3PRIA

Crystal structure of human b-raf kinase in complex with a non-oxime furopyridine inhibitor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
264
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title Non-oxime inhibitors of B-Raf(V600E) kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 74
structure length 264
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3priA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3priA01
2X8IA 4I20A 5J9LA 5HD4A 4LRMA 3KVXA 5IU2A 4IWQA 3AC3A 3H9OA 2CMWA 2XJ0A 2UW3A 3A62A 4IX6A 2QOKA 3EQGA 4O7WA 4L45A 4TWOA 3SC1A 4XJ0A 2XF0A 3DZOA 3E63A 2VO3A 3FLYA 2YEXA 4YZDA 3SDJA 3ORXA 2UW7A 2XK3A 5H3QA 4HZSA 3GC8A 3BRBA 3FBVA 4OLIA 4WG3A 5E8YA 4RVLA 2PUNA 4USDA 5DRBA 2BROA 1IA9A 3D2KA 3EKNA 4FSQA 2RKUA 3IKAA 3LVPA 2I0YA 4JRNA 4MD8E 2R4BA 4QMSA 3R9HA 4DGOA 4RC4A 4OTRA 2JAVA 3I0QA 4JT3A 3PRIA 4ALWA 2YACA 2W7XA 2OO8X 3BYSA 4RFYA 4BYJA 1W98A 3NX8A 3RK5A 4U97A 5C27A 3I79A 2VX1A 1FBNA 5CI6A 3NWWA 4E7WA 4V01A 4CG9A 4H39A 3D5VA 5GINE 2XEZA 3JVSA 3GFWA 4EK4A 1BKXA 3UQCA 2W0JA 3RCDA 1GZOA 4IB5A 2OICA 5E9EA 4CTBA 2YDJA 1B6CB 3R01A 5M56A 3QLGA 3TZ7A 1PKGA 3COKA 4M67A 1Q8TA 3E93A 4X3FB 2B52A 4FV7A 3RAWA 3HLLA 3BU6A 3L9NA 3V01A 4O86A 3BHYA 2RFSA 5IQGA 2CGWA 3W32A 2ITPA 3MI9A 5K0XA 5KHWA 5FEDA 4MBLA 4EOSA 4EZ3A 1E1XA 3LOKA 3ZO4A 1UWHA 4PDYA 2PZRA 3R8ZA 1UV5A 3QZIA 4HW7A 3E7VA 4FZAB 4V04A 4BCNA 3D5WA 4BTFA 3E64A 1SYKA 3BHUA 3GCSA 2XIZA 3ITZA 3NAXA 1ZWSA 4DF3A 4CFUA 3FMMA 4QP7A 5ACKA 3ZLXA 3IK3A 2ETKA 4RGJA 4OBPA 5GJDA 1WBTA 4OTGA 3GU8A 3BGPA 3LQ8A 3EYHA 4TNBA 3OG7A 3Q04A 5J1WA 4QD6A 4GL9A 4C57A 5IH6A 3V04A 2V22A 3EN6A 3TNHA 4I5HA 2VWIA 4ALVA 5CAQA 3E8NA 5K4IA 4EH6A 1ZLTA 3QQGA 3RKBA 2WMTA 2VTNA 3FKOA 4IXPA 4FT3A 2CNVA 1DAYA 1JKKA 3B2TA 4R1YA 3PDTA 4GCJA 3L9LA 1DS5A 4FKJA 2J9MA 4KSQA 2VTSA 4XG8A 3UPZA 3PJ1A 4J99A 5LCJA 3ZUTA 2BTRA 3ETAA 4LUDA 1J1CA 2EXMA 4O91A 2HZNA 5C03A 3ZFMA 1MRYA 3OWKA 4G5JA 4FEQA 4QPSA 3OFMA 4N0SA 3NNXA 3TNPC 3K54A 4M3QA 1NA7A 2Y4PA 2ZYBA 1BL7A 4IDVA 3QBNA 4FUYA 3FXXA 4UZDA 5FBNC 4AA0A 3QX4A 3R7OA 1REJA 3LFQA 3QL8A 4CFMA 2UW6A 4BCPA 4EOOA 2X1NA 4O0WA 3DFCB 2IZSA 2G15A 3GOKA 4FIJA 4HJOA 4FGBA 4YJVA 5J95A 3ZRKA 3C9WA 3OVVA 5FLFA 2JIUA 4EOMA 5JMSA 4LG4A 4F1MA 4RSSA 2QU5A 3P0MA 3QC4A 3KN5A 1H1PA 4IC7A 2GHMA 3UIMA 3TDWA 3KKVA 3SKCA 5HE2A 4J95A 3U55A 4LV5A 4R77A 1NXKA 4LQMA 1GIHA 3FMEA 4ZXTA 2YCRA 5LWNA 4R5YA 2JGZA 4QQ5A 2B0QA 4XP2A 5ETCA 2B53A 2YCFA 3MH0A 4QMMA 5IQAA 5H8GA 2XNGA 2X39A 3U6HA 3H30A 4U5JA 4X6QC 3R7UA 4UMRA 1BUHA 5BMSA 2CLQA 4DN5A 5HE0A 2ERKA 2E9NA 4FV3A 4GT5A 5FBOA 3HA6A 3RWPA 5LVMA 1LEWA 3RPSA 4CNHA 4QTEA 4F64A 4S31A 4BL1A 4WUNA 2QQ7A 3BHVA 3GQLA 3F66A 4CT2A 3QCSA 2QOOA 4FTMA 4MHAA 4DGGA 5IDPA 3NYVA 2OW3A 4G6NA 4UALA 5KMJA 4JR7A 4ASEA 4KBKA 4L67A 4BCMA 1J7LA 3QCXA 4TW9A 3RJCA 3UP2A 1SVGA 3AT4A 2OG8A 2VZ6A 2WTDA 2YIRA 5I9XA 5CEPA 5BVWA 3TACA 5IISA 3ZS5A 3UMXA 2WO6A 3OWPA 4NIFB 3U6IA 2OH0E 3POOA 2PSQA 1R0EA 3WF6A 3E87A 4U80A 5HVKA 5JZNA 3ZO3A 2ZJWA 3G5DA 4ZTSA 3ZSGA 5HIDA 4DEEA 2YM8A 4EORA 3QTUA 4BC6A 4ERWA 3VUHA 4F6UA 3LXPA 4ZSAA 3W2SA 4AA5A 4DH5A 2VU3A 3JY0A 4YJTA 3W8QA 5BVOA 4JIKA 1WBSA 2PZIA 2XM8A 4OAUC 4IZ5A 3KXGA 3RM7A 4W9WA 1ZOHA 5LVLA 4W4YA 4I3ZA 5HTIA 4I41A 3PSDA 4O7VA 2QOFA 3QFVA 2IG7A 1Y6BA 1J7UA 1Z5MA 3I1AA 4GW8A 4LRJA 5F94A 3WOWA 4MXXA 2X6DA 3W10A 1YI6A 4BDCA 5LWMA 2UV2A 3VUDA 5HO6A 3KEXA 3W33A 4EOKA 3R9NA 4G3DA 4HGLA 4W4WA 4EH8A 3IO7A 3UIBA 3A7JA 3GC0A 1SMHA 2UUEA 4LUEA 4GK4A 2WMSA 2OI4X 2ZDTA 3CKXA 5LMKC 5HE1A 3BU5A 4BDGA 4XG4A 4IVDA 2O63A 4HPTE 5E8SA 4CMUA 2GNFA 3G51A 2DS1A 3FHRA 3ULIA 3CR0A 1M17A 2BAQA 3AG9A 4RA5A 3VHEA 3GU5A 2HZIA 4D9TA 4IFCA 5BNJA 3VNTA 2R3HA 3IDPA 4FKSA 3EFWA 2G01A 2X2MA 4U42A 2HW6A 5IA2A 3EN5A 2J51A 4RA4A 4YHTA 3NVKI 1PMUA 3QTZA 3MH3A 3RK7A 4EOIA 2B9IA 3EFLA 4L00A 3K5UA 4DT8A 5IQEA 3MY0A 2AUHA 3EH9A 3IW4A 2B7AA 4U81A 4YJPA 4RVMA 4FVQA 3R7EA 3OCTA 4P7EA 5GZ8A 4U45A 3LKMA 5DOSA 3ATTA 2BVAA 4C3FA 1XH5A 2X4FA 5GZAA 4YJUA 4DEDA 2PVJA 2VWYA 5HESA 2GNGA 4PDOA 4E73A 1J1BA 4BCQA 5ANEA 4DLJA 3Q9XA 1XO2B 3D9VA 1PRYA 3QHRA 4ZZOA 3HV3A 2OJ9A 2W96B 4BDKA 1Y91A 1O6YA 5IA5A 3DCVA 3V6RA 3Q53A 4FT5A 3R8MA 4PTCA 3FDNA 1URCA 3U9NA 2V0DA 3HRBA 2Z7SA 3TUBA 5ANJA 4XOZA 5F20A 4LRKA 3UNKA 2IVSA 4DGMA 1W7HA 3ALNA 4OTDA 2C5YA 3VS5A 3ZM4A 5AP4A 5M06A 4RJ4A 5EI8A 2AYPA 3VWAA 4I23A 3G90X 2PE2A 1QPJA 4AZSA 2OJGA 3AMBA 1WMKA 4X2GA 2VO0A 4ERKA 2WEIA 2EXCX 2PVMA 3C4FA 4Y83A 4LMUA 5D10A 1SZMA 3UC3A 3QALE 3MA6A 3GENA 3OT8A 3JYAA 3R73A 4H3PA 2QO7A 4BICA 5AR4A 5BPYA 3ORLA 3OUNB 1QPCA 3II5A 4BR3A 4ACHA 3PPKA 1S9JA 5EQEA 4D0WA 4QMTA 3KXNA 2FGIA 3FZRA 3DDQA 1OPLA 5DBXA 3GC9A 3TM0A 2C6TA 1IEPA 2GNHA 3P23A 4IX3A 4E3CA 1OGUA 3NUSA 1PXIA 4FKWA 3HX4A 3UO4A 3LFAA 4BDHA 5LOHA 2R3NA 1L3RE 3FZ1A 3L9PA 4KS7A 4UWCA 4X0MA 4FTIA 5E8TA 4M68A 3VRZA 4BGGA 4FZ7A 4M69B 4Q9ZA 4FA2A 2C47A 4IMYA 4L43A 4ANOA 4M69A 3OXIA 2C1BA 3NNVA 3PA3A 4U44A 3I81A 3Q2JA 3FC1X 4O82A 3KMMA 1DM2A 4HCTA 2YLFA 4L8MA 4TYGA 3ZOSA 3B8QA 3TTIA 3P86A 2GQGA 4YPDA 1NY3A 2UW5A 3EQCA 3M1SA 3NZ0A 5IF1A 4QMXA 5C4LA 4L3LA 