1OL5A 3KULB 1EH6A 2E9UA 1SMHA 5HLIA 5M4CA 5ED4A 1AQ1A 2WTWA 2ZMDA 2BZKB 2ESNA 5I9XA 3ID6C 4M66A 1G3SA 1YYVA 2C5YA 4IMYA 3BGPA 1IN6A 2JSCA 4NCTA 3D5UA 4MNEB 4O7TA 3QLGA 4L43A 2R3QA 5ICEA 3PLAE 3LWFA 4HX4A 4I94A 1R22A 2J7TA 4GH2A 1YFHA 3K2LA 1SMYF 4KS8A 4HCTA 2XA4A 1J7IA 3RJPA 4R7HA 4QYEA 4U80A 1WVWA 4LLGF 1TW3A 2UV2A 3W6JB 4A0ZA 3R60A 4NK9A 2FSLX 3RIRA 1H9TA 2C5OA 2YLFA 2DWBA 3C9WA 3QWJA 4RRVA 3UC4A 4CMUA 5FEQA 1UU8A 3F2AA 5CEMA 2ITYA 3AXWA 3FMEA 3PXKA 3FMQA 2CGPA 1V0OA 4KSQA 5L6OA 2GNLA 4A07A 1JGSA 2QVSE 1BC8C 4IZYA 3LFBA 3DLSA 1MUOA 2OZ6A 5D5WB 4QYHA 4IVBA 3P4KA 2LF8A 3DQVC 4M72A 3VNTA 5C9CA 1RI7A 3MFSA 2R3IA 4AGWA 4FX0A 2A0CX 3CTJA 3H0ZA 2QOLA 4EK5A 4U0VA 5E8GA 3KULA 3W10A 3IRQA 4P2KA 5D41A 1FBSA 1H1PA 4L0YB 3RMFA 4HZSA 4S34A 3L9MA 3VHKA 5JHUA 4YTHA 2XS0A 2XASA 3ML6A 2YIRA 1Q8TA 4XG2A 2EXEA 2JKKA 3GWZA 2Y4IB 3VC4A 3Q2JA 3NYOA 2BV6A 2LSOA 1ZRFA 4GS6A 5CAUA 5JH6A 2XIGA 3EJ1A 4QD6A 2CNUA 3ZO1A 2H6BA 5IH6A 1MJAA 5BVFA 4JX7A 4E5WA 2GNIA 4PDPA 2YPRA 3SQQA 4GFMA 5AR4A 3PPZA 4JBVA 1R1VA 4BDGA 2A3SA 3HRSA 3ITZA 2GQSA 5IISA 3CIKA 3COIA 4CZYB 1E1XA 4UMTA 5M53A 1MP8A 3R30A 4FTIA 2R64A 3FMNA 4EH2A 3BV3A 3GC9A 4AQCA 2K27A 2IW8A 4B0GA 3D94A 3ZCLA 1UWJA 3O6BB 4KSPA 3UYSA 2DPDA 3GO5A 4BC6A 5DWRA 3HUBA 5H8BA 4DGGA 3EL8A 2GMXA 4XLNF 4V04A 3I5UA 1MGTA 3ELJA 1KV2A 1VTNC 4TZRA 4O7SA 4ASNA 5LMBA 5DEQA 4EOIA 4FZDB 5CI6A 3VOEA 1I6XA 1EV7A 3LMHA 4KRDA 5CF4A 3RWPA 1P4XA 3FY0A 2X81A 4BNCA 5AUVA 3RAKA 1S29A 1UA2A 2XNNA 3MH3A 5EI6A 4ON0A 3V5TA 4LM5A 4D2SA 4TYEA 4AG8A 2EK5A 4M7IA 5EW8A 4MXCA 3E93A 2RGPA 3EQCA 4MQ1A 5AP4A 3KXHA 2IA1A 4C7TA 1PYXA 5E4HA 4FT3A 5CXHA 2WAJA 1HW1A 3ALOA 3QCQA 3OZ6A 1PJKA 3BIZA 4M69B 4DFZE 4EVIA 4LMYA 3BU5A 3GEZA 4NYEA 4QMWA 1Q8ZA 2O6GE 4KDPA 1STCE 4BN1A 3U55A 1E1VA 1M52A 3PWDA 3P7BA 4ZTLA 3D2KA 3FXQA 4MXXA 4FTTA 3HDMA 2VBXA 2FGIA 5FDPA 4IWPA 3REPA 1U8RA 1KE7A 5DLSA 5CAOA 5IEYA 5BVWA 5KE0A 4MEDA 2GA1A 1I44A 3OWPA 3R9DA 2PVJA 4JXFA 2VTRA 3FWEA 2HEOA 3I59B 1W0XC 1Z5MA 3CR0A 3FHIA 3BU3A 3VUHA 4U40A 5CJ9A 3FZPA 4KN7X 2PMUA 4IWQA 4PRJA 4PGGA 4L53A 3BBTB 2YIYA 4CYJA 4LLLA 3SKCA 4DEAA 2VX1A 1P4AA 4TYJA 3C5IA 2YAAA 5IQAA 3CLYA 2C0OA 2W85A 4FX3A 5CASA 3KKVA 1HKTA 4H3BA 1MKMA 4A9UA 1JBPE 2BRHA 2UZDA 1Z7UA 4BH9A 5LMKA 3R9OA 1QL6A 3I53A 1R5GA 3KXXA 4IM2A 2XV4S 