4MF1A

Itk kinase domain in complex with benzothiazole inhibitor 12b (1s,2s)-2-{4-[(dimethylamino)methyl]phenyl}-n-[6-(1h-pyrazol-4-yl)-1,3-benzothiazol-2-yl]cyclopropanecarboxamide
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
265
structure length
243
Chain Sequence
GSVIDPSELTFVQEIGSGGLVHLGYWLNKDKVAIKTIAMSEEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRTQRGLFAAETLLGMCLDVCEGMAYLEEASVIHRDLAARNCLVGENQVIKVSDFGMPVKWASPEVFSFSRYSSKSDVWSFGVLMWEVFSEGKIPYENRSNSEVVEDISTGFRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAAIAASG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase ITK/TSK
publication title Structure-based design and synthesis of potent benzothiazole inhibitors of interleukin-2 inducible T cell kinase (ITK).
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 243
sequence length 265
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4mf1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4mf1A01
2W1CA 1PKGA 1L3RE 1Y6AA 2W1DA 1Q62A 2XBJA 3ZXTA 1J91A 4H3BA 4B9DA 3QLFA 5IA1A 4KIKB 3LXNA 3MIAA 3FQHA 2ZOQA 2VWUA 2OIBA 4G2FA 4IJPA 4FNWA 2ZV7A 5CZHA 3I7BA 4IZ7A 3UODA 1U5QA 2YM8A 3K3JA 5DR9A 1PXNA 3IPHA 3ORLA 4PQNA 1B6CB 3MYGA 2W17A 3PSBA 4QP4A 3SXRA 2UZWE 3ID6C 2FYSA 2OJ9A 3HGKA 5AP5A 2VAGA 2EUFB 5HCXA 3BHYA 3E87A 4H39A 2WMBA 2SRCA 4R5SA 3PDTA 5BVOA 1F0QA 4CFMA 4FTJA 2QONA 4G9CA 5CU6A 5JGBA 4F09A 3PY0A 5JFXA 4GG5A 3T9TA 4HCUA 4P4CA 4M14A 4ZIMA 2C3IB 4FUXA 4DH3A 5IQEA 4CTCA 2JGZA 2XNGA 5JQ5A 4TW9A 1KE7A 4ZJIA 4WRSA 3PWYA 4J8NA 4PNKA 4R77A 1M7QA 3G6GA 4I93A 4RSSA 3UE4A 5GJDA 3WZKA 3TM0A 4RFYA 2BAKA 5CT0A 3D14A 1U46A 3UTOA 4FKJA 5TF9A 4FSWA 3VRZA 3HMNA 2BZIB 3MBLA 4DBXA 3V8TA 2WMSA 2YDJA 4P90A 3NWWA 2GFSA 3AGMA 4IDVA 3C9WA 4ZTLA 4A9UA 4C0TA 2PVMA 1H25A 5IQFA 3GGFA 2BRNA 4PWNA 3W8LA 4YJTA 1PMVA 2B9HA 4I21A 3E5AA 4ERWA 4I6QA 2HW7A 3L8VA 1DAYA 3Q60A 4E6DA 5C26A 2ZB0A 1JKKA 4O83A 1GZ8A 1WBVA 3LXPA 4QQ5A 1FBNA 3KRLA 2C5NA 4XX9A 2GSFA 1XWSA 5M55A 1P4OA 3AC2A 3GC8A 4K8AA 4N4SA 4O2PA 4QPSA 2UZLA 3RALA 3ZSGA 5KO1A 3GXLA 3ZMMA 2PZ5A 3TN8A 4UEUA 4D9UA 2XNEA 4ZTMA 4EJNA 3MB6A 4QP7A 4RJ6A 5A4QA 4FIJA 1Q97A 5EW9A 3GC7A 3FY0A 5AUTA 4PPCA 4Z7GA 4JBVA 4BCJA 3CGFA 2VD5A 2J7TA 3R28A 5L8KA 2UZTA 5I9UA 3UVRA 2CLQA 4KUJA 4FL1A 4I6HA 2WHBA 4UZDA 2GS7A 3PE1A 3C51A 2B52A 2JKMA 4C3FA 3UO4A 3W2CA 4GJ3A 1GY3A 2W0JA 2C6OA 4JDIA 3I7CA 4MEDA 3U4UA 2YISA 4EHVA 4ZAUA 4PL5A 2XKEA 4X2FA 1JAMA 4D2RA 4EZ5A 3AC4A 4OTFA 1IA8A 5AP1A 3NW6A 2GQGA 3R1NA 5HKMA 4MWHA 1R1WA 2ZDUA 4FSRA 1LEWA 4CFXA 4D2VA 4LL5A 3WIKA 5HNBA 3QC9A 2QHMA 5HVJA 2OZOA 2WTVA 3A60A 5LVNA 3RINA 4C34A 2WMVA 3ACJA 2XM8A 5I9WA 2PVFA 4QMSA 1BX6A 4BR3A 4ID7A 2E2BA 4C36A 3NUPA 3ZDUA 1RQQA 3QZIA 4DG0E 5BX0A 4QMUA 3MFRA 3M42A 2C6LA 5C4LA 4G3GA 2R4BA 3EYGA 5M57A 3LE6A 5HHWA 1WVXA 4XEYA 3PXRA 3RTPA 3UOJA 3KN6A 3R8LA 2PE1A 3UG1A 2JAMA 4PL3A 3FZTA 4CKJA 3HRFA 1UKHA 3EN7A 3CKWA 1Z57A 2DS1A 3PTGA 4FV7A 3UNZA 4GIIA 4EHZA 2FSOX 2HWOA 1YI4A 4NH1A 2V0DA 4CYJA 5EQYA 3QALE 4U43A 1J7UA 2EXMA 4O82A 4IADA 3OWLA 5EDQA 4L67A 3BLRA 3U51A 3R8MA 1ZXEA 3F61A 4DG3E 4UWYA 2R7BA 3QQUA 3W2QA 5IQBA 5AP0A 4ASZA 2I0YA 4N6ZA 5CF8A 4I0RA 3RPSA 2BHEA 4B4LA 4YMJA 2PZRA 3MH0A 2C6MA 3UVPA 2RF9A 4EC9A 4C2VA 3QD3A 4KIPA 4K77A 4CD0A 5HLWA 2W5HA 4DCEA 4DGMA 4JR3A 3G2FA 1Q3DA 2WKMA 2G01A 3CQWA 4ONAA 1S9IA 3TJCA 3A62A 3VHKA 5ACKA 3Q4UA 3QTSA 3FJQE 4CRLA 1VJYA 3OUNB 3QHWA 4PUZA 5L2QA 4F08A 4FKWA 5HGIA 5CEOA 5EHLA 1OZ1A 3R7GA 4ALVA 2O64A 4TWPA 5HCYA 2X0GA 4H58A 2V62A 5KHXA 1URCA 5I3RA 4ZLZA 5E91A 3ZSHA 5AP4A 5GJGA 5CSWA 2X6DA 3D2IA 3EZVA 5HIEA 4CMOA 4GW8A 4FK3A 3FY2A 4AFEA 5TR6A 4EWHA 2WQMA 3NSZA 2GDOA 4GRBA 5J1VA 3GI3A 5HBEA 3D2KA 3V04A 1R39A 2PVLA 5CEMA 3CIKA 3AMAA 5HE2A 3R7IA 4EONA 2PUIA 1JQHA 4GK3A 3AD5A 3HNGA 4XV1A 4JJRA 5JZJA 4FZAB 3LFBA 3V5JA 3PIXA 2AYPA 2B7AA 4HVSA 2NPQA 3D83A 5GZAA 1FQ1B 2WTDA 4XLIA 3QTRA 1XQZA 4QO9A 4F9BA 3FEGA 4B6LA 5JH6A 2W1HA 2YCQA 3EN5A 2YZLA 2QOOA 3UG2A 2WQEA 5D9HA 3UVQA 1GZOA 2VX0A 5D12A 1CDKA 1YDSE 5KBRA 3MFUA 1OKVA 4P7EA 4RJ3A 1U54B 3LCKA 5DEWA 1OPLA 3H9RA 5HTBA 1YXSA 5E8VA 5AAFA 4JDKA 3B2TA 4QMLA 4O96A 4ANLA 4F4PA 5CSPA 5FEDA 2WPAA 4UMTA 3OCSA 4TY1A 3QWKA 2C5VA 5DN3A 4F70A 4HPUE 4G6OA 4Z9LA 2GQRA 4QP9A 5EKOA 4U8ZA 4FEQA 4CQEA 3IQ7A 4O27B 4M0YA 3RM7A 4RZVA 4YP8A 1PHKA 4IB0A 4J52A 2GNJA 3QX2A 4RA4A 5EI6A 3VUIA 2DWBA 2HZ4A 4G5JA 4D9TA 4IWQA 2QOCA 4DINA 4R8QA 5CU2A 3F7WA 4TYIA 4XRJA 3OWKA 5T68A 1KOAA 4BCGA 5EM8A 3MA3A 4RLLA 3QAME 4KKGA 2Z7QA 1OL2A 2HIWA 1MQ4A 3TKHA 3QQHA 1OIYA 4RT7A 4I5PA 4N6YA 1WFCA 1BLXA 3DTCA 4FR4A 4KA3A 2WZJA 3TIYA 5IA3A 3SXSA 2UZOA 3LFDA 5KE0A 2G2HA 3NVKI 3KMUA 4QTCA 3LLAA 2IWIA 3I60A 4FE2A 3Q5ZA 3EQCA 4XG7A 5DBXA 4YTCA 2CSNA 3GCSA 3OP5A 4I6FA 4GS6A 1NVRA 1OPJA 2Q0BA 4CV9A 3CBLA 4IE9A 2QO9A 3GQIA 1FOTA 1GIHA 2WTJA 2VTHA 2WMRA 3OWJA 3RK9A 3UZRA 2EWAA 3QF9A 2Y6MA 4MCVA 5GNKA 5HZNA 4RJ4A 3MVHA 4CNHA 3NZ0A 3BWJA 4UYAA 4BGGA 3TV6A 1BL7A 3HP2A 3CJGA 3HMOA 1WBPA 4K33A 3O23A 4FV3A 4IM2A 4WNPA 4FYNA 5M56A 3EN4A 4R7BA 5C8NA 4ZJJA 3ZM9A 3QL8A 5CENA 4EEVA 4F0FA 2C6DA 1J1CA 2QOQA 4O22A 3S0OA 1YOLA 3TDWA 2GCDA 4BDAA 2JDRA 2PVKA 2PZPA 2OZAA 