1M2PA

Crystal structure of 1,8-di-hydroxy-4-nitro-anthraquinone/ck2 kinase complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
325
structure length
325
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II, alpha chain
publication title Inhibition of protein kinase CK2 by anthraquinone-related compounds. A structural insight
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 107
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2002-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1m2pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1m2pA01
4DH3A 3LMGA 2BALA 3HEGA 1ND4A 1P4OA 5C4KA 4ID7A 4OTIA 3NEWA 4O96A 3HKOA 4L43A 2WMWA 4J8MA 4R3PA 2IVSA 3QCSA 3DFAA 3OD6X 3VO3A 4LGGA 2X9FA 4OTRA 2YM5A 4I6HA 3E64A 3LM0A 3SHEA 1U5QA 2CPKE 1T46A 2V0DA 4L01A 3DCVA 2OZAA 3LXKA 4NW6A 4AE9A 3HX4A 2VWVA 4QYEA 3RJCA 4H39A 4BY9E 4FIEA 5CXHA 3HV5A 3EQHA 3F7WA 5E8XA 3QHWA 4HVDA 4FKVA 5DR9A 3UTOA 3ZXTA 3IDCA 3LCKA 3EN6A 4O2ZA 3R04A 4PF4A 1MQBA 3R7GA 3FSKA 4FIJA 4F0GA 2DQ7X 3FLSA 4GUEA 3RALA 2VTRA 3VBQA 3COIA 3BQRA 2WIHA 5HTBA 4FV8A 5CEKA 3TXOA 5DEWA 4QP1A 5AV0A 2WTJA 4CKIA 2OG8A 3D5VA 3MBLA 2HXQA 3UODA 1Y91A 3I79A 4GFGA 3TV6A 1CSNA 1H28A 5DYJA 2OICA 3QC4A 2WB8A 2XCHA 4YJTA 4KAOA 3U9NA 3QZFA 4E1ZA 1PJKA 3LFQA 2YEXA 1W82A 3ORXA 2WMVA 4FV4A 3GBZA 4XCUA 2NP8A 2IZTA 3HLLA 3BGZA 4YJSA 1PYEA 4DH1A 3HAVA 2ERZE 2WXVA 5IQCA 3H0ZA 4WT6A 4BCMA 2XYNA 5LCKA 4L3LA 1W8CA 2FB8A 4NTTA 4LRMA 2RF9A 3D94A 5HE1A 5J79A 3MVMA 5L8JA 1Q41A 4GV1A 4PPBA 4W4VA 3DZQA 3W18A 1OPJA 1R39A 3PJ2A 4DF3A 3NIEA 5IKWA 3AT4A 3FYKX 1H24A 3ZBFA 4QQTA 5J7HA 4EH9A 3TKHA 3FEGA 4AQCA 5FM3A 5HI2A 3LFEA 4MXXA 4Z9LA 4Z16A 4S2ZA 3RP9A 3BHYA 2GNIA 5LOHA 2O3PA 3AD4A 3GCQA 2CMWA 2OXYA 2JKMA 3WF6A 4F1TA 4DT9A 3QKKA 5DLSA 4D0XA 3EQFA 4G5PA 4KWPA 4NJ3A 2Y4IB 2ZM1A 3A60A 3PA4A 5CSWA 3ELJA 4U97A 1NW1A 4E5WA 3QLFA 4G6NA 3PUPA 4FX3A 4O6LA 5JKGA 3GU5A 3A8WA 3UVQA 1KOAA 2QO2A 3IW8A 4QP6A 1BI7A 3WF9A 5IQBA 3D7TB 4CD0A 3SXRA 5BUJA 4E73A 3UJGA 5CAUA 3OHTA 4QP2A 2R64A 5AAGA 2J0KA 3FLWA 3R22A 5DEYA 3RPRA 2QNJA 4FOCA 5EHOA 3V04A 2O5KA 5I9WA 3MA6A 1ZZ2A 4FV1A 4KABA 1OECA 2ZJWA 1ZYJA 5DGZA 4KD1A 3EQPA 4MKCA 3LJ1A 4W9XA 5E7RA 4AGUA 3IO7A 4FIGA 3BV3A 3VUHA 3KRWA 1LR4A 3QL8A 1ZYSA 2ZB1A 2FSOX 4NW5A 4O0WA 3FI8A 5AX9A 3QD3A 4CFUA 3OVVA 4GJ3A 2R3MA 2UZBA 4GT5A 2BDFA 2VTOA 5BMSA 5BQ0A 1MUOA 3FLYA 3R73A 4GVJA 4Y83A 2GTNA 4NJDA 3KMWA 4LL0A 5HE3A 4E8AA 5JMSA 1SM2A 3MFRA 4IWPA 2X7FA 5AWMA 5BVNA 4FVPA 4LYNA 4D2VA 1A48A 3MI9A 4O0XA 4XG2A 4V04A 3O96A 1G5SA 4OBQA 4QD6A 3AC2A 4AU8A 4L3JA 5LARA 5AUZA 3I4BA 4IZ7A 4RVMA 1QPJA 1M2RA 1JSTA 3GNIB 4L45A 4I93A 4G34A 2AUHA 4ASZA 4BCOA 4EORA 5KHWA 3GCVA 2W05A 5EM8A 2YLFA 4RJ7A 3ZUVA 5AR2A 4HNIA 2OGVA 4ZMFA 2VTQA 2FH9A 5CSXA 3FYJX 3WILA 3OXZA 3C7QA 3AMYA 4FZAB 4IVDA 3BI6A 5K9IA 2C30A 4CMOA 4HW7A 3BKBA 3NCGA 4KIKA 5CU4A 4BGGA 2OF4A 3RHKA 2AYPA 4CT2A 1URCA 2QOHA 3PSDA 3GB2A 2IW6A 2OZAB 3G0EA 3GU8A 4NH1A 3KN6A 4K33A 2ITVA 4FSZA 3CS9A 4LM5A 4QPSA 4YZBA 3O8UA 2YFXA 2C5OA 3PRIA 3NZ0A 1NVSA 4K6ZA 4QP9A 1XJDA 3GGFA 5FP6A 4FEWA 3WIKA 3Q6UA 1UU8A 2R5TA 1ERKA 5CAQA 1T45A 3FE3A 3PE2A 4QOXA 2FGIA 5E8TA 3HV4A 3FUPA 2XH5A 2BCJA 3KMUA 2ITNA 4WBBB 3SOCA 3LE6A 4FKJA 4S30A 5HLWA 3NUAA 3KFAA 3C13A 4FT5A 3EWHA 4EH2A 3TDWA 3BE9A 2UVZA 3ZHPC 4JQ8A 3OWPA 4UWBA 3TJDA 1YHWA 5H8BA 3WYXA 4HCTA 1UU7A 1BKXA 3FV8A 4C02A 1M2QA 4C57A 1SNXA 5JT2A 3OG7A 2WKMA 2XS0A 4BDEA 3HZTA 4DN5A 3UIBA 4BDGA 2NNWB 3DNEA 4CT1A 1IAJA 3DZOA 3MS9A 3OTUA 3VF9A 3ZSGA 2PVJA 4YLJA 1YW2A 4TNBA 4YZ9A 1WZYA 3DK7A 3UG1A 2HY0A 2E9UA 3MDYA 2YAKA 1RQQA 3OW4A 4GK3A 5E8VA 4BB4A 2QOBA 5EDQA 3JR1A 2BAQA 2GNHA 3Q53A 4U80A 1PMUA 2C4GA 2I40A 4FKGA 3KRLA 4H3BA 4QRCA 5M53A 3KULA 4CFNA 4FSWA 2JBPA 3I5ZA 4G16A 1XH4A 2GFSA 3TNQB 2C68A 2WMTA 3QGYA 2G1TA 3R7YA 5C8KA 5IH4A 5J1WA 1RW8A 1LP4A 3EQDA 4YU2A 1YOJA 3BYOA 4YC3A 1B6CB 2B1PA 3HP2A 3V5WA 5KO1A 1KUTA 5CX9A 3PIZA 1ZY5A 5HBHA 1QCFA 1F0QA 4RWJA 2AC3A 4QMQA 2Z2WA 2Z02A 2W96B 2YA9A 3OY3A 2B9IA 4U6RA 2OSCA 4CFMA 5K0XA 2O64A 4M3QA 2C5VA 1H00A 4NFNA 5IUIA 4GU9A 5J87A 3R1NA 2RIOA 3NYXA 2WZJA 2UZTA 4FG7A 4AT3A 4DAWA 3R8UA 3DK3A 4DA5A 4IIRA 2WPAA 4U7ZA 4XX9A 4ACGA 2X6EA 4DGMA 4QMOA 5A6OA 4DFUA 4DH7A 1MQ4A 5AR8A 4O0RA 5JRQA 3T8OA 4II5A 2O8YA 3UO4A 3AT2A 3FXZA 5IQIA 3NPCA 4LGHA 4TWNA 4UV0A 3NNXA 4D4SA 2F57A 3TZMA 5IUGA 3NMUF 1U4DA 3V6RA 1FINA 3NVKI 2YAAA 3R8VA 5IA0A 4FL2A 4CG8A 3FL4A 5FG8A 3AC5A 3FLQA 3VUIA 4KIOA 4UB7A 4RA5A 4BICA 4MD8E 4TYJA 4FTMA 3QAME 1YWRA 3BHHA 2EVAA 2XM9A 2ZMCA 4IWDA 5E1EA 2WGJA 4FSQA 3Q04A 3Q9ZA 3ZRKA 4ZTSA 2CNVA 3A61A 4CZUA 1G8AA 5IA3A 3F3ZA 2WTIA 5DT3A 1Q62A 3FMEA 4BR3A 1WBTA 3Q52A 3RZBA 3E63A 3ZUUA 3IONA 3WIGA 4ACCA 4BDDA 2PZPA 4IDVA 3QQLA 5EYKA 5DI1A 3DB6A 4C4JA 4XG4A 3UIMA 2VV9A 4EYJA 5I0BA 5D7AA 4YP8A 2ESMA 4I5PA 4NIFA 3WZKA 3PXKA 1DAWA 3MY0A 5LJJA 4G2FA 5HIEA 2R3QA 4LG4A 5A14A 4ANQA 1ZYDA 4I5HA 1OKZA 2OO8X 2C6KA 4MTAA 4DH5A 3QCYA 2VNWA 5HE0A 3LVPA 2OJJA 2B9HA 3IGGA 4BCFA 3LIJA 4CKRA 1H08A 4FE2A 3PXYA 4UN0C 1ZZLA 5EOLA 5L8LA 2DYLA 1OZ1A 1SMHA 5CNOA 3FMLA 2XRWA 4MQ2A 3EMGA 4XH6A 5ETAA 