4XH6A 2HS5A 1LNWA 2WGJA 2XNOA 5AUXA 4OT5A 3TZ7A 3KRXA 4BCGA 4ENXA 4EYMA 1UU9A 2ZV9A 1HCKA 4D1ZA 1BIAA 2QOHA 4IRGA 3G5DA 3DDQA 1X3UA 1YHSA 3DK6A 5I3OA 3ZDUA 4RSSA 4DYMA 3QP5A 4I0RA 2OJFE 4MBLA 5L3CA 4F7LA 2B9IA 4UMUA 3OBGA 2BYVE 2PE1A 4ZH4F 2YISA 2X7FA 3C7QA 5HD7A 4D4RA 4MEXF 4MF1A 4ZY5A 3QUPA 3DNDA 3A8XA 1WSUA 5DRBA 4C3FA 2ZO4A 5AUYA 4IZAA 2PE0A 4ORKA 3RKBA 2XJ0A 3LKMA 2OZAA 5BVEA 1XD7A 4KKHA 3OOGA 3R7EA 4RGRA 4D0WA 2P5KA 3VUGA 3BYVA 1BC7C 4HF0A 2ITPA 2C5NA 3W2OA 1H27A 2YFXA 2OIQA 4P7EA 3WTUC 3HV6A 4M9XA 3ZEWA 4EQMA 1OB3A 5HG8A 5IDPA 2VX0A 2OBPA 3LFCA 1DI9A 3NR9A 1Q41A 4E4LA 1I1GA 4PTCA 4CYIA 1SZMA 2J0JA 5DGZA 1QPMA 5IA5A 3CEKA 2OD5A 4HW7A 2ITOA 5L3BA 4OMZA 3FQEA 4PPCA 2FA5A 4UX9A 5FXSA 3EH9A 3T1BA 4ZSJA 5JN2A 1ZG3A 2W1CA 5F6FA 4DFUA 4CSVA 3F2RA 1GXQA 2QVOA 3OUNB 5FP6A 3BYOA 3GFIA 4R5SA 4RIXA 4H39A 1Q5KA 4D9TA 2NNYA 3ZRLA 4G7OF 1G6NA 4X3FC 4X2FA 4M71A 1H1QA 2C1AA 2ZB0A 4EKLA 4LJZF 2ITVA 4RFMA 3ROUA 2G7UA 1VEBA 2CO5A 4TWOA 1YKRA 3WZKA 3DKGA 4OMYA 5DR6A 1LJ9A 1WBSA 5KMKA 2OAZA 5CLPA 2H94A 4FZ7A 3FXUA 4J71A 3KFAA 5T68A 2NO3A 4AX8A 4RLKA 3NX8A 5HKMA 2EWAA 4BCOA 5D4RA 2IA0A 4MK0A 2GA2A 3ERKA 2GDOA 1YRPA 4RB1A 3V6RA 4N4SA 4FT0A 5E1XA 2F5DA 3GFEA 5HVKA 1H1SA 3HDNA 4RWKA 2C47A 5AIQA 3POOA 1VR2A 5FP5A 3PIZA 4QMLA 4UBAA 2QONA 3SVVA 2DU9A 2UW7A 4HVGA 3EQLF 4XMOA 4RIXB 3PP0A 1LEAA 1NVSA 1ZG1A 2MLGA 2UW0A 4UWCA 3TZ9A 1P4FA 2LAVA 4MF0A 5DI1A 2YDKA 2J9MA 3EFKA 3PXRA 1WVXA 4S2ZA 3RAIA 4R1YA 2BFYA 4J52A 3N4MA 3V4GA 2XVDA 2XIRA 1URCA 5J6XA 1WZYA 1H1WA 2Y9QA 4Q5SF 5HX8A 2Z99A 2HTJA 5E20A 5AFVA 3FQSA 3O71A 1YG2A 4G31A 5FO5A 3IS5A 3VS4A 2BTRA 3OROA 4HVDA 2CNVA 3JAMK 3GCSA 1UHMA 3AT2A 3IRRA 4AUAA 5IUHA 3M8FA 2WQMA 3GF2A 2RFSA 3CY2A 3W55A 1S7OA 4GL9A 4MTDA 4NH1A 4B99A 2HDCA 2I1MA 4UEUA 2NPQA 3ZUTA 4FVPA 3V5PA 1RIOH 3QHRA 3KZZA 3OF0A 4IFGA 4QP4A 3NW5A 1CDKA 4O0SA 1P6RA 3ROCA 5GIOE 1E9HA 2EB3A 1F5TA 3FXRA 3G2FA 3AMYA 2ITUA 1RE8A 1BUHA 4BGGA 5EH0A 3FMJA 4WSYA 2EFWA 3MBLA 2IVVA 2BEOA 2B53A 4HVHA 1UNLA 5J79A 1IW7F 1IA9A 2GXBA 2PE2A 2XNGA 3C50A 4WIHA 3HP5A 2UW9A 4XG6A 3NYVA 5JK3A 4U3YA 2V6CA 5KKRC 2P33A 3GC7A 3U6HA 4CT2A 2B0LA 1JXSA 1IXCA 2PVRA 2WU7A 4EHGA 3OS3A 4ANNA 5LEKA 3UZPA 3GOKA 3KCFA 2PUIA 3TV4A 2AS5F 4RX9A 2E9OA 4R1HA 2J5OA 4DH1A 2RF9A 4DEGA 5GIPE 2R3FA 2ACJA 3KF4A 2C6MA 