2YM5A 5DG5A 3RP9A 5AAEA 3C7QA 1OL5A 3EL8A 3FQEA 3R7EA 3PPZA 4Y46A 4IEBA 4ENYA 1XH4A 3H9FA 1PY5A 3OD6X 4ZSGA 3BWFA 3VUHA 2PVJA 4O7YA 2CNUA 2VTTA 3ZZWA 3Q9ZA 2ZDTA 5DE2A 3WARA 3V5LA 3UC3A 2GFCA 2XCKA 3AGLA 1W82A 3HUBA 2UZBA 2P4IA 3FZSA 5E9EA 5CANA 4YJPA 3QX4A 2XB7A 4L53A 4LI5A 4L9IA 4C38A 1Q8ZA 2UW8A 2YAKA 3MIYA 5JEBA 3B8QA 1WBSA 3G0EA 4R6VA 4ZSJA 3E88A 3NLBA 5D7AA 3ZEWA 4I5HA 4AZWA 3I1AA 2OLCA 1UNGA 3R8VA 4DEAA 2C6IA 2BDFA 3O8PA 4RPVA 4QP3A 4FIEA 2JBOA 5FTOA 3VHEA 4CV8A 4ZLYA 1IA9A 4UMRA 1OUKA 5AFVA 1GNGA 1FGKA 2R3HA 3AG9A 3FMHA 2Y8OA 2AUHA 5HTCA 5EHYA 4R5YA 1K3AA 4XMOA 4UY9A 3AOXA 5F94A 4EUTA 3GU8A 3MESA 3KRJA 3ORPA 5TT7A 3LVPA 5EYKA 3ATTA 1VEBA 4BHNA 4NM5A 3S3IA 3SOCA 1RDQE 3BI6A 3KVWA 2E9PA 4L3LA 1FMOE 2BTSA 1V1KA 4HYIA 5BQ0A 2XIZA 4XRLA 1DI9A 3F9NA 3PP1A 3TNPC 1NA7A 2A4LA 5BVFA 4IC7A 4PMTA 3OWPA 3CQUA 4CYIA 3HECA 3OF0A 2V22A 3QUDA 3R22A 4RX5A 4GU6A 2O63A 4XOYA 1M7NA 4JQ8A 4A4LA 3DGKA 4ZSAA 3TL8A 5AJQA 1OKWA 3DBCA 4NKSA 2HXQA 3D4QA 2HOGA 1PKDA 5EM7A 3FMMA 3ZFYA 3RAIA 4DFYA 3VQHA 4LFIA 4P2KA 4R3CA 2BAQA 4E7WA 1ZOGA 5E92A 4AT3A 4KIQA 4EUUA 1KWPA 4JIKA 4FT3A 4X2GA 4J1RA 4N70A 1UWJA 5DT0A 3U8WA 3UO5A 3WILA 4ZS4A 1H07A 1PXLA 4U0IA 3DXQA 4DC2A 3DXNA 5JGDA 5DA3A 3EMGA 4U9AA 1R3CA 2ONLC 3WI6A 4AS0A 2C5XA 3G15A 5CI7A 3SLSA 5HORA 3ZRKA 3FMEA 3O50A 3OCBA 3N9XA 4F65A 2YM6A 1DI8A 3BHVA 4EOQA 4QOXA 3R1YA 3PRFA 4U3YA 3QYWA 2I0EA 3LPBA 4PV0A 3V8SA 4A4XA 3QHRA 5JMSA 2QI8A 3VS7A 2WMTA 4AE9A 4CEGA 5LVMA 4IWDA 4ARKA 2XNMA 3W1FA 4R78A 1FINA 4BFMA 1OBDA 5J95A 4HGEA 3HUCA 4WG5A 5AR8A 3LLTA 3VJOA 1JPAA 4CCBA 2V5QA 1OUYA 3D94A 4G17A 4D0WA 3PXKA 3TEIA 4EQCA 4KAOA 3CTHA 4M15A 4IVCA 4AE6A 3FC2A 3H30A 4WD5A 5C03A 1Q99A 5AM7A 4AXAA 2W1ZA 3C50A 3EFWA 1APME 4PP7A 4HJOA 4V05A 4C62A 3FYJX 5BVDA 3NVMB 3NPCA 3CLYA 4DYMA 1PJKA 1K2PA 4U44A 5DNRA 4LGGA 1SVEA 5ACBC 3IW5A 4AZTA 2QG5A 3H10A 4D2PA 4ZZMA 5HD4A 5DYJA 3O71A 4U7ZA 5DT4A 4F7NA 2AC3A 4GG7A 2RFDA 2XM9A 3EQIA 4O21A 5LVOA 4OT5A 2VRXA 2H6DA 3GB2A 3NEWA 4OGRA 5ETIA 4YLKA 4QP8A 2VTNA 4RX9A 1U4DA 4MTAA 5I3OA 1ZLTA 3PJ3A 4JL9A 4EK4A 3DAKA 3QQFA 4DEBA 2CKPA 2VU3A 2B0QA 4EK5A 2YJSA 3OT8A 4FV6A 4O0YA 5DLSA 5AV2A 4D4RA 4CG9A 2C47A 3V6RA 2WMUA 3BYUA 4FOCA 4FSTA 4FK6A 2QOLA 5KUPA 4G3CA 3F69A 1BKXA 5CAQA 2R3RA 4OT6A 2OXYA 3KGAA 2W4JA 5EQEA 4WSQA 2GNIA 4DT8A 2YIXA 4L43A 5HVYA 4ZEGA 3IO7A 2C30A 2PY3A 3EWHA 3PXFA 1NXKA 4YSJA 4Y73A 3P4KA 4JS8A 2A2AA 1PXKA 1VR2A 4DFZE 4ALUA 4Z16A 3JY0A 3I0OA 3F3WA 3UO6A 3CP9A 2Y7JA 4IWOA 2CHLA 5CS6A 4ZY4A 4YO4A 2E9UA 4FV1A 3O7LB 5FDPA 3OT3A 1TQIA 2X2LA 5EKNA 5LWNA 3F5UA 5DH3A 4PDSA 4ACMA 1KV2A 2H8HA 4L68A 4XJ0A 1ZZ2A 1ZMVA 3LFQA 4A9TA 4F7JA 2Z02A 1V0OA 4DHFA 1BYGA 3UGCA 2W1IA 4RC2A 3VUMA 3GFWA 4FTAA 2XNBA 4FKUA 2QHNA 3BE2A 1UA2A 4XV9A 4RX8A 4YJRA 3BGZA 2XNPA 2HCKA 2EXEA 3BZ3A 3Q04A 2IVVA 2XJ0A 4M67A 5CAPA 4LL0A 3E63A 3EZRA 2Z8CA 3MH2A 3C5UA 1BI8A 2GHLA 4NK9A 4GYGA 2BR1A 1CMKE 3N4TA 4IH8A 3QZFA 3OUKA 4YPDA 5EI8A 4ASDA 2PMLX 3Q6UA 2FVDA 4RIXA 4HYSA 3Q9WA 4CFUA 4ZZNA 4G1WA 1JLUE 3AT2A 2ONLA 4AW1A 1O9UA 4Z7HA 4BDKA 4ACDA 4IJ9A 5HOAA 2PL0A 4EOOA 4TWOA 1ZY5A 1ZYSA 5I0BA 3BBWA 4YJVA 1H1RA 4PRJA 4EOKA 5M44A 1XH6A 4ASXA 3MJ1A 5GZ9A 3QGWA 4C4GA 4BICA 3FLSA 3MPMA 3HDMA 4FVQA 2O3PA 3R73A 4Y5HA 5IA2A 2QG7A 2Y6OA 2OGVA 4FI1A 4L01A 4MXCA 4ITHA 4YHFA 4IX4A 3Q9YA 3EFKA 4I3ZA 4H3PA 1ERKA 4WUAA 4PTCA 4YZDA 4Z55A 5CAUA 2WMWA 3SVVA 2YCRA 2QR7A 3BRBA 4MH7A 4BCKA 3I4BA 1MRVA 4FNZA 4A9YA 5KCVA 5J8IA 4KKHA 5KNJA 2Z60A 3HV6A 2BKKA 4FT5A 4D0XA 3ET7A 4IDTA 2JFLA 3LW0A 2W05A 3VS6A 4GK4A 4O0TA 3ZTXA 2VWIA 1OMWA 2OW3A 4EWQA 1KUTA 2C6TA 5CU0A 2BFYA 3LFSA 2R9SA 1K9AA 1H00A 3BPRA 3DDPA 4ZOGA 3UQGA 3JR1A 2WO6A 4JNWA 3QCSA 5E8ZA 2YLEA 2GNFA 1CSNA 2B1PA 1H1QA 3A7JA 3BEGA 3QBNA 4FEXA 1YVJA 4ZTQA 4EK8A 4KSPA 2HXLA 4QTAA 3H4JA 2VZ6A 1AQ1A 3PJCA 5CU3A 4X6RA 1KOBA 5F1ZA 2J0IA 4RA5A 4J95A 5FTQA 3MFTA 4MQ1A 3VBQA 3FQSA 3MY5A 4I24A 4BKJA 4XYFA 4O86A 3QCQA 2Z7SA 3QKKA 4RVMA 5HE3A 5C8MA 2J6MA 3KK8A 3O8TA 4AF3A 3P7BA 1O6YA 4R1VA 2CMWA 2C0OA 2X4ZA 5K5NA 5J9LA 5AR5A 4QYHA 4R3PA 5KMJA 2JC6A 4RZWA 4XG2A 3QA8A 4AZVA 4ZS0A 3SV0A 4FTUA 4NFMA 5EQPA 2XYNA 1H08A 5IA5A 4D1ZA 3CPBA 2OFVA 4BI2A 4LM5A 4G9RA 5G6VA 1R78A 2VGOA 1PYEA 3L8XA 2QU6A 4FKSA 3EHAA 4CKRA 3PJ8A 5AEPA 2G1TA 4D4SA 5CQWA 1J1BA 3KY2A 3PLSA 4K6ZA 1UNLA 4IAIA 4MNEB 5HIBA 2PULA 4DEIA 4DN5A 4TL0A 2O8YA 3ULZA 4S34A 4V0GA 3SKCA 3P79A 3JY9A 3ROCA 4EH6A 3ACKA 2EB2A 4GJ2A 3ELJA 4GIHA 4Q5HA 5BNJA 2ETKA 4G3DA 1P14A 5IPJA 5EDPA 3PVBA 4IANA 1H0VA 3TV4A 4RWLA 5IUHA 4OLIA 2XK9A 1T45A 4AWIA 3PYYA 3QRJA 3RM6A 2F57A 4RX7A 5BPYA 4F6WA 4MKCA 5AV3A 4XBUA 2BRBA 2HY81 4WBOA 5DT3A 3E3PA 4F1TA 1OIUA 4E1ZA 1XJDA 3EIDA 5D7VA 3LCDA 1HCKA 4LV5A 3DBQA 4U45A 5J87A 4UV0A 3QQGA 3HV4A 4G3FA 5KMKA 3ZBXA 2X8IA 3W2OA 5IH6A 3MS9A 1R0PA 3ZO4A 4HVIA 5DI1A 1OL7A 3R6XA 3IECA 5A4TA 3TNWA 3LFFA 2A0CX 3DFAA 3IOPA 5J9YA 3RK7A 2UW5A 5FP5A 4Z3VA 3HV3A 1WBOA 1PXJA 2YABA 2PHKA 1TQMA 2QKRA 5FP6A 5LARA 4BTFA 1YXTA 2W9ZB 5FRIA 3FKLA 4Y8DA 2WMXA 3OHTA 3GCUA 5HEZA 3PUPA 4OTPA 2XK7A 4HYUA 1CKPA 2HZNA 2ZV2A 3G5DA 2QQ7A 4I1ZA 3T8OA 2ITQA 4YZMA 2B4SB 3ETAA 2JLDA 1YXUA 3AT3A 1V0PA 2OXDA 4S2ZA 3TNHA 