1M2PA

Crystal structure of 1,8-di-hydroxy-4-nitro-anthraquinone/ck2 kinase complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
325
structure length
325
Chain Sequence
b'SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II, alpha chain
publication title Inhibition of protein kinase CK2 by anthraquinone-related compounds. A structural insight
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 107
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1m2pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1m2pA01
3R9OA 4E20A 4FZ7A 5A6NA 1IAJA 3KF4A 2VN9A 5DA3A 4ZTRA 3RPVA 4R3CA 3QXOA 4R1VA 5KZIA 5BMSA 1M7QA 3JY9A 4NUSA 5IQGA 3F5PA 1XH4A 4AN9A 3PG1A 2Y4PA 4GT5A 4YJTA 3SD0A 1JKSA 5BPYA 4AW1A 4QMVA 1GOLA 3Q9ZA 2QOFA 5A4TA 2PMOX 3GI3A 3FZSA 3O51A 2PMNX 4HGSA 3DA6A 2R3MA 5EHLA 3UQCA 4G3EA 5M4FA 2BAKA 5AIRA 1M2RA 4XMOA 3AC4A 3R1SA 4I0RA 1ATPE 2BIYA 3FPMA 5J87A 4QMZA 3ROYA 3HDNA 3EFLA 5AX3A 4BIDA 4XG9A 3Q6UA 5GZ9A 2YDIA 5IDNA 1LP4A 3FSKA 1U5RA 3BBTB 3CKXA 3ORMA 4V01A 4EUUA 2XIKA 1WBNA 5CZHA 5EQYA 2YLEA 3AT2A 4O96A 2VWUA 3PDTA 2QOKA 5JGBA 1NVSA 2Y4IC 2YACA 3C0HA 3E3BX 3RZFA 2R3LA 1YOLA 2QU5A 4XG3A 1ZZ2A 2OXYA 1JSTA 4DGNA 4ZLYA 5CEPA 4OGRA 5I9VA 1T46A 4RLLA 1H07A 4I4EA 3VF8A 3UG1A 4BR3A 2PE0A 2I0VA 4EOJA 4K2RA 4BCGA 1Q97A 3PTGA 3QRUA 5TOZA 1GZNA 2YWPA 4R3PA 4EK6A 3QGWA 5L6OA 4EYJA 3PY0A 4FNXA 4FT9A 4I6BA 4RQVA 4BGQA 5AADA 3VHEA 5IQDA 2B52A 2GFSA 3GBZA 4RWIA 3U4UA 1R0EA 4AX8A 1YOJA 2OW3A 3VUHA 3BELA 3WE8A 3W2PA 4IX6A 3OUNB 3NYVA 3NUNA 4FODA 4M67A 4WRSA 3RINA 2BRBA 2RIOA 4LRJA 2Y6OA 4O0UA 4I21A 3UYSA 4MKCA 2Z8CA 5FEEA 2OIQA 2XRWA 3MB6A 4RBLA 5DOSA 3VS4A 5EM5A 4GW8A 4FVRA 4O1PA 1QPEA 5DLSA 4EK5A 5G6VA 1JKLA 3BPRA 4DN5A 4AW0A 3DY7A 4FTCA 3ZDUA 2QKRA 4CT1A 4IB5A 2W5AA 4AGUA 4NWMA 4FKOA 1FGIA 3C9WA 4IC8A 4OTFA 5CASA 3W8LA 4AG8A 4ZLZA 1OKYA 3HDMA 5T68A 2YA9A 3LMGA 3ZSIA 2BRHA 3RHKA 1GZKA 5IQAA 1YQJA 3MPTA 3W16A 2A4LA 3AD4A 4PNKA 3N51A 4BTMA 5DG5A 2B55A 4Z55A 3LCDA 4YLLA 3AMYA 3RHXA 3VUKA 4R7IA 2W4OA 1TQMA 3NPCA 3E92A 2I0HA 1H1WA 3AOXA 4I23A 4Q2AA 1NVRA 2R0UA 5H8BA 2C5OA 4A9UA 3VBXA 4DT8A 2CN5A 3CD3A 2ITWA 3TIYA 5HE0A 4MH7A 3MESA 3F3VA 4I0SA 4HCUA 3HLLA 4RFYA 5AUZA 3QYZA 4OT5A 2ZMDA 3C1XA 1XQZA 2VO6A 3HKOA 4QNYA 3AG9A 2OXDA 3EKNA 1UU9A 3GCQA 3OCSA 4IZAA 4KINA 4BDIA 5BQ0A 1E1VA 3PLSA 4IANA 4I3ZA 3LM5A 2REIA 3GU4A 2OH0E 4IM2A 3EYHA 3FV8A 3E8NA 5HLPA 4TKSA 1WZYA 5DVRA 1VJYA 2FSTX 5DBXA 3SDJA 3VRZA 1Z9XA 2HY81 4E5BA 3I6UA 3QHWA 4W8DA 1DS5A 4Y83A 4YHTA 5TO8A 5IQCA 5EQEA 5HTCA 1SVHA 4USDA 4MXOA 5HU3A 2QO7A 4PPAA 2WOTA 4YO4A 5CZIA 1FVTA 3FLNC 3FMKA 1KE5A 5CEMA 3RZBA 3TWJA 2WTCA 4BRXA 2WFYA 4QMOA 3K5UA 4ASDA 3ULZA 2WU7A 3OXZA 4RPVA 3NAXA 3B2WA 4QYGA 5DRDA 2WO6A 4F65A 2R3RA 3DBFA 3EQPA 4O81A 3BBWA 3VW8A 1WBVA 5CSVA 3DXPA 3DQWA 4TYIA 4H05A 4XG7A 2ZMCA 3ZZEA 3ORNA 5IA2A 4EQMA 1PHKA 2IN6A 4FYNA 5HNIX 4DTKA 4KD1A 4NM7A 2IW9A 4FKGA 4IHPA 5E8SA 3FWQA 3PJ3A 5TF9A 4F7NA 1PMNA 4TW9A 3G0EA 1OBDA 4UY9A 4O2ZA 3O7LB 1XHAA 2J2IB 2UW3A 5EH0A 3RCDA 5KBQA 3F9NA 4JBQA 3ZEPA 4WHZA 4YUQA 1Q3DA 3PYYA 3UJGA 4F6UA 3O8TA 1YHVA 3T9TA 4AN3A 5EKNA 2JDRA 1TKIA 1B6CB 2GTNA 3A99A 4EOOA 3BYVA 3D9VA 4DGGA 4EOKA 5IEVA 3VN9A 4C38A 5CF8A 1GNGA 4RMZA 5K3YA 4I5CA 4DF3A 4U45A 1BYGA 4FR4A 4G34A 3PY3A 4YP8A 3C4CA 3RNIA 3ETAA 4FEWA 2C5YA 4FGRA 5AUTA 4J7BA 2DS1A 2E9VA 2VWIA 4S2ZA 4FKLA 2I0EA 3NS9A 3CCNA 3NUUA 2VNWA 5E8VA 5FM2A 3ZSGA 4C4EA 3CE3A 5AV4A 4HGTA 3A62A 5AMNA 4B7TA 5CENA 2QLQA 4UN0C 3NEWA 1OBGA 1PXKA 3HAMA 1PW2A 1VR2A 2Y0AA 1WFCA 3HRFA 3UNJA 4OUCA 3WYYA 3HV4A 4K8AA 4FTTA 5GJDA 3FI2A 4AS0A 2HYYA 3ANRA 4JDJA 3DZQA 3ORTA 1Y6AA 3M42A 3TT0A 4RX7A 4E4XA 5T6KA 3U6HA 3V5WA 4PPCA 4FV1A 1IA8A 3SOAA 4GK2A 2E9OA 3FC1X 4GS6A 4MCVA 3I81A 3OEFX 2IZSA 2XRUA 4E6AA 3TNHA 4O7TA 5CAVA 1Q8WA 4RWJA 4FSRA 1ZMVA 4TT7A 3FMHA 4DLJA 4CFXA 2F9GA 4ZTMA 1G8AA 5HU9A 4FEUA 3BYOA 4R6VA 5AM7A 2BZHB 3UIMA 5C4KA 4RRVA 4QNAA 4OTWA 4Y5QA 2HWOA 5EW8A 4UV0A 4WKQA 4ALUA 5BUJA 3LQ5A 5C26A 4FZAB 2QVSE 4FZDB 4O7RA 3UG2A 4QP1A 2ITQA 3TNQB 2WQOA 5IA5A 3WE4A 1KUTA 3E62A 4DG0E 3MA3A 4M7IA 5IQHA 3UIBA 3PXFA 4FK6A 4D9TA 5CAPA 5I9WA 4CRLA 2H96A 2OK1A 5ANJA 4V0GB 1MUOA 2C4GA 4WNPA 3RTPA 2A27A 4DGMA 3LE6A 3IW8A 5EI2A 3KA0A 2Z7QA 4O83A 2C6EA 3HL7A 5LOHA 3PPZA 5EOBA 2Y6MA 3ZLSA 2YEXA 4LOPA 4C3PA 5J7HA 4MEDA 3TEIA 4ANBA 3NNUA 4ZZOA 4F6SA 3P23A 2XK8A 2WQEA 1CM8A 4F7LA 2GQGA 5KMNA 1XWSA 4FIIA 3W32A 4E3CA 2QG5A 4APPA 2UW6A 5BMMA 3VS7A 2ZM4A 5J7BA 1BMKA 1ZYJA 4ITJA 2C47A 3FLZA 1PMVA 1WBPA 4PP9A 5A4EA 3RMFA 2XS0A 3QTQA 5CS6A 1KSWA 5AP3A 1PXMA 4MNEA 3V3VA 2W5BA 5J5TA 4GJ2A 3EN7A 3L9NA 4PMTA 1YW2A 5L2TA 5E9EA 2UZUE 2UW5A 3TV7A 3WF6A 4AT5A 3VS5A 5FDPA 2FO0A 1WCCA 2XVDA 3Q32A 5DT3A 2BUJA 3FLQA 1QPCA 4PY1A 2QURA 4MXYA 5ETFA 2HIWA 5EFQA 3JYAA 3L1SA 4O0YA 2Y8OA 3F88A 2V55A 3OCGA 3RPRA 4L3PA 4NJ3A 3NW7A 2YM5A 3EHAA 3ZONA 2GS2A 3R8MA 3ROCA 3DZOA 3NR9A 3QXPA 4XHKB 4HZRA 3TUCA 4RWLA 2GHLA 2JAMA 2B9FA 4GVJA 3SG8A 2YLFA 3P4KA 5DR2A 4WSYA 5E91A 2ZAZA 4GT4A 3E8EA 1OIRA 3PXRA 3KVWA 2JKQA 4L6QA 4BCOA 4EOQA 1REKA 3II5A 3LJ1A 3QHRA 5CVHA 3PSCA 4DBXA 