4KIKB 4AUAA 3PP1A 1MRYA 3BWJA 2G2FA 3SLSA 3ZSHA 1LEZA 4YO6A 3I5NA 4TN6A 5ANEA 2QC6A 3D9VA 4GUBA 1F5QA 5IQFA 2BILB 4KA3A 3VS1A 3BQCA 4EUTA 3GT8A 2B52A 2R7BA 4OLIA 4RIWA 5E8SA 5GJDA 3UP7A 4LFIA 5LVLA 4EKKA 3ETAA 3HUCA 4XG3A 3QALE 1GZNA 5GJFA 3EYGA 3NCZA 5EQYA 2FUMA 4MXYA 5EOBA 2CN5A 3EQGA 4DEDA 2WQBA 4NKSA 2ZV8A 4NT4A 2UW6A 4EK8A 4QYGA 4G6OA 3MIYA 3DNDA 1W98A 2H9VA 3R00A 1DS5A 3BU3A 4X7QA 4FYNA 3W2PA 3KC3A 3LLAA 4OT6A 4JLCA 3T9TA 1MRVA 2YDKA 4TYEA 4Y46A 3VN9A 4S33A 2UW9A 4YPDA 4GT3A 3DAEA 4EHZA 3EQIA 3TL8A 1OI9A 3SD0A 4FZ6A 2ZVAA 3BLHA 2HIWA 4IFGA 4JBQA 1H07A 2ETRA 4EOOA 4ANMA 4FNXA 2GHLA 3N51A 4QYHA 4RVLA 3NW6A 4XBRA 5CI7A 3P7BA 2A2AA 1ZAOA 5L2IA 4O7WA 3H4JA 5AP0A 1NVQA 1QL6A 1UNGA 3LQ5A 3QTZA 5ETCA 1JSVA 2XNOA 3IS5A 2CCIA 3UGCA 3MPTA 2GMXA 2OU7A 4G3EA 4QMUA 3SX9A 3VQHA 3DFCB 4AN3A 3KULB 4G3CA 1ZLTA 4RA4A 3DDPA 3K5UA 4IHPA 1IAHA 4J8NA 3SA0A 3U55A 2BDJA 3K54A 5JZJA 3RWQA 1H0WA 4Y8DA 3LFNA 3TNHA 3TKIA 4YZMA 4ZTRA 3GOKA 4XEYA 3NUXA 4FZ7A 5FEQA 3VS4A 5M07A 2Y6OA 1ZARA 4TYIA 3PSCA 2JDRA 1KE5A 3PJ8A 4HPTE 2XJ2A 2YDJA 3NYNA 2VWBA 4RJ4A 2BR1A 3JPVA 5GINE 5EYCA 1K3AA 4AOIA 4KSPA 4O83A 4IZAA 3O7LB 4EH6A 1R0PA 4YTHA 2EXMA 3OZ6A 5C4LA 1TQMA 3BZ3A 1H1PA 3QCQA 4WNOA 4X2FA 5EI6A 4IW0A 1PKGA 1NA7A 5E8YA 4HGTA 2CJMA 3QTWA 4XV3A 5EW9A 3LQ8A 3M1SA 4U43A 2Y4IC 3RI1A 2WMSA 3E5AA 3UZTA 4O91A 2UZOA 2YN8A 5H3QA 2F7ZE 4FVQA 4BTKA 5E9EA 4JBPA 3LCOA 5J8IA 5HNIX 3VUKA 2XUUA 1H1SA 4Z3VA 4MBIA 4TW9A 4AF3A 4EEVA 2GQSA 3G6GA 1H27A 4AX8A 2OI4X 5HX6A 3RKBA 4IWQA 3MY5A 2E2BA 2R3PA 2OJ9A 4GIHA 1CTPE 3DBCA 4DFBA 5CT7A 2EB2A 3CP9A 3SOAA 3DXNA 4K11A 4YJPA 4NU1A 4RFMA 2F7XE 4IZ5A 4WNKA 1PXLA 5IQHA 2QU5A 3GP0A 4RJ3A 5GZ8A 2XJ0A 3ZO3A 3UC3A 5EK7A 3DOGA 2QOOA 4KNBA 3RAIA 3QRIA 2WTVA 3BHVA 4LRJA 4RX7A 5ANGA 3LFCA 3QQFA 5L8KA 2W17A 5ITAA 4JS8A 4K2RA 4TPTA 4JJRA 4YO4A 1KWPA 3A7JA 5HIBA 3AC4A 4EZ5A 4CCBA 3UQCA 5CWZA 4ZK5A 4FTCA 4M13A 1CKIA 2X6DA 3CKWA 1OIRA 3SC1A 3UOKA 1URWA 3FQHA 4NIFB 4IM0A 3W8QA 4YHTA 4FI1A 4KBKA 4RJ8A 2JC6A 3JY9A 2WFYA 5GIOE 3O50A 2VZ6A 2YM6A 4UZDA 2PVYA 4O7LA 3LMIA 3UDBA 3R21A 3LW0A 2EXEA 4P2KA 1XBAA 5KMLA 5JGDA 2PUIA 1QPCA 2JDVA 3UVRA 4HYSA 4PRJA 4XYFA 3OS3A 4DEHA 3NSZA 5E90A 4WUNA 3CTQA 3LJ0A 3RAHA 5L6PA 2XZSA 5A4EA 2ZOQA 5E1SA 4ZZMA 5HCXA 3C5UA 2W4KA 4CKJA 4KKHA 5D12A 3RVGA 2WMBA 2GPHA 3FZSA 4GEOA 5HD4A 3VRZA 3L8XA 3GC8A 1EH4A 2DWBA 3H9OA 4RIWB 5HG8A 3PA5A 5TOZA 2QOQA 4ZY4A 3BELA 3WF5A 3O23A 2KTYA 4Q5EA 4C61A 3N9XA 2W1HA 4E5BA 2P2IA 3MH1A 2YACA 4FV9A 4HOKA 4MK0A 2JAMA 4FTTA 5E8UA 4F6UA 3MJ2A 2C47A 4RJ5A 4PP9A 5TT7A 3ZDUA 4TWCA 2JKOA 3PY3A 5HHWA 1Q8UA 2VN9A 2GTMA 2R3GA 3CPCA 3KVXA 4RQKA 1NY3A 5IU2A 4M15A 5EHYA 3TTJA 4FIHA 5DR2A 4DLIA 4D2WA 3R8MA 5C9CA 4NCTA 3R8ZA 1GIHA 5IQGA 4E4MA 3QXPA 3TIYA 3ALNA 4QMLA 3IGOA 4IH8A 3ZO2A 3CD3A 3JYAA 4HGEA 4BKYA 4C4IA 2XK6A 4EWHA 4ERKA 5AAFA 5I4NA 4GKIA 4A9UA 3SVVA 3Q4UA 1PXMA 3PXQA 4J98A 4UALA 4XG9A 3ORNA 4RSSA 3MB7A 1XH7A 3VS0A 4E4NA 3F3UA 3ZH8A 3N4VA 3CQUA 3CR0A 2OKRA 4ONAA 4E20A 3MY1A 3ZM4A 1KV1A 4XNEA 3ZLXA 2PPQA 1WBPA 4GT4A 4CLJA 4FGRA 4K18A 1Y6BA 3NNUA 3NYVA 1ZRZA 4MNFA 4O82A 2XK4A 3AT3A 2BTRA 4WG5A 5HNBA 5JGAA 4WO5A 4V0GA 4RVTA 5KZ0A 2VAGA 2C6LA 4FVRA 3Q2MA 4FSYA 1JKTA 2X2KA 3CQWA 3D2IA 4FV0A 2W06A 4BYIA 3ACJA 3TT0A 4EH7A 4UMRA 4OTGA 4O0VA 3QQKA 2RFNA 2XNEA 4R1YA 4XV2A 3UMXA 4UMQA 4CFWA 4CZYB 4HGLA 4FNYA 1S9IA 4ZMEA 2ITQA 3SDJA 1YHVA 3M42A 3RAKA 3V8WA 3DBQA 3LFBA 3MB6A 4QP4A 2VTTA 5K5XA 4IB0A 3RPYA 5C8NA 5IISA 4AW2A 4EZ7A 1BI8A 1CKJA 2BMCA 1PY5A 2C1BA 4MF0A 4B99A 4ZS4A 2UZNA 4DEIA 2YM4A 4W9WA 3FI2A 4C62A 3NUUA 3QYZA 5KZIA 1OIYA 3VWAA 2PHKA 4F65A 3Q5IA 3DBEA 5AM6A 3GVUA 4BWXA 4BCIA 3V3VA 5CALA 3OOMA 3ZO4A 4U5JA 5AP2A 3TI1A 1FPUA 2I0YA 3B8RA 4J7BA 4O6EA 4UZHA 3VUDA 3CBLA 3QWKA 4C0TA 5KNJA 1P5EA 3OF0A 4E3CA 3JY0A 4EOPA 5HQ0A 3ID6C 5C03A 5LWNA 2FSLX 5GIPE 4L7FA 3ZZEA 1PXIA 2GHGA 4GS6A 4QYYA 4X2NA 4B8MA 3H10A 4BZNA 2WQOA 4OAVB 4RG0A 4FV5A 3R71A 4IM3A 3VAPA 2OFUA 3PTGA 4L6QA 1VR2A 3QUPA 4AGDA 3N4UA 4EZ3A 3PJCA 4OTQA 4OAUC 2YIWA 3MGYA 5HO7A 5HZNA 3VBXA 3S0OA 3I7BA 3CLYA 2A27A 3BIZA 1OIQA 3ORLA 4U3YA 4I94A 3RCDA 2JDOA 4QQJA 3NUNA 4YPSA 5K3YA 4ZY5A 4D2PA 5IMXA 2IJMA 3FZRA 3ZRLA 3PVBA 4BI2A 4YURA 2RGPA 1S9JA 3BBTB 5CT0A 4CMTA 4YJOA 2XBAA 4TKSA 3FMMA 2GHMA 4O7NA 4G5JA 2WU7A 3CTJA 4DINA 2HZNA 4JDKA 3FKNA 3FWQA 4BC6A 3KXGA 4QMZA 4EBWA 4EOMA 4GSBA 2YHVA 4FSMA 3W16A 2BZJA 3CC6A 1U54A 3QLGA 1WCCA 3BRBA 4KKEA 1ZOGA 3EH9A 2F49A 4ZTNA 3R9DA 4AE6A 2J0IA 1I09A 5KE0A 5K4JA 3F5PA 2Z7LA 2OIDA 3WZDA 4PPCA 3CTHA 4PL4A 2QR8A 5AX3A 4LI5A 4QNYA 3LFSA 3U6HA 4AA4A 1PXJA 3MA3A 4BZDA 1YRPA 2DS1A 4BCKA 1AGWA 2OXXA 3CCNA 2WTKB 3VS6A 4O21A 1DI8A 1U46A 2ONLA 4EOKA 3MH2A 5AV3A 3WZJA 4EHEA 4YC8A 3F2AA 1H1WA 3MVLA 1L3RE 4QMVA 2F4JA 1X8BA 1YI6A 5A46A 2RL5A 4O86A 4FIFA 4F9BA 4Z7GA 3M2WA 3NYOA 4U0IA 3P4KA 1Q61A 3O2MA 4Y73A 4FK6A 2JBOA 4KIQA 4TWPA 4K77A 3HUBA 3IQ7A 5G1XA 3COMA 2VWIA 5IQEA 2BFXA 3MPMA 2PL0A 3KB7A 4MD9E 5BYLA 3UPZA 4XP2A 4ANNA 4MYGA 2BRNA 3SW4A 3UOJA 5LQFA 4C38A 4MXAA 5JGBA 4GL9A 4U41A 2YISA 4YUQA 1GZ8A 4FG8A 2ITTA 3R28A 4AZEA 4OR5A 4EOSA 