4I22A

Structure of the monomeric (v948r)gefitinib/erlotinib resistant double mutant (l858r+t790m) egfr kinase domain co-crystallized with gefitinib
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
315
structure length
297
Chain Sequence
NQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELRKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Epidermal growth factor receptor
publication title Insights into the Aberrant Activity of Mutant EGFR Kinase Domain and Drug Recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 297
sequence length 315
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4i22A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4i22A01
4YBKA 1JQHA 1XH5A 2XK9A 3UZRA 4ZP5A 3OEFX 4O0TA 3W33A 3PRFA 5FEQA 2QNJA 4EOMA 4BDAA 4XV9A 4RIYB 3UPZA 2QOQA 4C2WA 4R78A 2CGVA 4CXAA 5JRSA 4UY9A 5FBNC 2OI4X 4F70A 3ZS5A 5LVLA 5CAUA 1CM8A 3QTXA 3L8VA 3QQHA 1Z5MA 2OFUA 4W8EA 1OL6A 1AQ1A 2XIZA 2PVFA 3PY0A 4QP8A 4IANA 4RWKA 5ACKA 4YJNA 3EN6A 3NR9A 4YZDA 4TPTA 5KMKA 5CEMA 3ZU7A 2BRHA 4NU1A 1PXLA 1UWJA 3MWUA 3NYXA 2A2AA 4UMTA 3UQGA 2QOIA 3EKNA 4CYIA 4QNYA 4RX9A 3SW7A 1YWRA 3NW5A 4YZCA 2PPQA 3KXNA 3OMVA 3GCPA 2CCIA 3FMMA 4O0YA 3TIZA 3NNWA 3ZUUA 3LFQA 4I3ZA 1H4LA 3EL8A 5ANGA 4YP8A 4FC0A 2IN6A 3BYUA 4WBBB 4PMSA 1PXJA 2JD5A 2YDJA 4U5JA 4JLCA 4MF0A 4EH7A 5M55A 3V01A 4F1OA 1GOLA 2PYWA 2JIIA 4O1OA 3R9RA 3PFQA 3KC3A 3D5UA 2P3GX 4YLLA 4RT7A 3UIBA 3BBTB 3I1AA 1L8TA 2VO0A 4YC8A 5ETAA 3RM7A 4PRJA 2WHBA 3IW4A 3D5XA 3OWPA 2UW9A 4RJ3A 3N4TA 4X3FB 1IEPA 2GNFA 5KX8A 4LMUA 2EXMA 3UO5A 3C4FA 4ZZOA 4FZ6A 2QG7A 4JRNA 2Y9QA 4L68A 3Q6UA 3PWDA 3KK8A 4G31A 3LXKA 5L2TA 4I93A 1AGWA 3CD3A 5LXMA 4YJTA 4IAIA 4RJ6A 1NW1A 4IVBA 3FMKA 3DS6A 5IF1A 3QKMA 2ITWA 4QOXA 4M69A 4M66A 3F88A 4L43A 2OH4A 4FEVA 4Y5QA 2DYLA 3GC9A 4PTCA 5M44A 4AQCA 3LHJA 2OJGA 4X2FA 2VGPA 1FINA 1Q3DA 1ZYDA 3OG7A 5CTPA 5LJJA 2CNVA 2BDWA 1PYXA 2J5FA 3I6WA 5I3OA 4QMUA 3AC2A 5C8NA 3P5KA 5AUUA 1U5RA 2J6MA 3R73A 2WMAA 3NWWA 5FWKK 1DI8A 3LVPA 1MQ4A 3PRIA 2VWVA 1H27A 3K5VA 3Q4ZA 5BUIA 2QOCA 4EH4A 4DFZE 5G6VA 5A6OA 2IVTA 3MPAA 4AGUA 5CF8A 2X4ZA 4O0XA 3PPZA 5AM7A 4L3PA 4H36A 4AF3A 4HPUE 3II5A 3EJ1A 2HY81 3M2WA 4FG8A 5IH4A 3DKGA 4C59A 2W5BA 2J5EA 3KREA 3FMHA 2BPMA 4L3JA 1XH9A 3RAIA 3TJCA 1FGKA 3F66A 4IZ7A 5EHLA 4BDEA 4AE6A 5CY3A 5H8BA 3R01A 5CASA 1HOWA 3CKXA 4HGEA 3G6HA 2G2HA 2JDRA 3IW5A 5IQEA 3DLZA 1OPKA 4YZMA 3V3VA 4D2VA 5HG5A 3ZZWA 1QPJA 4TL0A 4Z9LA 4DGMA 3SA0A 3MTFA 4GT3A 2HK5A 4PMPA 5IEXA 2WEVA 1ZLTA 4YGAA 3Q3BA 3CQWA 1FMKA 4LUDA 4LYNA 2VWYA 3G0FA 3RNYA 2WQNA 1WAKA 1H1SA 2WXVA 4EOQA 1ZYJA 4F65A 1SNXA 4LGHA 2BDFA 2WOTA 3Q2MA 4YO4A 3NLBA 3HA8A 2PE1A 2C5XA 3ZFMA 2WZJA 4FT9A 2ZV9A 4WKQA 4AT3A 5A54A 3UQFA 3Q5IA 5FRIA 4FIFA 4M3QA 1W0XC 4WUNA 2QOLA 5HD4A 2OIBA 1TQMA 1URWA 1QPCA 2OK1A 1S9IA 3R1YA 4FT7A 3HMMA 5KO1A 3EWHA 2OF2A 3KF4A 3QD2B 5A3XA 2C6DA 2VO7A 2UZUE 5JK3A 4JG7A 2BILB 4UMPA 3PDTA 2JFLA 5L6OA 3ZXTA 3CTQA 5A4TA 2G9XA 3C1XA 4I0SA 5AR8A 4L7SA 3E5AA 5CYIA 2RFDA 2DS1A 3RZFA 3FLZA 3R6XA 5J9LA 1ZZLA 4RJ4A 5CF5A 5GJDA 1DS5A 2ITOA 2I0VA 2WKMA 3C9WA 3QCXA 4NJDA 4E6QA 4K9YA 5IUGA 5CENA 3EH9A 4D1ZA 4F1MA 3CPCA 2G2IA 4X2NA 2FB8A 5AIKA 3IK3A 5K3YA 4CMUA 5HU9A 4OTIA 4IAKA 3ZDIA 2QC6A 3DQXA 4EK4A 5KMOA 4BTKA 4ZTLA 3NUYA 4IZ5A 4DGGA 4R5YA 1NVQA 3O8PA 4UZDA 4EH5A 4ALVA 5C4KA 4W8DA 4DFXE 4O0RA 2PMNX 2OXXA 3NS9A 5IQCA 4FE2A 3QD3A 5HNGA 5BYLA 3R8MA 5BNJA 3LAUA 2ZB0A 1HCKA 2G01A 3CY3A 3QA8A 3BI6A 4FG9A 4ACHA 2RSVA 4C35A 4FKOA 5IG1A 2VTOA 3RGFA 4F6UA 1BYGA 2WQBA 3PJ8A 5DVRA 3UNKA 3VAPA 3PZEA 5GHVA 4ANOA 1UNHA 3FPMA 3HMOA 4YC3A 5I9WA 3UG2A 4UWYA 5B2KA 2OZOA 4WBOA 3OT8A 4XP0A 4JI9A 5FBOA 1OITA 5I9UA 4G6LA 4KD1A 3UNJA 3VF9A 1H07A 2JKMA 3WZEA 2ETMA 2UW4A 2YJRA 1MQBA 2OJJA 2W1ZA 4R8QA 3VS3A 4W4YA 2PVHA 4TNBA 4CLIA 1CKJA 2BUJA 3QX4A 3FHIA 4QMWA 4Y85A 5E1EA 4EL9A 3C13A 4FV6A 5FXRA 3E64A 4MD9E 3KXGA 4AGWA 2F4JA 4PDSA 2OF4A 3FY2A 2WTKC 4Q9SA 4QRCA 5I9YA 4A4XA 4WT6A 4NIFB 3COHA 4LOPA 4XBUA 4I23A 3HAVA 3ZBFA 1MRYA 1WBTA 3CCNA 5T68A 3R8VA 4CRLA 4YJRA 4QTCA 3TT0A 4ACDA 5HCZA 2WPAA 4AN2A 3GT8A 3E93A 2J0IA 3VS6A 4O2ZA 4GFOA 4AA4A 5HBEA 4QP4A 5J87A 1X8BA 2JDSA 3VUHA 1JKSA 3BLQA 3RK7A 5C01A 3QQLA 5AMNA 4EZ7A 4BCIA 1TQIA 3LW0A 5ICPA 4CFXA 4RC3A 3HV3A 3BQCA 4CV8A 1STCE 5CU0A 1M52A 2PUNA 3TIYA 5FM3A 1SVHA 2C6LA 3F3VA 3IDBA 3O17A 3QLGA 4IB3A 5AR3A 4ZTSA 4IWQA 3A4OX 3EN9A 3KGAA 3EL7A 5HHWA 5HICA 3ZYAA 1Q61A 5FDPA 5CI7A 4IFGA 5A9UA 1ZY4A 2WTJA 3ZSGA 5CSHA 4MBIA 5AUTA 1WVYA 4IW0A 4MHAA 3RPOA 1VYZA 3RCJA 1T45A 3OVVA 4UX9A 1IAHA 3BX5A 4NT4A 2C69A 4NM0A 4FTUA 1W8CA 3OCGA 4GMYA 3RMFA 1DM2A 3HZTA 5C9CA 4E93A 2XNBA 4BI0A 5IZFA 5M51A 4K18A 4P5QA 3LCDA 3FMNA 4RGJA 3QRUA 2XZSA 4IE9A 5AR5A 3MFUA 3Q53A 4QPSA 4GV1A 4BDJA 1XH4A 3M11A 2JBOA 1HCLA 4HYIA 4FKUA 3GCVA 3SKCA 4NM3A 4X6RA 5JGBA 2UZEA 5A4CA 5KZ0A 5IQAA 3PVGA 3H9OA 3KULB 4QP2A 3R63A 4R3PA 5IDPA 2WQOA 4I21A 5LVMA 5LWNA 4DTBA 3PP0A 1H24A 4X6QC 4GUBA 2ITTA 4ZJVA 2VD5A 3UYSA 1Y8YA 3LMIA 2YIRA 1KSWA 4DLIA 4CTBA 3FE3A 5AAFA 2XNGA 4EOOA 5H8EA 3V8TA 4CYJA 4RQKA 5DN3A 3IW6A 3CEKA 1Q8WA 3HYHA 4DT9A 1YQJA 1YWNA 3G15A 5DR9A 