3PRIA

Crystal structure of human b-raf kinase in complex with a non-oxime furopyridine inhibitor
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
276
structure length
264
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
publication title Non-oxime inhibitors of B-Raf(V600E) kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 264
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3priA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3priA01
2GHMA 3NRMA 4WG4A 2UVZA 4CQGA 1AD5A 4R7BA 2OIQA 2WMWA 3LFCA 4HYUA 1PMUA 4UEUA 3VS4A 4O7VA 5IQFA 2W5HA 4JRVA 4OTRA 4QMMA 4V0GB 3SQQA 4JIKA 4C61A 4TWNA 4AP7A 4TYHB 5CF5A 5BYLA 3NX8A 2W05A 3D94A 4AU8A 2XK6A 2GQSA 4FTKA 3R22A 2ZM1A 4ZTMA 4QTEA 3DJ7A 3Q53A 4I5CA 4IAFA 5CT7A 3KF4A 3F2AA 3O8TA 4IAKA 3R9OA 2ITTA 5FEQA 4ZK5A 3ZXZA 4DEEA 5LVLA 3LOKA 3HMOA 4J96A 2CCHA 2KTYA 4L8MA 4MD8E 4XCUA 3W2QA 3QLFA 2I40A 5E8XA 5JRQA 2WU6A 4AT4A 3FL5A 3DAKA 3SAYA 4O2PA 2QNJA 2F7ZE 3KXNA 4HNFA 5AV1A 2IJMA 3NDMA 4KUJA 3EN4A 1OL5A 4G1WA 4FKSA 4Z7GA 3JXWA 3F9NA 3TZMA 3NYNA 3FQSA 5BQ0A 4I41A 1JQHA 2IVVA 3RK9A 5BNJA 1SNUA 4QNAA 4XG9A 5KCVA 5F4NA 4FNXA 4L3JA 1GNGA 5LVPA 5I3OA 3E8DA 4E26A 5HNIX 4DEGA 2CN5A 3WF5A 4XBUA 4YHJA 3CQEA 4DH3A 5FD2A 3F69A 4RA4A 4L01A 1HCKA 3IDCA 2REIA 4O0UA 3VQUA 3E64A 3M1SA 4JR3A 1M7QA 3RP9A 4IVBA 2V55A 3BYUA 3ENMA 4PV0A 1YI3A 4LV8A 4AA4A 3QAME 3CPBA 4BKZA 2B0QA 5J79A 2OKRA 4R1YA 2IW9A 4BCJA 5CX9A 1YDSE 3CTJA 4E6AA 5AAEA 4M67A 2F7EE 3VHKA 4A7CA 5M07A 5LJJA 4EQUA 5AFVA 5LWNA 4O0VA 3H0ZA 4ONAA 4LOOA 5D9HA 3PXKA 2QKRA 2VTMA 1R39A 2WQNA 3OBGA 3KY2A 3NAYA 3LXPA 3SLSA 3HMPA 2JFMA 4FODA 3ZUVA 3UPZA 5JFSA 4PL4A 5IQCA 1ZLTA 4PTEA 4NKSA 3F3ZA 1Y6AA 3Q4TA 4NW5A 4PDPA 5CY3A 4MK0A 4TYIA 3Q2JA 4RC2A 3BGZA 2GNIA 4ZTNA 4F0FA 4X2KA 2UZNA 3A7IA 4X6RA 1BUHA 3PWDA 3QUEA 5HTBA 3TM0A 4L44A 3NGAA 3QF9A 1ZAOA 4JAJA 5EKNA 3LCOA 4CD0A 2IVUA 1ZZ2A 4FX3A 2IZSA 3P5KA 4L53A 5ETFA 3R9NA 2IPXA 2BZIB 2BTRA 3FKLA 1Q8YA 3BPRA 4LM5A 4CRLA 4D4RA 3DKOA 4O38A 5TE0A 4F7LA 1LPUA 2FSLX 4IWOA 3VAPA 3ZRKA 3CLYA 3OWKA 1YHVA 3KN5A 4F7JA 2HCKA 3NUAA 2BDJA 4Q2AA 3CQWA 3WZEA 2VO6A 3KRXA 3MPMA 5EI6A 2QQ7A 4GFGA 3H9FA 3EQDA 4BDDA 3B8RA 3DNEA 1W83A 4EBWA 2Z60A 3GQIA 3KCFA 4YP8A 2PE1A 1VEBA 3P0MA 2QHMA 1VR2A 3CXWA 3PPZA 4ALWA 2WQOA 2GS2A 1L3RE 4YNOA 1UVRA 4HZSA 3MA6A 3KEXA 5J9YA 3VS5A 5AV4A 1O6KA 1PYXA 1P2AA 4F70A 5CNNA 4DH5A 4GK3A 2A27A 1SNXA 4GL9A 4K2RA 1X8BA 4XV3A 5AIKA 1FOTA 4FKTA 5AR8A 4BDEA 3HVCA 4KRCA 2CN8A 4C4IA 2BAJA 5ANDA 4EYMA 2G01A 1FGKA 1WBVA 2C6IA 3ORIA 4HNIA 4U7ZA 3BYOA 3C4FA 2HXQA 1JSUA 3HV7A 5AJQA 2XK7A 5K3YA 2PHKA 3FZRA 3V6RA 4ZLZA 2X0GA 1AQ1A 2WQEA 3F5UA 2VZ6A 2JLDA 3HRBA 3CEKA 4DG2E 1TKIA 3BV3A 4IWQA 1OIQA 2WPAA 3GBZA 3O17A 5FP6A 5EI8A 3MTLA 3NYOA 3UOJA 5AUVA 2DUVA 3BKBA 4QYGA 3VW8A 5B2LA 1GIIA 3VNTA 3VC4A 1M17A 3GI3A 4RGJA 5A4QA 2X2LA 4P5ZA 5E90A 5EK7A 4CZTA 3MSSA 4EH4A 4X2GA 3V5WA 4D0XA 4CLIA 2YM5A 3RMFA 4AOJA 2W17A 1JLUE 5GIPE 1E9HA 5M4IA 4G3DA 2G2HA 2ZDTA 3FMLA 4ZTSA 5IQGA 2XIZA 4BTKA 1CDKA 5AEPA 2JIUA 5L2IA 4MXCA 3Q9YA 2H96A 2UZDA 3I7CA 4HGLA 1IA8A 4G9CA 3C4EA 5DHJA 5K5NA 3PY1A 3NUUA 2VWXA 5B2KA 4HVDA 2JIIA 5EHLA 3AGLA 1H1QA 4ZSAA 5HBHA 4FVPA 4D55A 4TW9A 4TWCA 1ZMUA 4QPSA 3U9NA 2HZ4A 2O65A 4RWKA 3NAXA 5HLWA 3FI4A 2H34A 3UQCA 3ID6C 3DXNA 3ODYX 3QQFA 3LFAA 1G3NA 4GV1A 4AS0A 4YJQA 1ZY5A 3QLGA 2FSMX 3MIYA 1OVEA 2EWAA 3PLSA 4X2NA 3AC1A 4JJRA 1JPAA 3KFAA 4RJ5A 5DE2A 3QD0A 5CEIA 4C34A 5KKRC 1U54A 3U4UA 2WMAA 4TWPA 5M4CA 4F09A 3R6XA 5HIEA 3P08A 2XIYA 3RZFA 3FMEA 2VX1A 4ZJVA 4W8EA 5JGAA 4JG8A 4L46A 4FIIA 3AG9A 5ANJA 4Y83A 4DFZE 2GHLA 3EJ1A 1IASA 3L1SA 4AZWA 2BFYA 2DYLA 2JIVA 4QQTA 3OUKA 4DCEA 5CEMA 1YRPA 3SRVB 5JFXA 3R8VA 4O0RA 3LJ2A 3QQGA 2JFLA 1H01A 5HCXA 4CGAA 4NM0A 3DT1A 2I0HA 2WEVA 3ORZA 5C8KA 1PMVA 4FKUA 3WOWA 3R8UA 4CCBA 4CV9A 2ETRA 4H3QA 2XJ2A 3TNPC 3WI6A 4FV4A 3L8XA 4FEWA 3F3WA 3KK8A 3WZDA 4F1OA 3MESA 1BI7A 5J9ZA 3IW6A 2VN9A 4RSSA 4WNKA 4BDCA 4C62A 2VTPA 5EW3A 1SVEA 3QRKA 1A06A 3ANRA 4BI2A 3NW5A 5AUXA 5FTQA 3R73A 4EJNA 2C0IA 5CAUA 3DNDA 4FTRA 4FSYA 5EM5A 2CDZA 3IECA 5CF8A 3BU3A 4FNZA 5KMJA 4ZS4A 3C51A 4AZVA 4DTKA 4Y73A 3U51A 2JD5A 4IVDA 1OIUA 5E8YA 5I9UA 2R3MA 2VTRA 3ELJA 3ZO2A 3ZLSA 3AQVA 3O8PA 4GK2A 4NTTA 3VUDA 2R9SA 3F66A 4J53A 4QMQA 3KL8A 1MUOA 2J7TA 5ANOA 3Q04A 5DR9A 5FXQA 1R3CA 1GIJA 4QPMA 3ZZWA 2OK1A 4AGCA 4AZTA 4BCKA 3H9OA 4DGMA 4I5HA 5JMSA 2X39A 4TZRA 4XG6A 3OXIA 4USFA 3MIAA 2R3OA 4NKAA 4C2WA 3C0GA 2PE2A 1YW2A 4C2VA 4R5SA 4IB5A 3PFQA 5AR3A 4I20A 4I23A 1OKZA 1YQJA 3T9TA 3DKCA 4BF2A 5CU0A 1PXLA 4F9CA 4ZJJA 3WE4A 4IZ7A 4J71A 3UTOA 3W10A 5L8KA 3SOCA 2Z8CA 3FJQE 4FSWA 1P4OA 5CAVA 5CLPA 5FTGA 4LGGA 4G6OA 5CWZA 3FQEA 5L6PA 3CY3A 4I24A 2HAKA 1J7UA 3C4ZA 5EM6A 5EM7A 3KK9A 4M8TA 2JDRA 2PVHA 2YDJA 3NYXA 4KRDA 2XCKA 5CQWA 4FE2A 2RFDA 5D7AA 4MKCA 4I1ZA 3SOAA 3DA6A 4E7WA 3VBYA 3VUMA 3VHEA 4MTAA 4AGDA 4RIWB 4UYAA 4XJ0A 4F63A 2EVAA 5AIRA 4W4YA 1QCFA 3NCGA 5JGBA 4C3RA 2UZOA 3QL8A 3TNIA 3OD6X 4OBPA 4UWCA 4L42A 2WD1A 3TV4A 4C7TA 4CFVA 4CQEA 4TTHB 3LFSA 4GUEA 5HORA 3TN8A 1SVGA 3TI1A 3VQHA 2F7XE 3F5GA 3ZONA 2W1GA 