2HW6A 3KU2A 4HQEA 1NVRA 3R2BA 3BHYA 5FEEA 3QU6A 1O7LA 4DT8A 5GJFA 3HV7A 3OTVA 4RZWA 1XB4A 4FIJA 4WCGA 4DGLC 4QP2A 4QP1A 2IA2A 1GNGA 3J80K 2UW3A 1R7JA 2QKWB 4G17A 2P3GX 3POZA 4ZY4A 2OFVA 4AN2A 1S8NA 4ZMFA 1QMZA 2PZPA 3DNEA 4OBQA 4I1ZA 5HE2A 3KLNA 2PZIA 3RNIA 2JT1A 3VBQA 3MTLA 3VULA 2QBYB 2CKPA 3E6BA 5A4LA 1UB9A 5AONA 3QHWA 3L9LA 2I0EA 3MZYA 4FTRA 1CSNA 1E17A 3CPCA 5C4LA 2VAGA 4YC8A 4XOZA 3T9TA 5ANGA 2W9FB 4CV9A 3UG2A 4IACA 2WB8A 4MGRA 4F9CA 3HVCA 2PLYA 4U7ZA 5EG3A 5LMKC 2OG8A 5AV2A 4P4CA 1U5QA 2VGPA 4I23A 1TNSA 4JDKA 3KA0A 2K86A 3NLBA 4QMZA 1MD0A 4F09A 4RFYA 1R23A 4BR3A 5DR9A 4HYEA 2IJLA 5LLQA 5KBQA 2PU8A 5M55A 4D28A 4U9AA 1Q24A 1XQZA 5K5XA 5CT7A 4EORA 5F95A 1J75A 1O3SA 1J0RA 4U43A 2B9FA 3A4PA 4Y13A 4XOYA 1YOJA 5BX0A 1W7PA 1PP8F 4AOIA 3RAWA 3QFVA 3VVHA 4YTCA 2O63A 2FQ3A 3ANRA 5FM2A 5IPJA 2LF7A 3D5WA 5DH3A 5AIKA 4C2VA 2BDWA 3MH2A 3SG9A 2KKOA 2F5CA 1W5SA 4O96A 5HBJA 1QNTA 4BCPA 2EB2A 3MSSA 3E88A 3I71A 4MD8E 3GZ6A 2H6DA 4JQ8A 3PVUA 2A2AA 3TKIA 1NHAA 3GVAA 3ORMA 4NKAA 2JFMA 4MKCA 3Q6UA 2QOCA 3NZ0A 3QKMA 3PXFA 4FL2A 3SZTA 4UB7A 1PW2A 3ZMSA 3BLRA 2COMA 4IAFA 2HOEA 3W32A 2Z7SA 4JG6A 1KWPA 4F1TA 3V8KA 3P5KA 2VWWA 1GZKA 3AC2A 3FHRA 5AR3A 3KY2A 4CMOA 3W2PA 1B1BA 3EN4A 2Y7JA 2BDFA 3MI9A 4UV9A 4HOBA 5DCMA 2H96A 3WE4A 3FMMA 4FEXA 4IHSA 3EYIA 3Q32A 3V8WA 4O7YA 3EZRA 2OSCA 1J91A 3I4PA 4QTBA 5JGDA 2WMVA 2ETHA 2XZSA 3R71A 3RALA 4A5MA 3KCCA 2C6IA 1FZPB 3OUKA 4FGRA 2JD5A 2G15A 3J80Z 4DEBA 5IU2A 2HGCA 2OO8X 2EA4A 4IC7A 2C6OA 2GZWA 4FKQA 3O2PE 4C58A 3NVKI 1YWVA 3FMLA 3EIDA 2YU3A 1TKIA 1XSDA 4RT7A 4RVTA 3JY9A 2P7VB 2WU6A 3OMVA 5K5QA 3FLSA 2VUWA 2CHLA 3AD4A 3RI4A 2JIVA 2XNBA 3ORLA 2QOKA 5CX9A 1IAWA 4OUCA 2KRFA 3ZH8A 3Q9SA 3JPVA 4KIPA 3GOPA 3UPXA 4CRSA 2JLDA 1CKJA 3UTOA 1A48A 5DN3A 3TKYA 2FH9A 1K2PA 4ENMA 5LHGA 1SYKA 3LFAA 4HOKA 1ZYRF 4WKQA 5CU3A 3WYXA 3VUTA 4TV7A 4XV9A 4JIKA 3U87A 2J0IA 2QU5A 5H8GA 5ANDA 2QNJA 1XCVA 2PPQA 3OVVA 4L52A 5TT7A 4G6LA 3WE2A 4FTCA 4G3GA 2WMWA 4HGTA 5HO8A 3R83A 4ESJA 2H27A 4FYOA 3VW8A 3PJ3A 1Z6TA 4ZSAA 4I7HA 3IOPA 1YVJA 4XBUA 2J5FA 5HE1A 3JS2A 5IQEA 2K4JA 5DYMA 4U42A 4O84A 4BBFA 4MYGA 3LXKA 3DP7A 3LAUA 5HICA 4KB8A 2BIKB 4EYJA 1B59A 5ANIA 5EI8A 2BAQA 4E8AA 2E7WA 4FTLA 4FK3A 1G3WA 3KEXA 3RVGA 3WTVC 1CGPA 5CALA 2V7OA 3NS9A 1ZLKA 2X6EA 3ORXA 2Z33A 