3PRIA

Crystal structure of human b-raf kinase in complex with a non-oxime furopyridine inhibitor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
264
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Non-oxime inhibitors of B-Raf(V600E) kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 74
structure length 264
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3priA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3priA01
3OUKA 2VX0A 4ID7A 2V62A 1AD5A 1ZY5A 2PVKA 4XBUA 4O7NA 5EI8A 2R3FA 3TTIA 4BDFA 4QQTA 4MH7A 2EXEA 3FXWA 4LGHA 3RJCA 3Q2JA 3ERKA 4J96A 4ZTQA 5CAOA 3VNTA 4CNHA 4L3PA 2R0UA 3HUBA 4O7WA 2O2UA 1BL7A 3PA4A 4O0XA 2XK4A 4AAAA 4M8TA 4A9YA 5KMOA 3U9NA 3VO3A 3QD0A 4FVRA 1PW2A 3FDNA 5K0XA 4Q9SA 1JKSA 1ZYLA 4RIOA 4TL0A 1YWNA 2XYUA 3D5UA 3LLTA 5BVOA 4NJDA 5F20A 3SHEA 3PPKA 5KNJA 2XM9A 3QALE 5LJJA 5LVMA 1ZYJA 4D1SA 2PMLX 4X3FB 3HGKA 3IDPA 5JK3A 3TDVA 3EQBA 4EH3A 2OICA 4JLCA 5LMKC 4R1VA 3AT3A 3GB2A 3UVPA 3D5WA 3GOPA 5E8XA 2G01A 2BZIB 3AG9A 3LHJA 3MBLA 2J2IB 2W4JA 3OBGA 4LFIA 4XG3A 1JSTA 4KS8A 4G2FA 4P4CA 1Y6BA 3K2LA 3PJCA 3QQLA 3C0IA 3FZSA 2V7OA 1W7HA 4LMNA 4PWNA 4XS2A 3RCJA 4GKIA 5D9HA 4KS7A 3Q4UA 4P5QA 5CTPA 3FAAA 4DGMA 1QL6A 3V8WA 1XHAA 5D1JA 4G3FA 4QMUA 3FMNA 2Q83A 4D55A 3UBDA 1UKHA 2OZAA 4EYJA 4ACMA 1YI3A 4YNOA 4I0RA 1MQBA 3EL7A 1YDTE 4WT6A 1I44A 5IUHA 4XYFA 3KXMA 3O7LD 4NCTC 3ITZA 3DAEA 1Q4LA 4ENYA 2YAKA 4UMPA 3SXRA 4CT1A 3AC3A 3VJNA 4NEUA 3C0HA 4FTLA 3DB6A 4O7TA 5LMAA 2PSQA 4ACGA 3TM0A 3Q2MA 3V6SA 5IH6A 3HRCA 1STCE 5AUWA 2XKEA 2IZTA 3IQ7A 4E4NA 3O17A 2C1AA 2YIYA 4PDSA 2YDJA 3HMMA 3ZDIA 2OBJA 5FEEA 4FT5A 1P4OA 3VRZA 4QO9A 3ENHA 4PDOA 4PL3A 3GOKA 3FWQA 4MXZA 2WQOA 2WELA 4W9WA 1OGUA 4ZS4A 1H24A 2W9FB 2YLEA 4F1MA 1GJOA 4AZVA 3FEGA 1ZZLA 4A4OA 5M07A 4XLIA 4LI5A 4C3RA 4DCEA 1YXXA 4CFNA 3PZHA 4BWPA 2BRMA 4MKCA 5GINE 2FVDA 4FSMA 3UIXA 5IH4A 1PMUA 2GDOA 4FV2A 4BTFA 4KUJA 2YM8A 4CQEA 1OIYA 2FSOX 2P4IA 3RK7A 4A9TA 3HMIA 1J7UA 3FHIA 2IVVA 2IW8A 5LVLA 1FVTA 5IMXA 4FG7A 5DWRA 2VRXA 5AR3A 4HVSA 4DCAA 4TYIA 3B8RA 3OY3A 2ZDTA 5J7BA 2BHHA 3SX9A 5AV3A 4KIKB 2Y6OA 1PF8A 4YSJA 4XMOA 2R3GA 3FXXA 5KZ0A 1DAWA 5AMNA 3ETAA 3OOMA 3SLSA 1OL7A 5HG9A 5IQFA 1PRYA 1OKVA 2A4LA 2W1HA 3EQRA 3HNGA 4L01A 4APCA 2UZBA 4RX5A 2HXLA 4H36A 3BLRA 2YLFA 1V0PA 4Q5HA 2UW4A 2UZEA 3BV2A 3EN6A 4LOQA 4Z9LA 2HCKA 2PVHA 2QOCA 3MVJA 4G34A 4MXCA 2F57A 3F5PA 3Q4ZA 3FMKA 1URCA 3D83A 4HYUA 5AUXA 4NU1A 5GJDA 2J0MB 3JUHA 5IA4A 4HVDA 5GIPE 2ITVA 3ATSA 3G6GA 1U5QA 3GU5A 3I60A 4IVDA 4XOYA 2O3PA 1MRUA 2B9IA 3D94A 5FRIA 3BU6A 5M44A 3DJ6A 1FOTA 2H6DA 3GCUA 5AADA 3R8VA 4O0YA 3JVRA 3BPRA 1YHWA 3CJFA 5K4IA 3N9XA 1XBAA 4HW7A 3MDYA 5HVJA 4ITJA 3QA8A 3M11A 4FC0A 3AC1A 5TO8A 2F2CB 2HYYA 4AWIA 1OPKA 4RGJA 3PXQA 5D41A 4UWYA 4QP3A 4BDCA 2OXDA 5ETFA 4KRDA 2XBJA 3C9WA 5FQDC 4RG0A 5ANKA 1XWSA 5C8MA 1FMOE 2VTHA 3ZM9A 1FVRA 3VN9A 4RIXB 4DFBA 1YXVA 3EOCA 3I79A 4Y72A 5AP1A 2Y0AA 4YTHA 5B2LA 3OT3A 4EH6A 4BI2A 2VGOA 4MBIA 4LL0A 5BUEA 5E8YA 2A1AB 3A8WA 1REKA 2AC5A 2QR7A 3EZVA 1H1PA 2C6EA 3TXOA 1BX6A 4K8AA 2YIWA 4ONAA 2JIVA 3V8SA 4W4VA 4D4VA 3FI4A 3CTJA 4FTUA 3TJDA 4O7VA 2IZSA 1Q97A 4UBAA 1IG1A 4X2FA 5BYYA 2PTKA 4QYEA 4F7SA 2H96A 3IPHA 2YM3A 4NL0A 3CEKA 4AGUA 5L2IA 4E8AA 2GS7A 1KWPA 2R3MA 3QXPA 3TT0A 3RKBA 4Z3VA 4IHPA 3NSZA 4AA4A 4FL1A 5B2MA 4MWIA 2CKPA 4JX3A 4ZLZA 3HA8A 1RQQA 5AJQA 5CT0A 5AR7A 1FVVA 4PDYA 4LGDA 4O7ZA 2VTRA 1P5EA 3DA6A 3TNQB 2WMWA 1FBNA 1CMKE 4BKZA 3ORXA 4D0XA 4GVJA 3RK5A 2GCDA 4G5JA 4JBQA 5FD2A 2C6MA 2JKOA 3MSSA 4ZZMA 5ICPA 3Q96A 3E3PA 4IB1A 2WAJA 3IOKA 4EHVA 3KQ7A 5CNOA 3S00A 4IAKA 4GCJA 4PPAA 3SRVA 3EHAA 2JDOA 5LWMA 3UTOA 3OCBA 4A9UA 4EORA 3ZO4A 4I5PA 3CP9A 4IDTA 4OLIA 2VTJA 1W83A 1CTPE 2QR8A 4II5A 4D5HA 5E9EA 3AC4A 3FUPA 3QD4A 3ZONA 3DY7A 3EL8A 2VTOA 3OCSA 5JT2A 2BDFA 2P3GX 3E62A 1M2PA 3BU3A 3W2SA 4ALWA 3GBZA 3MFRA 3LXNA 3O96A 3UPZA 2GQRA 3NAYA 1JAMA 1V0BA 4FYOA 4MHAA 4XOZA 3HP5A 2GHMA 3D7TB 3II5A 4HGLA 5DVRA 3REPA 4E73A 5JKGA 4G5PA 3F88A 3R04A 2EU9A 4MQ2A 1ZARA 1WBNA 3G15A 3P23A 5EI6A 4YBKA 5EM8A 4GG7A 2J4ZA 2X4ZA 1VJYA 2BTRA 4IVBA 2X9EA 3W1FA 3PXKA 4BDJA 4NKAA 5FEQA 3S2PA 5KO1A 4PPBA 4YTFA 3MVMA 3UDBA 4UWBA 4YHFA 4ZEGA 4AW5A 4NW5A 3C0GA 5CSPA 5AUUA 4L43A 3EFJA 3NPCA 3PIXA 4XG4A 4UWCA 4DH7A 4K11A 3G33A 2WOTA 4S30A 3L8SA 3QC4A 3VBWA 4ITIA 2ITOA 3BE9A 5IQEA 2ZM4A 4RIWA 3B2TA 5J1VA 3MTFA 4AE6A 3DPKA 4YSMA 4ASZA 1CDKA 4BYIA 4CMUA 4YC8A 4OTGA 3V5JA 3VQUA 5M4IA 3TNIA 1F0QA 4IH8A 3OY1A 5CS6A 2IG7A 2J5FA 4XG2A 3QHRA 4F9BA 2YCQA 3R7UA 2QNJA 2QOHA 4F4PA 3W2QA 4DTAA 1ERKA 2OJGA 2OKRA 5IQBA 4TWCA 2C6IA 2RGPA 3KCFA 2CGUA 3DLZA 4G3DA 4FV3A 2ZAZA 4CXAA 1IASA 4V0GB 3FLNC 3R8PA 4C35A 4PL5A 2WTKB 2FSMX 4YGAA 2BMCA 2JBOA 3EN9A 4F70A 1XH8A 1UA2A 5LVOA 3NCZA 3EN4A 2YFXA 3CTHA 4FL2A 4LM5A 3MFUA 3L1SA 2B9HA 1QPEA 3LXKA 4E5AX 4PPCA 1OECA 3HV4A 4EH2A 1OVEA 5M4FA 1EH4A 2WO6A 2UUEA 4C4FA 5E8VA 3MIAA 1FGIA 2G2IA 5M4UA 4ZSJA 2XM8A 4FEWA 3QZFA 2FGIA 1Q8WA 3WF9A 5L2SA 5HO7A 3FKOA 4D1ZA 4LQMA 2QU5A 3F3UA 3RCDA 1S9IA 2R3KA 4PY1A 4FYNA 3DLSA 3PA3A 2RFDA 3QTQA 1CM8A 4RJ6A 5KE0A 4EQMA 4AU8A 4ALVA 