2OIDA 4MQ2A 5HBEA 4DAWA 2YLEA 1OL7A 3B8QA 3UGCA 5EYDA 5HESA 2XKFA 3TZ8A 1MQBA 5EI2A 4B6LA 4PRJA 4TYJA 4A9UA 3WE8A 4I5PA 3PY3A 3F5XA 4AGUA 3K5VA 3LM5A 4G6LA 1ND4A 1QMZA 2C0TA 3QQLA 2E9OA 2WFYA 2W5BA 3HUCA 2P3GX 3A7GA 3OZ6A 3HX4A 5FM2A 2JITA 2XKEA 4YJRA 5JT2A 2A1AB 4UWYA 3PJ8A 5HO7A 4MXAA 1GIHA 3DK6A 4C02A 3BEAA 4WKQA 1NT2A 3WYXA 1BL7A 4FT3A 4HYSA 5F1ZA 3QUPA 3GC0A 3T8OA 5L6OA 2ITZA 1R78A 4QMUA 4Y5QA 5KMIA 4YLJA 4U40A 5AM6A 3GVUA 3S00A 5ETIA 2F57A 4J95A 4EZ7A 2ZDUA 3W2OA 3TZ9A 2F9GA 3ZUTA 2XP2A 3PVWA 5H8BA 1YOJA 2PMNX 4YBKA 4IH8A 3AT2A 3DBDA 3S95A 4Z16A 3M11A 4LV5A 3QRTA 4DEAA 4S31A 4YNEA 3WIKA 4AA0A 5HOAA 2XRWA 3M42A 1YWVA 1XH4A 3DK3A 4TPTA 4ZTQA 3PXFA 4DEIA 4U42A 4BDBA 3VBQA 4EOKA 3SW7A 3UOKA 4UMQA 4JQ7A 1U46A 2OXYA 3UYSA 1BL6A 4ZY6A 2QO9A 4O0WA 4YTFA 1NA7A 3OTUA 5AA8A 3O0GA 3IG7A 2IVSA 4HVSA 2ITVA 5EDRA 2VWVA 3IDPA 4IFGA 1AGWA 3BRBA 4RX7A 4F9WA 5M51A 3RNIA 2CNQA 2H9VA 1HCLA 3IGOA 3R7GA 4RT7A 4ASXA 4FT0A 2VWUA 4EHVA 5DMZA 1RE8A 1Q97A 4QMWA 2XBJA 2B7AA 3ALNA 4M13A 5M53A 1M7NA 2NP8A 3AMAA 5EH0A 4XNEA 2I6LA 4M15A 3F82A 4KS7A 4MBJA 1IAJA 2YM7A 4AZEA 1OPJA 2JKKA 3F3TA 3KB7A 4NH1A 4E93A 3UZRA 5IQIA 3UO5A 4BTFA 3C9WA 4LYNA 3G6GA 1R1WA 2VO7A 3MVHA 1U54B 3PRFA 3UNJA 4XP0A 2FB8A 2HY81 4O6EA 2C1AA 1QPCA 4K9YA 4QMLA 3MTFA 1OIYA 3O23A 4FG9A 4IX6A 4TRLA 5EDQA 4EONA 5M56A 1WBPA 3VS7A 3OVVA 3DFAA 4E5AX 2W9FB 4V0GA 5L8JA 4YZMA 2XK4A 4D2PA 3MI9A 2PMOX 4RIYB 3ROCA 3O7LD 4AW2A 4F7NA 3UNKA 3CJGA 4PL3A 3NVMB 2PZ5A 3OBJA 4O22A 3BWFA 5CU3A 3H9RA 1KSWA 4FGRA 4XP3A 3L8PA 1ZMVA 2CKQA 3ZC5A 4ZZNA 5E8TA 3RPRA 4J52A 5JGDA 1J7IA 3QA0A 4FZFB 3LCTA 2XYUA 5HG8A 3UIXA 1UA2A 4PMPA 4QP8A 5EW9A 5T68A 3MH0A 1H08A 5FWKK 1YKRA 4PY1A 4A9YA 2WQMA 4LRKA 3IS5A 3CD3A 3DZOA 4MNFA 3AC3A 5TO8A 4ACMA 4DBNA 3BHUA 1Y8YA 1YVJA 3EYHA 1P5EA 1WZYA 4WBBB 4O7LA 4C4EA 4DHFA 1XR1A 3JVRA 1PKDA 2YM3A 1WFCA 1Q3DA 4K11A 2G2FA 4IDTA 4YSMA 3DV3A 4M12A 4KWPA 2XYNA 3IPHA 3MVMA 5L4QA 1GAGA 1Y8GA 3LM0A 4KBAA 3OT3A 3AD4A 1L8TA 3VRYA 4RVMA 1Z57A 5AA9A 3HA8A 3CCNA 5DBXA 3AC4A 2YWVA 4L6QA 3TKUA 4EKKA 1H26A 4W8DA 4DGGA 1ZYSA 3Q6UA 4XUFA 4ZTHA 3PY0A 4XHKB 1OPKA 1PMNA 3EQGA 4QD6A 3EQBA 4YZNA 3PSCA 4Q9ZA 1PRYA 3G51A 5AR7A 4ZXTA 4CYIA 4EK3A 4DTAA 3ZYAA 3KXHA 3NPCA 1PXOA 2PVKA 3MJ1A 4HVHA 5TKDA 1LR4A 3UP7A 4FBXA 3RHKA 3S2PA 1KOAA 1XH7A 4QO9A 3FLYA 1KE6A 5CI7A 5M09A 4O7YA 2W1FA 2CGXA 4WRSA 1Z9XA 4EC9A 4KAOA 3OTVA 2Q0BA 3QZHA 5IZFA 5M4UA 2JAVA 3IW7A 4WA9A 4FOCA 1OUKA 3EYGA 1Q3WA 1V1KA 2PVFA 2QD9A 5GJDA 5HNBA 4BKYA 4E6QA 4EOQA 4Y95A 1M52A 3Q4UA 4XP2A 2BKKA 3PE1A 3CY2A 3QTIA 4LOPA 3PTGA 3QQJA 4B99A 4BICA 1BMKA 2G9XA 3O71A 4X3JA 3HMNA 4I3ZA 4NIFB 4IFCA 3FMJA 4BCQA 3QQUA 3QWKA 3WF9A 1B38A 3QTRA 2PPQA 1ZY4A 1YDTE 2VGPA 3HP2A 2OSCA 2BIKB 3BE2A 4ALVA 4IXPA 2GNFA 1DAWA 3FHRA 4O86A 4L52A 3COKA 3LQ5A 3THBA 4AXAA 3R9HA 2EXEA 4BBFA 3IW4A 3FC2A 4O6LA 3E93A 4OTQA 1OECA 4AE6A 5DGZA 4Q9SA 5I3RA 3RM6A 5HG9A 2PUIA 2X6EA 3D5UA 3MY5A 5KE0A 2E9UA 4QNYA 1R0PA 1CTPE 1JBPE 5DR2A 5EYCA 1LP4A 4QP4A 4CRSA 4A4LA 5DR6A 2ITXA 2VUWA 1PXKA 5HVYA 3VS0A 4L00A 1YHWA 3MY1A 3QXOA 4IB3A 2O0UA 4HVGA 4YJOA 4QMNA 3ULIA 3AMYA 4IADA 3VBXA 5IUHA 4X21A 1U5QA 3OP5A 1WAKA 2PUUA 4O27B 5H3QA 4E5WA 5AWMA 4EH3A 4U6RA 1U5RA 5DT0A 4XG3A 3NUSA 1H28A 3MH1A 2A0CX 5EHOA 3R7YA 1J91A 4IZAA 4C36A 2IZUA 4U5JA 3I60A 4MAOA 2PL0A 4I92A 1WBNA 4FI1A 5JK3A 3GXLA 2HW7A 2CNVA 1ZARA 1YOLA 2FSTX 2PSQA 4K1BA 3ZFYA 3RWQA 3UZTA 1WVWA 2VO0A 4YZBA 4U80A 4OTHA 3AC2A 3OFMA 3HP5A 2JDSA 4PWNA 4Q5EA 5KHWA 2WXVA 1W84A 2XS0A 3AXWA 1XBBA 4N6YA 5BVKA 4WIHA 2XIKA 4N4SA 4FK6A 4II5A 4RLLA 2P55A 4DG0E 3ET7A 3K54A 3ZEPA 2UW8A 3VS3A 3DLSA 5AP4A 3ZO3A 4M66A 4NFMA 3EFWA 3LCSA 3QHRA 2YISA 2E9PA 2UV2A 2X9EA 4K6ZA 3DKGA 5C8MA 2OJGA 4CVAA 4RIOA 4E20A 3UO4A 4B9DA 4D9UA 4ZZMA 4C0TA 5C4LA 4FSUA 2GPHA 1VZOA 3HV3A 4EZ5A 2BILB 3HLLA 3ORTA 4IBMA 3TL8A 4BWKA 3FY2A 4RQKA 5AUWA 4U9AA 3R9RA 2WMXA 2UZEA 3A7FA 5DNRA 4EH8A 2YA9A 3KQ7A 3PXRA 2QHNA 4FC0A 4XV9A 4ANMA 4BR3A 4YTIA 4L3LA 4HCUA 3Q52A 2XNPA 3RVGA 5EW8A 5F9EA 1ZYCA 4WBOA 4KD1A 5KX8A 5L3AA 3QC9A 4GH2A 4QP1A 3PXQA 3U87A 3DBFA 3TIZA 1QPJA 3EL7A 5JZNA 3GCUA 3NIEA 3RWPA 3SD0A 4R78A 3O50A 4K33A 4CNHA 2XIRA 2C68A 5E8SA 4EK8A 5BVDA 3I5ZA 2QOLA 2B1PA 2CKPA 5GNKA 1SMHA 3EQPA 4AOIA 5DLSA 4B8LA 4YHFA 4U41A 1OITA 5B2MA 4D2SA 2I0EA 2PE0A 2VWWA 3KC3A 3R30A 1H07A 3E8NA 4WG3A 2XJ0A 3QD3A 3UVPA 3VJNA 4CT2A 4I4EA 4AN9A 2BKZA 4UY9A 2QOCA 5A3XA 4BCOA 3U55A 5IA5A 3SRVA 5F95A 5A14A 4BTMA 3NLBA 3P78A 5L2QA 1UKHA 5HLNA 2C5OA 2XNMA 4FICA 4NT4A 4TKSA 5HQ0A 4PDOA 3GC9A 4CT1A 2XNNA 5IH4A 4H1JA 4R6VA 3MPAA 5F94A 4YZ9A 4A06A 4LQMA 1J1BA 2OI4X 4IHPA 4NWMA 2ITNA 5C01A 1OKVA 3PYYA 4L43A 4AW1A 3LFFA 1DAYA 4OAVB 4Z7HA 3POZA 1WVXA 4OTPA 4PMMA 3FPQA 4GT4A 2BAKA 2XCHA 4X6QC 4EH7A 2C6LA 2CSNA 3CS9A 3DTWA 1WMKA 3PIYA 3C1XA 4FSQA 3A99A 4IIRA 2BHEA 2HXLA 4D1SA 4F6SA 1F5QA 3MW1A 3VVHA 4PP7A 3BHYA 5A4CA 3VO3A 2GCDA 4JR7A 2GQGA 3KU2A 4FEUA 1ZYJA 1RQQA 1ZOHA 5HD7A 4O1OA 3JR1A 3OF0A 1OUYA 4K8AA 4U3YA 4YJVA 5J5TA 4S30A 2VGOA 3VUKA 1NVQA 4I22A 4EOIA 4N57A 4O7ZA 2W7XA 5FLFA 4FG7A 4ORKA 2R2PA 4RLKA 2QODA 