1M2PA

Crystal structure of 1,8-di-hydroxy-4-nitro-anthraquinone/ck2 kinase complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
325
structure length
325
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II, alpha chain
publication title Inhibition of protein kinase CK2 by anthraquinone-related compounds. A structural insight
pubmed doi rcsb
source organism Zea mays
total genus 107
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1m2pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1m2pA01
4NIFA 2BKZA 4U40A 2CCIA 5M55A 5HNGA 2XKDA 5AV1A 5F95A 4AZFA 3K3JA 2UZOA 4GU6A 4CMOA 3QZFA 2XA4A 3HA8A 2EB3A 4X7QA 3RHKA 2ZM1A 4BF2A 4E7WA 2FSMX 2VTQA 4G3EA 4MD9E 4O38A 2C6DA 4GH2A 5BQ0A 3AT3A 5AP1A 4WG3A 3TV6A 2OXDA 3ZFXA 3Q4ZA 3UNJA 2X7FA 1JOWB 4EK4A 2VWYA 2W0JA 3B2WA 1S9IA 4D58A 2ZMDA 4ITIA 4JL9A 3R22A 4EZ5A 3BEAA 3DKOA 1REKA 3HKOA 2R2PA 3HX4A 3OCBA 4FK3A 4IXPA 4K0YA 5DHJA 4ACHA 4C61A 1JNKA 3HVCA 1FGKA 4F9WA 4UMUA 2HWOA 4DF3A 4EZ7A 1M52A 3MIYA 4FT5A 4AGDA 3DA6A 3Q5ZA 3U55A 1LR4A 4FTQA 1VJYA 4QP2A 3K54A 2QHMA 4M68A 4MD8E 4UZDA 3A61A 3O71A 2VN9A 5LVMA 3ID6C 1ZZ2A 2WTWA 4QMPA 2WOUA 4IZ7A 3EL7A 3D0EA 5D10A 3NEWA 4DFYA 3EN9A 1Q8YA 5FUTA 3A4OX 4IWQA 1UKHA 5DT0A 4O0YA 4JDJA 4Z7GA 3UP7A 1UVRA 3C0IA 2GDOA 2C6OA 3F88A 4MYGA 1WBNA 1Y8GA 2YITA 3PTGA 3QD3A 4I22A 3MA3A 4GRBA 4PPBA 5ETCA 5D7VA 3HMOA 1OIYA 3P79A 2I6LA 3TZ9A 3UGCA 2VO7A 1OBGA 5EHLA 4IX5A 3P9JA 3SXFA 3MY0A 1U54A 1TKIA 1YI6A 5HICA 3TXOA 3LFFA 4L43A 4L3LA 4ZTRA 2X6DA 2ZOQA 3FLZA 5AAGA 3DXPA 3E8NA 2YJSA 3EYGA 2JDSA 4V05A 4IIRA 4S33A 3PSCA 4EQCA 5D1JA 2EVAA 3G33A 2BDJA 1YVJA 4RVMA 4EKKA 4XV3A 3II5A 5K5NA 5HZNA 1ZOHA 3AOXA 4TRLA 4JG8A 3NPCA 4X6RA 5JZNA 3PVWA 4YTCA 4IWOA 2BMCA 4DG0E 5LMKC 2BDFA 2CLQA 5C26A 3I6WA 1G5SA 3FMKA 5AP3A 5ETIA 5JGBA 3UMWA 1RE8A 3C13A 4K18A 4QNAA 1ZAOA 4ID7A 5AP0A 4R6VA 4M66A 4RFYA 4BDDA 3RPOA 3SGCA 3OXIA 1NXKA 2PZIA 4FSUA 3CIKA 5BPYA 3F5XA 3CXWA 4JG7A 3U4UA 2W9ZB 4FGBA 3P4KA 3W8QA 2O0UA 2P55A 2PZYA 4YJPA 3O51A 4DFLA 4NL0A 1BL6A 1MRVA 1ZRZA 5G6VA 4DFZE 3NAYA 2BHHA 1ZYCA 3AGLA 3DK3A 1AQ1A 3WIGA 3QUDA 3PSDA 3H3CA 4NJDA 4EUTA 4FKIA 3D5UA 4L68A 2QLQA 2Y6MA 3KXHA 3R7GA 2WTJA 1U5RA 3VF8A 2W4JA 5L2WA 2VTIA 3KRJA 3QALE 2NP8A 3E8DA 4DHFA 5E4HA 3UVRA 2W9FB 3M2WA 5AV0A 3D9VA 5TF9A 2O5KA 3R8PA 3UO4A 4YTFA 3AXWA 3GC8A 4FEQA 2XRWA 3O23A 4WSQA 3QQGA 3BHTA 4H36A 4CFUA 1R78A 4CMUA 4J53A 3WZDA 2CGXA 3ZS5A 5BVDA 4D9TA 3UZTA 4O0SA 5AV3A 1XH4A 5TO8A 4A4LA 3DQWA 3ZC5A 1XQZA 2WMWA 4CZUA 4J96A 3R02A 2JDTA 3U8WA 5CALA 2R0UA 5ICPA 3ZLWA 3EH9A 2VWXA 2PMNX 4M67A 3VUGA 2EXEA 5LJJA 5CNOA 4LOQA 2Q83A 2CKQA 4GYGA 2ACXA 3MDYA 2YHVA 3DS6A 3LIJA 5FM3A 5JN2A 1IA9A 4F08A 3ZLSA 4EJ7A 5IKWA 2OXYA 3ZZEA 3MJ2A 3MVLA 3RK9A 5L8KA 3PXRA 1IA8A 5E8YA 1YDSE 3EB0A 2HZ4A 4W4XA 4GYIA 3L9PA 4H1JA 4F9YA 1V0BA 3CKXA 3GU6A 1NY3A 4IM2A 5LCJA 4DEHA 4ZJIA 1ZMUA 2WMQA 4BCQA 2HY81 5CF5A 4QMNA 4MBJA 4I0RA 4PL5A 5DE2A 2A4LA 4CZTA 1ZMVA 4MAOA 4EOPA 4YZNA 4BVUA 4FEUA 3VULA 4YPDA 4J8MA 1YOJA 2HIWA 4BKJA 3Q04A 4R5YA 3SW7A 5HTBA 4QMOA 2PMOX 4ZY6A 4I6HA 4JVGA 4PMSA 2GPHA 2FSTX 2YIXA 3QWKA 3QCQA 3SQQA 1P4FA 4X2FA 4NCTC 3FMLA 3OD6X 3VS1A 4RZVA 2YZAA 4NUSA 5L3AA 4MH7A 4TYJA 5BVFA 4IX6A 3KF4A 4U43A 2R64A 4W4YA 4U81A 4UALA 3A60A 4L9IA 4GSBA 4NK9A 2C1BA 2W1HA 4AN3A 4YC8A 3QF9A 2VV9A 4BDIA 1CMKE 4AQCA 4ZTHA 3E3BX 3D14A 5KMKA 1VYZA 3JY9A 2XUUA 5EDRA 2QG5A 1PXMA 4BIEA 4GJ2A 2UW5A 1VEBA 2UZLA 5CU0A 4AW0A 2YWVA 2X4FA 3NCGA 1BI8A 1QPDA 1U5QA 3RCDA 2H9VA 4FSWA 4DYMA 2FH9A 2ITUA 2IW8A 3R71A 3ZTXA 4ONAA 3DK6A 4MWIA 2HXQA 4ZSJA 4MF0A 3SV0A 5L2TA 1A06A 2QODA 4O27B 1BKXA 3QU0A 3ROCA 1VYWA 5ACKA 2Z7QA 3ANQA 3NNVA 3NW6A 4QYHA 1ZARA 5GJFA 4A06A 4LV5A 5CSVA 4QRCA 4E4XA 3L9NA 4O0WA 4EONA 3KMUA 3NYVA 4UB7A 1AGWA 2C0OA 2GS7A 5KKRC 5LWNA 3HRBA 4FA2A 3IKAA 3HMPA 4B0GA 1YHVA 4BDGA 4F9AA 4FKTA 4CCUA 3F5PA 5LMBA 4QMWA 4WNOA 4F0GA 2Y4PA 3C4XA 3ZRLA 5K5XA 2E9UA 4G9CA 3OC1A 2QKRA 4RX7A 4AE6A 4BTMA 4QMYA 4DH5A 4EQUA 4NSTA 3KXZA 4GFOA 4PRJA 4R3CA 2XNBA 4FV0A 4HVSA 4DG3E 3RTPA 3HUCA 3VBVA 3FL4A 2ZV2A 4YBKA 2B52A 4BZNA 1UWHA 1REJA 2WMAA 4O83A 3H9FA 3EQDA 2OJGA 2WIHA 4FIJA 4KS7A 3IW6A 4U8ZA 1H1RA 3I0OA 4YZDA 5CAOA 3ATSA 4ENXA 4O7VA 4UMQA 3KB7A 2FGIA 3W32A 4KKHA 3FMJA 3ZUVA 4USDA 4DG2E 2J51A 5DT3A 1W8CA 4DC2A 3Q6UA 2WEVA 2XNNA 3N51A 3BHYA 4KB8A 4EH6A 4D2WA 4FR4A 3BZ3A 2Z8CA 1YDRE 2VU3A 1PXOA 2ITQA 3MTFA 4YHJA 1JLUE 5E91A 3W2RA 4X2GA 2P2HA 5A4CA 2PPQA 3PLAE 4FTKA 4TT7A 2JKKA 4I24A 2QOIA 4PMTA 3EN5A 3VRZA 2OJJA 1ZYDA 5IMEA 5CSPA 3LMIA 1QMZA 4O7WA 4G6LA 4P5ZA 3V8SA 4BGHA 5I9VA 3DGKA 1B38A 5AA9A 3AMBA 5FTOA 5TOZA 5FXSA 2X9EA 4FKRA 4RFZA 4FV5A 4KBKA 4NTSA 3ZLYA 3NCZA 3FZRA 4IACA 3VN9A 5I3RA 4CTCA 5CU3A 2VRXA 5KHWA 2ZV8A 4KKEA 4F9BA 3TKIA 3R9RA 4TN6A 4M7IA 4BTJA 3L8SA 3DPKA 4LFIA 3OY3A 4XHKB 4AX8A 3R8MA 2I0HA 4N0SA 1R39A 2BRGA 3ZBFA 4G6OA 2EB2A 2B55A 2ZDTA 3DXQA 3QX4A 3MFUA 1YRPA 2F9GA 2OSCA 2PL0A 2VTPA 3HMNA 3MY1A 3BHUA 3OBGA 4IAZA 5IA1A 4QP6A 1LPUA 4KRDA 2YM6A 5DR2A 2CMWA 3IONA 3TL8A 3HMMA 3T9IA 5HO6A 2ZVAA 3FY0A 2UW7A 4B8MA 3PZHA 4QQ5A 5IDPA 3SX9A 4TYIA 