4F08A 4ZSAA 3E8EA 1IR3A 4APPA 4F7LA 1PXOA 2A1AB 2WAJA 4WG3A 5D11A 1E9HA 4OUCA 3F66A 2PVMA 4U42A 4CRSA 3F5XA 4FV3A 2PZYA 1M7QA 4ALWA 4O7ZA 4WRSA 1WBSA 3CKXA 1XBBA 2XK9A 4V0GB 4UMUA 3OCGA 4L9IA 5I9XA 5JEBA 2WEIA 4FKPA 3A7GA 3P7CA 2P2HA 4O0TA 5IH6A 3QHRA 4MNEA 4CEGA 4IVBA 2OLCA 4MXCA 5IZFA 5HO8A 3TJCA 4DFNA 4XP3A 3ZC6A 3DA6A 3JVRA 3BEGA 2PVKA 3IW4A 1GOLA 4PL3A 3POOA 4UY9A 3FZTA 3LXLA 4ZTLA 2W1GA 3TZ8A 3WARA 3WZUA 4PMPA 4GKHA 3D7ZA 4PQNA 2IG7A 4AP7A 5GHVA 4IBMA 1OPLA 4QMXA 5HG7A 3ROYA 4M66A 3QZGA 4E4XA 5K4IA 3QRKA 2PZ5A 4E6DA 5EQPA 3TACA 4BDIA 2PULA 3F7ZA 3TUCA 2W7XA 2PWLA 2WQEA 5CAOA 2XIXA 1VJYA 5E8ZA 4JG7A 2R3JA 3A2CA 3ORPA 2VTMA 3OXIA 4RBLA 2UVYA 3OT3A 2LGCA 2YIRA 1M17A 3O0GA 3OW3A 4FTUA 5AP4A 1YWVA 3IOKA 5F4NA 5AV1A 3C4EA 2WEVA 5HU3A 2XK8A 3N4TA 3DTCA 4CQGA 3NUPA 4AW1A 5B2MA 3KQ7A 3CE3A 2IVTA 4QTBA 3VJOA 4ZSGA 3RAWA 5AV4A 4DEEA 3QTXA 4F1MA 5FEEA 1YOLA 4XUFA 5HKMA 3NLBA 1OUYA 1BL6A 5I9YA 4NEUA 4RX5A 3QXOA 3ZLWA 1H01A 2FO0A 4YBJA 3F9NA 3RCJA 4FA2A 1OPKA 4GCJA 3QBNA 2Z7QA 5DOSA 4FG9A 2GS2A 4D2TA 3FLZA 5BUEA 4XMOA 2ZV2A 3I60A 4L52A 3GXLA 3KEXA 4WUAA 5FDXA 3K3IA 2ACXA 4DGOA 2YIXA 1XH8A 5DWRA 1KV2A 2ITXA 4FKSA 4D9TA 3MTLA 4F9AA 3R9HA 3UQFA 3ZFYA 4MHAA 3P5KA 5LVPA 1OITA 2E9OA 2CN8A 2BZKB 2PVRA 3FDNA 4RRVA 4X0MA 3VS7A 4B6LA 1VZOA 3UNJA 3RBWA 4X6RA 3FXXA 1Z9XA 2PMIA 3QA8A 3TV4A 3DKCA 3RPVA 4KS8A 4F6WA 3OBJA 3SG8A 3QGWA 2H8HA 3PE1A 2HENA 2HAKA 3FZPA 3BYUA 4X6QC 2A19B 5HVJA 2ZDUA 4TXCA 2Q0NA 3NNWA 4BCNA 2WMAA 1Q8WA 1U54B 4AS0A 4MEDA 3CSVA 3DT1A 4ZJIA 4LMNA 3CXWA 5IA5A 4RT7A 3TV7A 1YXTA 3HMMA 3OROA 3DU8A 3MSSA 3R0TA 2BVAA 4A9RA 2VGPA 5HG9A 5IEXA 5KUPA 3PY1A 2BDWA 1Y8YA 2R9SA 3HV3A 1NVRA 1YI4A 3BLQA 3MVJA 3BBWA 3BE2A 4IANA 2Z60A 4MBJA 5HE2A 2YIQA 4K1BA 3WE8A 5J5TA 3VUMA 5T68A 3ZLYA 3R83A 3KKVA 5HBJA 1Q8YA 3VIDA 4DG3E 2OXDA 5F95A 4JRNA 4FR4A 3FHRA 3LCDA 2XMYA 2R3KA 4JG6A 3QYWA 1XH6A 3VS2A 3ATTA 3PVGA 4O0UA 4U44A 4EOJA 3HP5A 4MD7E 3DLZA 5IF1A 3LHJA 4AN9A 2RG6A 5AR3A 5FRIA 3V6SA 1YHSA 2A4LA 3Q6WA 5AJQA 4B9DA 4EOLA 4JVGA 4I0RA 3FMHA 4FNWA 2JLDA 3U87A 4HYHA 5DVRA 4E5AX 4LUEA 3AC1A 4JT3A 3RINA 4FV2A 5E91A 4F0FA 5CEPA 4BI1A 1SNUA 4R7IA 3W2QA 2HW6A 2UVXA 4RJ6A 4TTHB 3LFDA 3GOPA 3Q3BA 3IPHA 3ZZWA 4BDCA 3E87A 4DCEA 2V7AA 3EN7A 3F2RA 2E9NA 4FL1A 5KKRB 3P23A 1TQIA 1YVJA 4CRLA 2Y6MA 4C2VA 4BKZA 3W2CA 3VHEA 4WNPA 1OKWA 1GIJA 2YCQA 2HWOA 3PP0A 4GFMA 2UW3A 4FUXA 4KKGA 3OBGA 3DY7A 3MH0A 4JR7A 5AUTA 3CPBA 5EKNA 5A3XA 4MNEB 3CD8A 2PE2A 2WU6A 3G0FA 3FJQE 4PTGA 2XBJA 4F7NA 2B4SB 4OBOA 4QTCA 5CTPA 4O84A 4P5QA 1SVHA 1E1VA 2P4IA 4HVIA 5AADA 3RTPA 3EZVA 4CVAA 2CNQA 1APME 2YIYA 4L68A 3SV0A 2VTLA 5DBXA 5BX0A 2ITPA 4JIKA 2QO9A 3TEIA 3H30A 4EK6A 5CS6A 5HD7A 1ZY4A 4IAAA 4LV8A 4FKTA 3LFAA 3P08A 4JRVA 3VBWA 3ANRA 4EBVA 4QMYA 2CKOA 5IA4A 4AOJA 3A4OX 4HJOA 4L46A 2R0IA 4U45A 2PVNA 3UZPA 4IX3A 3CIKA 4S34A 1ZMWA 3F3WA 2JKKA 3UQGA 4PDSA 4OTWA 4YZNA 4CQEA 1YKRA 4YTCA 3W33A 1JBPE 4JG8A 4S31A 5JZNA 2RFSA 4FGBA 3GI3A 3BHTA 4U40A 4H3QA 1WBNA 2WTDA 3CGFA 3TNWA 3TTIA 2XKCA 3BYMA 5FBOA 4D4RA 3ZFXA 4M97A 2WTWA 4BBEA 3MPAA 3R8PA 3B8QA 1OL5A 5C1QB 3WF7A 1PXNA 3A62A 5CENA 3QWJA 3DJ7A 5LVNA 4GG7A 4BYJA 2C3JA 2I0VA 4XV9A 4QMTA 5ANKA 3UOLA 2XIYA 2QQ7A 3KU2A 4YNEA 4YJUA 4FTLA 4FOBA 2ZM3A 3BU6A 2Q0BA 3UIUA 3RWPA 2V22A 3VJNA 3BEAA 4ANOA 3F61A 1ZYCA 4TT7A 1UWJA 3UC4A 2OBJA 2HZ4A 5LMKA 5JRSA 3VHKA 5CASA 1G3NA 2PVFA 3F3VA 3ATSA 3KCFA 3QZHA 4GRBA 4C7TA 4UX9A 2CNUA 4IC7A 3GQLA 4GK4A 3RNYA 3S4QA 4CTBA 1J7IA 5AR4A 4EQCA 4DG2E 2O63A 2QOIA 3IOPA 4MBLA 3DLSA 2YWPA 4LRKA 4TWOA 3VS5A 3W32A 4EH4A 2QOCA 4C35A 5B7VA 2G15A 1LPUA 4IX4A 5J5SA 2ZYBA 2EXCX 4PNKA 1GAGA 2W4OA 1OMWA 3PSBA 4IAIA 5B2LA 2J0JA 4JX3A 3H3CA 5AR7A 4LV5A 3FLNC 3RPSA 4C8BA 2H34A 3G9NA 4YHFA 3Q2JA 3EFKA 2XYUA 4AA0A 4XHKB 4FT9A 1PMVA 1JLUE 1ZOHA 1JKKA 2UZVA 3EKKA 5IG1A 1ZXEA 3ZUTA 4IAYA 4JR3A 3AMBA 3HDMA 4BDAA 5HGIA 2WQNA 1Q8TA 5D7VA 5AUUA 3KRXA 4QP7A 4WHZA 2C3LA 2XNPA 4FL3A 1W7HA 4U8ZA 5H9BA 3EN9A 4WRGA 1R0EA 3QX2A 2XIRA 2R0UA 5EI8A 2VUWA 3NX8A 5FUTA 1KE6A 4JXFA 2X7OA 3OEZA 4IXPA 1KOBA 5EI2A 5F20A 5M4UA 4R7HA 1WMKA 2WTKC 2JIVA 4ZZOA 4EK5A 2QVSE 3B2TA 2C5XA 3UVPA 5I9UA 4CZTA 3P86A 3MFSA 4HYIA 1YWNA 3UO6A 5E92A 4B7TA 5FTQA 5L3AA 3KGAA 1XHAA 1Q97A 1Y6AA 4ZS0A 2QLUA 4CLIA 3LKMA 4BWPA 2XIZA 3DAKA 3W55A 3LJ2A 3QTSA 1XBCA 2GSFA 2OFVA 3F3TA 1H1RA 4NCTC 5JQ8A 4NKAA 5BVOA 2IO6A 4AT4A 2BZIB 2X8DA 3KA0A 5EDPA 4C4GA 2JKQA 5A4CA 3T3VA 4ALUA 2C6MA 3G90X 3BLRA 3Q4ZA 4CNHA 3S95A 5M51A 1GJOA 2BRGA 4XRJA 2QLQA 4FTQA 5CYIA 1W0XC 2VTPA 4IE9A 3ZYAA 3FY2A 4U79A 1OKVA 4M0ZA 3MFTA 1JPAA 1UKIA 5FXSA 3VUGA 5KBQA 3VRYA 5DT0A 4F7JA 4J53A 4UWYA 1LEWA 3ZFMA 1Y57A 2PMLX 2GU8A 3F88A 3PG1A 3FQEA 3GQIA 4ZIMA 4F9YA 5TKDA 3VW6A 1PMNA 1UWHA 4UMTA 5HLPA 4DHFA 1AD5A 3W2OA 2CCHA 3R1SA 4RMZA 2J51A 4TRLA 4JQEA 4FT3A 4DTKA 1E1XA 3A7FA 2CSNA 4G6LA 5CSVA 3K2LA 3G51A 2B55A 4L8MA 4MX9A 4OTHA 5DNRA 4XP0A 2JAVA 4ZY6A 2PTKA 2RKUA 2VGOA 2X4ZA 1F3MC 4IJPA 3FMJA 4MWIA 5KX8A 3ENHA 4TNDA 4B8LA 3V51A 3PJ1A 4I4EA 2VWUA 3R63A 5IQDA 2OW3A 2C69A 1ZWSA 3OWLA 5FEDA 5L2QA 3ZSIA 5KHXA 5LWMA 2I7QA 3COHA 3D2KA 