3I6UA 3CJGA 2YDKA 2ZOQA 5HCXA 1H0WA 1DAYA 5JQ5A 4ZMFA 2G1TA 3D7TA 4YJVA 4A9UA 5KMLA 4D5KA 3ORMA 5AV3A 4QMMA 2VTNA 4N6YA 4FG7A 4H3BA 4DH3A 3ZUVA 3Q32A 3ZLYA 2PVNA 4CFFA 3P86A 4Q5EA 2E9OA 3VO3A 4UN0C 3EFJA 3KF7A 4KIPA 3PIXA 3RALA 2FO0A 4TTHB 5CZHA 1VYWA 3BYVA 4DCAA 3NNUA 3ZMMA 5M4CA 3T9TA 3RHXA 3MTLA 4HNIA 4RFMA 1NVSA 2YACA 3ODZX 2BRNA 4NL0A 5IQGA 1PW2A 2CLQA 3FZPA 2OIDA 2YM6A 4IVCA 4YTHA 4YO6A 1OL7A 2VTSA 3DBFA 1PMEA 2E9NA 3HNGA 3VBQA 2PMLX 1M17A 3MH2A 4CCUA 4FTTA 3A8XA 4HYUA 3CSVA 4DFBA 2WMQA 4JL9A 4DEHA 1WCCA 3GXLA 3SOCA 4E3CA 3MJ1A 2WEIA 5HU3A 2PUIA 2BHHA 3KU2A 4FZDB 2CGUA 2Z60A 4EZ5A 4QQTA 4GT4A 4K33A 4NCTC 5IQBA 4OAVB 4AOTA 4BYJA 4X21A 3IG7A 1Y8GA 4XBRA 3FL4A 5FEEA 3P78A 3QQJA 3MSSA 3EMGA 4LRJA 3W55A 2PE0A 5GZ8A 4L3LA 5BMMA 5GJFA 4FT5A 1JSVA 1GY3A 2O5KA 4BKYA 3DTWA 4CFNA 5FTQA 4F63A 5KBRA 5KMNA 2ITXA 4JBPA 4BGGA 3TUCA 2CNUA 4FVRA 3LM0A 3AC3A 3EQHA 2R7IA 1K2PA 2PY3A 3KL8A 1NY3A 3MB6A 3BHHA 2JGZA 5AM6A 3W2CA 3ZUTA 1YHSA 1IRKA 3FAAA 4ZSLA 4D0WA 3KXHA 3V5PA 2IZUA 1U4DA 3OCSA 4EOKA 1XQZA 2ZMDA 4NTTA 1JKTA 5D11A 4BDIA 1Q62A 3H0ZA 2XIRA 2AC3A 3ORTA 3G90X 4M14A 5CU3A 4ZLOA 3QALE 4NCTA 4IMYA 4FKWA 4HOKA 5FUTA 2UW8A 5K0KA 1PXKA 4TYHA 3SVVA 4BRXA 5JZJA 3LE6A 4XRLA 2YM7A 5J8IA 1O6KA 2PU8A 4PNKA 4V0GB 4BCFA 5J9YA 2V7AA 3LFAA 3ZRLA 1ZAOA 3FKNA 4JDHA 4XOYA 5A4LA 3QRJA 4QPMA 3ACKA 3QAME 2P55A 3BGZA 3R7YA 2C1AA 4F1TA 4C57A 4QYGA 2Y7JA 3ZRMA 2YCSA 2QURA 4FV8A 5BVEA 2WQMA 1M7NA 4OBQA 3RWPA 5GZ9A 4C36A 4EH2A 4AG8A 2CJMA 3K3IA 4FTNA 3DFAA 4EQMA 3FLWA 3IS5A 5E8SA 2VU3A 3SG9A 3NMUF 4CCBA 4G9RA 4FSQA 2WMWA 4QMZA 2VWXA 3HDMA 5IUIA 2GQGA 5DI1A 4DG0E 3VF8A 4QPAA 5E7RA 3P9JA 4EH8A 4IAFA 5GIOE 3QUPA 3EQRA 4ZZNA 1OIUA 5K0XA 1R3CA 5LMBA 1GIHA 4FL3A 4C61A 3VW6A 4GT5A 4YPSA 2EWAA 3VC4A 2ZVAA 3DFCB 4FNYA 4K77A 3GI3A 3VS2A 3UC4A 4ANSA 5JQ8A 1UA2A 3TTIA 5HG8A 4Z55A 2J4ZA 4L45A 4RFZA 3GENA 4RJ7A 2W5AA 4XRJA 4M84A 4IACA 1JLUE 3VW8A 3UZTA 1JKKA 3N4UA 2J2IB 3HMNA 3ITZA 4AACA 4J1RA 5CEOA 2JKKA 3OROA 4EOPA 3E3BX 4OW8A 3GP0A 4CLJA 4GYGA 4IWDA 5KMMA 4U42A 2IVUA 2GU8A 1A9UA 2W1IA 3QUEA 4GL9A 3QGYA 3B2TA 2UW3A 5FTOA 2YN8A 4CZYB 2X8IA 4DE4A 4JBOA 2YM5A 4C37A 3H10A 3R71A 2VTPA 3DB8A 2WGJA 4U97A 4WHZA 4FTLA 4AW5A 3FWQA 5AX3A 4B7TA 4CKRA 3ANQA 4PL4A 5HLWA 1IA9A 3NUAA 5L2QA 4YJPA 3KQ7A 3R8PA 2R5TA 1F5QA 2BAKA 1FOTA 4ERKA 1WBVA 1S9JA 5EG3A 2X6DA 4PV0A 4F09A 3LKMA 5EFQA 3R1NA 1YOJA 3EZVA 3ZH8A 1OVEA 1OIYA 4WO5A 4G5JA 4E4LA 4U81A 4AN9A 3ZLSA 3RHKA 3NVMB 4PMMA 4YZNA 3QCYA 4PY1A 2EB2A 2VWIA 3COIA 4ZLZA 4MQ1A 5E1SA 5J7BA 5I9XA 1ZOGA 2ZAZA 4OAUC 4WNKA 3MH1A 3GFWA 5ANOA 2HZ0A 4IDVA 5FDXA 4CGAA 3GU7A 2B9HA 3ROYA 2VRXA 4WSYA 1QPDA 3R7GA 4LOQA 3HVCA 3V5WA 5AA9A 1YHVA 4Z7HA 4BCQA 2IW8A 4XG3A 1UV5A 2QR7A 3CP9A 4QMLA 3F5UA 4BVUA 3FL5A 2W99B 4BIEA 4BDBA 4IB0A 3HV5A 4L7FA 4APCA 2OZAB 5DT3A 1CMKE 4QMPA 3U6JA 4RIXB 3LJ2A 5AP2A 5BYYA 4Y73A 3BE9A 4IXPA 2RIOA 3ZSHA 4FUXA 4J97A 1ZYSA 1OMWA 3KVWA 4I0TA 1YOLA 3ZC5A 4O7LA 4MXOA 2B1PA 3G2FA 3NUNA 2X8DA 4IWPA 2ITQA 4WSQA 1F0QA 3VBVA 5HNIX 5GZAA 3E8DA 5HO7A 2ZB1A 4EHEA 2HY0A 5CX9A 1FGIA 4HGSA 3PLAE 3OT3A 4XCUA 4YSJA 1RW8A 4I5MA 2BRGA 3PVWA 4OGRA 2YFXA 4MXZA 3CJFA 4IADA 3RNIA 4WIHA 4MBJA 1QPEA 1GIIA 5EYKA 4HNFA 4ID7A 4KRDA 5KHXA 1XJDA 4CFVA 5JN2A 2VNYA 4FSWA 3RK9A 5M07A 3R00A 3QXPA 4U8ZA 1U54A 2ITPA 2J50A 3LM5A 3MFSA 2YCRA 5L3AA 3BLRA 3BPRA 4EC9A 5JFSA 4OT5A 3QGWA 3DBQA 4APPA 3QTUA 4EH9A 4BKJA 5IA1A 4KBAA 3UVRA 4GVAA 4JT3A 3CE3A 3FLSA 4TRLA 1JKLA 3RPSA 2V5QA 3UIXA 4EOLA 2OJIA 2QHMA 3HKOA 3EQGA 3U8WA 2I7QA 1LEZA 4DEAA 4MAOA 1Q8UA 2VTAA 1MUOA 2VX0A 4EONA 4C4FA 1SVGA 4NM5A 4LV8A 2WMTA 1NXKA 4KAOA 2PMOX 2OU7A 2CDZA 2LAVA 4F0GA 3FHRA 1UU8A 4CNHA 5BUEA 4LL5A 5IA3A 1V0BA 1W84A 2C3KA 4RJ5A 5TR6A 4ZS4A 3W10A 4I4FA 3A8WA 2R4BA 1BMKA 3PVBA 3C7QA 2RG6A 2OH0E 3LFEA 1H08A 4A4LA 2B7AA 4NW6A 4FZ7A 3EN7A 5E8TA 4CT2A 5F94A 3M1SA 2VGOA 4U3YA 3DA6A 5JGDA 2XNOA 4MF1A 5AUVA 3GBZA 3CC6A 1BL6A 1JSUA 5GNKA 2W4OA 4AW0A 4CG9A 2XJ2A 4HVDA 1YVJA 2UZLA 4QMTA 2PVYA 2BVAA 5CNOA 3QRIA 4E5AX 4QMXA 3R7EA 4FV4A 4DEIA 2C6TA 5L8JA 2GS6A 5L8KA 1H8FA 4ASZA 4AN3A 3FLNC 4BDGA 2SRCA 4XG6A 3RZBA 3TXOA 3F6XA 4BCKA 1QMZA 2VZ6A 3TNIA 2YM4A 4GW8A 3G51A 4U9AA 4L42A 4ANNA 4FKTA 3MIYA 4J52A 3RTPA 2YIWA 3G6GA 3O51A 4F9YA 4ZY5A 1OUYA 3R0TA 5IU2A 1H01A 4ZJIA 3VRZA 4EKLA 2H6DA 2Z8CA 4U7ZA 4HW7A 3TKHA 4OBOA 2HCKA 1YXTA 5M4FA 3SRVA 4AW1A 3LLTA 3RAWA 2RFSA 3U51A 3PJ3A 5T3QA 4RIWA 3L1SA 5KKRC 5KE0A 3DPKA 3EN4A 4N0SA 2PHKA 4ZLYA 4ZTMA 5J1VA 3BEAA 3DNEA 4FYNA 1P4FA 3AT2A 3AC5A 4GIIA 3VVHA 2HZIA 2B53A 2FSMX 4S2ZA 1V0PA 4PTEA 3WZUA 3ERKA 3R2BA 4O0UA 3E63A 1P14A 4GCJA 4P4CA 2QONA 3VUTA 3ANRA 3PXKA 1UKIA 2PE2A 2RKUA 3LOKA 1GAGA 3FEGA 3QQFA 2XYNA 4GRBA 4HVHA 3ULIA 3FDNA 3NUXA 4OTHA 4QNAA 5LQFA 3A7HA 3O8UA 3PY1A 5AV2A 3CR0A 3PXFA 4O21A 4MVFA 3DAKA 1YHWA 4CV9A 5BUJA 3TJDA 5HBJA 4USEA 3WI6A 3W2OA 3OBJA 5EW3A 5A6NA 4M13A 3D2KA 3A7JA 4H58A 1KUTA 1P5EA 5AP6A 3ZO2A 4O7RA 3VQUA 1PXIA 2WMSA 4HGTA 3QTZA 4L01A 3SW4A 4JVGA 1OKYA 2XIXA 1CKPA 5IEVA 5ITAA 3TZ8A 5L6PA 4GKIA 3LQ5A 4FIIA 1E9HA 2YHVA 4PMTA 2PWLA 4BI2A 4MD8E 5JFVA 2PZPA 3R8LA 1U59A 2QD9A 3A7GA 