4QYEA 4XEYA 4G6LA 3A7GA 3ZZWA 1L8TA 5GIOE 5AUVA 3P4KA 4FG9A 3VULA 4AW1A 3ZCLA 4DH1A 3DAEA 4O96A 3R8UA 4E4XA 5IEXA 3F7ZA 2GQSA 3Q60A 2JDRA 4Y72A 4J1RA 3SW4A 5H2UA 1BYGA 5HG5A 4FTRA 3PE2A 2LAVA 1M2PA 2YABA 3BYMA 3VW8A 4J96A 3FL4A 4GVJA 3DA6A 3NLBA 3NR9A 3EQPA 4J97A 4NFMA 4F1TA 3NIEA 1U5RA 5FEEA 4PV0A 2JDVA 4D55A 5HORA 5B7VA 3MH1A 4PF4A 1YWRA 4HCUA 4AX8A 3SX9A 3FMNA 4H3BA 4YU2A 5CEOA 3UDBA 5J9YA 5HQ0A 4DEIA 3CJGA 3GU6A 4H1MA 4E6QA 2FSLX 2PZPA 4FTOA 3DJ6A 5IH4A 2YFXA 3CQEA 3MJ2A 3OWJA 3PWDA 4YLLA 5HCYA 5IMXA 2PY3A 2HWOA 4H36A 4JG7A 5CT7A 4C61A 4EK5A 4F99A 1U59A 4ZTLA 2I7QA 2YM6A 3COHA 5AUZA 3V5JA 2WU6A 3PE1A 4IM0A 5CU6A 3DLSA 5FXSA 4IVCA 4WA9A 2YM3A 1UA2A 4HVGA 3RZBA 5CVFA 2GDOA 4BDIA 4EH2A 5E1SA 3ZSHA 2WD1A 2OKRA 2HCKA 4RX5A 4J8MA 5CSHA 2ITXA 4XP0A 2WTKC 4U0IA 4OTIA 4WG4A 3GP0A 4UY9A 2ZMDA 4S2ZA 2PUIA 2RL5A 4L42A 3WZDA 4EOLA 2BUJA 2CPKE 2X81A 3HMMA 2UW8A 4WO5A 3DQWA 3R04A 4MKCA 5IQBA 1ERKA 4ZZMA 4JBOA 2R3FA 3OC1A 2C5NA 3E8EA 1Q62A 4RJ8A 5TR6A 2O2UA 2XKDA 4GG5A 2R3PA 2OZAB 4F7JA 2OZAA 2XKFA 3PYYA 3WE4A 4FKIA 3ORKA 1ZMVA 5HE3A 1FVRA 1OL2A 4OAVB 4QQCA 4QT1A 2R3KA 4EJ7A 5JEBA 2REIA 2PVNA 3QUPA 5DRDA 2FSMX 1DI9A 1ZMWA 5B2LA 5LXMA 1CKIA 3QKMA 2V5QA 4F0FA 1F0QA 3NUXA 4AZVA 2QLQA 2JITA 1H8FA 3WBLA 2WKMA 4QMZA 5KMKA 3VUIA 4TRLA 5L2QA 4I93A 4RZWA 2IZRA 4ASXA 1VJYA 3SG9A 4BDFA 4F65A 1I09A 3OMVA 3E7OA 2BRHA 2F4JA 3H9FA 3TXOA 5DMZA 3ZBFA 3GCQA 2ITWA 4MAOA 1E9HA 4NT4A 3G15A 1RW8A 1O9UA 1PXMA 2HXLA 1OPJA 4DTAA 3PJ2A 3WF5A 1JQHA 2R3LA 5JN2A 5IPJA 3ID6C 4K8AA 3NAYA 5AR5A 3RI1A 3WIGA 4C4EA 5K5NA 2YCSA 5L2WA 4BKYA 2B9FA 4P90A 2WXVA 1BX6A 3CTQA 2F2UA 2OIQA 2WFYA 5M53A 2WQBA 5EYCA 3SHEA 3WF8A 3I6WA 3P7CA 5AFVA 3TT0A 3LJ2A 4A7CA 2ZV2A 4FKQA 5DPVA 3Q4CA 5IG1A 3G6HA 1JBPE 1LPUA 5M4UA 2PMLX 3DGKA 3Q96A 4NCTA 5H9BA 4D2VA 3A4OX 4F9CA 4GH2A 4AZEA 2R3JA 1ZOEA 3BIZA 4XUFA 1Q8WA 2O0UA 3EOCA 2CNQA 5ANGA 4OTWA 3TUDA 3QWJA 1JSVA 2OXDA 4FV8A 3EN9A 3NW5A 1REKA 2NNWB 2JDOA 5EKOA 4FUXA 5E8XA 2QLUA 3OXTA 4AZFA 2UZTA 5E91A 3BBWA 3QQHA 4KAOA 3G2FA 5H8EA 4C3RA 2Y4IC 3KULB 5JQ5A 2GFCA 2CSNA 2I40A 2IO6A 1UU9A 3LXKA 2ZV7A 4NKAA 4DG0E 3FL5A 4IBMA 3DAKA 4M66A 1M52A 3WZJA 3A7IA 4JG8A 3W2OA 3R9OA 4YUQA 2VX3A 3R8VA 2QKWB 2QOIA 3ZLYA 4ZS4A 4RMZA 4YHFA 3TKHA 2QHNA 4D4SA 4RJ3A 3AC4A 3JY9A 2HELA 2BPMA 3TIYA 5CU0A 3F6XA 5AP2A 4WOVA 4IB1A 5DT0A 3CQWA 3R00A 5JKGA 1ZARA 2QOCA 5EW9A 3RNYA 2C69A 3EZVA 3DB6A 4D1ZA 2W5AA 3FY0A 1YOJA 4FL1A 4PNKA 3EQFA 3K2LA 3IECA 2R3IA 4IE9A 5FEQA 5GJGA 1ZYJA 1PXPA 4G16A 5AM6A 1WVWA 3W16A 3I5NA 4AS0A 5EQPA 2E9VA 1YDSE 4IWPA 5HEZA 1OVEA 4L6QA 3BX5A 1W0XC 3MJ1A 3MSSA 5KMMA 3ANRA 5DVRA 3PXYA 2W1DA 3HP2A 2CCHA 3ACJA 4JOAA 4PTGA 1WAKA 2PVHA 4L01A 2VTIA 4EQCA 3UC4A 5LCKA 3TN8A 4AN3A 3ZDUA 5IEYA 1Y57A 3SXRA 5J1VA 1IRKA 2XNNA 3T3VA 4D4RA 2IPXA 3COMA 3SXSA 2GCDA 5DIAA 4G9CA 1U54B 4O38A 2JKQA 5FM2A 4AWIA 4TYHB 1U54A 3O71A 3JS2A 4TYHA 1HCLA 2WZJA 1PMNA 4IZAA 2C3LA 4G3CA 4H3QA 4MQ2A 4YNEA 4QP1A 5BVNA 5L6OA 4G5PA 4X2JA 3I0OA 2YIYA 4IWOA 4YSMA 4J53A 5FTGA 5CZIA 4EH4A 4O0XA 1PYXA 2J0JA 5AUWA 4YJSA 4N4SA 3TV4A 3DBCA 4U9AA 1PYEA 3RAHA 2YIWA 4EYMA 4R1VA 3QC9A 4D4YA 4JLCA 4CGAA 3GEQA 4O0TA 2VD5A 4YP8A 5JRQA 2YA9A 1H1QA 3S0OA 5IUIA 5AP0A 3NW7A 4ITJA 4QYFA 4YNOA 3WYXA 1OECA 2FA2A 3F7WA 3QQKA 3ODYX 1J7IA 3VHKA 2BDJA 3A4PA 3UZRA 1WBNA 3QLFA 2XNEA 4G1WA 4L52A 1K9AA 3FQSA 4CYJA 2GS2A 5DE2A 5FGKA 4UMTA 4CKRA 2BKKA 3HRFA 3S1HA 3BI6A 3REPA 4IADA 4UYAA 3HUCA 4Y95A 4C4GA 2WQEA 2F49A 3CPBA 3FJQE 3QTQA 4LOQA 4CFXA 2XNBA 4PPAA 5C4KA 4YZBA 2QR8A 1YDRE 5AR7A 3KREA 4BIDA 3FYKX 4I4EA 4EOJA 5M4FA 4O7ZA 5BYZA 1Q41A 2QCSA 4D1SA 1GJOA 3KXMA 5CENA 5AV4A 2XM9A 4EI4A 2BIYA 1ND4A 3CSVA 3TIZA 4IJPA 3WZKA 3FI2A 3CTJA 3O50A 4YZ9A 5DG5A 4EH9A 4UMPA 3DAJA 4OUCA 5FWKK 4NM0A 2J50A 4O7YA 3DBFA 3AC5A 3QRUA 4JX3A 3V5WA 3ZFYA 4A9SA 4AUAA 5KX8A 3C0IA 4EK8A 3FPMA 1YOLA 2IVTA 4PMMA 5EI6A 3MA3A 2VTOA 3AT3A 4GV1A 1OKVA 5A4LA 2YDIA 3OT3A 4EH5A 2XP2A 3FEGA 1R0PA 1VEBA 1KE5A 5EG3A 3KXHA 3PZEA 2QG7A 3G6GA 2DQ7X 2W1ZA 3FLSA 2Z60A 4M13A 4DGNA 2BDWA 3PLSA 3DK7A 3IQ7A 1Y8YA 3L8SA 4X3FC 4UWYA 5BVKA 1V0OA 1K3AA 5EM5A 3AT2A 3ELJA 2R3OA 3OEFX 3QX2A 5AV3A 4HNFA 4Q9SA 1AGWA 2P2HA 3O8UA 3QD2B 5ACBC 3RAIA 4L7FA 5AUTA 2F57A 4JDKA 1WBOA 4F6SA 4NU1A 4NTTA 4GT3A 3R63A 4XV2A 3IGOA 4G9RA 4MTAA 4G2FA 4PPCA 4PMTA 3DT1A 4AOIA 5M57A 3KF4A 4CTCA 5CYIA 3R28A 1JAMA 3AGLA 2X7GA 4MWIA 4ZSGA 4IAAA 3VN9A 3PSCA 4H1JA 4FKGA 4DAWA 3FHIA 1KOAA 1Q4LA 2XK8A 3EQDA 3MB7A 3CTHA 3F82A 5M44A 1YQJA 1GOLA 2X8EA 4BBEA 3KMUA 5HO7A 2QO9A 3EMGA 3GQIA 3V8TA 4RQKA 4CZYB 4FEWA 4FEXA 3GUBA 5A4TA 5CF8A 5CI7A 4ZK5A 3ROYA 2DUVA 2VGOA 4D58A 4L7SA 4FV0A 5C9CA 4BTKA 5A54A 1MP8A 3LAUA 4DH7A 4EHEA 5CU2A 3T9IA 5I4NA 1YDTE 5KKRB 4TT7A 4FSTA 4QP9A 4XG9A 3HA8A 5D1JA 3UVQA 4QPMA 3V5TA 2UZOA 3R30A 3MESA 5AM7A 2C6IA 2ITQA 4RIWB 2R2PA 2JC6A 4A9RA 3LCKA 4IZ7A 4RIWA 3LM5A 3TV6A 4UN0C 2C68A 4O22A 2FSOX 4DBNA 2VO6A 2B9JA 3BE9A 4HPUE 4J52A 4OT6A 4P4CA 4HOKA 5M4IA 3FYJX 2PU8A 2C6DA 3TZMA 5DYJA 1E1VA 2C6OA 2QOLA 4YZCA 3ORMA 5ETAA 3TTJA 1GAGA 2PE1A 2WOUA 4PWNA 1OMWA 5LVOA 2J90A 3UYTA 5CEQA 