4I22A

Structure of the monomeric (v948r)gefitinib/erlotinib resistant double mutant (l858r+t790m) egfr kinase domain co-crystallized with gefitinib
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
315
structure length
297
Chain Sequence
NQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELRKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGRAKLLVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMRKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Insights into the Aberrant Activity of Mutant EGFR Kinase Domain and Drug Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 90
structure length 297
sequence length 315
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4i22A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4i22A01
3WZUA 4L44A 4IAZA 5D7AA 1A9UA 5FDXA 3TTJA 4CZUA 3PXRA 4XLVA 3GU4A 4KRDA 2W1CA 5JZNA 2ETMA 2JDTA 3GOKA 2KTYA 3G15A 1KWPA 2FVDA 2W05A 4YZDA 4X2KA 4JS8A 1H1SA 4L46A 2J6MA 2UW6A 4PPAA 3RM6A 5HNIX 3F2RA 2ETRA 3WF8A 5KNJA 5KZ0A 3OXTA 4QQ5A 2F4JA 1PXLA 4A9YA 5K3YA 4FEXA 2BR1A 3NVKI 3JYAA 2PL0A 1ZZLA 4F99A 1ZXEA 4ACCA 2DWBA 5HVJA 2OG8A 3VBQA 3KRRA 3ORIA 3OCBA 5C4KA 2OW3A 3QTQA 2IZSA 4IW0A 3QFVA 4E4NA 4RQKA 1XH5A 3PJCA 1SVGA 3DDQA 3L9PA 1BL7A 2XF0A 2Y4IB 3FMEA 3PY1A 5ANDA 2A4LA 4KBKA 5AP3A 5AA9A 5DR6A 2O3PA 4IXPA 5DGZA 2GS2A 2WQEA 5AX9A 4DFLA 3KQ7A 4LUEA 5D10A 3UOLA 2G2FA 4HGTA 3B2TA 2ZB1A 4IAYA 2QCSA 1ZARA 4AN2A 2JKQA 4LRKA 4GMYA 4IDVA 4ID7A 2YZLA 1A48A 4D4VA 3HLLA 5A4LA 1AGWA 2XNOA 2PPQA 5DT3A 3PY0A 3UQCA 2XKEA 3LCKA 3EZVA 5DYJA 3MH0A 4XBRA 4E3CA 2E9PA 4FSZA 4BI2A 4CFWA 4K0YA 4ZEGA 4NM7A 4PL4A 1IEPA 2VTJA 3A8XA 4QT1A 4LV8A 4S32A 4XCUA 5LJJA 3ZLYA 4X2NA 2OXDA 2J50A 4F6UA 1Q8UA 4MBIA 2JIUA 4YJOA 1APME 4DLIA 1W98A 1UA2A 3KRWA 3S95A 4JQ8A 2UZDA 2WTVA 4CV9A 4DTKA 5HU3A 4W9XA 4ZS0A 4RA4A 5CSWA 3IONA 4L8MA 4O81A 4FL3A 2CCHA 5AP7A 5K4JA 5IMEA 4L42A 3U9CA 3ZXZA 1JLUE 4ZY5A 1BX6A 4C3PA 3NPCA 2G2IA 4OTPA 3C5IA 3ODYX 2XZSA 4HVGA 3KREA 2QOQA 4FKLA 4NTSA 2UW7A 4JR7A 3WF9A 4BCKA 