5A46A 2R3GA 2R64A 4O7SA 3QA0A 1IG1A 3Q32A 2UW4A 2CNQA 1CTPE 2RSVA 4O0XA 4QTDA 3V6SA 3EH9A 4F0GA 3GU7A 5IEYA 4H05A 2J9MA 2XBAA 4YJNA 1TKIA 3BYVA 4O84A 2VTSA 4DTBA 2WQOA 4QNAA 4JDHA 2PE0A 5EYMA 5HO6A 1Z5MA 4DG2E 3G33A 4N0SA 3GUBA 4FTMA 4BBEA 3GCPA 4EOMA 3KCFA 1OVEA 2YN8A 5M09A 3BGQA 4M12A 3DKOA 3I0QA 5EG3A 3SW4A 3P7AA 4QPMA 3DJ6A 4O91A 1XBBA 2WTCA 2C6EA 1SVGA 3FI4A 2YIQA 3L8SA 2YCSA 4APCA 2GPHA 2VX3A 3SGCA 1YKRA 3JPVA 3RPYA 4XOZA 5J9ZA 4H3QA 5EW3A 5L6OA 3DK6A 4PTEA 4O1OA 1YWRA 5GZ8A 4I23A 4O7ZA 3GC9A 3HV5A 3N51A 3FMKA 1A9UA 3TJDA 3VBXA 4J71A 4I41A 4E26A 2C0IA 3FL4A 3MFSA 4OTWA 5CXZA 5AR7A 1XKKA 2RG5A 3REPA 4FG9A 2PUUA 4O0UA 5BUJA 5KMOA 4AZEA 4IXPA 4I20A 3KKVA 4GKHA 4NYEA 4U3ZA 4JX7A 1UNHA 2R5TA 4ASEA 5ANKA 5KMMA 5DGZA 2CN8A 4XCUA 3WZDA 4AN3A 1H1PA 4RFMA 3LKMA 4FEVA 3GU5A 4C37A 2YDIA 1WBNA 4JQ7A 5TO8A 2JD5A 2LAVA 4E6CA 4IX3A 2CKQA 3V5TA 2C5OA 2YCFA 3TDVA 2QOHA 4MK0A 3TZ8A 3F6XA 3A7HA 2XK6A 2R3FA 4MXXA 4RIXB 1RE8A 3WZEA 4GFGA 1SNXA 4OBOA 5I4NA 1H1WA 4AUAA 3DT1A 4EOIA 3LCSA 3E93A 4DH7A 2PUNA 4ZSEA 2DQ7X 3H9OA 3C4XA 5DR2A 4UMQA 5HG8A 5KX8A 1A48A 2HZ0A 3UIMA 4JLCA 2UUEA 4FZFB 2JDOA 3G9LX 1O6KA 3DBFA 4GL9A 4NSTA 4U40A 1P4FA 4YUQA 4AA5A 3N4UA 4QQCA 2R3LA 3R30A 4DE4A 2GHMA 4FBXA 4CZTA 4EZ7A 5AIRA 4YTFA 3LM0A 5HLNA 3GP0A 3NUYA 4JAIA 4ANOA 5C1QB 4EYMA 5HU9A 3TZ7A 5ETFA 5IF1A 5E1EA 4LQMA 3F2RA 3H0ZA 5HTIA 4X3JA 3P23A 2OF2A 1YRPA 3E3BX 3O7LD 2Y0AA 3IW6A 4M13A 3EB0A 3ZLXA 3G0FA 1UWHA 2QO2A 5CY3A 4MQ2A 2JBPA 4O0RA 3W55A 5EFQA 3QU0A 4L3PA 2DYLA 4X0MA 3VUTA 4IB3A 3HVCA 4BIEA 5AR4A 2X2KA 2QLQA 3DJ7A 4HGTA 4NW6A 2QNJA 2ZMDA 4YGAA 3UOHA 1G8AA 2R3OA 5FTGA 5FXRA 1WBTA 3BHHA 3F82A 3V8WA 3F88A 3LXLA 2Y4IB 4WOVA 4RWKA 3CR0A 2XRUA 3O17A 4YHJA 4TN6A 3A99A 1TVOA 3D7TB 1FVTA 4W9XA 1XO2B 4D2TA 5LJJA 1YXXA 4MXOA 5CVHA 5CSHA 3NR9A 3W10A 4MYGA 3CY2A 4YU2A 3QFVA 4X3FC 2PVNA 3SDJA 4CFWA 5I9ZA 3IONA 3MJ2A 5FQDC 3VS5A 3VS2A 2ERKA 2XIXA 5HE0A 2VTRA 4QPAA 3BYMA 3L9NA 3TUCA 1H26A 4H1JA 3R1SA 4F7LA 4NW5A 3R02A 4AOIA 2I7QA 3C4CA 3GBZA 1TQPA 2QC6A 4DTAA 4EH2A 1Y91A 2JDVA 4KABA 1H01A 3FKNA 4ZTHA 4MNFA 3O8UA 4TYGA 3ZEPA 3DFCB 5L3AA 3UZTA 5J7BA 3R7OA 2BTRA 2CGXA 3HMPA 3DXPA 3ZHPC 3W8QA 4E4LA 2OJGA 3MPAA 2IZRA 4GVAA 2UZNA 3BLHA 2VWZA 1CKJA 2CN5A 3EQPA 2YERA 5IKWA 5IH5A 4E6QA 1ZOEA 1W84A 4RWIA 3AMBA 3DAEA 4RVLA 5H8GA 2X39A 4ERKA 2VWWA 4QQTA 2R2PA 4JG6A 4L42A 5ANGA 2VTLA 3SG8A 5CT7A 2RFSA 2IZUA 2VWYA 3BIZA 3RWPA 5CX9A 3SW7A 4ITJA 2VWBA 3NUAA 4JRNA 4IVBA 4QMPA 4CFVA 4V0GB 1YI3A 4FKOA 3HA6A 3CJFA 5AAGA 4BTKA 5CAOA 3NYVA 3NYXA 3UQCA 4E6AA 4FTIA 3PXYA 4FA2A 2WOTA 1Y6BA 1Q8WA 3ZC6A 4JAJA 4FX3A 4YJUA 5H8BA 4QTEA 4FSZA 2V7AA 2PZYA 2C3LA 4O7VA 4WT6A 3RBWA 3L1SA 3NUSA 5L2TA 1EH4A 4O2ZA 3R1QA 3FZ1A 4FKPA 2PMNX 1NW1A 4W8DA 2IG7A 4DT9A 3QTIA 4DGOA 3MA6A 4IVAA 4I5MA 5M51A 2A27A 4WG3A 3FLYA 1SNUA 3RMFA 1WAKA 5LOHA 4ITIA 1ZARA 4TYJA 4D58A 2W1FA 4HNFA 4K18A 2P33A 3I6WA 2UZEA 1V0BA 3R01A 4MD7E 4YR8A 3VS1A 1GIJA 2I0VA 4USEA 2EU9A 5ICPA 1IAHA 1Q3WA 2WOUA 3FMLA 5ANOA 3TNIA 3PVUA 3VUGA 2YA9A 1Y8YA 3A4PA 4QNYA 4FTTA 4FSQA 4O0SA 1UU9A 1JWHA 3C0IA 3G9NA 3PXZA 4FVRA 3CTQA 2W99B 4GH2A 5FXSA 4M84A 5ANEA 2XK4A 3IW4A 2WFYA 5A6NA 2GNLA 2C6KA 5HO7A 5ITAA 2C1BA 4K1BA 2XH5A 1G8SA 3PG1A 4AN9A 3ITZA 2F9GA 4KKEA 5EI2A 2UW6A 3CD8A 3TKUA 4FEWA 3KL8A 4IZYA 4G31A 2YM3A 3D15A 3Q52A 4JVGA 4W4YA 5EOBA 5BYZA 3VN9A 2H34A 3U4WA 3PP0A 2QLUA 3F3VA 4S33A 4C3RA 4EL9A 4TYHB 5AP6A 2V7OA 5TOZA 5L6PA 4II5A 3RAHA 4J53A 3BYOA 5CZIA 4X3FA 1YHWA 2X7GA 2BDWA 2J51A 2BCJA 2YHVA 3LFNA 4NJDA 5DR6A 2OBJA 4L3JA 4QD6A 4OR5A 4CZYB 1ZY4A 2I0HA 2UW9A 3NW5A 2JEDA 1M14A 5KZIA 4GFMA 3QKMA 2JKKA 1REKA 3H0YA 4O7WA 3W2PA 1YXVA 1FVVA 3R63A 1YHVA 3BLQA 3FC1X 3QD0A 3HMMA 4MX9A 1LUFA 1IEPA 5DRDA 3KC3A 2R7IA 1S9JA 2XIYA 3A61A 4EH4A 4IHPA 3UPZA 3RK5A 3U6JA 2KTYA 4TNDA 3DJ5A 5JGAA 3C0GA 3RKBA 3R00A 3IW8A 4DLJA 3ZYAA 2ITOA 4WIHA 5JZNA 4ANBA 4GU9A 4CZUA 5JRQA 5CQUA 4YC3A 4YHTA 4V01A 5HG5A 2C5YA 1GAGA 2OJJA 2Z7LA 1LR4A 4FTCA 4UN0C 4F6SA 4R3RA 3ZUVA 4WUNA 3ROYA 3ORZA 1XR1A 3VBWA 3DQXA 3RCJA 5AMNA 2HELA 3FWQA 3RZBA 4L46A 4MNEA 4YJQA 4NZWB 4NU1A 1YDTE 3AD6A 4DH8A 4FKGA 3R2BA 5LMBA 3DKGA 3UQFA 4YZNA 5JQ8A 4PPBA 4WG4A 3WF5A 2OF4A 3MH1A 1SM2A 3V5WA 3CC6A 5F95A 3E7VA 2JIVA 3TV7A 1UU7A 4W4WA 2J0LA 3ZUUA 2WU6A 3A8XA 4DFNA 4FEUA 5AP2A 2GU8A 5AM6A 4IFCA 3K3IA 4DGGA 1H27A 3E8DA 3JUHA 5E8UA 3LFAA 2XK8A 5HO8A 3R04A 3GU4A 3R7YA 1OGUA 3GVUA 5L2SA 2CCHA 4BTMA 4ZXTA 2WEVA 2R3QA 3JS2A 1E1VA 2PVHA 5LWMA 3C4ZA 3NS9A 3MDYA 4LUDA 1KE5A 4HW7A 1HOWA 3R0TA 5AIKA 3ZFXA 5C8KA 4TXCA 4ENXA 3QYZA 4WNMA 3BU3A 4C4IA 3DTWA 4IAKA 4UWCA 3KXNA 2YM7A 5EYCA 4UMUA 1WVYA 2R3NA 4YLLA 4L44A 3R7UA 2B53A 4ZK5A 4BWPA 3P0MA 4FZDB 4ZTSA 2FSMX 3S4QA 1IRKA 5FG8A 3GCVA 3TWJA 2VN9A 2J4ZA 3R7VA 5IQAA 4O7LA 2G9XA 3FAAA 4E4NA 3I81A 3A2CA 2PUPA 3TNQB 2XA4A 4TTHB 5A4LA 3KK9A 3KMWA 4JIAA 4BCNA 3KRRA 3RPRA 3ORXA 4HZRA 3NNWA 3VW6A 2ITWA 2C0TA 2VTPA 3DQWA 3OROA 2BROA 4G6NA 4Y5QA 4FC0A 3FE3A 4HVDA 4ZJVA 3MV5A 3NRMA 3CXWA 4BI1A 3DS6A 4FG7A 3JYAA 3HAMA 5HVKA 4HZSA 4MXYA 2XJ1A 4HCVA 1OITA 4FV9A 4LUEA 4MXAA 5HG9A 3U9CA 3D9VA 3VW8A 5GIOE 1XBAA 4J96A 5GJFA 5IQCA 2Y4IC 4CQGA 4E20A 