4MXYA 3MA3A 2JDTA 3ZSHA 4AXAA 1HOWA 5DLSA 2VWVA 3TDWA 2OXYA 5IUIA 4I92A 2HOGA 3VS4A 3IONA 3UMWA 4W8DA 2VAGA 2QCSA 3AD4A 2CNVA 5JFXA 4BN1A 3RPSA 4FTTA 3WE4A 2F4JA 1M7NA 4MBJA 5KMLA 3L9LA 5HTIA 4J53A 3F3ZA 3K5UA 1FQ1B 5HBEA 4EOQA 4ZSLA 5LOHA 2ZMDA 1W8CA 4AW2A 4RFZA 4UMUA 5KMJA 3KK8A 2R5TA 5FM2A 2B53A 3GFEA 4YHJA 4DG2E 3BCEA 3CY2A 5IQDA 2UZVA 5HD7A 1M14A 3D15A 3F5GA 4OW8A 4X6QC 4D58A 4QMOA 4BDIA 4IZYA 4XRLA 4ERKA 1SVGA 4DFLA 2J0KA 2X7FA 3NVKI 4F7JA 3D14A 2EB3A 4PTCA 3OWPA 3QX4A 5D7VA 3QFVA 2NPQA 1OKZA 2BILB 3KRRA 4L46A 4UY9A 4CYIA 4IVAA 2HIWA 5AA9A 4C4GA 1T46A 3O23A 5EYDA 5FG8A 3CPCA 4B6LA 3KXZA 3FLWA 1JLUE 3K3IA 1XBBA 4QYHA 2R3OA 5GHVA 4UV0A 2KULA 3TZ8A 4YZNA 5FEDA 1H00A 2QONA 1WFCA 4IB3A 1G3NA 4M0ZA 4X2JA 3VULA 1G5SA 5HO6A 4QMMA 4UZDA 3R8ZA 1PXIA 3BWJA 3ZUTA 3H4JA 3W16A 3PXRA 5HLWA 5TF9A 1KE8A 3BQCA 2YISA 5CNNA 4ZXTA 3ZO1A 1A48A 1GAGA 5E4HA 4MD9E 4BCPA 4DH1A 3ZRLA 4M15A 5KX8A 1RE8A 3UO6A 1JPAA 4FTJA 3R00A 3L8VA 4GW8A 4GS6A 2XIKA 2QHNA 3ODYX 5CENA 4DH3A 4A9RA 4O0WA 3VBVA 4E20A 4ZIMA 4FIJA 4R5SA 2HZ4A 4YJOA 3O8PA 3HUCA 4FSRA 3AC5A 5LXMA 4DT8A 3E8EA 4DH8A 1W82A 4D0WA 4GH2A 4HGEA 4O83A 4EK8A 3E92A 4EZ5A 4YJRA 4E4XA 1PXKA 3PSBA 3FMJA 4C4IA 4CZTA 3LFNA 4E6QA 2GNGA 1KUTA 4MNEB 2ZDUA 3BHHA 1B39A 3GC8A 5K0KA 4ALUA 5AP2A 3W2RA 3HDMA 3T9IA 5DNRA 1TQIA 3HAMA 4QYYA 4BHNA 3H3CA 2GNHA 5KHWA 4CSVA 4F64A 3FSFA 3E8NA 2YWVA 1KE9A 3KVWA 3MN3A 5DEYA 5HTBA 4O7SA 2XIZA 2R0IA 3R63A 2JAVA 5HVYA 1APME 2F2UA 4R7HA 3RHXA 3TCPA 4BB4A 3PFQA 4TNDA 2R3NA 3SDJA 2OH4A 4FV7A 3WF7A 4XP0A 4CLIA 3IDCA 2QC6A 4R5YA 2O65A 4H3QA 4FTRA 2WB8A 4KINA 2XB7A 4FV1A 3ID6C 5CVHA 3NUAA 1ZY4A 2VNYA 3GXLA 1MQ4A 1OKYA 1WBOA 3HRFA 4G9CA 4GG5A 4WKQA 3S4QA 3ZO3A 4H3PA 4FV9A 4YO6A 2R7IA 4BFMA 4NK9A 4F9AA 3AMAA 2G15A 3R01A 4ZY4A 4WIHA 4ZK5A 3V5QA 5GNKA 3A7FA 3U4UA 1W84A 4FKPA 3FZTA 3O8UA 2X2MA 1SZMA 2Y4IC 3UG1A 3QQKA 4WRGA 3NUXA 3QL8A 2C3JA 3QTRA 3ALNA 3B8QA 4KBAA 5DRBA 3DTCA 2UVZA 5DFPA 5HKMA 4Q9ZA 4UYNA 2FYSA 2PHKA 4CMTA 4RX9A 4PDPA 3GVUA 5D11A 3GP0A 4GJ3A 3VF9A 4XV3A 1DS5A 4CCUA 1H8FA 3KF7A 3MYGA 3HA6A 5HGIA 2XK9A 3NNXA 1Q8YA 2HY81 3VBQA 3LXLA 3MTLA 1ZOEA 4W4YA 3U87A 4D2SA 3OCTA 2BFXA 3COMA 3F3VA 4PUZA 4F65A 3HAVA 4QP8A 2W1GA 3MVLA 5E8ZA 4K18A 5EG3A 1Q41A 4BIEA 2PMNX 3TV6A 3NIZA 2OU7A 3RAIA 2WFYA 4ZLYA 2BUJA 2O63A 3EQCA 4MQ1A 2IVUA 4IAFA 5M53A 4I6QA 2HZ0A 1CKIA 2OK1A 4N6YA 1U46A 2ZV8A 5BVNA 5M06A 1YI6A 4CQGA 3TNPC 2O0UA 3CTQA 2ZMCA 4HGTA 2Z7LA 3BYVA 3CQWA 3G9LX 4R3PA 4IXPA 3GNIB 5EQYA 2R3LA 1BL6A 5AX3A 3RAHA 5EQPA 2CGWA 3LFFA 3JY0A 5L6PA 2F9GA 4FKJA 1M17A 4J95A 1TKIA 4MX9A 4D5KA 4FKTA 4YLLA 2IZUA 1XO2B 2WEVA 2VZ6A 4DN5A 1H1WA 2YITA 4L3LA 1QPJA 2R64A 3A7HA 4E6DA 2W05A 3EN7A 4GT5A 2PZIA 4GUEA 1F5QA 1M2RA 2CJMA 5ETCA 4BDKA 3FMLA 4U81A 1SVHA 2IO6A 3CPBA 4DEBA 2QO9A 2GNFA 5HEZA 2OG8A 4HJOA 4MF0A 1ZYSA 5J8IA 4EHZA 4MXAA 3R22A 4TT7A 2PMOX 4YBJA 3HL7A 3PJ8A 5BPYA 3DKOA 5CEOA 2C6KA 4BKJA 3IGGA 3D5XA 2HENA 3QTXA 3SKCA 1KE5A 2CNUA 4NJ3A 3A61A 3VUDA 1U54B 4AFEA 5GZAA 3FMHA 1Y57A 3UNZA 4O0SA 3PUPA 4AGCA 2Y8OA 4RVLA 5EM5A 2PPQA 2P0CA 3VW6A 3ELJA 4XHKB 4WNOA 4RWKA 3V51A 4I4FA 4FUXA 1YXTA 2JFMA 2WMBA 4FSUA 4QOXA 4K77A 3LMHA 2WMUA 2CSNA 1YOMA 4MD8E 4QMLA 2ZM1A 3LXPA 4DFXE 5IA3A 4ZMEA 3KVXA 1PMNA 3WZDA 4G16A 3ZEPA 3UIBA 2FUMA 2UW8A 2X7GA 2GQGA 2C6TA 2OWBA 4PRJA 3W33A 3RMFA 4K0YA 4CMOA 1BI7A 2ERKA 3UNJA 4IQ6A 3R1NA 1H25A 2RFSA 5AIKA 4FSQA 1PXPA 3LQ3A 4GSBA 2WD1A 3QTZA 5DHJA 2GS2A 3AC2A 4BCKA 4NWMA 4CG9A 2VX1A 3E5AA 4FT9A 5IQIA 3UIMA 4APPA 5ITAA 4FKLA 4X21A 5DR6A 3MY0A 1WVXA 3IS5A 3RPVA 5E8SA 4RIYA 4QQJA 4WNKA 5AA8A 3S0OA 1YHSA 2QOIA 2RSVA 1IAJA 1GZOA 3ENMA 4DFNA 3PVGA 3U9CA 4ANMA 4NFMA 1VZOA 4IE9A 3NW5A 5E91A 4EH5A 4C57A 3Q9WA 3VW8A 5AUVA 4ZSAA 1B6CB 3NDMA 2XNPA 4E4MA 1H1SA 2GTMA 4LOPA 4OTHA 4BZDA 4JRNA 3M1SA 2BALA 3LFBA 4FR4A 4GKHA 4UMTA 4IM2A 2VWUA 3SW7A 2VTAA 3E63A 4U3YA 3GU7A 2I0EA 2X81A 5CAPA 4EH9A 4L7FA 5CSHA 1SNUA 4C38A 3ORZA 4D2RA 2QQ7A 3I1AA 1I09A 3LFCA 3K54A 5FXQA 3BYOA 4IVCA 3HEGA 2RFNA 4YZBA 3VWAA 4BCHA 1XH5A 1W98A 4HCTA 1YWRA 2ETKA 3D9VA 3WF5A 4BRXA 2B4SB 3EKNA 1OI9A 2QOOA 3NNWA 4IAZA 4QTAA 5M08A 3MIYA 5DRDA 5HU9A 3E7OA 3E7VA 4I21A 2WIHA 5AR2A 4GFOA 5BVEA 2ZJWA 4I5HA 1YOJA 4NZWB 2YCFA 2CCIA 3CIKA 4O1OA 5I0BA 4BICA 5CU4A 2JIUA 3Q04A 4QPAA 4ANOA 4YZCA 3A62A 2GFCA 3P7BA 3R7GA 3QBNA 2EXCX 3GUBA 2W06A 4Q5EA 5DN3A 1H07A 4Z55A 5I4NA 4HZSA 4F6UA 4E6AA 3MJ2A 3FC2A 4KSPA 4U0IA 2W1DA 3HP2A 3R83A 4BCOA 4USDA 3LVPA 3FQSA 3RAKA 4DF3A 4MNFA 5JZJA 4C4JA 3QZHA 2HZIA 1OITA 2UW3A 3SOCA 2VWIA 3EQFA 3PRFA 2IW9A 3TN8A 5BVWA 4BZNA 3UQCA 1ZYDA 3I6UA 5EW3A 2EUFB 4J99A 4WUNA 2BKKA 5AP3A 4O27B 2WIPA 4DFYA 5LCJA 4G1WA 2WQMA 3NUNA 4EKKA 2XNNA 3POZA 3LE6A 2JEDA 4LOOA 2NNWB 3COHA 3QKLA 2WHBA 2QOKA 3FE3A 5DT3A 3ZXTA 4KD1A 2FA2A 2WMVA 2J9MA 3C5UA 4XEYA 5A3XA 1YXUA 1XKKA 4M7IA 3FXZA 1SNXA 5EM6A 2I0YA 4R7IA 3QRIA 3IW6A 3K3JA 4EKLA 1PYXA 4C37A 2IVTA 1PKDA 4X3FA 2W96B 3HMPA 4PMMA 5IMEA 3BGQA 3TIZA 2YZLA 2I40A 4G17A 5EDPA 4BDGA 4LYNA 5DIAA 1ZMWA 2HXQA 4XG9A 3GFWA 4IM0A 1JQHA 2J51A 4U6RA 1VEBA 5A4CA 2BROA 2E9NA 2VO3A 2JLDA 