5JGAA 2YIQA 1PMEA 4MX9A 2BCJA 3DKCA 2G2IA 4RWJA 3QTSA 5CAOA 2Y8OA 5JFWA 2H6DA 3M42A 4I5MA 3VW6A 2YISA 5TKDA 4EUUA 4CMOA 4WT6A 4EEVA 2WPAA 2ZOQA 3CY3A 3WF7A 3EQIA 4HVDA 2WNTA 2WMWA 3QD0A 4JVGA 3KQ7A 3FSKA 3LQ3A 4NEUA 3O2MA 3FMHA 1OI9A 1PXJA 4FSNA 4QMWA 5I9YA 1H25A 1PKDA 5M51A 4KABA 3PRFA 2ETRA 4Y5HA 3A7HA 4BCKA 1VR2A 1GZ8A 2I1MA 4RWIA 3CGFA 5L3AA 3BE2A 5CVHA 5EHLA 4YLJA 3AQVA 3IDBA 3VF9A 1YHSA 2V55A 4PL4A 3F5UA 4WBBB 3BZ3A 2GNIA 4AP7A 3TZ8A 5CEIA 2OFUA 4BI0A 5C8MA 2GNLA 5AP5A 3VQUA 4E26A 5I9WA 1SVEA 2IVUA 2WQNA 2BAKA 3R1NA 4GIIA 1LR4A 4RT7A 2EWAA 4BGQA 4GYGA 3SRVA 3NCZA 5L2IA 5HG7A 1OBGA 3DK3A 4WNKA 4HYUA 1A06A 4G34A 2Q0BA 3UBDA 2W17A 4NJ3A 2W5BA 1M2QA 4Y5QA 1FMOE 2IVVA 4DA5A 2CHLA 4I22A 3VUMA 3ZC5A 3SA0A 2FB8A 2IW9A 4QMNA 2XCKA 3F69A 1WBVA 4CSVA 1HOWA 4O7TA 4D2TA 1H08A 3O7LD 4Y8DA 4Y46A 5D12A 2YJSA 3CD3A 3R9RA 3W2PA 3F61A 3EFKA 3NUAA 4AOTA 1B39A 3ODZX 3UPXA 3Q4ZA 4BBMA 4JIAA 5F95A 5L6PA 3D5XA 2X6EA 1H1RA 4YMJA 3ZO2A 3AD5A 4QTCA 4RPVA 4ZTQA 2UVXA 4QTAA 2HZ4A 1BLXA 3ZHPC 2AC5A 1PJKA 2W9ZB 3FC2A 4XYFA 1XBBA 3HNGA 3IGGA 4ZJJA 4EH3A 1XH8A 2Z7QA 3MVMA 5GNKA 5CAVA 4BGHA 4V0GA 2BFXA 4A07A 3DXQA 3SG8A 2ERZE 4I5PA 2JBPA 3QA0A 4XRLA 1W83A 1A48A 5IQDA 4QO9A 3S2PA 3QQLA 4FX3A 3THBA 3GT8A 4NW6A 4CT1A 1XH4A 2BRGA 4O83A 5HTBA 5A6OA 5AV1A 4R7BA 2VTAA 1STCE 4O7SA 2NP8A 2QOBA 2F7XE 4M0YA 1UU7A 4FYNA 4YHJA 3FXZA 1QPEA 1MUOA 2QHMA 3MV5A 3OUKA 4KB8A 4WNMA 4EWHA 4CKIA 4CVAA 5IH5A 3KRWA 2BZKB 3RHXA 2J0KA 4M8TA 1APME 3ROCA 4QMVA 3W55A 4BDJA 5IA3A 3FMDA 4NH1A 4S34A 2P0CA 2BDFA 2PVKA 3IOPA 3Q32A 2Z02A 3NYNA 2PVFA 4HGEA 2H8HA 3BYUA 3A8WA 2Y0AA 4L3JA 4Z3VA 3ENMA 5BMMA 3A60A 4KWPA 2ITUA 4EBVA 3PVBA 2YAKA 4GU9A 3BLRA 4EBWA 3ZEPA 2F9GA 2ZB1A 5BYYA 3MYGA 3PPJA 2Y7JA 3FAAA 3L1SA 3PIXA 4ANQA 2QR7A 4C36A 4XV9A 2E9OA 4S32A 4J8NA 1IG1A 2W1IA 3LMGA 4K6ZA 5EM6A 1KE8A 2B54A 3UNJA 2W5HA 4HVHA 4BBFA 4FL3A 2BILB 5E8UA 4HYSA 4UBAA 4GK3A 4YC8A 5DN3A 4A4LA 4DINA 4GYIA 3ZTXA 3CC6A 4EYJA 4ZTRA 4PY1A 3EFJA 3FMJA 4DLIA 5A9UA 4CFNA 5JSMA 2WTWA 2GMXA 4C35A 2EVAA 3LFFA 3PY1A 2OIDA 2OZOA 4TXCA 4TNDA 2XRWA 4C4FA 3G9LX 3QZGA 1OPKA 1P14A 3DS6A 3QRKA 4BYIA 5I3RA 2BZJA 5J79A 4RVKA 4R3RA 2OJFE 2J4ZA 2NRYA 3OS3A 4HCVA 3HMPA 1TKIA 4PMSA 3F5GA 4JAJA 4MYGA 4XRJA 2UW0A 4JNWA 5HNGA 3GGFA 4PNIA 3BQCA 3QTWA 4YR8A 2PZYA 3LLTA 3FE3A 2JDTA 4GRBA 3FLQA 2OU7A 3IS5A 5BUIA 1PW2A 2GFSA 3KGAA 2X8DA 2CKOA 3WILA 3K3JA 3GU4A 4IEBA 5M4CA 3FUPA 2BTSA 4FV4A 4RJ7A 4F9AA 1B38A 1WBWA 3MFTA 3Q4UA 4EHZA 3VS0A 3UZTA 2QURA 2R3QA 4YTFA 1OKWA 3QZHA 3BYOA 3GCUA 4UV0A 5IKWA 5CXZA 1OM1A 4F9YA 3U51A 3CLYA 4QMPA 5EHOA 2CN8A 3TKIA 4EQUA 5F4NA 5CASA 2WMBA 3O23A 4PL5A 3MWUA 1YI4A 3UG1A 3FXWA 3Q9WA 4R8QA 4IC8A 4ZSJA 4K0YA 4MNFA 3ZFXA 3C0HA 3LCDA 3SQQA 3NPCA 4L44A 3OBJA 3RP9A 3VS4A 4AA4A 4DFXE 4CKJA 2R7BA 5JGBA 4ID7A 2I6LA 4D0XA 3HUBA 3DKFA 4GG7A 3PP1A 3LMIA 5L8JA 4CCBA 2YN8A 4LL5A 3QQJA 4YSJA 2W1GA 1ZYCA 2PWLA 5HICA 3LLAA 2RG5A 2W4JA 4O1OA 4PDSA 1H24A 4YGAA 4PRJA 2SRCA 4K11A 2E9PA 2XNMA 5ETIA 1JLUE 1P2AA 2C6KA 2C3IB 4RWKA 3LHJA 5FQDC 1FMKA 5M09A 5E8WA 2ETMA 3CE3A 5AX3A 3D7ZA 3VBWA 4BZDA 2ITOA 1ZYSA 4G3GA 4NFNA 5I9UA 3UODA 3ZBXA 5J7HA 3IG7A 2EXEA 5KZ0A 3MN3A 3H10A 2JKOA 2UZVA 3OHTA 3W2CA 3AC8A 1FGIA 3VBYA 4DCAA 4DITA 4FICA 1OZ1A 3OW3A 4JDIA 2ONLC 2C0OA 2RGPA 2X0GA 4ZIMA 2WQOA 4DFZE 1VZOA 2XK6A 4TWCA 1I44A 1F5QA 4UYNA 5GJFA 4B99A 4BB4A 4RC2A 3GBZA 2YERA 3P9JA 3NEWA 3BLQA 2VTJA 2Y9QA 5ETFA 3WF9A 5ANKA 5LMKA 4XX9A 3HZTA 4RIYB 3QU0A 3TEIA 3TG1A 4AQCA 4DFBA 4WSYA 4RIYA 4C38A 4DEHA 3ZUUA 2BIKB 2OJJA 4NSTA 1GZNA 3LCOA 4MQ1A 4MXYA 3U87A 3TZ9A 2OFVA 4AFEA 5CSWA 4EH7A 2YM4A 4PP7A 3UOJA 2IZUA 3PVUA 4JX7A 4TY1A 5DNRA 3LPBA 4YO4A 3EZRA 3FZTA 2E2BA 3LIJA 4OT5A 5DT3A 2OSCA 4C4HA 3ZXTA 4DH8A 3C51A 4BCGA 4ANNA 5IA1A 3VBVA 3ZM9A 3UO6A 3KC3A 3ZO1A 3ENHA 3WI6A 4MXOA 5D9HA 2XEYA 1WZYA 3MGYA 2PVRA 4FGRA 4XBRA 3R02A 3IPHA 4XH6A 1UVRA 2W9FB 4KBCA 4KIKA 4RJ6A 3VBQA 4O27B 4E5AX 4F7SA 2JLDA 5HKMA 4Q5HA 3PTGA 3F5PA 4F4PA 2A2AA 4O84A 2HIWA 2HZ0A 3R21A 4XV1A 2XKEA 5B2KA 3CBLA 2WMVA 3PJ3A 3CGOA 3RWQA 4MEDA 4BHNA 3UIXA 2XKCA 4O7NA 2B55A 4YURA 3UJGA 3ZH8A 5DR2A 3NDMA 1CDKA 5KBRA 4M0ZA 4B9DA 4W8EA 4JXFA 4XG3A 3MY5A 3KVWA 3DBDA 3F2NA 4YTHA 4FV6A 1PHKA 4IVBA 2HW7A 4O0RA 2R5TA 5AP1A 5AR8A 3HV6A 3MTFA 3R22A 3TI1A 3O7LB 3DK6A 3ZZEA 1YHWA 4FTKA 2PUUA 2GTNA 3VS3A 4QP3A 3BEAA 3DJ7A 1UNGA 1R1WA 3QTIA 5TE0A 4BCIA 4MNEA 1GZKA 3AMAA 3Q6UA 3QXPA 2C6MA 5FM3A 3EB0A 5ANDA 2P2IA 3F2RA 1JSUA 2O65A 2ZAZA 3RPOA 4M15A 5HZNA 2H9VA 1O6KA 3D7TA 2CDZA 5J5TA 3R71A 3SLSA 4LL0A 3VBXA 3BWJA 2XBJA 4YZNA 2YWPA 5EKNA 5G1XA 3V8SA 5LVNA 2C6EA 2QKRA 3TJDA 5IQCA 3U6JA 3R6XA 4FKRA 4QOXA 4F7LA 2J6MA 3FLWA 4FZFB 5FP5A 3UP7A 3CD8A 3EL7A 2VAGA 4FYOA 5AWMA 1G3NA 3CEKA 3G0FA 3D2IA 3CPCA 4HVIA 3DDPA 3P1AA 4RX9A 4X7QA 5A4QA 5AUYA 3U9CA 2YHVA 4I6BA 3PWYA 5JQ8A 2C4GA 5AMNA 4FSUA 5T3QA 3Q3BA 4L46A 4ZLZA 4CRSA 1XWSA 2PVLA 1ZXEA 4RFZA 4G17A 5CF5A 1IA8A 4I1ZA 2GS6A 2CLXA 2HWPA 2QVSE 5HIBA 4E6DA 4EL9A 4RVTA 4L9IA 2OF2A 3KK9A 5KMOA 5IZFA 4E93A 2W1EA 1QMZA 4K1BA 4FL2A 4N6YA 4GJ2A 3C4ZA 4AZWA 4WD5A 4D1XA 1PXKA 