4FIGA 3E62A 5F4NA 2B55A 4LYNA 4CLJA 5BVEA 1YWVA 3B8RA 3WBLA 3PZHA 3LQ8A 4FT7A 4DF3A 2BALA 1KE8A 4KRDA 3OY3A 2F7XE 1W83A 1DM2A 5LCKA 4FSYA 2C3JA 3IGOA 3QXOA 4NJ3A 4XS2A 2W5BA 1XBCA 5IMEA 4ORKA 3QLGA 2AC5A 2YEXA 4L00A 4XBRA 3ODYX 5AWMA 4DH1A 3E64A 3F2NA 3QRIA 4JT3A 3VS3A 1SVHA 3E8CA 3L8PA 3VO3A 4EH5A 4I6BA 2RIOA 4F64A 2WAJA 1OB3A 4UXQA 3QRKA 2UW0A 2P55A 1LP4A 2G2IA 3AXWA 3NNVA 2R3JA 4I4EA 3TI1A 4BDDA 5F9EA 2W7XA 5L4QA 5CVFA 3HZTA 1PMNA 3SX9A 5IEXA 2CGUA 3UIXA 4DAWA 3NGAA 4XG9A 4MWIA 4E73A 3GT8A 2OI4X 4QP2A 2J2IB 3VQUA 3QTWA 4JBOA 4YZ9A 4OTIA 4K11A 4J7BA 2ZM4A 3ORIA 3SD0A 3M2WA 4X2NA 3LQ5A 5HLPA 2F2UA 3EN6A 3LFCA 2B9IA 4TZRA 4QT1A 5CLPA 4JG8A 4NL0A 4BDEA 3FLZA 3FPMA 3CY3A 4TWNA 4D1XA 4F0IA 3ZXZA 2P2IA 3EKNA 3KQ7A 3THBA 4KBAA 4B8LA 4GKIA 5M4IA 4JI9A 3KCKA 4FOBA 1SZMA 4AGCA 4MAOA 2W4KA 3GEQA 5HICA 5FLFA 3K54A 3PA3A 1ZZLA 3AC5A 4J98A 4BDIA 3DOGA 4C8BA 2UW7A 3W2SA 3C4FA 4V04A 2XMYA 4BDFA 2QD9A 5M08A 1CM8A 4YJSA 4C7TA 4K0YA 3VIDA 5HX8A 2C1AA 5JK3A 5DFPA 4EOJA 1BMKA 5D1JA 3ZC5A 1PF8A 3W16A 2WELA 4UMPA 2YIRA 5BVKA 3MWUA 5E8YA 3SOAA 5CTPA 3VUDA 5KMLA 3LHJA 3FSKA 1BI7A 2WIPA 3WF8A 1ND4A 2OXXA 2R3KA 4IX6A 4AG8A 3TZ9A 4X6QC 2X2MA 3TTJA 3OCTA 4IAAA 2F49A 4JR7A 1NVSA 3BQRA 1YWNA 5KMIA 4GK2A 5LVPA 3VC4A 2GTMA 1B39A 3UOLA 3POOA 5BVWA 2R3MA 1LPUA 1R0EA 3KEXA 3ERKA 3TTIA 4BCFA 2HW6A 3Q4CA 1URWA 4JX3A 3VBTA 3NMUF 1PXMA 3EJ1A 4IAFA 1H8FA 1ZMUA 2ZM1A 3EFLA 3ZS5A 1OPKA 2XP2A 5K9IA 3BV3A 2GS2A 3QKLA 5CI6A 2GQSA 3QQKA 3ALOA 3HMIA 4TRLA 4DCAA 2UZUE 2WTKC 4RGJA 3W2RA 4DITA 1J7IA 5HBHA 4EKLA 3IGGA 4Q2AA 3VJNA 2VV9A 2Z7RA 1KE9A 5EHOA 3EQFA 4R1YA 2VTOA 3E7OA 4BDJA 4MD8E 2O65A 3NIEA 3ZLSA 4GCJA 3IK3A 4QP6A 4LGDA 3D7TA 2A19B 3FSFA 5HNIX 3DBDA 4X3FB 4OW8A 4ALWA 3UNKA 4I92A 4NCTC 4IWPA 5L2IA 3E92A 4AGDA 5CAVA 2P3GX 3NUUA 5L2WA 2ESMA 3FLWA 4FV8A 4DTKA 5I9XA 1H28A 4TKSA 3COIA 4EBVA 2CKEA 5E8WA 1WBWA 3OEFX 2PVRA 4A9RA 4AGUA 2J5FA 3PVGA 4CTBA 3VNTA 3QQJA 4BCPA 2O5KA 1QL6A 3UMWA 5KKRC 2PTKA 1FGIA 4FKRA 3VULA 3WYYA 3VS0A 2VNWA 2EB3A 3P5KA 2IW6A 3P86A 4FNYA 3ODZX 4I5CA 4U97A 4Y83A 5H9BA 1H4LA 3WF6A 4BYIA 2FH9A 3OTUA 4G5PA 2QCSA 3C4WA 4WA9A 5M4UA 3KVXA 5C9CA 3V3VA 1E1XA 4L8MA 4MBLA 5FWKK 5AV4A 4YPSA 2HAKA 2HENA 4HGLA 5FGKA 3L9PA 3DV3A 3QWJA 4QP1A 2VO7A 4EBWA 4PPAA 3D7ZA 3FPQA 2I6LA 1UU8A 2VUWA 3QGYA 3O0GA 4QYYA 1FVRA 4BC6A 5AV1A 4GEOA 4EQUA 3C1XA 2BMCA 5B2MA 3D0EA 5JFWA 3UMXA 4A07A 3PA5A 4PX6A 5E7RA 4C2WA 3KXXA 5BUIA 1JOWB 4CFFA 1LEZA 3JVSA 4BBFA 4RWJA 4FMQA 5A54A 3IKAA 3CGOA 5AX3A 2VWVA 2UZVA 2JAVA 3PVWA 4NT4A 2F4JA 4JBQA 3SG9A 1KV1A 3LMHA 4IC8A 3MVMA 2XS0A 3Q3BA 4M0ZA 2JKQA 5AV0A 5CVGA 1Q8UA 4ZSLA 4FUYA 2IZTA 4BIDA 1MUOA 2XNNA 5L8LA 3ULIA 1P5EA 3RJCA 3UNJA 1UKIA 3IOKA 3ZOSA 3CEKA 4XNEA 1OI9A 2OFUA 3OMVA 4FKLA 4IFGA 1CKIA 2UZDA 4O1PA 3EQHA 2BIKB 1YI6A 2UVZA 4O6LA 5ANJA 3AC3A 3DBEA 4EORA 4BYJA 4AW0A 4NFNA 3BV2A 5IDPA 4AP7A 4F9CA 4O38A 3RNIA 5EM6A 5HNGA 3RWQA 2F2CB 3HL7A 4C58A 3IS5A 5FEQA 1VYWA 3RZFA 3SAYA 3R9OA 3DCVA 1ZMWA 4Y72A 1OM1A 2WB8A 3A4OX 3F3ZA 1MQBA 4DFUA 4BCMA 3P1AA 3R8ZA 4HYHA 3BU5A 3KRWA 3OOGA 2BIYA 4IX5A 3ORTA 4L7SA 4QMVA 2ITUA 2R0IA 1ZOHA 4AFJA 1M52A 3GFEA 2BHHA 5IH4A 3NYNA 4C4EA 4EHEA 3V01A 5GINE 2QKWB 3C13A 2VO3A 4AA4A 5ANIA 3VVHA 4BDGA 4EOLA 4CG8A 4HCTA 3CKXA 3WZUA 3FLQA 4S31A 3TCPA 1FMKA 2GS6A 5EH0A 1QPJA 2PSQA 4DEGA 1OIQA 1QCFA 2VTAA 3MB7A 3QUPA 3PPJA 5A14A 2J5EA 3HA8A 2VO0A 4FIIA 3U55A 4P5ZA 4KRCA 1I09A 1PXIA 2QO7A 2OU7A 4YTHA 5E90A 3COMA 3F5PA 5AR3A 2IN6A 3FI8A 4KB8A 3EKKA 1WVWA 4BGQA 3U6HA 1ZYLA 3NAXA 5EW8A 4KBKA 2PVYA 2XJ2A 3RI1A 3ZO2A 3PIZA 2QVSE 4RBLA 3PJ2A 4N57A 1XH5A 2HYYA 3OEZA 2GMXA 3KXZA 3QTXA 5CYIA 5KBQA 4NWMA 4TYHA 3DLSA 4A9SA 4XG8A 5DIAA 3R9NA 4NCTA 2NP8A 4BCOA 4KWPA 3DDQA 1XH9A 3G90X 5CF5A 1F3MC 1Q8TA 3HRBA 5CEQA 5A4EA 2CCIA 3IDCA 3CE3A 1BUHA 3PZEA 4YJOA 3Q4ZA 4PY1A 2OIQA 4J8MA 5AA8A 4LMNA 3PSDA 3TG1A 1YDRE 1ZWSA 2YFXA 3QD4A 3QCYA 3OTVA 5B0XA 5LMKC 3FHIA 1MRYA 3KRXA 4CT1A 5E4HA 2UVXA 1OL1A 2IZSA 4ZLOA 3QTZA 4I22A 3ZBFA 4BBMA 4CMUA 4BCQA 1XH7A 4BL1A 3EQDA 4DBNA 4EQMA 4FSNA 4ZP5A 4RIOA 1OKZA 3FXWA 4MXZA 4C02A 5H2UA 5DEYA 3NUXA 1ZYDA 5AX9A 3BU6A 3ZSIA 3EL7A 3HRCA 4NTSA 1GZNA 3FZRA 4MHAA 4XV2A 5EDRA 3LCOA 4DEEA 2X4FA 3R2YA 2PZIA 4YC6A 5CSXA 3QRTA 4FTKA 4I0SA 4OBPA 4BKZA 1JSVA 1H1SA 2IVUA 4DFLA 4DGNA 2RFNA 1XHAA 3DY7A 4IAZA 4AT4A 2QOKA 4FGBA 4HPTE 3K2LA 4BCIA 2C4GA 3BCEA 4IQ6A 4UX9A 3VAPA 4ANMA 4L7FA 4F9AA 4HVGA 4IVDA 4FTLA 2NO3A 4LOPA 4FV2A 3WIGA 2ITPA 4UBAA 3IDBA 5IA0A 3V5QA 4R7IA 4RIWA 3WE4A 3FUPA 3GC0A 4BDBA 5FM3A 3KF7A 3LIJA 3FHRA 2B9JA 4YNOA 2QOFA 3MH3A 4I4FA 3Q2MA 1YHSA 3HYHA 2G2FA 4DFBA 4RC4A 4RLKA 1AGWA 4CT2A 3NCZA 4F99A 3QQLA 3ORMA 3AMYA 5A6OA 2OWBA 3ZO1A 4GMYA 3COKA 5J5TA 2X6EA 2YITA 3P9JA 2Q0NA 3DLZA 2BILB 1UU3A 4GT3A 4QYEA 2JIUA 5IU2A 5FBNC 4EH9A 5JN2A 4OAUC 4RJ5A 4RIYA 2F7EE 3COHA 3FXXA 3K5UA 4J97A 4BZDA 2F7ZE 3E8NA 2LGCA 4ZMEA 1OECA 3ENHA 4RQKA 4BDHA 3QC4A 2XKDA 5DHJA 2RFEA 3PG3A 3OW4A 3Q4TA 4U41A 5IMXA 3S95A 2BFXA 5JFSA 2XYUA 3EQRA 4AACA 3R71A 1QPEA 3F3TA 4KSQA 4RMZA 2G15A 1IAJA 1STCE 1WCCA 3EN9A 4F9YA 2XIKA 4CRSA 2I1MA 5IEVA 4EH8A 3PA4A 3HDNA 4MF1A 3SC1A 4OAVB 3CQEA 4LOOA 4ZY6A 