3SOAA 4EH2A 2H34A 1MQ4A 2RG6A 5IF1A 2O65A 3NZ0A 1YHSA 3QTZA 3UO5A 4FV9A 5JSMA 4F6UA 2OG8A 4BCFA 2GNHA 2UW8A 2PMIA 2W99B 4BDCA 4LMUA 1SMHA 4BCJA 3IDBA 4O7LA 3QBNA 3FWQA 1J7UA 1PW2A 4PDOA 3U9NA 3CR0A 3HAVA 3OW3A 5HG8A 2QR7A 2WQMA 4CFXA 3Q2MA 3DXNA 2GMXA 5E90A 5CTPA 4XNEA 5AIKA 1ZY5A 4N6YA 2PSQA 3VRYA 4A7CA 4HPUE 4WUNA 3KCFA 3OCTA 4U5JA 2WMRA 4D4SA 4BHZA 4C2VA 2B4SB 3I5ZA 4EH8A 2YJRA 4M14A 1FMKA 4S34A 3I7BA 5H3QA 5EK7A 4FT3A 3ZO4A 3CBLA 4DEEA 4MXXA 5FBOA 3DTCA 4OLIA 4ZTLA 3ELJA 4D1XA 2H6DA 4E6DA 3VQUA 1VR2A 4JNWA 5HNBA 1XHAA 4KD1A 5F20A 5A6OA 1H25A 4DFUA 2NNWB 1OPJA 1Z57A 2R0IA 3LFEA 4EHEA 1W84A 2X0GA 1ZLTA 4I6QA 4JQ7A 4FSTA 5DR9A 1JKSA 2Y6OA 1J91A 4P7EA 5E1EA 4ANBA 4QTDA 1KE9A 3H4JA 3OUKA 5IDNA 1PXLA 4I92A 4QQJA 2JAMA 2WQOA 3NNUA 3BKBA 3P08A 3P86A 4E6AA 1BX6A 4XRJA 1H28A 3QRKA 3DBQA 2HWPA 3MBLA 5FEQA 2LGCA 5CAVA 3F3ZA 4M69B 4A4XA 3ZBXA 2FSOX 4FV8A 4EOMA 3K5VA 4R1YA 5CANA 3OP5A 2A2AA 5AA8A 2HCKA 1KE8A 4IFCA 5BVNA 1ZYLA 5A4EA 4EBWA 5IQFA 2VTLA 4C4GA 2X1NA 1E1VA 3TT0A 2JDVA 3GC7A 3QRJA 4J52A 4L53A 3ZU7A 4YBJA 2BROA 1U59A 3HA6A 4FTRA 4TYHB 2CHLA 4EHGA 4ZLYA 1SNXA 2QNJA 4QP8A 4IH8A 1B6CB 3VQHA 1KWPA 3FZOA 2UVZA 4ZS4A 2X2MA 4FSNA 4M0YA 3ZO3A 5CF4A 2ZB0A 4FKLA 1QCFA 4GIHA 3R9HA 4HVDA 2WIPA 2QO9A 1OGUA 5AUWA 3PIZA 4FKJA 4U80A 3RINA 3C50A 4MXZA 2OF2A 3I1AA 3FEGA 1Q61A 3E3PA 4G31A 3R1YA 2BZIB 5HOAA 5J1WA 4FEWA 4FUYA 2VTTA 2REIA 2YCFA 1Y8YA 1OM1A 5C8NA 5CI6A 4FTOA 1UNGA 3VUMA 5IEYA 2PE0A 5L8JA 3FKOA 1WVYA 2ZM4A 4I0TA 4AZTA 4XEYA 2CCHA 3R2YA 1XR1A 2XMYA 5J9YA 3P7AA 4BCKA 1PKDA 1PXPA 4YZ9A 4PTCA 2H96A 3NUXA 3KF7A 3BGZA 4KSQA 4BWPA 3V5JA 3ULZA 3RJCA 3MFTA 4ZLZA 2B7AA 4F1TA 3GI3A 4HYIA 3OTUA 4RJ4A 3LLAA 1Y6AA 3CE3A 4JLCA 3W2CA 1SVGA 5IQGA 4EK5A 2YAAA 3V5LA 4EZ3A 4AA5A 2YERA 1Q4LA 3BELA 4QQTA 2YDKA 4U45A 3PA3A 1XJDA 2PVRA 1DI9A 5BYYA 2C5OA 4YTHA 2Y8OA 3PRIA 3DAJA 3W18A 2E2BA 5ANEA 5LMAA 3SHEA 3P23A 5KBRA 3U6IA 4ZTQA 3ZMMA 5DVRA 3ZSIA 3S2PA 3IG7A 5A4QA 1KUTA 3B8QA 4G1WA 5J7BA 2QOKA 1PXNA 3DY7A 5M57A 3ANRA 4DFBA 4CV8A 3SD0A 3EFWA 4BDHA 1OITA 4XYFA 1FGIA 4HW7A 2E9PA 3S00A 4C34A 1YXUA 5M06A 2J0MB 4K8AA 5GJDA 1J1CA 3E7VA 4DEIA 3QYWA 3UIMA 5L6WL 4D55A 3U51A 4AW1A 5LWMA 4R3RA 4XOZA 1CKJA 5EYMA 3MJ1A 5TE0A 3RNYA 3UE4A 2ZAZA 3W2OA 3Q96A 2XK6A 3D15A 3Q9ZA 1OIUA 4PNKA 1M2QA 5CT7A 3FLSA 3VBWA 2UZWE 3GBZA 2O2UA 3WZKA 2W7XA 2GS2A 4PP9A 4KA3A 5A46A 5IQHA 1WVWA 2DYLA 5C8KA 4F63A 1KOAA 3DAEA 4JX7A 5A4LA 3HP5A 4O7TA 3M42A 4Y5HA 3IW8A 1B39A 2JGZA 4IX3A 3VW8A 5HO8A 4EH7A 4Z55A 2V7AA 1W83A 1YQJA 3QZIA 5L2IA 3I6UA 2HXLA 4G3CA 4C3PA 3CGFA 3WOWA 3Q9YA 4LL0A 3Q4CA 4XG8A 3QCXA 4FICA 3NVKI 3UG2A 4RVLA 3H9RA 3NYOA 5F9EA 4FYNA 1WBOA 3LQ5A 5TR6A 4AW5A 1SZMA 2YIWA 1V0OA 4NKAA 4D4YA 1YI4A 3CPCA 5FD2A 5IUGA 5EI2A 1RJBA 3E7OA 2YEXA 3F69A 3IDPA 3NS9A 3GC9A 3LCKA 4FG8A 3BPRA 4LGHA 4TWNA 1O9UA 4U97A 4E5WA 5LVOA 4BYIA 1E9HA 4Z9LA 5JFSA 2I0VA 4RMZA 3R7YA 3FC2A 4I3ZA 3ULIA 5IUHA 5JGAA 5J7HA 4Q5EA 3QQLA 4E3CA 3KC3A 1FPUA 4BDBA 1J7IA 3ALOA 1MQBA 4FSZA 4L6QA 1V0PA 2YM3A 3ZO1A 2ERZE 2GNIA 4LRMA 1ZYJA 5IQEA 1P4OA 3HV7A 3HAMA 4A9SA 2QOQA 4TWOA 2DUVA 4G34A 5CYIA 5LXMA 1GNGA 1QPEA 4YZBA 3MV5A 3LKMA 3ORKA 5BVKA 4HGSA 3BYUA 3OFMA 1BMKA 2BIYA 4QNYA 4HZRA 1ATPE 3UOHA 1TQMA 3MVJA 3TZ7A 5CU2A 3R83A 3RK7A 3VO3A 1RQQA 4HJOA 3Q4UA 5M51A 3A7JA 4QPAA 4AP7A 4RIYB 3UPXA 4MQ1A 3TN8A 2YDJA 4YLLA 2NRUA 3ALNA 2QO7A 4BCIA 4JS8A 1NA7A 5CWZA 5BMMA 3GU7A 3KN5A 2FB8A 2F7XE 2YDIA 3LXPA 4AWIA 4GG7A 4WG5A 4EWHA 3BQCA 2CN5A 5IH6A 3LQ8A 1CSNA 3KGAA 1UNLA 2C3IB 3CJGA 3EJ1A 3KRRA 4FKQA 4MX9A 3BIZA 5DNRA 5LVLA 2C5XA 4EYJA 5A14A 3R8ZA 4M12A 4XG6A 4I5PA 2VNWA 3KVWA 3MB6A 5IISA 3QX2A 4FIGA 4W4VA 4ZEGA 5E7RA 3BYOA 5K4IA 4FIIA 2ZV7A 2XKCA 4NWMA 2XNOA 4MBIA 3DQXA 2X9FA 3BHVA 5FP5A 2WQBA 3EN4A 1OVEA 5HTIA 3WYYA 3G51A 2UZTA 4AT3A 5C01A 4M8TA 2GSFA 2GTNA 1BI7A 4D5KA 2PVHA 3DJ7A 4WD5A 3GCUA 2J0KA 2VD5A 3FMMA 3GOKA 4PDPA 4XRLA 4Y72A 3V5QA 3BYMA 3MS9A 2ITZA 2PUPA 3QHRA 3ZFYA 3DU8A 4FV3A 4LUEA 4XV2A 3VHKA 1OIQA 4JJRA 4Y85A 3CP9A 4X6QC 2R7IA 4RIWA 2VUWA 1XKKA 4DFXE 5FM2A 3F3WA 3UDBA 2UVYA 5BUJA 4QP7A 5GZ9A 2OLCA 4ZLOA 1XH7A 2XNPA 5CENA 4CSVA 5EH0A 3TCPA 5IQIA 4DTAA 3VS5A 3E63A 3QTSA 1H1QA 4HYUA 4YHFA 3HEGA 4F65A 3VS6A 3V6RA 5L8LA 4IDVA 2R3HA 5D9HA 5CAQA 2QQ7A 3CSVA 3OUNB 1F0QA 5EW8A 4DT9A 1U54B 2XS0A 4H1MA 3SAYA 4AFJA 5AFVA 3R8LA 4GVJA 4RWIA 4O91A 3N9XA 2WELA 4JDIA 5AR4A 5GZ8A 3CQEA 3A7GA 3UQGA 3CY3A 2VGOA 4FTTA 4HCUA 3BE9A 3EKKA 2HZ0A 3CQUA 4DBXA 5DRBA 4P5QA 3ORXA 4KKGA 3TTJA 2GNGA 3LFQA 5CZIA 4BZDA 1SNUA 3DKCA 2GU8A 1GZKA 1PF8A 3ZZWA 4IB1A 1H00A 2JBPA 3D5VA 5FDPA 3CD8A 1ZOEA 4F0FA 3ODYX 3RVGA 3LFSA 1KE5A 3JR1A 3UYSA 4KSPA 3OROA 1ZY4A 2RF9A 5EM5A 4AOIA 2IPXA 3UQCA 1YXSA 5ANJA 4ANQA 4XX9A 2VZ6A 2XJ0A 4D4RA 3CEKA 2BPMA 4ANNA 2J0LA 3V04A 2VNYA 5AP4A 3UOLA 2E9OA 3RP9A 4NCTA 4I93A 3H0ZA 5DLSA 4FNXA 4W9XA 3UODA 3EQCA 5HTCA 3VF9A 2JKOA 3WF9A 2YIQA 2B54A 4WO5A 3W8LA 2EU9A 4ACCA 3VUKA 5M4FA 3IPHA 3G90X 4KIQA 2KTYA 3PJ2A 4S32A 3HNGA 1H1WA 4QMZA 2UZUE 4E8AA 4ZSGA 2OWBA 2O64A 3CGOA 2FO0A 4RX9A 5JRQA 4O81A 5ETAA 3GOPA 3MYGA 2Y0AA 5AUZA 5GINE 