3A7JA 1RW8A 4D28A 3HUBA 2VD5A 4JI9A 4QMYA 5BVOA 5CANA 5DYJA 1WCCA 2VNWA 4YLKA 5ICPA 3GOKA 4CEGA 4FT9A 2PUPA 4XRJA 5KMMA 3MS9A 5HG5A 4YMJA 5TT7A 2F4JA 4NYEA 3LQ8A 5A9UA 5IQAA 4PL5A 3T9IA 2CHLA 3WYYA 3R0TA 4P5QA 1OL2A 4EWQA 5LXMA 2PVLA 2CCIA 3O96A 4A9TA 3QX2A 2EXMA 5H9BA 3LFDA 5KHXA 5TR6A 3VUGA 3QZIA 1KOBA 1YOMA 2CMWA 3PSBA 4IAAA 1IG1A 3D5XA 4FSMA 4S32A 4WD5A 4XLIA 5AP2A 3E8EA 4W4WA 3RCJA 3WIGA 2BUJA 2WTCA 2YIQA 3QD2B 4RIWA 5D1JA 2O64A 4KA3A 2CLXA 2G15A 3A2CA 2X4ZA 5CSHA 5IUIA 3ACKA 2WMSA 3RAKA 3TJCA 4BHZA 4HGEA 3KMMA 2R3HA 5DT4A 3I7BA 3BV2A 3QWJA 2CGUA 3D7ZA 2XEYA 3PRIA 4IMYA 1Q41A 2C5NA 3DBEA 4FSTA 4MF1A 4Y46A 3TNHA 1PXMA 3TUBA 3Q4ZA 5AV2A 3WF7A 2CNUA 1GY3A 2W4KA 3D14A 1UV5A 3FYJX 1Y6BA 5AP5A 4RFMA 4EOOA 4GRBA 4CG8A 1DS5A 3OW3A 3D7TB 4IX5A 4YZCA 3ZOSA 4DLIA 4FV1A 2F2UA 2PVJA 5C27A 3G5DA 3UODA 4TNDA 4J8NA 3O8UA 4YO6A 5FQDC 5HIDA 4EHGA 2C1BA 3QHWA 4NFNA 2BCJA 3RI1A 3PJ3A 5DI1A 2Y4PA 3SGCA 1M2QA 3DXQA 1Q61A 4IAZA 3VW6A 5C8NA 1HOWA 1V0BA 3VBTA 1XH8A 3QU0A 3EFJA 4YJNA 4F4PA 3C7QA 5M55A 2PVYA 1PMEA 2XBAA 4L45A 3EN7A 4GKIA 3D15A 2ITQA 1FMKA 4QP7A 1K9AA 3D4QA 3EN5A 4MD7E 4QYYA 4B8MA 4BYIA 4FKWA 4FL3A 4AA5A 3FXWA 3BLRA 4RQVA 3BGQA 3U9CA 5HE2A 4BKJA 4ZJIA 2ERZE 3FPMA 4V05A 3TWJA 4I93A 4ITJA 1OBDA 4ACHA 3R01A 4L7SA 5IUGA 1PF8A 3QD4A 4KSPA 3FKNA 3BLQA 2UZWE 2R3PA 3C0IA 3A60A 3OUNB 2PULA 2OICA 2X81A 4F08A 5GHVA 4GVJA 5CEQA 2RFSA 3HEGA 3SV0A 2GHGA 3HDNA 3OWJA 4O7NA 3CR0A 3H10A 5T3QA 4ACCA 4AFEA 2VRXA 3FI2A 3CJFA 3MV5A 3GB2A 4NW6A 5CSXA 5E1SA 1BKXA 3PZHA 4ACGA 2PVMA 3PXZA 5IA4A 3RHXA 5FTOA 5LMKA 2ERKA 5HU9A 2YERA 1YWRA 3RAHA 4H58A 4G17A 3UVRA 5L2WA 4CMOA 3ZSHA 1YXTA 3GFEA 4BZDA 4WHZA 3R63A 4DGNA 4ZY5A 4EZ3A 4EC8A 3FZSA 3FLQA 3PPKA 2X1NA 4BFMA 5C4KA 4FKRA 3ZM4A 4ZSGA 4EL9A 3CTHA 4KB8A 4M69B 4ZSJA 2XVDA 4BI1A 4L68A 2Y4IB 4QTCA 4WRGA 5HCZA 2J6MA 3OHTA 3P23A 2PUNA 3K3JA 3HECA 2WMQA 4Z55A 3FMNA 4FGBA 2WGJA 4WT6A 5HI2A 4EOPA 5CT0A 2WMVA 4AW0A 2XUUA 5LVMA 3MFSA 5ANKA 3WF8A 4ANNA 2ZV2A 4FTCA 4JBOA 3I79A 4J98A 2R3QA 3IW8A 1VYWA 2OU7A 3EQIA 2A2AA 3ZU7A 2RF9A 4Y72A 4RIYA 5HKMA 5ACBC 4E73A 5GZAA 1CKIA 2J90A 2V7AA 3CBLA 4LL5A 5BVFA 5CNOA 5M08A 3UYTA 1JNKA 4I6HA 5I9XA 4K18A 3MH3A 3NSZA 1V0OA 2J2IB 4I6QA 3FY0A 3KKVA 4LGDA 2VNYA 2WOTA 4OGRA 3EZRA 2Z7SA 5DN3A 2Z7QA 4JIAA 4HW7A 2B4SB 2BMCA 2VTHA 3DKFA 5IQHA 4OUCA 4KBKA 5HEZA 2J5FA 3TTJA 2W1CA 1H0WA 3UOLA 4H05A 4DH1A 2YCQA 3R83A 4CV8A 3TNQB 3IO7A 3UQGA 1NVSA 3REPA 4BC6A 2V0DA 4ZAUA 3AOXA 4FKPA 3R9DA 1OIRA 3QCYA 2X2MA 4EQCA 1XBCA 4JDJA 1PXNA 3FLNC 4EKLA 3E8CA 2B54A 4IEBA 4NTSA 4I6FA 5CAQA 3E7OA 4J99A 3R1QA 4LMNA 5DEYA 4GW8A 4LGHA 5KMKA 2O2UA 4XMOA 5AP0A 5E7RA 4X0MA 3OCGA 3QKKA 4IAIA 4PP9A 4XH6A 1DI8A 2OF2A 3VN9A 5FGKA 3BEGA 4EORA 3LXNA 2BVAA 4U79A 4F65A 1FVVA 5DWRA 4FZ6A 4AQCA 2J5EA 2UW0A 5E9EA 3UG1A 5K4IA 4O7SA 2VO3A 3AT3A 4HYIA 2YAAA 4RRVA 3TJDA 5E8UA 3WF6A 5J5SA 2BDFA 4EHEA 4UX9A 3V5TA 3CKXA 4R3PA 4YPSA 2OJIA 4EUTA 2FO0A 4PMTA 3E5AA 2ZV8A 5I5ZA 3W2CA 3VULA 2QOKA 3F7WA 4D5KA 3AMBA 1DI9A 2XMYA 4CKRA 3ZC6A 2J0MB 2ZJWA 4ZEGA 4B4LA 2UVYA 5L6WL 5FDPA 1NW1A 1P4FA 2QO7A 4O0TA 5ETAA 3V3VA 4BVUA 3DAJA 4CTCA 5JEBA 2X7OA 1REJA 2Z02A 1XO2B 4CKJA 4DGOA 4E5BA 4FTNA 4FV6A 3LQ3A 1S9JA 5LMKC 3U6JA 3QGWA 3V6SA 3KREA 4F6UA 3FSFA 4XOZA 4G5PA 3ZEWA 2J0IA 3BI6A 3L9LA 4RJ4A 4G34A 2ZB0A 4M14A 1LEZA 1O6YA 4X3FB 3TCPA 3VF9A 2UVXA 4BRXA 4NIFA 1FPUA 2FYSA 3UC3A 3FXXA 3MB6A 5GJFA 4UMTA 3Q9XA 4RJ7A 2CKEA 2YCSA 3GENA 4C8BA 2R7IA 3EHAA 3LIJA 5T6KA 4JVGA 4TXCA 2W0JA 3TKIA 3DBCA 4GIIA 4C4FA 4H3BA 3ZLXA 3UBDA 2PMIA 2RFEA 3IOKA 3QRUA 2B52A 4C37A 5KO1A 4HCVA 1JKKA 4GVAA 4NM7A 4UB7A 4UYNA 4DITA 1H1RA 2ZM4A 3FLZA 4BDGA 4FZ7A 4XYFA 2DS1A 5ANGA 2VWIA 4UZDA 5FUTA 3VBWA 4DH8A 2WTWA 4F99A 3DZQA 3SKCA 3W16A 1JAMA 2GU8A 3TV6A 5IEVA 4F0GA 2V7OA 3L9MA 3KRJA 2EB3A 5FM3A 3ORKA 4FIEA 2XNEA 5L2TA 2AC3A 4CTBA 2HOGA 2GFSA 2BRBA 4FT7A 4W9WA 3W1FA 4BHNA 4C33A 4QYHA 3FZ1A 2BHHA 3HKOA 1WVYA 2KULA 2DWBA 5M44A 4XS2A 3ZDUA 2C69A 1UU8A 3QGYA 3R71A 5CAPA 5ANIA 4V04A 5ACKA 3DDPA 3R2YA 4JLCA 2W5AA 3DGKA 4YLLA 4DINA 3ATSA 2XF0A 5FP5A 5JQ5A 2BZHB 4JDIA 2YN8A 2ZV7A 3GU8A 3KA0A 4FK3A 3UNZA 1KE7A 1MRUA 2YITA 3GFWA 2QG5A 3HMIA 3JPVA 3QKLA 4QMXA 4ZTLA 2WO6A 2RL5A 3TNWA 2J0KA 4EOJA 4ERWA 4KSQA 3CE3A 4E4XA 3R1NA 3UE4A 4E6CA 1V0PA 3NVKI 4KNBA 3TIYA 4FV5A 1YXVA 4UV0A 2BIYA 4FA2A 4UN0C 5KMLA 3V8WA 2X9FA 3PPJA 2P4IA 4C4HA 4QQCA 5IH5A 5CENA 4MQ1A 2VTNA 4WSYA 1VYZA 4BCFA 2C3JA 5E4HA 4F0IA 2R3NA 5J7BA 1XH9A 4WSQA 1YXXA 2I0YA 2HZIA 4CCUA 5J95A 2J9MA 3UZPA 5C03A 4AZSA 2BRNA 4LUDA 2XEZA 4FT5A 4FSZA 5KMNA 4IW0A 5IMXA 4U0IA 3L9NA 5BVNA 4AW5A 3GU4A 4BY9E 4GEOA 4LFIA 3LHJA 4XG2A 5E8WA 3IDBA 4APCA 4PMSA 2Y7JA 3BQCA 5GIOE 5CVFA 4DLJA 3C13A 1STCE 1WBSA 2QU6A 1XHAA 3F2RA 2UZTA 2YIWA 3G6HA 3PA3A 3ZBXA 1J1CA 4D2VA 1YI4A 2R64A 4E4NA 3DTCA 5CU2A 5IU2A 3P7AA 4M84A 3HL7A 4GYIA 5BUIA 2YABA 4AUAA 3VJOA 2VTSA 1OZ1A 4GSBA 2A4LA 2QI8A 3DB6A 4NU1A 2W1IA 3AC8A 1F3MC 4AACA 3D5WA 2WELA 5J1WA 4XOYA 3G2FA 4IB1A 4D4YA 2GMXA 3E92A 4G3FA 2WMRA 4L3PA 2OBJA 3CC6A 3PJ2A 3ERKA 2HYYA 3GC7A 2OW3A 4EH6A 3DJ5A 5DRDA 2ACXA 