3PIYA 2UW3A 2CGVA 3QZHA 5FD2A 4BIBA 3QTUA 4IW0A 3FLNC 3NUNA 2Y9QA 3ZRLA 3DZQA 4M69A 1QPCA 1U5RA 3Q2JA 2A1AB 4B0GA 1SMHA 4TNBA 5D41A 3GNIB 2HK5A 4HOKA 4F6UA 2X7FA 3PWDA 1WZYA 5HG7A 1GZKA 1JVPP 4BRXA 3G6HA 2O2UA 5FXQA 5AP7A 5LVLA 5IQGA 4FV5A 1FPUA 1G5SA 4ZTNA 2BKZA 4AX8A 2OH4A 2VNYA 5K5XA 4FT0A 5AUWA 4O7RA 5LQFA 2JFMA 5HIDA 4TWCA 4F1MA 2B9FA 2XKCA 4FZ7A 5HU3A 2XUUA 4CSVA 2J0JA 5LMAA 5C01A 5TE0A 4AGWA 3Q6WA 3TUBA 2ZV8A 4BN1A 4MD9E 5HE1A 4IB1A 4TT7A 5LMKA 3U87A 3BELA 2XRWA 4JXFA 3OW3A 3MN3A 5A4CA 4UZHA 4O0WA 4M3QA 2IW9A 4EI4A 4FV0A 4P5QA 2PWLA 4CXAA 5GIPE 5FBOA 3MVJA 3VF9A 5BYYA 3DZOA 1Q24A 4RFZA 3BYSA 3NNXA 4YZBA 4PDOA 5I5ZA 3D5UA 3ZDIA 4NIFA 4FIFA 4S32A 2BZKB 3FKOA 4FF8A 4AZSA 3LXKA 4B7TA 3ZLYA 3U54A 3FZOA 4UXLA 1MP8A 2BRMA 4LRJA 3P08A 1OIRA 4D2WA 4KNBA 5M4CA 2X81A 3NCGA 4KD1A 3HV7A 3DKCA 3TXOA 3ZM4A 2V55A 4GSBA 2OKRA 4BWXA 4L6QA 4EK6A 1RW8A 2CLXA 2ITYA 3PXQA 4FL2A 4PNIA 3AD4A 3UP7A 4OTRA 4HVHA 1KSWA 3C0HA 2FA2A 4FTRA 3OS3A 2XZSA 1BL6A 4YC8A 3PFQA 5JFVA 5LCJA 2WEIA 5M4FA 3S00A 2BRGA 2ITNA 3GCQA 5J1WA 4Y95A 3R21A 4QMZA 3LCTA 2ZM3A 4D28A 4Q9SA 3CD3A 3R83A 3JXWA 4E5AX 2J90A 5CEKA 5CALA 4W4VA 4XLVA 4X2JA 3VRYA 2BZHB 4IZAA 3ZU7A 1W7HA 3OXZA 4IM3A 3E8EA 2P2HA 2FGIA 3CPCA 5GHVA 4EH3A 4OUCA 3KA0A 1GJOA 4UYNA 2OH0E 3OVVA 4LV8A 3PJ1A 4IACA 3FI3A 1H0WA 5T6KA 4PMPA 2YZAA 2CPKE 3EFJA 4R7HA 5AUVA 2CNVA 4BB4A 2IPXA 2FUMA 2OJIA 3Q5IA 2YACA 3DB8A 4B99A 1M2QA 2NRYA 3KULA 4IB5A 3LJ0A 2GHGA 4TYEA 1JKTA 3GOPA 4PTGA 2X9FA 4GT4A 1NY3A 4M68A 3PRIA 4LRMA 5DWRA 5JSMA 5IQHA 4G34A 4W9WA 2QR8A 1WMKA 2ZB1A 3ALNA 1E9HA 2ACXA 3VUKA 2OK1A 4BDCA 4BGHA 4JRVA 5AR2A 5IZFA 3NW7A 4Q5EA 5IQDA 1IR3A 3QRUA 4XUFA 2EVAA 3A7FA 4RJ7A 5CWZA 4M66A 4G3EA 5AA9A 5CEPA 4K9YA 3VBVA 4C61A 4GUBA 2R3IA 3BHTA 4XP0A 5K0XA 3QXPA 3HX4A 4D55A 1Q41A 4WNOA 4QMYA 2VX1A 4YZCA 3UIUA 4YBJA 3ZUTA 5B7VA 4E4XA 3TACA 4D1SA 4JG7A 2WTKB 2UVYA 4BTJA 2YIWA 4E5WA 4DEDA 1NT2A 1A06A 4PP9A 2NNWB 4X2KA 4J99A 1HCLA 2ZJWA 3DA6A 2J0KA 3RHKA 3UYSA 3SXFA 2QOBA 2PE2A 3MW1A 3BGPA 4EOSA 4DA5A 3CCNA 4S30A 4DGLC 1JKLA 3AC1A 3I6UA 4FNXA 4JQEA 4QYGA 3FMJA 2WNTA 4HGSA 4U6RA 2Y4PA 4ANQA 3ANQA 3UYTA 3NIZA 4DEHA 1JBPE 3MI9A 3OG7A 2BRHA 1W0XC 4AZFA 1YW2A 4AOJA 3RGFA 3UIBA 4FGRA 1M2RA 2BVAA 3LAUA 4D4YA 4E93A 2ERZE 4AN2A 2E9NA 4TPTA 4ANNA 5IUIA 3BX5A 4FT9A 4FZ6A 4QMXA 2VO6A 4BHZA 4USDA 5F20A 1VYZA 3PSCA 4E5BA 5KKRB 2VTIA 4Y85A 3CTJA 4MF0A 4CCUA 3VF8A 3UJGA 2X8EA 3S2PA 5L6WL 4JOAA 3TKIA 1OL6A 2JDTA 3Q96A 2RL5A 4I0TA 5E8SA 1Y57A 5LXMA 4FKIA 2CJMA 5FDXA 2RKUA 1IASA 4QMMA 4C4JA 2WQBA 3AT4A 3KMMA 1J3HA 2P0CA 3BHUA 4EKKA 3AC8A 4QYFA 3F2AA 4PDPA 3KB7A 5E8XA 3OBJA 3QD2B 5AADA 3EOCA 3R9HA 4KBCA 5DRBA 5J7HA 3LJ1A 3LM5A 3ZLWA 4YO6A 3PPKA 4IZ5A 3M1SA 5M06A 4LRKA 4WKQA 3BBTB 5CNOA 4CKIA 3W32A 2FSLX 4FSUA 4YURA 4AOTA 2QURA 3FMDA 3NNUA 2C68A 1RJBA 4IAYA 3KXHA 4M8TA 1J7LA 5HBJA 1UV5A 3RPVA 2GNGA 2W1EA 3LZBA 3WE8A 4AAAA 4BVUA 4D4VA 4FICA 5M53A 4FG8A 4RIWB 2Q83A 1QPDA 2XNOA 5AUZA 4APPA 2R3PA 3RVGA 2IO6A 2ITTA 4ZY5A 4QMOA 3DU8A 3F5XA 3RPOA 3DB6A 3DNEA 4C59A 4CVAA 5M07A 2E9VA 5CXHA 5TKDA 5IG1A 4EZ3A 3PLAE 1I44A 4OTHA 4KINA 3DPKA 5D10A 3PE2A 4NUSA 3OOMA 4GVJA 2OIDA 5AUXA 2BAJA 2FSTX 4RC3A 4QMNA 3UP2A 2H9VA 3BQCA 1H24A 2ZAZA 3Q9XA 1B38A 4RG0A 4O6EA 4C57A 2GNHA 4OBQA 3NYOA 5HCZA 3QTQA 4YNEA 3KU2A 1Q5KA 3T9IA 2ETRA 3W18A 4RIYB 3ORKA 3HEGA 4A4OA 5I9VA 4C4HA 5T3QA 3GENA 4M7IA 3CSVA 2YDKA 2VTJA 3EQGA 3MTLA 5HESA 2WXVA 3QCXA 4GYIA 2XIRA 4RQVA 4CLIA 5D11A 3F3UA 4FTQA 1Z9XA 2H96A 3D5WA 3SRVA 2WGJA 2R0UA 4DH5A 2YM4A 5IISA 2X8DA 2XK3A 4CMTA 5FEEA 3POZA 3AQVA 2O0UA 4O7NA 3GU6A 2W96B 3D5VA 4KIKA 1P2AA 4D5HA 4W4XA 2ITZA 5AP3A 3UBDA 4BI0A 2PMIA 3MPTA 4GT5A 1W98A 4BKYA 4XV3A 4M69B 3OC1A 3A8WA 2X9EA 4O0VA 2EXCX 5JRSA 3WF9A 4RVKA 3ZZEA 3TUDA 4XG6A 5CU4A 3LJ2A 4ACHA 4UWBA 4W8EA 4EHGA 2REIA 5H8EA 4WO5A 2BPMA 2E9OA 4NKAA 3TT0A 1MRUA 3KF4A 4BF2A 4EYJA 1X8BA 4USFA 3MGYA 3BE9A 5HI2A 1GOLA 4U42A 3FI2A 3WZJA 3NDMA 4KIOA 2YJRA 4IBMA 1OBGA 1PXOA 2PMOX 3VBYA 4L52A 3H3CA 4AW5A 1OKYA 3UOKA 4OTQA 1QMZA 2OG8A 3O51A 4BY9E 3M11A 1Q61A 3RCDA 3IG7A 3G51A 3ZO3A 5HX6A 2VTMA 4ZMFA 4QMWA 2PU8A 2W5AA 3N4VA 2BUJA 2JITA 5EOLA 3NAYA 4B8MA 4FTNA 3R8PA 3Q53A 2YAAA 2B54A 3RNYA 2IJMA 1AD5A 4EK3A 2YWPA 3OZ6A 1U59A 3GOKA 4NIFB 3DNDA 3I5ZA 4LMUA 3SHEA 4O7TA 4KS7A 3LMIA 1XH8A 3FL5A 4AA0A 4QMTA 5KHWA 3CS9A 3LMGA 3SA0A 2HZIA 3ZH8A 4JDJA 3T3UA 3VS4A 4C35A 2I40A 2ZVAA 5L8JA 4FV4A 4GUEA 3KN5A 1Q8YA 2CGWA 4AT5A 2YLFA 5CSVA 5G1XA 1M2PA 3S1HA 1YOMA 4LG4A 4OTDA 4WRGA 3FMNA 5CEIA 5J79A 1NVQA 1GIIA 2XEYA 2J50A 1PW2A 4BZOA 3PY1A 4NTTA 4QTBA 2KULA 3JVRA 3UZPA 1M17A 2HY0A 4XP2A 3ZCLA 3OBGA 3ZFMA 3L9MA 3VWAA 4E8AA 2OSCA 5JKGA 3F7ZA 4WNKA 4PDYA 4YTIA 1ATPE 3L9LA 3OCGA 3A7GA 4AQCA 3FDNA 3II5A 4UALA 3ZRMA 5IUGA 4H36A 4G6LA 2Z2WA 3EYHA 4EC8A 4L45A 2CDZA 5EK7A 4F1OA 3U6IA 1W8CA 4M97A 4BCHA 4A7CA 2WTIA 4IIRA 2W4OA 4EOPA 3FV8A 5KMNA 1UVRA 4DFXE 3KULB 5K0KA 2W1GA 3A7IA 1PYXA 1VZOA 4FL3A 3ANRA 3UC4A 3B2WA 4YLJA 3UDBA 3V5PA 4FKVA 4GFOA 4D2SA 3GQLA 5DOSA 4KS8A 5CF6A 2QOIA 3FYKX 2ZYBA 4O81A 2PK9A 1ZYJA 2QU5A 4YBKA 2NRUA 4FKTA 4C4FA 1REJA 5I9YA 3HLLA 2CKOA 2ETMA 3R9RA 3IDPA 1JSUA 