3P78A 5DEYA 4DEIA 1DI9A 4JG8A 4CTCA 2R3OA 1BL7A 1H4LA 3C4WA 2VTSA 1LUFA 2X4ZA 1Q5KA 4GEOA 1H1SA 4K11A 3QKKA 4UMPA 5I3RA 1B38A 4FV8A 4C34A 3LKMA 3HRCA 4D0WA 3UNZA 1QPDA 3CPCA 3BRBA 3KXNA 3RJCA 3ZEWA 3ZFMA 4NCTC 1R39A 4WNKA 1MP8A 2GNLA 4GVAA 4AQCA 4N6ZA 3E7VA 2OKRA 2GU8A 2XKDA 4D9UA 5JH6A 3DBCA 3LXPA 4WG3A 1V1KA 1E9HA 2C6OA 4WBBB 5CXZA 3A7JA 2HCKA 3SA0A 5LVMA 5LVPA 3VO3A 3SHEA 2J0JA 1UA2A 4ZJVA 2BAQA 4HCTA 2QD9A 4D55A 5C27A 4OTRA 2PZYA 2AUHA 3OY3A 4QTDA 4FEVA 4HNIA 4AUAA 3IPHA 3S95A 5IPJA 2C3LA 3KRJA 3LM0A 5M06A 3CTJA 3SC1A 4FIHA 4XUFA 4ZTHA 4LQMA 3F3UA 4MXZA 4F9CA 1G8SA 3FEGA 5HIEA 4DCAA 3G0FA 2JKKA 5HG8A 2JIVA 4QMTA 4FIEA 3FMNA 5EOLA 2HZIA 2ETRA 2QQ7A 3CS9A 3R7IA 1H24A 3KCKA 5FEDA 5CNNA 1SM2A 3R04A 5LCKA 4A4LA 2GMXA 3VBYA 5FP5A 4AGCA 2B54A 5K5XA 3DKOA 4G2FA 4OW8A 3CQWA 3I4BA 4MF1A 3Q9WA 3VIDA 4ALWA 4X0MA 1L3RE 5KMMA 2JFMA 4YMJA 3SLSA 3ZMMA 3E63A 3RALA 3MWUA 2J0IA 1SZMA 4HPUE 2EXMA 4FT7A 4ACCA 2HY0A 2YIWA 5FBOA 4EH9A 1XBAA 3ZC5A 2R3HA 2HW6A 4LOOA 4DINA 4O7NA 5LMAA 3RWQA 4XG2A 2XBAA 2PHKA 4WG4A 4DEEA 5D41A 4CMTA 5HNGA 4O84A 4MD9E 3ZBFA 3I5NA 3EQGA 4M66A 2YHVA 4AZFA 4CTBA 4ZTSA 4AA5A 4F0FA 5JQ5A 3QD2B 1QPJA 4KABA 4HVHA 4BDFA 2UUEA 4XH6A 4O7ZA 4QP3A 1QCFA 2R3IA 5B0XA 2WKMA 4WA9A 5AR3A 4HYSA 1O9UA 1B39A 3RI1A 3A2CA 1W83A 2VTJA 3QQFA 4LL0A 4BZDA 4MBIA 1Q8YA 4HYIA 1BL6A 3WARA 4OBOA 2ERKA 4EYMA 4O0TA 2V22A 5EDPA 3G6HA 2VWBA 3PA3A 5CF4A 2QR7A 3GCPA 3NZ0A 3V01A 2UW7A 5BVWA 3UIXA 3QUDA 5E8YA 1CDKA 1ZY4A 4EOLA 2CKEA 3R02A 4FL3A 5A14A 4U0IA 1R78A 4XCUA 4EOIA 3TKHA 3C5UA 3WF7A 4IX3A 2YM6A 4FNYA 4BDHA 4QP8A 4MVFA 3VULA 4A9SA 2OSCA 5JFXA 2ZB0A 4LOQA 4AFEA 4H1MA 4F99A 5BVNA 2W9FB 3QLFA 2P55A 3VRYA 4GFGA 4RFZA 4BDBA 4Z7HA 1ZMWA 4K77A 5AR8A 1U54A 3ZSHA 5HO6A 3R1QA 1XO2B 4I20A 3ZZWA 5IUHA 5J1WA 3PLAE 3RVGA 3PP1A 4NTSA 3IDBA 3O7LD 4BIBA 5GZAA 2X6EA 5F95A 3CEKA 5HQ0A 3KK8A 3HMMA 2X4FA 3LLTA 5HE1A 5FBNC 4FIFA 2CGVA 4D4YA 2WIHA 4QO9A 3CKWA 4XOZA 3R7YA 3BYMA 1P4OA 4ZSLA 3HYHA 3R30A 3IW4A 3QX2A 4PUZA 1J3HA 4IWOA 1H28A 2FH9A 5CU3A 3V5JA 4K18A 4I93A 3KULA 3FMJA 1JKKA 2O63A 3MW1A 4TWCA 5AV1A 5FP6A 3OWLA 5A6OA 2VTRA 3ITZA 5C8NA 4PX6A 3P1AA 4HYUA 3BHUA 2H9VA 3GXLA 1NVQA 3S3IA 5D10A 1ZRZA 3Q04A 4PP7A 3M2WA 4LV8A 1XKKA 3C0GA 3VNTA 4USFA 4LYNA 4J8MA 3OT8A 3JUHA 5BYZA 2W1FA 4R77A 3F5UA 3R71A 1OUYA 1H08A 2WMBA 3LAUA 4BF2A 3CJFA 4GSBA 3ALNA 4CMOA 2VTTA 2XB7A 5E8WA 4UWCA 5TKDA 3EMGA 3WOWA 4YTIA 4FG8A 5I5ZA 4GG5A 5C01A 5HZNA 3Q4CA 4FSWA 4OAUC 4F0IA 2C3IB 4IVBA 4EI4A 5DYJA 3POOA 4IACA 3AXWA 4U7ZA 3D14A 4M13A 4L45A 5AR5A 5B7VA 2PVMA 3HV5A 3QZGA 5CF6A 5FWKK 4QMXA 4G3FA 3Q9XA 3BYUA 2ITOA 4MBLA 2EXCX 4GUBA 5ANIA 4GU9A 3SVVA 4G6OA 2J90A 2UZVA 3V8WA 3LCOA 1VEBA 3D7TB 5DGZA 4CFWA 5FXSA 3BKBA 3UPXA 3KN5A 1UVRA 4H3BA 1SMHA 2RGPA 1IRKA 4TYHB 3IECA 3OCTA 4MNFA 2C6KA 5B2LA 2Z02A 2OGVA 2NRUA 3GB2A 3FLWA 4FSMA 5J1VA 1MQBA 3HA8A 3LMHA 3ZOSA 2OZAB 4QYFA 2WMAA 4F9YA 4V05A 4DFBA 4M0ZA 4NJDA 2C6TA 5HGIA 4X3FC 4ENYA 3UNKA 2Q83A 2WMVA 4OR5A 5E8XA 5EK7A 3W8QA 4TXCA 4YJRA 3O0GA 4MXXA 2F7XE 5HOAA 1PXOA 5CAOA 5HTIA 4PL3A 5ANKA 1ZYCA 4UMRA 4AA4A 1UNHA 5LMBA 1TQIA 3NCGA 4FT0A 1JNKA 3MH0A 5I0BA 1M17A 5EI6A 4RX9A 1WMKA 5ETAA 4GYIA 5HVYA 1WVWA 3QWJA 4LMNA 1Z5MA 4F08A 5JMSA 3D4QA 3MVHA 5IMEA 1DAYA 2LGCA 2P33A 3AD6A 5D7AA 3EN4A 5IEYA 1RE8A 4C4FA 3QF9A 5LVLA 2X7FA 4EBVA 3U6IA 3N4UA 4YJSA 4EH2A 3PIYA 4FTKA 5TE0A 4BDJA 4QPMA 3O96A 3F69A 4GV1A 1FBNA 2WAJA 2HAKA 2XKCA 4M68A 5K4IA 3BHYA 2ZM3A 3CY3A 3D5WA 2RL5A 2VWYA 1ZARA 3ACJA 3LFDA 4QYYA 5ETCA 5J9ZA 4D2PA 2R7BA 3OBGA 3IOKA 3WZKA 4RIWA 3COKA 4IM3A 2G1TA 4O27B 4DH8A 2YCRA 4FKJA 4BTJA 4BTKA 3FQSA 4H58A 4X2FA 4F0GA 4ZOGA 2OICA 1PF8A 4BZNA 5IUGA 4HGLA 4NYEA 3KQ7A 3PY1A 2J5FA 4H3PA 4OBQA 2JKOA 4YHFA 3Q6WA 3PJCA 3TZ8A 2UVZA 4BI1A 2Q0BA 2JFLA 3EFJA 2QG7A 3HV7A 4YZMA 2OO8X 2XF0A 1KOAA 1W84A 2RG6A 3RAWA 4LGHA 4P5ZA 5FQDC 4JRVA 5HG5A 3TKUA 1H00A 4HYHA 4BC6A 4E4LA 4FIGA 2BFXA 3IO7A 1M2QA 1WAKA 4F9BA 4XG6A 1Y8GA 4FK3A 3MY1A 3UOKA 5IH6A 4CG8A 3UZRA 3PA5A 5M57A 5B2KA 5M56A 2C69A 2W06A 3LHJA 4C3RA 4F1TA 3A7FA 3KXZA 1U4DA 3CQEA 5HEZA 3VS3A 4OBPA 5BX0A 4CLJA 2O0UA 5EYDA 5M51A 4PTEA 2YZAA 3IQ7A 4L00A 4NM5A 5HHWA 3EQFA 1PMUA 3FY0A 1ZY5A 1PMEA 2X81A 4DEDA 4NEUA 2OLCA 2IJMA 2E9NA 2WQMA 1I44A 3LCTA 4FNWA 2XIRA 3F66A 4FV6A 4MAOA 4BDCA 5HX6A 3LLAA 4L3JA 2R3PA 4I5MA 3NYNA 1R1WA 2HWPA 2ITZA 3UQGA 3EQRA 3ERKA 3VS1A 3GU7A 2ZV9A 1H0VA 3QQGA 3DNEA 4Z16A 4C2VA 3FZTA 3COHA 2EXEA 4CFFA 4MYGA 1YI6A 4BYJA 5M44A 1S9IA 1Y57A 2XNBA 3OW4A 2A1AB 4C4JA 1H8FA 3PPJA 5BVKA 4JR7A 5KMJA 1STCE 4HGEA 2VWVA 3MDYA 4J71A 4EHEA 1Q61A 2ITNA 3F61A 4BZOA 3AD5A 4CQGA 4P90A 1ZZLA 2YITA 3OWKA 3PJ8A 2QOBA 1DAWA 2VGPA 4U79A 1XH5A 3DB6A 4QTAA 3RM7A 3Q60A 3RM6A 2BTSA 1O6KA 1M14A 5HD7A 5M4CA 5J9LA 5IG1A 2CKPA 4CGAA 2H34A 4NH1A 2X39A 4P5QA 4ZXTA 3FHIA 3QD3A 4KIKB 4EOSA 3P9JA 1O6LA 5IMXA 3KRWA 5HKMA 4EQUA 4H36A 3RAKA 4IVCA 1T45A 3UZTA 2WTVA 1RDQE 4FE2A 4R8QA 4Y8DA 3TZ7A 4KIPA 4WUAA 3IW5A 3QC9A 4ZP5A 2W0JA 5DR6A 3HGKA 3U4WA 3BLQA 4O7VA 4CG9A 4QQTA 2F2CB 4B8MA 2A19B 4O7YA 2RSVA 4BFMA 3MFRA 3L9MA 1OIUA 4I6QA 5GIOE 