5J1WA 2F7XE 3KXMA 4FSTA 4LRMA 3U87A 4OBOA 4QTBA 2WTWA 3TG1A 4GJ2A 4EHVA 3BBTB 2J0JA 3V6SA 4D0WA 1NA7A 4B6LA 1OL1A 3ZC6A 3P23A 3EWHA 2XBJA 4FVPA 3F3ZA 4FKPA 1FOTA 2PZPA 4QP2A 4EHGA 4ZJVA 2OBJA 3AD4A 1HOWA 4RT7A 4HOKA 4UV0A 2RF9A 3VUTA 4BCHA 5CZHA 4NH1A 3NYNA 2O65A 3RNYA 2FO0A 3MFSA 4O7NA 3LCSA 3QQHA 3FLQA 4RC3A 4BCQA 1YKRA 3HMPA 4HVHA 4IVDA 3O17A 3DB8A 3R8MA 3Q52A 4LMUA 4AZFA 5L4QA 3I5ZA 3JPVA 4CCUA 4FTRA 3WZJA 3II5A 4I4FA 1WAKA 3W2SA 2RSVA 3KC3A 4Y85A 1WVWA 2WTCA 4MXXA 4QMMA 4ZS4A 5BMMA 3BU6A 3U6HA 4IWPA 5KX8A 4CXAA 5EQPA 1CKIA 3QA8A 5LWMA 3PRFA 2Z2WA 3BU5A 5IF1A 3M42A 3R01A 2AC5A 4BC6A 2ZB0A 3QL8A 4FKUA 1Q4LA 4PDPA 3FMJA 1ZAOA 4C34A 1DAWA 4KIKA 4I5HA 5CQUA 4EOLA 1VJYA 5AUYA 3P79A 3I1AA 5DG5A 2YCFA 4RJ3A 5AP1A 2IG7A 2PVNA 2V5QA 4R7HA 4RIYA 1FMOE 3NUSA 3KMWA 4F0IA 5K0KA 3ZLWA 3ANQA 2PZIA 3PSBA 5LVOA 4X2JA 5LVNA 4BWXA 4C4HA 3HV5A 4IE9A 3L9MA 2R3PA 4I93A 3OCSA 5M53A 3QHRA 4JLCA 3S2PA 3HEGA 2Z7RA 3A99A 3R9RA 3PDTA 4KIKB 5TE0A 4E7WA 5CTPA 4OTDA 4BF2A 2UVZA 2YDKA 4I0SA 4WO5A 5A6NA 4FV9A 3NS9A 3MJ1A 4NYEA 3AC5A 4E6CA 3IW8A 3NNVA 1MQ4A 3IOKA 4II5A 4UXLA 2WKMA 4RIYB 5H8GA 3UZPA 3VVHA 2X8EA 2BDJA 2C3IB 3R7UA 4GW8A 4E73A 2W06A 3DV3A 4AW2A 2B55A 3N51A 3FLZA 3GU7A 3HV4A 3JVSA 1J7LA 2VV9A 3GEQA 1PXOA 3DKFA 4GG7A 2CN8A 1H24A 4MBJA 4C58A 3GI3A 3HRBA 5CYIA 3ZS5A 4YJRA 3NUPA 4RPVA 4KB8A 4BRXA 4M3QA 4G9RA 4Z7HA 3EFLA 2BRGA 3WYYA 4D1ZA 4F63A 4XBUA 4C35A 1WBOA 3BV3A 5C4LA 3TV7A 2C6EA 3BE2A 4GVJA 4AFEA 3SOCA 4EWQA 1NVSA 4IVBA 4FBXA 2WNTA 4YSJA 3QAME 4LGHA 2B9IA 3KN5A 4Q9SA 1DAYA 1KOAA 3PP0A 4B99A 4O7ZA 3E3BX 5IQEA 3BEGA 1LR4A 2X9FA 2ITXA 3JVRA 3QKKA 5LCKA 4AUAA 4BBFA 3MYGA 4E5WA 5FTOA 2WO6A 2WMVA 5E8UA 4DHFA 2I0YA 4FK6A 3LE6A 3Q6UA 4L3PA 3OOMA 3EL8A 4AT4A 4BB4A 2BRBA 3FE3A 4BHNA 2GQRA 5I9YA 5CNOA 3V5QA 4P90A 2JIVA 4DH3A 4XG3A 2R3IA 3R28A 5AP6A 2ONLC 1H1RA 5KCVA 3QTXA 3F3VA 3VS4A 4EKKA 4HZRA 3FY0A 3TV6A 1ZYLA 3R9DA 4AOJA 2WTJA 5HG8A 2R3GA 3KXGA 2BZHB 3SA0A 5DRDA 4Z16A 4NIFA 4D5HA 4LMNA 4DEGA 4O82A 4S34A 5HE3A 5IMXA 3PZEA 5HKMA 