2CGWA 5KZ0A 5IA2A 3DK7A 3ORXA 4JS8A 4MNEA 4Y5HA 4DTBA 5I9ZA 5IH6A 4O0SA 4DT8A 3SDJA 1UU9A 3A62A 1KE5A 2FUMA 3COHA 3OCBA 5FXSA 2ITPA 3OROA 3SVVA 3RKBA 3FE3A 2GNHA 3RJCA 1J7LA 5JH6A 5EDPA 5AR4A 1PXIA 2CPKE 4D5HA 1ATPE 4DF3A 4DFBA 4ASZA 2RGPA 4PDSA 4HYHA 4ZSLA 5HNGA 3QQKA 3ZO4A 1TVOA 3PDTA 5HCYA 2B9IA 3S4QA 3I6UA 2QOIA 3W55A 4EYJA 4E1ZA 5BYZA 5CU6A 5E91A 3AD5A 3O7LB 2VWBA 4FEVA 1K3AA 2UW5A 3JYAA 5HD4A 2UW9A 4EI4A 4GS6A 4KINA 4HGSA 4IB0A 3HRCA 1BLXA 4IACA 5AR2A 2CLQA 4IWPA 3P1AA 3QTXA 4RC3A 4ZLOA 3ORNA 3NNXA 4OBOA 4IX4A 2GNLA 3DOGA 1IEPA 2F49A 3TACA 4FUYA 3KF7A 2FGIA 5H8EA 5BYYA 4YO4A 3DXPA 3CIKA 3GU5A 4FTUA 2P2IA 3F3VA 5IF1A 3D2IA 3COMA 3OY1A 3PVGA 2RIOA 3VBVA 1G5SA 5AR5A 1IAHA 3G90X 2H8HA 4AG8A 3NNVA 4RZWA 3GT8A 4TWOA 3UMXA 2XH5A 3HMMA 1OL1A 2JDTA 3OW4A 4GG7A 4PTGA 4WOVA 5LMBA 5J9LA 2XNBA 2ZB1A 2W1EA 1W0XC 3LFNA 4NJDA 4TNBA 3TUDA 1LUFA 5IEXA 1YXSA 4X2JA 4OTFA 3HAVA 1H1PA 2FA2A 3QZFA 4YBJA 5DRBA 3W2SA 4ACDA 3GU6A 3K3IA 2BDWA 4RFZA 3LAUA 3CGOA 4ITIA 4ZMEA 4R1VA 3FQHA 4FIFA 4FVRA 1VJYA 2QU5A 1XJDA 3E3BX 4AT3A 5CEKA 5AX3A 4BTJA 3WILA 4BWXA 1YI6A 5CALA 1Q8UA 3MWUA 2HENA 2OZAB 3LE6A 3NR9A 4FV3A 4M97A 3S1HA 4I4FA 1O6LA 4DT9A 2OFVA 3KMWA 5AP3A 1SVHA 2PMLX 3PE2A 3EQCA 2C6DA 2UZBA 4YJSA 3D7TA 4RX5A 1XH5A 3E88A 3M2WA 3P4KA 3ZCLA 5J8IA 2QLUA 1W82A 3KRLA 3EH9A 3I6WA 3OCTA 4AZFA 2P0CA 2VWYA 4RVLA 4B7TA 2JDVA 4EOLA 4E4LA 5GZ9A 5DA3A 4RWJA 1A9UA 3ETAA 3L8SA 5E8VA 4ERKA 3DJ6A 4DFUA 1QL6A 2V22A 2V62A 3ORMA 2XJ1A 3ZSIA 4QP2A 4ZMFA 4QP9A 3UMWA 4FSRA 4L67A 4Q5HA 4UWBA 5AV3A 4BWPA 3Q60A 3UJGA 1OMWA 2R0UA 5L2SA 1S9IA 3GC8A 4IC7A 4J7BA 2OJ9A 4E6DA 4TL0A 3PG1A 4XRLA 3ULZA 1NXKA 4WNMA 1ZXEA 2GTMA 4DEDA 3C4XA 1EH4A 4OT5A 2EXCX 2R7BA 4S2ZA 4UZHA 4UMUA 4NM3A 5EYMA 5CS6A 5D41A 3ZH8A 3DY7A 4UXLA 3W18A 2FH9A 4XLVA 3ZZEA 4EEVA 2JKOA 3R8MA 3FI3A 2Z7LA 4JRNA 2BZKB 4PUZA 3OC1A 2GS7A 3WARA 4A4XA 4FV8A 1A48A 4BIBA 5A4EA 3DAEA 3ZFXA 4C38A 3FEGA 3HV6A 1UWHA 5I9VA 2JBOA 1GZNA 4IAYA 3EN9A 3G9NA 4P7EA 4AF3A 4GT3A 4XEYA 5CYIA 4EH5A 4TYGA 4M7IA 3Q6WA 4RVTA 4JNWA 4EUUA 5HU3A 3ORLA 2LAVA 2IN6A 4MWHA 4H36A 2VTAA 2ITOA 3QTZA 4C59A 4EK5A 2VWZA 3QYWA 2F2CB 2W06A 3OT8A 4BDAA 2XK3A 4ANLA 2OH4A 2FVDA 3W8QA 4FV9A 3BU5A 4EK4A 3QYZA 4NCTA 2RKUA 2R4BA 4R5YA 3FMDA 3QALE 3EN6A 4FSNA 2BR1A 3EIDA 4D2TA 2PYWA 4L9IA 3VUIA 3PA4A 5DG5A 2OXDA 5ITAA 3DBQA 4HVIA 5GZ8A 2YJSA 4D0WA 1MP8A 2WEIA 3GOPA 1H24A 3ZS5A 4C3PA 3CD8A 2YM4A 3FZTA 3RPSA 2YCFA 3F3UA 4M69A 4BCPA 3MB7A 4JT3A 3A4PA 4WO5A 1E1XA 3H4JA 4EJ7A 3V5QA 3ATTA 4RX9A 1TQIA 3TKHA 5CASA 5HLPA 4BIEA 3CGFA 1JOWB 2NRUA 4IM0A 3COIA 3S3IA 4GU6A 4C4GA 5DEWA 4EHZA 4NL0A 3MA3A 3RTPA 3PWYA 3ZXTA 2XNOA 4R7HA 2XRUA 5FDXA 5H8GA 4CFMA 3TDVA 4R3RA 3LMIA 3PJCA 2UZUE 4EH2A 5JZJA 1FQ1B 4ARKA 5HVKA 2H6DA 3LFEA 3LZBA 3IGGA 3P9JA 4CZUA 5JKGA 2YM6A 2XK8A 4RJ6A 5IA1A 5HE1A 2IO6A 4DGLC 2XB7A 1I09A 5DH3A 4USEA 3N9XA 2IZTA 3NNWA 4JX7A 2C5VA 5C26A 3QTQA 2RG6A 3LJ1A 3PP1A 4AGWA 4YU2A 5AAGA 2GNJA 1CMKE 3FL4A 4ASEA 2BROA 1Q99A 1R0EA 1APME 4XV2A 2QR7A 3RPOA 3EQFA 3GU7A 5EFQA 3QTWA 5IDPA 4MNEB 3IKAA 2G1TA 3IW5A 1H4LA 4IJPA 4DFNA 3LKMA 3GQLA 2WTKB 4U45A 4ANQA 3RGFA 3ANQA 4BDJA 4MCVA 3ZLYA 5IA3A 3U6IA 2R5TA 3ODZX 1FVRA 3II5A 4YJPA 3NW7A 5E92A 4QP3A 3SC1A 3PLAE 3O51A 5HTCA 1PYEA 4H3PA 1GZ8A 2PZPA 5EQEA 4IZYA 4N6ZA 2VTOA 4D58A 4GJ3A 3SXSA 2C30A 5CZIA 5FEEA 4JG6A 5FXRA 3GCSA 5IG1A 3W8LA 4ZOGA 3CPCA 4NK9A 2PWLA 2UW4A 2ZOQA 1YWNA 2DQ7X 3LCDA 3UIUA 2HZ0A 3ZO1A 2ESMA 5HO6A 1UU7A 3A7HA 3EWHA 3NUYA 2OFUA 2W4OA 3TT0A 4BDKA 5EQPA 4U44A 4I0RA 4DEBA 1OPLA 1PHKA 2J0LA 1PY5A 2UUEA 2WTVA 2ZMCA 1YXUA 3KN6A 3H30A 3F61A 3OXZA 4GU9A 4ENXA 5JQ8A 4G2FA 5BUEA 2Q0NA 4HCTA 3DPKA 4FUXA 1REKA 3VS2A 4EBVA 4D2WA 3GCVA 4I0SA 1GZOA 1NY3A 1E1VA 3GNIB 3MGYA 4RFYA 2C5YA 1URCA 3MFTA 4YJUA 2HZNA 4HGTA 5DPVA 2PTKA 4XG7A 5LCJA 3KMUA 3TEIA 5IA0A 1QPEA 4FTQA 4FTLA 2WOUA 4G9RA 2W99B 3RCDA 3JS2A 3PG3A 3SXFA 4FKQA 4KIKA 4I94A 2C6OA 2X8EA 2IW8A 3HRFA 3EKKA 4YC3A 4MVFA 4CLJA 4H1MA 1WBOA 3KULB 3FC1X 3RM7A 5KBRA 1J3HA 4NCTC 3F5PA 4FR4A 5CU4A 3I0OA 1GJOA 4G31A 1UNLA 3FUPA 1FBNA 4A4OA 3MDYA 1H8FA 3BYVA 3BGPA 1CSNA 2VTQA 2ZMDA 4X3FA 4FZAB 5AX9A 1BYGA 3VS1A 2QCSA 4D1ZA 2HELA 4YHTA 3R7EA 4YURA 5M4FA 5CF4A 3CKWA 4PPAA 2WU7A 3FHIA 3U6HA 1XKKA 2Y0AA 3C4WA 2IWIA 4RPVA 5JFVA 3LJ0A 4JBQA 3PVBA 2VTIA 3FMKA 2OGVA 4D2RA 4F7SA 2O8YA 2Y4IC 3OOGA 3QZGA 2PU8A 4DN5A 4ZLYA 2OJJA 4O7RA 2X2KA 2PZRA 1W98A 1ZYLA 4FEQA 2YHVA 4Z9LA 2NNWB 4MYGA 4MBIA 3P7CA 4FKLA 4W4XA 3PJ1A 3QCXA 2UZLA 4LRJA 4QMSA 3KXGA 5AAFA 4AN3A 5HHWA 2OZOA 2XA4A 3K2LA 3WZKA 2YACA 3V5PA 3I4BA 3R1SA 5HTIA 3UQFA 1XWSA 4DH7A 4FTOA 3KGAA 4IX3A 4OBQA 4JQEA 2HIWA 2UZVA 4QYEA 3RAWA 1TQPA 1PW2A 2Y6MA 3G9LX 3N51A 3PA5A 4OTDA 3OWLA 3GUBA 4RJ3A 4QQJA 3WZJA 4BCMA 1BX6A 2B53A 3ACJA 3IONA 3T3VA 3UG2A 4E8AA 2I1MA 1H1WA 1ZMWA 5HE3A 3HGKA 4GJ2A 4FL2A 4QYFA 3PXYA 3LPBA 3MH2A 4HPUE 2R3JA 4NM5A 4P90A 4GCJA 2QVSE 2P2HA 3MJ2A 4PX6A 1UKIA 3Q9ZA 2HK5A 4A07A 5BX0A 5K5XA 3R1YA 1Q8ZA 3E7VA 4Z3VA 4UMPA 5BMMA 2HY0A 1UNHA 2W1HA 2WMBA 3EZVA 4J1RA 4MXZA 5CEOA 4EOMA 5EKOA 4FL1A 5ETCA 4Y8DA 2GNGA 4QTBA 2X8DA 