2UV2A 4G6OA 2AYPA 5D41A 2FSTX 1UNGA 3VHKA 2UZVA 4G17A 4AGCA 4PPCA 4YTFA 3PIYA 3QFVA 3K5UA 3QBNA 2PVRA 3DDQA 5BMSA 4ZOGA 4D58A 2XVDA 2IVVA 4O38A 1FVRA 3NYOA 4RIYA 4ZZMA 3GU5A 4G2FA 5JKGA 1M14A 1YW2A 3PG3A 5FGKA 4YTIA 1B38A 3VS7A 2VN9A 5LVPA 4BZNA 3QTQA 4G5PA 3UBDA 4ALWA 3R1QA 4NZWB 4E26A 3AMBA 4ZAUA 3D4QA 4BC6A 3VJNA 1O9UA 3BGQA 3BWJA 2R3OA 1GZKA 3CGOA 1Q97A 1ZYCA 2FYSA 4MH7A 4EHVA 4FSUA 4F08A 5EYDA 1KE5A 1YDTE 1E1XA 1Q3WA 4QYEA 5CZIA 2XKCA 3TTJA 4YTCA 1LP4A 2OICA 4RLKA 3A2CA 5CVGA 5EHOA 3HX4A 4X3FC 5BVOA 3TDVA 3ZHPC 1WBWA 1PXPA 2FSLX 3P23A 4F7JA 3GVUA 4O7SA 4MK0A 4M8TA 3VBYA 3GEQA 2ZJWA 3PA5A 4YPDA 3S0OA 1H1RA 3V8WA 2BR1A 2YM3A 2XJ0A 3QZGA 3DKCA 5M57A 2X9FA 2Y4IB 5AUYA 3WZKA 3RM6A 3VS4A 1OKVA 1R1WA 4CD0A 4Z16A 1YRPA 2PVJA 3HV6A 1KWPA 5CAPA 3KMMA 2C0IA 2OW3A 2XKFA 3CTJA 4JIKA 4FL1A 4ITJA 3U9NA 3VULA 4B99A 4Y46A 5EM7A 5AIRA 1FVVA 3E3PA 5CSXA 1W7HA 4EYMA 4E6DA 4TY1A 4NSTA 3WF6A 4ZK5A 3TNWA 3ZSIA 5IMXA 3FYJX 4QMOA 5CEPA 3BKBA 2PMIA 4RWIA 2WOUA 4BIBA 4XLIA 2XBAA 3FMEA 1ZZ2A 5EDPA 3POZA 4O96A 1JSTA 3EQFA 3IOKA 4EI4A 5HE3A 3BIZA 3BCEA 2I0EA 1JOWB 1PMVA 5HLNA 5CNNA 5AP5A 2QR8A 4CMTA 3O0GA 4B8LA 3H9RA 4CQEA 5IUHA 3OFMA 4FX3A 3REPA 1SVEA 2QI8A 2JIUA 4IZAA 2AC5A 5HO8A 3RWQA 3GCQA 4IVAA 3T3UA 4DITA 1H25A 1RJBA 2JDTA 2GTNA 2XH5A 4XOZA 1BI7A 3Q96A 4MNEA 3V6RA 3WF8A 1ZOHA 2BFYA 4G3CA 1XBCA 2XK7A 2YJSA 3VIDA 3ATSA 4IB5A 2GHGA 4FTQA 3WIKA 1SM2A 4I92A 2RF9A 5AFVA 3QL8A 3B8QA 3ENHA 3R28A 4A9SA 3IDCA 3UODA 3DK3A 1ZMUA 3OCBA 4K1BA 4AT4A 2VTQA 3FV8A 4U45A 5ANKA 3VBTA 5HGIA 4IJPA 4AWIA 1ERKA 3PA4A 4HCTA 3W2RA 4KBCA 5HBHA 5AA8A 4EEVA 2CKQA 2F2CB 4G16A 4UEUA 1VR2A 1H26A 3I7BA 2ZDUA 4FZFB 2CMWA 3UYTA 4JX3A 4BI1A 4DCEA 1SMHA 4GK2A 4OR5A 3RBWA 3PG1A 4I1ZA 5IA4A 3AXWA 4ITIA 3PSDA 5EI6A 1H1QA 4G3EA 4O0WA 4H3PA 4QP6A 3U6HA 1ZMWA 3FUPA 3Q9ZA 2UW7A 3C51A 3MFRA 3R7UA 1M7QA 4ZSAA 5HZNA 1UU3A 3QTWA 3EQDA 4EJNA 3O96A 4YC6A 1A06A 2Q83A 3UP2A 2C6MA 3QRKA 4JJRA 4R6VA 3W18A 3KN5A 4X3JA 1JVPP 4TT7A 4Z3VA 4JRVA 3FMDA 3CIKA 3BHYA 4OBPA 4YLKA 5J5TA 4PDYA 4RC2A 4JAJA 2BAJA 3I60A 4OTFA 3ZM9A 4FODA 3LFDA 4AZFA 4KS8A 4DHFA 2IO6A 5KHWA 2R3RA 4AZSA 2QG5A 3FI4A 5JMSA 1MRUA 1H00A 2ZMCA 3BYMA 5FM2A 2YA9A 5D1JA 2C30A 1ZOEA 2GSFA 1WBSA 3O8TA 3EOCA 4KRCA 3G5DA 1V1KA 5E8WA 4LGGA 4HZRA 4AZTA 3PY3A 3C50A 3VBWA 1Q8YA 2W1EA 1B6CB 5HX8A 1ZXEA 4M68A 3IECA 3W8LA 5EYMA 2E9PA 3JVRA 4JOAA 1XH6A 2UVZA 2YABA 2R3IA 3E8CA 5DWRA 5E90A 4GYIA 3VBXA 3W1FA 3ZTXA 5EQYA 4IX4A 5IQHA 5E8XA 2H96A 3ZONA 3IW8A 5ANEA 4JG6A 4YR8A 2CSNA 4NKSA 4UV0A 3PPJA 3MIAA 2B4SB 4EWHA 3SV0A 3JPVA 4RFYA 5CWZA 2O2UA 4J71A 4QTBA 4TWOA 4TYIA 5CS6A 5IKWA 3R9HA 4C0TA 4AAAA 3TNQB 4FTRA 3PSBA 1DI9A 3AGMA 3C4WA 4KWPA 3OY3A 5J7HA 3I5ZA 4FIHA 2GPHA 3GFEA 4ZTRA 3E7VA 4FNWA 4K6ZA 4OTQA 5E92A 3VRYA 2GNIA 2R0UA 2QHNA 3C0GA 4G6NA 5AX9A 5EM6A 1G8SA 4ZY6A 4WRGA 5FXSA 3DCVA 4IB1A 5AEPA 3MPMA 1PXOA 2PK9A 4DLJA 3DXNA 3F7WA 2XIKA 5HVKA 2XK4A 2ZYBA 3C4XA 4MBLA 3LMGA 4O82A 2GNJA 2C0TA 1IASA 2ACXA 4WRSA 3PVUA 1XKKA 2ESMA 4Q9ZA 2B9JA 3QYZA 4UMRA 3DTCA 3RINA 1J3HA 1G8AA 5ANJA 3D2IA 3C0IA 5ETFA 4BICA 3TZMA 5IMEA 2W17A 4B9DA 3AD4A 4AZEA 3V5TA 2R3KA 4KS7A 4O91A 4XX9A 4DFUA 3UDBA 5M4UA 4QP9A 4HPTE 2OXYA 3F5GA 4C62A 5DFPA 3I79A 5L2SA 1BL7A 2EUFB 4RPVA 3SHEA 4A07A 5EOLA 3M42A 4FMQA 4DFNA 5HORA 2JC6A 3K2LA 1LUFA 3OXIA 4PPAA 5ACBC 2YLEA 5EDRA 4R5SA 4AX8A 3PYYA 5TE0A 3ZFXA 3VS1A 5EK7A 4A9YA 3DBEA 5HE0A 4EOSA 2BZHB 3Q52A 4ZMEA 3NW7A 2EB3A 5DRBA 3FXZA 2HW7A 1Z57A 2C1BA 4IC8A 4RVTA 4IHPA 5ANIA 4EK5A 3LXNA 4R1YA 5BVNA 3TDWA 3IDPA 2FH9A 2OJFE 4FSYA 1Z9XA 2WAJA 2WTCA 4BCNA 4KNBA 2C0OA 4DG3E 4G3DA 1W98A 1H28A 4RC4A 4JXFA 4NIFA 4IWOA 4RX8A 5DOSA 4CZUA 4RX7A 3W8QA 2IZTA 4HJOA 4S34A 5AP7A 2PZRA 4O86A 3B2WA 4C2VA 3ORZA 5J95A 4ERWA 4MNFA 3KB7A 3ZOSA 2VV9A 4L67A 3HP5A 3KRXA 3BYOA 3V5LA 3O7LD 4FNXA 4D28A 4MTAA 4FV2A 1IAJA 3BWFA 3D0EA 3AT4A 2IVSA 2QU5A 4KSQA 4UALA 3U4UA 5HVJA 3RJCA 2BAQA 4G3FA 3BELA 1YXXA 2EXEA 2J0KA 3BV2A 3HA6A 4O0VA 4FKRA 4XMOA 4H1MA 2GQRA 3QC9A 4I6HA 2FUMA 3MB7A 3DJ5A 5HNBA 3WE8A 4I24A 4U0IA 4UZHA 5E8ZA 2O63A 5HCYA 3FMJA 4F7LA 3BHTA 2C6EA 5JZNA 3RKBA 3PE1A 4MD7E 4DBXA 3K54A 4JBQA 5F4NA 1REJA 4M0ZA 4O22A 5EI2A 2BZIB 3F3TA 3FI2A 5C03A 5CEKA 1GZ8A 3C0HA 5K9IA 1WBPA 5CI6A 3VNTA 2X2KA 5HIDA 4FKSA 4EK6A 2J0JA 5DBXA 3WYYA 3MESA 3MFTA 4BB4A 4F9BA 4JNWA 5EKNA 2EU9A 5AR2A 3NDMA 5L2IA 2WD1A 3LJ1A 3SQQA 2UZTA 3NGAA 4KSPA 5FP5A 2BCJA 2GMXA 2QOBA 2F2UA 5DG5A 4ANLA 4DBNA 2BTRA 3MVMA 2YISA 5HEZA 3KULA 1TVOA 4FSTA 4Y5HA 3T3VA 4BZDA 4A7CA 2WMUA 2X81A 3OS3A 4JG8A 4JDKA 3DQWA 3O2MA 5AV0A 4FT3A 4JS8A 2GHMA 3VUIA 4C4JA 2C6IA 4LV5A 3MBLA 4IJ9A 2CN8A 3D15A 3NCZA 5DPVA 3SLSA 1ND4A 4TYGA 3U4WA 3AOXA 2OG8A 4GH2A 4C8BA 5DMZA 3ATTA 4I6FA 3ALOA 3FSFA 3FXXA 3QHWA 2Y8OA 4RBLA 3RK5A 3TV7A 4QMNA 3A62A 3KVXA 3ZLWA 3D5WA 3JS2A 4ZIMA 5EQPA 2OWBA 2GFCA 4OTDA 3CXWA 2B54A 3BHUA 4UBAA 2QO7A 4E5WA 4J98A 3FZ1A 2A4LA 4IX5A 2C68A 2QOKA 3UZPA 2PVLA 1F3MC 2O3PA 3NUSA 3S00A 2XM8A 4BDFA 5AAGA 1PJKA 4BGQA 3UO4A 4TZRA 1PXNA 3PE2A 3MVLA 4DH7A 2EXCX 2VX1A 3D94A 4YU2A 5BQ0A 4A4OA 3SXFA 5TT7A 3HP2A 4FEUA 3DK7A 3MV5A 3U9CA 3DOGA 4D2WA 