3L8VA 2UZUE 3PG3A 4R78A 1OKZA 3TV7A 3LCTA 4ENXA 4M12A 4TWNA 3ORZA 5KE0A 1P5EA 2UVYA 3D94A 3GXLA 3PUPA 4ZMFA 2YWVA 3KCKA 3RAKA 4CYIA 4Z9LA 3C0GA 3RALA 4NZWB 4CRLA 3ACKA 4FKPA 3QZFA 2OBJA 4OTPA 3PPZA 5CNNA 4FE2A 2XB7A 1K2PA 3TNIA 4B8LA 3LXLA 2PMIA 4LYNA 2FH9A 4FIFA 4GUBA 2CGXA 3NVMB 5L2TA 4TWPA 4BI1A 4AXAA 2RFDA 5HO8A 2EU9A 4N57A 2WHBA 5CXHA 2CGVA 2PHKA 3C5UA 3QTXA 5HCXA 5I3OA 4WSQA 3EKKA 3V51A 3IDCA 4A9UA 3UQFA 4BDDA 1XH9A 4GFGA 3UOHA 1YKRA 4Y85A 5DGZA 2UZEA 4WNOA 4TPTA 4X2KA 5IUHA 3TCPA 3I4BA 3NSZA 4CQEA 4CFVA 3MPMA 5GIPE 3T9TA 4GVAA 3G0EA 4GU6A 3I5ZA 3OWLA 2VX0A 2XIXA 5CTPA 5HI2A 3SGCA 4FTTA 5TT7A 3EQHA 4CMTA 2J5FA 3U4WA 3PA4A 4O0UA 4R5SA 1J91A 4X2FA 4DEGA 1PMVA 4ORKA 2CJMA 4UXLA 5CS6A 1YXXA 2FVDA 5CT0A 4II5A 5AEPA 4LMNA 4FF8A 4AOJA 1V1KA 5D41A 3JPVA 4JQ8A 4TN6A 4D5HA 4DFYA 1Q5KA 3MY1A 3VQHA 4IQ6A 4MBIA 5KHXA 3DBEA 2X4ZA 5HVYA 4E1ZA 2JIIA 2QONA 2XBAA 4YBJA 2XIRA 2ITYA 2W06A 3O51A 3PSBA 4B6LA 5C1QB 1ZAOA 2C5VA 4XS2A 3KA0A 3ULZA 1H0VA 4DEBA 2XYUA 3DXPA 2WMAA 3EHAA 4JS8A 1M7NA 4BCHA 1H00A 4TYEA 4EK3A 1FINA 4ZY5A 2J7TA 3MFSA 4KINA 4UMQA 2JD5A 3VJOA 4APCA 4D2WA 5DH3A 1BMKA 2IJMA 5FTOA 3CKWA 4FNYA 4JQEA 4XP3A 2UZWE 2RF9A 3I6UA 3QAME 4BZNA 4AG8A 4I6FA 2WB8A 4RIXA 1FOTA 1DAWA 3V5QA 3A8XA 4BWXA 4PP9A 4OBQA 4TZRA 2VTRA 2BALA 5DA3A 4CEGA 2BAJA 1ZY5A 4C02A 3R9DA 1TQMA 2GHLA 2WIHA 4KD1A 4QYYA 4KBAA 3AOXA 4I94A 5IA0A 1NVQA 4IB0A 5AIKA 5JK3A 2C5OA 5HOAA 4E5BA 3TNQB 2CKPA 4C0TA 2W05A 2OH4A 4N70A 5CU3A 4NUSA 5D7VA 3DV3A 4FT0A 4AN2A 4ZLOA 5I9ZA 2JAMA 1PXOA 3GU7A 3OOMA 1OL7A 1H1WA 1XBAA 5CAPA 2YZAA 3T3UA 5AADA 4OR5A 1SNUA 2PVYA 3QKLA 4Q5EA 4MD7E 4BN1A 1MRVA 4NW5A 4O6EA 5EDQA 2OIBA 1JKSA 4LGDA 4EOPA 5CANA 2UZLA 3VJNA 4I24A 3RBWA 1H26A 1Q8ZA 3HDMA 5T68A 3OOGA 1JSTA 2NO3A 2QODA 2B4SB 4G3EA 3QHWA 3D5UA 4CQGA 3BYVA 1SVHA 4U43A 3O96A 2VWUA 3NYXA 2J0IA 3ZXZA 2CKQA 2R3RA 1ZZLA 3GOPA 5EM8A 1CM8A 4ACCA 3S3IA 1F3MC 2WMUA 4FG8A 3KMWA 2FUMA 4QYGA 3KRLA 3B2WA 5HLNA 2GNJA 4D2SA 1YWVA 4D9UA 3D83A 4BWKA 2VWWA 4NM5A 2Y4IB 5LMAA 4DG3E 5AA9A 5CWZA 5F9EA 3QWKA 1WVYA 3U54A 3KFAA 3GVUA 3Q2MA 5HD7A 3TL8A 3SOCA 4JG6A 5HX8A 2PK9A 3LM0A 4MXCA 3VUGA 3HMOA 5DEYA 3H4JA 5FXRA 4MF0A 5IMEA 3GFEA 4CD0A 5J87A 5HVJA 3TUCA 2V62A 4GKIA 4O7LA 4FKLA 3BGZA 2C3KA 1URWA 3P5KA 2OGVA 2JKMA 2R64A 3QCQA 4QP6A 4C33A 5HBJA 3H0ZA 4QQTA 1BL6A 4TKSA 5EYMA 4EONA 2BZIB 4L3PA 2B1PA 3GI3A 1YHVA 5E8VA 4QMYA 2NPQA 3QD4A 4USEA 1H28A 3EN4A 4PX6A 5CQWA 5EM7A 2QOHA 2GTMA 3N4UA 5TF9A 2J0MB 3QGYA 4ACDA 4F70A 3OW4A 2R0UA 3C4EA 4WRSA 5EYDA 3RCJA 4KSPA 3M2WA 3R83A 4KIQA 5E8ZA 1WVXA 2JBOA 4YO6A 5CZHA 3BCEA 4AAAA 2GQRA 1XJDA 4QMUA 4RQVA 2CNUA 4NYEA 3D15A 1R78A 5AP7A 4DGLC 4E5WA 1Z9XA 4BVUA 3R2BA 2P33A 5KKRC 4O0SA 2QG5A 2PPQA 2WMRA 5G6VA 3OY3A 4E4NA 1MQBA 4MXAA 3ZU7A 3LQ5A 5GZ9A 4YJOA 4IAIA 3CXWA 4S33A 2GHGA 3LJ1A 1UKIA 4RIOA 3S4QA 4QYHA 5AIRA 2W4OA 1FGKA 3ZEWA 1CSNA 4WUAA 2W1HA 3E5AA 3W1FA 4AT5A 4LOOA 3NNUA 4A9TA 3GCPA 3QQFA 3SW7A 3UO5A 3OCBA 1JOWB 5HBEA 3Q9YA 3T8OA 2ESMA 5C8KA 2VTHA 3GB2A 3NUNA 4IAZA 3R0TA 5EI2A 2XJ1A 4K9YA 2OF4A 3FWQA 4IAFA 4BFMA 4IM3A 3SOAA 4ANSA 4EOQA 3UMWA 4UX9A 4HNIA 3BV3A 3ANQA 1U46A 4JJRA 3RVGA 1KV1A 3NS9A 5FDPA 3DB8A 1SM2A 3NYOA 4ZLYA 3V6SA 4O2ZA 2VWZA 3ZRMA 2XMYA 4FBXA 5IEVA 3QTRA 3OXZA 5AUXA 2WOTA 2WEVA 3D0EA 5KCVA 1KE7A 1H1SA 3F88A 3MS9A 5EHYA 4NTSA 1W82A 3FQHA 4CFWA 4OTFA 5M08A 3RPYA 1YI3A 1MQ4A 1WFCA 3I7BA 3FMLA 4FSMA 3DQXA 3R1YA 2QI8A 4APPA 4DFUA 3FQEA 3NUYA 3WARA 1U4DA 4LI5A 2PMOX 3FZPA 4F08A 1IR3A 5CF6A 2WMQA 2AC3A 2XUUA 2IWIA 4FC0A 2R7IA 2ITVA 4FTLA 2KULA 3RK9A 5FD2A 5IQIA 3MDYA 3OY1A 5CAUA 4U40A 3V8WA 3QYWA 3JUHA 4AW2A 4FEUA 1ZRZA 3QQUA 2WIPA 3CIKA 4M97A 5HGIA 2VNWA 4MWHA 3S95A 1V0PA 2WU7A 2XK7A 2VTPA 4U41A 3IW7A 4DCEA 4J71A 3G33A 3UGCA 4O21A 1JWHA 2KTYA 3E8CA 4EHVA 2PL0A 4FOBA 3R7IA 2WTVA 3BWFA 5HX6A 3OCSA 5AX9A 4XG7A 3R7VA 2EB2A 4FK3A 4AT4A 3UIUA 3LFEA 4X3FA 1KWPA 3FI4A 3NW6A 4YJNA 5BVFA 4BDEA 5BYLA 3O8TA 5E7RA 1GY3A 1M2RA 3BELA 2P3GX 3LFCA 3V5PA 4KUJA 5CX9A 2BRMA 2XH5A 5AAEA 2XA4A 3OBGA 4FR4A 4OGRA 2XCHA 1UWJA 4YJQA 3PFQA 4A4XA 4XG2A 4RC3A 4UMUA 3UVPA 2XVDA 3VUKA 4C34A 4QTBA 3AXWA 4G31A 2A4LA 3SRVB 4YTCA 4X6RA 3VS7A 2J5EA 2CN5A 3PY0A 2IW8A 4A4OA 2WQMA 2ZM3A 2UZBA 4C37A 4O81A 4QMOA 4XG6A 1TQIA 3UYSA 4EKLA 4O6LA 4V05A 3VO3A 4M84A 2A0CX 2B9HA 5EH0A 4F0GA 3QRTA 3E8DA 5KO1A 4HGTA 4D4VA 5IUGA 3PVWA 4U3ZA 3IONA 5KZIA 3DTCA 2Z2WA 2YM5A 4LV8A 3M11A 5AAFA 1QL6A 3S00A 4LOPA 1YWNA 3EIDA 4LFIA 2PE0A 2W99B 3LFSA 4AGUA 3BLHA 1TQPA 4ZP5A 4FKUA 3AGMA 1ZY4A 3F3UA 3VRYA 4KS8A 1G5SA 2UW4A 2YITA 5HLWA 3MVJA 2UZDA 2G2FA 2C30A 3BBTB 3JXWA 5K9IA 3P7BA 3PJCA 4ZSLA 3HRCA 4ZY4A 4H05A 4RWLA 3EQRA 3LMHA 3BHHA 4IX4A 4FZDB 3AD6A 4IFGA 4DG2E 1Y6AA 1XKKA 4QPAA 5AV2A 4ZJVA 3O17A 1ZMUA 4NM3A 4FTUA 4V0GB 4DYMA 1YXTA 4FEVA 4BDBA 4FKVA 5D11A 2WELA 3K5VA 3HDNA 3RM6A 2WAJA 3C4CA 3GNIB 1Q8UA 2YAAA 4D5KA 3U8WA 5CSXA 5JT2A 4GT4A 2XJ2A 4PUZA 1NW1A 3K3IA 1KSWA 3MTLA 1UNHA 3ZYAA 1YXUA 3H3CA 4FTNA 2C3JA 1T46A 5DT4A 1OBDA 4C2VA 4Z7HA 4XV3A 2Z7LA 3EL8A 3LFDA 3FKLA 5HTCA 1M7QA 3R7YA 4LGGA 1YOMA 1FVVA 3QA8A 4X3JA 4EC9A 