4BZNA 2HWPA 4LL0A 4BBMA 1RDQE 3LFBA 2P33A 3Q3BA 4PPBA 5CQUA 2QO2A 4LG4A 2ZAZA 5I0BA 5LARA 2OIBA 4BGHA 4O7TA 3IQ7A 1XH6A 3NEWA 3QBNA 3C5IA 4J8MA 2YDKA 1CM8A 3CQUA 4IM3A 1Y91A 3FLWA 3OMVA 4FYNA 3CSVA 2R3GA 4NSTA 2JKMA 4O0YA 3R28A 4YJTA 5DOSA 1I44A 2BALA 2BAQA 2YIYA 3I81A 4FTJA 4PTCA 3RK5A 2ZV9A 4ZP5A 4R77A 3H3CA 3FWQA 3IOPA 3L9PA 3FI8A 5J87A 2E2BA 3JVSA 3WBLA 4F9BA 4V01A 3B2WA 3PZEA 4FV0A 1U4DA 4X7QA 5JN2A 3S0OA 5HGIA 2PY3A 4DFYA 1MRYA 5LVNA 3ZRLA 3FKOA 3EQHA 4CFUA 3A61A 1G8SA 1IA9A 3EMGA 1JWHA 1T46A 4XG8A 3PSDA 1M2PA 4PNKA 4FG8A 4MF0A 3T3UA 3RZBA 3KXXA 5CXHA 4DYMA 5HVJA 3MY0A 5CTPA 4CYJA 1FMOE 5D11A 1JSTA 5IKWA 1JKSA 5JSMA 5AM7A 1NVRA 3MBLA 5EQYA 4X3FC 2XKDA 4JBVA 1IRKA 1ZRZA 3VIDA 4AOTA 3C0HA 2E9NA 4CZYB 3VUTA 3MYGA 5HO8A 3R8PA 4FIJA 3AD6A 5BUJA 1Q62A 3TZ7A 4R3CA 3G0FA 3NWWA 3D2KA 4FKJA 5AP6A 2ZVAA 2R3RA 4FKGA 2CKOA 4IC8A 5IMEA 2RG5A 3C4CA 3P86A 4HJOA 5H2UA 1SYKA 3EQRA 3ITZA 3KCKA 3NYVA 3PIXA 4JAIA 4YPDA 3R7VA 3FDNA 3OWPA 4ENYA 4AFJA 3NMUF 3C5UA 2Y9QA 4KS8A 3ZDIA 5LQFA 1OGUA 5GJGA 5B0XA 4O84A 2EU9A 5FBOA 3VF8A 4ZIMA 3B2TA 2ETKA 2WMTA 3BHVA 2WZJA 4OAUC 2CGVA 1OL6A 4CMUA 4DEHA 4FIHA 1Q24A 2NRYA 4BGGA 2JEDA 4KIPA 4ANOA 4OR5A 5IISA 5CVHA 2WTJA 3VS6A 2WMUA 2J51A 2XM8A 2YDIA 4NJ3A 4RVKA 2QOFA 3V8SA 4C35A 3UPXA 4OW8A 2GTNA 4APPA 4KABA 4JDHA 4AE9A 1ZOGA 4F1MA 3DB8A 2YAKA 2VTTA 4I21A 4M0YA 5L8LA 3BBTB 1KV2A 4N70A 5KUPA 4KKGA 3FLSA 3POOA 3P7BA 5LWMA 4NEUA 3LMGA 4ZY4A 3BHHA 3ROYA 4QRCA 3QTSA 3QRIA 3F88A 3R2BA 3NNUA 3OEFX 4WG5A 5ANEA 3V04A 5IQDA 4LMUA 1B39A 3RBWA 4EQMA 3R8LA 2X7FA 3QRJA 5EHYA 4RIXA 3UOHA 3LLTA 4FOBA 4C58A 3Q32A 4ZSEA 4WUNA 3ALOA 4G3EA 2QKWB 1KE9A 1JKTA 2QURA 4FV7A 4MXYA 4DC2A 4GYGA 4L7FA 3EFLA 4ITHA 3D0EA 4NZWB 1OBGA 2XNGA 5M06A 2ITYA 3V51A 1W7HA 5A4LA 3LLAA 4C3FA 3NS9A 4HPTE 2J4ZA 4MWIA 4KIKB 4OTIA 2O63A 3ZLWA 2W96B 3UIMA 4RX8A 4EH9A 2R0IA 1M2RA 3L8VA 3BZ3A 3QCQA 3SHEA 4O7WA 1GZKA 2X7GA 4QMOA 5A6NA 4WNPA 3EKNA 1ZZLA 3ZBFA 5AMNA 3JY9A 3MFRA 5KZIA 5CI6A 5K9IA 1FINA 3Q96A 4QMPA 1FVTA 3HYHA 4S33A 4K77A 1MRVA 4D9TA 5A46A 2QC6A 4EWHA 5G6VA 3D9VA 3QQHA 4X2FA 3I1AA 2RFNA 2HW6A 2PK9A 4AX8A 4FTTA 4XG4A 4HOKA 1QPDA 4FV2A 5KKRB 2OZAA 4RMZA 4KIOA 3TUCA 3ZUUA 2OLCA 2X6DA 4OLIA 4IZ5A 2IVTA 3MPTA 3FMMA 4ANSA 5A54A 4RWLA 5JRSA 4CFXA 4JXFA 5E1EA 1SM2A 5CSPA 2QOBA 4M68A 2BRMA 3RINA 5AADA 3HV5A 4AN2A 5LVOA 2C6KA 1H27A 4MXOA 5FG8A 3ZFMA 4YR8A 4FKOA 4UBAA 1H1SA 5IPJA 2C0OA 4DFLA 5LMAA 5BVWA 3QFVA 4D1XA 3NIZA 3SX9A 2X8IA 4JOAA 3KVWA 4USDA 1K2PA 3DCVA 4XX9A 1B6CB 5AUUA 3SG9A 5CSVA 2AYPA 4N0SA 5EOLA 3C50A 4MHAA 4KKHA 1LEWA 2UW6A 3TTIA 1Q8WA 2UW7A 2J0JA 2BRGA 2J50A 4O0XA 5CXZA 4GKHA 5AP1A 5IDNA 2YEXA 4O82A 3HAMA 4FYOA 4CFWA 4D4VA 4YTCA 5G1XA 5CZHA 3BCEA 4FNYA 4O21A 4GIHA 1CKPA 4GMYA 3EB0A 4OTWA 5FBNC 4KBCA 5AUTA 4GFMA 4JQ8A 4FTMA 2YIRA 2GFCA 3R00A 4M0ZA 3IK3A 4PF4A 2R3LA 4ZZOA 2VV9A 2YIXA 3HDMA 5TF9A 4IANA 3DS6A 3AT4A 3RAIA 4CMTA 4CSVA 4F64A 5IEYA 1KUTA 2I7QA 3FBVA 4PPCA 3NUNA 5FEDA 2WTIA 3ZMMA 4JL9A 4UMRA 3R7UA 4BCHA 3OOMA 4DA5A 4GK4A 4CFFA 2PZYA 2A19B 3GCQA 3LFQA 4GUBA 4QP6A 3H0YA 4G16A 3V8TA 2QOOA 2PVNA 3NUXA 4DCAA 1PXPA 3BWJA 2QG7A 2EB2A 3D83A 4TN6A 3LMHA 5GINE 3E63A 4YZDA 3KRWA 1Y57A 2R3IA 4A9SA 2W1DA 3MN3A 3R8ZA 4RBLA 5CF6A 2IZRA 4FTIA 1PJKA 5AV0A 3G33A 5HIBA 2C6TA 2Z2WA 3E62A 3W32A 4BDIA 1JSVA 4BYJA 4DG3E 3BHTA 4RZVA 1ZOEA 4BN1A 1DM2A 2VTJA 3UP2A 1Q8TA 4BZOA 3DLZA 4BCIA 4DE4A 3BYMA 5HX6A 5K0KA 1TQMA 2FSOX 3VWAA 4ASDA 4YC8A 2C3IB 2PZIA 3GEQA 3NW6A 2AUHA 4BI0A 3SW4A 4BGQA 3W33A 4AWIA 3E87A 1Q4LA 3P79A 4MH7A 5A4TA 4Y85A 2YCRA 3PIZA 1GOLA 4QTAA 3SXRA 1PKGA 2BPMA 4IE9A 2O3PA 2JBPA 3WZUA 5EYKA 4O83A 3A4OX 3OCSA 4LUEA 1H25A 1F0QA 4O91A 2WB8A 4TT7A 4U81A 4JX3A 1KWPA 4YUQA 4YGAA 3A8XA 3AC5A 2R3FA 3BIZA 3F7ZA 4LRMA 1ZWSA 3O2MA 4MEDA 4P2KA 5BVEA 4R8QA 4RJ8A 1XQZA 4IWDA 2JGZA 1PXJA 5AP7A 1H0VA 4ZS0A 4G3GA 1W8CA 1JVPP 3I0QA 3MVJA 3D5VA 2LGCA 5K0XA 3FZPA 3Q5IA 4TYHA 4IDVA 2ONLA 3V5JA 5KNJA 3QX4A 3FMHA 5DVRA 4I5MA 2VX0A 4EOSA 2OG8A 3JUHA 4PNIA 3CP9A 3GGFA 3PVUA 3OG7A 4UALA 5HG7A 4UXQA 4GG5A 3R7IA 3UDBA 3ZRMA 3RALA 5HX8A 2NO3A 5IQBA 2GS6A 4RWIA 2OWBA 1UU3A 3CTQA 2YM8A 4C57A 4CKIA 3FAAA 5A6OA 5FRIA 2QONA 5BMSA 3MFUA 2W4JA 4ANBA 1WBTA 3LXKA 4FVQA 4O1PA 4ZTRA 3N4VA 4S34A 2C6MA 5CAOA 2WNTA 3QKMA 4I6BA 2IW6A 4U97A 3SA0A 4O81A 4FMQA 1YHSA 4QOXA 3GP0A 3QUDA 4U43A 4XBRA 2VAGA 4MXXA 4BDHA 3PP0A 2C3LA 4XV1A 4QMTA 3KRRA 4FNWA 4RIXB 2B9JA 4IJ9A 1JKLA 2WTDA 4D4SA 3FYKX 4ALUA 5BPYA 5EOBA 3HNGA 4FKIA 4QMVA 1Q5KA 4WNOA 2WAJA 4EK6A 2ITUA 3Q4CA 2B55A 3FV8A 1ERKA 3AGMA 4A9RA 2GSFA 3ENHA 2XM9A 1OM1A 4OT6A 2UW3A 1KV1A 4FF8A 4YTHA 4DBXA 4JBPA 2W1ZA 3UC4A 3KULA 3E3PA 4KIQA 3ZHPC 2WQBA 4AAAA 4QQ5A 2OXXA 2IG7A 4IVCA 2C5XA 4YC6A 2WKMA 3EL8A 4CXAA 4F9AA 3UVQA 2O5KA 2SRCA 3R02A 3R21A 5DIAA 2I0VA 3NUPA 4RC4A 3DU8A 5D7VA 4M3QA 4FKVA 4BBEA 1O9UA 2Y6OA 4PQNA 2EUFB 5CVGA 2QOQA 3QCSA 3GCPA 5CSWA 3BX5A 4BCGA 5IQEA 1CKJA 4J97A 4W4VA 3R7OA 2PVRA 2BTSA 5HE0A 3K5UA 4IQ6A 2YWPA 3OS3A 1FGIA 2ETMA 5LOHA 3HA6A 2ITWA 5LCKA 3W2RA 2HWOA 5KMOA 3V5LA 3VRZA 3Q5ZA 4NUSA 2XKCA 3UIBA 3VUHA 4BIDA 3TDWA 3U8WA 