3I4BA 4F9YA 3OXIA 3IECA 4GIIA 2IJMA 4GIHA 3JY9A 4PX6A 2QO7A 3P86A 3UZRA 1MP8A 4GRBA 3QZGA 3PY0A 4FKSA 3OF0A 1QMZA 3IW4A 2XK3A 3SG9A 1VYWA 4OTPA 2Z7QA 1M52A 4DEAA 3NVMB 4LGGA 2AYPA 4C0TA 5CU2A 2I0VA 3HKOA 3C4CA 3FKLA 4S34A 4C33A 3TKIA 2X2LA 1TVOA 1H1QA 3C4XA 3K5VA 3ORPA 4FKRA 4KAOA 1ZMVA 3EKKA 4KIPA 5L8JA 4EK4A 5AWMA 4ERWA 4F0IA 3BBTB 3OUNB 4F6SA 5DYJA 2Q0NA 3NYOA 5L4QA 3FLSA 3CSVA 5L6WL 3UC4A 3VS6A 3PWDA 4BBFA 3TNHA 4FA2A 3Q6UA 4F1TA 5HX6A 3PRIA 4P90A 3TV4A 1OBGA 4P7EA 2NO3A 3KY2A 4KBCA 2PL0A 1MRVA 4MBLA 1J7IA 2ITUA 5CASA 2ZYBA 3BELA 2JKKA 4I0SA 4F7LA 3DAKA 3F5UA 5TR6A 3MH2A 1BKXA 3RALA 4F9CA 5JQ8A 2W17A 2PVMA 5EW9A 1NT2A 4IX3A 3W32A 3O7LB 4DHFA 3FV8A 3MY5A 4S33A 4HVIA 2YM4A 1PHKA 2C1BA 2LGCA 2REIA 3BGZA 2B52A 4E7WA 1GIIA 3TZMA 2VN9A 4D28A 5I9XA 3SGCA 3WF8A 4ACDA 3F2AA 3NLBA 3TZ7A 4ZS0A 4OTQA 3FI8A 4IWDA 3MB6A 2OW3A 5AP5A 4YC3A 3WOWA 3OWKA 5A4TA 2UW9A 2BVAA 2CNQA 2GTNA 3VS5A 3DBCA 4JT3A 3G2FA 4RJ5A 2HZNA 4U8ZA 3P1AA 4OTFA 4QPMA 3UIUA 4U45A 4LG4A 4TYGA 3FSKA 2PULA 4FSNA 4KIKA 3LCSA 4C8BA 4PF4A 3D7ZA 3P7AA 4IBMA 3MI9A 3FKNA 4FNYA 4PQNA 3A8XA 4QTDA 4U97A 3RM7A 4R3RA 5EFQA 3ZYAA 4BC6A 4CFVA 3EIDA 5FP6A 4J97A 1K9AA 4MD7E 2W1FA 4ACCA 5HO8A 3G0FA 4YNEA 4NM0A 4B99A 4CFXA 3DDQA 2C3IB 3DK6A 4EUTA 4BBEA 5BYZA 3ZBFA 3QRTA 3I6WA 3G90X 4DBNA 3OW3A 2W4KA 4H05A 4GEOA 2EB2A 3GT8A 5BYLA 3ORTA 4FNZA 3DZOA 4FTCA 2I1MA 4U40A 3UC3A 2RIOA 2WTCA 1WAKA 3OEFX 4FI1A 2C4GA 5AX9A 2PVYA 5HTCA 2WMQA 3RGFA 3IW7A 4G3EA 4IIRA 4MXXA 2VU3A 2UZWE 5CSWA 4YHTA 2UVXA 3RVGA 3ZSIA 1Q8ZA 4AACA 5M4CA 3Q53A 1BLXA 2RF9A 4WBOA 4XRJA 5GIOE 1IAHA 3PJ2A 3JXWA 4AW0A 3NMUF 5I3RA 4M13A 4XG6A 4DFZE 1OL1A 4FIFA 4G3GA 3LMGA 4IWPA 3N4TA 2PVNA 3DK3A 4MWHA 1GZNA 3TV7A 1OKWA 3R7IA 3U51A 3QUPA 3QKMA 4K2RA 4IAIA 3PJ1A 4JBPA 3VUGA 4DG3E 4LUDA 5CF4A 2C6LA 3FPQA 3AMBA 4WOVA 4M97A 5CI7A 3E8CA 4FVPA 3Q9YA 3RTPA 3U6IA 2Z7RA 3OT8A 4FZDB 4PTEA 4RIXA 2WMAA 4IZAA 4D2TA 4AFJA 4QMVA 2FSLX 3PY3A 2VO7A 2VUWA 5J95A 5AFVA 1E1VA 2XNBA 5HIEA 3HECA 3A2CA 1BMKA 2CKEA 4IACA 3PY1A 4NFNA 3G6HA 4HCVA 4N0SA 3QWJA 1P4FA 1A06A 2X7OA 1YI4A 5JMSA 5HE0A 3R7OA 3ZSGA 2GFSA 4OT6A 4UB7A 4EOIA 3KRJA 1Q8TA 4MEDA 5ANEA 2VTPA 3A60A 2ESMA 3DTWA 3CY3A 3OCGA 2OXXA 4RT7A 4TYEA 4WHZA 3QD3A 2PE2A 5BVFA 5B2KA 4OTDA 3BE2A 5HG5A 4AX8A 3NW7A 4U80A 4JDIA 2CMWA 3F82A 3OZ6A 3PDTA 3MA6A 3CKXA 5FM3A 2IZRA 4AN3A 5JN2A 4EQCA 4CRLA 4RJ3A 2PZPA 2HY0A 1J3HA 3ZBXA 1RJBA 2XS0A 5L6OA 2CPKE 2JC6A 1NW1A 3LMIA 4BCFA 1GOLA 4RPVA 4CLJA 1SYKA 5DG5A 3VBTA 5IF1A 3ODZX 5JGDA 2XIXA 4DEIA 5F1ZA 1HCKA 3ZXZA 3AT2A 4GU6A 4OTIA 4J8MA 2VX3A 3CD3A 1J1BA 3NYNA 3BEGA 1UU8A 4CV9A 1L8TA 3HVCA 4HYIA 5F9EA 3A7GA 4KIOA 5LQFA 3LCOA 4XV9A 2UW6A 4JIAA 5EM7A 4J1RA 4I41A 4ORKA 4C61A 4CKRA 4ZY5A 4CEGA 3PE2A 4L7SA 3AGMA 5JZNA 3T8OA 4FOBA 4I94A 1K2PA 5HX8A 3V04A 2ONLA 3ZZWA 4ACHA 5ANOA 4NM5A 2X0GA 4WNPA 2GNJA 4X3FC 5M09A 3BWFA 4XNEA 5A4QA 2B9FA 3D7TA 3AD5A 3BRBA 5HE3A 5M51A 2JDSA 1DI8A 1UU7A 3DT1A 4GVAA 3HDNA 4ITHA 2C30A 1ZYCA 5J9YA 3SAYA 2YABA 2BRBA 4KKHA 3LCKA 3VS2A 3WE8A 5HIDA 4BCMA 4EOOA 1JKTA 4YTCA 3V5LA 3DNDA 5BMSA 3KB7A 2ETMA 4WA9A 4Z7HA 4DGLC 1OIRA 4EI4A 4B0GA 5DT4A 4EOSA 4R77A 2O64A 4OAUC 4EL9A 1UWJA 3R1YA 5FUTA 2C5NA 1PXLA 1WZYA 2W9ZB 3AQVA 4Q2AA 3OG7A 1IA8A 3NGAA 4M68A 5HNBA 4PP9A 5A6NA 4UN0C 2OFVA 2WMSA 3P0MA 1LPUA 4FKVA 1NVQA 3PP0A 3W8QA 5H9BA 3VUMA 3NUYA 4M3QA 2FSTX 4V04A 4EOMA 4IC7A 2WQNA 4TW9A 2FO0A 5CAUA 1XBCA 3CD8A 3ZC5A 4P5ZA 4BCQA 4D4RA 2ITWA 3U8WA 4GT4A 1WVYA 3DXNA 4Y95A 4OGRA 4DTKA 3BLHA 2OSCA 3P79A 3C7QA 5HHWA 2W7XA 5H8GA 4RQKA 1ZAOA 4ZJJA 5IUGA 4XG7A 4AA5A 2HK5A 3OVVA 2EXMA 4GFGA 4JXFA 4O96A 5CQWA 2QG5A 4BDAA 5BUJA 4EK5A 5IG1A 2DUVA 5L2WA 3KEXA 2I6LA 2XNEA 3OTVA 2FH9A 2E9PA 3PYYA 4V0GA 5GJFA 3VQHA 4TYJA 5AM6A 3UPXA 3TIYA 1U4DA 2Z7SA 3FY2A 4FV8A 1Q3DA 2PU8A 5HVKA 1J7LA 1KSWA 2QOFA 3HRBA 4DT9A 2J90A 2WQEA 3E3BX 2W1ZA 4YZ9A 1K3AA 2JITA 4TWPA 2UZUE 3OOGA 1YQJA 3M2WA 1Z57A 3QCQA 2ZOQA 2WOUA 4QT1A 5IA1A 4D9TA 4HVHA 4QP6A 3NWWA 4P2KA 4ZJIA 4YR8A 1IRKA 2OH0E 5C9CA 3DFCB 5L8LA 3NZ0A 4MVFA 4PTGA 2E9VA 3N4VA 1A9UA 2H9VA 2XIYA 5AAGA 5BVKA 4UMRA 5K3YA 4FUYA 2PUPA 1Q99A 2RG6A 2X6EA 3R28A 1Q61A 4JI9A 4ZSEA 4D4YA 3BV3A 2P33A 5HORA 3SD0A 4KABA 4GK2A 4DEEA 2JIIA 2GS6A 3DNEA 5CAQA 2W1IA 4AN2A 5A4LA 2O8YA 3HV3A 5I9VA 3FL5A 4DC2A 1R1WA 2X8EA 5BQ0A 4WO5A 3SA0A 5CQUA 4JR7A 2GSFA 4BIDA 2CKQA 1SVEA 4EYMA 3E87A 2VWXA 3Q9ZA 4FF8A 3TACA 1ZXEA 4YU2A 4ASDA 2RFEA 2GNIA 2XJ1A 1PY5A 1WBVA 3QLGA 4JOAA 4JG6A 4O0UA 4O81A 2VTNA 1OZ1A 3PJ3A 4FIEA 5JFSA 3OXZA 4FSWA 4IX5A 2XNGA 1LP4A 4NTTA 4RWLA 1GY3A 3DQXA 4BIBA 5E92A 4IJPA 2YM6A 4JBVA 1H01A 2YIQA 4AW1A 3M42A 3ZFXA 2AC3A 4AE9A 3R9OA 3KRWA 4DITA 4BBMA 2G1TA 4GL9A 4M66A 3F7WA 3Q4TA 5DGZA 3SV0A 2XCKA 4ASXA 2ZVAA 3KMWA 4E1ZA 2H34A 3VJOA 5JEBA 4BCGA 4DEHA 5J79A 5I3OA 5CEMA 2CN5A 3SC1A 1OBDA 3COIA 3QZIA 4RLKA 2Y7JA 5H8EA 5C03A 4RQVA 5LARA 4RA4A 3EZRA 5EYMA 4EEVA 3ZEWA 4BL1A 2BIYA 3ROYA 4IZ7A 2ZV2A 1R39A 4BHZA 4PMTA 3QAME 4ANNA 3O2MA 2QG7A 1PXJA 5D12A 3R8MA 4R3CA 4W4WA 4L52A 2BRHA 5G6VA 2F7EE 3NNVA 4G9RA 2YCSA 4RZVA 2OF4A 2VTIA 3GGFA 4GYIA 