5HNIX 3NNWA 2LGCA 4GJ3A 3PXZA 3UQGA 4QP2A 4JL9A 3HV7A 2FO0A 3UNZA 1T45A 3R7GA 2EUFB 4MCVA 2QD9A 2X2KA 3SAYA 4IJ9A 5DHJA 4ZS0A 4YTIA 4XCUA 5A3XA 3N4VA 2OWBA 2O8YA 4WIHA 4O2PA 5J9ZA 5EDPA 3VAPA 4YC6A 4EKKA 1GIJA 3DNDA 3V5LA 1CMKE 5EYKA 2F2CB 4C4IA 3A2CA 1EH4A 4XHKB 3F9NA 4RG0A 3KXXA 1YXVA 3L8XA 3UG2A 4IX5A 4RZVA 1RQQA 4X21A 4AE6A 2A1AB 2RFEA 4MF1A 2XNOA 4EHGA 4B4LA 4EUTA 5FG8A 2X9FA 3EJ1A 4XNEA 3OP5A 4C3PA 2ZB0A 3MVLA 4QRCA 4DTKA 4RRVA 4F6WA 1WCCA 4ZEGA 2C0TA 2Z8CA 4XMOA 3CQUA 3QD3A 4U8ZA 3RPVA 4PL3A 4NIFA 5B2MA 2HXQA 5EW8A 5JZJA 4FT7A 5M55A 5L8LA 4FKOA 4HZRA 2HY81 1MRUA 3F3ZA 3F3WA 4NKSA 4AGDA 3BPRA 3QKKA 3R1SA 4D2RA 3JR1A 4IW0A 2BZHB 3W18A 3HMNA 5CVGA 2VWVA 3EN7A 2FSTX 1Q97A 2Z7RA 5DLSA 3FV8A 5I9VA 3DU8A 2CCIA 3E92A 3LE6A 4YC3A 3FKNA 3VS1A 3PG1A 3KB7A 3RGFA 1OIUA 3MIYA 2YZLA 2VN9A 1KE9A 2J2IB 2C6LA 3KK8A 3A61A 3KN6A 5T6KA 1A9UA 3HVCA 5L6WL 4KRCA 1WBPA 4QNYA 3AMYA 2ZVAA 3BHTA 4TL0A 2H96A 2BFYA 2UW9A 4N6ZA 5IQHA 1W8CA 3WZUA 4NK9A 3MBLA 4OBOA 5EOBA 5ICPA 4IHPA 3Q6WA 1G8SA 1XR1A 1ZOGA 4ARKA 2O3PA 2UVZA 4YJRA 1R3CA 2JFMA 2XYNA 4CV9A 5CQUA 4CXAA 4CLJA 2YDKA 4AZTA 5KBQA 5LJJA 5CALA 4QP8A 3PY3A 4FIEA 1Z57A 2XZSA 3Q9ZA 4BY9E 3N9XA 2O64A 4AT3A 4BZOA 3C4WA 4UEUA 1H01A 3ZONA 4ITIA 3HGKA 4AW5A 3TWJA 4I92A 3DXNA 2BRNA 1H4LA 4MBJA 3PA5A 4BRXA 3UE4A 1P4OA 4KIPA 3PIZA 2R9SA 4DHFA 3IW6A 3QGWA 4C58A 2R3MA 3C5IA 5CLPA 2RG6A 5AV0A 1UU8A 1GNGA 4YLKA 3C7QA 4U3YA 4CZUA 3PXKA 4L53A 4F7NA 3PP0A 2VWXA 1R39A 3NIZA 5ITAA 3HAMA 4PDPA 4JDHA 4B8MA 2F7ZE 1XH6A 2V7OA 2XK4A 3OTVA 4U7ZA 5EW3A 4GFMA 3WZEA 3C4XA 4GEOA 5IDNA 1IAJA 2YLEA 2YIXA 4XBUA 4I21A 4FNXA 4O0VA 2BRBA 2OK1A 1CKJA 3FZSA 1X8BA 4UWBA 4GS6A 4YBKA 3ZUVA 2P55A 1G8AA 4ACGA 5K3YA 4QMQA 4LM5A 4I0RA 2R3GA 3B8RA 3NGAA 2PUPA 2VTTA 4QQJA 5AJQA 4MK0A 4ASZA 4FIIA 3HEGA 4BTJA 2HAKA 1RJBA 5DFPA 4HYHA 3QCYA 1H27A 2DWBA 5KMLA 1TVOA 3HYHA 3QUEA 5EFQA 4AACA 5CF4A 3ZLSA 3HV4A 5IA4A 5M07A 5ANOA 1XHAA 3FLNC 4KIOA 4E8AA 5KUPA 5JFXA 4BHZA 4CFFA 2QO2A 4ZOGA 2G9XA 3Q5IA 3RINA 5JGDA 5L4QA 1BI7A 4OW8A 3CS9A 3DY7A 3OTUA 1CTPE 4IM2A 3QXOA 3RNIA 2OJIA 1FVTA 3BQRA 4FSWA 4KNBA 2JEDA 5AA8A 2VUWA 3R2YA 5HLPA 4CCUA 2ZDUA 4Y73A 1J3HA 1SNXA 4KIKB 3O8PA 3NUPA 2OXXA 5FXQA 4FIHA 1OIRA 4Z7GA 4CG8A 3P79A 4W4XA 1IASA 2VWBA 1HCKA 2JIVA 4DC2A 4E20A 5KMNA 4FTCA 1M14A 1OB3A 1OITA 3P7AA 4LGHA 4UB7A 1BI8A 4B7TA 2GSFA 3L8PA 4FSZA 3PLAE 4BTMA 2Y6OA 4AGCA 4X2NA 2A27A 3KRJA 4EZ5A 4FV2A 4IVAA 4U6RA 5AR2A 4DE4A 2Q0NA 1U5QA 2BMCA 4BCFA 1ZYDA 3HP5A 5BUEA 3LXNA 4MVFA 4YZMA 1Q61A 4GSBA 4Q2AA 5ANIA 4IAYA 4W8DA 5AP3A 5H8BA 5C01A 3SV0A 2GS7A 4ITHA 3FPQA 2OLCA 2VNYA 4NM7A 5HG8A 2X9EA 3DBQA 5HG9A 2C1AA 2VRXA 4P5ZA 2BHHA 3Q52A 4FODA 4MNEB 2PTKA 3RTPA 3VBTA 2HOGA 1H0WA 4ZY6A 3FY2A 1LUFA 4A06A 4R7HA 1UU3A 3NMUF 3O0GA 1DI8A 2ZV8A 2XNPA 1NVSA 2ONLA 3H0YA 5HHWA 4CV8A 4ANMA 3HV5A 5LARA 5BVEA 4BF2A 2PULA 2UZNA 3D7TB 2Y6MA 4J98A 4D28A 1JVPP 3WE8A 1YXSA 3PXRA 4MD9E 3PJ8A 4EZ7A 2YCQA 3GC7A 3KY2A 3MPAA 3PVGA 4ACMA 4BIEA 5FP6A 2O5KA 3FMKA 1RDQE 1YRPA 4R3CA 4RX8A 3U4UA 1PXLA 5E92A 2VO7A 4PMPA 5JRSA 2QU6A 3BEGA 4ZZNA 4FTJA 3LFNA 4FNWA 1NT2A 4RLLA 4AW0A 5CY3A 3POZA 4RJ5A 1FPUA 4HYIA 2W1FA 3EQBA 4C4JA 5HIEA 4IANA 5DR9A 4B0GA 5BVDA 5LQFA 4NL0A 1NVRA 4I4FA 4E4LA 3D4QA 3PXQA 4NCTC 4USFA 4F9WA 5A6NA 4FV5A 3SXFA 4O0YA 2X7OA 2VV9A 3ERKA 3ZSIA 2BR1A 1PY5A 5BUJA 4BIBA 3AC2A 4UXQA 4JBPA 4DH3A 5FTQA 3KF7A 3I7CA 3OCGA 4OTHA 2I0HA 4JAIA 3KRXA 4P5QA 5AAGA 5A46A 3VIDA 2VTLA 5EK7A 4HVSA 4ZSEA 5HU3A 2WGJA 1Q3WA 2ZMCA 3A99A 3C13A 1QCFA 3DTWA 3VF8A 4ZTMA 5BQ0A 2WTJA 1ZYLA 1JKLA 2ZM1A 3HKOA 2VTQA 2W4KA 3LCSA 3Q4TA 4WRGA 5E90A 1OIQA 3LJ0A 4E6CA 2RFNA 3IOKA 3QUDA 4K33A 3QRIA 4NWMA 3SVVA 4C62A 1H07A 1VYWA 4RBLA 3ORPA 1VYZA 3E88A 3KL8A 4P2KA 5B0XA 3WIKA 3ZDIA 4ANLA 1UKHA 4TYJA 4W9XA 3GCVA 4PPBA 2CKEA 4QMLA 3P78A 5FRIA 4C2WA 4EWQA 3MH2A 5AR3A 4AF3A 4C59A 1Q3DA 2ACXA 5J8IA 3MFRA 4JBVA 3DLZA 4KRDA 3ZC6A 5JH6A 5E1EA 3E3BX 3OF0A 1UNLA 3HMIA 3F5XA 4FMQA 4ZAUA 3PZHA 4OTQA 4R6VA 3AC1A 2ITZA 4W4VA 4WG5A 3Q5ZA 5HU9A 2G2HA 4K2RA 4G3FA 2A19B 3HAVA 1FQ1B 3E3PA 3ET7A 1AQ1A 3OROA 4BCJA 1KOBA 2ZV9A 4ALUA 3VS6A 5K0KA 4FSRA 1P4FA 1QPDA 3R8PA 3FI8A 1KE6A 5JFVA 2JKKA 4IWDA 5A4EA 3WYYA 5J7BA 2IW6A 4EC8A 4L68A 4FIGA 3R1QA 2WTKB 5DWRA 2VGPA 3BV2A 2OXYA 1XH7A 2E9UA 3F2AA 4BDAA 2HYYA 5L8KA 2PYWA 4QNAA 4S30A 5K5XA 4PTEA 4WKQA 4DBXA 3V3VA 5LMBA 3UVRA 1RE8A 3R8LA 3RMFA 3UOKA 5KMIA 4I6QA 2W1CA 4AU8A 4I6HA 3MVHA 2NRUA 4ANBA 1KUTA 2HK5A 4BKJA 4JBQA 5AUUA 4IDTA 3ATSA 3ORNA 1GIIA 3TNWA 1Q8YA 4FTAA 4F1OA 3N4TA 1OUKA 1KV2A 2C0IA 1JPAA 2EB3A 2ITNA 4IZYA 3VUTA 3C1XA 2CGUA 2HY0A 3NCGA 5JFSA 3BGQA 2H34A 4FI1A 3DZQA 4I5CA 4YPSA 3SD0A 4I0TA 2IN6A 5A4CA 1Q24A 4D2PA 3NUUA 2HENA 2FYSA 3BU3A 3DJ5A 4U79A 1XQZA 3FSFA 3MW1A 1XBCA 2GU8A 3MPTA 4FSYA 4FV9A 4RIXB 3PIYA 5HBHA 5TOZA 3ZRLA 5I5ZA 4FG7A 2PMNX 3I60A 3TDVA 3PXFA 3FLZA 2Q83A 4J7BA 3OZ6A 5CEMA 1PF8A 3KULA 4H58A 4UZHA 3ORTA 4O1PA 4IIRA 4WBOA 4JDJA 4F09A 5C8NA 5CEKA 5CU4A 1S9IA 3KRRA 4IACA 3UZPA 4C8BA 2XS0A 4AE9A 4RFMA 3BKBA 4K77A 4DT9A 3QF9A 2QC6A 3HECA 4A9YA 3AD4A 3KCFA 3IW5A 4TYIA 5CNOA 