3UO6A 4I0TA 3HV4A 3LVPA 3N4UA 3G0EA 2XIXA 2AC5A 4BCNA 1H00A 2Y8OA 3R04A 1SZMA 4P4CA 2XZSA 4IVAA 3RPVA 4OTGA 1BI8A 2C4GA 4YSJA 4E3CA 3ZM9A 1IR3A 5JFWA 3ORPA 3W2PA 3U4WA 3LXLA 1U59A 4O96A 1XBAA 5F20A 4E4MA 3F2NA 4G3CA 2BRHA 1UNGA 2GDOA 5J1VA 5C9CA 2W9ZB 5HICA 3PUPA 4IM2A 5DT3A 2JKQA 3BBWA 2YZAA 1URWA 4BDFA 4H39A 2JDOA 3A8WA 2BFXA 2OH0E 3DQWA 2WTKC 5HZNA 1M14A 5EG3A 2ONLC 2G2IA 2XK9A 2ZM3A 2CJMA 3MVLA 4U8ZA 5EM8A 4FEXA 2QR8A 4JG7A 3RPYA 4TYEA 3TG1A 3RK7A 1MQ4A 2NPQA 3KXZA 3ZSGA 3BELA 1WBWA 2B9HA 2BZJA 2C3KA 2VTLA 3F6XA 4QT1A 5AUZA 5KBQA 4QTDA 3N4TA 5I9YA 1YDRE 1RJBA 3BQRA 3JY0A 4B0GA 3KVXA 4R7IA 4RG0A 5DFPA 5CEPA 2R3KA 1OI9A 1Z5MA 2VX3A 4W9XA 3OY3A 5K4JA 3QXPA 4FIGA 3BE9A 4GFOA 4O2ZA 3Q2MA 1UWJA 4DFXE 4F9YA 5B7VA 2V5QA 2WIHA 3EOCA 4HZRA 4AT5A 4KKEA 4QMZA 3TV7A 5D12A 2GQRA 5HBJA 3OEZA 3RNYA 3QTUA 3LCKA 3QC4A 4ID7A 3DQXA 4JDKA 5I4NA 3ZTXA 4F6WA 2QOHA 5E8ZA 2B9FA 1ZYDA 4MBLA 2YLFA 1OKYA 4CFNA 2YFXA 3FXZA 3V01A 1OB3A 3OXTA 4F1TA 3NCZA 1T45A 4RA5A 2WIPA 5I9WA 4MD9E 4QPAA 2VU3A 3BU6A 4MX9A 3NZ0A 4LOQA 2JAMA 4BB4A 3G15A 3EFKA 4FZDB 2QLQA 3FSKA 4WUAA 2C6EA 2OJFE 5M57A 3QA8A 4BL1A 4TY1A 5AUYA 4U3ZA 3Q9WA 2WHBA 1KE8A 5TOZA 2Q83A 5D10A 3KXMA 3FZOA 4GT5A 3BYSA 3BLHA 3TXOA 2YZLA 1OKWA 2RSVA 3U54A 2Z7RA 3DFCB 5J7HA 1P14A 5C1QB 3DDQA 4K0YA 2OO8X 3SG8A 2JC6A 2E9VA 4C4JA 4CG9A 1G8AA 3HZTA 3I5NA 4PDYA 4G5JA 2ZYBA 2YJRA 3LW0A 4G6NA 4FTAA 2C47A 2X4FA 2OF4A 4LI5A
chains in the Genus database with same CATH superfamily
2GHMA 3NRMA 4WG4A 2UVZA 4CQGA 1AD5A 4R7BA 2OIQA 2WMWA 3LFCA 4HYUA 1PMUA 4UEUA 3VS4A 4O7VA 5IQFA 4FRFA 2W5HA 4JRVA 4OTRA 4QMMA 4V0GB 3SQQA 4JIKA 4C61A 4TWNA 4AP7A 4TYHB 5CF5A 5BYLA 3NX8A 2W05A 3D94A 4AU8A 2XK6A 2GQSA 4FTKA 3R22A 2ZM1A 4ZTMA 4QTEA 3DJ7A 3Q53A 4I5CA 4IAFA 5CT7A 3KF4A 3F2AA 3O8TA 4IAKA 3R9OA 2ITTA 5FEQA 4ZK5A 3ZXZA 4DEEA 5LVLA 3LOKA 3HMOA 4J96A 2CCHA 2KTYA 4L8MA 4MD8E 4XCUA 3W2QA 3QLFA 2I40A 5E8XA 5JRQA 2WU6A 4AT4A 3FL5A 3DAKA 3SAYA 4O2PA 2QNJA 2F7ZE 3KXNA 4HNFA 5AV1A 2IJMA 3NDMA 4KUJA 3EN4A 1OL5A 4G1WA 4FKSA 4Z7GA 3JXWA 3F9NA 3TZMA 3NYNA 3FQSA 5BQ0A 4I41A 1JQHA 2IVVA 3RK9A 5BNJA 1SNUA 4QNAA 4XG9A 5KCVA 5F4NA 4FNXA 4L3JA 1GNGA 5LVPA 5I3OA 3E8DA 4E26A 5HNIX 4DEGA 2CN5A 3WF5A 4XBUA 4YHJA 3CQEA 4DH3A 5FD2A 3F69A 4RA4A 4L01A 1HCKA 3IDCA 2REIA 4O0UA 3VQUA 3E64A 3M1SA 4JR3A 1M7QA 3RP9A 4IVBA 2V55A 3BYUA 3ENMA 4PV0A 1YI3A 4LV8A 4AA4A 3QAME 3CPBA 4BKZA 2B0QA 5J79A 2OKRA 4R1YA 2IW9A 4BCJA 5CX9A 1YDSE 3CTJA 4E6AA 5AAEA 4M67A 2F7EE 3VHKA 4A7CA 5M07A 5LJJA 4EQUA 5AFVA 4O4FA 5LWNA 4O0VA 3H0ZA 4ONAA 4LOOA 5D9HA 3PXKA 2QKRA 2VTMA 1R39A 2WQNA 3OBGA 3KY2A 3NAYA 3LXPA 3SLSA 3HMPA 2JFMA 4FODA 3ZUVA 3UPZA 5JFSA 3KIOC 4PL4A 5IQCA 1ZLTA 4PTEA 4NKSA 3F3ZA 1Y6AA 3Q4TA 4NW5A 4PDPA 5CY3A 4MK0A 4TYIA 3Q2JA 3NFFB 4RC2A 3BGZA 2GNIA 4ZTNA 4F0FA 4X2KA 2UZNA 3A7IA 4X6RA 1BUHA 3PWDA 3QUEA 5HTBA 3TM0A 4L44A 3NGAA 3QF9A 1ZAOA 4JAJA 5EKNA 3LCOA 4CD0A 2IVUA 1ZZ2A 4FX3A 2IZSA 3P5KA 4L53A 5ETFA 3R9NA 2IPXA 2BZIB 2BTRA 3FKLA 1Q8YA 3BPRA 4LM5A 4CRLA 4D4RA 3DKOA 4O38A 5TE0A 4F7LA 1LPUA 2FSLX 4IWOA 3VAPA 3ZRKA 3CLYA 3OWKA 1YHVA 3KN5A 4F7JA 2HCKA 3NUAA 2BDJA 4Q2AA 3CQWA 3WZEA 2VO6A 3KRXA 3MPMA 5EI6A 2QQ7A 4GFGA 3H9FA 3EQDA 4BDDA 3B8RA 3DNEA 1W83A 4EBWA 2Z60A 3GQIA 3KCFA 4YP8A 2PE1A 1VEBA 3P0MA 2QHMA 1VR2A 3CXWA 1TFFA 4QEBA 3PPZA 4ALWA 2WQOA 2GS2A 1L3RE 4YNOA 1UVRA 4HZSA 3MA6A 3KEXA 5J9YA 3VS5A 5AV4A 1O6KA 1PYXA 1P2AA 4F70A 5CNNA 4DH5A 4GK3A 2A27A 1SNXA 4GL9A 4K2RA 1X8BA 4XV3A 5AIKA 1FOTA 4FKTA 5AR8A 4BDEA 3HVCA 4KRCA 2CN8A 4C4IA 2BAJA 5ANDA 4EYMA 2G01A 1FGKA 1WBVA 2C6IA 3ORIA 4HNIA 4U7ZA 3BYOA 3C4FA 2HXQA 1JSUA 3HV7A 5AJQA 2XK7A 5K3YA 2PHKA 3FZRA 3V6RA 4ZLZA 2X0GA 1AQ1A 2WQEA 3F5UA 2VZ6A 2JLDA 3HRBA 3CEKA 4DG2E 2IF8A 1TKIA 3BV3A 4IWQA 1OIQA 1TZDA 2WPAA 3GBZA 3O17A 5FP6A 5EI8A 3MTLA 3NYOA 3UOJA 5AUVA 3W0QA 2DUVA 3BKBA 4QYGA 3VW8A 5B2LA 1GIIA 3VNTA 3VC4A 1M17A 3GI3A 4RGJA 5A4QA 2X2LA 4P5ZA 5E90A 5EK7A 4CZTA 3MSSA 4EH4A 4X2GA 3V5WA 4D0XA 4CLIA 2YM5A 3RMFA 4AOJA 2W17A 1JLUE 5GIPE 1E9HA 5M4IA 4G3DA 2G2HA 2ZDTA 3FMLA 4ZTSA 5IQGA 2XIZA 4BTKA 1CDKA 5AEPA 2JIUA 5L2IA 4MXCA 3Q9YA 2H96A 2UZDA 3I7CA 4HGLA 1IA8A 4G9CA 3C4EA 5DHJA 5K5NA 3PY1A 3NUUA 2VWXA 5B2KA 4HVDA 2JIIA 5EHLA 3AGLA 1H1QA 4ZSAA 5HBHA 4FVPA 4D55A 4TW9A 4TWCA 1ZMUA 4QPSA 3U9NA 2HZ4A 2O65A 4RWKA 3NAXA 5HLWA 3FI4A 2H34A 3UQCA 3ID6C 3DXNA 3ODYX 3QQFA 3LFAA 1G3NA 4GV1A 4AS0A 4YJQA 1ZY5A 3QLGA 2FSMX 3MIYA 1OVEA 2EWAA 3PLSA 4X2NA 3AC1A 4JJRA 1JPAA 3KFAA 2X0OA 4RJ5A 3QD0A 5DE2A 5CEIA 4C34A 1U54A 3U4UA 2WMAA 4TWPA 5M4CA 4F09A 3R6XA 5HIEA 3P08A 2XIYA 3RZFA 3FMEA 2VX1A 4ZJVA 4W8EA 5JGAA 4JG8A 4L46A 4FIIA 3AG9A 5ANJA 4Y83A 4DFZE 2GHLA 3EJ1A 1IASA 3L1SA 4AZWA 2BFYA 2DYLA 2JIVA 4QQTA 3OUKA 4DCEA 5CEMA 1YRPA 3SRVB 5JFXA 3R8VA 4O0RA 3LJ2A 3QQGA 2JFLA 1H01A 5HCXA 4CGAA 4NM0A 3DT1A 2I0HA 2WEVA 3ORZA 5C8KA 1PMVA 2XARA 4FKUA 3WOWA 3R8UA 4CCBA 4CV9A 2ETRA 4H3QA 2XJ2A 3TNPC 3WI6A 4FV4A 3L8XA 4FEWA 3F3WA 3KK8A 3WZDA 4F1OA 3MESA 1BI7A 5J9ZA 3IW6A 2VN9A 4RSSA 4WNKA 4BDCA 4C62A 2VTPA 5EW3A 1SVEA 3QRKA 1A06A 3ANRA 4BI2A 3NW5A 5AUXA 