2X1NA 3QTXA 4AZVA 1UWHA 3I1AA 4P5ZA 1S9JA 5CT0A 4C4FA 4ZYGA 4AW2A 5CYIA 2QLUA 2WQBA 5CU0A 2B7AA 1OIQA 3CD8A 1FBUA 2ZMEB 4TT7A 3TOBA 3R8LA 1YIOA 4RX8A 1PMEA 4AN3A 5AUUA 4RJ3A 2RC4A 4FG8A 4JQEA 3M1EA 3EQBA 2TDXA 2A6EF 4BI0A 4TY1A 4YO6A 3UO4A 5AV0A 1KV1A 2I0VA 1ZLTA 3ACKA 3NW7A 3G9NA 3OW3A 5FEDA 3J81Z 4Y15A 4KD1A 3NUSA 4KA4A 4BGQA 4CXAA 1MDMB 4I0TA 2I0YA 3BX5A 4MQ9F 4UWYA 3S0OA 5D1JA 1PUEE 4BDFA 4TPTA 2BZJA 5TO8A 2J0MB 5IKWA 3FZVA 3HMPA 1IRFA 1K3AA 2DQLA 5J1VA 2OBJA 4IB0A 3IKTA 3ODYX 4FKUA 5EM8A 4QTDA 5J8CA 2R5TA 2QQ7A 5LGNA 4XRFA 3EQHA 4FBXA 2Q83A 2FSTX 2YDJA 4E6QA 3ZEPA 3WIKA 4YZNA 2J5PA 4GXOA 1QGPA 1UKIA 4FUXA 1QPDA 4QQJA 3D7TA 5CU4A 5J9ZA 2VZ6A 3FBVA 4KNBA 3K1NA 2Q0OA 3FZTA 3ABTA 3MW1A 5AP7A 5DD8A 4HF2A 1GOLA 2A69F 2E1CA 4JAJA 4FKSA 3NGAA 2AUHA 4FG7A 2YEXA 1J9IA 4RVKA 4PF4A 3T8TA 5IQCA 1J1BA 2Z8CA 5IA4A 3UMWA 2C0TA 1IA8A 2PG4A 1LDDA 3MN3A 5I9YA 1IN4A 4K77A 4YJQA 3H9OA 2VODA 5IT9K 3SOAA 2I0HA 4WWCA 3IG7A 4EOSA 2O8YA 3CJGA 3H9FA 3SA0A 3I64A 4O27B 5A9UA 4UVBA 1YXXA 3ALNA 3PIXA 4U0YA 1S7AA 2HYGD 2XKPA 5ILVA 4DH7A 3PJ2A 1FY7A 2HIWA 4C34A 3HZTA 3K9TA 2OXDA 4QNAA 2GQQA 2VOOA 4X6QC 2VRXA 1KUTA 4LYNA 2F57A 3DT1A 4D2VA 2XRWA 5EM5A 2WMUA 2PMNX 1WWXA 3RPQA 1DPRA 1U54A 4LUDA 1OBGA 3R04A 2VONA 1JAMA 3P9IA 2B0QA 2QG7A 3U4UA 2JRTA 5HI2A 4CCUA 5LARA 3PSDA 2A19B 2OZAB 3L2CA 5B2KA 4IWDA 3FSKA 4M8TA 4EK8A 4TYHB 4GKIA 3ZXTA 1ZGJA 5HLWA 1JLUE 3Q4UA 3PUPA 4EQCA 1Z6RA 4FTMA 2XK7A 2A1AB 2C69A 2ZOQA 3BY6A 1YOLA 4IRIA 5FDXA 5ICPA 1Y8YA 5D5UB 2G2FA 4O5VA 1YW7A 5A6NA 3VF8A 4N70A 1MJ9A 4BKYA 4XCUA 3IO7A 5FLFA 4FKWA 4M0ZA 3RKXA 4AW1A 3P79A 4LL0A 3JAMZ 3RPVA 4RJ4A 3PXYA 3W2QA 4AOTA 3RTPA 5E17F 1U3EM 2JIIA 4D4SA 5I3RA 3RTRA 3JVSA 2O03A 4IFCA 1ATPE 3CE3A 5JRQA 3C0GA 3EQFA 1JPAA 5HU9A 5EFQA 3DY7A 3ZLWA 4PMMA 3BGZA 2OA4A 5BPIA 3R8PA 2P55A 5FTGA 2G2HA 1Y0UA 1FQ1B 3BRBA 4KABA 4APCA 3ZMDA 2JDRA 4PQNA 4ASDA 2W9ZB 4ANQA 2VO3A 3MEXA 3GFMA 3KCKA 4FEVA 2STWA 4FV4A 1TQIA 3C51A 3AC3A 3QGYA 1OL6A 4ASEA 4ALVA 3F5GA 1R1TA 4E1ZA 5M08A 1O6KA 1SMTA 5ANEA 1KE9A 4XUFA 2W5HA 1YI4A 3HA8A 5M07A 3U6JA 3SX9A 5EDQA 4FL3A 4ID7A 5A4QA 2FSOX 3DK3A 1XBCA 1GVJA 2X6DA 3F6XA 2XAFA 4HLXA 3LXLA 4ACHA 4OIQF 1I09A 3FUPA 3N4VA 4Z9LA 2Q0NA 3LOKA 5JEBA 2RSVA 4AA4A 4EEVA 1GJOA 2QWWA 1U4DA 4GEOA 3TOAA 3ULIA 4FF8A 5E1WA 1ZRDA 