3TJCA 3C50A 4RLKA 1LP4A 4GFOA 3UTOA 1AD5A 2BHEA 4C7TA 5DR6A 4FK6A 5HNBA 4CLIA 2XRUA 5FUTA 3LZBA 3W8LA 3DKGA 5J5SA 1Q99A 2P4IA 1OL1A 1PXNA 4IB3A 4ZMEA 5L2SA 4FZ6A 3A7FA 4KKGA 5AP6A 5LVPA 3E62A 5BX0A 3D14A 3IW8A 3DOGA 4GUEA 2X7FA 3F3VA 3W2QA 3FZOA 5EOLA 2XK9A 2I0VA 1LEZA 4KA3A 4QTDA 3H9RA 5C26A 4PQNA 5EDRA 4ZJIA 3DPKA 2ZM4A 3LW0A 2JDSA 1OIYA 4O7RA 5IQFA 1OL6A 3HL7A 3EWHA 4FVPA 1JNKA 2IZTA 5D7AA 4BCOA 4ENYA 2RSVA 3L9MA 4M7IA 4RX7A 3P08A 3JVRA 4R7IA 3VC4A 5CSPA 1Y8GA 4CZTA 4M14A 2VTMA 3CP9A 4MH7A 4DTBA 3OD6X 5FDXA 4JRVA 2YJRA 2RIOA 4AGWA 4K18A 4KKHA 3FI3A 3COIA 3MFUA 4BI2A 4NJDA 2C5XA 4Z55A 4KKEA 2F7EE 4I0SA 3OEZA 4FOCA 3UOLA 4DFNA 5CSVA 1CKPA 4WHZA 4JR3A 1W84A 1IAHA 4FNZA 1O6LA 4GMYA 1YW2A 3MB6A 4FTQA 3N51A 3RZFA 4IAKA 3CY2A 1YVJA 3DKOA 3QRJA 4BKZA 5KNJA 4DFLA 3CCNA 4ASDA 5GHVA 4DEAA 2XIKA 2XIYA 2DYLA 1OKYA 3VVHA 3RPRA 1V0BA 2JFLA 2BKZA 4QP4A 1ZZ2A 4EJNA 3CJFA 3DFAA 2I0EA 4FT9A 4F0IA 3ORIA 4G6OA 2ITTA 4WNPA 4AN9A 4EK6A 3F3TA 5HCZA 3ZLWA 2QNJA 5F1ZA 2G1TA 3EYGA 3LFBA 4GK2A 2WTCA 2PZ5A 5TO8A 4XOYA 4BWPA 3RHKA 5DI1A 4E6AA 3KXZA 4FV1A 1OL5A 4XLIA 3TKUA 4HGSA 1OUYA 2X2LA 4FKTA 5A14A 1JKTA 4JI9A 3KU2A 5DEWA 4GKHA 4TTHB 2J0LA 4F9BA 5K4JA 5EQYA 3DNEA 2QOQA 2V7AA 5E4HA 2GPHA 3W2RA 3G9NA 4ZTNA 4FVRA 4IH8A 3QYZA 4Z16A 3VS2A 4R3PA 2WMXA 4XLVA 2YM7A 4ZTHA 1ATPE 4E4MA 4F63A 4JQ7A 4EQMA 4MXZA 3MIAA 5I0BA 4AFJA 2R0IA 3NRMA 4ONAA 2WTIA 3ZMMA 3ALOA 4GIHA
chains in the Genus database with same CATH superfamily
2X8IA 4I20A 5J9LA 5HD4A 4LRMA 3KVXA 5IU2A 4IWQA 3AC3A 3H9OA 2CMWA 2XJ0A 2UW3A 3A62A 4IX6A 2QOKA 3EQGA 4O7WA 4L45A 4TWOA 3SC1A 4XJ0A 2XF0A 3DZOA 3E63A 2VO3A 3FLYA 2YEXA 4YZDA 3SDJA 3ORXA 2UW7A 2XK3A 5H3QA 4HZSA 3GC8A 3BRBA 3FBVA 4OLIA 4WG3A 5E8YA 4RVLA 2PUNA 4USDA 5DRBA 2BROA 1IA9A 3D2KA 3EKNA 4FSQA 2RKUA 3IKAA 3LVPA 2I0YA 4JRNA 4MD8E 2R4BA 4QMSA 3R9HA 4DGOA 4RC4A 4OTRA 2JAVA 3I0QA 4JT3A 3PRIA 4ALWA 2YACA 2W7XA 2OO8X 3BYSA 4RFYA 4BYJA 1W98A 3NX8A 3RK5A 4U97A 5C27A 3I79A 2VX1A 1FBNA 5CI6A 3NWWA 4E7WA 4V01A 4CG9A 4H39A 3D5VA 5GINE 2XEZA 3JVSA 3GFWA 4EK4A 1BKXA 3UQCA 2W0JA 3RCDA 1GZOA 4IB5A 2OICA 5E9EA 4CTBA 2YDJA 1B6CB 3R01A 5M56A 3QLGA 3TZ7A 1PKGA 3COKA 4M67A 1Q8TA 3E93A 4X3FB 4LV7A 2B52A 4FV7A 3RAWA 3HLLA 3BU6A 3L9NA 3V01A 4O86A 3BHYA 2RFSA 5IQGA 2CGWA 3W32A 2ITPA 3MI9A 5K0XA 5KHWA 5FEDA 4MBLA 4EOSA 4EZ3A 1E1XA 3LOKA 3ZO4A 1UWHA 4PDYA 2PZRA 3R8ZA 1UV5A 3QZIA 4HW7A 3E7VA 4FZAB 4V04A 4BCNA 3D5WA 4BTFA 3E64A 4O4CA 1SYKA 3BHUA 3GCSA 2XIZA 3ITZA 3NAXA 1ZWSA 4DF3A 4CFUA 3FMMA 4QP7A 5ACKA 3ZLXA 3IK3A 2ETKA 4RGJA 4OBPA 5GJDA 1WBTA 4OTGA 3GU8A 3BGPA 3LQ8A 3EYHA 4TNBA 3OG7A 3Q04A 5J1WA 4QD6A 4GL9A 4C57A 5IH6A 3V04A 2V22A 3EN6A 3TNHA 4I5HA 2VWIA 4ALVA 5CAQA 3E8NA 5K4IA 4EH6A 1ZLTA 3QQGA 3RKBA 2WMTA 2VTNA 3FKOA 4IXPA 4FT3A 2CNVA 1DAYA 1JKKA 1G8JA 3B2TA 4R1YA 3PDTA 4GCJA 3L9LA 1DS5A 4FKJA 2J9MA 4KSQA 2VTSA 4XG8A 3UPZA 3PJ1A 4J99A 5LCJA 3ZUTA 2BTRA 3ETAA 4LUDA 1J1CA 2EXMA 4O91A 2HZNA 5C03A 3ZFMA 1MRYA 3OWKA 4G5JA 4FEQA 4QPSA 3OFMA 4N0SA 3NNXA 3TNPC 3K54A 4M3QA 1NA7A 2Y4PA 2ZYBA 1BL7A 4IDVA 3QBNA 4FUYA 3FXXA 4UZDA 5FBNC 4AA0A 3QX4A 3R7OA 1REJA 3LFQA 3QL8A 4QDEA 4CFMA 2UW6A 4BCPA 4EOOA 2X1NA 4O0WA 3DFCB 2IZSA 2G15A 3GOKA 4FIJA 4HJOA 4FGBA 4YJVA 5J95A 3ZRKA 3C9WA 3OVVA 5FLFA 2JIUA 4EOMA 5JMSA 4LG4A 4F1MA 4RSSA 2QU5A 3P0MA 3QC4A 3KN5A 1H1PA 4IC7A 2GHMA 3UIMA 3TDWA 3KKVA 3SKCA 5HE2A 4J95A 3U55A 4LV5A 4R77A 1NXKA 4LQMA 1GIHA 3FMEA 4ZXTA 2YCRA 5LWNA 4R5YA 2JGZA 4QQ5A 2B0QA 4XP2A 5ETCA 2B53A 2YCFA 3MH0A 4QMMA 5IQAA 5H8GA 2XNGA 2X39A 3U6HA 3H30A 4U5JA 4X6QC 3R7UA 4UMRA 1BUHA 5BMSA 2CLQA 4DHIB 4DN5A 5HE0A 2ERKA 2E9NA 4FV3A 4GT5A 5FBOA 3HA6A 3RWPA 5LVMA 1LEWA 3RPSA 4CNHA 4QTEA 4F64A 4S31A 4BL1A 4WUNA 2QQ7A 3BHVA 3GQLA 3F66A 4CT2A 3QCSA 2QOOA 4FTMA 4MHAA 4DGGA 5IDPA 3NYVA 2OW3A 4G6NA 4UALA 5KMJA 4JR7A 4ASEA 4KBKA 4L67A 4BCMA 1J7LA 3QCXA 4TW9A 3RJCA 3UP2A 1SVGA 3AT4A 2OG8A 2VZ6A 2WTDA 2YIRA 5I9XA 5CEPA 5BVWA 3TACA 5IISA 4F78A 3ZS5A 3UMXA 2WO6A 3OWPA 4NIFB 3U6IA 2OH0E 3POOA 2PSQA 1R0EA 3WF6A 3E87A 4U80A 5HVKA 5JZNA 3ZO3A 2ZJWA 3G5DA 4ZTSA 3ZSGA 5HIDA 4DEEA 2YM8A 4EORA 3QTUA 4BC6A 4ERWA 3VUHA 4F6UA 3LXPA 4ZSAA 3W2SA 4AA5A 4DH5A 2VU3A 3JY0A 4YJTA 3W8QA 5BVOA 4JIKA 1WBSA 2PZIA 2XM8A 4OAUC 4IZ5A 3KXGA 3RM7A 4W9WA 1ZOHA 5LVLA 4W4YA 4I3ZA 5HTIA 4I41A 3PSDA 4O7VA 2QOFA 3QFVA 2IG7A 1Y6BA 1J7UA 1Z5MA 3I1AA 4GW8A 4LRJA 5F94A 3WOWA 4MXXA 2X6DA 3W10A 1YI6A 4BDCA 5LWMA 2UV2A 3VUDA 5HO6A 3KEXA 3W33A 4EOKA 3R9NA 4G3DA 4HGLA 4W4WA 4EH8A 3IO7A 3UIBA 3A7JA 3GC0A 1SMHA 2UUEA 4LUEA 4GK4A 2WMSA 2OI4X 2ZDTA 3CKXA 5LMKC 5HE1A 3BU5A 4BDGA 4XG4A 4IVDA 2O63A 4HPTE 5E8SA 4CMUA 2GNFA 3G51A 2DS1A 3FHRA 3ULIA 3CR0A 1M17A 2BAQA 3AG9A 4RA5A 3VHEA 3GU5A 4DDIA 2HZIA 4D9TA 4IFCA 5BNJA 3VNTA 2R3HA 3IDPA 4FKSA 3EFWA 2G01A 2X2MA 4U42A 2HW6A 5IA2A 3EN5A 2J51A 4RA4A 4YHTA 3NVKI 1PMUA 1ST0A 3QTZA 3MH3A 3RK7A 4EOIA 2B9IA 3EFLA 4L00A 3K5UA 4DT8A 5IQEA 3MY0A 2AUHA 3EH9A 3IW4A 2B7AA 4U81A 4YJPA 4RVMA 4FVQA 3R7EA 3OCTA 4P7EA 5GZ8A 4U45A 3LKMA 5DOSA 3ATTA 2BVAA 4C3FA 1XH5A 2X4FA 5GZAA 4YJUA 4DEDA 2PVJA 2VWYA 