3FJQE 3IGOA 3R9DA 3DXPA 4ZTHA 3KULB 3LJ2A 4RWIA 4DAWA 1YXSA 3DXQA 2RKUA 3R9RA 4NH1A 5E90A 5FLFA 3QXOA 1O9UA 3EYGA 5FXRA 2BIKB 4IW0A 1NY3A 2HWPA 3KXNA 3L8PA 2UZLA 3E64A 3R0TA 4M69A 3UG2A 4BGQA 1V1KA 3OC1A 4O7LA 5E8UA 2UV2A 5EHYA 3T3VA 2QOQA 3PPZA 3Q4CA 3TNWA 2V22A 4NM7A 4FKOA 4GV1A 5IQGA 1HCLA 5HQ0A 5CSVA 2QKRA 3MPTA 4RA5A 3GCQA 3P08A 4AZFA 4FT0A 3UE4A 4AT4A 4CYJA 4NW6A 2JFLA 1M7QA 4KB8A 5LCKA 2XNMA 2CN8A 4U9AA 3P4KA 5KUPA 1OL5A 2J7TA 3BHVA 3UQFA 4MNEA 3FLZA 4IEBA 1G8SA 5L2QA 2ONLC 2R3JA 3RPYA 5CEIA 2BHEA 2C0TA 4H58A 3ZHPC 1H26A 4DYMA 5ETAA 4QMTA 2CLQA 4E5BA 3IK3A 3O50A 4KBKA 3VUIA 3TKHA 2WPAA 3I5ZA 5EKOA 3F3WA 3LLAA 1O6LA 2P55A 3WARA 4FE2A 3ZMMA 4QYGA 1WBWA 3KFAA 4L6QA 4W8EA 4NUSA 5DR2A 5HBJA 1ZRZA 3WYXA 2QKWB 5CYIA 2XEYA 1Y91A 4IAAA 4EOLA 3N51A 4C59A 2JD5A 4O1PA 5JSMA 3VIDA 4FKUA 3R7EA 5FWKK 5JGAA 1Y6AA 4HYSA 4NIFA 2CHLA 2HELA 3HMNA 2XZSA 4BTJA 3CGFA 4CZYB 5A6OA 5AAEA 2YDKA 5JQ5A 2XRUA 4J7BA 3FLQA 3ATTA 3F5XA 3WZUA 3GI3A 2OJJA 3NUUA 4U41A 4PV0A 4IDVA 3UOKA 2OLCA 4FK6A 4EHEA 2UW0A 3F3TA 2P2HA 4ZOGA 5CF5A 2CDZA 2XK8A 3BHUA 5CZIA 4FT3A 1ZWSA 4OUCA 3UYSA 4PMPA 1Q3WA 1UNHA 2J0IA 1XR1A 2DYLA 2PVJA 2F7ZE 2QI8A 3PTGA 4G6OA 3ZOSA 4IMYA 4LV8A 4ZY6A 4A9SA 5M56A 2P2IA 4O91A 2YWPA 3UJGA 5AUTA 4K6ZA 4GK3A 2VWYA 4HZRA 4FEUA 3SG8A 4L00A 1B38A 2BPMA 2WTKC 4QNYA 3BI6A 3FL4A 3VUKA 5FTGA 1KE6A 4YMJA 2WMTA 4IAYA 5C8KA 3MY1A 5HLPA 3GC7A 3HLLA 3OEZA 3PLSA 4J52A 3DOGA 2PZ5A 3LM0A 1YWVA 3TI1A 3G9NA 4EOKA 4XP3A 1YRPA 3VF8A 4CTBA 4C2VA 5D7AA 3IO7A 4TYHB 5AP4A 4EUUA 3MESA 4RJ4A 1OL2A 3A99A 3OBJA 4AZTA 1UU9A 2PUIA 3GCVA 3S95A 3E93A 4NYEA 4I20A 4Z16A 3GENA 1PKGA 4RX8A 3LJ0A 2J5EA 2XIRA 4FTIA 5DEWA 2Y4PA 4HCUA 2BRGA 4C3FA 2PZRA 3IDBA 3LZBA 3RP9A 3ZCLA 5IQHA 3KK9A 5JRSA 2WTJA 4Y8DA 1KV2A 3D2KA 4TZRA 1YDRE 4RMZA 4Z7GA 3RNIA 2WEIA 4ENXA 3TUCA 1OIUA 3PVUA 3QLFA 4JNWA 4FVQA 2YCRA 3AOXA 4IB0A 4JDKA 5TKDA 2OIBA 2XUUA 4MTAA 4F9WA 3DBFA 4FTQA 2XA4A 2Y6MA 2X6DA 3TJCA 5BX0A 3RZFA 3DQWA 4FGBA 4EBWA 2J0LA 4AOJA 5F94A 3OTUA 5H8BA 4GUBA 4F6WA 4F63A 1QPCA 5C1QB 4I5MA 4C58A 3LKMA 3UOJA 3NNUA 1U54A 4BGGA 4OAVB 2E9OA 2G9XA 3FQEA 3QYWA 5FP5A 3OWLA 4IFCA 3HV5A 5L2TA 4FTAA 2QOBA 1JSVA 1PXNA 2A27A 4RIYB 3W2PA 4AZEA 2GHGA 4YJTA 3OROA 1F3MC 3FZ1A 4QP4A 5KBQA 2IN6A 4RC2A 1SMHA 4H39A 1TQMA 2VWZA 1OL6A 4QPSA 2C0IA 4YLKA 4DGNA 4BY9E 3ZC6A 5LVNA 4YLJA 4EHGA 4QMNA 5CXZA 4HYHA 2HWOA 4NTSA 2V0DA 3ZLSA 3QTIA 3BYMA 3HZTA 4MAOA 4GK4A 4G3CA 3ORMA 2R3PA 4WG5A 5C4LA 2BAKA 3LOKA 3B2WA 4YTIA 5CZHA 3A7JA 2R3RA 5CVGA 1YHVA 2OGVA 3W55A 1UKIA 3H9OA 4F09A 4BGHA 3KXXA 3FPMA 4F0GA 5EK7A 4JAJA 5IU2A 4O6LA 3D4QA 4I4EA 1BUHA 5M55A 4HPTE 4OTRA 4EQUA 3PWYA 2ITZA 4FNXA 1E9HA 4YPDA 3UODA 4IWOA 4QP9A 3VRYA 2F7XE 3FBVA 2PUUA 3PA5A 4UYAA 4R8QA 4RWJA 4QMPA 3RNYA 4BDDA 2ITYA 2GPHA 4AS0A 3QA0A 4BVUA 3LPBA 1H28A 4IJ9A 3ZRMA 2C3KA 2JDVA 3NUSA 2QODA 4AF3A 4RFYA 3QX2A 1WMKA 2GU8A 2YZAA 3NEWA 3QF9A 5HNGA 2ZV7A 1X8BA 5T6KA 3ZLXA 4DH5A 2UW7A 3QTUA 3PVWA 2OZOA 1JWHA 4RC3A 3KCKA 3O71A 2OIQA 5KCVA 4D4SA 3BZ3A 5HIBA 4QYFA 5AR4A 2OJIA 3Q5IA 4PL4A 2A2AA 3W2CA 1OUKA 4U42A 2EWAA 3KXGA 4RVKA 3KMUA 2WNTA 1GIJA 4EJ7A 2R3QA 5HOAA 4TKSA 3W18A 5HBHA 2IVSA 4QTEA 3ANQA 4XG8A 2UVYA 3EQPA 5E7RA 5EOBA 3T3UA 3V3VA 2I0HA 5ANJA 4F99A 2OF2A 2OZAB 4C2WA 5CALA 4X0MA 4DINA 4HOKA 2XCHA 4LRJA 3TEIA 2YDIA 3SVVA 5I9YA 2R3HA 2XMYA 3AD6A 2H8HA 2XKFA 1T45A 2WZJA 3DBQA 2YJSA 5LVPA 3LCDA 4TY1A 2YEXA 3VS3A 4XJ0A 4EONA 1CKPA 3L8XA 4S31A 3R6XA 3ZM4A 4FGRA 2PVRA 1XH7A 2C47A 4I3ZA 4EZ7A 3RWPA 2IW6A 5J9ZA 5HESA 5F95A 2PWLA 2WU7A 3VHEA 3CLYA 1PXOA 3GC0A 2VTMA 5HZNA 4IB5A 2XEZA 2BKZA 2ETRA 2O5KA 3PXZA 4WG3A 5EDRA 2C5OA 3RPOA 5HD4A 4ZZOA 3UNKA 3AGLA 5BVDA 5KKRC 2CGVA 4FSTA 1ZZ2A 4GT3A 5CY3A 1JBPE 4BI0A 3C5IA 4FZFB 3UP2A 4JAIA 3KGAA 4KIQA 4L9IA 4TWNA 5HG8A 4X3JA 4CFUA 2WGJA 2G2FA 3NYVA 4RRVA 3DDPA 3O0GA 4IZ5A 3R8LA 4EK6A 3NX8A 3CC6A 2JGZA 3MPMA 4L45A 2J0JA 5GZ8A 2B1PA 3IW8A 4WUAA 4MK0A 2R3IA 3RK9A 3GCPA 3R30A 2C3LA 3LQ5A 2PVFA 4PNIA 3KN6A 2R4BA 2HAKA 4N6ZA 2XVDA 3FC1X 1VYZA 4XX9A 4BZOA 3OWJA 1ZOGA 4D9UA 1FMKA 3H0YA 4HPUE 3DS6A 5CLPA 4O82A 2G2HA 1WCCA 5TE0A 3EQGA 2UZDA 3BQRA 4JQ7A 5CEKA 4PP7A 2NRYA 5K9IA 4FTKA 5CEPA 4AT3A 3QU0A 5HE2A 2Z02A 3E8DA 3JYAA 5CANA 5AM7A 2BDJA 2VWWA 4FIGA 2ITQA 4TTHB 5ANIA 4LL5A 5J87A 4JBOA 5KHXA 5LMBA 3ORKA 3WZEA 3QQHA 3T9TA 5CXHA 2J6MA 3AMYA 3H9FA 3AT4A 2AUHA 3LIJA 1XH4A 4FKGA 4O86A 1OPJA 2VO6A 2WKMA 4B4LA 5IEXA 4JG8A 5JRQA 5HU3A 5CEQA 2JBPA 3HV7A 3MV5A 5DOSA 4ZSGA 4EH7A 4FV5A 4H3BA 5ANGA 3DCVA 2QVSE 3FMEA 4BWXA 1URWA 2XBAA 3ZUUA 4R7BA 1NA7A 3VUHA 4I22A 1JVPP 2OI4X 4N70A 5AV1A 4C62A 4TPTA 3UOLA 4C4EA 2BAJA 4DFUA 4U3ZA 4YZDA 5JH6A 4J98A 2W1CA 4BWKA 3DBEA 3U6JA 3I7BA 4FV6A 4ZP5A 3LFDA 5EKNA 4JJRA 4K1BA 3R73A 5HE1A 4YJVA 5G1XA 4X2GA 1XH6A 3TKUA 2C5XA 5CVFA 1JOWB 4ZTMA 3C50A 3QTSA 3TWJA 2BTSA 4QTBA 5DPVA 3CQEA 3VC4A 4HNIA 5E1SA 5BMMA 3KREA 3DKCA 2XYNA 1Z5MA 4I93A 5A46A 4GFMA 3NR9A 5C4KA 5FGKA 3Q6WA 4IM3A 4AZWA 3ULIA 3QQJA 4PMSA 3PSDA 3DJ7A 3UYTA 3GEQA 1KV1A 3LFEA 4IFGA 4YO4A 3UZPA 3FHRA 1OMWA 4N4SA 3P7CA 1QCFA 1RW8A 4M0YA 5JGBA 3FZRA 5AUZA 