5IQDA 4IFGA 2BIKB 4C36A 1LUFA 2HW7A 2AC5A 2I0YA 1RDQE 3S0OA 4NM3A 3U87A 4X3FA 4BI2A 4PQNA 2BVAA 2IVVA 2J5FA 4L01A 4CEGA 3TI1A 5IEVA 2B53A 4AOJA 4XBUA 3Q60A 3PG3A 2HOGA 3BEGA 4W8DA 4ASDA 3EQGA 2HW6A 3F3TA 5CX9A 3R7EA 2EWAA 5KBQA 5EQYA 5IZFA 2PHKA 3FZPA 4L44A 2EUFB 3MN3A 4FV2A 4IAYA 4NM0A 3KK8A 2OZOA 1OMWA 3GFEA 4GEOA 3WI6A 2V7OA 4YSJA 3QRTA 4WG4A 1UV5A 3BBWA 3BX5A 3KXXA 2WTVA 4EK8A 3V5WA 3ZEWA 3ZLXA 4GUBA 3PFQA 1H0WA 2EXCX 3GXLA 3UP2A 2BRMA 2C30A 2HK5A 4JRNA 3TIYA 2QU6A 4EWQA 5BMSA 4O7ZA 2AC3A 4OW8A 4XUFA 1W82A 2YN8A 4ZZMA 3C4FA 3OY1A 1NT2A 3QC4A 4FTLA 2C5VA 5EDQA 3DBDA 4C33A 2WQNA 4YMJA 3LMGA 4ERWA 3OBJA 4MEDA 4TWPA 3ZO2A 4FTIA 4CFMA 3GT8A 4H3QA 4WT6A 3COMA 5AP6A 1XBCA 4ZP5A 4ZZNA 4WNKA 3O8PA 2GHMA 2PU8A 1W0XC 5AR7A 5K4JA 5FRIA 1GZ8A 3QHWA 3U4WA 5LOHA 4XP0A 1OUKA 1GAGA 3IW5A 4CLJA 2QLUA 3KMMA 4YP8A 1XH9A 4RT7A 4IWPA 4F7SA 1UU9A 3DLSA 3RAHA 4QO9A 4TPTA 2XH5A 1DI8A 2WAJA 1NVSA 4P4CA 3FPMA 3QTQA 3P5KA 3R01A 1DAYA 4OT6A 1LEZA 2J5EA 3I7CA 4FX3A 5GNKA 3P78A 3UC3A 3FE3A 4C8BA 2IZRA 2YA9A 1CDKA 5HU3A 3UG1A 5EYCA 4ASEA 2PVJA 3WE4A 4OTHA 4J7BA 4LOPA 4QQCA 3RPRA 2XM9A 4YJVA 2O8YA 4KIKA 4CFFA 4YR8A 5AAEA 2W96B 3O8TA 3PLSA 4GFGA 3NUAA 3CY2A 3ZXZA 3U54A 3LFAA 2F2UA 1KE6A 4G3GA 2R3GA 4O21A 3RAKA 1PMNA 1YXXA 3AD4A 3IO7A 1XWSA 4GW8A 3PUPA 3VUTA 2O3PA 4FOBA 5GJGA 1OPLA 3GENA 4FUXA 4BDEA 2A19B 3UIUA 2BRNA 4DLIA 4PP7A 4ZAUA 4WNPA 4Y83A 2XIYA 3WYXA 1ND4A 4QYGA 3FYJX 4ZSLA 3CD3A 3BYSA 2C0IA 4H3BA 4JBVA 1R3CA 2XK7A 4KBCA 4Y8DA 1JSTA 4ALWA 4EH4A 3FHIA 2XKEA 4ZJJA 2CKOA 3PXYA 3KA0A 2Z02A 3UNKA 3H0YA 4BB4A 5HE2A 2Z2WA 2UW0A 3SXSA 2RFSA 2I40A 4PMPA 3DJ5A 5DT4A 1A48A 3HV5A 5GHVA 3D7TA 3FV8A 4CYIA 3K2LA 3JVRA 5BVWA 4ANMA 3SRVA 4MXYA 3DV3A 3FI3A 4JBPA 4HYHA 5FTQA 5ANGA 5KZIA 3AGMA 4K1BA 3TZ8A 4EOKA 4TZRA 3E88A 3VNTA 4FZAB 3MA6A 4RIOA 4O82A 4V04A 4CCBA 2B9IA 2C0TA 3S95A 5IQBA 3A7IA 3OG7A 2XZSA 3FSFA 4LQMA 3CKWA 4BDAA 1Q8ZA 4X3FC 2AUHA 3ORLA 4NZWB 3LHJA 5ANOA 1Q8TA 5EW3A 2P3GX 4EC9A 1WMKA 5CU4A 5E1SA 3HV4A 4ZY5A 3FAAA 4X21A 2WHBA 4MNEB 2YLFA 4BBEA 4YLJA 4IX4A 3TG1A 2JFMA 3NX8A 3WF8A 4CRSA 1UKIA 5KMMA 1STCE 2A27A 3R7IA 4XP3A 5B2MA 5EM6A 4D2PA 4UZHA 5C4LA 3CPBA 2QOFA 5EI8A 4ACDA 2BKKA 4TXCA 5DEYA 4O1OA 3ZHPC 4DH1A 3NR9A 3PP0A 4O6LA 5M53A 4F09A 3SW4A 3ACKA 4C35A 2BTSA 3ORNA 1KOBA 2F7ZE 4KNBA 3ERKA 2IWIA 3EQFA 3FKNA 3PZEA 3F5UA 4QP1A 4O22A 2QC6A 1PXJA 2ITNA 3NRMA 4FNWA 4IW0A 5CSHA 2V22A 2X8EA 3E5AA 2QU5A 4AU8A 3KULB 4CT2A 5AWMA 3UVQA 5BVOA 3BGPA 3I0QA 3RK5A 3NGAA 4NFMA 5J79A 5DMZA 4NEUA 3L8PA 4BTFA 4C58A 3QCYA 4CQGA 1R0PA 3PJ3A 1UU7A 1OIRA 4IM3A 5CI7A 3QL8A 5IUIA 4DGGA 5HORA 3ORIA 3R63A 4YZCA 5FP6A 1JBPE 2WTCA 2X7OA 4PTGA 4CG8A 4FSRA 4E5AX 3BRBA 5CT0A 1U46A 3HLLA 3UOJA 5EM7A 3NYXA 2WO6A 1OPKA 1SYKA 3VS0A 5DA3A 3V6SA 2UW6A 4JBOA 3R7UA 5HQ0A 2R3FA 4DA5A 4X3JA 5HVYA 1Q97A 3QCSA 2BUJA 3DZOA 3ORZA 1L3RE 1H4LA 4ANOA 4C3FA 4E4MA 5FG8A 5DIAA 3A8XA 4U3YA 3TM0A 2RIOA 3HGKA 4L8MA 4PV0A 3KU2A 1I09A 3SKCA 4NW6A 1F3MC 5AAFA 5M44A 5B2LA 5M4IA 3SG9A 1G8SA 3TNWA 4PNIA 3R28A 5CU6A 5KZ0A 1PRYA 3KXGA 4MK0A 3MFSA 3GCSA 3QQKA 4UV0A 2QURA 2VX1A 3C4WA 3MPMA 3F5GA 4OGRA 1GZNA 1YWNA 2X8DA 1IASA 3F61A 4S30A 3UNZA 3VS2A 4HPTE 1WBSA 1X8BA 1UWJA 5DBXA 2C68A 2P4IA 2XIZA 2Z7SA 4NM7A 3C1XA 4QMUA 1FOTA 2WMTA 4RG0A 4C59A 3PIXA 4YJOA 1J7LA 3R6XA 3G0FA 4WOVA 2W1EA 3BU6A 4R8QA 3PA4A 2IW9A 5BUIA 4FMQA 4FC0A 4RZWA 4YJNA 4N70A 3LFCA 4DEGA 2CLXA 4XV1A 4OAVB 1H08A 4E93A 5KMJA 4RC4A 4XBRA 1Y91A 4XLVA 2OBJA 4U44A 5EKNA 3H9OA 3KN6A 4FG9A 5BVEA 4NU1A 4J1RA 4HZSA 4ZMEA 2XB7A 4A4OA 3R1NA 4ZTSA 1DM2A 2IO6A 3R21A 2WTDA 3RM7A 4Q2AA 2YM8A 1GIIA 3F7ZA 3P7BA 4E73A 4EQMA 2GNFA 2IVSA 4GK2A 3ZRKA 4RVTA 3VW6A 3ZXTA 4G5PA 4G16A 5E8TA 4L7SA 5CF8A 4NW5A 3BHHA 3R1QA 4WHZA 2QOBA 3A2CA 4YSMA 1PYEA 5BX0A 4OBPA 3EKNA 4IE9A 3UBDA 4EOOA 4UXQA 1H1PA 2WMVA 3F9NA 3EQIA 3IECA 4E6QA 4RLKA 1Q3WA 2BAKA 4RQVA 5HI2A 5M4UA 2J2IB 3COIA 5ANKA 1WBPA 1YOLA 1NVRA 4FF8A 5I9YA 3NW5A 2CPKE 3WZJA 5TKDA 3SLSA 4ASZA 1ZOGA 3O7LB 3DTWA 3GU5A 3ODZX 2YM7A 4IAIA 4YNOA 4GT4A 2W17A 3CJFA 4BICA 2XBJA 4MXAA 1WFCA 3PVGA 4B7TA 2PVYA 3VUDA 3R7VA 2OH0E 4FVQA 2X81A 4ASXA 3EHAA 4IBMA 3BU3A 1H1SA 5IA0A 4FKOA 3EZVA 3QRUA 5IH4A 1PJKA 4LMNA 3VAPA 1PHKA 4MHAA 4O0TA 1G3NA 3UYTA 1WCCA 2C47A 4CV9A 3FMNA 2O63A 3MGYA 4DITA 5L6PA 3EQPA 4YJTA 4BR3A 3FUPA 4K11A 2OGVA 4WIHA 1XO2B 4B6LA 5IA4A 3VIDA 2OKRA 3EQRA 3JUHA 3L8VA 4MXOA 4U7ZA 3KREA 4M97A 4N4SA 5EOLA 2ETMA 2YIYA 3SA0A 3OHTA 4F0IA 3HECA 4GJ3A 4JIAA 4JR7A 1OKWA 4H05A 4K33A 2C5NA 3FQSA 1T46A 4IEBA 4JBQA 5LQFA 1GZOA 2R3LA 3PWDA 3RKBA 2R3MA 5J87A 2XK9A 4ITHA 5CQWA 5H8EA 2VTOA 3N4VA 3TTIA 3EWHA 1JWHA 2UZBA 3VBXA 3EZRA 4CTBA 5JGDA 3GCQA 1Q8UA 5H8GA 4DINA 3KL8A 4MF1A 1XBAA 3LFBA 4V01A 4ZS0A 4E4NA 3LMHA 3ZC6A 2OZAA 3TDWA 3PE2A 3PJ8A 5C4KA 2BRBA 4ZTNA 4AUAA 1WBWA 5CXHA 2RKUA 2Z7LA 5FXQA 2IZTA 4MVFA 3TEIA 1OKVA 1XH8A 2UW4A 3EMGA 1AD5A 4U0IA 3CQWA 4A9TA 2C3LA 3WF6A 3RI1A 4XG4A 5KE0A 2QVSE 4GKHA 4O2ZA 4F6WA 2VO3A 4BCGA 4RGJA 1IAHA 3ET7A 4KAOA 2VWZA 3L8XA 4IAAA 2GQRA 2QOCA 2GFCA 4I1ZA 3AMYA 4RJ6A 1YXVA 3FLWA 5M09A 5AIRA 4KBAA 3VWAA 