4A06A 5ETCA 4ACGA 4Q9ZA 4FTOA 1DAWA 5ETAA 4E4MA 4UB7A 3I5NA 5IQIA 4ZZOA 4F9WA 4QMQA 3U9NA 3HKOA 2WMQA 3KREA 4C3PA 1Q4LA 2DUVA 1PMUA 3BEAA 5BYLA 4I94A 1KE6A 2ITXA 2WIHA 1ZAOA 5CF4A 5HQ0A 2OICA 4CGAA 4XG3A 3SQQA 2FB8A 4BZNA 5DMZA 4FODA 3MY0A 4WSYA 4MVFA 5IDNA 5K3YA 4NM7A 5A9UA 5DPVA 2XF0A 4XP3A 3EQBA 5BMSA 4DLIA 3DK3A 2JDSA 1F5QA 2VGPA 4BWKA 1JSTA 4X21A 5K4IA 4ZTRA 4H1MA 3I79A 2JKOA 3W33A 3MSSA 3FXZA 4FIHA 2GTNA 5EM5A 4NM0A 4RRVA 5CNNA 3R8UA 4XH6A 4EH7A 1JKSA 3ORNA 3MTFA 4FSMA 5KZ0A 3P7CA 3LFEA 2J0MB 2ZMCA 3PY3A 3FBVA 3KXMA 3OXTA 3C4EA 4RJ8A 2OO8X 4XHKB 3F66A 2OZAB 2HWPA 3KXGA 4ANSA 5BUEA 2ZV9A 4WBBB 3ATSA 4U80A 5ANDA 3O2MA 2UV2A 4OTGA 2VWXA 3DAJA 4G16A 4PMSA 4XG4A 5C27A 3OFMA 4FVPA 4C33A 4D5KA 2WTWA 4QRCA 1ZRZA 5FM2A 3OY1A 2XVDA 2WU7A 2X1NA 4MBIA 2XKFA 3IW7A 4YSMA 2IVSA 1ZYCA 2ITVA 4FKQA 4MBJA 4RVTA 5AUUA 1DS5A 1JNKA 1PXPA 2IW8A 4IMYA 4LOQA 5B2LA 3BKBA 4NEUA 1YQJA 5E8TA 4FYOA 2RGPA 3MVLA 4PL4A 4PMMA 4K2RA 3RAWA 3WOWA 5BVNA 5HD7A 3R9DA 3HAVA 4QQJA 5K4JA 3O96A 4CFNA 3RAKA 2VTQA 1G3NA 4F63A 3V51A 2PPQA 1SYKA 4JBPA 3T3VA 2IVTA 3F5GA 4WHZA 1Y8GA 5FUTA 2JIIA 4AW2A 3FZPA 5A3XA 3RHXA 3QZGA 1O6LA 2RG6A 2YIYA 4IM0A 1L8TA 2W9FB 4AU8A 4X7QA 4GV1A 5H3QA 1PMEA 3TIZA 3WYXA 2X7OA 4U5JA 3D5XA 4PF4A 3OXIA 5EYDA 1PRYA 4NM3A 4ACCA 3TZMA 3UPXA 1U54A 3ZONA 3DKFA 4U79A 2W06A 4E3CA 4EJ7A 4U81A 2WQNA 3LOKA 2BDJA 3LQ3A 5DVRA 3C5IA 2PYWA 2FO0A 2BZJA 3MY1A 3NX8A 2C69A 3K5VA 5E1SA 3ENMA 5B2KA 3KFAA 1T46A 2WMAA 3DK7A 1YOJA 3HP5A 2OJFE 3WF7A 3P78A 2YWVA 3QUEA 5JT2A 4F7SA 4HNIA 5AUYA 2WD1A 2XCHA 5BMMA 2QODA 3SRVB 5IA4A 5J5SA 2XEZA 4LGHA 5C4KA 2C3KA 5CASA
chains in the Genus database with same CATH superfamily
2W1CA 3AKJA 1PKGA 1L3RE 1Y6AA 2W1DA 1Q62A 2XBJA 3ZXTA 1J91A 2ZFYA 4H3BA 4B9DA 3QLFA 5IA1A 3W0SA 4KIKB 3LXNA 3MIAA 3FQHA 2ZOQA 2VWUA 2OIBA 4G2FA 4IJPA 4FNWA 2ZV7A 5CZHA 3I7BA 4IZ7A 3UODA 1U5QA 2YM8A 3K3JA 5DR9A 1PXNA 3IPHA 3ORLA 4PQNA 1B6CB 3MYGA 2W17A 3PSBA 4QP4A 3SXRA 2UZWE 3ID6C 2FYSA 2OJ9A 3HGKA 5AP5A 2VAGA 2EUFB 5HCXA 3BHYA 3E87A 3PUFC 4H39A 2WMBA 2SRCA 4R5SA 3PDTA 5BVOA 1F0QA 4CFMA 4FTJA 2QONA 4G9CA 5CU6A 5JGBA 4F09A 3PY0A 5JFXA 4GG5A 3T9TA 4HCUA 4P4CA 4M14A 4ZIMA 2C3IB 4FUXA 4DH3A 5IQEA 4CTCA 2JGZA 2XNGA 5JQ5A 4TW9A 1KE7A 4ZJIA 4WRSA 3PWYA 4J8NA 4PNKA 1XMMA 4R77A 1M7QA 3G6GA 4I93A 4RSSA 3UE4A 5GJDA 3WZKA 3TM0A 4RFYA 2BAKA 5CT0A 3D14A 1U46A 3UTOA 4FKJA 5TF9A 4FSWA 3VRZA 3HMNA 2BZIB 3MBLA 4DBXA 3V8TA 2WMSA 2YDJA 4P90A 3NWWA 2GFSA 3AGMA 4IDVA 3C9WA 4ZTLA 4A9UA 4C0TA 2PVMA 1H25A 5IQFA 3GGFA 2BRNA 4PWNA 3W8LA 4YJTA 1PMVA 2B9HA 4I21A 3E5AA 4ERWA 4I6QA 2HW7A 3L8VA 1DAYA 3Q60A 4E6DA 5C26A 2ZB0A 1JKKA 4O83A 1GZ8A 1WBVA 3LXPA 4QQ5A 1FBNA 3KRLA 2C5NA 4XX9A 2GSFA 1XWSA 5M55A 1P4OA 3AC2A 3GC8A 4K8AA 4N4SA 4O2PA 4QPSA 2UZLA 3RALA 3ZSGA 5KO1A 3GXLA 3ZMMA 2PZ5A 3TN8A 4UEUA 4D9UA 2XNEA 4ZTMA 4AXEA 4EJNA 3MB6A 4QP7A 4RJ6A 5A4QA 4FIJA 1Q97A 5EW9A 3GC7A 3FY0A 5AUTA 4PPCA 4Z7GA 4JBVA 4BCJA 3CGFA 2VD5A 2J7TA 3R28A 5L8KA 2UZTA 5I9UA 3UVRA 2CLQA 4KUJA 4FL1A 4I6HA 2WHBA 4UZDA 2GS7A 3PE1A 3C51A 2B52A 2JKMA 4C3FA 3UO4A 3W2CA 4GJ3A 1GY3A 2W0JA 2C6OA 4JDIA 3I7CA 4MEDA 3U4UA 2YISA 4EHVA 4ZAUA 4PL5A 2XKEA 4X2FA 1JAMA 4D2RA 4EZ5A 3AC4A 4OTFA 1IA8A 5AP1A 3NW6A 2GQGA 3R1NA 5HKMA 4MWHA 1R1WA 2ZDUA 4FSRA 1LEWA 4CFXA 4D2VA 4LL5A 3WIKA 5HNBA 3QC9A 2QHMA 5HVJA 2OZOA 2WTVA 3A60A 5LVNA 3RINA 4C34A 2WMVA 3ACJA 2XM8A 5I9WA 2PVFA 4QMSA 1BX6A 4BR3A 4ID7A 2E2BA 4C36A 3NUPA 3ZDUA 1RQQA 3QZIA 4DG0E 5BX0A 4QMUA 3MFRA 3M42A 2C6LA 5C4LA 4G3GA 2R4BA 3EYGA 5M57A 3LE6A 5HHWA 1WVXA 4XEYA 3PXRA 3RTPA 3UOJA 3KN6A 3UDSA 3R8LA 2PE1A 3UG1A 2JAMA 4PL3A 3FZTA 4CKJA 3HRFA 1UKHA 3EN7A 3CKWA 1Z57A 2DS1A 3PTGA 4FV7A 3UNZA 4GIIA 4EHZA 2FSOX 2HWOA 1YI4A 4NH1A 2AQXA 2V0DA 4CYJA 3PFYA 3QALE 4U43A 1J7UA 5EQYA 2EXMA 4O82A 4IADA 3OWLA 5EDQA 4L67A 3BLRA 3U51A 3R8MA 1ZXEA 3F61A 4DG3E 4UWYA 2R7BA 3QQUA 3W2QA 5IQBA 5AP0A 4ASZA 2I0YA 4N6ZA 5CF8A 4I0RA 3RPSA 2BHEA 4B4LA 4YMJA 2PZRA 3MH0A 2C6MA 3UVPA 2RF9A 4EC9A 4C2VA 3QD3A 4KIPA 4K77A 4CD0A 5HLWA 2W5HA 4DCEA 4DGMA 1TZDA 4JR3A 3G2FA 1Q3DA 2WKMA 2G01A 3CQWA 4ONAA 1S9IA 3TJCA 3A62A 3VHKA 5ACKA 3Q4UA 3QTSA 3FJQE 4CRLA 1VJYA 3OUNB 3QHWA 4PUZA 5L2QA 4F08A 4F78A 4FKWA 5HGIA 5CEOA 5EHLA 1OZ1A 3R7GA 4ALVA 2O64A 4TWPA 5HCYA 2X0GA 4H58A 2V62A 5KHXA 1URCA 5I3RA 4ZLZA 5E91A 3ZSHA 5AP4A 5GJGA 5CSWA 2X6DA 3D2IA 3EZVA 5HIEA 4CMOA 4GW8A 4FK3A 3FY2A 4AFEA 5TR6A 4EWHA 2WQMA 3NSZA 2GDOA 4GRBA 5J1VA 3GI3A 5HBEA 3D2KA 3V04A 1R39A 2PVLA 5CEMA 3CIKA 3AMAA 5HE2A 3R7IA 4EONA 2PUIA 1JQHA 4GK3A 3AD5A 3HNGA 4XV1A 4JJRA 5JZJA 4FZAB 3LFBA 3V5JA 3PIXA 3ML1A 2AYPA 2B7AA 4HVSA 2NPQA 3D83A 5GZAA 1FQ1B 2WTDA 4XLIA 3QTRA 1XQZA 4QO9A 4F9BA 3FEGA 4B6LA 5JH6A 2W1HA 2YCQA 3EN5A 2YZLA 2QOOA 3UG2A 2WQEA 5D9HA 3UVQA 1GZOA 2VX0A 5D12A 1CDKA 1YDSE 5KBRA 3MFUA 1OKVA 4P7EA 4RJ3A 1U54B 3LCKA 5DEWA 1OPLA 3H9RA 5HTBA 1YXSA 5E8VA 5AAFA 4JDKA 3B2TA 4QMLA 4O96A 4ANLA 4F4PA 5CSPA 5FEDA 2WPAA 4UMTA 3OCSA 4TY1A 3QWKA 2C5VA 5DN3A 4F70A 4HPUE 4G6OA 4Z9LA 2GQRA 4QP9A 5EKOA 4U8ZA 4FEQA 4CQEA 3IQ7A 4O27B 4M0YA 3RM7A 4RZVA 4DHJA 4YP8A 1PHKA 4IB0A 4J52A 2GNJA 3QX2A 4RA4A 5EI6A 3VUIA 2DWBA 2HZ4A 