4IC7A 5ETIA 4ASDA 4PNIA 3KCFA 3OC1A 2PZIA 1J91A 2UVXA 4KIOA 3ZO1A 2R0IA 4EQCA 3E62A 4DT8A 4YZBA 4ACMA 4CKIA 3NRMA 5B2MA 2PL0A 5CALA 3Q9YA 4W4XA 1GIJA 3LIJA 3QZHA 4FNZA 2R3HA 4LUEA 4J8NA 4O7VA 3F9NA 1OL2A 3F7ZA 3KCKA 3OF0A 2XK6A 4L46A 2I6LA 1XR1A 1YXUA 5JRQA 4AE9A 4EZ3A 3PIZA 4UXQA 2UZNA 2QOFA 3UPXA 2HWOA 4M15A 4QMSA 4AFEA 4NEUA 4ZS0A 1XHAA 2Z7QA 3WF5A 1OPLA 3R8ZA 3KA0A 4CG8A 2CHLA 5A14A 3GUBA 4O2PA 4BBEA 2YCQA 4EK8A 5AAEA 3VS0A 4FA2A 4W4WA 1Q8TA 1WBNA 3NEWA 3QKKA 3UOHA 3UVPA 3WZDA 2YAAA 5M53A 3PTGA 3KN6A 2ITNA 2R2PA 4JR7A 3V5JA 4QP7A 4EHZA 4LG4A 4AW2A 4EUTA 5CAVA 4FV0A 3UOLA 3LXPA 1BUHA 4BR3A 3OXTA 3UOKA 3P7CA 3B8RA 4LRMA 3ORLA 3D83A 1IA8A 4NWMA 4K2RA 4FV5A 4V0GA 3ZBXA 4FTKA 1QCFA 4FVPA 4U41A 3H30A 4S30A 2PTKA 4H1JA 4FSRA 4UWCA 3UJGA 4C02A 1Q41A 2ERZE 4FK6A 5EW8A 4B4LA 2Y6OA 3V5QA 3C4ZA 3WZJA 4BF2A 2O64A 3PZHA 2R3NA 3VUGA 5CT7A 4EH3A 2XNMA 4ZSJA 3KMWA 4QMYA 4HCUA 2W9FB 4C7TA 3FQEA 3UQCA 1XWSA 2GNHA 2V7OA 4KIKB 2YIQA 4DINA 2C5NA 3DT1A 4ZTNA 2B55A 3I7CA 1AD5A 3D9VA 2RGPA 2E2BA 4FKVA 3WE4A 3W32A 3LQ8A 1OUKA 4D5HA 4CRSA 1J1CA 3TI1A 5IPJA 5K4IA 4D0XA 3NCGA 4UWBA 4A06A 1MP8A 3PXYA 4GKHA 3PXQA 5EM5A 4JDJA 3JUHA 3CQEA 4NW5A 4IBMA 3ZEPA 3ET7A 3DNDA 1OB3A 2W1DA 4ENYA 4I22A 4XG8A 3VJOA 3ZO3A 4FTMA 4E20A 4RZWA 2VTJA 4U3ZA 3S1HA 2G2FA 2GHLA 2J7TA 4BHNA 5C4LA 1WVXA 3DK6A 2KULA 5AUWA 4DAWA 1Y57A 1TKIA 2VTLA 2YCFA 1GJOA 3L8XA 3MVJA 1L3RE 5I0BA 3PPKA 2IZSA 4TXCA 2G15A 3PWYA 4IIRA 5AUXA 3SOAA 3EKKA 4Q5HA 5ETCA 2I0YA 3EFWA 2IW9A 2PZ5A 2X1NA 4FSNA 4M97A 4E4MA 4RMZA 3R9OA 4GJ3A 4D9TA 1MRVA 1UNLA 4NTSA 3R9DA 4O7ZA 2X7OA 3FQHA 4D9UA 4BHZA 2BHEA 4P90A 4W9XA 2E9VA 4AFJA 1BX6A 4Y8DA 5A4QA 1Q5KA 2W1GA 3Q5ZA 4U43A 2XK8A 3RAKA 1FQ1B 1WBOA 3RCDA 4AU8A 4PX6A 3TACA 4YURA 5IISA 4BN1A 3WF9A 4BCJA 2YDIA 4ANQA 1OM1A 4PDOA 4DFYA 4O84A 4LOOA 2R64A 3TZ9A 4NKAA 2KTYA 1NT2A 2BZJA 5DT0A 4B8MA 2FGIA 3FC2A 2IJMA 3HRBA 4I5CA 3PSCA 4BIDA 3FI8A 4XH6A 5CU6A 5HKMA 4EK3A 4IM2A 4QYFA 2J0LA 2ZM1A 3KY2A 2NRUA 3Q04A 4JQEA 4OTGA 2J9MA 2JBPA 3OWJA 4RQVA 4X2GA 4X2KA 5D12A 1SZMA 4KA3A 4WNMA 1CTPE 3P7BA 5IA5A 1KOBA 2ITVA 2NP8A 2DUVA 3GQIA 3EN5A 4GFMA 4MKCA 3JY0A 5HTCA 2CN5A 4K8AA 3SXSA 2YM8A 2ITUA 2WTVA 5DEWA 4ZSGA 2WELA 2OZAA 2W1HA 2WNTA 5AWMA 3HV4A 2XA4A 3GU8A 4RIXA 3I0OA 2A27A 2DWBA 5CU4A 2BKZA 2XKEA 3E92A 4BTFA 4CFMA 4S32A 4AT5A 4C3RA 4E8AA 5JFXA 3AGLA 2W96B 3F5XA 3QTSA 3NUUA 2WMBA 4OT6A 3HDNA 3JY9A 3V6SA 2CLXA 2ITZA 2VTRA 4O6LA 3SXRA 2BIKB 3R04A 4PWNA 4WD5A 5KMJA 4CKJA 3AC8A 3NNVA 3G9NA 4P5ZA 3BHVA 1OIQA 3SDJA 3RVGA 3QKLA 5IQIA 2W4JA 4KABA 4AOJA 1PY5A 5T6KA 2OBJA 5LVOA 1J7LA 3MI9A 2C3JA 4FIGA 1G3NA 2HAKA 2JITA 2OLCA 3RPVA 2X39A 5I4NA 3BV3A 3QZIA 4NM7A 5LCJA 5L6WL 4ZTQA 1ZY5A 1PKGA 2QU6A 3EYGA 2VUWA 4FOCA 4IAZA 4MWHA 5JEBA 1M2RA 2RFEA 3L9LA 5E8VA 4BCHA 3TM0A 4RA5A 4LMNA 1KV2A 3BYSA 3IGGA 5LMAA 3QCQA 2R3JA 2BDJA 2GNGA 2WQEA 5CXHA 3GU4A 2GDOA 3JYAA 2W5HA 3Q60A 3UC3A 2F49A 4DN5A 4AA0A 3BZ3A 4F0IA 5GINE 3GC7A 4GG5A 3SD0A 5DIAA 4DEEA 5KUPA 2W9ZB 3EYHA 5EI8A 5HX6A 3G9LX 2V62A 4GU6A 5JFWA 4DH8A 4HVSA 2C6KA 1JWHA 4WG4A 1ATPE 4BTMA 5JT2A 5CEQA 3BU5A 4UXLA 3OW3A 4YBJA 2WU6A 4GK3A 1Y91A 4JX7A 2J51A 5LOHA 3BBWA 3H0YA 4RIOA 4XP3A 3CGFA 5LMKC 4XEYA 3WARA 3F82A 4RLLA 3FZRA 4EJ7A 4TYJA 3A99A 4AUAA 2FA2A 5AP1A 4O7WA 4MX9A 2YIXA 1OECA 2OXDA 2VNWA 1H1PA 1ZYLA 4YHTA 3OOMA 3FYKX 4FZAB 4AS0A 4F4PA 3GB2A 3G33A 3Q4CA 4ANMA 3SGCA 3D7ZA 2Q0NA 5DNRA 3AD5A 3Q9XA 4JBVA 2Q0BA 2OJ9A 3DLSA 2XB7A 3POOA 3NPCA 3VS5A 3MDYA 5HI2A 3S3IA 3P7AA 1BI8A 4ALUA 5J79A 3GC0A 4GVJA 3IONA 4I0RA 4HGLA 4OUCA 5FTGA 4M69B 2RL5A 3TZ7A 1ZRZA 1KE9A 5HOAA 2A0CX 5LMKA 5CQWA 5CVHA 3OUNB 2ZV2A 1APME 2ZM3A 4FL2A 4O0SA 3LFCA 1XBAA 1OGUA 3EHAA 3L9PA 1O6LA 3RAHA 3FBVA 3R1SA 4U80A 2GQSA 3VQHA 3ALNA 4DH5A 3FI3A 5LVNA 4FV3A 4GUEA 2XEZA 4EH6A 2ZV7A 4M67A 4QTDA 1P4OA 1ZARA 4I6BA 5M4IA 4O7TA 3FKOA 3EIDA 3LCOA 3TUBA 4BWKA 5BVWA 3BQRA 4C34A 4S33A 5KZIA 2IW6A 2XMYA 2WMXA 3KEXA 5HIEA 2C6OA 2UVYA 3IPHA 5C26A 3KRLA 3EQPA 3LPBA 3NZ0A 3ORPA 2C3IB 2OGVA 3MJ2A 2P33A 3LCKA 4UYAA 4XLVA 3FQSA 2BKKA 3P1AA 4L53A 2PULA 4R7HA 5TOZA 4V05A 3BU3A 4KKHA 3ROCA 1JNKA 3ORIA 4YUQA 4A9RA 5F95A 4BDHA 4O6EA 1G5SA 1YOMA 3ODYX 4IM0A 1WFCA 5E4HA 3NVKI 1LPUA 3F3ZA 4DG2E 3VUDA 1PHKA 2V0DA 4G9CA 4D4RA 2CKPA 4QP3A 4I5PA 4FV7A 4N57A 3AQVA 4NUSA 4BKZA 3KXXA 3DGKA 4FSMA 2VTTA 4R3CA 2P2HA 4ZSEA 3IW7A 3AMAA 4ZTHA 1E1VA 1W82A 1U46A 5EHYA 2BTSA 3PXZA 2Z7LA 4FKLA 3CPBA 3A60A 1J7IA 3OY1A 2Y0AA 2B9FA 4PF4A 4MNEB 5AP4A 3PA3A 4WOVA 1FBNA 2VTMA 2P4IA 4HYSA 5AUZA 2BMCA 4YJQA 1URCA 1BLXA 2BROA 3Q4UA 2PUPA 4P2KA 3OWLA 3LLAA 4PP9A 5IH5A 2QOHA 2V22A 4X3FA 5LCKA 3ZLXA 4TNDA 3R02A 5CSWA 1J1BA 2W7XA 2BFXA 2GTMA 5D10A 3A7IA 4ONAA 2QO2A 4B6LA 3C4CA 4FR4A 4IEBA 4PPBA 1ZWSA 2PUUA 4KKEA 4MXYA 3AT3A 1KE8A 3O71A 4W9WA 5DYJA 1R0PA 4FK3A 4G34A 4IQ6A 4L44A 3MA3A 2B52A 5LWMA 2Y4IC 3BLHA 3NIEA 1FMOE 1OL1A 4I94A 2JEDA 5HVYA 4CEGA 5B2LA 5KMIA 2BIYA 3H4JA 2QLQA 4YNOA 5AV1A 3ZXZA 2GFSA 4DC2A 3F69A 4GJ2A 2IWIA 2R3MA 1Q99A 2X7FA 4OTRA 3EQIA 3JXWA 3UIUA 4YJOA 2QKRA 3OBGA 4JAIA 3MS9A 4PQNA 3BU6A 5M56A 1OPJA 3TCPA 4D1SA 5F20A 4RA4A 5TKDA 4C4IA 2F7XE 