2QO2A 2L02A 1FSHA 3R8UA 2ETMA 4L00A 3I6WA 5KMJA 3RZBA 2XBJA 1FSEA 5AP3A 2HXQA 5K5OA 4EOOA 4L67A 4QTEA 3UPZA 4AZTA 1LR4A 1XR1A 4R8HA 2SRCA 4WNKA 5DPVA 2P2IA 4YJRA 1YDTE 2ACXA 2VTNA 1V1KA 3CLOA 2GIVA 4MNFA 4MD9E 2WEIA 4F0FA 2ESHA 3ZRMA 2E9PA 4WG4A 3NIZA 4JS8A 5EOLA 3NNWA 5FTOA 3ET7A 1U46A 4CQEA 4YNOA 1AD5A 5IT3A 1BLXA 4YZBA 3DXNA 5CLSA 1R36A 3VWAA 4YZDA 4XV3A 3R63A 3WODF 4G1WA 3UVQA 4A6EA 4EZ5A 2CSNA 3EQPA 2XF0A 4KIFA 4KWPA 1OL1A 3VS5A 4TTHB 5CVHA 3KEQA 1L0OC 3SFZA 2ITZA 3T3VA 4ITJA 2RKUA 3PVBA 5HG7A 4LD5A 4PMTA 4GO1A 5BS6A 4OAVB 4Z3VA 2WOUA 1QBJA 1R0EA 5KZIA 5AR2A 1G8SA 3IONA 4IANA 5CEIA 3QUDA 3A7GA 3O17A 4O2PA 4GRBA 2DBBA 5CAVA 1SD6A 5ILSA 3FXWA 5T3QA 2EFNA 5BQTA 1U78A 3ZPLA 3IOKA 1URWA 4GYGA 2WTKC 4HGSA 3E3BX 3PFQA 2YCSA 4QP6A 4ACCA 1GXPA 4C3RA 2WTCA 1PY5A 3QD0A 4KKGA 5JMSA 1BN5A 1K7AA 5KMLA 1ZOEA 4YIIA 4B8MA 4XG8A 4WRGA 2W17A 4OTDA 5EW9A 1I27A 4FK6A 4BZOA 4S31A 5TRDA 4AGCA 4BDIA 2P4IA 4FTUA 4I2OA 4G2FA 3DTWA 5IG1A 4AOJA 4F9YA 4GK2A 2R3MA 4BYJA 2JKQA 3AC5A 5DV5A 5JFVA 4AFEA 2J5EA 4WK8F 2FU4A 4ZAUA 5LRRA 1Q3WA 3A61A 3EN9A 4GW8A 4AU8A 2HKOA 2VWXA 3RPSA 4JBAA 4N9IA 2PUUA 2J6MA 2PZRA 3V3VA 3MVHA 4NM0A 4RIWA 3FYKX 2DYLA 4D5HA 1MRVA 4KMUX 1OL7A 3PY0A 2VWZA 3K69A 4G94A 3SW4A 2QQBA 4FVQA 3MA3A 4CFXA 3ISPA 3RM6A 3LQ3A 3A2CA 4K33A 3F21A 4HYSA 2BRMA 4CZUA 5IF1A 3BE2A 5I9WA 3PRFA 3ZTXA 5L3EA 3II5A 4NUSA 4YJNA 3FXXA 3I58A 3EFJA 5IZFA 2VTQA 4UV0A 4F1OA 2W96B 3GQLA 2YDIA 3KC3A 5HS7A 3OCGA 3VODA 4C38A 4JDHA 3CP9A 5D6FA 1K78B 1NY3A 2RG5A 4GK3A 1W84A 1ZHFA 3KP5A 5EYCA 3IW5A 3FKNA 3O8PA 5I9ZA 4IH8A 3KK8A 4ETSA 4UZHA 4G5PA 2X7OA 2PTKA 3F22A 3LIJA 3TNHA 3H4JA 1FNNA 1QCFA 3HRTA 4O21A 2EVAA 2HCKA 4PDKA 3DV3A 2LGCA 2VO0A 3QGWA 1SVHA 4BCJA 4USEA 3F82A 4IX6A 3WZJA 4E7WA 3GC8A 3BDDA 1J7KA 4BGHA 2LDUA 3RYPA 4P9FA 1OITA 1U6GA 2Y0MA 3CBLA 4YLJA 4Z55A 3DAEA 4BI1A 5LJJA 2P5VA 5CVFA 4RJ7A 4FKOA 1OBDA 3FZRA 2PL0A 1F5QA 3DKOA 1W83A 5HNBA 4R5YA 3F6OA 3AG9A 4WBOA 3E5XA 4A7CA 2OQRA 1ULYA 1EH7A 4RWLA 4HNIA 3I81A 4UMQA 3HLLA 2IVMA 2KTYA 3KZYA 4RJ8A 4I93A 3K5UA 4DEHA 1WBPA 3P23A 4HJOA 4K0YA 5JQ5A 3U2RA 3EN6A 1KE8A 1H01A 3UIMA 3HSEA 1RUOA 3GCPA 3DAKA 2XROA 4P5QA 2CN8A 1KU9A 5JQ8A 2DK5A 3MH1A 1QO0D 1RUNA 2FA2A 3FKOA 4RX5A 5BUIA 4O0VA 3UG1A 3BLHA 4KIQA 3NNXA 5AADA 4EJOA 4MBIA 1GZOA 3QQFA 