5E8VA 3QD4A 5KMIA 1FVRA 2PTKA 4YUQA 3KEXA 4UWYA 4D1SA 2WB8A 1O6LA 4U6RA 2C5YA 1GY3A 4AGUA 4I6BA 5H8BA 5I9UA 4CFWA 4G2FA 5IQCA 4FT0A 2JFLA 4GMYA 5BNJA 4PL4A 5AEPA 4F7NA 4GU9A 4D2VA 3ZFMA 3TUDA 2J7TA 4F7LA 3RHXA 4YNEA 2OW3A 2HELA 2BILB 1OL1A 3QKMA 5EHYA 5E9EA 3O96A 3NWWA 3Q5IA 4FKSA 5HKMA 2QONA 3DDPA 3MTLA 4IM0A 5FWKK 4AZWA 5IH5A 1KE7A 2JIVA 4WKQA 5M4CA 3KQ7A 4UEUA 3JS2A 4EEVA 4GV1A 2JAVA 3G6GA 4QP3A 4MXCA 3FY2A 5C27A 2JKQA 5EYDA 1PXKA 2IZUA 2J4ZA 4TYGA 4AZSA 2OK1A 3PA5A 5JKGA 3WIKA 3AD5A 3VBYA 2R3QA 2W1ZA 3E8CA 3NUNA 3QWJA 4QD6A 2R3NA 5I3OA 1FQ1B 4U41A 2CDZA 3SOCA 3HV3A 4WNMA 2VO0A 4LRKA 4YZMA 4RIXA 3IW7A 3MY5A 3EFKA 1XBBA 2X2KA 4UWBA 5KCVA 4QT1A 3QQUA 4G9RA 5E92A 5J5TA 2PUIA 3HZTA 4X2NA 4O7NA 2XVDA 5HEZA 5DH3A 4BRXA 3QFVA 3V5TA 3FI2A 5HIEA 3ZSGA 4D4VA 2QOOA 2Z60A 2Q0BA 5AR3A 3OMVA 4JXFA 4K2RA 2YACA 4UX9A 2PVMA 2GQSA 2QG7A 4RC2A 3E62A 4LRJA 1R1WA 5CASA 1YW2A 2ITWA 1PMVA 4X2JA 1SVEA 1CKPA 3HMIA 3ZONA 4C4FA 3ROYA 3MB7A 2RFDA 5ITAA 4PPAA 4UBAA 5I9ZA 4B4LA 4F1MA 2PVFA 2QR8A 2UZDA 4FZDB 1PYXA 3LLTA 2C6TA 2FUMA 4RC3A 3OW4A 4RJ3A 5KX8A 2ITYA 4YC6A 3DK7A 1GOLA 3DB6A 4DEBA 2XK8A 4RIWB 3V8TA 3LQ3A 3E93A 3KKVA 5IEXA 4DT8A 3QKKA 4WSYA 2OFVA 2FVDA 1J1BA 4TY1A 3FXWA 3VS4A 1S9JA 5HIDA 5KO1A 4AN9A 4Q5HA 3KRWA 4F4PA 5I0BA 2G2FA 1ZWSA 2PVLA 4L42A 5HVJA 5ETFA 2BTRA 4XP2A 1KSWA 3WE8A 1SVHA 3U6HA 2F2CB 4Z16A 4QYEA 1Y6BA 2CGWA 2PUUA 3DZQA 2VWVA 4TWCA 3TACA 3LFDA 2W1DA 4O96A 1JSVA 2ERKA 2GFSA 4DCAA 5CAUA 2PZ5A 4ZSEA 2XRUA 2Y4IB 2W1IA 4BWKA 5K0XA 3CTJA 5J5SA 5AM6A 1BYGA 3EL8A 1PXIA 3ZDIA 4FSMA 4QTAA 4NIFB 3PXQA 4F1OA 2B1PA 3N4UA 5CY3A 4J98A 3W33A 5D12A 4DGNA 5LVNA 2C69A 2WNTA 5DPVA 5CZHA 4IJ9A 5CVFA 4QYFA 4UY9A 4DBNA 5I9WA 1FVTA 5DI1A 4DGMA 2OJIA 3CC6A 3EQBA 3UC4A 4FZFB 2XJ2A 4UMPA 4C4EA 3LXNA 5BYZA 1PMUA 3GGFA 2ITOA 3SDJA 3IOPA 3TKHA 4AXAA 4ZZOA 1Z9XA 3G5DA 4HGEA 4NT4A 4CYJA 3OOGA 3PXZA 2ITTA 5JK3A 3W2SA 4C3RA 4RQKA 4FIEA 4FYOA 3QTIA 4CFNA 4D28A 3LM5A 1M14A 1LEWA 2PULA 3AMAA 4DH7A 3W1FA 4M0ZA 5IA3A 3RALA 3VC4A 4GKIA 5HCXA 4FTJA 5L4QA 3A8WA 3V3VA 3TNQB 4L3JA 4YPSA 2W06A 4BCMA 3BWJA 5D41A 5CEPA 1W98A 3UZRA 4GIIA 3QUEA 4IZAA 3IGOA 4IC7A 4IB0A 2VTHA 4C0TA 1OZ1A 2YWPA 4OBQA 3MPTA 3DDQA 3VJNA 5HX6A 5GIOE 3Q3BA 3V01A 5D11A 5DFPA 5KUPA 4OTFA 5ANIA 2B0QA 1QPJA 4P2KA 2YISA 4QTBA 4BYJA 3NUPA 3QAME 2F7EE 2XIXA 2XNEA 4Z7HA 2UV2A 1K3AA 4MD7E 5HVKA 4FE2A 5B2KA 3PRFA 3EFLA 5FEDA 3BYVA 4R7BA 2JKMA 4O0UA 2B9JA 2GHGA 4LYNA 1V1KA 3R0TA 2QD9A 2BDWA 3FQHA 3THBA 4GK4A 4F9CA 5K3YA 2R3OA 4Y5QA 4RSSA 4RPVA 3WF5A 3WZUA 3FLYA 5KKRB 3EFJA 3COKA 2WU6A 3BLQA 3ZOSA 2ONLC 3P7CA 4QMXA 1ZZLA 2PMLX 4XH6A 3O2MA 4TL0A 2J0JA 3MSSA 3PY3A 2UW9A 2UZVA 3C51A 4O84A 5IQAA 4FKVA 3C7QA 3O17A 5JQ8A 4RVKA 3TNIA 5K0KA 3R9NA 2G2IA 4DEAA 4LUDA 4WUAA 4EK6A 4D2TA 3UJGA 1WBTA 4JAJA 4AT5A 4BN1A 4XV9A 4EOSA 2CNQA 4KIOA 3LZBA 2R3RA 2RFNA 3GCVA 2JC6A 2KULA 1GIHA 2VTAA 1YKRA 2RFEA 3BV2A 4PF4A 3KVXA 1YXTA 4QMLA 4B99A 4FGRA 4G3FA 4BBFA 2PK9A 3QD0A 3NAXA 4GL9A 1IRKA 5D7AA 2VTMA 4ZXTA 4C37A 3AT4A 5E8WA 4MKCA 4YGAA 1H24A 4I5CA 3OCGA 4D0WA 3GC0A 4A9YA 2PZRA 2RGPA 2ITXA 4HNIA 4UXLA 3E92A 3V51A 4C4JA 2BCJA 3LW0A 4H39A 3Q52A 5EKOA 5KHXA 5EDPA 3C4EA 4NH1A 3PXFA 1H01A 2X6EA 2AYPA 3BQRA 3S4QA 4YO4A 4LV8A 4NJ3A 3ZH8A 3NUYA 4JT3A 3WZEA 1P2AA 3TJDA 4CQEA 4UMRA 3PPJA 5JZJA 3FSKA 3QKLA 1HCLA 4D1ZA 4EH5A 5KMLA 3AQVA 3UZPA 1WZYA 5IA5A 3MIAA 1H07A 3FBVA 4YU2A 4J71A 4ZK5A 1JVPP 5A4TA 1G8AA 4NFNA 4R78A 3A7HA 3FC1X 4HVHA 2XKFA 4OT5A 4V0GA 5EG3A 5HLPA 5C8MA 4HVGA 3MESA 3ENMA 1Q99A 3LJ1A 4TTHB 1T45A 2IZSA 4EJNA 5HX8A 5E8ZA 4F7JA 1FBNA 3Q53A 4KIKB 3G2FA 2WD1A 3QTUA 2ETKA 4A9RA 3ORMA 5LCKA 5J1VA 3QLFA 2XYNA 4ZIMA 4EL9A 4RLLA 1UNHA 4AACA 4EI4A 5B7VA 3KCKA 4YLKA 4RX5A 3PY1A 3I79A 2BALA 2F4JA 4FV4A 3FZ1A 1F5QA 4R7IA 5J9LA 4TYEA 2BHEA 2OIQA 4GCJA 3UIXA 3COHA 3DJ6A 1MP8A 2HENA 3FMHA 3OVVA 5HBJA 3QXPA 5FQDC 4JG6A 5T6KA 2WZJA 4S2ZA 4UWCA 2RG5A 3QTRA 2OU7A 4LGGA 1RW8A 5EM8A 4FIHA 5DR6A 4KINA 5CEKA 3QQHA 3DLZA 4OTGA 2W5AA 3RZBA 5K9IA 2WEIA 4MQ2A 3D4QA 3OEFX 3VVHA 5CEMA 4YTIA 2OJFE 4PUZA 3UO6A 2OXXA 4CLIA 1OECA 3D7TB 5E8XA 5HD7A 5HU9A 1BLXA 3R30A 1Q24A 3SRVB 3TNHA 2BAQA 3QGYA 4AGCA 4YJRA 4Y95A 4AF3A 1A9UA 1LP4A 2C6MA 5IMXA 4FI1A 2VX0A 2CSNA 3F3VA 5DYJA 4N57A 4OUCA 1KV1A 3PDTA 4O0RA 5HE3A 3WARA 3G9NA 4NYEA 4UN0C 1NW1A 3PJCA 4IAKA 5IPJA 4ITJA 4E26A 5DGZA 3Q9XA 4BZOA 5AJQA 2GQGA 4EKLA 5JQ5A 3LPBA 3QZHA 3REPA 4E4LA 3RWQA 1O6YA 3QD2B 2VTRA 5L2QA 5IA2A 4I4FA 4IANA 2OJ9A 3D5XA 2YM5A 4FV7A 4RRVA 4CVAA 2XBAA 2BFXA 2XK3A 4ENYA 3KXMA 5AUTA 3MWUA 2A1AB 1KV2A 5AR5A 4IWDA 3RM6A 4DTBA 3NYNA 4APCA 3FLNC 4BKYA 4BIDA 4AAAA 3T9TA 3DNEA 3NUUA 1K2PA 4F70A 1YDTE 1XH6A 5HD4A 5I9XA 4QMSA 2FA2A 3PE1A 5CVGA 1WBVA 4L00A 3PVUA 4D2SA 3MFRA 5EOBA 5AMNA 5AR2A 1URCA 2VX3A 3UOKA 4AA4A 2UUEA 1EH4A 2IW6A 2XK4A 3D83A 3DFCB 3EN6A 3GQLA 3OXZA 4I4EA 5HIBA 4CRLA 4KIPA 4G17A 3KFAA 3CCNA 2XJ1A 3JYAA 5DOSA 3RWPA 3O8UA 1UU3A 4J8NA 4CXAA 2R7BA 2UZEA 4OTPA 4LL5A 4RFMA 4UYNA 3TZMA 1ZMWA 4HCVA 2W1FA 3BE2A 4MTAA 5DRDA 5AP7A 3RBWA 2W4KA 3TJCA 4APPA 4OTWA 3NUSA 4W9WA 2WTIA 3PP1A 1FINA 3BCEA 