2CHLA 4QMNA 3G9NA 4FK3A 1JKLA 1Q8ZA 3KFAA 5IUIA 4F4PA 1FVTA 1NXKA 3D7ZA 4JI9A 4QD6A 3QU0A 3PXFA 3H30A 4DITA 4N0SA 3H10A 3BGPA 4OR5A 2QC6A 3E8CA 2BZIB 3HV3A 3IDPA 5AV1A 1PXIA 1G8SA 3AT3A 4JL9A 3U6IA 2X7FA 3RGFA 3REPA 4K8AA 3S4QA 5CU2A 3BWFA 3PVBA 5KO1A 3V8SA 3ZFXA 4ORKA 3FZTA 5L2TA 3HUBA 3FMDA 4MD9E 4NIFB 1YDTE 2YM5A 2PWLA 5AUXA 4QMUA 3WF5A 3F3WA 4ERWA 4NEUA 2OJGA 4CG8A 3MTFA 4JBPA 5AP5A 2OO8X 2RG6A 3QTZA 4L9IA 3QQLA 3DGKA 5DT0A 5DVRA 5E1EA 4L3JA 4FEWA 3HECA 3R8LA 4Y83A 2VTOA 1XBCA 2PE0A 4BBMA 2HZ0A 4NJ3A 3QCXA 4DH5A 4MXOA 3FI4A 3EKNA 3IW5A 4UEUA 4IB5A 2YJRA 1L3RE 3LFCA 3QUDA 2ITUA 5FTQA 2YIYA 3L8PA 4BL1A 2PVFA 5B2MA 3OHTA 4NFMA 2W1FA 3PE2A 3NEWA 3H0ZA 3ORPA 4FIEA 4N57A 4FNZA 4QMTA 3QTIA 4OUCA 4AE9A 3FC1X 3ORZA 4ZY6A 2BROA 2WTDA 4O2ZA 3D4QA 4NCTC 5BQ0A 3MVLA 5IU2A 4MAOA 1M2QA 3ZONA 4EH5A 3HRCA 4FKVA 1OITA 4S30A 2PZRA 4O96A 4ZP5A 5H8EA 3C4EA 5CANA 4O1OA 4D58A 2ZV7A 2PVRA 3DXPA 3E5AA 1YHWA 5AR8A 3V6RA 2HWOA 3LQ5A 2Y4PA 2H34A 1H1QA 5CU6A 2IVVA 3SDJA 3PIYA 5D9HA 2R3OA 4C36A 4DGMA 4KD1A 2XNBA 3EN6A 2QNJA 4APCA 4QQJA 4YLKA 3TDWA 2ITNA 3ETAA 5GINE 3QKMA 4IM3A 4R1VA 1BI8A 4RX8A 4A9TA 3V3VA 3FMMA 4NT4A 1GZKA 2XCHA 2PMIA 4AACA 2WTKB 2OI4X 4XHKB 3EQIA 3MH1A 5CI7A 4EH6A 5IA1A 2AC3A 1PMNA 1S9JA 4X6QC 4F7SA 2IVSA 2BILB 3ZFMA 3OT8A 5DI1A 2RFDA 3CR0A 4MBLA 4Y46A 4CYJA 3H0YA 5FQDC 3VF8A 4AZWA 1TQIA 1VR2A 4FG9A 4FTCA 3Q5IA 4QP7A 1V0BA 5L6WL 3LJ1A 1MQBA 2X4FA 3ORLA 4K2RA 2BHHA 2BDWA 3LCOA 3L9LA 4UYAA 3Q4UA 3IQ7A 1KSWA 4JAIA 4ZMFA 5M09A 1Y8GA 2C3KA 3DQWA 3VUHA 4BDDA 5HNBA 4JAJA 5AR7A 2R3KA 2HY0A 2GS7A 2X7GA 4BKYA 3UZTA 5DIAA 1FPUA 2CGVA 3PIZA 2YACA 3OZ6A 5AWMA 4CZTA 4WNPA 3G33A 3AXWA 2JEDA 4XEYA 4F0FA 3N4TA 5A46A 5C8NA 3ATSA 1AD5A 2C0OA 3HX4A 4MHAA 2IJMA 5HTIA 1G8AA 4NW5A 1FGKA 5J9LA 5GZ8A 2XKFA 4YO4A 3SG8A 1J3HA 4J8MA 5AV3A 2VWIA 3G90X 1JAMA 1IRKA 4J52A 3HP2A 4D1XA 1ERKA 3F2NA 2GQSA 3RKBA 4F08A 3AC2A 5L2IA 1GIJA 5AM6A 4D9UA 2VX1A 3CQEA 4FUYA 4ITJA 2JC6A 4EI4A 3C0HA 4R3PA 4LRJA 2PUUA 2XK4A 3AMYA 3CY3A 3PIXA 5CF4A 3ACJA 1JSVA 