1H1RA 3HP2A 1BI7A 3KXGA 2A2AA 4MX9A 4DLIA 3EFWA 3EQBA 5ACBC 4JG6A 3ZH8A 2IVTA 4FOCA 3PG3A 5L4QA 5LXMA 3BCEA 3GFWA 2GCDA 2FYSA 4I6HA 4FTAA 3TM0A 3DBEA 1Q3WA 1ZAOA 4CNHA 5IH4A 2B4SB 4WT6A 3A7IA 4U8ZA 3N4TA 5KCVA 2XYUA 4KRDA 5KHWA 3U6JA 4RX8A 3NLBA 3KVXA 3QYWA 2G2HA 3MFTA 4KBCA 3QCYA 4OTGA 4CLIA 3R0TA 4F63A 1OGUA 4RZWA 4ZZNA 5EI8A 3PVWA 3T9IA 4TWPA 1SYKA 3QQUA 3A7HA 3W18A 4JJRA 3ZHPC 4BL1A 5JFSA 2WTWA 3E93A 4C8BA 5IA4A 4DHFA 1YXVA 5AP0A 2JBPA 5E8UA 2XBJA 3Q4UA 4JQEA 4W4XA 5GZ8A 4K0YA 3QRTA 3SRVB 4M97A 2JIUA 4PPBA 3MH3A 2PE1A 4MD7E 3M11A 4EOMA 2WHBA 4N57A 3RAHA 4IADA 4P7EA 5AP2A 4E73A 5KNJA 4NL0A 4JAJA 4EC8A 4R7BA 2BRMA 3QTXA 4WUNA 4JOAA 2PL0A 2IPXA 2BKZA 3MY0A 4K1BA 4NU1A 3ZXZA 2VO3A 4TTHB 1FQ1B 4RA5A 5KMOA 2BALA 3GNIB 4FL2A 1VYWA 4QRCA 3EN5A 4BN1A 3BIZA 1LPUA 2YFXA 5IUIA 3RCJA 2YM4A 2UW0A 4HVGA 3QKMA 4CFNA 4CYIA 4Q5HA 3UO5A 5A4LA 1K2PA 4FTLA 5LMKA 3G15A 2YIRA 4WSQA 5FTQA 3F2AA 2JAVA 3VBQA 4IX5A 3TI1A 3MV5A 5CSXA 3EZRA 5GHVA 1BLXA 2ITPA 2FSOX 2ZV8A 3R9DA 3ZRMA 5A54A 1FGKA 2ERZE 3U51A 1J1BA 3EB0A 2QI8A 4ZSJA 3ZYAA 4ZTQA 4F1MA 2YM8A 3DAJA 2C0OA 3Q53A 1YKRA 4G9RA 2XMYA 1FOTA 3OD6X 4O91A 4XBRA 3OOMA 1YOMA 5KE0A 4E4MA 4EKKA 3NMUF 1ZWSA 2X1NA 4CKIA 1ND4A 3RK5A 4B9DA 1UU8A 4IAZA 4GMYA 4P4CA 5J5SA 3ZCLA 3FL5A 3MN3A 3PSBA 2C6LA 5A3XA 2XJ2A 3CSVA 3GCUA 5JFVA 4NM0A 4W4VA 3ANQA 3EIDA 4Q9ZA 4GK4A 4LRKA 4NM3A 3PJ2A 2IWIA 2VWWA 3WYXA 2XK9A 3VWAA 4L8MA 3QC4A 1HCKA 4CCBA 1ZYLA 5D1JA 4BWXA 2BRNA 4EH8A 4L68A 3HMIA 4O22A 3AC2A 3NX8A 4A07A 2YDJA 4C4IA 1AQ1A 4EEVA 3HMOA 2CN8A 3O71A 2GNIA 4F70A 4IEBA 4HNFA 5IQEA 2C30A 4AT3A 4UXQA 2W05A 3C5IA 2RFEA 1WBSA 2W99B 3IDPA 3R73A 4WRGA 5F1ZA 4K9YA 2ZJWA 4IZ7A 3D2IA 4AGWA 1H1PA 3UBDA 3H3CA 5AP7A 3IGGA 5HBEA 5AP4A 4GUEA 3I0QA 1JBPE 4PNIA 4XOYA 2W1DA 4DGOA 2QCSA 2PUPA 4MBJA 1LEZA 1KE9A 5HO8A 2HW7A 4QMSA 5BYYA 3RK7A 3D7TA 3LXNA 4M14A 2YCFA 4X2GA 5CQUA 1URCA 5FTOA 3FI3A 2PSQA 4XEYA 2VTMA 5CT7A 4G16A 3UQFA 3ALOA 2HENA 3NUSA 5AJQA 2FSMX 3K2LA 3D5XA 4FG7A 3IGOA 4NT4A 3UO6A 4D2TA 1ZYSA 2C3JA 2HK5A 5A9UA 5AAEA 4XLVA 3KMUA 3N9XA 2UZDA 3BLHA 4CZYB 2RFDA 4AOTA 3BE2A 4U3YA 2X2MA 2Y7JA 1MQ4A 4Y95A 3ODYX 3QL8A 5DN3A 3FQEA 2G2FA 3LFFA 4N0SA 3KXXA 3ZFXA 2YAKA 3EQIA 3WZEA 4FX3A 3R9HA 1PY5A 1PRYA 5LJJA 4EH3A 5C1QB 4R5SA 5LARA 4U42A 3H0ZA 4AT4A 3Q2JA 2NNWB 4OLIA 4L52A 4G1WA 3SXFA 4U80A 3DTWA 4IB3A 5BVOA 3R28A 4FTIA 3DFCB 2Q0NA 3UVPA 4KSQA 5JN2A 4UMUA 3V6SA 1JOWB 1P4FA 2YAAA 2BZIB 4XNEA 2UW4A 4KWPA 3K54A 3PVBA 2BDFA 5HX8A 2W1IA 2O5KA 4FV2A 1F3MC 2XEYA 4FUYA 5A46A 1G3NA 5TT7A 2R3NA 4C33A 5AA9A 3AQVA 3MBLA 5AUUA 3HAVA 5IF1A 2RFNA 3OHTA 4N4SA 2OF4A 4AW2A 4JBOA 2CLQA 2HXLA 4MWHA 5LVNA 2XYNA 4LM5A 2PVKA 3P08A 2AC3A 2C6IA 2VX0A 1ZMUA 5E90A 2B0QA 4Y72A 1JQHA 1WVYA 4G31A 4IMYA 5EM6A 3VVHA 1Q8ZA 2CPKE 3ENMA 4QQ5A 3JY0A 4PTCA 3LFEA 3WILA 3NNXA 4L7FA 4YJQA 3CGOA 3L8PA 4QMQA 1IEPA 1J7LA 2R2PA 3A8WA 3FMMA 4FG9A 3FMDA 4E6DA 5BVFA 3L8XA 4JBPA 3H9OA 2QNJA 4MXAA 2GHMA 4I41A 3BWJA 2OIDA 4U97A 4BCQA 4YLKA 2ETKA 2EWAA 2KULA 3EZVA 3OEZA 2JDSA 3C7QA 5I9XA 2ZV7A 4QMUA 3BI6A 2IG7A 5HIDA 4OTPA 3IONA 2GPHA 3GC7A 5I3OA 4YTFA 2WQBA 4NFMA 4EZ5A 3DB8A 5CU0A 2FUMA 4RIYA 4FT3A 4QMWA 3NIEA 4IFCA 1K3AA 4QMMA 1GZOA 3PZHA 4R3RA 3G51A 3QD4A 4C7TA 1W0XC 2XM8A 4RGJA 3WBLA 5JGDA 2WB8A 4YBKA 5HNBA 4AN2A 5HLWA 2J0LA 1UV5A 3E64A 3QX4A 3COMA 4QYHA 4DGLC 2VX3A 5HICA 3FXXA 3BV2A 2R3KA 1H27A 2RF9A 2P2IA 1IG1A 3QALE 3LZBA 3FLYA 3KMWA 3D94A 3MA6A 4W9WA 5LWMA 3QTRA 3GENA 3ID6C 3T3VA 4YR8A 4DFXE 2PWLA 3H10A 1ZOGA 2XZSA 3FKLA 3EL8A 3OWPA 1ZOHA 5AR4A 2VTOA 3F2RA 5HVKA 3MGYA 4I1ZA 1Q8TA 2WGJA 2QONA 3LFBA 3OS3A 4L67A 4LUEA 4QD6A 3HP5A 4JX3A 2CKQA 3MVJA 4GT3A 2J0KA 3MVMA 4GJ3A 2PVRA 4YJUA 4ZEGA 3O8PA 1Y8YA 3F7WA 2X8DA 4M69B 4FTUA 3NUAA 4S30A 4BHZA 3HZTA 1H0WA 3F3WA 3HVCA 4IZ5A 4WNOA 4C2WA 1OPLA 1WBWA 2PZIA 1YRPA 2VWXA 3NYXA 4IB0A 4CD0A 5AA8A 4KBAA 4CV9A 3ATSA 4IBMA 2B53A 5HORA 4X21A 3MPAA 2X0GA 3TTJA 5FG8A 4FTJA 4YSJA 4ZSGA 5CU6A 2JBOA 2OFVA 3QCSA 3E7OA 3G5DA 4DH5A 2PULA 2R3GA 3Q9YA 2R3QA 4D58A 4FZFB 3TZMA 4MQ1A 3F3TA 5EHOA 3U54A 4S31A 5IU2A 3V5QA 3HRBA 4FVPA 4B99A 3V51A 5GIPE 2YIYA 4BGGA 2CGWA 2O8YA 4FKWA 3R7EA 4FUXA 2ZYBA 4ASEA 3A8XA 3D0EA 1UNLA 3D15A 4QPAA 3R7VA 2OF2A 4BWKA 4FSTA 4FT5A 4LUDA 4G6LA 1BUHA 3PE1A 3LCSA 4PRJA 3TNWA 5IZFA 3EQHA 4QP4A 2OJJA 1RJBA 4JLCA 3CPBA 5CANA 5F9EA 4HJOA 2ITTA 3SOCA 4PF4A 4MTAA 2V7OA 3QWKA 5IA3A 5M09A 4O2PA 4W8EA 2OJ9A 2WMWA 4F4PA 4IZYA 3OOGA 4X2KA 1VYZA 4IB1A 2B9JA 4N6YA 4AXAA 4RJ8A 4II5A 4L43A 2BDJA 5KMLA 3KGAA 1GIHA 3O8UA 4Q5EA 1OMWA 2WMQA 4XLIA 1JLUE 2WTDA 4FL1A 4BCIA 4R7HA 4WIHA 4BKYA 5IA0A 1YVJA 3PPKA 4O38A 4JVGA 1REJA 2J51A 2R3FA 1WVXA 2PYWA 3FMLA 3ENHA 3OVVA 4LRMA 5CALA 2PZ5A 3S1HA 4EH7A 3LW0A 4FYOA 2C5NA 2C6DA 4QPSA 2BHHA 3LQ8A 4FTRA 2C0IA 3EFKA 2PVYA 4IAYA 3A60A 4ONAA 4PQNA 4QP7A 4YNEA 3PUPA 3KKVA 3UGCA 1EH4A 4IVDA 4C4HA 3I60A 4E8AA 2YZLA 2R4BA 2XK6A 5I9ZA 4I94A 4FKVA 2JIIA 4Q9SA 3V8TA 2PUUA 2ITYA 1PYXA 3SGCA 3MYGA 3P7BA 4F7JA 4GYGA 1OECA 5JKGA 2X2KA 2ZDUA 1PKGA 1W7HA 4XP0A 5DT0A 4QMPA 2VGOA 2JLDA 4NZWB 4RIOA 4U81A 3VAPA 5ANOA 4DE4A 2JEDA 