4G5JA 4D9TA 4IWQA 2QOCA 4DINA 4R8QA 5CU2A 3F7WA 4TYIA 4XRJA 3OWKA 5T68A 1KOAA 4BCGA 5EM8A 3MA3A 4RLLA 3QAME 4KKGA 2Z7QA 1OL2A 2HIWA 1MQ4A 3TKHA 3QQHA 1OIYA 4RT7A 4I5PA 4N6YA 1WFCA 1BLXA 3DTCA 4FR4A 4KA3A 2WZJA 3TIYA 5IA3A 3SXSA 2UZOA 3LFDA 5KE0A 2G2HA 3NVKI 3KMUA 4QTCA 3LLAA 2IWIA 3I60A 4FE2A 3Q5ZA 3BL9A 3EQCA 4XG7A 5DBXA 4YTCA 2CSNA 3GCSA 3OP5A 4I6FA 3W0NA 4GS6A 1NVRA 1OPJA 2Q0BA 4CV9A 3CBLA 4IE9A 2QO9A 3GQIA 1FOTA 1GIHA 2WTJA 2VTHA 2WMRA 3OWJA 3RK9A 3UZRA 2EWAA 3QF9A 2Y6MA 4MCVA 5GNKA 5HZNA 4RJ4A 3MVHA 4CNHA 3NZ0A 3BWJA 4UYAA 4BGGA 3TV6A 1BL7A 3HP2A 3CJGA 3HMOA 1WBPA 4K33A 3O23A 4FV3A 4IM2A 4WNPA 4QDEA 4FYNA 5M56A 3EN4A 4R7BA 5C8NA 4ZJJA 3ZM9A 3QL8A 5CENA 4EEVA 4F0FA 2C6DA 1J1CA 2QOQA 4O22A 3S0OA 1YOLA 3TDWA 2GCDA 4BDAA 2JDRA 2PVKA 2PZPA 2OZAA 2YM5A 5DG5A 3RP9A 5AAEA 3C7QA 1OL5A 3EL8A 3FQEA 3R7EA 3PPZA 4Y46A 4IEBA 4ENYA 1XH4A 3H9FA 1PY5A 3OD6X 4ZSGA 3BWFA 3VUHA 2PVJA 4O7YA 2CNUA 2VTTA 3ZZWA 3Q9ZA 2ZDTA 5DE2A 3WARA 3V5LA 3UC3A 2GFCA 2XCKA 3AGLA 1W82A 3HUBA 2UZBA 2P4IA 3FZSA 5E9EA 5CANA 4YJPA 3QX4A 2XB7A 4L53A 4LI5A 4L9IA 4C38A 1Q8ZA 2UW8A 2YAKA 3MIYA 5JEBA 3B8QA 1WBSA 3G0EA 4R6VA 4ZSJA 3E88A 3NLBA 5D7AA 3ZEWA 4I5HA 4AZWA 3I1AA 2OLCA 1UNGA 3R8VA 2X0OA 4DEAA 2C6IA 2BDFA 3O8PA 4RPVA 4QP3A 4FIEA 2JBOA 5FTOA 3VHEA 4CV8A 4ZLYA 1IA9A 4UMRA 1OUKA 5AFVA 1GNGA 1FGKA 2R3HA 3AG9A 3FMHA 2Y8OA 2AUHA 5HTCA 5EHYA 4R5YA 1K3AA 4XMOA 4UY9A 3AOXA 5F94A 4EUTA 3GU8A 3MESA 3KRJA 3ORPA 5TT7A 3LVPA 5EYKA 3ATTA 1VEBA 4BHNA 4NM5A 3S3IA 3SOCA 1RDQE 3BI6A 3KVWA 2E9PA 4L3LA 1FMOE 2BTSA 1V1KA 4HYIA 5BQ0A 2XIZA 4XRLA 1DI9A 3F9NA 3PP1A 3TNPC 1NA7A 2A4LA 5BVFA 4IC7A 4PMTA 3OWPA 3CQUA 4CYIA 3HECA 3OF0A 1W2CA 2V22A 3QUDA 3R22A 4GU6A 2O63A 4RX5A 4LDTA 4XOYA 1M7NA 4JQ8A 4A4LA 3DGKA 4ZSAA 3TL8A 5AJQA 1OKWA 3DBCA 4NKSA 2HXQA 3D4QA 2HOGA 1PKDA 5EM7A 3FMMA 3ZFYA 3RAIA 4DFYA 3VQHA 4LFIA 4P2KA 4R3CA 2BAQA 4E7WA 1ZOGA 5E92A 4AT3A 4QEBA 4KIQA 4EUUA 1KWPA 4JIKA 4FT3A 4X2GA 4J1RA 4N70A 1UWJA 5DT0A 3U8WA 3UO5A 3WILA 1G8JA 1H07A 1PXLA 4U0IA 4ZS4A 3DXQA 4DC2A 3DXNA 5JGDA 5DA3A 3EMGA 4U9AA 1R3CA 2ONLC 3WI6A 4AS0A 2C5XA 3G15A 5CI7A 3SLSA 5HORA 3ZRKA 3FMEA 3O50A 3OCBA 3W0MA 3N9XA 4F65A 2YM6A 1DI8A 3BHVA 4EOQA 4QOXA 3R1YA 3PRFA 4U3YA 3QYWA 2I0EA 3LPBA 4PV0A 3V8SA 4A4XA 3QHRA 5JMSA 2QI8A 3VS7A 2WMTA 4AE9A 4CEGA 5LVMA 4IWDA 4ARKA 4FJVA 2XNMA 3W1FA 4R78A 1FINA 4BFMA 1OBDA 5J95A 4HGEA 3HUCA 4WG5A 5AR8A 3LLTA 3VJOA 1JPAA 4CCBA 2V5QA 1OUYA 3D94A 4G17A 4D0WA 3PXKA 3TEIA 4EQCA 4KAOA 3CTHA 4M15A 4IVCA 4AE6A 3FC2A 3H30A 4WD5A 5C03A 1Q99A 5AM7A 4AXAA 2W1ZA 3C50A 3EFWA 1APME 4PP7A 4HJOA 4V05A 4C62A 3FYJX 5BVDA 3NVMB 3NPCA 3CLYA 4DYMA 1PJKA 1K2PA 4U44A 5DNRA 4LGGA 1SVEA 5ACBC 3IW5A 4AZTA 2QG5A 3H10A 4D2PA 4ZZMA 5HD4A 5DYJA 3O71A 4U7ZA 5DT4A 4F7NA 2AC3A 4GG7A 2RFDA 2XM9A 3EQIA 4O21A 5LVOA 4OT5A 2VRXA 2H6DA 3GB2A 3NEWA 4OGRA 5ETIA 4YLKA 4QP8A 2VTNA 4RX9A 1U4DA 4MTAA 5I3OA 1ZLTA 3PJ3A 4JL9A 4EK4A 3DAKA 3QQFA 4DEBA 2CKPA 2VU3A 2B0QA 4EK5A 2YJSA 3OT8A 4FV6A 4O0YA 5DLSA 5AV2A 4D4RA 4CG9A 2C47A 3V6RA 2WMUA 3BYUA 4FOCA 4FSTA 4FK6A 2QOLA 5KUPA 4G3CA 3F69A 1BKXA 5CAQA 2R3RA 4OT6A 2OXYA 3KGAA 2W4JA 5EQEA 4WSQA 2GNIA 4DT8A 2YIXA 4L43A 5HVYA 4ZEGA 3IO7A 2C30A 2PY3A 3EWHA 3PXFA 1NXKA 4YSJA 4Y73A 3P4KA 4JS8A 2A2AA 1PXKA 1VR2A 4DFZE 4ALUA 4Z16A 3JY0A 3I0OA 3F3WA 3UO6A 3CP9A 2Y7JA 4IWOA 2CHLA 5CS6A 4ZY4A 4YO4A 2E9UA 4FV1A 3O7LB 5FDPA 3W0QA 3OT3A 1TQIA 2X2LA 5EKNA 5LWNA 3F5UA 5DH3A 4PDSA 3BL7A 4ACMA 1KV2A 2H8HA 4L68A 4XJ0A 1ZZ2A 1ZMVA 3LFQA 4A9TA 4F7JA 2Z02A 1V0OA 4DHFA 1BYGA 3UGCA 2W1IA 4RC2A 3VUMA 3GFWA 4FTAA 2XNBA 4FKUA 2QHNA 3BE2A 1UA2A 4XV9A 4RX8A 4YJRA 3BGZA 2XNPA 2HCKA 2EXEA 3BZ3A 3Q04A 2IVVA 2XJ0A 4M67A 5CAPA 4LL0A 3E63A 3EZRA 2Z8CA 2NYAA 3MH2A 3C5UA 3O5AA 1BI8A 2GHLA 4NK9A 4GYGA 2BR1A 1CMKE 3N4TA 4IH8A 3QZFA 3OUKA 4YPDA 5EI8A 4ASDA 2PMLX 3Q6UA 4O4FA 2FVDA 4RIXA 4HYSA 3Q9WA 4CFUA 4ZZNA 4G1WA 1JLUE 3AT2A 2ONLA 4AW1A 1O9UA 4Z7HA 4BDKA 4ACDA 4IJ9A 5HOAA 2PL0A 4EOOA 4TWOA 1ZY5A 1ZYSA 5I0BA 3BBWA 4YJVA 1H1RA 4PRJA 4EOKA 5M44A 1XH6A 4ASXA 3MJ1A 5GZ9A 3QGWA 4C4GA 4BICA 3FLSA 3MPMA 3HDMA 4FVQA 2O3PA 3R73A 4Y5HA 5IA2A 2QG7A 2Y6OA 2OGVA 4FI1A 4L01A 4MXCA 4ITHA 4YHFA 4IX4A 3Q9YA 3EFKA 4I3ZA 4H3PA 1ERKA 4WUAA 4PTCA 4YZDA 4Z55A 5CAUA 2WMWA 3SVVA 2YCRA 2QR7A 3BRBA 4MH7A 4BCKA 3I4BA 1MRVA 4FNZA 4A9YA 4O4BB 5KCVA 5J8IA 4KKHA 5KNJA 2Z60A 3HV6A 2BKKA 4FT5A 4D0XA 3ET7A 4IDTA 2JFLA 3LW0A 2W05A 3VS6A 4GK4A 4O0TA 3ZTXA 2VWIA 1OMWA 2OW3A 4EWQA 1KUTA 2C6TA 5CU0A 2BFYA 3LFSA 2R9SA 1K9AA 1H00A 3BPRA 3DDPA 4ZOGA 3UQGA 3JR1A 2WO6A 4JNWA 3QCSA 5E8ZA 2YLEA 2GNFA 1CSNA 2B1PA 1H1QA 3A7JA 3BEGA 3QBNA 4FEXA 1YVJA 4ZTQA 4EK8A 4KSPA 2HXLA 4QTAA 3H4JA 2VZ6A 1AQ1A 3PJCA 5CU3A 4X6RA 1KOBA 5F1ZA 2J0IA 4RA5A 4J95A 5FTQA 3MFTA 4MQ1A 3VBQA 3FQSA 3MY5A 4I24A 4BKJA 4XYFA 4O86A 3QCQA 2Z7SA 3QKKA 4RVMA 5HE3A 5C8MA 3TMOA 2J6MA 4DHIB 3KK8A 3O8TA 4AF3A 3P7BA 1O6YA 4R1VA 2CMWA 2C0OA 2X4ZA 5K5NA 5J9LA 5AR5A 4QYHA 4R3PA 5KMJA 2JC6A 4RZWA 4XG2A 3QA8A 4AZVA 4ZS0A 3SV0A 4FTUA 4NFMA 5EQPA 2XYNA 1H08A 5IA5A 4D1ZA 3CPBA 2OFVA 4BI2A 4LM5A 4G9RA 5G6VA 1R78A 2VGOA 1PYEA 3L8XA 2QU6A 4FKSA 3EHAA 4CKRA 3PJ8A 5AEPA 2G1TA 