4J8MA 3TV6A 4D2TA 5HLPA 4DEBA 4EORA 3MY5A 4EQUA 5B0XA 5GJGA 1SYKA 4FUYA 5IDNA 1REKA 4L6QA 1KE6A 4FYOA 4C38A 4E6CA 3NW6A 3H9FA 2CKOA 1TQPA 5EYCA 4L9IA 5C27A 4BCGA 2A1AB 2X4FA 2CKEA 2H34A 2CGWA 5F1ZA 4FGBA 4BBMA 3W2PA 5K4JA 3SG8A 3OTUA 4FKJA 4I4EA 2W06A 5DRDA 3W2QA 4UYNA 4XG2A 4PUZA 2RG5A 2R3FA 3THBA 4EOJA 3LMHA 4WNPA 5F9EA 4DF3A 5HQ0A 4BWPA 2C5OA 1JPAA 5J9ZA 3PUPA 3FY0A 2QKWB 5IQFA 4AP7A 1LR4A 1YDRE 4H39A 4WA9A 5KCVA 4H3QA 1WMKA 3FPQA 1OIRA 4TWNA 5AADA 2UW0A 3NYVA 5CF4A 3KFAA 1GNGA 2I40A 4O7YA 5I9ZA 3QYWA 3E87A 4BY9E 3ZDUA 5IQDA 2XP2A 3CLYA 1RQQA 2XJ1A 4R7IA 2ITYA 5D7VA 3ZRKA 2HXQA 4P7EA 3TUDA 4E7WA 3VUMA 3HUBA 5I5ZA 4TW9A 2Y6MA 3GNIB 2XCKA 4QTAA 4RWJA 3O7LB 4WNOA 1B39A 4QQCA 5EH0A 3R7IA 4PDPA 4EC8A 3S4QA 2GCDA 3Q6WA 2OIQA 2QLUA 4X0MA 5IH6A 2YWVA 3LQ3A 5CANA 4EBWA 4GS6A 3DBDA 5HESA 1WZYA 1OKZA 4FV9A 1ZMVA 3TKIA 2YERA 3W2SA 5DT4A 3PP1A 5AJQA 5M09A 3DJ6A 3HV7A 4MXCA 5H8GA 3U54A 2WB8A 2WTWA 4C3PA 4HVGA 1YI4A 2WTKB 2HZNA 3T8OA 4XV3A 4MCVA 3DZOA 4M7IA 5K5XA 2R3GA 2XK3A 4ASXA 4ZY4A 2R3PA 1GZNA 3QLFA 5BYZA 3DAJA 3NAYA 4XJ0A 5A46A 4OTWA 3G0EA 2O8YA 3FZTA 3U87A 4C4EA 5CAQA 5EDQA 5HD7A 4XV1A 4KIQA 4FICA 4YMJA 3BGPA 3OZ6A 1NA7A 4GU9A 4NYEA 1RDQE 4DA5A 2Y4PA 4II5A 1T46A 2WO6A 4NJ3A 3GOPA 3N9XA 4N70A 4J99A 5L4QA 2GNLA 5FEDA 2YZAA 1XBBA 3DU8A 1Q8ZA 4XNEA 2XNPA 4KBKA 3UTOA 1R39A 2VO6A 1LEWA 3OOGA 3QD4A 4HZSA 4QQJA 4EUUA 3HMIA 3R30A 3DBCA 4IAAA 4KUJA 1NVRA 5E9EA 5EM8A 3DZQA 3OW4A 3P08A 3PXRA 5CLPA 3CKWA 3NIZA 5ANDA 3TG1A 3F2NA 5K5NA 4FEXA 4RVLA 3QA0A 4MXAA 3CS9A 3HAMA 3KK9A 3HEGA 4FEWA 3WBLA 3EQBA 4IX6A 3UIMA 1Q4LA 4G1WA 5BVKA 3MA6A 2B0QA 5J5SA 3TL8A 3D7TB 2W1CA 4Y72A 2JKQA 5TF9A 5J1WA 3NAXA 2O0UA 4UMQA 3QRTA 3KRJA 5HTIA 1YWVA 2Z2WA 1YI6A 4WG5A 5DE2A 5FP6A 3FLYA 3UO6A 4EHGA 5C8KA 3OCTA 4FIEA 4XG7A 3R7VA 4DEDA 1UU7A 2H9VA 3R21A 4BDDA 3SC1A 4XUFA 5H2UA 1UU9A 1QL6A 1GZOA 4FKIA 4FT0A 4DGLC 2X9EA 2WIPA 3TWJA 3F2RA 4NFNA 5DR6A 4KB8A 1FPUA 2WU7A 3LCSA 1H0VA 4Y95A 3DY7A 3BRBA 4NK9A 4WG3A 1IR3A 1OKWA 3ORNA 3F5PA 5CEIA 4FV1A 5KNJA 3UNZA 1YDSE 3FKLA 4QYHA 2GS2A 2NNWB 5CF6A 1I44A 3F3WA 3V8SA 2Z7RA 5G1XA 4BYIA 3UE4A 3C5UA 2Z7SA 4LRKA 3UVQA 1VJYA 4CT1A 5EKOA 3RP9A 4Q2AA 3IO7A 1CDKA 3QTRA 1P2AA 3HRFA 3WYXA 3KXZA 1PXMA 3A7FA 4XV2A 4TYEA 1A48A 5HE1A 3ULZA 4BCOA 4EWQA 3I81A 3ZO4A 1PKDA 3VWAA 4AZWA 4QD6A 4CTCA 4E5BA 4K11A 3QQGA 4CVAA 2IG7A 3P4KA 5FD2A 5H9BA 4FI1A 4YJUA 2VO3A 5CXZA 3TNPC 4XHKB 4X7QA 2X6EA 4O81A 3ORXA 1KOAA 2XF0A 5L8LA 4ORKA 1CKIA 3VHEA 4BCMA 3EQCA 4FGRA 5CVFA 4DTKA 1IG1A 2X2MA 4TYHB 4CSVA 3ZZEA 4FTOA 2XBJA 1R78A 4UMUA 4L8MA 2JDVA 3GCSA 3HGKA 4FBXA 4GFGA 5AR4A 2HIWA 3KRRA 3GC8A 2JAVA 2YEXA 3NUPA 2R7BA 2WMRA 4GIHA 5I9VA 4MQ2A 4H05A 4QO9A 4TWPA 3P79A 1OBGA 4TKSA 3AC1A 4CZTA 1W83A 2IPXA 5JH6A 3WOWA 3AD6A 3CD8A 5DHJA 2P0CA 4QMVA 4HYHA 4DYMA 2BZKB 2YITA 3U55A 4XP2A 4JDIA 4FVQA 3E8EA 3H3CA 5I3RA 4AGDA 3UP7A 2C3LA 4AA5A 2DQ7X 3DB6A 4GG7A 1KV1A 4GSBA 1XH7A 5AP3A 3FZOA 3DXQA 3LJ0A 2HXLA 3Q2JA 4A9TA 4EBVA 1DAWA 4LL0A 3RPYA 3RPRA 4F7SA 4IVDA 4YNEA 2JFMA 4K0YA 2ONLC 5BVFA 3DAEA 2OFVA 4RZVA 4Z7GA 2XCHA 4OLIA 3QXOA 3P0MA 3IGOA 4QP1A 4RG0A 4L00A 2X2LA 3MH3A 2XKDA 3KRWA 4U79A 4HCVA 5KBQA 3ZFYA 1OL5A 4E4XA 2OKRA 4BWXA 1UWHA 4TN6A 4D55A 3QWKA 5CU2A 4ITHA 4E1ZA 4PP7A 4F0FA 4AOIA 4U6RA 3DKFA 1PYEA 3L8SA 4V01A 4PL5A 4D4SA 2ZDTA 2QQ7A 3ELJA 3KMUA 4YSMA 3OXZA 4U44A 4AZVA 3FJQE 4ANBA 2R3QA 4IZYA 3WIGA 4JQ7A 3ZM4A 3QQUA 2ONLA 3WILA 4TWCA 5E8UA 4C3FA 3ZCLA 1XO2B 5BPYA 2CPKE 2OSCA 2NPQA 2W05A 1CSNA 3FSKA 3QU0A 4ACGA 3OTVA 4CMOA 4I20A 3HMPA 4USFA 3S95A 2UW5A 3O50A 4ARKA 3A4PA 5HIBA 2VWZA 3BEGA 3K3JA 4F6SA 4HVIA 2C5YA 4QMQA 1M2PA 4QYYA 3CTHA 3EZRA 4BFMA 3ETAA 3FLQA 5IEYA 3TNHA 2OO8X 2QOOA 1Q24A 1OZ1A 2UZWE 4KINA 2HWPA 4LFIA 4R7BA 4XG4A 4AXAA 5BVDA 5A4EA 3NNXA 2QCSA 3E7OA 2ETKA 4V04A 3MH0A 3RI1A 5HG9A 4R77A 3GU6A 3QTIA 4W4VA 4NH1A 4D2SA 1YXSA 2UZOA 4WUAA 3R7OA 3HUCA 4O7NA 2R9SA 4F64A 1YI3A 4QTEA 2X0GA 3LFBA 4D2RA 4LQMA 4DGNA 2A19B 2XEYA 3PJ2A 4XYFA 4E73A 5EQEA 4LGDA 4DFLA 2AUHA 2QODA 2XUUA 5HE2A 3Q4TA 4EOIA 3OD6X 4ZEGA 4FIJA 4BBFA 1WVWA 2B9IA 3N51A 5EOBA 3E8NA 3PJCA 5D9HA 3QCSA 2FVDA 2VX3A 4X2JA 3UOJA 2VTIA 5LARA 3AG9A 5IA2A 4FKGA 4D4VA 2QVSE 3Q9WA 2UZDA 3CBLA 3ORKA 4YHJA 2JKOA 3I4BA 3V04A 4CFWA 4YZ9A 3W16A 3I5NA 3S2PA 3UG1A 2VAGA 2RFNA 3TN8A 4BDCA 2WTDA 2GS7A 3D5VA 3ACJA 4FTCA 4XG9A 5CQUA 3GOKA 4G3GA 4DTAA 2W0JA 4M0YA 3ZEWA 2I0HA 3AMYA 4C58A 2REIA 2CNQA 3T9IA 5DLSA 3QZFA 3OP5A 2CCHA 3I0QA 1XH8A 3ID6C 3KXMA 2X8EA 4I41A 4I6QA 3SX9A 1V0OA 1PF8A 1OI9A 2UW6A 4BDKA 2BRMA 2JLDA 3D14A 3EFKA 2BALA 2J0MB 2P2IA 5FXQA 1U54B 5CAOA 2XYUA 5D7AA 4FKQA 3DXPA 3N4VA 3MW1A 1UKHA 2JAMA 5TO8A 2F57A 4R3RA 2YLFA 3TV4A 4BCPA 1H1WA 4D1XA 3NX8A 5AV4A 4FEQA 2ZM4A 2VTHA 3OWKA 4F9CA 2XM9A 4IDTA 4JQ8A 3MVHA 4ZJJA 4CFUA 2O65A 3EFLA 4D2PA 5CSVA 3COKA 3L9NA 4NFMA 5JGAA 3R22A 3QHRA 4F99A 4RJ8A 5GIPE 3LCTA 3WF7A 3IOPA 4O27B 5DH3A 3OEZA 3DDPA 4QT1A 3F2AA 4MEDA 5CT0A 3UMWA 3F61A 4PTGA 4JR3A 2UZBA 2PSQA 3FZSA 2C4GA 2WIHA 5HG7A 4DH1A 3GQLA 3FXWA 3MYGA 1M2QA 4IAYA 1J7UA 2YWPA 2EVAA 1OBDA 4RX5A 1PMUA 5E91A 2X7GA 4FTAA 4O83A 4BZOA 4QQ5A 3MGYA 