3QQFA 4TYIA 4EK5A 3DK6A 5EFQA 3WE8A 4V0GA 4BCIA 4ZTMA 3D5VA 3CD8A 5CASA 3RWPA 1YXTA 4AZSA 4FEUA 3BYVA 1M2RA 2CKQA 4E6AA 1Q24A 5KMMA 4ZLZA 3UODA 3ELJA 5JT2A 4RWIA 1ZOEA 1ZYJA 2HELA 2JFLA 3OS3A 4PNIA 4TYJA 4ZOGA 5EOLA 4RIWA 4D2SA 3ZM9A 3IG7A 3UPZA 2HIWA 4B8LA 3U54A 3PY3A 5EM5A 3KKVA 3PXZA 2J7TA 3NMUF 1RE8A 2UZVA 5CXHA 1H25A 3K5UA 4FEQA 2PUNA 4AW0A 2OKRA 1YHVA 5ACKA 2GNLA 4FICA 4DLJA 3DBDA 5AUVA 1PJKA 3LPBA 4V0GB 1Q3WA 4YJUA 2Z7LA 1FVRA 3W2OA 2VGOA 5JQ8A 1B6CB 2HWPA 3FL4A 3QUEA 4HGLA 3EYHA 4IX6A 4RFMA 3W16A 4C2WA 2ITQA 4TNBA 2WFYA 5EW9A 4K18A 4F1OA 2OK1A 5CVFA 1OMWA 4HYUA 5HE0A 4UWCA 4OT6A 3ZXTA 3UMXA 5DMZA 4IANA 5CI6A 2EXCX 4EH2A 4O27B 3FKNA 4BICA 5E8XA 4RIWB 4X2FA 3A7HA 4NKSA 4JDKA 3R2YA 4GT4A 3NUUA 3D9VA 3QQUA 4IJPA 1YI3A 3OC1A 2QOOA 4ZLOA 4ASXA 2GPHA 3SXFA 2ERKA 2G1TA 4PDYA 2NRYA 3NLBA 3KCFA 3ZO4A 5HG9A 3N9XA 5CEKA 5DEWA 3BBWA 5DWRA 4ALWA 4BI1A 3DKCA 1IA9A 2QOCA 3FL5A 3I7BA 3I79A 1GIIA 3R00A 4EEVA 3PXKA 3MH3A 4JDHA 4C4JA 3MESA 4YU2A 5EK7A 5FBNC 1Y91A 2NP8A 4IVAA 4LQMA 4YTHA 3RMFA 4EQMA 4DTAA 4HNIA 3C4CA 4N4SA 3BELA 3LLAA 1TQPA 4FX3A 3THBA 4XV9A 4N6YA 2V0DA 4E26A 3RAIA 1GZ8A 2OJFE 2JKMA 3LVPA 4CMOA 4DT8A 2Z7QA 1UU9A 4L6QA 4YSMA 2QKWB 3TKUA 3OVVA 2V7AA 2YN8A 3BE9A 3WF6A 1LEWA 1OL2A 1OBDA 1A06A 2I0HA 3G6GA 4ZSEA 4P4CA 3IGOA 3QD3A 4D5KA 2C6KA 4PP9A 3F9NA 3CC6A 2X8DA 4GKHA 2ZM3A 3R02A 2PVJA 4WSYA 3FXZA 5KMNA 3GQLA 3UVPA 3TJCA 4ANNA 1W82A 5CEOA 1M52A 3TUDA 3T9TA 4ZIMA 4XV2A 5HBEA 3LFQA 3C0IA 5AIRA 5HIBA 4NSTA 2WHBA 4IQ6A 3A7FA 3FPQA 2W1HA 3NYXA 3PLSA 4J97A 4CNHA 5M55A 1JWHA 4FT5A 5EW3A 3B8RA 5T68A 4UMUA 4Z55A 4BR3A 3CE3A 1M7QA 2QD9A 1QPJA 2ZMDA 2UZUE 3IDBA 4YZNA 1XH6A 1OUKA 2H8HA 4E8AA 1BUHA 1OKYA 3LFNA 1WBWA 4MWIA 5DBXA 3TZ7A 1IASA 3ZTXA 5EHYA 3ZLXA 3G2FA 1YQJA 4H1JA 4QP9A 3R1YA 5CQWA 3IW4A 3D15A 5GJDA 3MB7A 3ORTA 3RHXA 4F65A 3UNZA 3JY0A 4I6BA 4AZTA 2X2KA 1STCE 5HG7A 3C9WA 3MSSA 4J95A 5KMOA 4JBOA 4F1TA 2QG5A 4ACGA 5HBHA 5J79A 2YWVA 4HZSA 4A06A 2B9FA 3BLHA 4YZBA 3LQ3A 4MF1A 3T3VA 2O0UA 3EQPA 5HI2A 2YIRA 