4O21A 4XX9A 3GU5A 4KIQA 3MS9A 3QRJA 4DFLA 3ZFYA 4A9RA 4EORA 3NUPA 3H4JA 1YXTA 2OWBA 2XM9A 5B2MA 3IG7A 1NT2A 3W33A 5AAFA 3GEQA 3TZ9A 2BIKB 2XP2A 2IW6A 2JC6A 5AP5A 2R5TA 3TNPC 2I0YA 3BX5A 3FYJX 3R63A 4IJPA 3R7GA 3W1FA 3QQJA 3OZ6A 3EQCA 4NSTA 4EUTA 2Y4IB 3OTUA 3GC8A 5CEOA 5AUYA 1NXKA 4EC9A 4I5PA 1KE8A 4D1XA 2XKFA 1OKVA 2XCHA 4AZTA 1XH6A 2HXQA 4R5YA 3ZXTA 4ZSEA 5J9YA 4NKAA 3DS6A 5HE2A 1FMOE 2PVLA 4RVKA 4A7CA 1ZYDA 5CI6A 4MQ2A 4UX9A 1Q62A 4S32A 3QFVA 3UO4A 3FL4A 2ITUA 2RG5A 5CU4A 2QHNA 4E7WA 4OTDA 3ZC6A 3AT4A 3I79A 4DH1A 2V7AA 4ITIA 3TXOA 3R8PA 2J6MA 5L8JA 5FGKA 2XEZA 1XR1A 1IA9A 2UZBA 4CZTA 5CSWA 4WBOA 4F9WA 3BE9A 5M07A 3U9NA 4E4NA 2W1HA 4PMPA 4J53A 2VTLA 3BLRA 4GFMA 4FICA 3FUPA 4G5JA 4NW6A 4YO6A 3ORKA 3OG7A 5M55A 4QMNA 1M52A 2QOOA 3HNGA 5J8IA 3OT3A 4FV3A 4Y46A 3TG1A 2WMUA 3AMAA 2IZTA 3NWWA 1H1QA 3PE2A 5AV0A 3FAAA 4IFGA 5EW9A 4IIRA 4FSYA 3ZLWA 4RT7A 5C4LA 1RW8A 3PXYA 4KNBA 4MHAA 3BU3A 5EHYA 3ZM4A 1APME 1F0QA 3BGPA 3BU6A 3PXKA 3C4ZA 2OJGA 4J8NA 4YZDA 2JDVA 4G6NA 5CVGA 5HCYA 3MH2A 3TV4A 4NFNA 2PVFA 4W9XA 3D2KA 2G15A 5L2SA 4PDOA 4TYGA 4DC2A 2W5HA 3TUDA 4D2RA 2XIYA 4XV2A 3GOKA 3ZUUA 4PDSA 4I22A 3ZUTA 3C4EA 3DAKA 3GC0A 4KAOA 5FRIA 4O7SA 2YDKA 3UDBA 3KEXA 1UWJA 1NY3A 4YC8A 2C0TA 3LXLA 3ELJA 5H8EA 2BPMA 3ZUVA 2J4ZA 2FSLX 1WBOA 3KB7A 1I09A 2OIBA 4IE9A 4AFJA 3FPQA 5CAUA 4BCJA 3LFCA 3QTIA 5TR6A 1PYEA 2B9IA 2BCJA 5KX8A 4JI9A 4ZLOA 4JXFA 2QKWB 1GIJA 1R3CA 3S0OA 3FYKX 4DEBA 1Q41A 3JR1A 4X3JA 5CLPA 3WI6A 3MY5A 4YZBA 3OW3A 1ZOEA 5KKRC 2BAJA 3VUGA 1KWPA 3C50A 4CFMA 5IQIA 1Q8UA 2EVAA 4WG5A 5M4UA 5HG9A 4QP2A 3QRKA 5K0XA 2V0DA 3CP9A 4C02A 3P79A 3K3IA 3K3JA 2BR1A 4QYEA 4L53A 4D4VA 4USEA 4O6EA 2BZKB 5IISA 4TWOA 4RC4A 5AR2A 2G2IA 4L46A 5CEIA 5DHJA 4WOVA 1L8TA 1XBBA 5KBRA 3N4VA 4ORKA 4IH8A 2J9MA 3ZO2A 4E5WA 4JBVA 3P7CA 4V0GA 2UVXA 4LV5A 4W4YA 1R0PA 5FM3A 3KRRA 5J79A 3CY2A 4EZ3A 2R3JA 3VC4A 4B8LA 3PFQA 3KY2A 4JQ7A 3QZHA 3VBTA 4CKRA 3T3UA 5ICPA 3ET7A 3B8QA 3DCVA 3PIXA 3VJNA 5AFVA 5JRSA 4KBKA 1AGWA 2GQSA 3UVQA 3G6GA 1H01A 2HZ0A 3NCZA 3R2BA 4GG7A 1JKTA 4BIEA 4GKIA 4DFUA 3E88A 2ESMA 5GJFA 5F20A 3OROA 4S34A 2ZVAA 4LGDA 1LR4A 2CHLA 3E8CA 3HMNA 3POZA 5CSHA 1OITA 1GAGA 3F6XA 4FGBA 4BI0A 3QRIA 4I92A 3QQHA 4EHGA 3CBLA 4IQ6A 4BBEA 1OL2A 3QUEA 1NA7A 3RGFA 4CXAA 4EQCA 2VX1A 4J1RA 1OM1A 2QOHA 4M8TA 3BZ3A 3UE4A 3R6XA 2V62A 3O17A 4V04A 2PE2A 4EBWA 4RSSA 3IOPA 1S9JA 5JZJA 2NO3A 2XIZA 4M84A 3BEGA 4J96A 3FY2A 3UOJA 4MWIA 5H9BA 4ASZA 4O82A 2XJ0A 3EQDA 3VUMA 3DK6A 2CNUA 2OJIA 4FKRA 4JIKA 4Z7GA 3MVLA 3R7UA 4YPSA 3R83A 4A9YA 4BCMA 2GNFA 3U87A 3ODZX 3QTSA 4IAAA 3FZOA 2GQRA 4EK4A 5A4QA 2YM3A 3G2FA 4IX4A 5FLFA 1CKIA 3LPBA 4C3FA 4RJ5A 4YPDA 5LVOA 4XJ0A 2WTJA 4CZUA 4ANQA 3UYTA 3GOPA 4M69A 2WZJA 4BDKA 4AA0A 3S2PA 3ZLXA 5BUIA 2X8EA 4DH3A 4QTEA 2HELA 2XNPA 2YISA 3FI8A 4CV8A 1G5SA 1YWVA 4BDAA 2OI4X 1ERKA 4FF8A 4AP7A 3ZRLA 5HBHA 4EJNA 5IQFA 2JDOA 1GJOA 4RG0A 4C35A 2Z7RA 2DYLA 3DDQA 3MPMA 4U44A 4XV9A 4DG2E 1RQQA 5JEBA 3CQUA 3ACKA 5CSPA 4FVQA 3SW7A 1YDTE 1OL1A 4BICA 4B6LA 4PDYA 4MNEB 3G9LX 5CWZA 2AYPA 2I40A 3M1SA 1TVOA 2VTNA 4PL5A 4O86A 2H6DA 2XNEA 2WEIA 2VRXA 2UZOA 3A7GA 5HVJA 2NPQA 4XP3A 4YZ9A 2PZPA 5FD2A 3F82A 4HOKA 5G1XA 3I7BA 4P2KA 3JVSA 4FV0A 4C57A 3DKGA 2UVYA 2XNMA 3FZPA 2OG8A 3GCSA 5DE2A 4I0TA 1UKIA 3TIZA 4BCFA 2XNOA 4GRBA 4YU2A 5K4JA 4D4SA 3E87A 5CU2A 2ZM1A 3SAYA 3ZRKA 5AV3A 4A4OA 3QZFA 2W1EA 2YN8A 3IW6A 4EHVA 4GKHA 1KE6A 3VQUA 4GU6A 4OTIA 2CDZA 2WD1A 1JAMA 4IXPA 3R9NA 4EL9A 1PXLA 3SV0A 4IDTA 1GY3A 4ZMEA 2B1PA 2F2UA 2F7ZE 2ONLA 2ZB1A 1F5QA 1SNXA 3QZIA 5DFPA 3ZO3A 3LQ3A 3ULIA 3HECA 3UODA 5IEXA 4QT1A 4G3GA 4RIXB 1OIQA 3UP2A 3R01A 2VTPA 3QQKA 2X7OA 3FSFA 2P2HA 4OTQA 4FV7A 3BHTA 3KCFA 3EN6A 3LFQA 4G3CA 4ZTNA 2BRGA 2C6MA 4PMSA 4ZSAA 3F2NA 5AUVA 4WNMA 3UOLA 4AZSA 1A06A 3EL7A 3VBWA 4JDKA 4CKJA 2GS6A 3BU5A 4FKTA 3DLSA 3GCVA 2CGUA 4MXCA 3REPA 5LMKC 2PZRA 2YWVA 1V0BA 2GDOA 2W7XA 3HUCA 3QQLA 2C1BA 5BNJA 3CC6A 3ZU7A 1YWNA 1JWHA 4U40A 3NSZA 3NGAA 3PVUA 1P5EA 3I7CA 3R8VA 2QODA 3R00A 5JFWA 2WPAA 2Z60A 3WIGA 4NKSA 2QO2A 2W9ZB 1SNUA 3PWDA 3FXZA 4BKZA 3KU2A 3DGKA 3LCKA 3PVGA 3ZDIA 4LI5A 4FEQA 4ZS0A 4G9CA 3TACA 1J91A 5ANEA 2QHMA 2JITA 4M3QA 2J5EA 4AU8A 1KV1A 3FZ1A 4UB7A 2IVVA 1Y6BA 5GNKA 3Q52A 4IWQA 1URWA 4FNZA 4TY1A 3TCPA 5EDRA 5DEWA 4BDGA 3G90X 2W96B 4WD5A 5EYCA 1V0OA 5AIKA 4NIFB 5L3AA 2V5QA 4L42A 3MIAA 3ATTA 3QA0A 3DJ5A 3NRMA 3DXNA 3V5PA 5HESA 3RAIA 4ACHA 4FKUA 3TNIA 3UMWA 4K33A 2XA4A 1GZ8A 2SRCA 2ETMA 1H25A 4W4WA 3JXWA 3E5AA 1M2PA 3AT3A 2XNGA 3HUBA 1J1CA 4IDVA 3SKCA 3W2CA 1K9AA 3NIZA 2W1GA 4JS8A 3W2OA 3RP9A 4D2SA 3DAEA 3PP0A 3G9NA 3TTIA 1OIYA 4AWIA 4ZZMA 3SXSA 3ZO4A 2YM7A 5AAGA 4LG4A 4U5JA 3DU8A 4BYIA 2WELA 4YBJA 4DTBA 1YHWA 3MFSA 4UWBA 1UNGA 3WZDA 3BHHA 4YTHA 5AV2A 2IZRA 3KN6A 3VS6A 4IVAA 3LIJA 4YZCA 3OF0A 4FSQA 4IAKA 3QKLA 2WTKC 4UYNA 3VUIA 4M15A 4YHJA 5EQPA 5FTGA 4A9TA 2ZV2A 5F94A 2I1MA 5EG3A 3UP7A 4B0GA 2X9EA 3KXMA 2CLXA 3THBA 5GJGA 1YXUA 2IW8A 3WF9A 4E6CA 4FSNA 4HVSA 4BVUA 2YABA 3BV3A 4WO5A 3O2MA 3Q3BA 4RJ6A 2HOGA 4DFZE 4BCNA 5BYLA 2P4IA 3QTWA 4JG7A 5D7VA 1JSUA 5CTPA 3E3PA 4FTOA 5E7RA 