5HESA 2GNGA 4PDOA 4E73A 1J1BA 4BCQA 5ANEA 4DLJA 3Q9XA 1XO2B 3D9VA 1PRYA 3QHRA 4ZZOA 3HV3A 2OJ9A 2W96B 4BDKA 1Y91A 1O6YA 5IA5A 3VONA 3DCVA 3V6RA 3Q53A 4FT5A 3R8MA 4PTCA 3FDNA 1URCA 3U9NA 2V0DA 3HRBA 2Z7SA 3TUBA 5ANJA 4XOZA 5F20A 4LRKA 3UNKA 2IVSA 4DGMA 1W7HA 3ALNA 4OTDA 2C5YA 3VS5A 3ZM4A 5AP4A 5M06A 4RJ4A 5EI8A 2AYPA 3VWAA 4I23A 3G90X 2PE2A 1QPJA 4AZSA 2OJGA 3AMBA 1WMKA 4X2GA 2VO0A 4ERKA 2WEIA 2EXCX 2PVMA 3C4FA 4Y83A 4LMUA 5D10A 1SZMA 3UC3A 3QALE 3MA6A 3GENA 3OT8A 3JYAA 3R73A 4H3PA 2QO7A 4BICA 5AR4A 5BPYA 3ORLA 3OUNB 1QPCA 3II5A 4BR3A 4ACHA 3PPKA 1S9JA 5EQEA 4D0WA 4QMTA 3TYKA 3KXNA 2FGIA 3FZRA 3DDQA 1OPLA 5DBXA 3GC9A 3TM0A 2C6TA 1IEPA 2GNHA 3P23A 4IX3A 4E3CA 1OGUA 3NUSA 1PXIA 4FKWA 3HX4A 3UO4A 3LFAA 4BDHA 5LOHA 2R3NA 1L3RE 3FZ1A 3L9PA 4KS7A 4O4DA 4UWCA 4FTIA 4X0MA 5E8TA 4M68A 3VRZA 4BGGA 4FZ7A 4M69B 4Q9ZA 4FA2A 2C47A 4IMYA 4L43A 4ANOA 4M69A 3OXIA 2C1BA 3NNVA 3PA3A 4U44A 3I81A 3Q2JA 3FC1X 4O82A 3KMMA 1DM2A 4HCTA 2YLFA 4L8MA 4TYGA 3ZOSA 3B8QA 3TTIA 3P86A 2GQGA 4YPDA 1NY3A 2UW5A 3EQCA 3M1SA 3NZ0A 5IF1A 4QMXA 5C4LA 4L3LA 4QYEA 4XEYA 4G6LA 3A7GA 3ZZWA 1L8TA 5GIOE 5AUVA 3P4KA 4FG9A 3VULA 4AW1A 3ZCLA 4DH1A 3DAEA 4O96A 3R8UA 4E4XA 5IEXA 3F7ZA 2GQSA 3Q60A 2JDRA 2X0QA 4Y72A 4J1RA 3SW4A 5H2UA 1BYGA 5HG5A 4FTRA 3PE2A 2LAVA 1M2PA 2YABA 3BYMA 3VW8A 4J96A 3FL4A 4GVJA 3DA6A 3NLBA 3NR9A 3EQPA 4J97A 4NFMA 4F1TA 3NIEA 1U5RA 5FEEA 4PV0A 2JDVA 4D55A 5HORA 5B7VA 3MH1A 4PF4A 1YWRA 4HCUA 4AX8A 3SX9A 3FMNA 4H3BA 4YU2A 5CEOA 3UDBA 5J9YA 5HQ0A 4DEIA 3CJGA 3GU6A 4H1MA 4E6QA 2FSLX 2PZPA 4FTOA 3DJ6A 5IH4A 2YFXA 3CQEA 3MJ2A 3OWJA 3PWDA 4YLLA 5HCYA 5IMXA 3W0NA 2PY3A 2HWOA 4H36A 4JG7A 5CT7A 4C61A 4EK5A 4F99A 1U59A 4ZTLA 2I7QA 2YM6A 3COHA 5AUZA 3V5JA 2WU6A 3PE1A 4IM0A 5CU6A 3DLSA 5FXSA 4IVCA 4WA9A 2YM3A 1UA2A 4HVGA 3RZBA 5CVFA 2GDOA 4BDIA 4EH2A 5E1SA 3ZSHA 2WD1A 2OKRA 2HCKA 4RX5A 4J8MA 5CSHA 2ITXA 4XP0A 2WTKC 4U0IA 4OTIA 4WG4A 3GP0A 4UY9A 2ZMDA 4S2ZA 2PUIA 2RL5A 4L42A 3WZDA 4EOLA 2BUJA 2CPKE 2X81A 3HMMA 2UW8A 4WO5A 3DQWA 3R04A 4MKCA 5IQBA 1ERKA 4ZZMA 4JBOA 2R3FA 3OC1A 2C5NA 3E8EA 1Q62A 4RJ8A 5TR6A 2O2UA 2XKDA 4GG5A 2R3PA 2OZAB 4F7JA 2OZAA 2XKFA 3PYYA 3WE4A 4FKIA 3ORKA 1ZMVA 5HE3A 1FVRA 1OL2A 4OAVB 4QQCA 4QT1A 2R3KA 4EJ7A 5JEBA 2REIA 2PVNA 3QUPA 5DRDA 2FSMX 1DI9A 1ZMWA 5B2LA 5LXMA 1CKIA 3QKMA 2V5QA 4F0FA 1F0QA 3NUXA 4AZVA 2QLQA 2JITA 1H8FA 3WBLA 2WKMA 4QMZA 5KMKA 3VUIA 4TRLA 5L2QA 4I93A 4RZWA 2IZRA 4ASXA 1VJYA 3SG9A 4BDFA 4F65A 1I09A 3OMVA 3E7OA 2BRHA 2F4JA 3H9FA 3TXOA 5DMZA 3ZBFA 3GCQA 2ITWA 4MAOA 1E9HA 4NT4A 3G15A 1RW8A 1O9UA 1PXMA 2HXLA 1OPJA 4DTAA 3PJ2A 3WF5A 1JQHA 2R3LA 5JN2A 5IPJA 1TFFA 4K8AA 3ID6C 3NAYA 5AR5A 3RI1A 3WIGA 4C4EA 5K5NA 2YCSA 5L2WA 4BKYA 2B9FA 4P90A 2WXVA 1BX6A 3CTQA 2F2UA 2OIQA 2WFYA 5M53A 2WQBA 5EYCA 3SHEA 3WF8A 3I6WA 3P7CA 5AFVA 3TT0A 3LJ2A 4A7CA 2ZV2A 4FKQA 5DPVA 3Q4CA 5IG1A 1ST4A 3G6HA 1JBPE 1LPUA 5M4UA 2PMLX 3DGKA 3Q96A 4NCTA 5H9BA 4D2VA 3A4OX 4F9CA 4GH2A 4AZEA 2R3JA 1ZOEA 3BIZA 4XUFA 1Q8WA 2O0UA 3EOCA 2CNQA 5ANGA 4QDVA 4OTWA 3TUDA 3QWJA 1JSVA 2OXDA 4FV8A 3EN9A 3NW5A 1REKA 2NNWB 2JDOA 5EKOA 4FUXA 5E8XA 2QLUA 3OXTA 4AZFA 2UZTA 4FRFA 5E91A 3BBWA 3QQHA 4KAOA 3G2FA 5H8EA 4C3RA 2Y4IC 3KULB 5JQ5A 2GFCA 2CSNA 2I40A 2IO6A 1UU9A 3LXKA 2ZV7A 4NKAA 4DG0E 3FL5A 4IBMA 3AKKA 3DAKA 4M66A 1M52A 3WZJA 3A7IA 4JG8A 3W2OA 3W0RA 3R9OA 4YUQA 2VX3A 3R8VA 2QKWB 2QOIA 3ZLYA 4ZS4A 4RMZA 4YHFA 3TKHA 2QHNA 4D4SA 4RJ3A 3AC4A 3JY9A 2HELA 2BPMA 3TIYA 5CU0A 3F6XA 5AP2A 4WOVA 4IB1A 5DT0A 3W0SA 3CQWA 3R00A 5JKGA 1ZARA 2QOCA 5EW9A 3RNYA 2C69A 3EZVA 3DB6A 4D1ZA 2W5AA 3FY0A 1YOJA 4FL1A 4PNKA 3EQFA 3K2LA 3IECA 2R3IA 4IE9A 5FEQA 5GJGA 1ZYJA 1PXPA 4G16A 5AM6A 1WVWA 2XARA 3W16A 3I5NA 4AS0A 5EQPA 2E9VA 1YDSE 4IWPA 5HEZA 1OVEA 4L6QA 3BX5A 1W0XC 3MJ1A 3MSSA 5KMMA 3ANRA 5DVRA 3PXYA 2W1DA 3HP2A 2CCHA 3ACJA 4JOAA 4PTGA 1WAKA 2PVHA 4L01A 2VTIA 4EQCA 3UC4A 5LCKA 3TN8A 4AN3A 3ZDUA 5IEYA 1Y57A 3SXRA 5J1VA 1IRKA 2XNNA 3T3VA 4D4RA 2IPXA 3COMA 3SXSA 2GCDA 5DIAA 4G9CA 1U54B 4O38A 2JKQA 5FM2A 4AWIA 4TYHB 1U54A 3O71A 3JS2A 4TYHA 1HCLA 2WZJA 1PMNA 4IZAA 2C3LA 4G3CA 4H3QA 4MQ2A 4YNEA 4QP1A 5BVNA 5L6OA 4G5PA 4X2JA 3I0OA 2YIYA 4IWOA 4YSMA 4J53A 5FTGA 5CZIA 4EH4A 4O0XA 1PYXA 2J0JA 5AUWA 4YJSA 4N4SA 3TV4A 3DBCA 4U9AA 1PYEA 3RAHA 2YIWA 4EYMA 4R1VA 3QC9A 4D4YA 4JLCA 4CGAA 3GEQA 4O0TA 2VD5A 4YP8A 5JRQA 2YA9A 1H1QA 3S0OA 5IUIA 5AP0A 2NYAA 3NW7A 4ITJA 4QYFA 4YNOA 3WYXA 1OECA 2FA2A 3F7WA 3QQKA 3ODYX 1J7IA 3VHKA 2BDJA 3A4PA 3UZRA 1WBNA 3QLFA 2XNEA 4G1WA 4L52A 1K9AA 3FQSA 4CYJA 2GS2A 5DE2A 5FGKA 4UMTA 4CKRA 2BKKA 3HRFA 3S1HA 3BI6A 3REPA 4IADA 4UYAA 3HUCA 4Y95A 4C4GA 2WQEA 2F49A 3CPBA 3FJQE 3QTQA 4LOQA 4CFXA 2XNBA 4PPAA 5C4KA 4YZBA 2QR8A 1YDRE 5AR7A 3KREA 4BIDA 3FYKX 4I4EA 4EOJA 5M4FA 4O7ZA 5BYZA 1Q41A 2QCSA 4D1SA 1GJOA 3KXMA 5CENA 5AV4A 2XM9A 4EI4A 2BIYA 1ND4A 3CSVA 3TIZA 4IJPA 3WZKA 3FI2A 3CTJA 3O50A 4YZ9A 5DG5A 4EH9A 4UMPA 3DAJA 4OUCA 5FWKK 4NM0A 2J50A 4O7YA 3DBFA 3AC5A 3QRUA 4JX3A 3V5WA 3ZFYA 4A9SA 4AUAA 5KX8A 3C0IA 4EK8A 3FPMA 1YOLA 2X0OA 2IVTA 4PMMA 5EI6A 3MA3A 2VTOA 3AT3A 4GV1A 1OKVA 5A4LA 2YDIA 