5FTQA 3R73A 4EJNA 2C0IA 5CAUA 3DNDA 4FTRA 4FSYA 5EM5A 2CDZA 3IECA 5CF8A 3BU3A 4FNZA 5KMJA 4ZS4A 3C51A 4AZVA 4DTKA 4Y73A 3U51A 2JD5A 4IVDA 1OIUA 5E8YA 5I9UA 2R3MA 2VTRA 3ELJA 3ZO2A 3ZLSA 3AQVA 3O8PA 4GK2A 4NTTA 3VUDA 2R9SA 3F66A 4J53A 4QMQA 3KL8A 1MUOA 2J7TA 5ANOA 3Q04A 5DR9A 5FXQA 1R3CA 1GIJA 4QPMA 3ZZWA 2OK1A 4AGCA 4AZTA 4BCKA 3H9OA 4DGMA 4I5HA 5JMSA 2X39A 4TZRA 4XG6A 3OXIA 4USFA 3MIAA 2R3OA 4NKAA 4C2WA 3C0GA 2PE2A 1YW2A 4C2VA 4R5SA 4IB5A 3PFQA 5AR3A 4I20A 4I23A 1OKZA 1YQJA 3T9TA 3DKCA 4BF2A 5CU0A 3AKJA 1PXLA 4F9CA 4ZJJA 3WE4A 4IZ7A 4J71A 3UTOA 3W10A 5L8KA 3TMOA 3SOCA 2Z8CA 3FJQE 4FSWA 1P4OA 5CAVA 5CLPA 5FTGA 4AXEA 4LGGA 4G6OA 5CWZA 3FQEA 5L6PA 3CY3A 4I24A 2HAKA 1J7UA 3C4ZA 5EM6A 5EM7A 3KK9A 4M8TA 2JDRA 2PVHA 2YDJA 3NYXA 4KRDA 2XCKA 5CQWA 4FE2A 2RFDA 5D7AA 4MKCA 4I1ZA 3SOAA 3DA6A 4E7WA 3VBYA 3VUMA 3VHEA 4MTAA 4AGDA 4RIWB 4UYAA 4XJ0A 4F63A 2EVAA 5AIRA 4W4YA 1QCFA 3NCGA 5JGBA 4C3RA 2UZOA 3QL8A 3TNIA 3OD6X 4OBPA 4UWCA 4L42A 2WD1A 3TV4A 4C7TA 4CFVA 4CQEA 4TTHB 3LFSA 4GUEA 5HORA 3TN8A 4DHZA 1SVGA 3TI1A 3VQHA 2F7XE 3F5GA 3ZONA 2W1GA 2OIDA 4MQ2A 5HBEA 4DAWA 2YLEA 1OL7A 3B8QA 3UGCA 5EYDA 5HESA 2XKFA 3TZ8A 1MQBA 5EI2A 4B6LA 4PRJA 4TYJA 4A9UA 3WE8A 4I5PA 3PY3A 3F5XA 4AGUA 3K5VA 3LM5A 4G6LA 1ND4A 1QMZA 2C0TA 3QQLA 2E9OA 2WFYA 2W5BA 3HUCA 2P3GX 3A7GA 3OZ6A 3HX4A 5FM2A 2JITA 2XKEA 4YJRA 5JT2A 3NFGB 2A1AB 4UWYA 3PJ8A 5HO7A 4MXAA 1GIHA 3DK6A 4C02A 3BEAA 4WKQA 1NT2A 3WYXA 1BL7A 4FT3A 4HYSA 5F1ZA 3QUPA 3GC0A 3T8OA 5L6OA 2ITZA 1R78A 4QMUA 4Y5QA 5KMIA 4YLJA 4U40A 5AM6A 3GVUA 3S00A 5ETIA 2F57A 4J95A 4EZ7A 3AKLA 2ZDUA 3W2OA 3TZ9A 2F9GA 3ZUTA 2XP2A 3PVWA 5H8BA 1YOJA 2PMNX 4YBKA 4IH8A 3AT2A 3DBDA 3S95A 4Z16A 3M11A 4LV5A 3QRTA 4DEAA 4S31A 4YNEA 3WIKA 4AA0A 5HOAA 2XRWA 3M42A 1YWVA 1XH4A 3DK3A 4TPTA 4ZTQA 3PXFA 4DEIA 4U42A 4BDBA 3VBQA 4EOKA 3SW7A 3UOKA 3PFYA 4UMQA 4JQ7A 1U46A 2OXYA 3UYSA 1BL6A 4ZY6A 2QO9A 4O0WA 4YTFA 1NA7A 3OTUA 5AA8A 3O0GA 3IG7A 2IVSA 4HVSA 2ITVA 5EDRA 2VWVA 3IDPA 4IFGA 1AGWA 3BRBA 4RX7A 4F9WA 5M51A 3RNIA 2CNQA 2H9VA 1HCLA 3IGOA 3R7GA 4RT7A 4ASXA 4FT0A 2VWUA 4EHVA 5DMZA 1RE8A 1Q97A 4QMWA 2XBJA 2B7AA 3ALNA 4M13A 5M53A 1M7NA 2NP8A 3AMAA 5EH0A 4XNEA 2I6LA 4M15A 3F82A 4KS7A 4MBJA 3SXRA 1IAJA 2YM7A 4AZEA 1OPJA 2JKKA 3F3TA 3KB7A 4NH1A 4E93A 3UZRA 5IQIA 3UO5A 4BTFA 3C9WA 4LYNA 3G6GA 1R1WA 2VO7A 3MVHA 1U54B 3PRFA 3UNJA 4XP0A 4MUQA 2FB8A 2HY81 4O6EA 2C1AA 1QPCA 4K9YA 4QMLA 3MTFA 1OIYA 3O23A 4FG9A 4IX6A 4TRLA 5EDQA 4EONA 5M56A 1WBPA 3VS7A 3OVVA 3DFAA 4E5AX 2W9FB 4V0GA 5L8JA 4YZMA 2XK4A 4D2PA 3MI9A 2PMOX 4RIYB 3ROCA 3O7LD 4AW2A 4F7NA 3UNKA 3CJGA 4PL3A 3NVMB 2PZ5A 3OBJA 4O22A 3BWFA 5CU3A 3H9RA 1KSWA 4FGRA 4XP3A 3L8PA 1ZMVA 2CKQA 3ZC5A 4ZZNA 5E8TA 3RPRA 4J52A 5JGDA 1J7IA 3QA0A 4FZFB 3LCTA 2XYUA 5HG8A 3UIXA 1UA2A 4PMPA 4QP8A 5EW9A 5T68A 3MH0A 1H08A 5FWKK 1YKRA 4PY1A 4A9YA 2WQMA 4LRKA 3IS5A 3CD3A 3DZOA 4MNFA 3AC3A 5TO8A 4ACMA 4DDGA 4DBNA 3BHUA 1Y8YA 1YVJA 3EYHA 1P5EA 1WZYA 4WBBB 4O7LA 4C4EA 4DHFA 1XR1A 3JVRA 1PKDA 2YM3A 1WFCA 1Q3DA 4K11A 2G2FA 4IDTA 4YSMA 3DV3A 4M12A 4KWPA 2XYNA 3IPHA 3MVMA 5L4QA 1GAGA 1Y8GA 3LM0A 4KBAA 3OT3A 3AD4A 1L8TA 3VRYA 4RVMA 1Z57A 5AA9A 3HA8A 3CCNA 5DBXA 3AC4A 2YWVA 4L6QA 3TKUA 4EKKA 1H26A 4W8DA 4DGGA 1ZYSA 3Q6UA 4XUFA 4ZTHA 3PY0A 4XHKB 1OPKA 1PMNA 3EQGA 4QD6A 3EQBA 4YZNA 3PSCA 4Q9ZA 1PRYA 3G51A 5AR7A 4ZXTA 4CYIA 4EK3A 4DTAA 3ZYAA 3KXHA 3NPCA 1PXOA 2PVKA 3MJ1A 4HVHA 5TKDA 1LR4A 3UP7A 4FBXA 3RHKA 3S2PA 1KOAA 1XH7A 4QO9A 2NYAA 3FLYA 1KE6A 5CI7A 5M09A 4O7YA 2W1FA 5KKRC 2CGXA 4WRSA 1Z9XA 4EC9A 1W2CA 4KAOA 3OTVA 2Q0BA 3QZHA 5IZFA 5M4UA 2JAVA 3IW7A 4WA9A 4FOCA 1OUKA 3EYGA 1Q3WA 1V1KA 2PVFA 2QD9A 5GJDA 5HNBA 4BKYA 4E6QA 4EOQA 4Y95A 1M52A 3Q4UA 1OGYA 4XP2A 2BKKA 3PE1A 3CY2A 3QTIA 4LOPA 3PTGA 3QQJA 4B99A 4BICA 1BMKA 2G9XA 3O71A 4X3JA 3HMNA 4I3ZA 4NIFB 4IFCA 3FMJA 4BCQA 3QQUA 3QWKA 3WF9A 1B38A 3QTRA 2PPQA 1ZY4A 1YDTE 4DHIB 2VGPA 3HP2A 2OSCA 2BIKB 3BE2A 4ALVA 4IXPA 2GNFA 1DAWA 3FHRA 4O86A 4L52A 3COKA 3LQ5A 3THBA 4AXAA 3R9HA 2EXEA 4BBFA 3IW4A 3FC2A 4O6LA 3E93A 4OTQA 1OECA 4AE6A 5DGZA 4Q9SA 5I3RA 3RM6A 5HG9A 2PUIA 2X6EA 3D5UA 3MY5A 5KE0A 2E9UA 4QNYA 1R0PA 1CTPE 1JBPE 5DR2A 5EYCA 1LP4A 4QP4A 4CRSA 4A4LA 5DR6A 2ITXA 2VUWA 1PXKA 5HVYA 3VS0A 4L00A 1YHWA 3MY1A 3QXOA 4IB3A 2O0UA 4HVGA 4YJOA 4QMNA 3ULIA 3AMYA 4IADA 3VBXA 5IUHA 4X21A 1U5QA 3OP5A 1WAKA 2PUUA 4O27B 5H3QA 4E5WA 5AWMA 4EH3A 4AXFA 4U6RA 1U5RA 5DT0A 4XG3A 3NUSA 1H28A 3MH1A 2A0CX 5EHOA 3R7YA 1J91A 4IZAA 4C36A 2IZUA 4U5JA 3I60A 4MAOA 2PL0A 4I92A 1WBNA 4FI1A 5JK3A 3GXLA 2HW7A 2CNVA 1ZARA 1YOLA 2FSTX 2PSQA 4K1BA 3ZFYA 3RWQA 3UZTA 1WVWA 2VO0A 4YZBA 4U80A 4OTHA 3AC2A 3OFMA 3HP5A 2JDSA 4PWNA 4Q5EA 5KHWA 2WXVA 1W84A 2XS0A 3AXWA 1XBBA 4N6YA 5BVKA 4WIHA 2XIKA 4N4SA 4FK6A 4II5A 4RLLA 2P55A 4DG0E 3ET7A 3K54A 3ZEPA 2UW8A 3VS3A 3DLSA 5AP4A 3ZO3A 4M66A 4NFMA 3EFWA 3LCSA 3QHRA 2YISA 2E9PA 2UV2A 2X9EA 4K6ZA 3DKGA 5C8MA 2OJGA 4CVAA 4RIOA 4E20A 2AQXA 3UO4A 4B9DA 4D9UA 4ZZMA 4C0TA 5C4LA 4FSUA 2GPHA 1VZOA 3HV3A 4EZ5A 2BILB 3HLLA 3ORTA 4IBMA 3TL8A 4BWKA 3FY2A 4RQKA 5AUWA 4U9AA 3R9RA 2WMXA 2UZEA 3A7FA 5DNRA 