3VW6A 4C36A 4KSPA 4AW5A 1IASA 4D2WA 2E2BA 3NUYA 3QA8A 4Y5HA 4FSUA 2BVAA 2FA2A 5AEPA 3FKNA 4UZHA 1FVRA 4RA4A 4JNWA 3D7ZA 3SW4A 3BWFA 3C13A 3SG9A 4LL5A 3LJ2A 4YJPA 4BGHA 1Y91A 1OB3A 2R0IA 3FHRA 3MTFA 4O7LA 2OBJA 3GC9A 3W55A 3F7ZA 4FTNA 4X6RA 2BKKA 2C5XA 5KO1A 1U54B 5HCXA 5L8KA 3F5XA 4UZDA 3BHVA 4AZWA 4KRCA 1CSNA 5BVDA 1YDRE 2KTYA 3ZS5A 3U9CA 4IW0A 3CD8A 3PSDA 4BY9E 3F3ZA 3QU0A 1OL5A 2ZOQA 4IC7A 4TYHA 4O7WA 2ACXA 3BEAA 4QMLA 1UU7A 3DNDA 2XK4A 3RPOA 5HI2A 5DPVA 4AE9A 5CEKA 2OZAA 5L2QA 2YJRA 1YXXA 4IM0A 3L9PA 2OZOA 2HZNA 3EH9A 3OXTA 1PXPA 2G9XA 1CKJA 2IO6A 1DM2A 3G33A 3LFSA 3UVRA 4PDPA 2WEVA 3KULB 1UU3A 3ORLA 3IS5A 3HV3A 4QQJA 4UALA 2WTIA 2F49A 2GHGA 3CTQA 4BCKA 3TUBA 5JQ8A 1XBCA 2P3GX 5ANGA 2O2UA 2BILB 2GNGA 4PTGA 5JRQA 3UPZA 4FEXA 4HCVA 5M08A 2O64A 2VNYA 3MTLA 4HZSA 5E8TA 2I6LA 4F9AA 3F5GA 5DT4A 4C58A 5K5NA 4FOBA 1A48A 4QMYA 2J7TA 3QCQA 4DITA 5E4HA 2VO7A 4FZ6A 5L6PA 4YGAA 2CCIA 4RQKA 1BX6A 4J99A 3Q4ZA 2WOUA 5IQBA 2XNNA 2ZDTA 3W10A 4FMQA 4UBAA 4ZMFA 5GINE 3RPYA 5ETIA 3GT8A 3EKKA 5M53A 4TNDA 3C0IA 2BTRA 3AMBA 3H9RA 4FC0A 2X7GA 1JPAA 1MRYA 2EUFB 4G3DA 2LAVA 4CFVA 1OKZA 3TDVA 4JL9A 2JDTA 2OH4A 4YC3A 5JZNA 3LFAA 2XJ1A 2VV9A 4UMTA 3MI9A 4C59A 1JVPP 3CXWA 3EN9A 3NUXA 4CCUA 2ITVA 1OPKA 3QCXA 4UMQA 2PMIA 4OAVB 1KE7A 3I1AA 3VUTA 4E1ZA 3AGLA 4ANLA 4E93A 5K9IA 1CTPE 4YLJA 3I6WA 5FXQA 3DXQA 2QOIA 4CRSA 3FKOA 5HE3A 3R8LA 3L9LA 3LVPA 4RWKA 1YDSE 3KREA 2VO0A 4RC2A 4IWPA 3RKBA 3Q4TA 4QQCA 2E9UA 2CSNA 2IVUA 4RVLA 4ALVA 4HW7A 3OMVA 4D5HA 3BGZA 3PA4A 2BDWA 3OP5A 5FUTA 4Z9LA 4L01A 3NW5A 4JT3A 2QOQA 2XK7A 3MSSA 4CFUA 2BHEA 3HV6A 4YZNA 3WIKA 1SVEA 4APCA 4L44A 3EJ1A 5I4NA 3ZM9A 3IDCA 5C03A 3NYOA 2CGXA 3P86A 1M7NA 1XH9A 3DPKA 2YJSA 5E92A 3NVMB 4ANOA 4F09A 4FA2A 4D2VA 3COIA 3KF7A 5LCJA 3MH1A 4TRLA 3R1NA 4KKEA 3IW7A 3DT1A 3ORIA 3DOGA 2X2LA 3DBQA 4FKSA 4L3LA 5DWRA 1UWHA 3FBVA 5FDXA 4KA3A 4TPTA 3R21A 4EH4A 5DNRA 1W82A 4RIWB 4XV1A 3V5LA 2OJFE 4F64A 2JKMA 4TYJA 5CNOA 1IR3A 3BQCA 3H9FA 4JIAA 2QO9A 4TZRA 1Q4LA 3SXRA 5KKRB 4IJ9A 5CXHA 5ANDA 5AWMA 1O6YA 4KKGA 3RNYA 1UKHA 3HA6A 1MRVA 3L8SA 3MFUA 2E9PA 4FSZA 4PWNA 4BHNA 4TL0A 3CR0A 1A9UA 5DR9A 4EKLA 3KRLA 3DJ7A 4X3FB 1GIIA 5H2UA 4BDEA 5JK3A 3TJCA 2YIXA 3R1YA 4QOXA 4CT2A 3NVKI 5M4IA 3E8DA 4FV4A 2PPQA 4JRNA 4ERKA 5AUWA 2QR8A 2X9FA 4D1ZA 3B8RA 4ANMA 4D5KA 4X2NA 4DFNA 3TV6A 4YJVA 4YJOA 1LEWA 3A4OX 4KIKA 4A06A 3KFAA 4D0XA 5DI1A 4JDHA 5HO7A 5EM7A 3QGYA 5BVEA 2XCKA 1YHSA 3UZPA 2NP8A 3KRXA 2VUWA 4XP2A 1W98A 3LJ0A 3O50A 4J52A 4M12A 4MK0A 4UEUA 4BTFA 4QP6A 2C5VA 4RFMA 1OVEA 3OXIA 3UTOA 1JSVA 5L8LA 4EH6A 3QTZA 3P5KA 2EB2A 2C1AA 5A4CA 5DIAA 5LWNA 3GFEA 3GUBA 4RIXA 4XRJA 2YCSA 4G5PA 1QL6A 2UV2A 2XUUA 3W2RA 4D1SA 4K6ZA 5J95A 5E1EA 2JD5A 2CMWA 2PK9A 4ANSA 1V0PA 4GFOA 5CF5A 2PTKA 2B9HA 3DK3A 4U3ZA 4XG4A 1MRUA 3FI4A 3OWJA 4E6QA 2WXVA 3TN8A 4EK8A 3CLYA 5IH5A 2VTQA 5HCZA 1FMKA 3PXQA 5AP6A 2NRYA 4U6RA 5H3QA 3CIKA 5HLNA 3KMMA 5EKOA 4ASXA 2J50A 2WMTA 2F57A 3GVUA 1OL6A 2Y9QA 3LFNA 1XH7A 3OUKA 4IAFA 3SX9A 4BCHA 2VZ6A 4ZTLA 2QLUA 2O3PA 3DDPA 1XJDA 3VS2A 4X7QA 3FQHA 2C68A 1J7UA 4FKPA 3TJDA 4EHZA 3TDWA 4EH5A 3CGFA 4J98A 1FVVA 4DYMA 4C62A 3BYSA 3SRVA 2FGIA 4FI1A 5JSMA 2UW9A 4PL4A 4JQ8A 4BBMA 3FJQE 4UXLA 4FTQA 4O0SA 3R8UA 3RBWA 3VBVA 4ZJJA 5L2IA 4ACMA 4I5HA 2RKUA 4NIFA 3VUDA 3KC3A 4XS2A 4NCTA 2DUVA 1PXJA 5F4NA 4AACA 3DLZA 3PWYA 1Z57A 3GU6A 1PKDA 3QUPA 5D11A 4H1JA 5KMIA 2XIXA 4GIIA 1SVGA 3JS2A 1YI4A 3ZBXA 2W1CA 5DMZA 4O0XA 4RC3A 4BI2A 4D28A 4HVIA 2G01A 5CAQA 5E8ZA 3MIYA 2R64A 4QP9A 3QLGA 5IKWA 1X8BA 3KK9A 3R8ZA 4MD8E 2QC6A 4GCJA 3R22A 4MF0A 2AC5A 4LFIA 4R78A 1YI3A 2UZTA 4XV3A 2WU6A 3C51A 4X6QC 2IZUA 4O0WA 5AM6A 1OZ1A 5HTBA 4ID7A 3AGMA 4GL9A 4O0RA 2UZNA 5ACKA 1Q99A 3DK7A 2QOCA 4OTHA 4C0TA 3MJ2A 3AC3A 2CJMA 3C4XA 4EOPA 3RPSA 3GU8A 3OBJA 4EWQA 4OT6A 2PVJA 3BQRA 4DEAA 4RLKA 4JDIA 2PU8A 4ZS4A 4C4GA 1ZXEA 3AC5A 3CJGA 2WIPA 4J95A 3QAME 4DEHA 5CVFA 4EJ7A 2PMLX 4LMUA 3HEGA 4RJ3A 4RVMA 5CY3A 3WF8A 3ZTXA 3HX4A 4ACGA 4EWHA 1ZLTA 4DCEA 4ERWA 2PUIA 1P2AA 2GTMA 5AR7A 3S4QA 1OPJA 5KMKA 3PRIA 1Q24A 3GGFA 5EYKA 2YIQA 5KZ0A 5LQFA 4UYAA 3VHKA 4D4RA 2ITXA 5HIBA 3CTHA 3AC1A 4S33A 4XRLA 4CEGA 5I9YA 4BWPA 4GIHA 4I6FA 2H8HA 3LXKA 2OXXA 1BKXA 4KKHA 2VTHA 4O6LA 3UC3A 1HCLA 2VD5A 4CSVA 4TN6A 4TYEA 3V04A 2UZEA 2Z7SA 1OUKA 2Z7LA 4O0VA 4R1YA 4RVTA 3T8OA 4ZY5A 4DT9A 5CT0A 5D9HA 3DKFA 1BI8A 4DG3E 4KS7A 1FPUA 3FLSA 2W4KA 3P0MA 3UIUA 4KB8A 5CI7A 4FIJA 2VAGA 5IDPA 2XKEA 2WNTA 3S00A 2W17A 3QBNA 2R9SA 2GS7A 3GP0A 4GK3A 3A61A 3D5VA 1PJKA 5C8MA 4AZVA 4DFYA 1KV2A 4XG8A 2GFCA 4QTBA 2PVHA 3B2TA 3DBDA 4PV0A 4XYFA 5AP1A 4TNBA 1PXIA 2Z2WA 3V8SA 3Q96A 3R7OA 5C8KA 4BDDA 2I7QA 4CVAA 3OCBA 2WMXA 3SQQA 3NW6A 4DAWA 3PJ1A 1KOBA 4YC6A 4AF3A 2CNVA 4RJ4A 1U59A 2JGZA 2VWZA 2XH5A 3GQLA 2X6DA 4U43A 3ZO1A 5EYMA 3FXWA 4Y73A 1YXSA 3OTVA 2VU3A 4KUJA 4FV5A 2GNJA 3IK3A 2WMRA 1OI9A 3W2QA 4AOJA 3PXZA 4H39A 2QOLA 4AZEA 3R9RA 3DFAA 3PIZA 1XH8A 4BB4A 1P14A 3HMPA 2OFUA 5D12A 4C61A 4RX5A 4JR3A 4GH2A 4E26A 3WZUA 5ITAA 4ZY4A 5FXRA 5FEQA 3H30A 4N70A 5KHXA 4YNOA 1HOWA 3Q5IA 1YWRA 4FV9A 3RWPA 4F7SA 5T3QA 2PY3A 3KL8A 4U41A 