4F7NA 1R0EA 5H3QA 3R9NA 1JBPE 2ETRA 3IQ7A 3TKUA 4D4YA 2I1MA 4RVMA 4J96A 3HLLA 3O23A 2PVMA 3C4EA 4FKPA 4YHFA 5HO6A 2Z02A 3E88A 2NRYA 4MXXA 5BX0A 3F3UA 4DGOA 3HECA 5M06A 4KIKA 1PRYA 2IZRA 5AR7A 3LZBA 5DR2A 3MPTA 1Y6AA 2ERKA 3UGCA 4BL1A 2F7EE 3DJ7A 3V51A 2J90A 2UUEA 4U40A 4IM3A 5EW9A 4LI5A 4M12A 2XRWA 3VN9A 2XNEA 2VWBA 3HRCA 3KKVA 5FQDC 2HELA 4XS2A 3QC4A 5AP0A 1I09A 3NSZA 3R8UA 4J53A 4C4GA 4O1PA 2PZYA 3LFNA 3ZC6A 4F9AA 2ZV8A 1EH4A 4C33A 3ENMA 5CSPA 1VEBA 2V55A 4IFCA 2XS0A 1O6YA 4Y83A 4L52A 4BTJA 4DEGA 4MWIA 2F7ZE 3MY1A 3SRVB 4UB7A 4E4NA 4JIAA 2WTIA 2C5VA 3HL7A 1BKXA 3EB0A 4RIWB 2VWWA 3PLSA 1YKRA 4R1VA 4LM5A 5JSMA 1JAMA 4ENXA 5E8YA 3IKAA 4GEOA 4E6AA 2H8HA 3LFSA 4FTIA 2E9UA 3SAYA 5IA0A 3C5IA 2W1FA 2WFYA 2YZLA 4FF8A 3L8PA 3QF9A 5M08A 3PJ1A 4J7BA 3DV3A 3L9MA 3MY0A 4F6WA 4USDA 4C4HA 2XIYA 3LXLA 4IH8A 3U6IA 2QO9A 4I5HA 5HTBA 2W4KA 4ACCA 4GK4A 2HW6A 2R3LA 3FMLA 3QWJA 5C8MA 3GGFA 2WMVA 2NO3A 5FLFA 1U5QA 4RRVA 3GCUA 4YLJA 3BE2A 1Y6BA 4F9WA 2HYYA 2YIYA 3MN3A 4FTJA 4ASEA 2F9GA 2XRUA 1K3AA 1RE8A 4EKKA 3CQUA 2JDOA 4FOBA 4RVKA 5DA3A 5KKRB 5DGZA 2HENA 4IX3A 4S31A 3A61A 1FVTA 2JIVA 2VWUA 4YJSA 4MYGA 4B0GA 2FSOX 3TEIA 3OUKA 5L2WA 2HZ4A 2C47A 3COMA 3JVSA 1PMNA 3CY2A 3UMXA 3AC4A 4CQGA 4N6ZA 3LFFA 3NYNA 3QQKA 3VUKA 1UVRA 4FSZA 4OTPA 3QUDA 4EYJA 4BGHA 4J95A 3JR1A 2YAKA 1VZOA 2CGXA 3R83A 2XNNA 5FG8A 3QX2A 4RWLA 4KKGA 5C1QB 4ZXTA 1SNUA 5B7VA 2LGCA 3DKOA 2PVKA 1KE7A 4RSSA 1K9AA 3OHTA 4PL3A 2BRBA 2HOGA 3QD0A 3R2YA 3FC1X 4N4SA 1YXVA 5DEYA
chains in the Genus database with same CATH superfamily
4YBKA 1JQHA 1XH5A 2XK9A 3UZRA 4ZP5A 3OEFX 4O0TA 3W33A 3PRFA 5FEQA 2QNJA 4EOMA 4BDAA 4XV9A 4RIYB 3UPZA 2QOQA 4C2WA 4R78A 2CGVA 4CXAA 5JRSA 4UY9A 5FBNC 2OI4X 4F70A 3ZS5A 5LVLA 5CAUA 1CM8A 3QTXA 3L8VA 3QQHA 1Z5MA 2OFUA 4W8EA 1OL6A 1AQ1A 2XIZA 2PVFA 3PY0A 4QP8A 4IANA 4RWKA 5ACKA 4YJNA 3EN6A 3NR9A 4YZDA 4TPTA 5KMKA 5CEMA 3ZU7A 2BRHA 4NU1A 1PXLA 1UWJA 3MWUA 3NYXA 2A2AA 4UMTA 3UQGA 2QOIA 3EKNA 4CYIA 4QNYA 4RX9A 3SW7A 1YWRA 3NW5A 4YZCA 2PPQA 3KXNA 3OMVA 3GCPA 2CCIA 3FMMA 4O0YA 3TIZA 3NNWA 3ZUUA 3LFQA 1ST4A 4I3ZA 1H4LA 3EL8A 5ANGA 4YP8A 4FC0A 2IN6A 3BYUA 4WBBB 4PMSA 1PXJA 2JD5A 2YDJA 4U5JA 4JLCA 4MF0A 4EH7A 5M55A 3V01A 4F1OA 1GOLA 2PYWA 2JIIA 4O1OA 3R9RA 3PFQA 2X0QA 3KC3A 3D5UA 2P3GX 4YLLA 4RT7A 3UIBA 3BBTB 3I1AA 1L8TA 2VO0A 4YC8A 5ETAA 3RM7A 4PRJA 2WHBA 3IW4A 3D5XA 3OWPA 2UW9A 4RJ3A 3N4TA 4X3FB 1IEPA 2GNFA 5KX8A 4LMUA 2EXMA 3UO5A 3C4FA 4ZZOA 4FZ6A 2QG7A 4JRNA 2Y9QA 4L68A 3Q6UA 3PWDA 3KK8A 4G31A 3LXKA 5L2TA 4I93A 1AGWA 3CD3A 5LXMA 4YJTA 4IAIA 4RJ6A 1NW1A 4IVBA 3FMKA 3DS6A 5IF1A 3QKMA 2ITWA 4QOXA 3BLAA 4M69A 4M66A 3F88A 4L43A 2OH4A 4FEVA 4Y5QA 2DYLA 3GC9A 4O4BB 4PTCA 5M44A 4AQCA 4F78A 3LHJA 2OJGA 4X2FA 2VGPA 1FINA 1Q3DA 1ZYDA 3OG7A 5CTPA 5LJJA 2CNVA 2BDWA 1PYXA 2J5FA 3I6WA 5I3OA 4QMUA 3AC2A 5C8NA 3P5KA 5AUUA 1U5RA 2J6MA 3R73A 2WMAA 3NWWA 5FWKK 1DI8A 3LVPA 1MQ4A 3PRIA 2VWVA 1H27A 3K5VA 3Q4ZA 5BUIA 2QOCA 4EH4A 4DFZE 5G6VA 5A6OA 2IVTA 3MPAA 4AGUA 5CF8A 2X4ZA 4O0XA 3PPZA 5AM7A 4L3PA 4H36A 4AF3A 4HPUE 3II5A 3EJ1A 2HY81 3M2WA 4FG8A 5IH4A 3DKGA 4C59A 2W5BA 2J5EA 3KREA 3FMHA 2BPMA 4L3JA 1XH9A 3RAIA 3TJCA 1FGKA 3F66A 4IZ7A 5EHLA 4BDEA 4AE6A 5CY3A 5H8BA 3R01A 5CASA 1HOWA 3CKXA 4HGEA 3G6HA 2G2HA 2JDRA 3IW5A 5IQEA 3DLZA 1OPKA 4YZMA 3V3VA 4D2VA 5HG5A 3ZZWA 1QPJA 4TL0A 4Z9LA 4DGMA 3SA0A 3W0NA 3MTFA 4GT3A 2HK5A 4PMPA 5IEXA 2WEVA 1ZLTA 4YGAA 3Q3BA 3CQWA 1FMKA 4LUDA 4LYNA 2VWYA 3G0FA 3RNYA 2WQNA 1WAKA 1H1SA 2WXVA 4EOQA 1ZYJA 4F65A 1SNXA 4LGHA 2BDFA 2WOTA 3Q2MA 4YO4A 3NLBA 3HA8A 2PE1A 2C5XA 3ZFMA 2WZJA 4FT9A 2ZV9A 4WKQA 4AT3A 5A54A 3UQFA 4QDEA 3Q5IA 5FRIA 4FIFA 4M3QA 1W0XC 4WUNA 2QOLA 5HD4A 2OIBA 1TQMA 1URWA 1QPCA 2OK1A 1S9IA 3R1YA 4FT7A 3HMMA 5KO1A 3EWHA 2OF2A 3KF4A 3QD2B 5A3XA 2C6DA 2VO7A 2UZUE 5JK3A 4JG7A 2BILB 4UMPA 3PDTA 2JFLA 5L6OA 3ZXTA 3CTQA 5A4TA 2G9XA 3C1XA 4I0SA 5AR8A 4L7SA 3E5AA 5CYIA 2RFDA 2DS1A 3RZFA 3FLZA 3R6XA 5J9LA 1ZZLA 4RJ4A 5CF5A 5GJDA 1DS5A 2ITOA 2I0VA 2WKMA 3C9WA 3QCXA 4NJDA 4E6QA 4K9YA 5IUGA 5CENA 3EH9A 4D1ZA 4F1MA 3CPCA 2G2IA 4X2NA 2FB8A 5AIKA 3IK3A 5K3YA 4CMUA 5HU9A 4OTIA 4IAKA 3ZDIA 2QC6A 3DQXA 4EK4A 5KMOA 4BTKA 4ZTLA 3NUYA 4IZ5A 4DGGA 4R5YA 1NVQA 3O8PA 4UZDA 4EH5A 4ALVA 5C4KA 4W8DA 4DFXE 4O0RA 2PMNX 2OXXA 3NS9A 5IQCA 4FE2A 3QD3A 5HNGA 5BYLA 3R8MA 5BNJA 3LAUA 3P5JC 2ZB0A 1HCKA 2G01A 3CY3A 3QA8A 3BI6A 4FG9A 4ACHA 2RSVA 4C35A 4FKOA 5IG1A 4MUQA 2VTOA 3RGFA 4F6UA 1BYGA 2WQBA 3PJ8A 5DVRA 3UNKA 3VAPA 3PZEA 5GHVA 4ANOA 1UNHA 3FPMA 3HMOA 4YC3A 5I9WA 3UG2A 4UWYA 5B2KA 2OZOA 4WBOA 3OT8A 4XP0A 4JI9A 5FBOA 1OITA 5I9UA 4G6LA 4KD1A 3UNJA 3VF9A 1H07A 2JKMA 3WZEA 2ETMA 2UW4A 2YJRA 1MQBA 2OJJA 2W1ZA 4R8QA 3VS3A 4W4YA 2PVHA 4TNBA 1VLRA 4CLIA 1CKJA 2BUJA 3QX4A 3FHIA 4QMWA 4Y85A 5E1EA 4EL9A 3C13A 4FV6A 5FXRA 3E64A 4MD9E 3KXGA 4AGWA 2F4JA 4PDSA 2OF4A 3FY2A 2WTKC 4Q9SA 4QRCA 5I9YA 4A4XA 4WT6A 4NIFB 3COHA 4LOPA 4XBUA 4I23A 3HAVA 3ZBFA 1MRYA 1WBTA 3CCNA 5T68A 3R8VA 4CRLA 4YJRA 4QTCA 3TT0A 4ACDA 5HCZA 2WPAA 4AN2A 3GT8A 3E93A 2J0IA 3VS6A 4O2ZA 4GFOA 4AA4A 5HBEA 4QP4A 5J87A 1X8BA 2JDSA 3VUHA 1JKSA 3BLQA 3RK7A 5C01A 