4XP2A 5IH5A 1OUYA 4QRCA 1P2AA 3QC9A 5J5TA 2KTYA 1JNKA 3ZUVA 4MCVA 2VO0A 3A4PA 2PMIA 3C4EA 4NKSA 4TXCA 2C5VA 4FG8A 4D1XA 2W1EA 4E4LA 4F0FA 4CG8A 1WVWA 4FL3A 3DU8A 3F2NA 3LCTA 4OTWA 1YDSE 4ANBA 3L9NA 2VTTA 4JQ8A 4RFMA 5EHLA 1GIHA 5AP7A 3FYKX 1YVJA 3ZLWA 3VS7A 4D2WA 5EOLA 3FY0A 4BDBA 1ATPE 4U43A 3SRVB 4AP7A 5HCYA 2XK7A 5HNIX 2V7AA 4YC6A 4B8MA 3ACJA 3BKBA 4F08A 3H30A 3ZZEA 3ANRA 4I24A 1KOAA 3TL8A 2GHLA 4AA0A 5E1EA 1H08A 2QLUA 2ZB0A 3FZOA 2C6OA 5D10A 3OMVA 5EHOA 2C5YA 3U54A 3FI3A 3MH1A 5ETIA 4UEUA 5A54A 4FZAB 3CR0A 3DAJA 4U44A 1GZ8A 3P78A 4YJPA 3SXSA 4O38A 3L9PA 3VUTA 4QMXA 3DGKA 4YPSA 3PPJA 4QP7A 4QQCA 2OO8X 4FTNA 3D0EA 3PP1A 4AG8A 1UWHA 4QMZA 3F9NA 3QQGA 3QUDA 4C36A 2WMXA 1W0XC 4H1JA 1P14A 5AR8A 3GC9A 4JDHA 4I23A 4ZMFA 1YKRA 3QCXA 2YN8A 5DE2A 3VHKA 1YW2A 1CKJA 4RSSA 4FX3A 2QHMA 3QCSA 2JKQA 3CE3A 3EWHA 1LEWA 4FKWA 1MUOA 4CFWA 4JQEA 4ZTNA 4A7CA 2FB8A 3V5TA 5E8TA 3LAUA 3VS1A 5IZFA 5KMNA 1PMEA 3MFSA 2ZV9A 4KRCA 4BKYA 2ZB1A 4E6CA 3CJGA 5FDPA 4JX7A 4HVGA 3CGOA 3D2IA 2OFUA 2WTIA 2XKDA 4OBQA 5TT7A 4LUEA 1O6KA 3F61A 3FMMA 1GZKA 3FMDA 3ZFMA 5AIRA 4ZTLA 3MH3A 3I7CA 4WSQA 4RIWB 4TNBA 5FDXA 2YHVA 2WMRA 4ZTSA 3ZLYA 3SQQA 1R78A 4NSTA 2E9UA 1QPDA 5C27A 4R78A 5DT0A 4JDJA 1UNGA 2Y4IB 2PVLA 3FLYA 3JS2A 4IC8A 2CKOA 2IWIA 3KRLA 3TUDA 4C3PA 3F7ZA 3MPAA 3POOA 3ZO2A 5C8NA 4FK3A 1UVRA 3DJ5A 4O0RA 5T68A 4EC9A 3MJ1A 4H1MA 1H0VA 3F6XA 4L44A 4CTCA 2B54A 4WRSA 3DZQA 4Y46A 4Y85A 5CF6A 3CKWA 1H0WA 4A4LA 1XQZA 3LW0A 5DH3A 2RG5A 5HG7A 3UVQA 3WYYA 3ROCA 3WZJA 4OR5A 3Q3BA 4KSQA 2X2KA 1WBSA 4ARKA 2XJ0A 2XP2A 2R7BA 4UX9A 2PE0A 3HX4A 4FIHA 4RVTA 3ALOA 5IEVA 4GYGA 3RINA 3EQIA 2DS1A 3I0QA 5AV0A 5IKWA 3RPRA 1G8AA 4QP2A 1LR4A 3VVHA 4V05A 3KKVA 4RX7A 4BCJA 4EK3A 1PMVA 2W0JA 3W10A 2W5BA 4ANSA 5IA2A 1PXMA 2XK6A 3QCYA 5JFVA 2OJFE 4U79A 4DE4A 3Q9XA 4U7ZA 3VBXA 4I6BA 3MH0A 4J71A 4FV4A 2XRWA 2PK9A 2VNWA 3G51A 3R7VA 5IQCA 4AOTA 5CU0A 4JS8A 4TRLA 4U5JA 3LQ8A 2X8DA 2BZJA 4QD6A 5ANDA 5J5SA 2BDWA 2EVAA 4DTBA 3C4WA 3CCNA 3L9MA 1U59A 4JL9A 4X2KA 5GJGA 1U5RA 4RLLA 3OW4A 4E26A 4LRKA 1NXKA 4OBOA 2R9SA 4O22A 4I6FA 1REJA 2WQBA 3H0ZA 4MXOA 4W9XA 5H2UA 2ITNA 5FTQA 4YJSA 4J8NA 3ORIA 3BHTA 3RAWA 3KXHA 3SOAA 4YJUA 4JIKA 5K5NA 4WD5A 3WI6A 5KMIA 3ORLA 4NM3A 1FINA 3EQDA 1GNGA 2PYWA 3D5VA 3F69A 2YACA 5DMZA 4O84A 1SM2A 4C34A 3COKA 4ZAUA 2HW7A 3EH9A 4IADA 2E2BA 5I9WA 2B0QA 4QNAA 5GZ9A 2Z8CA 4MF1A 4ASEA 1J91A 2C0OA 4BDHA 1L3RE 3NAXA 4S32A 4FBXA 5CF8A 3NUPA 4L68A 4CFFA 2NRUA 3R02A 4I6HA 3Q52A 4TWOA 2C69A 4RC4A 4EWHA 3MGYA 3QRJA 5M57A 3G0EA 4K9YA 4G6NA 3QGYA 5IQAA 1UV5A 4O0TA 1KE7A 4M84A 2BRNA 4FKIA 5DA3A 3QHWA 5JFWA 1NVRA 3OS3A 4USFA 2IPXA 3W8LA 2B9JA 3G5DA 4HGSA 4XUFA 4AT5A 4FNWA 4C7TA 3GU8A 1OM1A 2X4FA 3QQUA 3RBWA 4DEDA 3VAPA 3RZBA 4L3JA 2C6DA 2YAAA 4KKEA 4L8MA 3GU4A 5AAFA 2XKCA 2PY3A 2SRCA 3PLAE 5ACKA 1ZMUA 4XCUA 4YJNA 1E1XA 1ZOHA 4O7YA 4EH4A 2BCJA 1MRYA 2ERZE 3WILA 2WTDA 1AQ1A 4RVMA 3SXFA 3RWQA 3VS0A 4B8LA 4E5WA 3TG1A 3OFMA 1O6YA 5KMMA 4FZ7A 2GMXA 5FTOA 2NP8A 1ND4A 4FICA 3DV3A 5KBRA 4Y83A 2YERA 4EZ3A 3HYHA 4Y73A 3Q32A 3ZTXA 3BU5A 2VWBA 1WBTA 4FMQA 2VV9A 3DBDA 3PIZA 4X7QA 3ET7A 4FTOA 3ORNA 3WZKA 4ZJVA 4QMWA 3S3IA 4BYJA 2A19B 4F7NA 4CD0A 4O7RA 2OIDA 3MVHA 3NW6A 3AC8A 5CX9A 4L53A 3MFTA 4BTKA 4M14A 2BR1A 3R8UA 3I81A 2OJ9A 3O8TA 5AEPA 4DA5A 4M69B 4AQCA 2QURA 2W99B 5DI1A 4I5CA 1JSUA 3U6HA 5K4JA 4LRMA 3ZS5A 3CS9A 4FZ6A 3UGCA 1Z9XA 4D2PA 3BBWA 3LM5A 4O0VA 5B0XA 2Q0BA 1RDQE 3GCSA 4BI1A 1YOLA 3BIZA 3DFAA 4ZZNA 5IA5A 3MWUA 3C4ZA 5CI6A 4ANLA 5I5ZA 5CU3A 3C51A 2X1NA 3P5KA 4IX6A 2WTVA 4IWQA 5AP6A 3ZDUA 1OB3A 1H4LA 3R9HA 3THBA 5EDQA 3R1SA 4BCIA 2BFYA 5EW8A 2VTSA 4DG0E 3KULA 4M67A 2CCHA 4C4HA 5CAVA 3QQFA 4LMUA 4CVAA 5HCXA 4EWQA 1H27A 1TQPA 3I5NA 3EB0A 4CFMA 4DGOA 4ZLOA 3R2YA 4GU9A 5H3QA 3IKAA 5FBNC 5HCZA 2WTWA 5TOZA 3R7YA 3SW4A 3U4WA 1Q5KA 4AGWA 2ITPA 1UNLA 4FOCA 4NT4A 3DK7A 2WXVA 4FIIA 4FT7A 5EI2A 1Q62A 4O2PA 3H9RA 4RJ8A 4CKJA 2I7QA 2WU6A 2XJ2A 4CT2A 2Y9QA 3BYSA 5J9LA 5I9UA 3PXYA 5KMKA 4DGGA 4MYGA 3OXTA 4CCBA 2Z2WA 3GU6A 1Q8UA 2W5HA 1FGKA 3QUEA 2VTQA 2W4OA 1DI9A 5EYKA 4PNKA 3U55A 2W5AA 2X9FA 3PG1A 2VGPA 3QD2B 4NIFB 3VBYA 3EFKA 3QGWA 4RBLA 3UMXA 3R21A 4C02A 3QYZA 3R71A 3UOHA 4FG9A 4DEGA 5EYCA 2DQ7X 3KN5A 5LMKA 2ITTA 5J1WA 2PZYA 3BEAA 1H1RA 2A0CX 4KA3A 3V5WA 4S2ZA 5A14A 2ITXA 4ZTRA 5IA0A 4DLIA 4RJ7A 3PXFA 4V01A 5BUIA 5AV2A 4R1YA 3UO4A 3NCGA 3WBLA 3EQHA 3IW5A 4EC8A 4FEVA 1ZLTA 5CT7A 4QTCA 2XNOA 3KL8A 4N57A 3OP5A 4BR3A 4KWPA 1XH9A 2YM5A 4L67A 4RZWA 2XH5A 3TUBA 2V5QA 4WNMA 4JVGA 1PYEA 4QP1A 4QQ5A 3WF6A 5KKRB 2YJRA 3OD6X 5HICA 4CRSA 4XV2A 1Q24A 4O2ZA 4UALA 3O51A 4BTMA 1V0OA 2BZKB 2VD5A 2YIXA 4FEQA 4UXLA 2V55A 4CZUA 4NCTA 4OT5A 3KMMA 5LWNA 2CGXA 2UZTA 1R0EA 3LJ1A 4QMQA 3ZFYA 4FEXA 2JAMA 3LFAA 5IDPA 2QOLA 2YIRA 4A07A 3UP7A 2X8IA 3IG7A 4FKQA 2GNLA 5CU6A 3E88A 3KF4A 2YA9A 3QRKA 4FTMA 4X2NA 3DKGA 4R6VA 3CBLA 3DB8A 3TZ9A 3V8TA 4USEA 3ACKA 1LEZA 2UW5A 5EQEA 2UZOA 3A4OX 5FBOA 2R2PA 1S9JA 3QKKA 3RHKA 4X6RA 2B55A 2X39A 4EOJA 4XV1A 3NS9A 3EFWA 4G6LA 2J50A 2QU6A 3PIYA 3BGPA 4DBXA 5I9ZA 3ULZA 4OBPA 4GMYA 2RL5A 3BHYA 5ACBC 3C13A 