3KK9A 4J97A 3R7UA 4NUSA 1H0VA 5AUVA 2E9VA 1H25A 3SG9A 1GIIA 2ZV9A 2G9XA 3PWYA 5HCYA 2QOFA 5C26A 5J9LA 3UIXA 5ETIA 4EH3A 3ZLSA 4CG9A 2XJ1A 4R1VA 3FBVA 4BBMA 4F7SA 3TDVA 2BIYA 2CLXA 3L1SA 3R6XA 4WNMA 4RC3A 2VWZA 2PU8A 2WQMA 2HW7A 4QPAA 5EDRA 2A0CX 4M12A 4FF8A 5M09A 2ITWA 4C59A 2CKQA 4QP3A 4FTIA 3ZCLA 2JITA 3A99A 3PG3A 4PMTA 4ZTMA 2C6IA 1XKKA 3JS2A 2PMOX 4RVKA 2BTSA 1V0OA 1JAMA 2WOUA 4G3GA 2PUPA 4ITHA 4FC0A 3LQ3A 4CCUA 3QA0A 3ZXZA 4QQCA 4UWCA 3SQQA 4FEXA 2YJSA 3QTQA 5H2UA 4TZRA 4TYGA 4KUJA 4JI9A 5L6WL 4D2RA 2QU6A 2AC5A 3H9RA 5AP3A 3C4WA 4A4OA 2E9PA 3C0IA 4EH8A 1HCKA 5CZIA 2QURA 4O2PA 4D4YA 3AMAA 3P7AA 4J1RA 4GK2A 4D5KA 2R3NA 3ZEPA 2Z7SA 4M14A 4K0YA 3TWJA 5HORA 3DK6A 2WO6A 4A06A 4MWHA 4EYMA 5KMKA 2CKEA 3EKNA 4CFFA 1XR1A 3C50A 3ACKA 4YJQA 5CAPA 5H8GA 3SXSA 4NM3A 3DAJA 2RSVA 1XWSA 2J5FA 2BFYA 2W99B 2ITZA 2Y0AA 1A06A 4QQ5A 1JOWB 3FAAA 3ORKA 5EM7A 3PJ3A 5C01A 2Q83A 5TE0A 2IVUA 1JWHA 1IA9A 3EQCA 3UMWA 3G33A 5FLFA 2BAKA 4AA5A 3Q9WA 5L2SA 1ZOEA 3BPRA 2FA2A 3E3PA 3T3UA 4M0YA 5AAEA 3VQUA 3O71A 4YHJA 3LCSA 2C6EA 1K2PA 1OB3A 2BIKB 5TO8A 3RK9A 4BKJA 1PF8A 4HGSA 4D9UA 2BRMA 4O7YA 3IDPA 5JFVA 2ONLC 3PFQA 4OT5A 4AG8A 2YM8A 2YZLA 3DS6A 1J1BA 1ATPE 3OT8A 1O9UA 2R3RA 3NW5A 4F64A 4JBVA 5FTGA 1RDQE 3GENA 4FBXA 2F2UA 3FY0A 3Q4CA 4YLLA 2GS7A 4BTMA 5CAVA 2VTSA 3D4QA 2F7EE 4IM2A 5HOAA 2OJIA 2ZM4A 2G2IA 3EB0A 3O7LD 2JD5A 3ORTA 4PMSA 4DC2A 3TUBA 4YZDA 2J4ZA 1VYZA 2F2CB 4NFMA 2V5QA 4LL5A 3U54A 3ROCA 3C4CA 3O17A 5M57A 4IWOA 3C0GA 3Q5ZA 3P0MA 1IASA 3NS9A 1VYWA 2EU9A 5LMBA 5AP1A 4U81A 4ERWA 5AA9A 4QNAA 3UP2A 2OJGA 4UXQA 4A07A 4A9YA 4BDBA 3F6XA 3E93A 4D1SA 4FNZA 5BPYA 4FK3A 4PNIA 2VWWA 2GFCA 3KY2A 5AMNA 5JFXA 5KKRC 3D5XA 2ZV7A 3AOXA 1R1WA 2W5HA 3UOHA 5HX8A 2UZEA 3HV6A 3ANQA 4USDA 4R3CA 1XO2B 4O22A 5J95A 2KULA 2QKWB 1O6KA 2CHLA 4ASEA 3O8PA 3BX5A 2YCFA 3HRBA 2J7TA 4WSQA 4I5CA 2J5EA 3V5JA 4RIXA 4RLKA 1PRYA 4HNFA 4BIEA 4F09A 1SVGA 4GU6A 5EW3A 5A4TA 1OL6A 5F94A 4IB1A 5EHLA 4EOIA 1TVOA 5DT4A 4KIPA 5KMMA 4A7CA 5M4IA 5DG5A 3P79A 5HESA 1FQ1B 4R5SA 3V5LA 1J7UA 3WZEA 3WF8A 1PXPA 2WOTA 3BYVA 4MCVA 5E8WA 4USFA 4FTNA 4O7VA 4W4XA 3QZIA 3C4FA 2B9JA 4WKQA 3RHXA 3RNIA 4X21A 4OW8A 4BCJA 3Q60A 4WIHA 5ACBC 4DFLA 5HVYA 2OK1A 3NGAA 3PPKA 2CGVA 2HY81 3D0EA 4IFCA 4V05A 5I3OA 3KXNA 3GC0A 1QPDA 4X3FA 3WYYA 1WAKA 3HAMA 4I6BA 4DBNA 5CNNA 4FSTA 1KE7A 5FQDC 3S3IA 4FEQA 3SGCA 5FD2A 3SKCA 2PVHA 4APCA 4PTCA 3ODZX 2C0IA 1I44A 1XH9A 4ZJVA 1M2PA 5I9VA 2QO7A 2V55A 3VNTA 3C4XA 3HRFA 3COKA 4F0IA 3C0HA 1IA8A 1BUHA 3EQRA 5DR6A 5ANDA 1REJA 4BN1A 3M11A 3UBDA 4GW8A 1SZMA 3MWUA 3OWJA 4CSVA 4A4XA 5LCJA 2JDSA 2R4BA 3AXWA 3HRCA 3R7VA 3DXPA 5CI6A 3DGKA 4YJNA 1OVEA 4X3JA 5AIKA 3GFWA 3U51A 1VEBA 3E7VA 2C5YA 2XNNA 3KRJA 3FQSA 4RQVA 4RWIA 1O6LA 4PDPA 5IPJA 2FYSA 4BIBA 2PSQA 1L8TA 1KE9A 3OOGA 1OL7A 1W84A 4J99A 4TY1A 5M08A 4JQ7A 3I1AA 5B2KA 4O0YA 3T9IA 2WMXA 2FSMX 2QI8A 5A4QA 2R3LA 4NTSA 1FVVA 5L2TA 4I23A 4HZSA 4IQ6A 3PZEA 3D5UA 5BVEA 2OF2A 4IX6A 2QCSA 4R5YA 4XG7A 3E88A 5A6NA 4GJ2A 2CKPA 3SW7A 4IVCA 3E92A 2Z7RA 2W5AA 4YJRA 4O7TA 1GZKA 3FKOA 3NDMA 2J50A 1H26A 4O1OA 4GH2A 5AIRA 3O51A 3QRUA 5AP6A 2BHEA 1CMKE 4FODA 4FKIA 4AGCA 5BYYA 3DKOA 2J9MA 4J95A 4ZSJA 2X2LA 2VRXA 3E8CA 3O8TA 4DH8A 1XH5A 3I81A 3L9LA 3VBYA 5CY3A 4O1PA 5KMIA 4IAZA 1KE8A 5E4HA 3JXWA 4FSRA 3AQVA 3F69A 4DG0E 1DI9A 1UU9A 1YXUA 5C8MA 1XQZA 2OZOA 2JFLA 2UZUE 5AEPA 2JGZA 2W5BA 4AW5A 4AFJA 5IQAA 4C4EA 4ZLZA 3KN5A 5J9ZA 3OWKA 2YCRA 3SRVA 2CGXA 4FUYA 2ZAZA 4DTAA 3EFWA 1YXXA 3BWFA 4YR8A 1ZYLA 4M68A 4FKRA 4FMQA 4EONA 4Q9ZA 3VVHA 4QTEA 3HMIA 4Q5HA 5FXRA 4YC6A 1YQJA 2UW0A 3QX4A 4ASDA 4E7WA 3ORMA 1JVPP 5M06A 3GCPA 3A4PA 2I0HA 1OM1A 3KRRA 4IMYA 4LOPA 3UNZA 4L3PA 5ANJA 4CV8A 4D5HA 4N57A 1JSUA 2UW5A 3PXRA 4YLKA 4AZTA 5KMOA 4ZAUA 4ENYA 4MVFA 2IZRA 5KBRA 5I3RA 4YGAA 3EFLA 2W1DA 1JKSA 2XA4A 3IKAA 4BCQA 4HVSA 2J90A 2IZSA 1YDRE 4FKQA 4IJ9A 2VD5A 4F4PA 2P33A 4ZJJA 2REIA 5A4LA 4DLJA 2IN6A 4FT0A 5HICA 4RX9A 4BGQA 3RK7A 4AZWA 3BV2A 3HDNA 2YERA 2HOGA 1K9AA 4FEUA 3I0QA 3H9FA 3TUDA 4HCUA 3PXFA 1CM8A 2W1CA 1GNGA 5CEIA 1WBWA 4TYHA 2YJRA 3ZBXA 3RK5A 2R7IA 4WBOA 4X2JA 2OH4A 4ACMA 4I21A 4BFMA 4Z55A 5L4QA 3EOCA 4XBUA 5JK3A 2H6DA 4KRCA 4JL9A 2QOLA 1P14A 5KMJA 1Q8ZA 4J96A 3AGMA 4YSMA 3NUSA 2C3KA 3QC9A 4XLVA 4JNWA 4RIXB 3PVUA 4ZLYA 5J9YA 3LFFA 3G6HA 1BYGA 3EQBA 4FZFB 5CU0A 4IACA 4AGWA 5JN2A 1J91A 2C0TA 3D15A 4DGNA 2GS6A 4JOAA 2PZIA 2VO0A 4MXZA 4NYEA 4M8TA 4MF1A 4EK3A 3HMOA 2I0EA 3DBDA 2EWAA 3MJ1A 4RZVA 3ALOA 4AACA 2ERKA 4XOZA 2CGUA 3GCSA 4D1XA 2C0OA 2V7OA 4DBXA 3K3JA 3FC2A 4BBFA 2ZB0A 1OIUA 2HYYA 3FHIA 4YTFA 5BVDA 4FEVA 4D1ZA 1PKDA 1Q99A 1YXSA 2IVVA 1HOWA 3I0OA 3ORIA 2O65A 3I6UA 4KBAA 2W0JA 4NL0A 3KCKA 2QKRA 4X3FB 5HU9A 4DGLC 2OWBA 4WA9A 4AN2A 4Y95A 1UU3A 2QG5A 2XEYA 3CJGA 4NM5A 1M14A 3CQEA 4F6SA 1HCLA 4FZDB 4AW0A 2QONA 3OMVA 4R7BA 4GIIA 1UKHA 1IG1A 4H36A 4ZTQA 2ETKA 4YBKA 4KSQA 5F1ZA 1FMOE 2XNGA 1REKA 3D83A 3PYYA 3F5UA 2HCKA 4IZYA 4DGGA 4S32A 3GU4A 3II5A 1YI3A 2OJFE 2EB3A 3HYHA 4ZXTA 2W1IA 5D1JA 2GDOA 1MP8A 2R3IA 3ORZA 3VUTA 4Y5QA 3DBFA 1H1QA 1UNHA 3EL7A 1Y8GA 2UZWE 2HZ0A 3MW1A 4C4HA 4DFYA 