3OT3A 4EH5A 2XP2A 3FEGA 1R0PA 1VEBA 1KE5A 5EG3A 3KXHA 3PZEA 2QG7A 3G6GA 2DQ7X 2W1ZA 3FLSA 2Z60A 4M13A 4DGNA 2BDWA 3PLSA 3DK7A 3IQ7A 1Y8YA 3L8SA 4X3FC 4UWYA 5BVKA 1V0OA 1K3AA 5EM5A 3AT2A 3ELJA 2R3OA 3OEFX 3QX2A 5AV3A 4HNFA 4Q9SA 1AGWA 2P2HA 3O8UA 3QD2B 5ACBC 3RAIA 4L7FA 5AUTA 2F57A 4JDKA 1WBOA 4F6SA 4NU1A 4NTTA 4GT3A 3R63A 4XV2A 3IGOA 4G9RA 4MTAA 4G2FA 4PPCA 4PMTA 3DT1A 4AOIA 5M57A 3KF4A 4CTCA 5CYIA 3R28A 1JAMA 3AGLA 2X7GA 4MWIA 4ZSGA 4IAAA 3VN9A 3PSCA 4H1JA 4FKGA 4DAWA 3FHIA 1KOAA 1Q4LA 2XK8A 3EQDA 3MB7A 3CTHA 3F82A 5M44A 1YQJA 1GOLA 2X8EA 4BBEA 3KMUA 5HO7A 2QO9A 3EMGA 3GQIA 3V8TA 4RQKA 4CZYB 4FEWA 4FEXA 3GUBA 5A4TA 5CF8A 5CI7A 4ZK5A 3ROYA 2DUVA 2VGOA 4D58A 4L7SA 4FV0A 5C9CA 4BTKA 5A54A 1MP8A 3LAUA 4DH7A 4EHEA 5CU2A 3T9IA 5I4NA 1YDTE 5KKRB 4TT7A 4FSTA 4QP9A 4XG9A 3HA8A 5D1JA 3UVQA 4QPMA 3V5TA 2UZOA 3R30A 3MESA 5AM7A 2C6IA 2ITQA 4RIWB 2R2PA 2JC6A 4A9RA 3LCKA 4IZ7A 4RIWA 3LM5A 3TV6A 4UN0C 2C68A 4O22A 2FSOX 4DBNA 2VO6A 2B9JA 3BE9A 4HPUE 4J52A 4OT6A 4P4CA 4HOKA 5M4IA 3FYJX 2PU8A 2C6DA 3TZMA 5DYJA 1E1VA 2C6OA 2QOLA 4YZCA 3ORMA 5ETAA 3TTJA 1GAGA 2PE1A 2WOUA 4PWNA 1OMWA 5LVOA 2J90A 3UYTA 5CEQA 5JGAA 2YIQA 1PMEA 4MX9A 2BCJA 3DKCA 2G2IA 4RWJA 3QTSA 5CAOA 2Y8OA 5JFWA 3PUFC 2H6DA 3M42A 4I5MA 3VW6A 2YISA 5TKDA 4EUUA 4CMOA 4WT6A 4EEVA 2WPAA 2ZOQA 3CY3A 3WF7A 3EQIA 4HVDA 2WNTA 2WMWA 3QD0A 4JVGA 3KQ7A 3FSKA 3LQ3A 4NEUA 3O2MA 3FMHA 1OI9A 1PXJA 4FSNA 3O5AA 4QMWA 5I9YA 1H25A 1PKDA 5M51A 4KABA 3PRFA 2ETRA 4Y5HA 3A7HA 4BCKA 1VR2A 1GZ8A 2I1MA 4RWIA 3CGFA 5L3AA 3BE2A 5CVHA 5EHLA 4YLJA 3AQVA 3IDBA 3VF9A 1YHSA 2V55A 4PL4A 3F5UA 4O4FA 3BZ3A 2GNIA 4WBBB 4AP7A 3TZ8A 5CEIA 2OFUA 4BI0A 5C8MA 2GNLA 5AP5A 3VQUA 4E26A 5I9WA 1SVEA 2IVUA 2WQNA 2BAKA 3R1NA 4GIIA 1LR4A 4RT7A 2EWAA 4BGQA 4GYGA 3SRVA 3NCZA 5L2IA 5HG7A 1OBGA 3DK3A 4WNKA 4HYUA 1A06A 4G34A 2Q0BA 3UBDA 2W17A 4NJ3A 2W5BA 1M2QA 4Y5QA 1FMOE 2IVVA 4DA5A 2CHLA 4I22A 3VUMA 3ZC5A 3SA0A 2FB8A 2IW9A 4QMNA 2XCKA 3F69A 1WBVA 4CSVA 1HOWA 4O7TA 4D2TA 1H08A 3O7LD 4Y8DA 4Y46A 5D12A 2YJSA 3CD3A 3R9RA 3W2PA 3F61A 3EFKA 3NUAA 4AOTA 1B39A 3ODZX 3UPXA 3Q4ZA 4BBMA 4JIAA 5F95A 5L6PA 3D5XA 2X6EA 1H1RA 4YMJA 3ZO2A 3AD5A 4QTCA 4RPVA 4ZTQA 2UVXA 4QTAA 2HZ4A 1BLXA 3ZHPC 2AC5A 1PJKA 2W9ZB 3FC2A 4XYFA 1XBBA 3HNGA 3IGGA 4ZJJA 4EH3A 1XH8A 2Z7QA 3MVMA 5GNKA 5CAVA 4BGHA 4V0GA 2BFXA 4A07A 3DXQA 3SG8A 2ERZE 4I5PA 2JBPA 3QA0A 4XRLA 1W83A 1A48A 5IQDA 4QO9A 3S2PA 3W0PA 3QQLA 1VLRA 4FX3A 3THBA 3GT8A 4NW6A 4CT1A 1XH4A 2BRGA 4O83A 5HTBA 5A6OA 5AV1A 4R7BA 2VTAA 1STCE 4O7SA 2NP8A 2QOBA 2F7XE 4M0YA 1UU7A 4FYNA 4YHJA 3FXZA 1QPEA 1MUOA 2QHMA 3MV5A 3OUKA 4KB8A 4WNMA 4EWHA 4CKIA 4CVAA 5IH5A 3NFFB 3KRWA 2BZKB 3RHXA 2J0KA 4M8TA 1APME 3ROCA 4QMVA 3W55A 4BDJA 5IA3A 3FMDA 4NH1A 4S34A 2P0CA 2BDFA 2PVKA 3IOPA 3Q32A 2Z02A 3NYNA 2PVFA 4HGEA 3PFYA 2H8HA 3BYUA 3A8WA 2Y0AA 4L3JA 4Z3VA 3ENMA 5BMMA 3A60A 4KWPA 2ITUA 4EBVA 3PVBA 2YAKA 4GU9A 3BLRA 4EBWA 3ZEPA 2F9GA 2ZB1A 5BYYA 3MYGA 3PPJA 2Y7JA 3FAAA 3L1SA 3PIXA 4ANQA 2QR7A 4C36A 4XV9A 2E9OA 4S32A 4J8NA 1IG1A 2W1IA 3LMGA 4K6ZA 5EM6A 1KE8A 2B54A 3UNJA 2W5HA 4HVHA 4BBFA 4FL3A 2BILB 5E8UA 4HYSA 4UBAA 4GK3A 4YC8A 5DN3A 4A4LA 4DINA 4GYIA 3ZTXA 3CC6A 4EYJA 4ZTRA 4PY1A 3EFJA 3FMJA 4DLIA 5A9UA 4CFNA 5JSMA 2WTWA 2GMXA 4C35A 2EVAA 3LFFA 3PY1A 2OIDA 2OZOA 4TXCA 4TNDA 2XRWA 4C4FA 3G9LX 3QZGA 1OPKA 1P14A 3DS6A 3QRKA 4BYIA 5I3RA 2BZJA 5J79A 4RVKA 4R3RA 2OJFE 2J4ZA 2NRYA 3OS3A 4HCVA 3HMPA 1TKIA 4PMSA 1XMMA 3F5GA 4JAJA 4MYGA 4XRJA 2UW0A 4JNWA 5HNGA 3GGFA 4PNIA 3BQCA 3QTWA 4YR8A 2PZYA 3LLTA 3FE3A 2JDTA 4GRBA 3FLQA 2OU7A 3IS5A 5BUIA 1PW2A 2GFSA 3KGAA 2X8DA 2CKOA 3WILA 3K3JA 3GU4A 4IEBA 5M4CA 3FUPA 2BTSA 4FV4A 4RJ7A 4F9AA 1B38A 1WBWA 3MFTA 3Q4UA 4EHZA 3VS0A 3UZTA 2QURA 2R3QA 4YTFA 1OKWA 3QZHA 3BYOA 3GCUA 4UV0A 5IKWA 5CXZA 1OM1A 4F9YA 3U51A 3CLYA 4QMPA 5EHOA 2CN8A 3TKIA 4EQUA 5F4NA 5CASA 2WMBA 3O23A 4PL5A 3MWUA 1YI4A 3UG1A 3FXWA 3Q9WA 4R8QA 4IC8A 4ZSJA 4K0YA 4MNFA 3ZFXA 3C0HA 3LCDA 3SQQA 3NPCA 4L44A 3OBJA 3RP9A 3VS4A 4AA4A 4DFXE 4CKJA 2R7BA 5JGBA 4ID7A 2I6LA 4D0XA 3HUBA 3DKFA 4GG7A 3PP1A 3LMIA 5L8JA 4CCBA 2YN8A 4LL5A 3QQJA 4YSJA 2W1GA 1ZYCA 2PWLA 5HICA 3LLAA 2RG5A 2W4JA 4O1OA 4PDSA 1H24A 4YGAA 4PRJA 2SRCA 4K11A 2E9PA 2XNMA 5ETIA 1JLUE 1P2AA 2C6KA 2C3IB 4RWKA 3LHJA 5FQDC 1FMKA 5M09A 5E8WA 2ETMA 3CE3A 5AX3A 3D7ZA 3VBWA 4BZDA 2ITOA 1ZYSA 4G3GA 4NFNA 5I9UA 3UODA 3ZBXA 5J7HA 3IG7A 2EXEA 5KZ0A 3MN3A 3H10A 2JKOA 2UZVA 3OHTA 3W2CA 3AC8A 1FGIA 3VBYA 4DCAA 4DITA 4FICA 1OZ1A 3OW3A 4JDIA 2ONLC 2C0OA 2RGPA 2X0GA 4ZIMA 2WQOA 4DFZE 1VZOA 2XK6A 4TWCA 1I44A 1F5QA 4UYNA 5GJFA 4B99A 4BB4A 4RC2A 3GBZA 2YERA 3P9JA 3NEWA 3BLQA 2VTJA 2Y9QA 5ETFA 3WF9A 5ANKA 5LMKA 4XX9A 3HZTA 4RIYB 3QU0A 3TEIA 3TG1A 4AQCA 4DFBA 4WSYA 4RIYA 4C38A 4DEHA 3ZUUA 2BIKB 2OJJA 4NSTA 1GZNA 3LCOA 4MQ1A 4MXYA 3U87A 3TZ9A 2OFVA 4AFEA 4BJJA 5CSWA 4EH7A 2YM4A 4PP7A 3UOJA 2IZUA 3PVUA 4JX7A 4TY1A 5DNRA 3LPBA 4YO4A 3EZRA 3FZTA 2E2BA 3LIJA 4OT5A 5DT3A 2OSCA 4C4HA 3ZXTA 4DH8A 3C51A 4BCGA 4ANNA 5IA1A 3VBVA 3ZM9A 3UO6A 3KC3A 3ZO1A 3ENHA 3WI6A 4MXOA 5D9HA 2XEYA 1WZYA 3MGYA 2PVRA 4FGRA 4XBRA