3QQLA 5AMNA 4EZ7A 4BCIA 1TQIA 3LW0A 5ICPA 4CFXA 4RC3A 3HV3A 3BQCA 4CV8A 1STCE 5CU0A 1M52A 2PUNA 3TIYA 5FM3A 1SVHA 2C6LA 3F3VA 3IDBA 3O17A 3QLGA 4IB3A 5AR3A 4ZTSA 4IWQA 3A4OX 3EN9A 3KGAA 3EL7A 4O4FA 5HICA 3ZYAA 1Q61A 5FDPA 5CI7A 4IFGA 5A9UA 1ZY4A 2WTJA 3ZSGA 5CSHA 4MBIA 5AUTA 1WVYA 4IW0A 4MHAA 3RPOA 1VYZA 3RCJA 1T45A 3OVVA 4UX9A 1IAHA 3BX5A 4NT4A 2C69A 4NM0A 4FTUA 1W8CA 3OCGA 4GMYA 3RMFA 1DM2A 3HZTA 5C9CA 4E93A 2XNBA 4BI0A 5IZFA 5M51A 4K18A 4P5QA 3LCDA 3FMNA 4RGJA 3QRUA 2XZSA 4IE9A 5AR5A 3MFUA 3Q53A 4QPSA 4GV1A 4BDJA 1XH4A 3M11A 2JBOA 1HCLA 4HYIA 4FKUA 3GCVA 3SKCA 4NM3A 4X6RA 5JGBA 2UZEA 5A4CA 4AXFA 5KZ0A 5IQAA 3PVGA 3H9OA 3KULB 4QP2A 3R63A 4R3PA 5IDPA 2WQOA 4I21A 5LVMA 5LWNA 4DTBA 3PP0A 1H24A 4X6QC 4BJJA 4GUBA 2ITTA 4ZJVA 2VD5A 3UYSA 1Y8YA 3LMIA 2YIRA 1KSWA 4DLIA 4CTBA 3FE3A 5AAFA 2XNGA 4EOOA 5H8EA 3V8TA 4CYJA 4RQKA 5DN3A 3IW6A 3CEKA 1Q8WA 3HYHA 4DT9A 1YQJA 4O4DA 1YWNA 3G15A 5DR9A 3I6UA 3CJGA 2YDKA 2ZOQA 5HCXA 1H0WA 1DAYA 5JQ5A 4ZMFA 2G1TA 3D7TA 4YJVA 4A9UA 5KMLA 4D5KA 3ORMA 5AV3A 4QMMA 2VTNA 4N6YA 4FG7A 4H3BA 4DH3A 3ZUVA 3Q32A 3ZLYA 2PVNA 4CFFA 3P86A 4Q5EA 2E9OA 3VO3A 4UN0C 3EFJA 3KF7A 1ST0A 4KIPA 3PIXA 3RALA 2FO0A 4TTHB 5CZHA 1VYWA 3BYVA 4DCAA 3NNUA 3ZMMA 5M4CA 3T9TA 3RHXA 3MTLA 4HNIA 4RFMA 1NVSA 2YACA 3ODZX 2BRNA 4NL0A 5IQGA 1PW2A 2CLQA 3FZPA 2OIDA 2YM6A 4IVCA 4YTHA 4YO6A 1OL7A 2VTSA 3DBFA 1PMEA 2E9NA 3HNGA 3VBQA 2PMLX 1M17A 3MH2A 4CCUA 4FTTA 3A8XA 4HYUA 3CSVA 4DFBA 2WMQA 4JL9A 4DEHA 1WCCA 3GXLA 3SOCA 4E3CA 3MJ1A 2WEIA 5HU3A 2PUIA 2BHHA 3KU2A 4FZDB 2CGUA 2Z60A 4EZ5A 4QQTA 4GT4A 4K33A 4NCTC 5IQBA 4OAVB 4AOTA 4BYJA 4X21A 3IG7A 1Y8GA 4XBRA 3FL4A 5FEEA 3P78A 3QQJA 3MSSA 3EMGA 4LRJA 3W55A 2PE0A 5GZ8A 4L3LA 5BMMA 5GJFA 4FT5A 1JSVA 1GY3A 2O5KA 4BKYA 3DTWA 4CFNA 5FTQA 4F63A 5KBRA 5KMNA 2ITXA 4JBPA 4BGGA 3TUCA 2CNUA 3AKLA 4FVRA 3LM0A 3AC3A 3EQHA 2R7IA 1K2PA 2PY3A 3KL8A 1NY3A 3MB6A 3BHHA 2JGZA 5AM6A 3W2CA 3ZUTA 1YHSA 1IRKA 3FAAA 4ZSLA 4D0WA 3KXHA 3V5PA 2IZUA 1U4DA 3OCSA 4EOKA 1XQZA 2ZMDA 4NTTA 1JKTA 5D11A 4BDIA 1Q62A 3H0ZA 2XIRA 2AC3A 3ORTA 3G90X 4M14A 5CU3A 4ZLOA 3QALE 4NCTA 4IMYA 4FKWA 4HOKA 5FUTA 2UW8A 5K0KA 1PXKA 4TYHA 3SVVA 4BRXA 5JZJA 3LE6A 4XRLA 2YM7A 5J8IA 1O6KA 2PU8A 4PNKA 4V0GB 4BCFA 5J9YA 2V7AA 3LFAA 3ZRLA 1ZAOA 3FKNA 4JDHA 4XOYA 5A4LA 3QRJA 4QPMA 3ACKA 3QAME 2P55A 3BGZA 3R7YA 2C1AA 4F1TA 4C57A 4QYGA 2Y7JA 3ZRMA 2YCSA 2QURA 4FV8A 5BVEA 2WQMA 1M7NA 4OBQA 3ML1A 3RWPA 5GZ9A 4C36A 4EH2A 4AG8A 2CJMA 3K3IA 4FTNA 3DFAA 4EQMA 3FLWA 3IS5A 5E8SA 2VU3A 3SG9A 3NMUF 4DHZA 4CCBA 4G9RA 4FSQA 2WMWA 4QMZA 2VWXA 3HDMA 2XARA 5IUIA 2GQGA 5DI1A 4DG0E 3VF8A 4QPAA 5E7RA 3P9JA 4EH8A 4IAFA 5GIOE 3QUPA 3EQRA 4ZZNA 1OIUA 5K0XA 1R3CA 5LMBA 1GIHA 4FL3A 4C61A 3VW6A 4GT5A 4YPSA 2EWAA 3VC4A 2ZVAA 3DFCB 4FNYA 4K77A 3GI3A 3VS2A 3UC4A 4ANSA 5JQ8A 1UA2A 3TTIA 5HG8A 4Z55A 2J4ZA 4L45A 4RFZA 3GENA 4RJ7A 2W5AA 4XRJA 3KIOC 4M84A 4IACA 1JLUE 3W0QA 3VW8A 3UZTA 1JKKA 3N4UA 2J2IB 3HMNA 3ITZA 4AACA 4J1RA 5CEOA 2JKKA 3OROA 4EOPA 3E3BX 4OW8A 3GP0A 4CLJA 4GYGA 4IWDA 5KMMA 4U42A 2IVUA 2GU8A 1A9UA 2W1IA 3QUEA 4GL9A 3QGYA 3B2TA 2UW3A 5FTOA 2YN8A 1OGYA 4CZYB 2X8IA 4DE4A 4JBOA 2YM5A 4C37A 3H10A 3R71A 2VTPA 3DB8A 2WGJA 4U97A 4WHZA 4FTLA 4O4CA 4AW5A 3FWQA 5AX3A 4B7TA 4CKRA 3ANQA 4PL4A 5HLWA 1IA9A 3NUAA 5L2QA 4YJPA 3KQ7A 3R8PA 2R5TA 1F5QA 2BAKA 1FOTA 4ERKA 1WBVA 1S9JA 5EG3A 2X6DA 4PV0A 4F09A 3LKMA 5EFQA 3R1NA 1YOJA 3EZVA 3ZH8A 1OVEA 1OIYA 4WO5A 4G5JA 4E4LA 4U81A 4AN9A 3ZLSA 3RHKA 3NVMB 4PMMA 4YZNA 3QCYA 4PY1A 2EB2A 2VWIA 3COIA 4ZLZA 4MQ1A 5E1SA 5J7BA 5I9XA 1ZOGA 2ZAZA 4OAUC 4WNKA 3MH1A 3GFWA 5ANOA 2HZ0A 4IDVA 5FDXA 4CGAA 3GU7A 2B9HA 3ROYA 2VRXA 4WSYA 1QPDA 3R7GA 4LOQA 3HVCA 3V5WA 5AA9A 1YHVA 4Z7HA 4BCQA 2IW8A 4XG3A 1UV5A 2QR7A 3CP9A 4QMLA 3F5UA 4BVUA 3FL5A 2W99B 4BIEA 4BDBA 4IB0A 3HV5A 4L7FA 4APCA 2OZAB 5DT3A 1CMKE 4QMPA 3U6JA 4RIXB 3LJ2A 5AP2A 5BYYA 4Y73A 3BE9A 4IXPA 1TZDA 2RIOA 3ZSHA 4FUXA 4J97A 1ZYSA 1OMWA 3KVWA 4I0TA 1YOLA 3ZC5A 4O7LA 4MXOA 2B1PA 3G2FA 3NUNA 2X8DA 4IWPA 2ITQA 4WSQA 1F0QA 3VBVA 5HNIX 5GZAA 3E8DA 5HO7A 2ZB1A 4EHEA 2HY0A 5CX9A 1FGIA 4HGSA 3PLAE 3OT3A 4XCUA 4YSJA 1RW8A 4I5MA 2BRGA 3PVWA 4OGRA 2YFXA 4MXZA 3CJFA 4IADA 3RNIA 4WIHA 4MBJA 1QPEA 1GIIA 5EYKA 4HNFA 4ID7A 4KRDA 5KHXA 1XJDA 4CFVA 5JN2A 2VNYA 4FSWA 3RK9A 5M07A 3R00A 3QXPA 4U8ZA 1U54A 2ITPA 4DHIB 2J50A 3LM5A 3MFSA 2YCRA 5L3AA 3BLRA 3BPRA 4EC9A 5JFSA 4OT5A 3QGWA 3DBQA 4APPA 3QTUA 4EH9A 4BKJA 5IA1A 4KBAA 3UVRA 4GVAA 4JT3A 3CE3A 3FLSA 4TRLA 1JKLA 3RPSA 2V5QA 3UIXA 4EOLA 2OJIA 2QHMA 3HKOA 3EQGA 3U8WA 2I7QA 1LEZA 4DEAA 4MAOA 1Q8UA 2VTAA 1MUOA 2VX0A 4EONA 4C4FA 1SVGA 4NM5A 4LV8A 2WMTA 1NXKA 4KAOA 2PMOX 2OU7A 2CDZA 2LAVA 4F0GA 3FHRA 1UU8A 4CNHA 5BUEA 4LL5A 5IA3A 1V0BA 1W84A 2C3KA 4RJ5A 5TR6A 4ZS4A 3W10A 4I4FA 3A8WA 2R4BA 1BMKA 3PVBA 3C7QA 2RG6A 2OH0E 3LFEA 1H08A 4A4LA 2B7AA 4NW6A 4FZ7A 3EN7A 5E8TA 4CT2A 5F94A 3M1SA 2VGOA 4U3YA 3DA6A 5JGDA 2XNOA 4MF1A 5AUVA 3GBZA 3CC6A 1BL6A 1JSUA 5GNKA 2W4OA 4AW0A 4CG9A 2XJ2A 4HVDA 1YVJA 2UZLA 4QMTA 2PVYA 2BVAA 5CNOA 3QRIA 4E5AX 4QMXA 2XANA 3R7EA 4FV4A 4DEIA 2C6TA 5L8JA 2GS6A 5L8KA 1H8FA 4ASZA 4AN3A 3FLNC 