3QTWA 1R0PA 1UU3A 4ANQA 2GQSA 4KKGA 3LFSA 2QLQA 3NRMA 3IOPA 3ZRKA 4JR3A 1JKLA 1KOBA 3CXWA 3KC3A 5IDNA 3QRUA 4GJ2A 3JPVA 1OIQA 4XH6A 3UO5A 4YUQA 5HLNA 3R1QA 4L42A 1PJKA 4TYHA 3BYUA 3WIKA 2VTLA 1LUFA 5AP0A 4CGAA 3FZPA 4QMSA 3HMOA 3PZEA 3Q60A 4I0TA 3TTJA 4EH8A 2ACXA 3LFQA 1IA9A 1FPUA 4CKIA 3BLQA 2JDRA 3P9JA 4E93A 4JG7A 3EMGA 4YJQA 4BDEA 5A9UA 4HNFA 2DWBA 3EN5A 4W4XA 3V6RA 3FYJX 1IR3A 1VR2A 3S1HA 3QWKA 3RM6A 5IPJA 2HW6A 4DLJA 5K5XA 3MB7A 2XF0A 3WIGA 3C1XA 3NYXA 4WBBB 2C68A 4EBVA 4XBRA 1NVSA 1OPLA 4QMYA 2BZHB 5E8WA 1DM2A 5CSXA 2B7AA 4K33A 4EJNA 3GQLA 3JR1A 1DAYA 5AR5A 4G31A 4I1ZA 5HI2A 3MS9A 4E3CA 5J7HA 4AN9A 3PE1A 3V5PA 1IEPA 3HV6A 4B7TA 1CSNA 4IX4A 1WBPA 4A06A 4AGDA 4EOPA 3ZU7A 1JKKA 3UQGA 3AXWA 2PUNA 4Y5HA 3R9NA 1M2QA 5DBXA 3A7IA 2Z60A 4AOIA 5IISA 3PSCA 1J1CA 5AUYA 4UXQA 3FI2A 5EH0A 1XJDA 3W2OA 3GQIA 5C01A 3RI1A 5L3AA 4LV5A 5IEYA 4CV8A 3R2BA 4A4XA 3KRXA 5F4NA 5T3QA 4B9DA 4Y5QA 4BF2A 5CWZA 5C26A 3OHTA 3N4UA 4YURA 2UZNA 3EFLA 3ZH8A 3EJ1A 3I0OA 2CLXA 4BCNA 3V01A 5L8KA 4WSYA 3UVRA 1BYGA 3H10A 3NIEA 3MW1A 1Y8GA 3C4FA 3BX5A 3DKFA 4FSZA 4JRVA 3FQHA 4YZMA 5B7VA 3KU2A 3F2RA 3PG3A 4F1OA 4KNBA 4FV0A 5BNJA 1AGWA 4FSYA 4O21A 3JVSA 3EYHA 4YP8A 4M12A 1Y8YA 3PVBA 3F66A 4FODA 2ZM3A 5A4EA 5KZIA 3KA0A 1BI8A 2YM7A 4AUAA 4O6EA 3UZTA 4XLVA 4UZHA 2QO2A 5FXSA 5AV4A 2QD9A 5DR9A 2JKMA 2F49A 4TN6A 2LAVA 3Q5ZA 4IANA 4D2VA 3CQUA 2BAQA 4AZSA 2PE1A 4WG4A 1R3CA 4UMQA
chains in the Genus database with same CATH superfamily
3OUKA 2VX0A 4ID7A 2V62A 1AD5A 1ZY5A 2PVKA 4XBUA 4O7NA 5EI8A 2R3FA 4O4BB 3TTIA 4BDFA 4MH7A 2EXEA 3FXWA 4LGHA 3RJCA 4QQTA 3Q2JA 3ERKA 4J96A 4ZTQA 5CAOA 3VNTA 4CNHA 4L3PA 2R0UA 3O5AA 3HUBA 4O7WA 4DHZA 2O2UA 1BL7A 3PA4A 4O0XA 2XK4A 4AAAA 4M8TA 4A9YA 5KMOA 3U9NA 3VO3A 3QD0A 4FVRA 1PW2A 3FDNA 5K0XA 4Q9SA 1JKSA 1ZYLA 4RIOA 4TL0A 1YWNA 2XYUA 3D5UA 3LLTA 5BVOA 4NJDA 5F20A 3SHEA 3PPKA 5KNJA 2XM9A 3QALE 5LJJA 5LVMA 1ZYJA 4D1SA 4QDVA 2PMLX 4X3FB 3HGKA 3IDPA 5JK3A 3TDVA 3EQBA 4EH3A 2OICA 4JLCA 5LMKC 4R1VA 3AT3A 3GB2A 3UVPA 3D5WA 3GOPA 5E8XA 2G01A 2BZIB 3AG9A 3LHJA 3MBLA 2J2IB 2W4JA 3OBGA 4LFIA 4XG3A 1JSTA 4KS8A 4G2FA 4P4CA 1Y6BA 3KIOC 3K2LA 3PJCA 3QQLA 3C0IA 3FZSA 2V7OA 1W7HA 4LMNA 4PWNA 4XS2A 3RCJA 4GKIA 5D9HA 4KS7A 3Q4UA 4P5QA 5CTPA 3FAAA 4DGMA 1QL6A 3V8WA 1XHAA 5D1JA 4G3FA 4QMUA 3FMNA 2Q83A 4D55A 3UBDA 1UKHA 2OZAA 4EYJA 4ACMA 1YI3A 4YNOA 4I0RA 1MQBA 3EL7A 1YDTE 4WT6A 1I44A 5IUHA 4XYFA 3KXMA 3O7LD 4NCTC 3ITZA 3DAEA 1Q4LA 4ENYA 2YAKA 4UMPA 3SXRA 4CT1A 3AC3A 3W0OA 3VJNA 4NEUA 3C0HA 4FTLA 3DB6A 4O7TA 5LMAA 2PSQA 4ACGA 3TM0A 3Q2MA 3V6SA 5IH6A 3HRCA 1STCE 5AUWA 2XKEA 2IZTA 3IQ7A 4E4NA 3O17A 2C1AA 2YIYA 4PDSA 4F78A 2YDJA 3HMMA 3ZDIA 2OBJA 5FEEA 4FT5A 1P4OA 3VRZA 4QO9A 3ENHA 4PDOA 4PL3A 3GOKA 3FWQA 3AKJA 4MXZA 2WQOA 2WELA 4W9WA 1OGUA 4ZS4A 1H24A 2W9FB 2YLEA 4F1MA 1GJOA 4AZVA 3FEGA 1ZZLA 4A4OA 5M07A 4XLIA 4LI5A 4C3RA 4DCEA 1YXXA 4CFNA 3PZHA 4BWPA 2BRMA 4MKCA 5GINE 2FVDA 4FSMA 3UIXA 5IH4A 1PMUA 2GDOA 4FV2A 4BTFA 4KUJA 2YM8A 4CQEA 1OIYA 2FSOX 2P4IA 3RK7A 4A9TA 3HMIA 1J7UA 3FHIA 2IVVA 2IW8A 2IEWA 5LVLA 1FVTA 5IMXA 4FG7A 5DWRA 2VRXA 5AR3A 4HVSA 4DCAA 4TYIA 3B8RA 3OY3A 2ZDTA 5J7BA 2BHHA 3SX9A 5AV3A 4KIKB 2Y6OA 1PF8A 4YSJA 4XMOA 2R3GA 3FXXA 5KZ0A 1DAWA 5AMNA 3ETAA 3OOMA 3SLSA 1OL7A 5HG9A 5IQFA 1PRYA 1OKVA 2A4LA 2W1HA 3EQRA 3HNGA 4L01A 4APCA 2UZBA 4RX5A 2HXLA 4H36A 3BLRA 2YLFA 1V0PA 4Q5HA 2UW4A 2UZEA 3BV2A 3EN6A 4LOQA 4Z9LA 2HCKA 2PVHA 2QOCA 3MVJA 4G34A 4MXCA 2F57A 3F5PA 3Q4ZA 3FMKA 1URCA 3D83A 4HYUA 5AUXA 4NU1A 5GJDA 2J0MB 3JUHA 5IA4A 4HVDA 5GIPE 2ITVA 3ATSA 3G6GA 1U5QA 3GU5A 3I60A 4IVDA 4XOYA 2O3PA 1MRUA 2B9IA 3D94A 5FRIA 3BU6A 5M44A 3DJ6A 1FOTA 2H6DA 3GCUA 5AADA 3R8VA 4O0YA 3JVRA 3BPRA 1YHWA 3CJFA 5K4IA 3N9XA 1XBAA 4HW7A 3MDYA 5HVJA 4ITJA 3QA8A 3M11A 4FC0A 3AC1A 5TO8A 2F2CB 2HYYA 4AWIA 1OPKA 4RGJA 3PXQA 5D41A 4UWYA 4QP3A 4BDCA 2OXDA 5ETFA 4KRDA 2XBJA 3C9WA 5FQDC 4RG0A 5ANKA 1XWSA 5C8MA 1FMOE 2VTHA 3ZM9A 1FVRA 3VN9A 4RIXB 4DFBA 1YXVA 3EOCA 3I79A 4Y72A 5AP1A 2Y0AA 4YTHA 5B2LA 3OT3A 4EH6A 4BI2A 2VGOA 4MBIA 4LL0A 5BUEA 5E8YA 3UDZA 2A1AB 3A8WA 1REKA 2AC5A 2QR7A 3EZVA 1H1PA 2C6EA 3TXOA 1BX6A 4K8AA 2YIWA 2IF8A 2JIVA 4ONAA 4W4VA 3V8SA 3FI4A 3CTJA 4D4VA 4FTUA 3TJDA 4O7VA 2IZSA 1Q97A 4UBAA 1IG1A 4X2FA 5BYYA 2PTKA 4QYEA 4F7SA 2H96A 3IPHA 2YM3A 4NL0A 3CEKA 4AGUA 5L2IA 4E8AA 2GS7A 1KWPA 2R3MA 3QXPA 3TT0A 3RKBA 4Z3VA 4IHPA 3NSZA 4AA4A 4FL1A 5B2MA 4MWIA 2CKPA 4JX3A 4ZLZA 3HA8A 1RQQA 5AJQA 5CT0A 5AR7A 1FVVA 4PDYA 4LGDA 4O7ZA 2VTRA 1P5EA 3DA6A 3TNQB 2WMWA 1FBNA 1CMKE 4BKZA 3ORXA 4D0XA 4GVJA 3RK5A 2GCDA 4G5JA 4JBQA 5FD2A 2C6MA 2JKOA 3MSSA 4ZZMA 5ICPA 3Q96A 3E3PA 4IB1A 2WAJA 3IOKA 4EHVA 3KQ7A 5CNOA 3S00A 4IAKA 4GCJA 4PPAA 3SRVA 3EHAA 2JDOA 5LWMA 3UTOA 3OCBA 4A9UA 4EORA 3ZO4A 2XAOA 4I5PA 3CP9A 4IDTA 4OLIA 2VTJA 1W83A 1CTPE 2QR8A 4II5A 4D5HA 5E9EA 3AC4A 3FUPA 3QD4A 3ZONA 3DY7A 3EL8A 2VTOA 3OCSA 5JT2A 2BDFA 2P3GX 3E62A 4AQKA 1M2PA 3BU3A 3W2SA 4ALWA 3GBZA 3MFRA 3LXNA 3O96A 3UPZA 2GQRA 3NAYA 1JAMA 1V0BA 4FYOA 4MHAA 4XOZA 3HP5A 2GHMA 3D7TB 3II5A 4HGLA 5DVRA 3REPA 4E73A 5JKGA 4G5PA 