1IG1A 2J6MA 3IGGA 1QPCA 4IJPA 4KABA 3TDVA 2JLDA 2Y4IC 2GCDA 4LI5A 3QQFA 4U3ZA 4S31A 4WBBB 5HLWA 4QYYA 5FTGA 1R0EA 2G01A 2WTKB 5M07A 3LCDA 5CEQA 4YJQA 2BR1A 3FI4A 4O0VA 3OZ6A 4RJ5A 3L9LA 5HNIX 3NMUF 2VAGA 3E64A 3ZRMA 5T3QA 2C6LA 3DKGA 1O6KA 5A6NA 3HV6A 3ZYAA 2A0CX 2IN6A 3GNIB 2WU7A 4ANLA 4FTMA 3LOKA 4FV6A 3UMXA 4P90A 1ZXEA 4WRSA 5AX9A 2BZJA 5FXRA 4FKGA 4UMTA 2WMSA 4I0SA 3BWFA 5JFVA 3LCSA 4RWJA 3FJQE 4HGTA 1IEPA 3KK9A 4IZ5A 3OTVA 4O86A 3JXWA 2PE1A 3FMDA 2JD5A 4CKIA 3NW7A 3HRCA 2GNLA 4IVDA 3DB8A 5KNJA 5C03A 4GT3A 3QYZA 5AR8A 4USEA 2W4OA 4PMMA 4IVAA 4GT5A 4BCOA 2BZHB 3OWJA 4H58A 1IR3A 5AM7A 5HHWA 2UVXA 5ANDA 2BFYA 4PL3A 3MVHA 4E20A 4PY1A 4OBOA 5JMSA 2ZMCA 2XYUA 3NNWA 5LVPA 3U6JA 1IAJA 4I41A 3AC5A 3DT1A 4O7YA 4QMQA 1URWA 2XCHA 3ZUUA 2ZJWA 4LG4A 2NO3A 2JIIA 5BUEA 4O6EA 3CLYA 3G15A 2SRCA 2V5QA 4CD0A 4FKWA 4KS8A 1WAKA 3MVMA 5A3XA 2P33A 3OCSA 3F6XA 3L9MA 4DLJA 5CS6A 3I60A 2UZNA 3ORTA 3WBLA 4ZMFA 4CG9A 3Q6WA 3Q9WA 2IG7A 4EH3A 3POZA 2XNMA 1CTPE 3L1SA 4IVBA 1JKTA 2ZV9A 3KRLA 4GS6A 4BCNA 4ZJVA 4USFA 2XEYA 5IU2A 5AX3A 2JEDA 1OL6A 1OKYA 3R9OA 4JAIA 4HNFA 2GTMA 3IDCA 3PVBA 3VJOA 1Q3DA 3GCPA 1W7HA 3P1AA 2JDOA 1M7QA 3C4ZA 3C9WA 3MH0A 4N6ZA 4EOQA 3PPZA 4AG8A 4XMOA 4K77A 3IQ7A 5C9CA 4EYMA 3W2QA 5HCZA 4XG9A 1YI3A 4AGWA 3VS7A 5HG7A 4QPSA 5FEEA 2HY0A 3MH2A 4QTEA 4G3DA 1BL7A 2JITA 2WKMA 4EHZA 3GFWA 1M17A 3I81A 2I7QA 2YLEA 3FXXA 3A7FA 5AUXA 3VBQA 4GFMA 3FL5A 2ITVA 4ALUA 4FTAA 4L46A 2X7GA 1E1XA 4C7TA 3FZSA 3GP0A 1P14A 3GU8A 2E9VA 3OWPA 4FZ6A 3ZEPA 2BAJA 4FL2A 4FKPA 4YO6A 3R7OA 2R9SA 2PZPA 2YZLA 3R73A 3CTHA 4D0XA 4O2PA 4GUEA 5T68A 3T3UA 3M1SA 2FYSA 1BUHA 3R8UA 3DCVA 4FODA 5LARA 1Z5MA 5DWRA 1Q41A 3QUPA 4R77A 1DS5A 3OOMA 5F94A 4I5HA 2R3KA 3DBCA 5HLNA 2PWLA 2J0IA 1ZYSA 1GIJA 1FMOE 2GNJA 2ZM3A 4FL1A 4R5SA 5CSWA 4AE9A 4FTNA 4MNEA 1Q8WA 3RPSA 1HOWA 1MUOA 3GUBA 4BWXA 4CMTA 2R3PA 3E87A 3RPYA 3KMWA 4TW9A 3ACJA 2G9XA 5CQUA 5AP2A 3PSBA 3ATTA 3NLBA 2R3IA 4TKSA 2W05A 4HYSA 5IG1A 2WPAA 4IZYA 3WILA 3TV7A 4Y73A 4J95A 2CNVA 3EIDA 4PPCA 3DBEA 4OTRA 1M2PA 2B9HA 5HESA 2OZAB 1M7NA 3KXNA 3RGFA 4JR3A 4FL3A 3KRXA 2R5TA 4IMYA 4LOOA 5CF6A 3EQHA 3AC1A 2G2HA 4IAFA 3ITZA 3LCTA 4O1PA 4R1VA 4MWHA 3QC9A 2V55A 2VWIA 3FLQA 3KULA 5B0XA 4E1ZA 3ZDUA 2Z7RA 3FMEA 4BL1A 3R9DA 5AP5A 2X8IA 4DEDA 4BCPA 4C62A 4CFVA 3Q4TA 4RWLA 1CM8A 1JKLA 2QOLA 5HO7A 5HE1A 4CGAA 3LAUA 5KMNA 2XIRA 3SVVA 3C5UA 5I4NA 2HZIA 3F3UA 5EI6A 1VZOA 3C0HA 3FDNA 4ZY4A 5FGKA 2PVNA 3F2AA 3OT3A 4FKUA 3HDNA 2CN8A 2Q0NA 4FEVA 1DAWA 2E9NA 3U9CA 2X4ZA 5HG9A 3RAWA 1U4DA 3C0GA 3ETAA 4ZTMA 3AC3A 4C4IA 5HCYA 2C4GA 1CKIA 4FT9A 2ESMA 2WGJA 2OICA 3LCOA 3Q32A 4U9AA 2JDRA 2CKPA 1UA2A 3R2BA 5AV2A 4EC8A 3MPAA 3QTXA 4AZVA 5A54A 1JQHA 2P2IA 2XF0A 3FI8A 2F57A 3DBFA 3MH1A 4PDSA 4BCHA 4O7RA 3AT2A 3A99A 3IW4A 4ZOGA 4YURA 5EQPA 3GB2A 4BFMA 5KMOA 4HVIA 5BYLA 2GS6A 4C4HA 4D5HA 3CTQA 1OB3A 4XLIA 2WMUA 4I94A 3BLRA 3O50A 3AC8A 3OWKA 4K6ZA 4TNDA 4QP4A 5F4NA 2DQ7X 1PY5A 4BGQA 2IJMA 4MNFA 4BDKA 3DAKA 4ANSA 3ZM4A 5I5ZA 4FTUA 2H8HA 3HP2A 4FSQA 2V0DA 4RIXB 2DWBA 4IC8A 2C6EA 4LM5A 5CNNA 4YJUA 2QOHA 5L2SA 4JQ8A 5CSXA 4OAUC 3D2IA 4DAWA 1JAMA 4RA4A 4YJSA 4BI0A 2IVUA 2HAKA 3NDMA 5EW9A 5FBNC 2R3JA 1PMEA 3I4BA 5JRSA 5AUYA 3OT8A 5AADA 2JIUA 3ZCLA 3BU5A 4NM5A 3AD6A 3F7WA 1OL7A 2UW3A 4A07A 3OEZA 3HDMA 3PXKA 5EFQA 1OUYA 4O0XA 3FXZA 2WMBA 4FTCA 3PJ1A 3T8OA 2VTJA 4C02A 4E5BA 4F99A 4BDFA 3UPZA 3OF0A 3VHEA 3TKUA 4R3PA 4G6NA 5DG5A 4FK6A 3MI9A 4JIKA 3BI6A 3IK3A 4I21A 4XJ0A 3PIYA 2WTKC 2YM4A 5F1ZA 4DGLC 1HCKA 5AV4A 2YCSA 3DOGA 3LXKA 5GZAA 2OI4X 4D9UA 4XOYA 3O0GA 3UTOA 3ZUTA 2YAKA 1Q62A 5HE0A 4QMTA 3JPVA 2F49A 4IB5A 4FVPA 4JOAA 2W5BA 3D5WA 3PG1A 4NTTA 3ZM9A 2PE2A 4BHNA 3WF7A 4QMMA 5M56A 2NRYA 4CT1A 2ZYBA 3G6HA 3EN7A 4EUUA 3A62A 2J90A 4BTKA 2PVKA 1OL2A 2VWWA 3RNIA 3SC1A 3PY0A 2WFYA 4ZSAA 5CLPA 3AG9A 4OTDA 5ACBC 4I23A 5HGIA 4H3PA 3AC2A 4JQEA 2HYYA 4WRGA 3M11A 3FPQA 4ACMA 1H8FA 5JH6A 3LXLA 4RWKA 2VTNA 4JRVA 3V5PA 3F66A 4HCTA 3T3VA 2FSLX 4M69A 2QCSA 4W8EA 3VUIA 3QQJA 2VTSA 3QLGA 4XG7A 2ONLA 3VBTA 4C57A 3FHRA 3C5IA 3F2RA 4PDYA 3MW1A 3VS3A 1MRUA 2YABA 5FDXA 3SG8A 4ALVA 1YOMA 3B8RA 4PTEA 4BBMA 4DTKA 5CEIA 3A4PA 4RA5A 3SXRA 2XP2A 1SM2A 2P0CA 4TYHA 5GIPE 3TIZA 5AUUA 2G15A 4BGGA 3R04A 4AOTA 3JVSA 3LM0A 3Q2JA 4U42A 2ITPA 2W1CA 4GG5A 4JDHA 3AC4A 3W16A 2W1GA 4RX8A 4YHTA 4HGLA 1TQIA 1ERKA 2PY3A 3EYHA 2X2LA 3GEQA 2QKWB 4I6FA 3B2TA 5H2UA 3O7LD 2BZKB 4MBLA 2QHNA 5EHOA 3ZSHA 4WBOA 1FVVA 2CGVA 3S1HA 4LGDA 2PUNA 5M08A 5CXZA 3TUBA 4FV1A 5L6OA 3QRIA 3F2NA 2OF4A 4XS2A 4BY9E 3JY0A 2YCRA 3EOCA 3OWLA 4IQ6A 2QO2A 4QOXA 4AS0A 4AZEA 4BKZA 3LE6A 5FLFA 3NIZA 2C6KA 2CJMA 2OO8X 2XM8A 3HL7A 2B9FA 2XEZA 2OFUA 3PYYA 4M13A 4Q9ZA 2LAVA 3MH3A 4F6SA 2QI8A 3HYHA 1WVXA 3RZFA 2X39A 1TVOA 1K9AA 4QTCA 3R8VA 4OTQA 4FVRA 2WXVA 5J8IA 3PPKA 3FZTA 3RPVA 4C38A 3N4TA 3ORPA 2PYWA 1OKZA 3GQIA 3HRFA 4DH3A 4FOCA 2C3KA 4I5MA 1YWRA 3E8EA 4FIFA 2Y9QA 3V8WA 2C6IA 4FZ7A 3LFNA 5JFWA 2WQEA 4II5A 4Y46A 5TT7A 4GK3A 5HBHA 2R4BA 3VUHA 5JEBA 1JKKA 4FSYA 1QL6A 2NPQA 3DKFA 4FBXA 4UYAA 4X0MA 4KRCA 5EYKA 4DN5A 2WOTA 4K9YA 4F64A 2ETRA 4G5JA 3IOKA 