3BWGA 1IRKA 4CZTA 1KGSA 4R3PA 4U97A 4MEYF 4L3LA 4YC3A 5ACBC 3Q3BA 5HNGA 3G0FA 2C4GA 4OGRA 3CUQA 3GX4X 1YXUA 3ZFMA 2YM7A 5B2LA 2IZUA 4KIOA 1QPJA 2W5BA 4I20A 4BZNA 1P4WA 4FT5A 4PDSA 4BCQA 2C6KA 2M87A 2GTNA 2G7HA 3F66A 3PJ8A 4XRJA 3VJNA 2NNWB 2B55A 4JNWA 5FLXK 4XP2A 2CMWA 4AZEA 3TT0A 4CKIA 2EFOA 4I24A 2CGUA 3NAXA 2UZLA 4QP8A 3RP9A 4M84A 4LOQA 5DG5A 1Q62A 1SM2A 1B9NA 2Y4IC 2WQEA 3AGMA 4HYUA 4OTGA 1YS6A 4EQQA 3PQJA 1UU3A 4FEQA 4BHBA 3DU8A 1RW8A 2YCRA 5B0XA 1JHHA 2VTPA 2BPMA 5EQYA 4M13A 5HCZA 4YTFA 5DYJA 2HZIA 1D5VA 5IT9Z 3MY1A 5K4IA 4YR8A 3W6KB 4EUTA 1H08A 4DQ2A 4Q2AA 3RPUA 1CKIA 2K02A 2ZNYA 5E18F 2WMAA 2W5AA 5H8EA 4PY1A 4GT4A 5J7BA 3FAAA 4Q48A 4M0YA 5I9UA 4KMFA 2JPBA 3GFJA 4BZDA 1V0PA 2A07F 2NRAC 4CVAA 4ERKA 5AAFA 4QMXA 4OT6A 2Z9OA 2GTMA 3TDVA 3AC4A 4DH3A 1SVGA 2V62A 5K4JA 4ANSA 5L2TA 5IUGA 1FVRA 2H34A 5DT0A 4GIHA 3QKLA 4F6WA 4XG3A 5HE3A 4Z7HA 4BWKA 1U54B 4AAAA 4YJOA 2FXAA 3LCDA 1TBXA 4O0RA 4E70A 3DTCA 5BVDA 3DKFA 3BJOA 5G6VA 4K8AA 5CEPA 3GLXA 1SVEA 4TNBA 2CFXA 2HXLA 3NAYA 2GNFA 4YJSA 3PJCA 2A6HF 2JITA 1BYGA 1JE8A 2VXZA 1T98A 3UO5A 3GU8A 3OV8A 4BHPA 3KP7A 3GYHX 1ND4A 2F7ZE 3F3UA 1MDMA 4FVRA 4V01A 3A7FA 2Y75A 5HBEA 5F9EA 2MD5A 3D15A 3RCJA 1XGSA 4CFNA 5HCYA 5EK7A 4L68A 3BPXA 1FPUA 3PQKA 3WILA 3F8CA 2UZOA 2FE3A 3BHUA 5LMAA 3DF8A 2YABA 4R7IA 4PTGA 1U5TA 4DLIA 2ZNZA 2OIDA 1JSTA 2JEDA 1VYZA 4I41A 3PA3A 4WRSA 4IVNA 2OW3A 3MFRA 2UZVA 3KGAA 3WE8A 3KMUA 3CTQA 1C0WA 3MCZA 4OINF 1Y6AA 1ZMUA 2GXGA 3Q04A 4B8LA 4AZWA 2XIXA 2L3DA 4J98A 4KRCA 3QQGA 3LFNA 2PVLA 5LEJA 4DGNA 5B2MA 2QURA 5TF9A 3IDPA 5EYMA 4C02A 5DHJA 2CKOA 4G6OA 2HZTA 5J9YA 3CTHA 3FPMA 3G3ZA 3M7GA 1ZYJA 2YJSA 4LV8A 3WF9A 4KUJA 4BFMA 2VTLA 2XUBA 4EJNA 5KCVA 5BVOA 3R0AA 1PXOA 1WBNA 4DCEA 4Q9SA 4YLLA 4KBKA 3D14A 3R9HA 5DUIA 1FGKA 2WPAA 4EOMA 4R1VA 3UIBA 2O5KA 2AC3A 3N4TA 4B8XA 4AE9A 3VO3A 5K9IA 2HAKA 2R0IA 1JSVA 4LMNA 3NCZA 3R21A 4CFMA 4PUZA 4C62A 5HLGA 2ZJWA 2R3KA 4WHZA 5DEWA 3L8XA 4EL9A 4HLYA 4U88A 2VE8A 3I0TA 3N97A 3DKWA 3LCOA 3SDJA 5AP0A 1DS5A 2VN9A 5DT3A
chains in the Genus database with same CATH superfamily