4XG8A 1OBGA 1PXKA 3GU6A 3WBLA 1OGUA 4W8EA 2Y8OA 5EW8A 4EH5A 4PX6A 4ZSEA 3MFUA 5LMKC 1NT2A 2EUFB 5K5NA 3PA3A 2VX1A 3NWWA 4C4FA 2BRHA 3U9CA 3TZ9A 4BZOA 1GZOA 3EN5A 4EHVA 3R2BA 3VW8A 2PE1A 3DJ6A 4RIOA 3ZRMA 2BHHA 3HMNA 3FXWA 1JQHA 4EI4A 4RWLA 4C3RA 5AA8A 5AFVA 4RX8A 3R2YA 3G2FA 5ETFA 4P5ZA 3DPKA 3FI4A 4JDHA 2WMUA 3W8LA 2XP2A 4Q2AA 3AG9A 4NSTA 3NR9A 2G2HA 4QMNA 1WBOA 3DTWA 3TIZA 5IEVA 4OGRA 2JDTA 5CF6A 4Q9SA 1TKIA 5IDPA 5CF5A 3V01A 4DCAA 3A7HA 4RC4A 2WIPA 3DQWA 3C4ZA 3C5IA 2DUVA 1AQ1A 4WG4A 2QHMA 2VO7A 3TZ7A 3V5TA 2J2IB 3S00A 4I24A 4NM7A 3F5GA 4QMPA 4BL1A 3Q9XA 4N6YA 5LVMA 3SRVB 2QR7A 3W2SA 1KSWA 2W9ZB 3RM6A 1J3HA 4U3ZA 4EHGA 4OTDA 4MH7A 4ZEGA 1QMZA 4O27B 3THBA 4AOTA 4FICA 4FTJA 4PP7A 3FL5A 4LMUA 3NRMA 4X2KA 3UNKA 1P2AA 2GNFA 3IW7A 4OBPA 3FI3A 4WD5A 1FOTA 2HXLA 3EN4A 4FKWA 4FTOA 3PIXA 2HZIA 3HECA 4PUZA 3PPZA 3Q32A 3FC1X 5BYZA 4BTJA 3UO5A 5JQ5A 2O0UA 3R7OA 2X8IA 3RPOA 3R7IA 4GG5A 2X4FA 3AD5A 3EJ1A 3G9LX 3FMNA 2GCDA 3CJFA 2PVLA 3ENMA 3KMMA 5GZ9A 3LMHA 2CLQA 4HZRA 4R78A 2BKZA 4H1MA 5CANA 1WFCA 1M7NA 2XNBA 4DEBA 1PW2A 4TL0A 3ULIA 3C1XA 4F1OA 2GNJA 4D58A 5T3QA 2JEDA 3WOWA 4C34A 3UPXA 4BCPA 4J71A 3FZ1A 3KXZA 2YCSA 3IW5A 3LCTA 1Q5KA 4FSUA 4JAIA 2XNMA 3VF8A 4L67A 4B0GA 3QKLA 2VNYA 4TYHB 4EJNA 4ARKA 1PHKA 3I7CA 4RGJA 1ZMVA 3OCBA 4ZTHA 4JBOA 5GNKA 5M4FA 1BMKA 3UZRA 2VTIA 1OL1A 1Z5MA 2ETMA 4DEGA 3HVCA 3KF7A 1M52A 2UUEA 5DIAA 4ZSLA 2P0CA 5ACKA 5K0KA 4AXAA 3IDBA 2YABA 4L44A 2WMQA 5EYDA 5D41A 5I9ZA 3G15A 2PZRA 5DRBA 4D4VA 1IRKA 4IB3A 3DQXA 3ZDIA 1WVYA 3ERKA 3EZRA 2F9GA 2R3OA 3G5DA 3QUDA 4C3PA 3V8TA 2X39A 3QF9A 1B39A 4I1ZA 4D0WA 1WVWA 2ZMDA 4L7SA 3L8PA 5CEOA 2PY3A 2OIBA 3GC7A 3HA8A 4LQMA 2X2MA 4MAOA 1SYKA 3OEFX 5J7BA 4B4LA 4EOQA 2XIKA 1SVEA 3BU5A 3OY1A 3DKFA 4ITIA 5IA2A 2B54A 2Y9QA 4ORKA 4V01A 4G9RA 2X1NA 3NAXA 2HWPA 5HO6A 4IC8A 5H8EA 2QD9A 4QP8A 5LMAA 3K5VA 3LXNA 2XVDA 3BGQA 4IAKA 3PXZA 4W4YA 5BVFA 5LVOA 4L53A 1CDKA 2YITA 4CGAA 2QODA 4O7SA 2X8EA 2PUNA 2JIIA 5A54A 4ANLA 4EKLA 2GNLA 4UYNA 3WE4A 4BDJA 2B53A 4KB8A 3PLSA 4RFYA 3S2PA 2RG5A 2W1FA 4FKOA 5AP5A 4AT5A 4E93A 3TN8A 4C3FA 4AFEA 3E8DA 4W4WA 4BHZA 2B7AA 2BRBA 4IADA 3W10A 3A7IA 4ZZNA 4DTBA 4KINA 5CU6A 4C58A 5KMNA 4CXAA 3R9NA 5HTIA 3R1QA 3V8SA 4D2SA 2RFDA 2BKKA 3BYSA 4XV1A 4HYUA 2YWVA 4X2GA 5AP7A 4FSNA 2W4JA 2XF0A 3NIZA 4A4LA 4I0SA 4I4FA 5EM5A 4XLIA 4HCVA 2XK7A 2R3HA 4FTKA 1OL2A 3E8NA 4MQ1A 5D9HA 4IEBA 3W1FA 1PMEA 2BZHB 3QFVA 3HNGA 4FV6A 4Y5HA 3MESA 2BPMA 2QHNA 4XJ0A 3SXFA 4IAFA 5L2WA 5HTCA 2C5NA 2BUJA 5EQEA 5EKOA 3IECA 4JDJA 5G6VA 1V1KA 4IX5A 4YMJA 1Q3DA 3PY0A 2C6DA 5CVGA 2XCKA 4OTPA 4O7RA 2XRUA 4RFZA 5HCZA 3FSFA 2C6OA 1A9UA 3R1YA 2UW8A 4MXOA 4L42A 3KXHA 4BCGA 4K8AA 4Z7HA 1UV5A 2X7GA 4HVGA 4I20A 4RC2A 4AAAA 5CQWA 2QOKA 5D10A 3RMFA 3AC8A 4H05A 1LUFA 4GMYA 1U5RA 2ITOA 4IVAA 5IDNA 5FXQA 2QG7A 4I41A 2IW8A 3RZFA 3DDQA 2JIUA 3DB8A 4FKLA 2GNGA 4FT7A 2UW7A 4XS2A 3HL7A 1DAYA 1R3CA 3LZBA 3E7OA 5CVHA 4JIAA 4ZP5A 3LLTA 4DFXE 4HVHA 3LM5A 5M4CA 2GQGA 3ZC5A 3PDTA 4EJ7A 2HK5A 1H4LA 5IH5A 3Q4TA 3QUEA 5JH6A 3JVSA 3A8XA 3R02A 4QMMA 5CEQA 4KS7A 2NO3A 3IK3A 5IEYA 2SRCA 3NVMB 3OXTA 5ICPA 3D5WA 2VTNA 5CEMA 1ZMUA 4QMWA 5CVFA 3HA6A 2W1ZA 4AZVA 3GEQA 3NUYA 3IW6A 2YLEA 3WI6A 3KXMA 3UE4A 4DITA 1BX6A 2P3GX 3MH3A 3P9JA 5M55A 1UVRA 3ZOSA 3I6WA 2VWXA 5F9EA 4ITJA 5EYMA 4M69A 2P55A 4P90A 3PLAE 3ET7A 4UYAA 3TNIA 4J52A 4P7EA 4PDOA 3ZEWA 5CLPA 1J7LA 2PYWA 3TM0A 4E4LA 4M67A 4EWQA 4PDYA 3EHAA 3MVHA 4IB5A 3R9RA 1CKPA 4R3RA 4RIYA 4QO9A 4PWNA 4W8DA 1G8SA 3JUHA 5FBNC 4YZCA 2VX3A 5AV2A 4R6VA 2Y4PA 3POZA 3EL8A 5DHJA 5KCVA 4CFXA 4G31A 4QPMA 1FBNA 3L9NA 2XKDA 2VO6A 4NK9A 5DRDA 4Y72A 2ITYA 3V5PA 3F82A 4BHNA 5FTOA 4I92A 3OCSA 4FIIA 3ZO1A 1V0PA 3MV5A 5CF8A 2UZLA 2C3IB 3OC1A 3C51A 2XKFA 5HEZA 5FP5A 2OH0E 2UZDA 3LPBA 1FVRA 5J1VA 2W1EA 3CGOA 3QCXA 4BTFA 4KBCA 5GJGA 5AUYA 2Z8CA 1OBDA 2PMNX 3D14A 3KF4A 5DPVA 2VX0A 1NXKA 4I3ZA 4I5MA 3GCUA 4QT1A 5CU2A 3UYSA 5JFWA 2CGWA 4ZLOA 4RWKA 3GUBA 5FWKK 4GYIA 4BIDA 3QQGA 4PTEA 5DH3A 2PK9A 1FVTA 1OUKA 4E26A 4EQMA 3DXQA 5TF9A 3ITZA 3QU0A 5L6OA 5EH0A 2X0GA 3KXXA 5GZAA 4I6QA 3C9WA 5FM2A 2PE0A 5DA3A 4R77A 2WMRA 2I6LA 2V62A 4H1JA 4WSYA 5DFPA 2LAVA 3SAYA 4XRLA 4ENXA 4PV0A 4O38A 3F2NA 4LOQA 2HELA 5B0XA 2IPXA 3OUKA 3PPJA 2PUUA 4M7IA 2WELA 4X3FC 3PVWA 3OTVA 1W83A 4F63A 4EC8A 5BNJA 4NM0A 2O2UA 2VTJA 4ANBA 3HV7A 4F70A 1BL7A 4JAJA 2R2PA 3Q9YA 2Y7JA 4HPUE 4USEA 2VU3A 3U4UA 3PZHA 5DMZA 5CQUA 3OP5A 5AM7A 1JNKA 4CYIA 2XK3A 4Y85A 4EK4A 3KK8A 5ANOA 1Q4LA 4M84A 3LAUA 4C36A 5IA1A 2G01A 3ULZA 2W9FB 4YTIA 2WD1A 2VTHA 4FKUA 4N0SA 3U6JA 4GFOA 4F99A 4UEUA 5EG3A 3DJ5A 4PY1A 3GU7A 4DEAA 5C27A 2C6TA 1H8FA 3NW7A 5TR6A 3LOKA 4ALVA 4ANSA 4P4CA 3S1HA 4DYMA 1OKYA 5AUXA 3ZONA 4K9YA 5CSPA 3DKGA 2IW9A 2ITUA 3ZTXA 4NWMA 2OIQA 4R8QA 5HBEA 3AGLA 3NAYA 3MN3A 5BUIA 4GVAA 4BRXA 1Q24A 3TNPC 1JKLA 4BF2A 3B2WA 4AWIA 5CZHA 5M56A 4BWKA 3HMPA 4QMSA 2YM7A 3ZM9A 5JSMA 3GFEA 3EFJA 4KRDA 1Q3WA 3FZOA 4G3DA 4A9SA 1FGKA 1Z57A 2XM8A 4LUDA 3E3BX 3QD2B 5A9UA 1UNLA 4E6QA 4LGDA 3BHUA 3R8LA 1TQPA 3FMDA 4O0SA 2BAJA 4YNOA 3H0YA 2XEZA 2BROA 2ZDTA 1YXVA 3DV3A 3E62A 4FV7A 5BVKA 