4EONA 3EWHA 4AE6A 2DQ7X 1OL7A 3RK9A 4XBUA 4C37A 1CKPA 2BZJA 3P7AA 4NW5A 4FKQA 2HZ4A 4ZIMA 2B7AA 2A0CX 2GNHA 4ACDA 3WF5A 2IVSA 2UZLA 4NTTA 5E1SA 4CQEA 4F1OA 4QTCA 4B4LA 1IAHA 1FINA 1PXNA 2VTIA 2WTKB 3LOKA 1WBTA 4DA5A 3OFMA 2OU7A 4FKIA 5AX9A 1TQPA 5H8GA 2WMSA 4ARKA 2R7IA 3VJOA 4FTMA 2PUNA 3I0OA 3FDNA 4KS8A 2W4JA 4CMUA 4CYJA 4DTAA 4AOIA 1VZOA 3Q5ZA 4I4FA 2FB8A 3H0YA 4TWNA 3VQHA 2X8IA 5C9CA 5CX9A 4RJ7A 4YSMA 5EM8A 3ZLYA 3QTUA 5HG7A 4M0YA 4L7SA 4EK3A 3FC2A 3JPVA 3V5TA 1QMZA 4AAAA 5DH3A 4HVDA 2CKOA 1NW1A 4H3QA 4ANNA 3FMEA 4YURA 4BKJA 5HD4A 3D83A 3KXHA 2YCQA 4I24A 4LGGA 5L2WA 3I5ZA 3ORPA 5AUXA 2DWBA 3FZRA 5EDQA 3V6RA 3OC1A 3WZJA 4ZY6A 2FVDA 3AC8A 4JAIA 5DRBA 2J0MB 3VF9A 2BMCA 4O1OA 2VTAA 3PRFA 4E5AX 3QD0A 3DV3A 3GQIA 4IAIA 3UC4A 3W2SA 4YTCA 4JX7A 4ZAUA 5HBJA 5KUPA 4KIOA 2C3KA 2F7EE 5CEQA 4DBNA 4L9IA 3DKCA 3UMXA 5L6WL 4RZVA 3VS0A 3K5VA 3DJ6A 3EOCA 3NNWA 4BBFA 5I9UA 3D5UA 2UW8A 3R2YA 4Y85A 2EB3A 2BROA 3L8VA 4BCPA 4F6WA 3NDMA 4J97A 2PVNA 4EZ7A 4ITHA 3JVRA 2CNQA 3DQXA 3IKAA 3UOHA 4ZK5A 4X3FA 2P0CA 3A4PA 3U55A 1W8CA 3MJ1A 2ONLC 4HPTE 4G17A 2W1ZA 2O65A 1H26A 1U5QA 3EYGA 4X2JA 2WQNA 2UZWE 3BGQA 5JT2A 3U8WA 2F4JA 3O23A 2QU6A 4YJNA 1AD5A 1DI8A 5BUEA 3MB7A 4DH7A 3NAYA 4NK9A 4FBXA 4DEGA 2XK3A 4U9AA 1OKWA 2CCHA 1E1XA 3C4FA 5CQWA 3LMIA 3PZEA 4ZJIA 4A4XA 3NNVA 3TL8A 4RIYB 5K0KA 3DTCA 2EU9A 4AGDA 4Z3VA 1U46A 3ORXA 4UWYA 2BFYA 2YERA 3ORZA 5EW3A 1CMKE 4PMMA 3TKIA 5IA1A 4IWDA 2GSFA 3Q2MA 3OY1A 4ENXA 3FE3A 5JGAA 1J7IA 5CYIA 2RFSA
chains in the Genus database with same CATH superfamily
3R9OA 4E20A 4FZ7A 5A6NA 1IAJA 3UDZA 3KF4A 2VN9A 5DA3A 4ZTRA 3W0SA 3RPVA 4R3CA 3QXOA 4R1VA 5KZIA 5BMSA 1M7QA 3JY9A 4NUSA 5IQGA 3F5PA 3W0QA 1XH4A 4AN9A 3PG1A 2Y4PA 4GT5A 4YJTA 3SD0A 1JKSA 5BPYA 4AW1A 4QMVA 1GOLA 3Q9ZA 2QOFA 5A4TA 2PMOX 3GI3A 3FZSA 3O51A 2PMNX 4HGSA 3DA6A 2R3MA 5EHLA 3UQCA 4G3EA 5M4FA 2BAKA 5AIRA 1M2RA 4XMOA 3AC4A 3R1SA 4I0RA 1ATPE 2BIYA 3FPMA 5J87A 4QMZA 3ROYA 3HDNA 3EFLA 5AX3A 4BIDA 4XG9A 3Q6UA 5GZ9A 2YDIA 5IDNA 1LP4A 3FSKA 1U5RA 3BBTB 3CKXA 3ORMA 4V01A 4EUUA 2XIKA 1WBNA 5CZHA 5EQYA 2YLEA 3AT2A 4O96A 2VWUA 4DDGA 3PDTA 2QOKA 5JGBA 1NVSA 2Y4IC 2YACA 3C0HA 3E3BX 3RZFA 2R3LA 1YOLA 2QU5A 4XG3A 1ZZ2A 2OXYA 1JSTA 4DGNA 4ZLYA 5CEPA 4OGRA 5I9VA 1T46A 4RLLA 1H07A 4I4EA 3VF8A 3UG1A 4BR3A 2PE0A 2I0VA 4EOJA 4K2RA 4BCGA 1Q97A 3PTGA 3QRUA 5TOZA 1GZNA 2YWPA 4R3PA 4EK6A 3QGWA 5L6OA 4EYJA 3PY0A 4FNXA 4FT9A 4I6BA 4RQVA 4BGQA 5AADA 3VHEA 5IQDA 2B52A 2GFSA 3GBZA 4RWIA 3U4UA 1R0EA 4AX8A 3W0OA 1YOJA 2OW3A 3VUHA 3BELA 3WE8A 3W2PA 4IX6A 3OUNB 3NYVA 3NUNA 4FODA 4M67A 4WRSA 3RINA 2BRBA 2RIOA 4LRJA 2Y6OA 4O0UA 4I21A 3UYSA 4MKCA 2Z8CA 5FEEA 2OIQA 2XRWA 3MB6A 4RBLA 5DOSA 3VS4A 5EM5A 4GW8A 4FVRA 4O1PA 1QPEA 5DLSA 4EK5A 5G6VA 1JKLA 3BPRA 4DN5A 4AW0A 3DY7A 4FTCA 3ZDUA 2QKRA 4CT1A 4IB5A 2W5AA 4AGUA 4NWMA 4FKOA 1FGIA 3C9WA 4IC8A 4OTFA 5CASA 3W8LA 4AG8A 4ZLZA 1OKYA 3HDMA 5T68A 2YA9A 3LMGA 3ZSIA 2BRHA 3RHKA 1GZKA 5IQAA 1YQJA 3MPTA 4FJVA 3W16A 2A4LA 3AD4A 4PNKA 3N51A 4BTMA 5DG5A 2B55A 4Z55A 3LCDA 4DHJA 4YLLA 3AMYA 3RHXA 3VUKA 4R7IA 2W4OA 1TQMA 3NPCA 3E92A 2I0HA 1H1WA 3AOXA 4I23A 4Q2AA 1NVRA 2R0UA 5H8BA 2C5OA 4A9UA 3VBXA 4DT8A 2CN5A 3CD3A 2ITWA 3TIYA 5HE0A 4MH7A 3MESA 3F3VA 4I0SA 4HCUA 3HLLA 4RFYA 5AUZA 3QYZA 4OT5A 2ZMDA 4O4DA 3C1XA 1XQZA 2VO6A 3HKOA 4QNYA 3AG9A 2OXDA 3EKNA 1UU9A 3GCQA 3OCSA 4IZAA 4KINA 4BDIA 5BQ0A 1E1VA 3PLSA 4IANA 4I3ZA 3LM5A 2REIA 3GU4A 2OH0E 4IM2A 3EYHA 3FV8A 3E8NA 5HLPA 4TKSA 1WZYA 4DHIB 5DVRA 1VJYA 2FSTX 5DBXA 3SDJA 3VRZA 1Z9XA 2HY81 4E5BA 3I6UA 3QHWA 4W8DA 1DS5A 4Y83A 4YHTA 5TO8A 5IQCA 5EQEA 5HTCA 1SVHA 4USDA 4MXOA 5HU3A 2QO7A 4PPAA 2WOTA 4YO4A 5CZIA 1FVTA 3FLNC 3FMKA 1KE5A 5CEMA 3RZBA 3TWJA 2WTCA 4BRXA 2WFYA 4QMOA 3K5UA 4ASDA 3ULZA 2WU7A 3OXZA 4RPVA 3NAXA 3B2WA 1OGYA 4QYGA 5DRDA 2WO6A 4F65A 2R3RA 3DBFA 3EQPA 4O81A 3BBWA 3VW8A 1WBVA 5CSVA 3DXPA 3DQWA 4TYIA 4H05A 4XG7A 2ZMCA 3ZZEA 3ORNA 5IA2A 4EQMA 1PHKA 2IN6A 4FYNA 5HNIX 4DTKA 4KD1A 4NM7A 2IW9A 4FKGA 4IHPA 5E8SA 3FWQA 3PJ3A 5TF9A 4F7NA 1PMNA 4TW9A 3G0EA 1OBDA 4UY9A 4O2ZA 3O7LB 1XHAA 2J2IB 2UW3A 5EH0A 3RCDA 5KBQA 3F9NA 4JBQA 3ZEPA 4WHZA 4YUQA 1Q3DA 3PYYA 3UJGA 4F6UA 3O8TA 1YHVA 3T9TA 4AN3A 5EKNA 2JDRA 1TKIA 1B6CB 2GTNA 3A99A 4EOOA 3BYVA 3D9VA 4DGGA 4EOKA 5IEVA 4O4EA 3VN9A 4C38A 5CF8A 1GNGA 4RMZA 5K3YA 3NFFB 4I5CA 3PFYA 4U45A 4DF3A 1BYGA 4FR4A 4G34A 3PY3A 4YP8A 3C4CA 3RNIA 3ETAA 4FEWA 2C5YA 4FGRA 5AUTA 4J7BA 2DS1A 2E9VA 2VWIA 4S2ZA 4FKLA 2I0EA 3NS9A 3CCNA 3NUUA 2VNWA 5E8VA 5FM2A 3ZSGA 4C4EA 3CE3A 5AV4A 4HGTA 3A62A 5AMNA 4B7TA 5CENA 2QLQA 4UN0C 3AKLA 3NEWA 1OBGA 1PXKA 3HAMA 1PW2A 1VR2A 2Y0AA 1WFCA 3HRFA 3UNJA 4OUCA 3WYYA 3HV4A 4K8AA 4FTTA 5GJDA 3FI2A 4AS0A 2HYYA 3ANRA 4JDJA 3DZQA 3ORTA 1Y6AA 3M42A 3TT0A 4RX7A 4E4XA 5T6KA 3U6HA 3V5WA 4PPCA 4FV1A 1IA8A 3SOAA 4GK2A 2E9OA 3FC1X 4GS6A 4MCVA 4O4BB 3I81A 3OEFX 2IZSA 2XRUA 4E6AA 3TNHA 4O7TA 5CAVA 1Q8WA 4RWJA 4FSRA 1ZMVA 4TT7A 3FMHA 4DLJA 4CFXA 2F9GA 4ZTMA 1G8AA 5HU9A 4FEUA 3BYOA 4R6VA 5AM7A 2BZHB 3UIMA 5C4KA 4RRVA 4QNAA 4OTWA 4Y5QA 2HWOA 5EW8A 4UV0A 4WKQA 4ALUA 5BUJA 3LQ5A 