3VN9A 1YOVB 3GCVA 5CVRA 2LMDA 5TOZA 1J59A 3DZOA 3W0MA 1FX7A 4ZZMA 4ZJVA 2JKMA 2XH5A 1S6LA 4AU7A 2O65A 4M14A 1XTAA 1PXPA 4QMYA 4ZSEA 2BOLA 2JBOA 4FNYA 1JVPP 4QNYA 3VW6A 4H0EA 1OIUA 4BCIA 2AYPA 3DU6A 4QP3A 3A99A 1LEZA 4K9YA 2BKZA 4B09A 3EETA 4AT3A 3G9LX 1YWRA 1ZLJA 3K6GA 2E2BA 5KHXA 2XKEA 4D9JA 2YAKA 4BAYA 4HA8A 5C8KA 2MYSA 5A2QZ 1M7QA 4YEJA 2QOQA 3ZO3A 4K2RA 5ANJA 3QRUA 2IPXA 3QKKA 4MLOA 3CCLI 2DN0A 4RB3C 1JKLA 2QQ9A 1MQ4A 3G6HA 3G33A 4G6NA 1BI7A 4Z7GA 4D2RA 3IW4A 4GRIA 4PJMA 3V7CA 4HPQA 2BY0A 3UOKA 3MA6A 2RL5A 1T0FC 2EXCX 4BHCA 4Z6YA 4BL1A 4QTCA 5FBNC 1H9GA 5HVJA 1OI9A 3MFKA 4G5JA 3LLTA 1T38A 4DG2E 3F69A 3TP0A 2QCOA 4O22A 4UHTA 4FOCA 5GINE 2XGCA 4M9ZA 4QQTA 3NUYA 3Q4ZA 2DOEA 4IF4A 5G1XA 3AC8A 5E8ZA 2XGXA 1ERDA 4KT5C 1N77A 3VRZA 3LJ2A 4BHZA 5ETCA 2XYNA 3CQEA 3QCYA 2WO6A 3I5ZA 3E8EA 4ZC3A 1FVVA 3HYIA 4RGJA 3FXKA 1OKZA 3VAPA 3K54A 4AWIA 4O3MA 3BTJA 2XRLA 4UMPA 1R6RA 3R7OA 2W4JA 4M15A 4ENJA 3FM5A 4IB1A 2C30A 3ORTA 1ZRCA 3LOCA 5E3LA 5JZNA 4QMNA 2AEGA 4I01A 3OYBA 1PVEA 1KU7A 2QI8A 1SANA 2L9VA 3R0JA 4ZYHA 4BJ6C 3H3ZA 2XKOA 3ORZA 1G5SA 1Z1DA 3IGOA 4IVAA 4B7TA 3UQCA 5GZ9A 3MVJA 3CUQC 3DCFA 1YQAA 3HOVJ 2P0CA 3H0GJ 1TFFA 4OR5A 3GZNB 3S4QA 4HYIA 3E97A 1JUPA 2WOTA 3VFZA 3T8RA 5KK1A 3RCDA 3S1MJ 2VKEA 4FIHA 3NRMA 3H35A 4MHGA 3TXOA 2W4SA 1OUKA 5HU3A 4YC6A 2R3PA 4U79A 5LVLA 5AX3A 2M30A 1A5JA 4M12A 2DFIA 3L00A 1IRZA 5E7RA 3A4CA 2B9SA 2H1KA 4XKBA 4JL9A 2F4IA 5JT2A 2FEZA 3AMBA 2HDWA 3ZLYA 3CCRI 1X1PA 4K1BA 2WTKB 4BKZA 3GXLA 2ZXWH 3ENMA 4DFBA 1VQNI 5EDRA 4P96A 2ZJQF 1TWFJ 4BCKA 3HMIA 2WXVA 1Q4LA 1OGYA 4O82A 4M69A 3DPKA 4BBRJ 3FLZA 2QO7A 4DFYA 1CM8A 2EV5A 4GCJA 1WCCA 3CCSI 5AMNA 1RJBA 3UMXA 3LA7A 3AT3A 3QP6A 5L6PA 1BI0A 2XAUA 4FV9A 2HOTA 1RKWA 5ERIA 1AGWA 2WTJA 3F7ZA 3PSBA 2R3GA 2RDPA 4LOPA 3IGGA 5DCMB 4DFXE 1WJBA 4E4XA 1VNDA 4IW0A 3S95A 5GAEJ 3Q96A 2XEZA 3HMOA 4C61A 4P55A 3G90X 5CVUA 4WD5A 5E8IA 3ZQCA 3OL4A 3OY1A 3R8ZA 3CUQB 1IAJA 3WGIA 3F3WA 5ACKA 3D9VA 3R73A 2X6XA 3RHKA 3DU5A 2YIQA 3FPQA 2DYRH 1ZMVA 4AM3A 4ZLOA 5CNNA 2LY2A 3IWFA 2BHYA 2W1ZA 1M17A 4NWMA 2ZFWA 4D2WA 4A3EJ 1XPXA 3H0DA 4DAWA 3FLYA 1H00A 5E1EA 5D5VB 1YXSA 3C4CA 3UIUA 3IW7A 4IBMA 3QA8A 4HX8A 4R3CA 1F0QA 4KIBA 1X4PA 2EU9A 2YM5A 2EFQA 4AUXA 3E5QA 3HHGA 3DJ5A 4J8MA 4X2KA 1QPCA 3RAHA 3BG9A 2DDAA 3F8MA 1YW9A 2R7VA 4EZ7A 2ETRA 3OXTA 3GTKJ 2CGXA 1M2PA 1Q1HA 4C3IJ 2CS3A 4PDYA 5IQFA 1KU3A 1W7PD 2F2EA 4Y17A 3UO6A 4G16A 5IY5H 4XYFA 2R7SA 2CNQA 1ZZ2A 4ZZNA 4WNPA 2CDZA 2QHNA 4C4EA 2ECCA 2X9FA 4H3QA 2A5WA 1GIIA 