5I5ZA 3TG1A 1O6YA 1YOMA 4DFZE 4UXLA 4PMMA 2YM3A 5DE2A 4CV9A 4DE4A 4I6FA 3REPA 4N70A 4XG6A 3TCPA 3KL8A 2CDZA 3L8SA 3Q96A 4FTRA 4C33A 3L8VA 4FYOA 3MYGA 1R78A 2NRYA 4PL5A 1DM2A 3PRFA 5CU3A 3VBTA 4BDFA 4C37A 4U9AA 5HG5A 1B38A 3EIDA 3R9OA 1QPEA 4FTAA 4E6AA 3FMKA 4CMUA 5IUHA 5BVWA 2B9FA 3L9MA 4I22A 4LOOA 1P4FA 1PYXA 3QRTA 4ACHA 3W2RA 3CY3A 4G17A 1GY3A 2GQRA 3U6IA 4AZSA 2H96A 5FDPA 3QTUA 2FSTX 5AR5A 2VWYA 2IZUA 3CEKA 1UA2A 3FPQA 2FVDA 2WNTA 3VC4A 1FGIA 3ODYX 4F9WA 5DN3A 3QKMA 4QTDA 5ANIA 3U4WA 4M69B 5HNGA 3R30A 4CYJA 5M44A 4YJVA 3V5QA 3NNVA 3R7EA 3OCTA 4BGHA 2XB7A 4JDIA 3KVWA 4ASXA 3U8WA 5HLNA 3BGPA 4EQUA 5T6KA 3ZMMA 2UW4A 4RIYB 3FKLA 2NRUA 4G1WA 3ZS5A 3MTFA 4BVUA 5HVKA 3D7TA 2R3FA 1IEPA 2YZAA 1STCE 2X81A 3GC9A 4DT8A 2JFMA 3QD4A 1WVXA 4CTCA 5FGKA 3FPMA 3TKUA 4EUUA 4YSJA 4BDHA 4O81A 4UBAA 1U59A 2X9EA 4PPAA 3VS3A 3P78A 4CFVA 4BCHA 2J6MA 3QQJA 3BCEA 3QTRA 4BI0A 4F9CA 2B0QA 1V0BA 5BMMA 4N4SA 1BLXA 2IWIA 3AC3A 5CF4A 4BDKA 2VTAA 2WHBA 4AZFA 4RZWA 1RE8A 4QYFA 4EC9A 1MRUA 3AD6A 1J1CA 1YDTE 3OFMA 3ZU7A 4G3FA 3CY2A 3QD0A 3VBVA 5CXZA 4L00A 2I1MA 4XOYA 3R01A 3QQUA 2UV2A 4I0TA 2YDIA 4H58A 3IG7A 3QQHA 4WOVA 5IMEA 2WTCA 4NZWB 4UMPA 4GYGA 5JFSA 3KREA 2VO3A 4N6ZA 1FMKA 3RM7A 1YDSE 3UYTA 2J0MB 3QTIA 3MIAA 5EFQA 3UG2A 2XKEA 4ACDA 1RJBA 4EL9A 4G9CA 5AUWA 4RPVA 3HGKA 3LXPA 3P1AA 4JX7A 4ZOGA 3QRJA 3PWDA 4IDTA 2NPQA 4H3PA 4D28A 3VULA 4A9TA 4RLLA 5EM6A 3L9PA 3PIYA 1WBVA 2RFEA 5HIDA 5LXMA 4D55A 4QTAA 3EYHA 4C2WA 3OUNB 3RGFA 2C1AA 5CSHA 4E6CA 4OTFA 2J0LA
chains in the Genus database with same CATH superfamily
4DH3A 3LMGA 2BALA 3HEGA 1ND4A 1P4OA 5C4KA 4ID7A 4OTIA 3NEWA 4O96A 3HKOA 4L43A 2WMWA 4J8MA 4R3PA 2IVSA 3QCSA 3DFAA 3OD6X 3VO3A 4LGGA 2X9FA 4OTRA 2YM5A 4I6HA 3E64A 3LM0A 3SHEA 1U5QA 2CPKE 1T46A 2V0DA 4L01A 3DCVA 2OZAA 3LXKA 4NW6A 4AE9A 3HX4A 2VWVA 4QYEA 3RJCA 4H39A 4BY9E 4FIEA 5CXHA 3HV5A 3EQHA 3F7WA 5E8XA 3QHWA 4HVDA 4FKVA 5DR9A 3UTOA 3ZXTA 3IDCA 3LCKA 3EN6A 4O2ZA 3R04A 4PF4A 1MQBA 3R7GA 3FSKA 4FIJA 4F0GA 2DQ7X 3FLSA 4GUEA 3RALA 2VTRA 3VBQA 3COIA 3BQRA 2WIHA 5HTBA 4FV8A 5CEKA 3TXOA 5DEWA 4QP1A 5AV0A 2WTJA 4CKIA 2OG8A 3D5VA 3MBLA 2HXQA 3UODA 1Y91A 3I79A 4GFGA 3TV6A 1CSNA 1H28A 5DYJA 2OICA 3QC4A 2WB8A 2XCHA 4YJTA 4KAOA 3U9NA 3QZFA 4E1ZA 1PJKA 3LFQA 2YEXA 1W82A 3ORXA 2WMVA 4FV4A 3GBZA 4XCUA 2NP8A 2IZTA 3HLLA 3BGZA 4YJSA 1PYEA 4DH1A 3HAVA 2ERZE 2WXVA 5IQCA 3H0ZA 4WT6A 4BCMA 2XYNA 5LCKA 4L3LA 1W8CA 2FB8A 4NTTA 4LRMA 2RF9A 3D94A 5HE1A 5J79A 3MVMA 5L8JA 1Q41A 4GV1A 4PPBA 4W4VA 3DZQA 3W18A 1OPJA 1R39A 3PJ2A 4DF3A 3NIEA 5IKWA 3AT4A 3FYKX 1H24A 3ZBFA 4QQTA 5J7HA 4EH9A 3TKHA 3FEGA 4AQCA 5FM3A 5HI2A 3LFEA 4MXXA 4Z9LA 4Z16A 4S2ZA 3RP9A 3BHYA 2GNIA 5LOHA 2O3PA 3AD4A 3GCQA 2CMWA 2OXYA 2JKMA 3WF6A 4F1TA 4DT9A 3QKKA 5DLSA 4D0XA 3EQFA 4G5PA 4KWPA 4NJ3A 2Y4IB 2ZM1A 3A60A 3PA4A 5CSWA 3ELJA 4U97A 1NW1A 4E5WA 3QLFA 4G6NA 3PUPA 4FX3A 4O6LA 5JKGA 4MUQA 4QEBA 3GU5A 3A8WA 3UVQA 1KOAA 2QO2A 3IW8A 4QP6A 1BI7A 3WF9A 5IQBA 3D7TB 4CD0A 3SXRA 5BUJA 4E73A 3UJGA 5CAUA 3OHTA 2X0QA 4QP2A 2R64A 5AAGA 2J0KA 3FLWA 3R22A 5DEYA 3RPRA 2QNJA 4FOCA 5EHOA 3V04A 2O5KA 5I9WA 3MA6A 1ZZ2A 4FV1A 4KABA 1OECA 2ZJWA 1ZYJA 5DGZA 4KD1A 3EQPA 4MKCA 3LJ1A 4W9XA 5E7RA 4AGUA 3IO7A 4FIGA 3BV3A 3VUHA 3KRWA 1LR4A 3QL8A 1ZYSA 2ZB1A 2FSOX 4NW5A 4O0WA 3FI8A 5AX9A 3QD3A 4CFUA 3OVVA 4GJ3A 2R3MA 2UZBA 4GT5A 2BDFA 2VTOA 5BMSA 5BQ0A 1MUOA 3FLYA 3R73A 4GVJA 4Y83A 2GTNA 4NJDA 3KMWA 4LL0A 5HE3A 4E8AA 5JMSA 1SM2A 3MFRA 4IWPA 2X7FA 5AWMA 5BVNA 4FVPA 4LYNA 4D2VA 1A48A 3MI9A 4O0XA 4XG2A 4V04A 3O96A 1G5SA 4OBQA 4QD6A 3AC2A 4AU8A 4L3JA 5LARA 5AUZA 3I4BA 4IZ7A 4RVMA 1QPJA 1M2RA 1JSTA 3GNIB 4L45A 4I93A 4G34A 2AUHA 4ASZA 4BCOA 4EORA 5KHWA 3GCVA 2W05A 5EM8A 2YLFA 4RJ7A 3ZUVA 5AR2A 4HNIA 2OGVA 4ZMFA 2VTQA 2FH9A 5CSXA 3FYJX 3WILA 3OXZA 3C7QA 3AMYA 4FZAB 4IVDA 3BI6A 5K9IA 2C30A 4CMOA 4HW7A 3BKBA 3NCGA 4KIKA 5CU4A 4BGGA 2OF4A 3RHKA 2XARA 2AYPA 4CT2A 1URCA 2QOHA 3PSDA 4BJJA 3GB2A 2IW6A 2OZAB 3G0EA 3GU8A 4NH1A 3KN6A 4K33A 2ITVA 4FSZA 3CS9A 4LM5A 4QPSA 4YZBA 3O8UA 2YFXA 2C5OA 3PRIA 3NZ0A 1NVSA 4K6ZA 4QP9A 1XJDA 3GGFA 5FP6A 4FEWA 3WIKA 3Q6UA 1UU8A 2R5TA 1ERKA 5CAQA 1T45A 3FE3A 3PE2A 4QOXA 2FGIA 5E8TA 3HV4A 3FUPA 2XH5A 2BCJA 3KMUA 2ITNA 4WBBB 3SOCA 3LE6A 4FKJA 4S30A 5HLWA 3NUAA 3KFAA 3C13A 4FT5A 3EWHA 4EH2A 3TDWA 3BE9A 2UVZA 3ZHPC 4JQ8A 3OWPA 4UWBA 3TJDA 1YHWA 5H8BA 3WYXA 4HCTA 1UU7A 1BKXA 3FV8A 4C02A 1M2QA 4C57A 1SNXA 5JT2A 3OG7A 2WKMA 2XS0A 4BDEA 3HZTA 4DN5A 3UIBA 4BDGA 2NNWB 3DNEA 4CT1A 1IAJA 3DZOA 3MS9A 3OTUA 3VF9A 3ZSGA 2PVJA 1W2CA 1YW2A 4YLJA 4TNBA 4YZ9A 1WZYA 3DK7A 3UG1A 2HY0A 2E9UA 3MDYA 2YAKA 1RQQA 3OW4A 4GK3A 5E8VA 4BB4A 2QOBA 5EDQA 3JR1A 2BAQA 2GNHA 3Q53A 4U80A 1PMUA 2C4GA 2I40A 4FKGA 3KRLA 4H3BA 2IEWA 4QRCA 5M53A 3KULA 4CFNA 2X0PA 4FSWA 2JBPA 3I5ZA 4G16A 1XH4A 2GFSA 3TNQB 2C68A 2WMTA 3QGYA 2G1TA 3R7YA 5C8KA 5IH4A 5J1WA 1RW8A 1LP4A 3EQDA 4YU2A 1YOJA 3BYOA 4YC3A 1B6CB 2B1PA 3HP2A 3V5WA 5KO1A 1KUTA 5CX9A 3PIZA 1ZY5A 5HBHA 1QCFA 1F0QA 4RWJA 2AC3A 4QMQA 2Z2WA 2Z02A 2W96B 2YA9A 3OY3A 2B9IA 4U6RA 2OSCA 4CFMA 5K0XA 2O64A 4M3QA 2C5VA 1H00A 4NFNA 