2X0QA 4D4SA 5CQWA 1J1BA 3KY2A 5BV3A 3PLSA 4K6ZA 1UNLA 4IAIA 4MNEB 5HIBA 2PULA 4DEIA 4DN5A 4TL0A 2O8YA 3ULZA 4S34A 4V0GA 3SKCA 3P79A 3JY9A 3ROCA 4EH6A 3ACKA 2EB2A 4GJ2A 3ELJA 4GIHA 4Q5HA 5BNJA 2ETKA 4G3DA 1P14A 5IPJA 5EDPA 3PVBA 4IANA 1H0VA 3TV4A 4RWLA 5IUHA 4OLIA 2XK9A 1T45A 4AWIA 3PYYA 3QRJA 3RM6A 2F57A 4RX7A 5BPYA 4F6WA 4MKCA 5AV3A 4XBUA 2BRBA 2HY81 4WBOA 5DT3A 3E3PA 4F1TA 1OIUA 4E1ZA 1XJDA 3EIDA 5D7VA 3LCDA 1HCKA 4LV5A 3DBQA 4U45A 5J87A 4UV0A 3QQGA 4FRFA 3HV4A 4G3FA 5KMKA 3ZBXA 2X8IA 1ST0A 3W2OA 5IH6A 3MS9A 1R0PA 3ZO4A 4HVIA 5DI1A 1OL7A 3R6XA 3IECA 5A4TA 3TNWA 3LFFA 2A0CX 3DFAA 3IOPA 5J9YA 3RK7A 2UW5A 5FP5A 4Z3VA 3HV3A 1WBOA 1PXJA 2YABA 2PHKA 1TQMA 2QKRA 5FP6A 5LARA 4BTFA 1YXTA 2W9ZB 5FRIA 3FKLA 4Y8DA 2WMXA 3OHTA 3GCUA 5HEZA 3PUPA 4OTPA 2XK7A 4HYUA 1CKPA 2HZNA 2ZV2A 3G5DA 2QQ7A 4I1ZA 3T8OA 2ITQA 4YZMA 2B4SB 3ETAA 2JLDA 1YXUA 3AT3A 1V0PA 2OXDA 4S2ZA 3TNHA 5A46A 2R3GA 2R64A 4O7SA 3QA0A 1IG1A 3Q32A 2UW4A 2CNQA 3BLAA 1CTPE 2RSVA 4O0XA 4QTDA 3V6SA 3EH9A 4F0GA 3GU7A 5IEYA 4H05A 2J9MA 2XBAA 4YJNA 1TKIA 3BYVA 4O84A 2VTSA 4DTBA 2WQOA 4QNAA 4JDHA 2PE0A 5EYMA 5HO6A 1Z5MA 4DG2E 3G33A 4N0SA 3GUBA 4FTMA 4BBEA 3GCPA 4EOMA 3KCFA 1OVEA 2YN8A 5M09A 3BGQA 4M12A 3DKOA 3I0QA 5EG3A 3SW4A 3P7AA 4QPMA 3DJ6A 4O91A 1XBBA 2WTCA 2C6EA 1SVGA 3FI4A 2YIQA 3L8SA 2YCSA 4APCA 2GPHA 2VX3A 3SGCA 1YKRA 3JPVA 3RPYA 4XOZA 5J9ZA 4H3QA 5EW3A 5L6OA 3DK6A 4PTEA 4O1OA 1YWRA 5GZ8A 4I23A 4O7ZA 3GC9A 3HV5A 3N51A 3FMKA 1A9UA 3TJDA 3VBXA 4J71A 4I41A 4E26A 2C0IA 3FL4A 3MFSA 4OTWA 5CXZA 5AR7A 1XKKA 2RG5A 3REPA 4FG9A 2PUUA 4O0UA 5BUJA 5KMOA 4AZEA 4IXPA 4I20A 3KKVA 4GKHA 4NYEA 4U3ZA 4JX7A 1UNHA 2R5TA 4ASEA 5ANKA 5KMMA 4BJJA 5DGZA 2CN8A 4XCUA 3WZDA 4AN3A 1H1PA 4RFMA 3LKMA 4FEVA 3GU5A 4C37A 2YDIA 1WBNA 4JQ7A 5TO8A 2JD5A 2LAVA 4E6CA 4IX3A 2CKQA 3V5TA 2C5OA 2YCFA 3TDVA 2QOHA 4MK0A 3TZ8A 3F6XA 3A7HA 2XK6A 2R3FA 4MXXA 4O4DA 1RE8A 4RIXB 3WZEA 4GFGA 1SNXA 4OBOA 5I4NA 1H1WA 4AUAA 3DT1A 4EOIA 3LCSA 3E93A 4DH7A 2PUNA 4ZSEA 4MUQA 2DQ7X 3H9OA 3C4XA 5DR2A 4UMQA 5HG8A 5KX8A 1A48A 2HZ0A 3UIMA 4JLCA 2UUEA 4FZFB 2JDOA 3G9LX 1O6KA 3DBFA 4GL9A 4NSTA 4U40A 1P4FA 4YUQA 4AA5A 3N4UA 4QQCA 4AXFA 2R3LA 3R30A 4DE4A 2GHMA 4FBXA 4CZTA 4EZ7A 5AIRA 4YTFA 3LM0A 5HLNA 3GP0A 3NUYA 4JAIA 4ANOA 5C1QB 4EYMA 5HU9A 3TZ7A 5ETFA 5IF1A 5E1EA 4LQMA 3F2RA 3H0ZA 5HTIA 4X3JA 3P23A 2OF2A 1YRPA 3E3BX 3O7LD 2Y0AA 3IW6A 4M13A 3EB0A 3ZLXA 3G0FA 1UWHA 2QO2A 5CY3A 4MQ2A 2JBPA 4O0RA 3W55A 5EFQA 3QU0A 4L3PA 2DYLA 4X0MA 3VUTA 4IB3A 3HVCA 4BIEA 5AR4A 2X2KA 2QLQA 3DJ7A 4HGTA 4NW6A 2QNJA 2ZMDA 4YGAA 3UOHA 1G8AA 2R3OA 5FTGA 5FXRA 1WBTA 3BHHA 3F82A 3V8WA 3F88A 3LXLA 2Y4IB 4WOVA 4RWKA 3CR0A 2XRUA 3O17A 4YHJA 4TN6A 3A99A 1TVOA 3D7TB 1FVTA 4W9XA 1XO2B 4D2TA 5LJJA 1YXXA 4MXOA 5CVHA 5CSHA 3NR9A 3W10A 4MYGA 3CY2A 4YU2A 3QFVA 4X3FC 2PVNA 3SDJA 4CFWA 5I9ZA 3IONA 3MJ2A 5FQDC 3VS5A 3VS2A 2ERKA 2XIXA 5HE0A 2VTRA 4QPAA 3BYMA 3L9NA 3TUCA 1H26A 4H1JA 3R1SA 4F7LA 4NW5A 3R02A 4AOIA 2I7QA 3C4CA 3GBZA 1TQPA 2QC6A 4DTAA 4EH2A 1Y91A 2JDVA 4KABA 1H01A 3FKNA 4ZTHA 4MNFA 3O8UA 4TYGA 3ZEPA 3DFCB 5L3AA 3UZTA 5J7BA 3R7OA 2BTRA 2CGXA 3HMPA 3DXPA 3ZHPC 3W8QA 4E4LA 2OJGA 3MPAA 2IZRA 4GVAA 2UZNA 3BLHA 2VWZA 1CKJA 2CN5A 3EQPA 2YERA 5IKWA 5IH5A 4E6QA 1ZOEA 1W84A 4RWIA 3AMBA 3DAEA 4RVLA 5H8GA 2X39A 4ERKA 2VWWA 4QQTA 2R2PA 4JG6A 4L42A 5ANGA 2VTLA 1OGYA 5CT7A 3SG8A 2RFSA 2IZUA 2VWYA 3BIZA 3RWPA 5CX9A 3SW7A 4ITJA 2VWBA 3NUAA 4JRNA 4IVBA 4QMPA 4CFVA 4V0GB 1YI3A 4FKOA 3HA6A 3CJFA 5AAGA 4BTKA 5CAOA 3NYVA 3NYXA 3UQCA 4E6AA 4FTIA 3PXYA 4FA2A 2WOTA 1Y6BA 1Q8WA 3ZC6A 4JAJA 4FX3A 4YJUA 5H8BA 4QTEA 4FSZA 2V7AA 2PZYA 2C3LA 4O7VA 4WT6A 3RBWA 3L1SA 3NUSA 5L2TA 1EH4A 4O2ZA 3R1QA 3FZ1A 4FKPA 2PMNX 1NW1A 4W8DA 2IG7A 4DT9A 3QTIA 4DGOA 3MA6A 4IVAA 4I5MA 5M51A 2A27A 4WG3A 3FLYA 1SNUA 3KIOC 3RMFA 1WAKA 5LOHA 4ITIA 1ZARA 4TYJA 4D58A 2W1FA 4HNFA 4K18A 2P33A 3I6WA 2UZEA 1V0BA 3R01A 4MD7E 4YR8A 3VS1A 1GIJA 2I0VA 4USEA 2EU9A 5ICPA 1IAHA 1Q3WA 2WOUA 3FMLA 5ANOA 3TNIA 3PVUA 3VUGA 2YA9A 1Y8YA 3A4PA 4QNYA 4FTTA 4FSQA 4O0SA 1UU9A 1JWHA 3C0IA 3G9NA 3PXZA 4FVRA 3CTQA 2W99B 4GH2A 5FXSA 4M84A 5ANEA 2XK4A 3IW4A 2WFYA 5A6NA 2GNLA 2C6KA 5HO7A 5ITAA 2C1BA 4K1BA 2XH5A 1G8SA 3PG1A 4AN9A 3ITZA 2F9GA 4KKEA 5EI2A 2UW6A 3CD8A 3TKUA 4FEWA 3KL8A 4IZYA 4G31A 2YM3A 3D15A 3Q52A 4JVGA 4W4YA 5EOBA 5BYZA 3VN9A 2H34A 3U4WA 3PP0A 3P5JC 2QLUA 3F3VA 4S33A 4C3RA 4EL9A 4TYHB 5AP6A 2V7OA 5TOZA 5L6PA 4II5A 3RAHA 4J53A 3BYOA 5CZIA 4X3FA 1YHWA 2X7GA 2BDWA 2J51A 2BCJA 2YHVA 3LFNA 4NJDA 5DR6A 2OBJA 4L3JA 4QD6A 4OR5A 4CZYB 1ZY4A 2XALA 2I0HA 2UW9A 3NW5A 2JEDA 1M14A 5KZIA 4GFMA 3QKMA 2JKKA 1REKA 3H0YA 1ST4A 4O7WA 3W2PA 1YXVA 1FVVA 3R63A 1YHVA 3BLQA 3FC1X 3QD0A 3HMMA 4MX9A 1LUFA 1IEPA 5DRDA 3KC3A 2R7IA 1S9JA 2XIYA 3A61A 4EH4A 4IHPA 3UPZA 3RK5A 3U6JA 2KTYA 4TNDA 3DJ5A 5JGAA 3C0GA 3RKBA 3R00A 3IW8A 4DLJA 3ZYAA 2ITOA 4WIHA 5JZNA 4ANBA 4GU9A 4CZUA 5JRQA 5CQUA 4YC3A 4YHTA 4V01A 5HG5A 2C5YA 1GAGA 2OJJA 2Z7LA 1LR4A 4FTCA 4UN0C 4F6SA 4R3RA 3ZUVA 4WUNA 3ROYA 3ORZA 1XR1A 3VBWA 3DQXA 3RCJA 5AMNA 2HELA 3FWQA 3RZBA 4L46A 4MNEA 4YJQA 4NZWB 4NU1A 1YDTE 3AD6A 4DH8A 4FKGA 3R2BA 5LMBA 3DKGA 3UQFA 4YZNA 5JQ8A