3EKKA 5EM7A 3UOJA 3PY3A 3H9QA 2G2IA 4J8NA 2IP2A 4M9SA 3EWHA 3W2WA 3CP2A 2KJCA 5AEPA 2V0DA 1DU6A 1GLNA 4DZPA 5TE0A 3LMIA 2Q8KA 5JFRA 4AW0A 1ZYCA 3W8QA 1D5YA 3EUHA 2B1PA 5CF5A 1OKVA 3F23A 3BR2A 5C4KA 4EOPA 4FKIA 2GSFA 5HE0A 4JVGA 4FTNA 5EG0B 3QTSA 1G8XA 3UC3A 4L9JA 4E6AA 2PYWA 3O5AA 1LDJA 3ACJA 3ZOSA 4F99A 3GLLA 1XDUA 3EYGA 2GPHA 3JRIA 3ECOA 2J90A 3QPTA 2WNTA 3QQJA 2QGUA 2O5RA 1OVEA 4ONAA 4PMSA 2XK6A 2VXDA 1FMOE 2UZBA 4GFGA 2X6WA 2CQXA 5CU2A 2R5YA 1D0XA 4KS7A 5TKDA 2G9WA 4GU6A 4YRVA 4HDUA 3D83A 2BFXA 4XLVA 4LG0A 3UE4A 3BL9A 2RFNA 2CUJA 3IW8A 3D5LA 3MH0A 2XCHA 2VBWA 5CS6A 3LQ5A 2VUMJ 3PLSA 2X0GA 4EH4A 2K9SA 2VD5A 3GEQA 4J7BA 4UY9A 4RJ6A 4PZJA 4R7BA 4NC7A 2CUFA 5HGIA 3FZOA 2EV0A 2L9RA 2EZIA 3QU3A 3RKYA 3FJQE 1M2RA 1T8IA 1HW2A 3GZ5A 2PZYA 5FROA 4N6ZA 2PMIA 4NNJA 4RQVA 3WTXC 3CC4I 3IPHA 5E90A 2X8DA 2QG5A 1W7PB 4QRCA 5CSWA 3BC8A 1HOWA 3Q4CA 4YHJA 3E3PA 4RA5A 3RNYA 4I5CA 1Q3DA 4PL5A 2UW8A 2ZMCA 5HDNA 1NG6A 3OIQA 3ZQGA 1J7LA 3O8HA 4U0WA 2ETKA 1ZTRA 2WKMA 1W8CA 3RJCA 3VBXA 3KVXA 1LPUA 4Q5HA 5ICCA 2WMSA 3NAUA 3B8RA 3I0OA 4BY7J 1G3NA 3DXJF 3HIFA 5LVOA 2BRBA 3N51A 4U7DA 4JOMA 4A3IJ 1SAXA 1MMNA 1DI8A 5K0XA 2P4WA 3VBWA 1FC3A 1IG1A 4RVMA 2CQNA 5J5TA 2A4LA 3DBQA 4NFMA 5JLWA 1XHAA 4UWBA 4B4CA 2BDJA 3PP1A 2J0LA 4K2EA 5E8TA 5IUIA 1U0JA 2P8TA 3DFCB 3HP2A 1Z9XA 4XM3A 1IV8A 5FJ8J 2FQ4A 1H4LA 5GTIC 5E3OA 3DOGA 3IHUA 4ZTSA 2M0CA 2JGZA 4NU1A 5D7VA 2HPMA 2EQRA 2XK4A 3KL8A 5GTHC 1FP1D 4HZFA 2F7XE 1FOTA 3UP2A 3U8WA 4F93B 3JR9A 5KBRA 3GUDA 1D8JA 3F5XA 4TYHA 1OCCH 1UHWA 4O6EA 3W0PA 2R3HA 3FYJX 2NOJB 2ZCWA 3KFWX 3EQRA 2GHGA 4FIFA 2VBZA 2B54A 5BMSA 3BEGA 5AR7A 1BI1A 3KN5A 4G6DA 1WFCA 5CQGA 1X3ZB 2PMOX 3LXPA 5E1SA 5KHDA 4CG9A 2XPUA 2BTSA 2NP8A 4NIFB 4K18A 1LFBA 4MVFA 3TDWA 2C6YA 5E8WA 2OV7A 1MH4A 4O38A 1ETXA 3BELA 4MWIA 2XCKA 5FD6A 2OCCH 2B63J 4D0PA 5E3MA 2WMQA 4BDEA 2HZDA 1YWNA 5J1UA 2IXSA 4XEYA 5JGBA 2EINH 2OIBA 2C5VA 2XM9A 1JKSA 1DGWY 1UMQA 1IN5A 3EN7A 4U0IA 3VS0A 3V8SA 1XBAA 3OD6X 2OQGA 3GU5A 4Q47A 2VKVA 4ZK5A 1T33A 4AGDA 2VQCA 4AP7A 5KVRA 5DT4A 2X39A 1IEPA 5T6KA 1Q97A 2W25A 5HOAA 3TQNA 1R39A 3ETAA 3WI6A 5E3NA 2P6TA 4PX6A 3S1RJ 4O7NA 4RDUA 3V5LA 2FOKA 2WC2A 5JFSA 4NQWA 4L3PA 4JJRA 1IN7A 3RDIA 1T2KA 4L44A 3F7WA 4I09A 1OMIA 2JDTA 3LPBA 3RK5A 2IWIA 3CD3A 5FGKA 3CKXA 4L5EA 4FNZA 5BYLA