4ERKA 3NVMB 4O7SA 2IVTA 2J9MA 3LVPA 3R1SA 1MRYA 4W4WA 4XCUA 5H9BA 3F82A 2V62A 2ZDUA 3OXTA 4OR5A 4RJ8A 2DS1A 4XG2A 4E6CA 3C4CA 5DN3A 4RJ7A 3RAIA 3W2PA 1Q5KA 1TQPA 4OTIA 4DGOA 4QPMA 5CAPA 4B8LA 5JFXA 3RMFA 4CKRA 4FEXA 4PX6A 1NVQA 2J50A 4L7FA 2ZB1A 4QMVA 3TWJA 2Y7JA 5DEWA 5G1XA 3W10A 4L45A 4AW2A 4ARKA 2YCQA 1OI9A 3QA0A 2OIDA 2XNGA 2C3JA 5E8UA 3GU4A 4EOJA 4AA0A 3FKLA 4CZYB 2I0EA 4U79A 4D2RA 4IHPA 4M3QA 5LMKA 3NNXA 3UVPA 2VWBA 4X2KA 4EOIA 5JT2A 1OBDA 1XH5A 3R00A 5AUVA 4ACGA 3BV3A 4BC6A 1JPAA 3P0MA 3QTWA 1YHWA 1M2RA 2OH4A 3DFAA 3H10A 3TV4A 3GVUA 4Q9SA 4JDKA 3K3IA 4DFNA 3G9LX 4RBLA 4AN2A 1J3HA 3BLHA 3UQFA 3BBTB 4M15A 2WMXA 3PWYA 4M84A 1GJOA 2VWUA 4FG7A 4CKJA 4L52A 4TNBA 4EBVA 4X3FB 3POOA 3G0EA 4IB3A 3NIEA 4BIBA 1H27A 3RCJA 4EH9A 1H26A 5CVHA 2OIBA 3HUBA 4IDTA 4DE4A 5J9ZA 2YIRA 2GHLA 3D7ZA 2XIKA 2XCKA 2HZNA 1YWVA 3D2KA 4FNYA 4IADA 4V0GB 4DH8A 4A9UA 4B9DA 5A9UA 4EHVA 4DCEA 3QXOA 3LJ0A 4J97A 4C2WA 4ORKA 2CKEA 4KWPA 1UU8A 3OS3A 2I1MA 4MCVA 3UIBA 4R7HA 1APME 2JBOA 2RSVA 4WA9A 4BDJA 2YFXA 3LJ2A 2G1TA 3I5NA 3QGWA 3BGQA 4FT7A 4JI9A 1I44A 3CS9A 3NSZA 2C1AA 4XG3A 3ENHA 2VO6A 5HG5A 5J95A 2W5HA 4FNZA 3S3IA 4IVCA 2CNUA 3TUCA 1PKGA 5EQEA 5C1QB 2BRHA 4GVAA 4AFEA 1JSUA 3QZGA 4KUJA 5HBEA 2EXMA 4I20A 4J99A 4CNHA 2CGUA 1Y57A 3IS5A 2VGPA 3KY2A 4HOKA 3QA8A 3TNPC 4AT4A 3FQEA 4QP9A 4BI1A 3K5UA 1L8TA 5E8SA 3D94A 4L3PA 4NKSA 4EK3A 4Z3VA 1H0VA 3H30A 4L67A 4RIYA 3DNDA 1OL5A 5CEOA 4JX3A 4PWNA 4EORA 4YC3A 1P5EA 3FYKX 4EOLA 2RL5A 3W55A
chains in the Genus database with same CATH superfamily
4NIFA 2BKZA 4U40A 2CCIA 5M55A 5HNGA 2XKDA 5AV1A 5F95A 4AZFA 3K3JA 2UZOA 4GU6A 4CMOA 3QZFA 2XA4A 3HA8A 2EB3A 4X7QA 3RHKA 2ZM1A 4BF2A 4E7WA 2FSMX 2VTQA 4G3EA 4MD9E 4O38A 2C6DA 4GH2A 5BQ0A 3AT3A 5AP1A 4WG3A 3TV6A 2OXDA 3ZFXA 3Q4ZA 3UNJA 2X7FA 1JOWB 4EK4A 2VWYA 2W0JA 3B2WA 1S9IA 4D58A 2ZMDA 4ITIA 4JL9A 1W2DA 3R22A 3BEAA 3DKOA 1REKA 3HKOA 2R2PA 3HX4A 3OCBA 4FK3A 4IXPA 4K0YA 5DHJA 4ACHA 4C61A 1JNKA 3HVCA 1FGKA 4F9WA 4UMUA 2HWOA 4DF3A 5BV3A 4EZ7A 1M52A 3MIYA 4FT5A 4AGDA 3DA6A 3PFYA 3Q5ZA 3U55A 1LR4A 4FTQA 1OGYA 1VJYA 4QP2A 3K54A 2QHMA 4M68A 4MD8E 4UZDA 3A61A 3O71A 2VN9A 5LVMA 3ID6C 1ZZ2A 2WTWA 4QMPA 2WOUA 4IZ7A 3EL7A 3D0EA 5D10A 3NEWA 4DFYA 3EN9A 1Q8YA 5FUTA 3A4OX 4IWQA 1UKHA 5DT0A 4O0YA 4JDJA 4Z7GA 3UP7A 1UVRA 3C0IA 2GDOA 2C6OA 3F88A 4MYGA 1WBNA 1Y8GA 2YITA 3PTGA 3QD3A 4I22A 3MA3A 4GRBA 4PPBA 5ETCA 5D7VA 3HMOA 1OIYA 3P79A 2I6LA 3TZ9A 3UGCA 2VO7A 1OBGA 5EHLA 4IX5A 3P9JA 3SXFA 3MY0A 1U54A 1TKIA 1YI6A 5HICA 3TXOA 3LFFA 4L43A 4L3LA 4ZTRA 2X6DA 2ZOQA 3FLZA 5AAGA 3DXPA 3E8NA 2YJSA 3EYGA 2JDSA 4V05A 4IIRA 4S33A 3PSCA 4EQCA 2X0QA 5D1JA 2EVAA 3G33A 2BDJA 1YVJA 4RVMA 4EKKA 4XV3A 3II5A 5K5NA 5HZNA 1ZOHA 3AOXA 4TRLA 4JG8A 3NPCA 4X6RA 5JZNA 3PVWA 4YTCA 4AAYA 4IWOA 2BMCA 4DG0E 5LMKC 2BDFA 2CLQA 5C26A 3I6WA 1G5SA 3FMKA 5AP3A 5ETIA 5JGBA 3UMWA 1RE8A 2IEWA 2IF8A 3C13A 4K18A 4QNAA 1ZAOA 4ID7A 5AP0A 4R6VA 4M66A 4RFYA 4BDDA 3RPOA 3SGCA 3OXIA 1NXKA 2PZIA 4FSUA 3CIKA 5BPYA 3F5XA 3CXWA 4JG7A 3U4UA 2W9ZB 4FGBA 3P4KA 3W8QA 2O0UA 2P55A 2PZYA 4YJPA 3O51A 4DFLA 4NL0A 1BL6A 1MRVA 1ZRZA 5G6VA 4DFZE 3NAYA 2BHHA 1ZYCA 3AGLA 3DK3A 1AQ1A 3WIGA 3QUDA 3PSDA 3H3CA 4NJDA 4EUTA 4FKIA 3D5UA 4L68A 2QLQA 2Y6MA 3KXHA 3R7GA 2WTJA 1U5RA 3VF8A 2W4JA 5L2WA 2VTIA 3KRJA 3QALE 2NP8A 3E8DA 4DHFA 5E4HA 3UVRA 2W9FB 3M2WA 5AV0A 3D9VA 5TF9A 2O5KA 3R8PA 3UO4A 4YTFA 3AXWA 3GC8A 4FEQA 2XRWA 3O23A 4WSQA 3QQGA 3BHTA 4H36A 4CFUA 1R78A 4CMUA 4J53A 3WZDA 2CGXA 3ZS5A 5BVDA 4D9TA 3UZTA 4O0SA 5AV3A 1XH4A 5TO8A 4A4LA 2XARA 3DQWA 3ZC5A 1XQZA 2WMWA 4CZUA 4J96A 3R02A 2JDTA 3U8WA 5CALA 2R0UA 5ICPA 3ZLWA 3EH9A 2VWXA 2PMNX 4M67A 3VUGA 2EXEA 5LJJA 5CNOA 4LOQA 2Q83A 2CKQA 4GYGA 2ACXA 3MDYA 2YHVA 3DS6A 3LIJA 5FM3A 5JN2A 1IA9A 4F08A 3ZLSA 4EJ7A 5IKWA 2OXYA 3ZZEA 3MJ2A 3MVLA 3RK9A 5L8KA 3PXRA 1IA8A 5E8YA 1YDSE 3EB0A 2HZ4A 4W4XA 4GYIA 3L9PA 4H1JA 4F9YA 1V0BA 3CKXA 3GU6A 1NY3A 4IM2A 5LCJA 4DEHA 4ZJIA 1ZMUA 2WMQA 4BCQA 2HY81 5CF5A 4QMNA 4MBJA 4I0RA 4PL5A 5DE2A 2A4LA 4CZTA 1ZMVA 4MAOA 4EOPA 4YZNA 4BVUA 4FEUA 3VULA 4YPDA 4J8MA 1YOJA 2HIWA 4BKJA 3Q04A 4R5YA 3SW7A 5HTBA 4QMOA 2PMOX 4ZY6A 4I6HA 4JVGA 4PMSA 2GPHA 2FSTX 2YIXA 3QWKA 3QCQA 3SQQA 1P4FA 4X2FA 4NCTC 3FMLA 3OD6X 3VS1A 4RZVA 2YZAA 4NUSA 5L3AA 4MH7A 4TYJA 5BVFA 4IX6A 3KF4A 4U43A 2R64A 4W4YA 4U81A 4UALA 3A60A 4L9IA 4GSBA 4NK9A 2C1BA 2W1HA 4AN3A 4YC8A 3QF9A 2VV9A 4BDIA 1CMKE 4AQCA 4ZTHA 3E3BX 3D14A 5KMKA 1VYZA 3JY9A 2XUUA 5EDRA 2QG5A 1PXMA 4BIEA 4GJ2A 2UW5A 1VEBA 2UZLA 5CU0A 4AW0A 2YWVA 2X4FA 3NCGA 1BI8A 1QPDA 1U5QA 3RCDA 2H9VA 4FSWA 4DYMA 2FH9A 2ITUA 2IW8A 3R71A 3ZTXA 4ONAA 3DK6A 4MWIA 2HXQA 4ZSJA 4MF0A 3SV0A 5L2TA 1A06A 2QODA 4O27B 1BKXA 3QU0A 3ROCA 1VYWA 5ACKA 2Z7QA 3ANQA 3NNVA 3NW6A 4QYHA 1ZARA 5GJFA 4A06A 4LV5A 5CSVA 4QRCA 4E4XA 3L9NA 4O0WA 4EONA 3KMUA 3NYVA 4UB7A 1AGWA 2C0OA 2GS7A 5KKRC 5LWNA 3HRBA 4FA2A 3IKAA 3HMPA 4B0GA 1YHVA 4BDGA 4F9AA 4FKTA 4CCUA 3F5PA 5LMBA 4QMWA 4WNOA 4F0GA 2Y4PA 3C4XA 3ZRLA 5K5XA 2E9UA 4G9CA 3OC1A 2QKRA 4RX7A 4AE6A 4BTMA 4QMYA 4DH5A 4EQUA 4NSTA 3KXZA 4GFOA 4PRJA 4R3CA 2XNBA 