5C26A 4FZAB 2QVSE 4FZDB 4O7RA 3UG2A 4QP1A 2ITQA 3TNQB 4F78A 2WQOA 5IA5A 3WE4A 1KUTA 3E62A 4DG0E 3MA3A 4M7IA 5IQHA 3UIBA 3PXFA 4FK6A 4D9TA 5CAPA 5I9WA 4CRLA 2H96A 2OK1A 5ANJA 4V0GB 1MUOA 2C4GA 4WNPA 3RTPA 2A27A 4DGMA 3ML1A 3LE6A 3IW8A 5EI2A 3KA0A 2Z7QA 4O83A 2C6EA 3HL7A 5LOHA 3PPZA 5EOBA 2Y6MA 3ZLSA 3TMOA 2YEXA 4LOPA 1ST4A 4C3PA 5J7HA 4MEDA 3TEIA 4ANBA 3NNUA 4ZZOA 4F6SA 3P23A 2XK8A 2WQEA 1CM8A 4F7LA 2GQGA 5KMNA 1XWSA 4FIIA 3W32A 4E3CA 2QG5A 4APPA 2UW6A 5BMMA 3VS7A 2ZM4A 5J7BA 1BMKA 1ZYJA 4ITJA 2C47A 3FLZA 1PMVA 1WBPA 4PP9A 5A4EA 3RMFA 2XS0A 3QTQA 5CS6A 1KSWA 5AP3A 1PXMA 4MNEA 3V3VA 2W5BA 5J5TA 4GJ2A 3EN7A 3L9NA 4PMTA 1YW2A 5L2TA 5E9EA 2UZUE 2UW5A 3TV7A 3WF6A 4AT5A 3VS5A 5FDPA 2FO0A 1WCCA 2XVDA 3Q32A 5DT3A 2BUJA 3FLQA 1QPCA 4PY1A 2QURA 4MXYA 5ETFA 2HIWA 5EFQA 3JYAA 3L1SA 4O0YA 2Y8OA 3F88A 2V55A 3OCGA 3RPRA 4L3PA 4NJ3A 3NW7A 2YM5A 3EHAA 3ZONA 2GS2A 3R8MA 3ROCA 3DZOA 3NR9A 3QXPA 4XHKB 4HZRA 3TUCA 4RWLA 2GHLA 2JAMA 2B9FA 1ST0A 4GVJA 3SG8A 2YLFA 3P4KA 5DR2A 4WSYA 5E91A 2ZAZA 4GT4A 3E8EA 1OIRA 3PXRA 3KVWA 2JKQA 4L6QA 4BCOA 4EOQA 1REKA 3II5A 3LJ1A 3QHRA 5CVHA 3PSCA 4DBXA 3P78A 5DEYA 4DEIA 1DI9A 4JG8A 4CTCA 2R3OA 1BL7A 1H4LA 3C4WA 2VTSA 1LUFA 2X4ZA 1Q5KA 4GEOA 1H1SA 4K11A 3QKKA 4UMPA 5I3RA 1B38A 4FV8A 4C34A 3LKMA 3HRCA 4AXCA 4D0WA 3UNZA 1QPDA 3CPCA 3BRBA 3KXNA 3RJCA 3ZEWA 3ZFMA 4NCTC 1R39A 4WNKA 1MP8A 2GNLA 4GVAA 4AQCA 4N6ZA 4I6LA 3E7VA 2OKRA 2GU8A 2XKDA 4D9UA 5JH6A 3DBCA 3LXPA 4WG3A 1V1KA 2X0OA 1E9HA 2C6OA 4WBBB 5CXZA 3A7JA 2HCKA 3SA0A 5LVMA 5LVPA 3VO3A 3SHEA 2J0JA 1UA2A 4ZJVA 2BAQA 4HCTA 2QD9A 4D55A 5C27A 4OTRA 2PZYA 2AUHA 3OY3A 4QTDA 4FEVA 4HNIA 4AUAA 3IPHA 3S95A 5IPJA 2C3LA 3KRJA 3LM0A 5M06A 3CTJA 3SC1A 4FIHA 4XUFA 4ZTHA 4LQMA 3F3UA 4MXZA 4F9CA 1G8SA 3FEGA 4BJJA 5HIEA 4DCAA 3G0FA 2JKKA 5HG8A 2JIVA 4QMTA 4FIEA 3FMNA 5EOLA 2HZIA 2ETRA 2QQ7A 3CS9A 3R7IA 1H24A 3KCKA 5FEDA 5CNNA 1SM2A 3R04A 5LCKA 4A4LA 2GMXA 3VBYA 5FP5A 4AGCA 2B54A 5K5XA 3DKOA 4G2FA 4OW8A 3CQWA 3I4BA 4MF1A 3Q9WA 3VIDA 4ALWA 4X0MA 1L3RE 5KMMA 2JFMA 4YMJA 3SLSA 3ZMMA 3E63A 3RALA 3MWUA 2J0IA 1SZMA 4HPUE 2EXMA 4FT7A 4ACCA 2HY0A 2YIWA 5FBOA 4EH9A 1XBAA 3ZC5A 2R3HA 2HW6A 4LOOA 4DINA 4O7NA 5LMAA 3RWQA 4XG2A 2XBAA 2PHKA 4WG4A 4DEEA 5D41A 4CMTA 5HNGA 4O84A 4MD9E 3ZBFA 3I5NA 3EQGA 4M66A 2YHVA 4AZFA 4CTBA 4ZTSA 4AA5A 4F0FA 5JQ5A 3QD2B 1QPJA 4KABA 4HVHA 4BDFA 3TYKA 2UUEA 4XH6A 4O7ZA 4QP3A 1QCFA 2R3IA 5B0XA 2WKMA 4WA9A 5AR3A 4HYSA 1O9UA 1B39A 3RI1A 3A2CA 1W83A 2VTJA 3QQFA 4LL0A 4BZDA 4MBIA 1Q8YA 4HYIA 1BL6A 3WARA 4OBOA 2ERKA 4EYMA 4O0TA 2V22A 5EDPA 3G6HA 2VWBA 3PA3A 5CF4A 2QR7A 3GCPA 3NZ0A 3V01A 2UW7A 5BVWA 3AKKA 3UIXA 3QUDA 5E8YA 1CDKA 1ZY4A 4O4FA 4EOLA 2AQXA 2CKEA 3R02A 4FL3A 5A14A 4U0IA 3BLAA 1R78A 4XCUA 4EOIA 3TKHA 3C5UA 3WF7A 4IX3A 2YM6A 4FNYA 4BDHA 4QP8A 4MVFA 3VULA 4A9SA 2OSCA 5JFXA 2ZB0A 4LOQA 4AFEA 4H1MA 4F99A 5BVNA 2W9FB 3QLFA 2P55A 3VRYA 4GFGA 4RFZA 4BDBA 4Z7HA 1ZMWA 4K77A 2NYAA 5AR8A 1U54A 3ZSHA 5HO6A 3R1QA 1XO2B 4I20A 3ZZWA 5IUHA 5J1WA 3PLAE 3RVGA 3PP1A 4NTSA 3IDBA 3O7LD 4BIBA 5GZAA 2X6EA 5F95A 3CEKA 5HQ0A 3KK8A 3HMMA 2X4FA 3LLTA 5HE1A 5FBNC 4FIFA 2CGVA 4D4YA 2WIHA 4QO9A 3CKWA 4XOZA 3R7YA 3BYMA 1P4OA 4ZSLA 3HYHA 3R30A 3IW4A 3QX2A 4PUZA 1J3HA 4IWOA 1H28A 2FH9A 5CU3A 3V5JA 4K18A 4I93A 3KULA 3FMJA 1JKKA 2O63A 3MW1A 4TWCA 5AV1A 5FP6A 3OWLA 5A6OA 2VTRA 3ITZA 5C8NA 4PX6A 2X0QA 3P1AA 4HYUA 3BHUA 2H9VA 3GXLA 1NVQA 3S3IA 5D10A 1ZRZA 3Q04A 4PP7A 3M2WA 4LV8A 1XKKA 3C0GA 3VNTA 4USFA 4LYNA 4J8MA 3OT8A 3JUHA 5BYZA 2W1FA 4R77A 3F5UA 3R71A 1OUYA 1H08A 2WMBA 3LAUA 4BF2A 3CJFA 4GSBA 3ALNA 4CMOA 2VTTA 2XB7A 5E8WA 4UWCA 5TKDA 3EMGA 3WOWA 4YTIA 4FG8A 5I5ZA 4GG5A 5C01A 5HZNA 3Q4CA 4FSWA 4OAUC 4F0IA 2C3IB 4IVBA 4EI4A 5DYJA 3POOA 4IACA 3AXWA 4U7ZA 3D14A 4M13A 4L45A 5AR5A 5B7VA 2PVMA 3HV5A 3QZGA 5CF6A 5FWKK 4QMXA 4G3FA 3Q9XA 3BYUA 2ITOA 4MBLA 2EXCX 4GUBA 5ANIA 4GU9A 3SVVA 4G6OA 2J90A 2UZVA 3V8WA 3LCOA 1VEBA 3D7TB 5DGZA 4CFWA 2XANA 5FXSA 3BKBA 3UPXA 3KN5A 1UVRA 4H3BA 1SMHA 2RGPA 1IRKA 4TYHB 3IECA 3OCTA 4MNFA 2C6KA 5B2LA 2Z02A 2OGVA 2NRUA 3GB2A 3FLWA 4FSMA 5J1VA 1MQBA 3HA8A 3LMHA 3ZOSA 2OZAB 4QYFA 2WMAA 4F9YA 4V05A 4DFBA 4M0ZA 4NJDA 2C6TA 5HGIA 4X3FC 4ENYA 3UNKA 2Q83A 2WMVA 4OR5A 5E8XA 5EK7A 3W8QA 4TXCA 4YJRA 3O0GA 4MXXA 2F7XE 5HOAA 1PXOA 5CAOA 5HTIA 4PL3A 5ANKA 1ZYCA 4UMRA 4AA4A 1UNHA 5LMBA 1TQIA 3NCGA 4FT0A 1JNKA 3MH0A 5I0BA 1M17A 5EI6A 4RX9A 1WMKA 5ETAA 4GYIA 5HVYA 1WVWA 3QWJA 4LMNA 1Z5MA 4F08A 5JMSA 3D4QA 3MVHA 5IMEA 1DAYA 2LGCA 2P33A 3AD6A 5D7AA 3EN4A 5IEYA 1RE8A 4C4FA 3QF9A 5LVLA 2X7FA 4EBVA 3U6IA 3N4UA 4YJSA 4EH2A 3PIYA 4FTKA 5TE0A 4BDJA 4QPMA 1VLRA 3O96A 3F69A 4GV1A 1FBNA 2WAJA 2HAKA 2XKCA 4M68A 5K4IA 3BHYA 2ZM3A 3CY3A 3D5WA 2RL5A 2VWYA 1ZARA 3ACJA 3LFDA 4QYYA 5ETCA 5J9ZA 4AAYA 4D2PA 2R7BA 3OBGA 3IOKA 3WZKA 4RIWA 3COKA 4IM3A 2G1TA 4O27B 4DH8A 2YCRA 4FKJA 4BTJA 4BTKA 3FQSA 4H58A 4X2FA 4F0GA 4ZOGA 2OICA 1PF8A 4BZNA 5IUGA 4HGLA 4NYEA 3KQ7A 3PY1A 2J5FA 4H3PA 4OBQA 2JKOA 4YHFA 3Q6WA 3PJCA 3TZ8A 2UVZA 4BI1A 2Q0BA 2JFLA 3EFJA 2QG7A 3HV7A 3PUFC 4YZMA 2OO8X 2XF0A 1KOAA 1W84A 2RG6A 3RAWA 4LGHA 4P5ZA 