3F88A 3R04A 2EU9A 4MQ2A 1ZARA 1WBNA 3G15A 3P23A 5EI6A 4YBKA 5EM8A 4GG7A 2J4ZA 2X4ZA 1VJYA 2BTRA 4IVBA 2X9EA 3W1FA 3PXKA 4BDJA 4NKAA 5FEQA 3S2PA 5KO1A 2XALA 4PPBA 4YTFA 3MVMA 3UDBA 4UWBA 4YHFA 4ZEGA 4AW5A 4NW5A 3C0GA 5CSPA 5AUUA 4L43A 3EFJA 3NPCA 3PIXA 4XG4A 4UWCA 4DH7A 4K11A 3G33A 2WOTA 4S30A 3L8SA 3QC4A 3VBWA 4ITIA 2ITOA 3W0QA 3BE9A 5IQEA 2ZM4A 4RIWA 3B2TA 5J1VA 3MTFA 4AE6A 3DPKA 4YSMA 4ASZA 1CDKA 4BYIA 4CMUA 4YC8A 4OTGA 3V5JA 3VQUA 5M4IA 3TNIA 1F0QA 4IH8A 3OY1A 5CS6A 2IG7A 2J5FA 4XG2A 3QHRA 4F9BA 2YCQA 3R7UA 2QNJA 2QOHA 4F4PA 3W2QA 4DTAA 1ERKA 2OJGA 2OKRA 5IQBA 4TWCA 2C6IA 2RGPA 3KCFA 2CGUA 3DLZA 4G3DA 3BLAA 4FV3A 2ZAZA 4CXAA 1IASA 4V0GB 3FLNC 3R8PA 4C35A 4PL5A 2WTKB 2FSMX 4YGAA 2BMCA 2JBOA 3EN9A 4F70A 1XH8A 1UA2A 5LVOA 3NCZA 3EN4A 2YFXA 3CTHA 4FL2A 4LM5A 3MFUA 3L1SA 2B9HA 1QPEA 3LXKA 4E5AX 4PPCA 1OECA 3HV4A 4EH2A 1OVEA 5M4FA 1EH4A 2WO6A 2UUEA 4C4FA 5E8VA 3MIAA 1FGIA 2G2IA 5M4UA 4ZSJA 2XM8A 4FEWA 3QZFA 2FGIA 1Q8WA 3WF9A 5L2SA 5HO7A 3FKOA 4D1ZA 4LQMA 2QU5A 3F3UA 3RCDA 1S9IA 2R3KA 4PY1A 4FYNA 3DLSA 3PA3A 2RFDA 3QTQA 1CM8A 4RJ6A 5KE0A 4EQMA 4AU8A 4ALVA 4MXYA 3MA3A 2JDTA 3ZSHA 4AXAA 1HOWA 5DLSA 2VWVA 3TDWA 2OXYA 5IUIA 4I92A 2HOGA 3VS4A 3IONA 3UMWA 4W8DA 2VAGA 2QCSA 3AD4A 2CNVA 5JFXA 4BN1A 3RPSA 4FTTA 3WE4A 2AEGA 2F4JA 1M7NA 4MBJA 5KMLA 3AKLA 3L9LA 5HTIA 4J53A 3F3ZA 3K5UA 1FQ1B 5HBEA 4EOQA 4ZSLA 5LOHA 2ZMDA 1W8CA 4AW2A 4RFZA 4UMUA 5KMJA 3KK8A 2R5TA 5FM2A 2B53A 3GFEA 4O4EA 4YHJA 3BCEA 3CY2A 4DG2E 5IQDA 2UZVA 5HD7A 4I6LA 1M14A 3D15A 4O4CA 3F5GA 4OW8A 4X6QC 4D58A 4QMOA 4BDIA 4IZYA 4XRLA 4ERKA 1SVGA 4DFLA 2J0KA 2X7FA 3NVKI 4F7JA 3D14A 2EB3A 4PTCA 3OWPA 3QX4A 5D7VA 3QFVA 2NPQA 1OKZA 2BILB 3KRRA 4L46A 4UY9A 4CYIA 4IVAA 2HIWA 5AA9A 4C4GA 1T46A 3O23A 5EYDA 5FG8A 3CPCA 4B6LA 3KXZA 3FLWA 1JLUE 3K3IA 1XBBA 4QYHA 2R3OA 5GHVA 4UV0A 2KULA 3TZ8A 4YZNA 5FEDA 1H00A 2QONA 1WFCA 4IB3A 1G3NA 4M0ZA 1TZDA 4X2JA 3VULA 1G5SA 5HO6A 4QMMA 4UZDA 3R8ZA 1PXIA 3BWJA 3ZUTA 3H4JA 3W16A 3PXRA 5HLWA 5TF9A 3W0RA 1KE8A 3BQCA 2YISA 5CNNA 4ZXTA 3ZO1A 1A48A 1GAGA 5E4HA 4MD9E 4BCPA 4DH1A 3ZRLA 4M15A 5KX8A 1RE8A 3UO6A 1JPAA 4FTJA 3R00A 3L8VA 4GW8A 4GS6A 2XIKA 2QHNA 3ODYX 5CENA 4DH3A 4A9RA 4O0WA 3VBVA 4E20A 4ZIMA 4FIJA 4R5SA 2HZ4A 4YJOA 3O8PA 3HUCA 4FSRA 3AC5A 3W0PA 5LXMA 4DT8A 3E8EA 2A98A 4DH8A 1W82A 4D0WA 4GH2A 4HGEA 4O83A 4EK8A 3E92A 4EZ5A 4YJRA 4E4XA 1PXKA 3PSBA 3FMJA 4C4IA 4CZTA 3LFNA 4E6QA 2GNGA 1KUTA 4MNEB 2ZDUA 3BHHA 1B39A 3GC8A 5K0KA 4ALUA 5AP2A 3W2RA 3HDMA 3T9IA 5DNRA 1TQIA 3HAMA 4QYYA 4BHNA 3H3CA 2GNHA 5KHWA 4CSVA 4F64A 3FSFA 3E8NA 2YWVA 1KE9A 3KVWA 3MN3A 5DEYA 5HTBA 4O7SA 4AXFA 2XIZA 2R0IA 3R63A 2JAVA 5HVYA 1APME 2F2UA 4R7HA 3RHXA 3TCPA 4BB4A 3PFQA 4TNDA 2R3NA 3SDJA 2OH4A 4FV7A 3WF7A 4XP0A 4CLIA 3IDCA 2QC6A 4R5YA 2O65A 4H3QA 4FTRA 2WB8A 4KINA 2XB7A 4FV1A 3ID6C 5CVHA 3NUAA 1ZY4A 2VNYA 3GXLA 1MQ4A 1OKYA 1WBOA 3HRFA 4G9CA 4GG5A 4WKQA 3S4QA 3ZO3A 4H3PA 4FV9A 4YO6A 2R7IA 4BFMA 4NK9A 4F9AA 3AMAA 2G15A 3R01A 4ZY4A 4WIHA 4ZK5A 3V5QA 5GNKA 3A7FA 3U4UA 1W84A 4FKPA 3FZTA 3O8UA 1OGYA 2X2MA 1SZMA 2Y4IC 3UG1A 3QQKA 4WRGA 3NUXA 3QL8A 2C3JA 3QTRA 3ALNA 3B8QA 4KBAA 5DRBA 3DTCA 2UVZA 5DFPA 5HKMA 4Q9ZA 4UYNA 2FYSA 2PHKA 4CMTA 4RX9A 4PDPA 3GVUA 5D11A 3GP0A 4GJ3A 3VF9A 4XV3A 1DS5A 4CCUA 1H8FA 3KF7A 3MYGA 3HA6A 5HGIA 2XK9A 3NNXA 1Q8YA 2HY81 3VBQA 3LXLA 3MTLA 1ZOEA 4W4YA 3U87A 4D2SA 3PUFC 3OCTA 2BFXA 3COMA 3F3VA 4PUZA 4F65A 3HAVA 4QP8A 2W1GA 3MVLA 5E8ZA 4K18A 5EG3A 1Q41A 4BIEA 2PMNX 3TV6A 3NIZA 2OU7A 3RAIA 2WFYA 4ZLYA 2BUJA 2O63A 3EQCA 4MQ1A 2IVUA 4IAFA 5M53A 4I6QA 2HZ0A 1CKIA 2OK1A 4N6YA 1U46A 2ZV8A 5BVNA 3TMOA 5M06A 1YI6A 4CQGA 3TNPC 2O0UA 3CTQA 2ZMCA 4HGTA 2Z7LA 3BYVA 3CQWA 3G9LX 4R3PA 4IXPA 3GNIB 5EQYA 2R3LA 1BL6A 5AX3A 3RAHA 5EQPA 2CGWA 3LFFA 3JY0A 5L6PA 2F9GA 4FKJA 1M17A 3AKKA 4J95A 1TKIA 4MX9A 4D5KA 4FKTA 4YLLA 2IZUA 1XO2B 2WEVA 2VZ6A 4DN5A 1H1WA 2YITA 4L3LA 1QPJA 2R64A 3A7HA 4E6DA 2W05A 3EN7A 4GT5A 2PZIA 4GUEA 1F5QA 1M2RA 2CJMA 5ETCA 4BDKA 3FMLA 4U81A 1SVHA 2IO6A 3CPBA 4DEBA 2QO9A 2GNFA 5HEZA 2OG8A 4HJOA 4MF0A 1ZYSA 5J8IA 4EHZA 4MXAA 3R22A 4TT7A 2PMOX 4YBJA 3HL7A 3PJ8A 5BPYA 3DKOA 5CEOA 2C6KA 4BKJA 3IGGA 3D5XA 2HENA 3QTXA 3SKCA 1KE5A 2CNUA 4NJ3A 3A61A 3VUDA 1U54B 4AFEA 5GZAA 3FMHA 1Y57A 3UNZA 4O0SA 3PUPA 4AGCA 2Y8OA 3NFGB 4RVLA 5EM5A 2PPQA 2P0CA 3VW6A 3ELJA 4XHKB 4WNOA 4RWKA 3V51A 4I4FA 4FUXA 1YXTA 2JFMA 2WMBA 4FSUA 4QOXA 4K77A 3LMHA 2WMUA 2CSNA 1YOMA 4MD8E 4QMLA 2ZM1A 3LXPA 4DFXE 5IA3A 4ZMEA 4LDTA 3KVXA 1PMNA 3WZDA 4G16A 3ZEPA 3UIBA 2FUMA 2UW8A 2X7GA 2GQGA 2C6TA 2OWBA 4PRJA 3W33A 3RMFA 4K0YA 4CMOA 1BI7A 2ERKA 3UNJA 4IQ6A 3R1NA 1H25A 2RFSA 5AIKA 4FSQA 1PXPA 3LQ3A 4GSBA 2WD1A 3QTZA 5DHJA 2GS2A 3AC2A 4BCKA 4NWMA 4CG9A 2VX1A 3E5AA 4FT9A 5IQIA 3UIMA 4APPA 5ITAA 4FKLA 4X21A 5DR6A 3MY0A 1WVXA 3IS5A 3RPVA 5E8SA 4RIYA 4QQJA 4WNKA 5AA8A 3S0OA 1YHSA 2QOIA 2RSVA 1IAJA 4AXEA 1GZOA 3ENMA 4DFNA 3PVGA 3U9CA 4ANMA 4NFMA 1VZOA 4IE9A 3NW5A 5E91A 4EH5A 4C57A 3Q9WA 3VW8A 5AUVA 4ZSAA 1B6CB 3NDMA 2XNPA 4E4MA 3BL9A 1H1SA 2GTMA 4LOPA 4OTHA 4BZDA 4JRNA 3M1SA 2BALA 3LFBA 4FR4A 4GKHA 4UMTA 4IM2A 