4BDGA 2NYAA 2SRCA 4XG6A 3RZBA 3TXOA 3F6XA 4BCKA 1QMZA 2VZ6A 3TNIA 2YM4A 4GW8A 3G51A 4U9AA 4L42A 4ANNA 4FKTA 3MIYA 4J52A 3RTPA 2YIWA 3G6GA 3O51A 4F9YA 4ZY5A 1OUYA 3R0TA 5IU2A 1H01A 4ZJIA 3VRZA 4EKLA 2H6DA 2Z8CA 4U7ZA 4HW7A 3TKHA 4OBOA 2HCKA 1YXTA 5M4FA 3SRVA 4AW1A 3LLTA 3RAWA 2RFSA 4AXEA 3U51A 3PJ3A 5T3QA 4RIWA 2X0OA 3L1SA 5KE0A 5KKRC 3DPKA 3EN4A 4N0SA 2PHKA 4ZLYA 4ZTMA 5J1VA 3BEAA 3DNEA 4FYNA 1P4FA 3AT2A 3AC5A 4GIIA 3VVHA 2HZIA 2B53A 2FSMX 4S2ZA 1V0PA 4PTEA 3WZUA 3ERKA 3R2BA 4O0UA 3E63A 1P14A 4GCJA 4P4CA 2QONA 3VUTA 3ANRA 3PXKA 1UKIA 2PE2A 2RKUA 3LOKA 1GAGA 3FEGA 3QQFA 2XYNA 4GRBA 4HVHA 3ULIA 3FDNA 3NUXA 4OTHA 4QNAA 5LQFA 3A7HA 3O8UA 3PY1A 5AV2A 3CR0A 3PXFA 4O21A 4MVFA 3DAKA 1YHWA 4CV9A 5BUJA 3TJDA 5HBJA 4USEA 3WI6A 3W2OA 3OBJA 5EW3A 5A6NA 4M13A 3D2KA 3A7JA 4H58A 1KUTA 1P5EA 5AP6A 3ZO2A 4O7RA 3VQUA 1PXIA 2WMSA 4HGTA 3QTZA 4L01A 3SW4A 4JVGA 1OKYA 2XIXA 1CKPA 5IEVA 5ITAA 3TZ8A 5L6PA 4GKIA 3LQ5A 4FIIA 1E9HA 2YHVA 4PMTA 2PWLA 4BI2A 4MD8E 5JFVA 2PZPA 3R8LA 1U59A 2QD9A 3A7GA 2UV2A 4G6OA 2AYPA 5D41A 2FSTX 1UNGA 3VHKA 2UZVA 4G17A 4AGCA 4PPCA 4YTFA 3PIYA 3QFVA 3K5UA 3QBNA 2PVRA 3DDQA 5BMSA 4ZOGA 4D58A 2XVDA 2IVVA 4O38A 1FVRA 3NYOA 4RIYA 4ZZMA 3GU5A 4G2FA 5JKGA 1M14A 1YW2A 3PG3A 5FGKA 4YTIA 1B38A 3VS7A 2VN9A 5LVPA 4BZNA 3QTQA 4G5PA 3UBDA 4ALWA 3R1QA 4NZWB 4E26A 3AMBA 4ZAUA 3D4QA 4BC6A 3VJNA 1O9UA 3BGQA 3BWJA 2R3OA 1GZKA 3CGOA 1Q97A 1ZYCA 2FYSA 4MH7A 4EHVA 4FSUA 4F08A 5EYDA 1KE5A 1YDTE 1E1XA 1Q3WA 4QYEA 5CZIA 2XKCA 3TTJA 4YTCA 1LP4A 2OICA 4RLKA 3A2CA 5CVGA 5EHOA 3HX4A 4X3FC 5BVOA 3TDVA 3W0SA 3ZHPC 1WBWA 1PXPA 2FSLX 3P23A 4F7JA 3GVUA 4O7SA 4MK0A 4M8TA 4LV7A 3VBYA 3GEQA 2ZJWA 3PA5A 4YPDA 3S0OA 1H1RA 3V8WA 2BR1A 2YM3A 2XJ0A 3QZGA 3DKCA 5M57A 2X9FA 2Y4IB 5AUYA 3WZKA 3RM6A 3VS4A 1OKVA 1R1WA 4CD0A 4Z16A 1YRPA 2PVJA 3HV6A 1KWPA 5CAPA 3KMMA 1XMMA 2C0IA 2OW3A 2XKFA 3CTJA 4JIKA 4FL1A 4ITJA 3U9NA 3VULA 4B99A 4Y46A 5EM7A 5AIRA 1FVVA 3E3PA 5CSXA 1W7HA 4EYMA 4E6DA 4TY1A 4NSTA 3WF6A 4ZK5A 3TNWA 3ZSIA 5IMXA 3FYJX 4QMOA 5CEPA 3BKBA 2PMIA 4RWIA 2WOUA 4BIBA 4XLIA 2XBAA 3FMEA 1ZZ2A 5EDPA 3POZA 4O96A 1JSTA 3EQFA 3IOKA 4EI4A 5HE3A 3BIZA 3BCEA 2I0EA 1JOWB 1PMVA 5HLNA 5CNNA 5AP5A 4DDGA 2IEWA 2QR8A 4CMTA 3O0GA 4B8LA 3H9RA 4CQEA 5IUHA 3OFMA 4FX3A 3REPA 1SVEA 2QI8A 2JIUA 4IZAA 2AC5A 5HO8A 3RWQA 3GCQA 4IVAA 3T3UA 4DITA 1H25A 1RJBA 2JDTA 2GTNA 2XH5A 4XOZA 1BI7A 3Q96A 4MNEA 3V6RA 3WF8A 1ZOHA 2BFYA 4G3CA 1XBCA 2XK7A 2YJSA 3VIDA 3ATSA 4IB5A 2GHGA 4FTQA 3WIKA 1SM2A 4I92A 2RF9A 5AFVA 3QL8A 3B8QA 3ENHA 3R28A 4A9SA 3IDCA 3UODA 3DK3A 1ZMUA 3OCBA 4K1BA 4AT4A 2VTQA 3FV8A 4U45A 5ANKA 3VBTA 5HGIA 4IJPA 4AWIA 1ERKA 3PA4A 4HCTA 3W2RA 4KBCA 5HBHA 5AA8A 4EEVA 2CKQA 2F2CB 4G16A 4UEUA 1VR2A 1H26A 3I7BA 2ZDUA 4FZFB 2CMWA 3UYTA 4JX3A 4BI1A 4DCEA 1SMHA 4GK2A 4OR5A 3RBWA 3PG1A 4I1ZA 5IA4A 3AXWA 4ITIA 3PSDA 5EI6A 1H1QA 4G3EA 1G8JA 4O0WA 4H3PA 4QP6A 3U6HA 1ZMWA 3FUPA 3Q9ZA 2UW7A 3C51A 3MFRA 3R7UA 1M7QA 4ZSAA 5HZNA 1UU3A 3QTWA 3EQDA 4EJNA 3O96A 4YC6A 1A06A 2Q83A 3UP2A 2C6MA 3QRKA 4JJRA 4R6VA 3W18A 3KN5A 4X3JA 1JVPP 4TT7A 4Z3VA 4JRVA 3FMDA 3CIKA 3BHYA 4OBPA 4YLKA 5J5TA 4PDYA 4RC2A 4JAJA 2BAJA 3I60A 4OTFA 3ZM9A 4FODA 3LFDA 4AZFA 4KS8A 4DHFA 2IO6A 5KHWA 2R3RA 4AZSA 2QG5A 3FI4A 5JMSA 1MRUA 1H00A 2ZMCA 3BYMA 5FM2A 2YA9A 5D1JA 2C30A 1ZOEA 2GSFA 1WBSA 3O8TA 3EOCA 4KRCA 3G5DA 1V1KA 5E8WA 4LGGA 4HZRA 4AZTA 3PY3A 3C50A 3VBWA 1Q8YA 2W1EA 1B6CB 5HX8A 1ZXEA 4M68A 3IECA 3W8LA 5EYMA 2E9PA 3JVRA 4JOAA 1XH6A 2UVZA 2YABA 2R3IA 3E8CA 5DWRA 5E90A 4GYIA 3VBXA 3W1FA 3ZTXA 5EQYA 4IX4A 5IQHA 5E8XA 2H96A 3ZONA 3IW8A 5ANEA 4JG6A 4YR8A 2CSNA 4NKSA 4UV0A 3PPJA 3MIAA 2B4SB 4EWHA 3SV0A 3JPVA 4RFYA 5CWZA 2O2UA 4J71A 4QTBA 4TWOA 4TYIA 5CS6A 5IKWA 3R9HA 4C0TA 4AAAA 3TNQB 4FTRA 3PSBA 1DI9A 3AGMA 3C4WA 4KWPA 3OY3A 5J7HA 3I5ZA 4FIHA 2GPHA 3GFEA 4ZTRA 3E7VA 4FNWA 4K6ZA 4OTQA 5E92A 3VRYA 2GNIA 2R0UA 2QHNA 3C0GA 4G6NA 5AX9A 5EM6A 1G8SA 4ZY6A 4WRGA 5FXSA 3DCVA 4IB1A 5AEPA 3MPMA 1PXOA 2PK9A 4DLJA 3DXNA 3F7WA 2XIKA 5HVKA 2XK4A 2ZYBA 3C4XA 4MBLA 3LMGA 4O82A 2GNJA 2C0TA 1IASA 2ACXA 4WRSA 3PVUA 1XKKA 2ESMA 4Q9ZA 2B9JA 3QYZA 4UMRA 3DTCA 3RINA 1J3HA 1G8AA 5ANJA 3D2IA 3C0IA 5ETFA 4BICA 3TZMA 5IMEA 2W17A 4B9DA 3AD4A 4AZEA 3V5TA 2R3KA 4KS7A 4O91A 4XX9A 4DFUA 3UDBA 5M4UA 4QP9A 4HPTE 2OXYA 3F5GA 4C62A 5DFPA 3I79A 5L2SA 1BL7A 2EUFB 4RPVA 3SHEA 4A07A 5EOLA 3M42A 4FMQA 4DFNA 5HORA 2JC6A 3K2LA 1LUFA 3OXIA 4PPAA 5ACBC 2YLEA 5EDRA 4R5SA 4AX8A 3PYYA 5TE0A 3ZFXA 3VS1A 5EK7A 4A9YA 3DBEA 5HE0A 4EOSA 2BZHB 3Q52A 4ZMEA 3NW7A 2EB3A 5DRBA 3FXZA 2HW7A 1Z57A 2C1BA 4IC8A 4RVTA 4IHPA 5ANIA 4EK5A 3LXNA 4R1YA 5BVNA 3TDWA 3IDPA 2FH9A 2OJFE 4FSYA 1Z9XA 2WAJA 2WTCA 4QDVA 4BCNA 4KNBA 2C0OA 4DG3E 4G3DA 1W98A 1H28A 4RC4A 4JXFA 4NIFA 4IWOA 4RX8A 5DOSA 4CZUA 4AAYA 4RX7A 3W8QA 2IZTA 4HJOA 4S34A 5AP7A 2PZRA 4O86A 3B2WA 4C2VA 3ORZA 5J95A 4ERWA 4MNFA 3KB7A 3ZOSA 2VV9A 4L67A 3HP5A 3KRXA 3BYOA 3V5LA 3O7LD 4FNXA 4D28A 4MTAA 4FV2A 1IAJA 3BWFA 3D0EA 3AT4A 2IVSA 2QU5A 4KSQA 4UALA 3U4UA 5HVJA 3RJCA 2BAQA 4G3FA 3BELA 1YXXA 2EXEA 2J0KA 3BV2A 3HA6A 4O0VA 4FKRA 4XMOA 4H1MA 2GQRA 3QC9A 4I6HA 2FUMA 3MB7A 3DJ5A 5H