4EH8A 4DDIA 2YA9A 3KQ7A 3PXRA 2QHNA 4FC0A 4XV9A 4ANMA 4BR3A 4YTIA 4L3LA 4HCUA 3Q52A 2XNPA 3RVGA 5EW8A 5F9EA 1ZYCA 4WBOA 4KD1A 5KX8A 5L3AA 3QC9A 4GH2A 2IEWA 4QP1A 3PXQA 3U87A 3DBFA 3TIZA 1QPJA 3EL7A 5JZNA 3GCUA 3NIEA 3RWPA 3SD0A 4R78A 3O50A 4K33A 4CNHA 2XIRA 2C68A 5E8SA 4EK8A 2X0QA 5BVDA 3I5ZA 2QOLA 2B1PA 1G8JA 1XMMA 2CKPA 5GNKA 1SMHA 3EQPA 4AOIA 5DLSA 4B8LA 4YHFA 4U41A 1OITA 5B2MA 4D2SA 2I0EA 2PE0A 2VWWA 3KC3A 3R30A 1H07A 3E8NA 4WG3A 2XJ0A 3QD3A 3UVPA 3VJNA 4CT2A 4I4EA 4AN9A 2BKZA 4UY9A 2QOCA 5A3XA 4BCOA 3U55A 5IA5A 3SRVA 5F95A 5A14A 4BTMA 3NLBA 3P78A 5L2QA 1UKHA 5HLNA 2C5OA 2XNMA 4FICA 4NT4A 4TKSA 5HQ0A 4PDOA 3GC9A 4CT1A 2XNNA 5IH4A 4H1JA 4R6VA 3MPAA 5F94A 4YZ9A 4A06A 1VLRA 4LQMA 1J1BA 2OI4X 4IHPA 4NWMA 3VONA 2ITNA 5C01A 1OKVA 3PYYA 4L43A 4AW1A 3LFFA 1DAYA 4OAVB 4Z7HA 3POZA 1WVXA 4OTPA 4PMMA 3FPQA 4GT4A 4O4CA 2BAKA 2XCHA 4DHJA 4X6QC 4EH7A 2C6LA 2CSNA 3CS9A 3DTWA 1WMKA 3PIYA 3C1XA 4FSQA 3A99A 4IIRA 2BHEA 2HXLA 4D1SA 4F6SA 1F5QA 3MW1A 3VVHA 4PP7A 3BHYA 5A4CA 3VO3A 2GCDA 4JR7A 2GQGA 3KU2A 4FEUA 1ZYJA 1RQQA 1ZOHA 5HD7A 4O1OA 3JR1A 3OF0A 1OUYA 4K8AA 4U3YA 4YJVA 5J5TA 4S30A 2VGOA 3VUKA 1NVQA 4I22A 4EOIA 4N57A 4O7ZA 2W7XA 5FLFA 3W0MA 4FG7A 4ORKA 2R2PA 4RLKA 2QODA 3A7JA 1RW8A 4D28A 3HUBA 2VD5A 4JI9A 4QMYA 5BVOA 5CANA 5DYJA 1WCCA 2VNWA 4YLKA 5ICPA 3GOKA 4CEGA 4FT9A 2PUPA 4XRJA 5KMMA 3MS9A 5HG5A 4YMJA 5TT7A 2F4JA 4NYEA 3LQ8A 5A9UA 5IQAA 4PL5A 3T9IA 2CHLA 3WYYA 3R0TA 4P5QA 1OL2A 4EWQA 5LXMA 2PVLA 2CCIA 3O96A 4A9TA 3QX2A 2EXMA 5H9BA 3LFDA 5KHXA 5TR6A 3VUGA 3QZIA 1KOBA 1YOMA 2CMWA 3PSBA 4IAAA 1IG1A 3D5XA 4FSMA 4S32A 4WD5A 4XLIA 5AP2A 3E8EA 4W4WA 3RCJA 3WIGA 2BUJA 2WTCA 2YIQA 3QD2B 4RIWA 5D1JA 2O64A 4KA3A 2CLXA 2G15A 3A2CA 2X4ZA 5CSHA 5IUIA 3ACKA 2WMSA 3RAKA 3TJCA 4BHZA 4HGEA 3KMMA 2R3HA 5DT4A 3I7BA 3BV2A 3QWJA 2CGUA 3D7ZA 2XEYA 3PRIA 4IMYA 1Q41A 2C5NA 3DBEA 4FSTA 4MF1A 4Y46A 3TNHA 1PXMA 3TUBA 3Q4ZA 5AV2A 3WF7A 2CNUA 1GY3A 2W4KA 3D14A 1UV5A 3FYJX 1Y6BA 5AP5A 4RFMA 4EOOA 4GRBA 4CG8A 1DS5A 3OW3A 3D7TB 4IX5A 4YZCA 3ZOSA 4DLIA 4FV1A 2F2UA 2PVJA 5C27A 3G5DA 3UODA 4TNDA 4J8NA 3O8UA 4YO6A 5FQDC 5HIDA 4EHGA 2C1BA 3QHWA 4NFNA 2BCJA 3RI1A 3PJ3A 5DI1A 2Y4PA 3SGCA 1M2QA 3DXQA 1Q61A 4IAZA 3VW6A 5C8NA 1HOWA 1V0BA 3VBTA 1XH8A 3QU0A 3EFJA 4YJNA 4F4PA 3C7QA 5M55A 2PVYA 1PMEA 2XBAA 4L45A 3EN7A 4GKIA 3D15A 2ITQA 1FMKA 4QP7A 1K9AA 3D4QA 3EN5A 4MD7E 4QYYA 4B8MA 4BYIA 4FKWA 4FL3A 4AA5A 3FXWA 3BLRA 4RQVA 3BGQA 3U9CA 5HE2A 4BKJA 4ZJIA 2ERZE 3FPMA 4V05A 3TWJA 4I93A 4ITJA 1OBDA 4ACHA 3R01A 4L7SA 5IUGA 1PF8A 3QD4A 4KSPA 3FKNA 3BLQA 2UZWE 2R3PA 3C0IA 3A60A 3OUNB 2PULA 2OICA 2X81A 4F08A 5GHVA 4GVJA 5CEQA 2RFSA 3HEGA 3SV0A 2GHGA 3HDNA 3OWJA 4O7NA 3CR0A 3H10A 5T3QA 4ACCA 4AFEA 2VRXA 3FI2A 3CJFA 3MV5A 3GB2A 4NW6A 5CSXA 5E1SA 1BKXA 3PZHA 4ACGA 2PVMA 3PXZA 5IA4A 3RHXA 5FTOA 5LMKA 2ERKA 5HU9A 2YERA 1YWRA 3RAHA 4H58A 4G17A 3UVRA 5L2WA 4CMOA 3ZSHA 1YXTA 3GFEA 4BZDA 4WHZA 3R63A 4DGNA 4ZY5A 4EZ3A 4EC8A 3FZSA 3FLQA 3PPKA 2X1NA 4BFMA 5C4KA 4FKRA 3ZM4A 4ZSGA 4EL9A 3CTHA 4KB8A 4M69B 4ZSJA 2XVDA 4BI1A 4L68A 2Y4IB 4QTCA 4WRGA 5HCZA 2J6MA 3OHTA 3P23A 2PUNA 3K3JA 3HECA 2WMQA 4Z55A 3FMNA 4FGBA 2WGJA 4WT6A 5HI2A 4EOPA 5CT0A 2WMVA 4AW0A 2XUUA 5LVMA 3MFSA 5ANKA 3WF8A 4ANNA 2ZV2A 4FTCA 4JBOA 3I79A 4J98A 2R3QA 3IW8A 4AXDA 2XALA 3UDSA 1VYWA 2OU7A 3EQIA 2A2AA 3ZU7A 2RF9A 4Y72A 4RIYA 5HKMA 5ACBC 4E73A 5GZAA 1CKIA 2J90A 2V7AA 3CBLA 4LL5A 5BVFA 5CNOA 5M08A 3UYTA 1JNKA 4I6HA 5I9XA 4K18A 3MH3A 3NSZA 1V0OA 2J2IB 4I6QA 3FY0A 3KKVA 4LGDA 2VNYA 2WOTA 4OGRA 3EZRA 2Z7SA 5DN3A 2Z7QA 4JIAA 4HW7A 2B4SB 2BMCA 2VTHA 3DKFA 5IQHA 4OUCA 4KBKA 5HEZA 2J5FA 3TTJA 2W1CA 1H0WA 3UOLA 4H05A 4DH1A 2YCQA 3R83A 4CV8A 3TNQB 3IO7A 3UQGA 1NVSA 3REPA 4BC6A 2V0DA 4ZAUA 3AOXA 4FKPA 3R9DA 1OIRA 3QCYA 2X2MA 4EQCA 1XBCA 4JDJA 1PXNA 3FLNC 4EKLA 3E8CA 2B54A 4IEBA 4NTSA 4I6FA 4AAYA 5CAQA 3E7OA 4J99A 3R1QA 4LMNA 5DEYA 4GW8A 4LGHA 5KMKA 2O2UA 4XMOA 5AP0A 5E7RA 4X0MA 3OCGA 3QKKA 4IAIA 4PP9A 4XH6A 1DI8A 2OF2A 3VN9A 5FGKA 3BEGA 4EORA 1G8KA 3LXNA 2BVAA 4U79A 4F65A 1FVVA 5DWRA 4FZ6A 4AQCA 2J5EA 2UW0A 5E9EA 3UG1A 5K4IA 4O7SA 2VO3A 3AT3A 4HYIA 2YAAA 4RRVA 3TJDA 5E8UA 3WF6A 5J5SA 3W0NA 2BDFA 4EHEA 4UX9A 3V5TA 3CKXA 4R3PA 4YPSA 2OJIA 4EUTA 2FO0A 4PMTA 3E5AA 2ZV8A 5I5ZA 3W2CA 3VULA 2QOKA 3F7WA 4D5KA 3AMBA 1DI9A 2XMYA 4CKRA 3ZC6A 2J0MB 2ZJWA 4ZEGA 4B4LA 2UVYA 5L6WL 5FDPA 1NW1A 3O5AA 1P4FA 2QO7A 4O0TA 5ETAA 3V3VA 4BVUA 3DAJA 4CTCA 5JEBA 2X7OA 1REJA 2Z02A 1XO2B 4CKJA 4DGOA 4E5BA 4FTNA 4FV6A 3LQ3A 1S9JA 5LMKC 3U6JA 3QGWA 3V6SA 3KREA 4F6UA 3FSFA 4XOZA 4G5PA 3ZEWA 2J0IA 3BI6A 3L9LA 4RJ4A 4G34A 2ZB0A 4M14A 1LEZA 1O6YA 4X3FB 3TCPA 3VF9A 2UVXA 4BRXA 4NIFA 1FPUA 2FYSA 3UC3A 3FXXA 3MB6A 5GJFA 4UMTA 3Q9XA 4RJ7A 2CKEA 2YCSA 3GENA 4BJJA 4C8BA 2R7IA 3EHAA 3LIJA 5T6KA 4JVGA 4TXCA 2W0JA 3TKIA 3DBCA 4GIIA 4C4FA 4H3BA 3ZLXA 3UBDA 2PMIA 2RFEA 3IOKA 3QRUA 2B52A 4C37A 5KO1A 4HCVA 1JKKA 4GVAA 4NM7A 4UB7A 4UYNA 4DITA 1H1RA 2ZM4A 3FLZA 4BDGA 4FZ7A 4XYFA 2DS1A 5ANGA 2VWIA 4UZDA 5FUTA 3VBWA 4DH8A 2WTWA 4F99A 3DZQA 3SKCA 3W16A 1JAMA 2GU8A 3TV6A 5IEVA 4F0GA 2V7OA 3L9MA