3OUKA 4RZWA 5I9WA 3W2PA 5IQIA 4U6RA 4S2ZA 4WRSA 2QU6A 1QPEA 5IQGA 3KRLA 2GMXA 4IAIA 2UW5A 1LP4A 4QP6A 4IFCA 3I7CA 3QXOA 4FV3A 4KKHA 3W55A 5AUWA 5LMKC 3R8PA 5CWZA 4D2RA 4EORA 3OTUA 5HNGA 5L2QA 3TZ9A 4USFA 5ICPA 3EB0A 5HO6A 3GU5A 3OD6X 4F9AA 5M07A 2GHLA 3RBWA 1O6YA 5ANGA 2CGWA 2XYUA 1XBBA 4C57A 4C8BA 4DN5A 4NTTA 3LQ8A 2E9NA 3GCPA 4Y72A 2ZDTA 4I92A 3EKKA 5AUZA 3ATTA 5GZAA 4XRLA 4O7RA 5AUUA 3TN8A 3NIZA 1XJDA 3QCQA 2CLXA 3VS7A 4FKIA 3DAJA 2FUMA 2Y6MA 5CSHA 3RTPA 3PP1A 1I09A 3MIAA 4FTOA 5DHJA 2V55A 3H9OA 3IS5A 3G0FA 4FV0A 4O0XA 4W4WA 1URWA 4XX9A 3R0TA 2GQGA 2Z60A 4X3FC 3Q9YA 1YOLA 4I0RA 4L01A 2XB7A 1JQHA 4GFGA 4FTTA 5C01A 3HA6A 3OEZA 3OFMA 3B2WA 4FTQA 4WG5A 4MVFA 5BMSA 4QPMA 3E8NA 5M4CA 2BIKB 2YERA 4Y8DA 5HGIA 4DGNA 1U59A 2OFVA 3O8UA 5AIKA 4ENXA 1ZOHA 5I5ZA 4YR8A 2BRNA 4F9CA 1J7IA 4E1ZA 1KV2A 3EQBA 5EM6A 3PTGA 5CEMA 5KUPA 2DS1A 4EHEA 4J96A 4OT5A 2BMCA 4FTJA 4MWHA 4X6RA 5LWNA 5BYYA 1U4DA 3LFDA 4AZEA 3E64A 4MF0A 5CALA 4DTBA 3OW3A 3L8XA 3UO6A 3FZOA 2H9VA 4O21A 3V04A 3FQSA 3V5JA 4APPA 4EOJA 5IUHA 5JRSA 4CQGA 4LOPA 2RIOA 3R30A 5AAFA 5A6OA 4EWHA 5C26A 1YHSA 3OY1A 3L9NA 4KSPA 5DE2A 2WMTA 4BIDA 1GIHA 2W0JA 3V01A 2E9OA 4OTGA 2BAQA 4V04A 4O7TA 4L53A 3GC9A 4JIAA 3DDPA 5ANEA 4YJNA 2W9FB 2KULA 4G3FA 4PWNA 5I0BA 4PX6A 4USEA 3SW7A 5TF9A 4AGCA 4FA2A 4GEOA 4XG4A 4I6HA 2BALA 3FZRA 5ETAA 3CJFA 5A4EA 4QP1A 4MQ2A 3ORKA 2PY3A 3EL7A 4AT5A 2YIWA 1PRYA 4QMQA 3R1NA 5FP5A 3GFEA 3TUBA 2VU3A 3QQJA 4FV8A 2XJ1A 3MI9A 4CRSA 3I6UA 3RCJA 4HVSA 5BVNA 3QCYA 1KV1A 1BLXA 5FXQA 3NUAA 5KKRB 1WCCA 3A7GA 4PP7A 4YJSA 2WEIA 4TXCA 3TNHA 2VX3A 3DFAA 4P7EA 3GCSA 3MPAA 4AA0A 2C5YA 2R64A 4IX3A 5HG5A 4O0WA 4ERKA 3QKLA 3VS3A 5E9EA 3BZ3A 4WRGA 4Z7GA 4I24A 3HMOA 4RVLA 3QYZA 1MRUA 4DG0E 3PVGA 1GAGA 3NRMA 4FIJA 3SGCA 5L8KA 3FV8A 2QLUA 1FGIA 5AP4A 5DN3A 3RK7A 3JXWA 4EL9A 5JN2A 2PVHA 3CCNA 4USDA 4KBCA 3MFUA 3NAYA 3LKMA 3PRIA 3GCUA 3NDMA 4FZAB 3O50A 2J2IB 2ZOQA 2IZRA 1YDSE 3OBGA 4IX5A 5HX8A 1PHKA 2J5FA 4QP4A 4AP7A 3FYKX 4XJ0A 3R6XA 4QMWA 3E3PA 3T9IA 1Q41A 1Z57A 5FXSA 