4FV0A 4HVSA 4DG3E 3RTPA 3HUCA 3VBVA 3FL4A 2XAOA 2ZV2A 4YBKA 2B52A 4BZNA 1UWHA 1REJA 2WMAA 4O83A 3H9FA 3EQDA 2OJGA 2WIHA 4FIJA 4KS7A 3IW6A 4U8ZA 1H1RA 3I0OA 4YZDA 5CAOA 3ATSA 4ENXA 4O7VA 4UMQA 3KB7A 2FGIA 3W32A 4KKHA 3FMJA 3ZUVA 4USDA 4DG2E 2J51A 5DT3A 1W8CA 4DC2A 3Q6UA 2WEVA 2XNNA 3N51A 3BHYA 4KB8A 4EH6A 4D2WA 4FR4A 3BZ3A 2Z8CA 1YDRE 2VU3A 1PXOA 2ITQA 3MTFA 4YHJA 1JLUE 5E91A 3W2RA 4X2GA 2P2HA 5A4CA 2PPQA 3PLAE 4FTKA 4TT7A 2JKKA 4I24A 2QOIA 4PMTA 3EN5A 3VRZA 2OJJA 1ZYDA 5IMEA 5CSPA 3LMIA 1QMZA 4O7WA 4G6LA 4P5ZA 3V8SA 4BGHA 5I9VA 3DGKA 1B38A 5AA9A 3AMBA 5FTOA 5TOZA 5FXSA 2X9EA 4FKRA 4RFZA 4FV5A 4KBKA 4NTSA 3ZLYA 3NCZA 3FZRA 4IACA 3VN9A 5I3RA 4CTCA 5CU3A 4AXDA 2VRXA 5KHWA 2ZV8A 4KKEA 4F9BA 3TKIA 3R9RA 4TN6A 4M7IA 4BTJA 3L8SA 3DPKA 4LFIA 3OY3A 4XHKB 4AX8A 3R8MA 2I0HA 4N0SA 1R39A 2BRGA 3ZBFA 4BJJA 4G6OA 2EB2A 2B55A 2ZDTA 3DXQA 3QX4A 3MFUA 1YRPA 2F9GA 2OSCA 2PL0A 2VTPA 3HMNA 3MY1A 3BHUA 3OBGA 4IAZA 5IA1A 4QP6A 1LPUA 4KRDA 2YM6A 5DR2A 2CMWA 3IONA 3TL8A 3HMMA 3T9IA 5HO6A 2ZVAA 3FY0A 2UW7A 4B8MA 3PZHA 4QQ5A 5IDPA 3SX9A 4TYIA 3SOAA 4EH2A 2H34A 1MQ4A 2RG6A 5IF1A 2O65A 3NZ0A 1YHSA 3QTZA 3UO5A 4FV9A 5JSMA 4F6UA 2OG8A 4BCFA 2GNHA 2UW8A 2PMIA 2W99B 4BDCA 4LMUA 1SMHA 4BCJA 3IDBA 4DHIB 4O7LA 3QBNA 3FWQA 1J7UA 1PW2A 4PDOA 3U9NA 3CR0A 4O4FA 3HAVA 3OW3A 5HG8A 2QR7A 2WQMA 4CFXA 3Q2MA 3DXNA 2GMXA 5E90A 5CTPA 4XNEA 5AIKA 1ZY5A 4N6YA 2PSQA 3VRYA 4A7CA 4HPUE 4WUNA 3KCFA 3OCTA 4U5JA 2WMRA 4D4SA 4BHZA 4C2VA 2B4SB 3I5ZA 4EH8A 2YJRA 4M14A 1FMKA 4S34A 3I7BA 5H3QA 5EK7A 4FT3A 3ZO4A 3CBLA 4DEEA 4MXXA 5FBOA 3DTCA 4OLIA 4ZTLA 3ELJA 4D1XA 2H6DA 4E6DA 3VQUA 1VR2A 4JNWA 5HNBA 1XHAA 4KD1A 5F20A 5A6OA 1H25A 4DFUA 2NNWB 1OPJA 1Z57A 2R0IA 3LFEA 4EHEA 1W84A 2X0GA 1ZLTA 4I6QA 4JQ7A 4FSTA 5DR9A 1JKSA 2Y6OA 1J91A 4P7EA 5E1EA 4ANBA 4QTDA 1KE9A 3H4JA 3OUKA 5IDNA 1PXLA 4I92A 4QQJA 2JAMA 2WQOA 3NNUA 3BKBA 3P08A 3P86A 4E6AA 1BX6A 4XRJA 1H28A 3QRKA 3DBQA 2HWPA 3MBLA 5FEQA 2LGCA 5CAVA 3F3ZA 4M69B 4A4XA 3ZBXA 2FSOX 4FV8A 4EOMA 3K5VA 4R1YA 5CANA 3OP5A 2A2AA 5AA8A 2HCKA 1KE8A 4IFCA 5BVNA 1ZYLA 5A4EA 4EBWA 5IQFA 2VTLA 4C4GA 2X1NA 1E1VA 3TT0A 2JDVA 3GC7A 3QRJA 4J52A 4L53A 3ZU7A 4YBJA 2BROA 1U59A 3HA6A 4FTRA 4TYHB 2CHLA 4EHGA 4ZLYA 1SNXA 2QNJA 4QP8A 4IH8A 1B6CB 3VQHA 1KWPA 3FZOA 2UVZA 4ZS4A 2X2MA 4FSNA 4M0YA 3ZO3A 5CF4A 2ZB0A 4FKLA 1QCFA 4GIHA 3R9HA 4HVDA 2WIPA 4FRFA 2QO9A 1OGUA 5AUWA 3PIZA 4FKJA 4U80A 3RINA 3C50A 4MXZA 2OF2A 3I1AA 3FEGA 1Q61A 3E3PA 4G31A 3R1YA 2BZIB 5HOAA 5J1WA 4FEWA 4FUYA 2VTTA 2REIA 2YCFA 1Y8YA 1OM1A 5C8NA 5CI6A 4FTOA 1UNGA 3VUMA 5IEYA 2PE0A 5L8JA 3FKOA 1WVYA 2ZM4A 4I0TA 4AZTA 4XEYA 2CCHA 3R2YA 1XR1A 2XMYA 5J9YA 3P7AA 4BCKA 1PKDA 1PXPA 4YZ9A 4PTCA 2H96A 3NUXA 3KF7A 3BGZA 4KSQA 4BWPA 3V5JA 3ULZA 3RJCA 3MFTA 4ZLZA 2B7AA 4F1TA 3GI3A 4HYIA 3OTUA 4RJ4A 3LLAA 1Y6AA 3CE3A 4JLCA 3W2CA 1ST0A 1SVGA 5IQGA 4EK5A 2YAAA 3V5LA 4EZ3A 4AA5A 2YERA 1Q4LA 3BELA 4QQTA 2YDKA 4U45A 3PA3A 1XJDA 2PVRA 1DI9A 5BYYA 2C5OA 4YTHA 2Y8OA 3PRIA 3DAJA 3W18A 2E2BA 5ANEA 5LMAA 3SHEA 3P23A 5KBRA 3U6IA 4ZTQA 3ZMMA 5DVRA 3ZSIA 3S2PA 3IG7A 5A4QA 1KUTA 3B8QA 4G1WA 3UDZA 5J7BA 2QOKA 1PXNA 3DY7A 5M57A 3ANRA 4DFBA 4CV8A 3SD0A 3EFWA 4BDHA 1OITA 4XYFA 1FGIA 4HW7A 2E9PA 3S00A 4C34A 1YXUA 5M06A 2J0MB 4K8AA 5GJDA 1J1CA 3E7VA 4DEIA 3QYWA 3UIMA 5L6WL 4D55A 3U51A 4AW1A 5LWMA 4R3RA 4XOZA 1CKJA 5EYMA 3MJ1A 5TE0A 3RNYA 3UE4A 2ZAZA 3W2OA 3Q96A 2XK6A 3D15A 3Q9ZA 1OIUA 4PNKA 1M2QA 5CT7A 3FLSA 3VBWA 2UZWE 3GBZA 2O2UA 3WZKA 2W7XA 2GS2A 4PP9A 4KA3A 5A46A 5IQHA 1WVWA 2DYLA 5C8KA 4F63A 1KOAA 3DAEA 4JX7A 5A4LA 3HP5A 3AKJA 4O7TA 3M42A 4Y5HA 3IW8A 1B39A 2JGZA 4IX3A 3VW8A 5HO8A 4EH7A 4Z55A 2V7AA 1W83A 1YQJA 3QZIA 5L2IA 3I6UA 2HXLA 4G3CA 4C3PA 4DDGA 3CGFA 3WOWA 3Q9YA 4LL0A 3Q4CA 4XG8A 3QCXA 4FICA 3NVKI 3UG2A 4RVLA 3H9RA 3NYOA 5F9EA 4FYNA 3O5AA 1WBOA 3LQ5A 5TR6A 4AW5A 1SZMA 2YIWA 1V0OA 4NKAA 4D4YA 1YI4A 3CPCA 5FD2A 5IUGA 5EI2A 1RJBA 3E7OA 2YEXA 3F69A 3IDPA 3NS9A 3GC9A 3LCKA 4FG8A 3BPRA 4LGHA 4TWNA 1O9UA 4U97A 4E5WA 5LVOA 4BYIA 1E9HA 4Z9LA 5JFSA 2I0VA 4RMZA 3R7YA 3FC2A 4I3ZA 3ULIA 5IUHA 5JGAA 5J7HA 3KIOC 4Q5EA 3QQLA 4E3CA 2A98A 3KC3A 1FPUA 4BDBA 1J7IA 3TYKA 3ALOA 1MQBA 4FSZA 4FJVA 4L6QA 1V0PA 2YM3A 3ZO1A 2ERZE 2GNIA 4LRMA 1ZYJA 5IQEA 1P4OA 3HV7A 3HAMA 4A9SA 2QOQA 4TWOA 2DUVA 4G34A 5CYIA 5LXMA 1TZDA 1GNGA 1QPEA 4YZBA 3MV5A 3LKMA 3ORKA 5BVKA 4HGSA 3BYUA 3OFMA 1BMKA 2BIYA 4QNYA 4HZRA 1ATPE 3UOHA 1TQMA 3MVJA 3TZ7A 5CU2A 3R83A 3RK7A 3VO3A 1RQQA 4HJOA 3Q4UA 5M51A 3A7JA 4QPAA 4AP7A 4RIYB 3UPXA 4MQ1A 3TN8A 1ST4A 2YDJA 4YLLA 2NRUA 3ALNA 2QO7A 4BCIA 4JS8A 1NA7A 5CWZA 5BMMA 3GU7A 3KN5A 2FB8A 2F7XE 2YDIA 3LXPA 4AWIA 4GG7A 4WG5A 4EWHA 3BQCA 2CN5A 5IH6A 3LQ8A 1CSNA 3KGAA 1UNLA 2C3IB 3CJGA 3EJ1A 3KRRA 4FKQA 4MX9A 3BIZA 5DNRA 5LVLA 2C5XA 4EYJA 5A14A 3R8ZA 4M12A 4XG6A 4I5PA 2VNWA 3KVWA 3MB6A 5IISA 3QX2A 4FIGA 4W4VA 4ZEGA 5E7RA 3BYOA 5K4IA 4FIIA 2ZV7A 2XKCA 4NWMA 2XNOA 4MBIA 3DQXA 2X9FA 3BHVA 5FP5A 2WQBA 3EN4A 1OVEA 5HTIA 3WYYA 3G51A 2UZTA 4AT3A 5C01A 4M8TA 2GSFA 2GTNA 1BI7A 4D5KA 2PVHA 3DJ7A 4WD5A 3GCUA 2J0KA 2VD5A 3FMMA 3GOKA 4PDPA 4XRLA 4Y72A 