5FQDC 4JRVA 5HG5A 3TKUA 1H00A 4HYHA 4BC6A 4E4LA 4FIGA 2BFXA 3IO7A 1M2QA 1WAKA 4F9BA 4XG6A 1Y8GA 4FK3A 3MY1A 3UOKA 5IH6A 4CG8A 3UZRA 3PA5A 5M57A 5B2KA 2XALA 5M56A 2C69A 2W06A 3LHJA 4C3RA 4F1TA 3A7FA 3KXZA 1U4DA 3CQEA 5HEZA 3VS3A 4OBPA 5BX0A 4CLJA 2O0UA 5EYDA 5M51A 4PTEA 2YZAA 3IQ7A 4L00A 4NM5A 5HHWA 3EQFA 1PMUA 3FY0A 1ZY5A 1PMEA 2X81A 4DEDA 4NEUA 2OLCA 2IJMA 2E9NA 2WQMA 1I44A 3LCTA 4FNWA 2XIRA 3F66A 4FV6A 4MAOA 4BDCA 5HX6A 3LLAA 4L3JA 2R3PA 4I5MA 3NYNA 1R1WA 2HWPA 2ITZA 3UQGA 3EQRA 3ERKA 3VS1A 3GU7A 2ZV9A 1H0VA 3QQGA 3DNEA 4Z16A 4C2VA 3FZTA 3COHA 2EXEA 4CFFA 4MYGA 1YI6A 4BYJA 5M44A 1S9IA 1Y57A 2XNBA 3OW4A 2A1AB 4C4JA 1H8FA 3PPJA 5BVKA 4JR7A 5KMJA 1STCE 4HGEA 2VWVA 3MDYA 4J71A 4EHEA 1Q61A 2ITNA 3F61A 4BZOA 3AD5A 4CQGA 4P90A 1ZZLA 2YITA 3OWKA 3PJ8A 2QOBA 1DAWA 2VGPA 4U79A 1XH5A 3DB6A 4QTAA 3RM7A 3Q60A 3RM6A 2BTSA 1O6KA 1M14A 5HD7A 5M4CA 5J9LA 5IG1A 2CKPA 4CGAA 2H34A 4NH1A 2X39A 4P5QA 4ZXTA 3FHIA 3QD3A 4KIKB 4EOSA 3P9JA 1O6LA 5IMXA 3KRWA 5HKMA 4EQUA 4H36A 3RAKA 4IVCA 1T45A 3UZTA 2WTVA 1RDQE 4FE2A 4R8QA 4Y8DA 3TZ7A 4KIPA 4WUAA 3IW5A 3QC9A 3BL9A 4ZP5A 2W0JA 5DR6A 3HGKA 3U4WA 3BLQA 4O7VA 4CG9A 4QQTA 2F2CB 4B8MA 2A19B 4O7YA 2RSVA 4BFMA 3MFRA 3L9MA 1OIUA 4I6QA 5GIOE 1H1RA 3HP2A 1BI7A 3KXGA 2A2AA 4MX9A 4DLIA 3EFWA 3EQBA 5ACBC 4JG6A 3ZH8A 2IVTA 4FOCA 3PG3A 5L4QA 5LXMA 3BCEA 3GFWA 2GCDA 2FYSA 4I6HA 4FTAA 3TM0A 3DBEA 1Q3WA 1ZAOA 4CNHA 5IH4A 2B4SB 4WT6A 3A7IA 4U8ZA 3N4TA 5KCVA 2XYUA 4KRDA 5KHWA 3U6JA 4RX8A 3NLBA 3KVXA 3QYWA 2G2HA 3MFTA 4KBCA 3QCYA 4OTGA 4CLIA 3R0TA 4F63A 1OGUA 4RZWA 4ZZNA 5EI8A 3PVWA 3T9IA 4TWPA 1SYKA 3QQUA 3A7HA 3W18A 4JJRA 3ZHPC 4BL1A 5JFSA 2WTWA 3E93A 4C8BA 5IA4A 4DHFA 1YXVA 5AP0A 2JBPA 5E8UA 2XBJA 3Q4UA 4JQEA 4W4XA 5GZ8A 4K0YA 3QRTA 3SRVB 4M97A 2JIUA 4PPBA 3MH3A 2PE1A 4MD7E 3M11A 4EOMA 2WHBA 4N57A 3RAHA 4IADA 4P7EA 5AP2A 4E73A 5KNJA 4NL0A 4JAJA 4EC8A 4R7BA 2BRMA 3QTXA 4WUNA 4JOAA 4AXEA 2PL0A 2IPXA 2BKZA 3MY0A 4K1BA 4NU1A 3ZXZA 2VO3A 4TTHB 1FQ1B 4RA5A 5KMOA 2BALA 3GNIB 4FL2A 1VYWA 4QRCA 3EN5A 4FRFA 4BN1A 3BIZA 1LPUA 2YFXA 5IUIA 3RCJA 2YM4A 2UW0A 4HVGA 3QKMA 4CFNA 4CYIA 4Q5HA 3UO5A 5A4LA 1TZDA 1K2PA 4FTLA 5LMKA 3G15A 2YIRA 4WSQA 5FTQA 3F2AA 2JAVA 3VBQA 4IX5A 3TI1A 3MV5A 5CSXA 3EZRA 5GHVA 1BLXA 2ITPA 2FSOX 2ZV8A 3R9DA 3ZRMA 5A54A 1FGKA 2ERZE 3U51A 1J1BA 3EB0A 2QI8A 4ZSJA 3ZYAA 4ZTQA 4F1MA 2YM8A 3DAJA 2C0OA 3Q53A 1YKRA 4G9RA 2XMYA 1FOTA 3OD6X 4O91A 4XBRA 3OOMA 1YOMA 5KE0A 4E4MA 4EKKA 3NMUF 1ZWSA 2X1NA 4CKIA 1ND4A 3RK5A 4B9DA 1UU8A 4IAZA 4GMYA 1W2DA 4P4CA 5J5SA 3ZCLA 3FL5A 3MN3A 3PSBA 2C6LA 5A3XA 2XJ2A 3CSVA 3GCUA 5JFVA 4NM0A 4W4VA 3ANQA 3EIDA 4Q9ZA 4GK4A 4LRKA 4NM3A 3PJ2A 2IWIA 2VWWA 3WYXA 2XK9A 3VWAA 4L8MA 3QC4A 1HCKA 4CCBA 1ZYLA 5D1JA 4BWXA 2BRNA 4EH8A 4L68A 3HMIA 4O22A 3AC2A 3NX8A 4A07A 2YDJA 4C4IA 1AQ1A 4EEVA 3HMOA 2CN8A 3O71A 2GNIA 4F70A 4IEBA 4HNFA 5IQEA 2C30A 4AT3A 4UXQA 2W05A 3C5IA 2RFEA 1WBSA 2W99B 3IDPA 3R73A 4WRGA 5F1ZA 4K9YA 2ZJWA 4IZ7A 2A98A 3D2IA 4AGWA 1H1PA 3UBDA 3H3CA 5AP7A 3IGGA 5HBEA 4DHZA 5AP4A 4GUEA 3I0QA 1JBPE 4PNIA 4XOYA 2W1DA 4DGOA 2QCSA 2PUPA 4MBJA 1LEZA 1KE9A 5HO8A 2HW7A 4QMSA 5BYYA 3RK7A 3D7TA 3LXNA 4M14A 2YCFA 4X2GA 5CQUA 1URCA 5FTOA 3FI3A 2PSQA 4XEYA 2VTMA 5CT7A 4G16A 3UQFA 2IF8A 3ALOA 2HENA 3NUSA 5AJQA 2FSMX 3K2LA 3D5XA 4FG7A 3IGOA 4NT4A 3UO6A 4D2TA 1ZYSA 2C3JA 2HK5A 5A9UA 5AAEA 4XLVA 3KMUA 3N9XA 2UZDA 3BLHA 4CZYB 2RFDA 4AOTA 3BE2A 4U3YA 2X2MA 2Y7JA 1MQ4A 4Y95A 3ODYX 3QL8A 5DN3A 3FQEA 2G2FA 3LFFA 4N0SA 3KXXA 3ZFXA 2YAKA 3EQIA 3WZEA 4FX3A 4AXFA 3R9HA 1PY5A 1PRYA 2XARA 5LJJA 4EH3A 5C1QB 4R5SA 5LARA 4U42A 3H0ZA 4AT4A 3Q2JA 2NNWB 4OLIA 4L52A 4G1WA 3SXFA 4U80A 3DTWA 4IB3A 5BVOA 3R28A 4FTIA 3DFCB 2Q0NA 3UVPA 4KSQA 5JN2A 4UMUA 3V6SA 1JOWB 1P4FA 2YAAA 2BZIB 4XNEA 2UW4A 4KWPA 3K54A 3PVBA 2BDFA 5HX8A 2W1IA 2O5KA 4FV2A 1F3MC 2XEYA 4FUYA 5A46A 1G3NA 5TT7A 2R3NA 4C33A 5AA9A 1XMLA 3AQVA 3MBLA 5AUUA 3HAVA 5IF1A 2RFNA 3OHTA 4N4SA 2OF4A 4AW2A 4JBOA 2CLQA 2HXLA 4MWHA 5LVNA 2XYNA 4LM5A 2PVKA 3P08A 2AC3A 2C6IA 2VX0A 1ZMUA 5E90A 2B0QA 4Y72A 1JQHA 1WVYA 4G31A 4IMYA 5EM6A 3VVHA 1Q8ZA 2CPKE 3ENMA 4QQ5A 3JY0A 4PTCA 3LFEA 3WILA 3NNXA 4L7FA 4YJQA 3CGOA 3L8PA 3W0NA 4QMQA 1IEPA 1J7LA 2R2PA 3A8WA 3FMMA 4FG9A 3FMDA 4E6DA 5BVFA 3L8XA 4JBPA 3H9OA 2QNJA 4MXAA 2GHMA 4I41A 3BWJA 2OIDA 4U97A 4BCQA 4YLKA 2ETKA 2EWAA 2KULA 3EZVA 3OEZA 2JDSA 3C7QA 5I9XA 2ZV7A 4QMUA 3BI6A 2IG7A 5HIDA 4OTPA 3IONA 2GPHA 3GC7A 5I3OA 4YTFA 2WQBA 3W0PA 4NFMA 4EZ5A 3DB8A 5CU0A 2FUMA 4RIYA 4FT3A 4QMWA 3NIEA 4IFCA 1K3AA 4QMMA 1GZOA 3PZHA 4R3RA 3G51A 3QD4A 4C7TA 1W0XC 2XM8A 4RGJA 3WBLA 5JGDA 2WB8A 4YBKA 5HNBA 4AN2A 5HLWA 2J0LA 1UV5A 3E64A 3QX4A 3COMA 4QYHA 4DGLC 2VX3A 5HICA 3FXXA 3BV2A 2R3KA 1H27A 2RF9A 2P2IA 1IG1A 3QALE 3LZBA 3FLYA 3KMWA 3D94A 3MA6A 4W9WA 5LWMA 3QTRA 3GENA 3ID6C 3T3VA 4YR8A 4DFXE 2PWLA 3H10A 1ZOGA 2XZSA 3FKLA 3EL8A 3OWPA 1ZOHA 5AR4A 2VTOA 3F2RA 5HVKA 3MGYA 4I1ZA 1Q8TA 2WGJA 1W2CA 2QONA 3LFBA 3OS3A 4L67A 4LUEA 3HP5A 4JX3A 2AEGA 3MVJA 4GT3A 2J0KA 3MVMA 2CKQA 4GJ3A 2PVRA 4YJUA 4ZEGA 3O5AA 3O8PA 1Y8YA 3F7WA 2X8DA 4M69B 4FTUA 3NUAA 4S30A 4BHZA