3Q9XA 3R7OA 3BYMA 5KHWA 4EYJA 4RC2A 3E7VA 4JOAA 5JFVA 3UIXA 3MV5A 4D55A 5HQ0A 4DCAA 3OBJA 3IECA 1J91A 5D41A 3MB6A 4EKLA 4O7SA 3JY9A 1WMKA 4FG8A 4O1PA 4HGEA 5AM7A 2XJ0A 4XG8A 3Q6WA 1R39A 3D5UA 3O8TA 4KS7A 4KS8A 4ALVA 4IM0A 3ZBXA 4FV5A 2C6DA 1F0QA 2X8IA 4IAKA 4C7TA 3LJ0A 5A54A 2WMQA 1OKZA 4WNMA 2XK6A 1YXXA 3EN4A 4TYEA 2IPXA 3D83A 2WIHA 3ODZX 3U55A 3EFKA 5E92A 4RJ7A 5A3XA 4IB1A 2Z8CA 3NUYA 4M15A 4YC8A 5EI2A 4D4RA 2ZM1A 2XIKA 4AF3A 4IWQA 1WFCA 5JEBA 3QUPA 4E6QA 1MUOA 4YNEA 2QOLA 4G3EA 5KMKA 3UTOA 2UUEA 4TT7A 3RCDA 3O2MA 5J95A 4ACMA 5AP2A 2W96B 4PL3A 3W10A 2VO6A 4FV1A 3EJ1A 3L8VA 3AT4A 1YOJA 4Y5QA 3ZZEA 1P4OA 4C3RA 4MXYA 4Y95A 2GNGA 2A19B 4FUXA 2JLDA 3UPXA 4AE6A 4FT3A 4JQ7A 2NNWB 5AR4A 3D2IA 2REIA 3U8WA 4GH2A 2YHVA 5HTBA 1YI4A 4TWCA 5KBQA 1UKHA 3KY2A 2XNGA 4G6NA 4L00A 4KUJA 2WELA 3RAWA 2NRUA 4M14A 4CTCA 5KMJA 3HZTA 4W8DA 4YHTA 4EK4A 5EM8A 3V5WA 5AEPA 4YTCA 4IFGA 3DOGA 2VNYA 3DQXA 4O0SA 4RGJA 4E4MA 2W1DA 3GP0A 3SQQA 4O86A 4DEEA 3MTLA 4EYMA 4CLIA 1H0WA 2AYPA 5LOHA 3HMMA 4DEAA 1REJA 3U6JA 2ZV8A 1SM2A 3EQGA 2BZJA 2WMRA 3HP5A 5J8IA 3KN6A 4HYIA 1PW2A 3WILA 1VYZA 2C0TA 3OY3A 1JKSA 3E88A 2G2HA 4NU1A 2QOFA 3L1SA 4BN1A 4EH7A 4CGAA 3BI6A 3E8DA 3NR9A 2HCKA 5IDPA 5E7RA 3GBZA 5EKNA 2R3QA 2PK9A 3QYWA 5E8SA 4FKQA 4YP8A 3PA4A 5A4QA 4CKIA 1JSTA 4FVRA 4XP3A 2YA9A 1XBAA 5CVGA 2VTIA 3JR1A 4JVGA 4BDEA 3VBVA 4IBMA 5CVHA 5LVPA 4DFUA 2F57A 3HV7A 3OUNB 3M1SA 3PVUA 4U3YA 4Z3VA 4KSQA 1KOBA 1PXJA 4UY9A 4BGQA 4IZ7A 3UOJA 1W0XC 3NYVA 3GC0A 3MH2A 5A4CA 2DUVA 3FUPA 4FNYA 2BHEA 1O9UA 3NX8A 4XV1A 4DEHA 3TJDA 2VO0A 2BPMA 4EHZA 5M44A 4C02A 2QVSE 4G34A 4CQEA 3P7BA 2ETKA 3GQIA 2R3LA 3CLYA 4FR4A 4OTFA 4XS2A 3TWJA 4EOSA 4FEVA 2R5TA 1OM1A 2XNNA 3DBCA 5G6VA 5IH6A 4KAOA 4U0IA 1GNGA 4PMPA 3UG1A 3NIEA 4E5AX 4FSMA 1JNKA 3MVJA 3RI1A 4U45A 5HCYA 4EOOA 5HLWA 2QQ7A 3Q32A 3CKWA 4D0XA 2BKZA 1JPAA 3W8QA 3KXZA 3VS2A 2W5BA 2X39A 4IHPA 2Q0BA 1CM8A 1UU3A 4RMZA 5AR3A 3F88A 2C5NA 5LMAA 4D4YA 4BBEA 3TKIA 4C4EA 4B4LA 4XP0A 3LCTA 4KINA 4IC7A 4FTIA 1I44A 2W1IA 1OIQA 4QYEA 