2VWUA 3SW7A 4BJJA 2VTAA 3E63A 4U3YA 3GU7A 2I0EA 2X81A 5CAPA 4EH9A 4L7FA 5CSHA 1SNUA 4C38A 4AXCA 3ORZA 4D2RA 2QQ7A 3I1AA 1I09A 3LFCA 3K54A 5FXQA 3BYOA 4IVCA 3HEGA 2RFNA 4YZBA 3VWAA 4BCHA 2ZFYA 1XH5A 1W98A 4HCTA 1YWRA 2ETKA 3D9VA 3WF5A 4BRXA 2B4SB 3EKNA 1OI9A 2QOOA 3NNWA 4IAZA 4QTAA 5M08A 3MIYA 5DRDA 5HU9A 3E7OA 3E7VA 4I21A 2WIHA 5AR2A 1G8KA 4GFOA 5BVEA 2ZJWA 4I5HA 1YOJA 4NZWB 2YCFA 2CCIA 3CIKA 4O1OA 5I0BA 4BICA 5CU4A 2JIUA 3Q04A 4QPAA 4ANOA 4YZCA 3A62A 2GFCA 3P7BA 3R7GA 3QBNA 2EXCX 3GUBA 2W06A 4Q5EA 5DN3A 1H07A 4Z55A 5I4NA 4HZSA 4F6UA 4E6AA 3MJ2A 3FC2A 4KSPA 4U0IA 2W1DA 3HP2A 3R83A 4BCOA 4USDA 3LVPA 3FQSA 3RAKA 4DF3A 4MNFA 5JZJA 4C4JA 3QZHA 2HZIA 1OITA 2UW3A 3SOCA 2VWIA 3EQFA 3PRFA 2IW9A 3TN8A 5BVWA 4BZNA 3UQCA 1ZYDA 3I6UA 5EW3A 2EUFB 4J99A 4WUNA 2BKKA 5AP3A 4O27B 2WIPA 4DFYA 5LCJA 4G1WA 2WQMA 3NUNA 4EKKA 2XNNA 3POZA 3LE6A 2JEDA 4LOOA 2NNWB 3COHA 3QKLA 2WHBA 2QOKA 3FE3A 5DT3A 3ZXTA 4KD1A 1ST0A 2FA2A 2WMVA 2J9MA 3C5UA 4XEYA 5A3XA 1YXUA 1XKKA 4M7IA 3FXZA 1SNXA 5EM6A 2I0YA 4R7IA 3QRIA 3IW6A 3K3JA 4EKLA 1PYXA 4C37A 2IVTA 1PKDA 4X3FA 2W96B 3HMPA 4PMMA 5IMEA 3BGQA 3TIZA 2YZLA 2I40A 1W2FA 4G17A 5EDPA 4LYNA 4BDGA 5DIAA 1ZMWA 2HXQA 4XG9A 3GFWA 4IM0A 1JQHA 2J51A 4U6RA 1VEBA 5A4CA 2BROA 2E9NA 2VO3A 1G8JA 2JLDA 3I4BA 4F9YA 3OXIA 3IECA 4GIIA 2IJMA 4GIHA 3JY9A 4PX6A 2QO7A 3P86A 3UZRA 1MP8A 4GRBA 3QZGA 3PY0A 4FKSA 3OF0A 1QMZA 3IW4A 2XK3A 3SG9A 1VYWA 4OTPA 2Z7QA 1M52A 4DEAA 3NVMB 4LGGA 2AYPA 4C0TA 1TFFA 1VLRA 5CU2A 2I0VA 3HKOA 3C4CA 3VONA 3FKLA 4S34A 4C33A 3TKIA 2X2LA 1TVOA 1H1QA 3C4XA 3K5VA 3ORPA 4FKRA 4KAOA 1ZMVA 3EKKA 4KIPA 5L8JA 4EK4A 5AWMA 4ERWA 4F0IA 3BBTB 3OUNB 4F6SA 5DYJA 3UDTA 2Q0NA 3NYOA 5L4QA 3FLSA 3CSVA 2X0OA 5L6WL 3UC4A 3VS6A 3PWDA 4BBFA 3TNHA 4FA2A 3Q6UA 4F1TA 5HX6A 3PRIA 4P90A 3TV4A 1OBGA 4P7EA 2NO3A 3KY2A 4KBCA 2PL0A 1MRVA 4MBLA 1J7IA 2ITUA 5CASA 2ZYBA 3BELA 2JKKA 4I0SA 4F7LA 4DHJA 3DAKA 3F5UA 5TR6A 3MH2A 1BKXA 3RALA 4F9CA 5JQ8A 2W17A 2PVMA 5EW9A 1NT2A 4IX3A 3W32A 3O7LB 4DHFA 3FV8A 3MY5A 4S33A 4HVIA 2YM4A 1PHKA 2C1BA 2LGCA 2REIA 3BGZA 2B52A 4E7WA 1GIIA 3TZMA 4AAYA 2VN9A 4D28A 5I9XA 3SGCA 3WF8A 4ACDA 3F2AA 3NLBA 3TZ7A 4ZS0A 4OTQA 3FI8A 4IWDA 3MB6A 2OW3A 5AP5A 4YC3A 3WOWA 3OWKA 5A4TA 2UW9A 2BVAA 2CNQA 2GTNA 3VS5A 3DBCA 4JT3A 3G2FA 4RJ5A 2HZNA 4U8ZA 3P1AA 4OTFA 4QPMA 3UIUA 4U45A 4LG4A 4TYGA 3FSKA 2PULA 4FSNA 4KIKA 3LCSA 4C8BA 4PF4A 3D7ZA 3P7AA 4IBMA 3MI9A 3FKNA 4FNYA 4PQNA 3A8XA 4QTDA 4U97A 3RM7A 4R3RA 5EFQA 3ZYAA 4BC6A 4CFVA 3EIDA 5FP6A 4J97A 1K9AA 4MD7E 2W1FA 4ACCA 5HO8A 3G0FA 4YNEA 4NM0A 4B99A 4CFXA 3DDQA 2C3IB 3DK6A 4EUTA 4BBEA 5BYZA 3ZBFA 3QRTA 3I6WA 3G90X 4DBNA 3OW3A 2W4KA 4H05A 4GEOA 2EB2A 3GT8A 5BYLA 3ORTA 4FNZA 3DZOA 4FTCA 2I1MA 4U40A 3UC3A 2RIOA 2WTCA 1WAKA 3OEFX 4FI1A 2C4GA 5AX9A 2PVYA 5HTCA 2WMQA 3RGFA 3IW7A 4G3EA 4IIRA 4MXXA 2VU3A 2UZWE 5CSWA 4YHTA 2UVXA 3RVGA 3ZSIA 1Q8ZA 4AACA 5M4CA 3Q53A 1BLXA 2RF9A 4WBOA 4XRJA 5GIOE 1IAHA 3PJ2A 3JXWA 4AW0A 3NMUF 5I3RA 4M13A 4XG6A 4DFZE 1OL1A 4FIFA 4G3GA 3LMGA 4IWPA 3N4TA 2PVNA 3DK3A 4MWHA 1GZNA 3TV7A 1OKWA 3R7IA 3U51A 3QUPA 3QKMA 4K2RA 4IAIA 3PJ1A 4JBPA 3VUGA 4DG3E 4LUDA 5CF4A 2C6LA 3FPQA 3AMBA 4WOVA 4M97A 5CI7A 3E8CA 4FVPA 3Q9YA 3RTPA 3U6IA 2Z7RA 3OT8A 4FZDB 4PTEA 4RIXA 2WMAA 4IZAA 4D2TA 4AFJA 4QMVA 2FSLX 3PY3A 2VO7A 2VUWA 5J95A 5AFVA 1E1VA 2XNBA 5HIEA 3HECA 3A2CA 1BMKA 2CKEA 4IACA 3PY1A 4NFNA 3G6HA 4HCVA 4N0SA 3QWJA 1P4FA 1A06A 2X7OA 1YI4A 5JMSA 5HE0A 3R7OA 3ZSGA 2GFSA 4OT6A 4UB7A 4EOIA 3KRJA 1Q8TA 4MEDA 5ANEA 2VTPA 3A60A 2ESMA 3DTWA 3CY3A 3OCGA 2OXXA 4RT7A 4TYEA 4WHZA 3QD3A 2PE2A 5BVFA 5B2KA 4OTDA 3BE2A 5HG5A 4AX8A 3NW7A 4U80A 4JDIA 2CMWA 3F82A 3OZ6A 3PDTA 3MA6A 3CKXA 5FM3A 2IZRA 4AN3A 5JN2A 4EQCA 4CRLA 4FRFA 4RJ3A 2PZPA 2HY0A 1J3HA 3ZBXA 1RJBA 2XS0A 5L6OA 2CPKE 2JC6A 1NW1A 3LMIA 4BCFA 1GOLA 4RPVA 4CLJA 1SYKA 5DG5A 3VBTA 5IF1A 3ODZX 5JGDA 2XIXA 4DEIA 5F1ZA 1HCKA 3ZXZA 3AT2A 4GU6A 4OTIA 4J8MA 2VX3A 3CD3A 1J1BA 3NYNA 3BEGA 1UU8A 4CV9A 1L8TA 3HVCA 4HYIA 5F9EA 3A7GA 4KIOA 5LQFA 3LCOA 4XV9A 2UW6A 4JIAA 5EM7A 4J1RA 4I41A 4ORKA 4C61A 4CKRA 4ZY5A 4CEGA 3PE2A 4L7SA 3AGMA 5JZNA 3T8OA 4FOBA 4I94A 1K2PA 5HX8A 3V04A 2ONLA 3ZZWA 4ACHA 5ANOA 4NM5A 2X0GA 4WNPA 2GNJA 4X3FC 5M09A 3BWFA 4XNEA 5A4QA 2B9FA 3D7TA 3AD5A 3BRBA 5HE3A 5M51A 2JDSA 1DI8A 1UU7A 3DT1A 4GVAA 3HDNA 4ITHA 2C30A 1ZYCA 5J9YA 3SAYA 2YABA 2BRBA 4KKHA 3LCKA 3VS2A 3WE8A 5HIDA 4BCMA 4EOOA 1JKTA 4YTCA 3V5LA 3DNDA 5BMSA 3KB7A 2ETMA 4WA9A 4Z7HA 4DGLC 3NFFB 1OIRA 4EI4A 4B0GA 5DT4A 4EOSA 4R77A 4QDEA 2O64A 4OAUC 1XMLA 4EL9A 1UWJA 3R1YA 5FUTA 2C5NA 1PXLA 1WZYA 2W9ZB 3AQVA 4Q2AA 3OG7A 1IA8A 3NGAA 4M68A 5HNBA 4PP9A 5A6NA 4UN0C 2OFVA 2WMSA 3P0MA 1LPUA 4FKVA 1NVQA 3PP0A 3W8QA 5H9BA 3VUMA 3NUYA 4M3QA 2FSTX 4V04A 4EOMA 4IC7A 2WQNA 4TW9A 2FO0A 5CAUA 1XBCA 3CD8A 3ZC5A 4P5ZA 4BCQA 4D4RA 2ITWA 3U8WA 4GT4A 1WVYA 3DXNA 2XANA 4Y95A 4OGRA 4DTKA 3BLHA 2OSCA 3P79A 3C7QA 5HHWA 2W7XA 5H8GA 4RQKA 1ZAOA 4ZJJA 5IUGA 4XG7A 4AA5A 2HK5A 3OVVA 2EXMA 4GFGA 4JXFA 4O96A 5CQWA 2QG5A 4BDAA 5BUJA 4EK5A 5IG1A 2DUVA 5L2WA 3KEXA 2I6LA 2XNEA 3OTVA 2FH9A 2E9PA 3PYYA 4V0GA