3V5QA 3BYMA 3MS9A 2ITZA 2PUPA 3QHRA 3ZFYA 3DU8A 4FV3A 4LUEA 4XV2A 3VHKA 1OIQA 4JJRA 4Y85A 3CP9A 4X6QC 2R7IA 4RIWA 2VUWA 1XKKA 4DFXE 5FM2A 3F3WA 3UDBA 2UVYA 5BUJA 4QP7A 5GZ9A 2OLCA 3W0QA 4ZLOA 1XH7A 2XNPA 5CENA 4CSVA 5EH0A 3TCPA 5IQIA 4DTAA 3VS5A 3E63A 3QTSA 1H1QA 4HYUA 4YHFA 3HEGA 4F65A 3VS6A 3V6RA 5L8LA 4IDVA 2R3HA 5D9HA 5CAQA 2QQ7A 3CSVA 3OUNB 1F0QA 5EW8A 4DT9A 1U54B 2XS0A 4H1MA 3SAYA 4AFJA 5AFVA 3R8LA 4GVJA 4RWIA 4O91A 3N9XA 2WELA 4JDIA 5AR4A 5GZ8A 3CQEA 3A7GA 3UQGA 3CY3A 2VGOA 4FTTA 4HCUA 3BE9A 3EKKA 2HZ0A 1VLRA 3CQUA 4DBXA 5DRBA 4P5QA 3ORXA 4KKGA 3TTJA 2GNGA 3LFQA 5CZIA 4BZDA 1SNUA 3DKCA 2GU8A 1GZKA 1PF8A 3ZZWA 4IB1A 1H00A 2JBPA 3D5VA 5FDPA 3CD8A 1ZOEA 4F0FA 3ODYX 3RVGA 3LFSA 1KE5A 3JR1A 3UYSA 4KSPA 3OROA 1ZY4A 2RF9A 5EM5A 4AOIA 2IPXA 3UQCA 1YXSA 5ANJA 4ANQA 4XX9A 2VZ6A 2XJ0A 4D4RA 3CEKA 2BPMA 4ANNA 2J0LA 3V04A 2VNYA 5AP4A 3UOLA 2E9OA 3RP9A 4NCTA 4I93A 3H0ZA 5DLSA 4FNXA 4W9XA 3UODA 3EQCA 5HTCA 3VF9A 4O4CA 2JKOA 3WF9A 2YIQA 2B54A 4WO5A 3W8LA 2EU9A 4ACCA 3VUKA 5M4FA 3IPHA 3G90X 4KIQA 2KTYA 3PJ2A 4S32A 3HNGA 1H1WA 4QMZA 2UZUE 4E8AA 4ZSGA 2OWBA 2O64A 3CGOA 2FO0A 2X0PA 4RX9A 4O81A 5ETAA 3GOPA 3MYGA 2Y0AA 5AUZA 5GINE 5IQDA 4IFGA 2BIKB 4C36A 1LUFA 2HW7A 2AC5A 2I0YA 1RDQE 3S0OA 4NM3A 3U87A 4X3FA 4BI2A 4PQNA 2BVAA 2IVVA 1TFFA 2J5FA 4L01A 4CEGA 3TI1A 5IEVA 2B53A 4AOJA 4XBUA 3Q60A 3PG3A 2HOGA 3BEGA 4QDVA 4W8DA 4ASDA 3EQGA 2HW6A 3F3TA 5CX9A 3R7EA 2EWAA 5KBQA 5EQYA 5IZFA 2PHKA 3FZPA 4L44A 2EUFB 3MN3A 4FV2A 4IAYA 4NM0A 3KK8A 2OZOA 1OMWA 3GFEA 4GEOA 3WI6A 2V7OA 4YSJA 3QRTA 4WG4A 1UV5A 3BBWA 3BX5A 3KXXA 2WTVA 4EK8A 3V5WA 3ZEWA 3ZLXA 4GUBA 3PFQA 1H0WA 2EXCX 3GXLA 3UP2A 2XANA 2BRMA 2C30A 2HK5A 4JRNA 3TIYA 2QU6A 4EWQA 5BMSA 4O7ZA 2AC3A 4OW8A 4XUFA 1W82A 2YN8A 4ZZMA 3C4FA 3OY1A 1NT2A 3QC4A 4FTLA 2C5VA 5EDQA 3DBDA 4C33A 2WQNA 4YMJA 3LMGA 4ERWA 3OBJA 4MEDA 4TWPA 3ZO2A 4FTIA 4CFMA 3GT8A 4H3QA 4WT6A 3COMA 5AP6A 2XALA 1XBCA 4ZP5A 4ZZNA 4WNKA 3O8PA 2GHMA 2PU8A 1W0XC 5AR7A 5K4JA 5FRIA 1GZ8A 3QHWA 3U4WA 5LOHA 4XP0A 1OUKA 1GAGA 3IW5A 4CLJA 2QLUA 3KMMA 4YP8A 1XH9A 4RT7A 4IWPA 4F7SA 1UU9A 3DLSA 3RAHA 4QO9A 4TPTA 2XH5A 1DI8A 2WAJA 1NVSA 4P4CA 3FPMA 3QTQA 3P5KA 3R01A 1DAYA 4OT6A 1LEZA 2J5EA 3I7CA 4FX3A 5GNKA 3P78A 3UC3A 3FE3A 4C8BA 2IZRA 2YA9A 1CDKA 5HU3A 4AXFA 3UG1A 5EYCA 4ASEA 2PVJA 3WE4A 4OTHA 4J7BA 4LOPA 4QQCA 3RPRA 2XM9A 4YJVA 2O8YA 4KIKA 4CFFA 4YR8A 5AAEA 2W96B 3O8TA 3PLSA 4GFGA 3NUAA 3CY2A 3ZXZA 3U54A 3LFAA 2F2UA 1KE6A 4G3GA 2R3GA 4O21A 3RAKA 1PMNA 1YXXA 3AD4A 3IO7A 1XWSA 4GW8A 3PUPA 3VUTA 2O3PA 4FOBA 5GJGA 1OPLA 3GENA 4FUXA 4BDEA 2A19B 3UIUA 2BRNA 4DLIA 4PP7A 4ZAUA 4WNPA 4Y83A 2XIYA 3WYXA 1ND4A 4QYGA 4LDTA 3FYJX 4ZSLA 3CD3A 3BYSA 2C0IA 4H3BA 4JBVA 1R3CA 2XK7A 4KBCA 4Y8DA 1JSTA 4ALWA 4EH4A 3FHIA 2XKEA 4ZJJA 2CKOA 3PXYA 3KA0A 2Z02A 3UNKA 3H0YA 4BB4A 5HE2A 2Z2WA 2UW0A 3SXSA 2RFSA 2I40A 4PMPA 3DJ5A 5DT4A 1A48A 3HV5A 5GHVA 3D7TA 3FV8A 4CYIA 3K2LA 3JVRA 5BVWA 4ANMA 3SRVA 4MXYA 3DV3A 3FI3A 4JBPA 4HYHA 5FTQA 5ANGA 5KZIA 3AGMA 4K1BA 3TZ8A 4EOKA 4TZRA 3E88A 3VNTA 4FZAB 3MA6A 4RIOA 4O82A 4V04A 4CCBA 2B9IA 2C0TA 3S95A 5IQBA 3A7IA 3OG7A 2XZSA 3FSFA 4LQMA 3CKWA 3UDSA 4BDAA 1Q8ZA 4X3FC 2AUHA 3ORLA 4NZWB 3LHJA 5ANOA 1Q8TA 5EW3A 2P3GX 4EC9A 1WMKA 5CU4A 5E1SA 3HV4A 4ZY5A 3FAAA 4X21A 2WHBA 4MNEB 2YLFA 4BBEA 4YLJA 4IX4A 3TG1A 2JFMA 4BJJB 2AEGA 3NX8A 3WF8A 4CRSA 1UKIA 5KMMA 1STCE 2A27A 3R7IA 4XP3A 5B2MA 5EM6A 4D2PA 4UZHA 5C4LA 3CPBA 2QOFA 5EI8A 4ACDA 2BKKA 4TXCA 5DEYA 4O1OA 3ZHPC 4DH1A 3NR9A 3PP0A 4O6LA 5M53A 4F09A 3SW4A 3ACKA 4C35A 2BTSA 3ORNA 1KOBA 2F7ZE 4KNBA 3ERKA 2IWIA 3EQFA 3FKNA 3PZEA 3F5UA 4QP1A 4O22A 2QC6A 1PXJA 2ITNA 3NRMA 4FNWA 4IW0A 5CSHA 2V22A 2X8EA 3E5AA 2QU5A 4AU8A 3KULB 4CT2A 5AWMA 3UVQA 5BVOA 3BGPA 3I0QA 3RK5A 3NGAA 4NFMA 5J79A 5DMZA 4NEUA 3L8PA 4BTFA 4C58A 3QCYA 4CQGA 1R0PA 3PJ3A 1UU7A 1OIRA 4IM3A 5CI7A 3QL8A 5IUIA 4DGGA 5HORA 3ORIA 3W0MA 3R63A 4YZCA 5FP6A 1JBPE 2WTCA 2X7OA 4PTGA 4CG8A 4FSRA 4E5AX 3BRBA 5CT0A 1U46A 3HLLA 3UOJA 5EM7A 3NYXA 2WO6A 1OPKA 1SYKA 3VS0A 5DA3A 3V6SA 2UW6A 4JBOA 3R7UA 5HQ0A 2R3FA 4DA5A 4X3JA 5HVYA 1Q97A 3QCSA 2BUJA 3DZOA 3ORZA 1L3RE 1H4LA 4ANOA 4C3FA 4E4MA 5FG8A 5DIAA 3A8XA 4U3YA 3TM0A 2RIOA 3HGKA 4L8MA 4PV0A 3KU2A 1I09A 3SKCA 4NW6A 1F3MC 5AAFA 5M44A 5B2LA 5M4IA 3SG9A 1G8SA 3TNWA 4PNIA 3R28A 5CU6A 5KZ0A 1PRYA 3KXGA 4MK0A 3MFSA 3GCSA 3QQKA 4UV0A 2QURA 2VX1A 3C4WA 3MPMA 3F5GA 4OGRA 1GZNA 1YWNA 2X8DA 1IASA 3F61A 4S30A 3UNZA 3VS2A 4HPTE 1WBSA 1X8BA 1UWJA 5DBXA 2C68A 2P4IA 2XIZA 2Z7SA 4NM7A 3C1XA 4QMUA 1FOTA 2WMTA 4RG0A 4C59A 3PIXA 4YJOA 1J7LA 3R6XA 3G0FA 4WOVA 2W1EA 3BU6A 4R8QA 3PA4A 2IW9A 5BUIA 4FMQA 4FC0A 4F78A 4RZWA 4YJNA 4N70A 3LFCA 4DEGA 2CLXA 4XV1A 4OAVB 1H08A 4E93A 5KMJA 4RC4A 4XBRA 1Y91A 4XLVA 2OBJA 4U44A 5EKNA 3H9OA 3KN6A 4FG9A 5BVEA 4NU1A 4J1RA 4HZSA 1XMMA 4ZMEA 2XB7A 3TMOA 4A4OA 3R1NA 4ZTSA 1DM2A 2IO6A 3R21A 2WTDA 3RM7A 4Q2AA 2YM8A 1GIIA 3F7ZA 3P7BA 4E73A 4EQMA 2GNFA 3W0SA 2IVSA 4GK2A 3ZRKA 4RVTA 3VW6A 3ZXTA 4G5PA 4G16A 5E8TA 4L7SA 5CF8A 4NW5A 3BHHA 3R1QA 4WHZA 2QOBA 3A2CA 4YSMA 1PYEA 5BX0A 4OBPA 3EKNA 4IE9A 3UBDA