5IUIA 4GU9A 5J87A 3R1NA 2RIOA 3NYXA 2WZJA 2UZTA 4FG7A 4AT3A 4DAWA 3R8UA 3DK3A 4DA5A 4IIRA 2WPAA 4U7ZA 4XX9A 4ACGA 2X6EA 4DGMA 4QMOA 5A6OA 4DFUA 4DH7A 2A98A 1MQ4A 5AR8A 4O0RA 5JRQA 3T8OA 4II5A 2O8YA 3UO4A 3AT2A 3FXZA 5IQIA 3NPCA 4LGHA 4TWNA 4UV0A 3NNXA 4D4SA 2F57A 3TZMA 5IUGA 3NMUF 1U4DA 3V6RA 4AQKA 1FINA 3NVKI 2YAAA 3R8VA 5IA0A 4FL2A 4CG8A 3FL4A 5FG8A 3AC5A 3FLQA 3VUIA 4KIOA 4UB7A 4RA5A 4BICA 4MD8E 4TYJA 4FTMA 3QAME 1YWRA 3BHHA 2EVAA 2XM9A 2ZMCA 4IWDA 5E1EA 2WGJA 4FSQA 3Q04A 3Q9ZA 3ZRKA 4ZTSA 2CNVA 3A61A 4CZUA 1G8AA 5IA3A 3F3ZA 2WTIA 4LV7A 5DT3A 1Q62A 3FMEA 3NFGB 4BR3A 1WBTA 3Q52A 3RZBA 3E63A 3ZUUA 3IONA 3WIGA 4ACCA 4BDDA 2PZPA 4IDVA 3QQLA 5EYKA 5DI1A 3DB6A 4C4JA 4XG4A 3UIMA 2VV9A 4EYJA 5I0BA 5D7AA 4YP8A 2ESMA 4I5PA 4NIFA 3WZKA 3PXKA 1DAWA 3MY0A 5LJJA 4G2FA 5HIEA 2R3QA 4LG4A 5A14A 4ANQA 1ZYDA 4I5HA 1OKZA 2OO8X 2C6KA 4MTAA 4DH5A 3QCYA 2VNWA 5HE0A 3LVPA 2OJJA 2B9HA 3IGGA 4BCFA 3LIJA 4CKRA 1H08A 4FE2A 3PXYA 4UN0C 1ZZLA 5EOLA 5L8LA 2DYLA 1OZ1A 1SMHA 5CNOA 3FMLA 2XRWA 4MQ2A 3EMGA 4XH6A 5ETAA 4KIKB 4AUAA 3PP1A 1MRYA 3BWJA 4BJJB 2G2FA 3SLSA 3ZSHA 1LEZA 4YO6A 3I5NA 4TN6A 5ANEA 2QC6A 3D9VA 4GUBA 1F5QA 5IQFA 2BILB 4KA3A 3VS1A 3ML1A 3BQCA 4EUTA 3GT8A 2B52A 2R7BA 4OLIA 4RIWA 5E8SA 5GJDA 3UP7A 4LFIA 5LVLA 4EKKA 3ETAA 3HUCA 4XG3A 3QALE 1GZNA 5GJFA 3EYGA 3NCZA 5EQYA 2FUMA 4MXYA 5EOBA 2CN5A 3EQGA 4DEDA 2WQBA 4NKSA 4O4DA 2ZV8A 4NT4A 2UW6A 4EK8A 4QYGA 4G6OA 3MIYA 3DNDA 1W98A 2H9VA 3R00A 1DS5A 5BV3A 3BU3A 4X7QA 4FYNA 3W2PA 3KC3A 3LLAA 4OT6A 4JLCA 3T9TA 1MRVA 2YDKA 4TYEA 4Y46A 3VN9A 4S33A 4AAYA 2UW9A 4YPDA 2NYAA 4GT3A 3DAEA 4EHZA 3EQIA 3TL8A 1OI9A 3SD0A 4FZ6A 2ZVAA 3BLHA 2HIWA 4IFGA 4JBQA 1H07A 2ETRA 4EOOA 4ANMA 4FNXA 2GHLA 3N51A 4QYHA 4RVLA 3NW6A 4XBRA 5CI7A 3P7BA 2A2AA 1ZAOA 5L2IA 4O7WA 3H4JA 5AP0A 1NVQA 1QL6A 1UNGA 3LQ5A 3QTZA 5ETCA 1JSVA 2XNOA 3IS5A 2CCIA 3UGCA 3MPTA 2GMXA 2OU7A 4G3EA 4QMUA 3SX9A 3VQHA 3DFCB 4AN3A 3KULB 4G3CA 1ZLTA 4RA4A 3DDPA 3K5UA 4IHPA 1IAHA 4J8NA 3SA0A 3U55A 2BDJA 3K54A 5JZJA 3RWQA 1H0WA 4Y8DA 3LFNA 3TNHA 3TKIA 4YZMA 4ZTRA 3GOKA 4XEYA 3NUXA 4FZ7A 5FEQA 3VS4A 5M07A 2Y6OA 1ZARA 4TYIA 3PSCA 2JDRA 1KE5A 3PJ8A 4HPTE 2XJ2A 2YDJA 3NYNA 2VWBA 4RJ4A 2BR1A 3JPVA 5GINE 5EYCA 1K3AA 4AOIA 4KSPA 4O83A 4IZAA 3O7LB 4EH6A 1R0PA 4YTHA 2EXMA 3OZ6A 5C4LA 1TQMA 3BZ3A 1H1PA 3QCQA 4WNOA 4X2FA 5EI6A 4IW0A 1PKGA 1NA7A 5E8YA 4HGTA 2CJMA 3VONA 3QTWA 4XV3A 5EW9A 3LQ8A 3M1SA 4U43A 2Y4IC 3RI1A 2WMSA 3E5AA 3UZTA 4O91A 2UZOA 2YN8A 5H3QA 2F7ZE 4FVQA 4BTKA 5E9EA 4JBPA 3LCOA 5J8IA 5HNIX 3VUKA 2XUUA 1H1SA 4Z3VA 4MBIA 4TW9A 4AF3A 4EEVA 2GQSA 3G6GA 1H27A 4AX8A 2OI4X 5HX6A 3RKBA 4IWQA 3MY5A 2E2BA 2R3PA 2OJ9A 4GIHA 1CTPE 3DBCA 4DFBA 5CT7A 2EB2A 3CP9A 3SOAA 3DXNA 4K11A 4YJPA 4NU1A 4RFMA 2F7XE 4IZ5A 4WNKA 1PXLA 5IQHA 2QU5A 3GP0A 4RJ3A 5GZ8A 2XJ0A 3W0PA 3ZO3A 3UC3A 5EK7A 2AQXA 3DOGA 2QOOA 4KNBA 3RAIA 3QRIA 2WTVA 3BHVA 4LRJA 4RX7A 5ANGA 3LFCA 3QQFA 5L8KA 2W17A 5ITAA 4JS8A 4K2RA 4TPTA 4JJRA 4YO4A 1KWPA 3A7JA 5HIBA 3AC4A 4EZ5A 4CCBA 3UQCA 5CWZA 1G8JA 4ZK5A 4FTCA 4M13A 1CKIA 2X6DA 3CKWA 1OIRA 3SC1A 3UOKA 1URWA 3FQHA 4NIFB 4IM0A 3W8QA 4YHTA 4FI1A 4KBKA 4RJ8A 2JC6A 3JY9A 2WFYA 5GIOE 3O50A 2VZ6A 2YM6A 4UZDA 2PVYA 4O7LA 3LMIA 3UDBA 3R21A 3LW0A 2EXEA 4P2KA 1XBAA 5KMLA 5JGDA 2PUIA 1QPCA 2JDVA 3UVRA 4HYSA 4PRJA 4XYFA 3OS3A 4DEHA 3NSZA 5E90A 4WUNA 3CTQA 3LJ0A 3RAHA 5L6PA 2XZSA 5A4EA 2ZOQA 5E1SA 4ZZMA 3AKKA 5HCXA 3C5UA 2W4KA 4CKJA 4KKHA 5D12A 3RVGA 2WMBA 2GPHA 3FZSA 4GEOA 4O4BB 5HD4A 3VRZA 3L8XA 3GC8A 1EH4A 2DWBA 3H9OA 4RIWB 5HG8A 3PA5A 5TOZA 2QOQA 4ZY4A 3BELA 3WF5A 3O23A 2KTYA 4Q5EA 4C61A 4JMQA 3N9XA 2W1HA 4E5BA 2P2IA 3MH1A 2YACA 4FV9A 4HOKA 4MK0A 2JAMA 4FTTA 5E8UA 4F6UA 3MJ2A 2C47A 4RJ5A 4PP9A 5TT7A 3ZDUA 4TWCA 2JKOA 3PY3A 5HHWA 1Q8UA 2VN9A 2GTMA 2R3GA 3CPCA 3KVXA 4RQKA 1NY3A 5IU2A 4M15A 5EHYA 3TTJA 4FIHA 5DR2A 4DLIA 4D2WA 3R8MA 5C9CA 4NCTA 3R8ZA 1GIHA 5IQGA 4E4MA 3QXPA 3TIYA 3ALNA 4QMLA 3IGOA 4IH8A 3ZO2A 3CD3A 3JYAA 4HGEA 4BKYA 4C4IA 2XK6A 4EWHA 4ERKA 5AAFA 5I4NA 4GKIA 4A9UA 3SVVA 3Q4UA 1PXMA 3PXQA 4J98A 4UALA 4XG9A 3ORNA 4RSSA 3MB7A 1XH7A 3VS0A 4E4NA 3F3UA 3ZH8A 3N4VA 3CQUA 3CR0A 2OKRA 4ONAA 4E20A 3MY1A 3ZM4A 1KV1A 4XNEA 3ZLXA 2PPQA 1WBPA 4GT4A 4CLJA 4FGRA 4K18A 1Y6BA 3NNUA 3NYVA 1ZRZA 4MNFA 4O82A 2XK4A 3AT3A 2BTRA 4WG5A 5HNBA 5JGAA 4WO5A 4V0GA 4RVTA 5KZ0A 2VAGA 2C6LA 4FVRA 3Q2MA 4FSYA 1JKTA 2X2KA 3CQWA 3D2IA 4FV0A 2W06A 4BYIA 3ACJA 3TT0A 4EH7A 4UMRA 4OTGA 4O0VA 3QQKA 2RFNA 2XNEA 4R1YA 4XV2A 3UMXA 4UMQA 4CFWA 4CZYB 3W0SA 4HGLA 3PUFC 4FNYA 1S9IA 4ZMEA 2ITQA 3SDJA 1YHVA 3M42A 3RAKA 3V8WA 3DBQA 3LFBA 3MB6A 4QP4A 2VTTA 5K5XA 4IB0A 3RPYA 5C8NA 5IISA 4AW2A 4EZ7A 1BI8A 1CKJA 2BMCA 1PY5A 2C1BA 4MF0A 4B99A 4ZS4A 2UZNA 4DEIA 2YM4A 4W9WA 3FI2A 4C62A 3NUUA 3QYZA 5KZIA 1OIYA 3VWAA 2PHKA 4F65A 3Q5IA 3DBEA 5AM6A 3GVUA 4BWXA 4BCIA 3V3VA 5CALA 3OOMA 3ZO4A 4U5JA 5AP2A 3TI1A 1FPUA 2I0YA 3B8RA 4J7BA 4O6EA 4UZHA 3VUDA 3CBLA 3QWKA 4C0TA 5KNJA 1P5EA 3OF0A 4E3CA 3JY0A 4EOPA 5HQ0A 3ID6C 5C03A 5LWNA 2FSLX 5GIPE 4L7FA 3ZZEA 1PXIA 2GHGA 4GS6A 4QYYA 4X2NA 4B8MA 3H10A 4BZNA 2WQOA 4OAVB 4RG0A 4FV5A 3R71A 