3VS1A 4FIFA 3Q3BA 1H00A 4AGWA 2IO6A 3BQRA 2EB2A 4C4IA 1ZZ2A 2F7EE 4OAUC 3NW6A 1MRYA 2YABA 2CN5A 3TV4A 4AG8A 2YM7A 5LCJA 1UKIA 3WZDA 3QTSA 4R7BA 2QONA 5AR2A 5CEPA 4F7LA 4O7YA 2XCKA 5GJFA 5FEEA 4BDHA 4NZWB 5BUIA 1O6LA 4G3DA 3F5PA 3PXYA 4OW8A 3V51A 3RZBA 4RWKA 1R78A 3VS0A 5KZIA 1QPCA 5EDRA 2PU8A 4FSYA 3UVRA 3TZ8A 3MWUA 4CD0A 1H28A 3R2BA 4HNFA 1QMZA 3GGFA 3QGYA 3C0GA 4FZ7A 4PV0A 4F09A 4QO9A 1JSUA 5JSMA 1XQZA 3Q9ZA 2GTNA 1M2PA 3PWDA 5IA2A 4OLIA 3MY1A 3NZ0A 4WUAA 5M51A 2E9VA 1KUTA 3O8PA 3DZOA 4K11A 2QR7A 3PWYA 3QBNA 3K3JA 4KKEA 3Q04A 4AS0A 3LM5A 2A2AA 4H3BA 4MCVA 1TKIA 2IZTA 2Z7SA 3OWJA 4LV5A 4CFXA 3LFAA 3TUCA 4BCFA 1DS5A 2BCJA 1CMKE 4XUFA 3FDNA 3KMUA 3BHHA 4AW1A 2BUJA 2X4ZA 3EFWA 3IK3A 3EQCA 3KL8A 2HY81 3WZKA 4ZAUA 4RJ4A 1XH9A 3ORNA 4IJ9A 4RLKA 4U42A 5FP6A 2PULA 3DBEA 2HZNA 5M4UA 3ZSGA 1UU8A 2X0GA 4M8TA 2P2HA 2Y8OA 4YGAA 3V8TA 2H96A 2WPAA 3DJ5A 3MVHA 5HO7A 4O7VA 3RINA 2OFUA 5H9BA 3ANRA 3O23A 3TIZA 1PXMA 5BUEA 4DE4A 2V7OA 3UGCA 1LUFA 1E9HA 5J9ZA 2GHGA 4PMTA 4YMJA 5BNJA 5AP0A 2EXMA 1RJBA 4HCVA 4GRBA 5TR6A 2C3LA 2WMXA 4YC6A 4C37A 4YZ9A 2WD1A 3CEKA 2CNVA 3ZO3A 4FYOA 2XEYA 4BTMA 5HCXA 4JX3A 3RPRA 3AD5A 2C1BA 4GG5A 5GZ9A 3R22A 4YNOA 2R3RA 2FSTX 3ZRLA 3HVCA 4DYMA 4PDOA 1K3AA 2PE2A 2JDRA 3ITZA 2ONLA 2VTPA 2RL5A 3QRJA 4MD8E 4ANBA 2WGJA 5IQFA 4TYHA 4IZYA 2CJMA 3DFCB 3OWKA 3MJ2A 5CU4A 2XVDA 1H1PA 3F7WA 5HD4A 2X9EA 4Y5HA 3FKLA 4FYNA 5C27A 4UB7A 4NKAA 4PNKA 5FG8A 4WIHA 3GNIB 4ANQA 5M06A 5M08A 3DT1A 5JZJA 4YHJA 1OPKA 2IVUA 5G1XA 5IKWA 4PF4A 4LYNA 1JOWB 5E4HA 3P0MA 5IA5A 2HZIA 3I0QA 3FZPA 4YJQA 4YHFA 4TKSA 4BTJA 3RK9A 2BAKA 3OP5A 5ETFA 5CX9A 3EOCA 3GOPA 2B1PA 2FA2A 3CKXA 2H6DA 4TRLA 3E8EA 2A1AB 4NWMA 3MPTA 3FHRA 4XH6A 3T8OA 4TYHB 3W8LA 2W99B 2BRHA 4A9RA 3NNUA 4DBXA 1OB3A 4LI5A 2OIBA 4R1YA 2W1ZA 1Q61A 1P4FA 1X8BA 2WXVA 4AGDA 2OH4A 3DA6A 3KA0A 4RVMA 1R3CA 3LFEA 4O0YA 2XRUA 4AWIA 1WZYA 4FL1A 1MP8A 4BDKA 4FV6A 3EN7A 3WE4A 5FLFA 2Y7JA 5H2UA 4U40A 5GIOE 1YDRE 2B9JA 2XNMA 4HJOA 4FSNA 4CFMA 4IB0A 4TL0A 5L8LA 4CMTA 2YCSA 3OF0A 1IAJA 