4IM3A 3VAPA 2OFUA 3PTGA 4L6QA 1VR2A 3QUPA 4AGDA 3N4UA 4EZ3A 3PJCA 4OTQA 4OAUC 2YIWA 3MGYA 5HO7A 5HZNA 3VBXA 3S0OA 3I7BA 3CLYA 2A27A 3BIZA 1OIQA 3ORLA 4U3YA 4I94A 3RCDA 2JDOA 4QQJA 3NUNA 3BLAA 4YPSA 5K3YA 4ZY5A 4D2PA 5IMXA 2IJMA 3FZRA 3ZRLA 3PVBA 4BI2A 4YURA 2RGPA 1S9JA 3BBTB 5CT0A 4CMTA 4YJOA 2XBAA 4TKSA 2XALA 3FMMA 2GHMA 4O7NA 4G5JA 2WU7A 3CTJA 4DINA 2HZNA 4JDKA 3FKNA 3FWQA 4BC6A 3KXGA 4QMZA 4EBWA 4EOMA 4GSBA 2YHVA 1TZDA 4FSMA 3W16A 2BZJA 3CC6A 1U54A 3QLGA 1WCCA 3BRBA 4KKEA 1ZOGA 3EH9A 2F49A 4ZTNA 3R9DA 4AE6A 2J0IA 1I09A 5KE0A 5K4JA 3F5PA 2Z7LA 2OIDA 3WZDA 4PPCA 3CTHA 4PL4A 2QR8A 5AX3A 4LI5A 4QNYA 3LFSA 3U6HA 4AA4A 1PXJA 3MA3A 4BZDA 1YRPA 2DS1A 4BCKA 1AGWA 2OXXA 3CCNA 2WTKB 3VS6A 4O21A 1DI8A 1U46A 2ONLA 4EOKA 3MH2A 5AV3A 3WZJA 4EHEA 4YC8A 3F2AA 1H1WA 3MVLA 1L3RE 4QMVA 2F4JA 1X8BA 1YI6A 5A46A 2RL5A 4O86A 4FIFA 4F9BA 4Z7GA 3M2WA 3NYOA 4U0IA 3P4KA 1Q61A 3O2MA 4Y73A 4FK6A 2JBOA 4KIQA 4TWPA 4K77A 3HUBA 3IQ7A 5G1XA 3COMA 2VWIA 5IQEA 2BFXA 3MPMA 2PL0A 3KB7A 4MD9E 5BYLA 3UPZA 4XP2A 4ANNA 4MYGA 2BRNA 3SW4A 3UOJA 5LQFA 4C38A 4MXAA 5JGBA 4GL9A 4U41A 2YISA 4YUQA 1GZ8A 4FG8A 2ITTA 3R28A 4AZEA 4OR5A 4EOSA 4F08A 4ZSAA 3E8EA 1IR3A 4APPA 4F7LA 1PXOA 2A1AB 2WAJA 4WG3A 5D11A 1E9HA 4OUCA 3F66A 2PVMA 4U42A 4CRSA 3F5XA 4FV3A 2PZYA 1M7QA 4ALWA 4O7ZA 4WRSA 1WBSA 3CKXA 1XBBA 2XK9A 4V0GB 4UMUA 3OCGA 4L9IA 5I9XA 5JEBA 2WEIA 4FKPA 3A7GA 3P7CA 2P2HA 4O0TA 5IH6A 3QHRA 4MNEA 4CEGA 4IVBA 2OLCA 4MXCA 5IZFA 5HO8A 3TJCA 4DFNA 4XP3A 3ZC6A 3DA6A 3JVRA 3BEGA 2PVKA 3IW4A 1GOLA 4PL3A 3POOA 4UY9A 3FZTA 3LXLA 4ZTLA 2W1GA 3TZ8A 3WARA 3WZUA 4PMPA 4GKHA 3D7ZA 4PQNA 2IG7A 4AP7A 5GHVA 1ST4A 2IF8A 4IBMA 1OPLA 4QMXA 5HG7A 3ROYA 4M66A 3QZGA 4E4XA 5K4IA 3QRKA 2PZ5A 4E6DA 5EQPA 3TACA 4BDIA 2PULA 3F7ZA 3TUCA 2W7XA 2PWLA 2WQEA 5CAOA 2XIXA 1VJYA 5E8ZA 4JG7A 2R3JA 3A2CA 3ORPA 2VTMA 3OXIA 4RBLA 2UVYA 3OT3A 2LGCA 2YIRA 1M17A 3O0GA 3OW3A 4FTUA 5AP4A 1YWVA 3IOKA 5F4NA 5AV1A 3C4EA 2WEVA 5HU3A 2XK8A 3N4TA 3DTCA 4CQGA 3NUPA 4AW1A 5B2MA 3KQ7A 3CE3A 2IVTA 4QTBA 3VJOA 4ZSGA 3RAWA 5AV4A 4DEEA 3QTXA 4F1MA 5FEEA 1YOLA 4XUFA 5HKMA 3NLBA 1OUYA 1BL6A 5I9YA 4NEUA 4RX5A 3QXOA 3ZLWA 1H01A 2FO0A 4YBJA 3F9NA 3RCJA 4FA2A 1OPKA 4GCJA 3QBNA 2Z7QA 5DOSA 4FG9A 2GS2A 4D2TA 3FLZA 5BUEA 4XMOA 2ZV2A 3I60A 4L52A 3GXLA 3KEXA 4WUAA 5FDXA 3K3IA 2ACXA 4DGOA 2YIXA 1XH8A 5DWRA 1KV2A 2ITXA 4FKSA 4D9TA 3MTLA 4F9AA 3R9HA 3UQFA 3ZFYA 4MHAA 3P5KA 5LVPA 1OITA 2E9OA 2CN8A 2BZKB 2PVRA 3FDNA 4RRVA 4X0MA 3VS7A 4B6LA 1VZOA 3UNJA 4FRFA 4X6RA 3RBWA 3FXXA 1Z9XA 2PMIA 3QA8A 3TV4A 3DKCA 3RPVA 4KS8A 4F6WA 3OBJA 3SG8A 3QGWA 2H8HA 3PE1A 2HENA 2HAKA 3FZPA 3BYUA 4X6QC 2A19B 5HVJA 2ZDUA 4TXCA 2Q0NA 3NNWA 4BCNA 2WMAA 1Q8WA 1U54B 4AS0A 4MEDA 3CSVA 3DT1A 4ZJIA 4LMNA 3CXWA 5IA5A 4RT7A 3TV7A 1YXTA 3HMMA 3OROA 3DU8A 3MSSA 3R0TA 2BVAA 4A9RA 2VGPA 5HG9A 5IEXA 5KUPA 3PY1A 2BDWA 1Y8YA 2R9SA 3HV3A 1NVRA 1YI4A 3BLQA 3MVJA 3BBWA 3BE2A 4IANA 2Z60A 4MBJA 5HE2A 2YIQA 4K1BA 3WE8A 5J5TA 3VUMA 5T68A 3ZLYA 3R83A 3KKVA 5HBJA 1Q8YA 3VIDA 4DG3E 2OXDA 5F95A 4JRNA 4FR4A 3FHRA 3LCDA 2XMYA 2R3KA 4JG6A 3QYWA 1XH6A 3VS2A 3ATTA 3PVGA 4O0UA 4U44A 4EOJA 3HP5A 4MD7E 3DLZA 5IF1A 3LHJA 4AN9A 2RG6A 5AR3A 5FRIA 3V6SA 1YHSA 2A4LA 3Q6WA 5AJQA 4B9DA 4EOLA 4JVGA 4I0RA 3FMHA 4FNWA 2JLDA 3U87A 4HYHA 5DVRA 4E5AX 4LUEA 3AC1A 4JT3A 3RINA 4FV2A 5E91A 4F0FA 5CEPA 4BI1A 1SNUA 4R7IA 3W2QA 2HW6A 2UVXA 4O4EA 4RJ6A 4TTHB 3LFDA 3GOPA 3Q3BA 3IPHA 3ZZWA 4BDCA 3E87A 4DCEA 2V7AA 3EN7A 3F2RA 2E9NA 4FL1A 5KKRB 3P23A 1TQIA 1YVJA 4CRLA 2Y6MA 4C2VA 4BKZA 3W2CA 3VHEA 4WNPA 1OKWA 1GIJA 2YCQA 2HWOA 3PP0A 4GFMA 2UW3A 4FUXA 4KKGA 3OBGA 3DY7A 3MH0A 4JR7A 5AUTA 3CPBA 5EKNA 5A3XA 4MNEB 3CD8A 2PE2A 2WU6A 3G0FA 3FJQE 4PTGA 2XBJA 4F7NA 2B4SB 4OBOA 4QTCA 5CTPA 4O84A 4P5QA 1SVHA 1E1VA 2P4IA 4HVIA 4O4CA 5AADA 3RTPA 3EZVA 4CVAA 2CNQA 1APME 2YIYA 4L68A 3SV0A 2VTLA 5DBXA 5BX0A 2ITPA 4JIKA 2QO9A 3TEIA 3H30A 4EK6A 5CS6A 5HD7A 1ZY4A 4IAAA 4LV8A 4FKTA 3LFAA 3P08A 4JRVA 3VBWA 3ANRA 4EBVA 4QMYA 2CKOA 5IA4A 4AOJA 3A4OX 4HJOA 4L46A 2R0IA 4U45A 2PVNA 3UZPA 4IX3A 3CIKA 4S34A 1ZMWA 3F3WA 2JKKA 3UQGA 4PDSA 4OTWA 1OGYA 4YZNA 4CQEA 1YKRA 4YTCA 3W33A 1JBPE 4JG8A 4S31A 5JZNA 2RFSA 4FGBA 3GI3A 3BHTA 4U40A 4H3QA 1WBNA 2WTDA 3CGFA 3TNWA 3TTIA 2XKCA 3BYMA 5FBOA 4D4RA 3ZFXA 4M97A 2WTWA 4BBEA 4I6LA 3MPAA 3R8PA 3B8QA 1OL5A 5C1QB 3WF7A 1PXNA 3A62A 5CENA 3QWJA 3DJ7A 5LVNA 4GG7A 4BYJA 2C3JA 2I0VA 4XV9A 4QMTA 5ANKA 3UOLA 2XIYA 2QQ7A 3KU2A 4YNEA 4YJUA 4FTLA 4FOBA 2ZM3A 3BU6A 2Q0BA 3UIUA 3RWPA 2V22A 3VJNA 3BEAA 4ANOA 3F61A 1ZYCA 4TT7A 1UWJA 3UC4A 2OBJA 2HZ4A 5LMKA 5JRSA 3VHKA 5CASA 1G3NA 2PVFA 3F3VA 3ATSA 3KCFA 3QZHA 4GRBA 4C7TA 4UX9A 2CNUA 3UDTA 4IC7A 3GQLA 4GK4A 3RNYA 3S4QA 4CTBA 1J7IA 5AR4A 4EQCA 4DG2E 2O63A 2QOIA 3IOPA 4MBLA 3DLSA 2YWPA 4LRKA 4TWOA 3VS5A 3W32A 4EH4A 2QOCA 4C35A 5B7VA 2G15A 1LPUA 4IX4A 5J5SA 2ZYBA 2EXCX 4PNKA 1GAGA 2W4OA 1OMWA 3PSBA 4IAIA 5B2LA 2J0JA 4JX3A 3H3CA 5AR7A 4LV5A 3FLNC 3RPSA 4C8BA 2H34A 3G9NA 4YHFA 3Q2JA 3EFKA 2XYUA 4AA0A 4XHKB 4FT9A 1PMVA 1JLUE 1ZOHA 1JKKA 2UZVA 3EKKA 5IG1A 1ZXEA 4DHZA 3ZUTA 4IAYA 4JR3A 3AMBA 3HDMA