5EI8A 1V0OA 1ZYCA 4DAWA 2F49A 2YZAA 3A60A 4BFMA 2WQMA 1H01A 4BCMA 4O84A 4MNEA 4JNWA 2EB3A 2ITVA 4CSVA 5CSPA 3S00A 2UZOA 1UNHA 3QX4A 2CSNA 3DXQA 1YXSA 4QMVA 3DAKA 5H8BA 4LFIA 2QLQA 1ZOGA 2PVLA 2JBPA 1SVHA 1XH4A 2BTRA 2UZEA 4IDTA 2B9HA 2R7BA 1BMKA 3LM0A 2I7QA 3AT2A 3WIGA 5D12A 4YTFA 3DB6A 4PTGA 4NCTA 2UW9A 1YWNA 4C0TA 4RWLA 3K2LA 2CCIA 2QOKA 1M14A 1ZYDA 4FIIA 4OBQA 2P0CA 4XG7A 5EDPA 3UBDA 2CKEA 2WMBA 3I4BA 4BWPA 5HVKA 2Q0NA 4JIKA 4PUZA 5AV2A 3QZGA 4GIHA 5E8ZA 2J0MB 4DH8A 1ZMUA 5AJQA 4MNEB 5HZNA 2OH0E 4LOOA 3SX9A 3T3UA 3UYSA 2HK5A 4UMTA 5D11A 4HGSA 3R7EA 5BPYA 3GU8A 4IAFA 2UW4A 5B0XA 3CXWA 5KE0A 3DNDA 2XBAA 1NW1A 4CKRA 1YOMA 1ZWSA 5DLSA 4AX8A 4W4XA 4GUEA 2LAVA 1T46A 2PZ5A 4I5CA 3OTVA 3U9NA 3KK8A 1S9IA 4DGOA 3PA3A 2QR8A 4FGRA 3NNWA 2EWAA 4QYGA 5HOAA 3WBLA 1H26A 3CIKA 5GHVA 4E93A 2ZVAA 2YJSA 4MKCA 5C8MA 3GC8A 3RJCA 3UYTA 2YEXA 3EH9A 2WAJA 4E4XA 4RIOA 3QALE 2B53A 2IWIA 3BHVA 2CPKE 2WMAA 3ZOSA 5KBRA 5K0XA 5I9VA 3MA6A 2PVKA 4I23A 2I6LA 1Q62A 2J0LA 4M69A 4UXQA 1OBGA 5HCZA 5JGAA 3UP2A 2XK8A 3ZUUA 2CGXA 5HBJA 4G1WA 3R71A 3Q4TA 4ALUA 4F7NA 1OUYA 3R21A 1REKA 1UU7A 3D0EA 4L43A 3K54A 3R04A 2E9UA 3G6HA 4KA3A 3UP7A 4YUQA 4R77A 5CNNA 3RPYA 3C50A 3CTJA 4F9YA 5BX0A 3OXIA 2C6TA 2OU7A 3OOGA 3UOKA 5T3QA 2XKDA 4M67A 4MX9A 2GNFA 2C30A 3GFWA 3VUIA 4EH3A 3LFFA 2UZTA 2XH5A 2VX0A 3A61A 4QTAA 2G9XA 4BCGA 1RDQE 2DYLA 3LXLA 2NO3A 4N6ZA 5I3OA 4WA9A 4YLLA 4AGUA 5FTGA 3ZLSA 4C59A 4M69B 4LG4A 4D2WA 2UVYA 3KMMA 2G01A 4G3GA 2PUIA 1J1BA 4PPBA 4BCOA 4MXZA 3C4WA 2P3GX 5J7HA 4O0RA 2V22A 4M7IA 4QRCA 4QYYA 3TT0A 3ORXA 4ZZNA 1NY3A 2LGCA 4MYGA 1UNGA 2PMLX 2WQOA 4W8EA 2HW7A 3HL7A 3OCGA 5A9UA 2HXQA 3MY5A 2ITPA 3OW4A 1PMEA 3QRTA 2ESMA 4U43A 2QURA 3E87A 3BLQA 4IM2A 2GHMA 3NCGA 5H3QA 2JDVA 3AGMA 3QQKA 1PXNA 4DFBA 2C1AA 3VW8A 4AA4A 1GZOA 3EN9A 4D2TA 5F95A 4HW7A 4P5ZA 1NT2A 3DU8A 2C5VA 2J5EA 3HYHA 3VS5A 3QLFA 4XOYA 5CAUA 4KIOA 5K5NA 3OWLA 1YWRA 1B38A 4WBOA 2YM8A 4RRVA 4CFNA 2PE1A 4R6VA 1DI8A 2JD5A 4Q5HA 5CENA 5IH5A 3H3CA 4AU8A 3P08A 4BHZA 4GV1A 4OTRA 4WSQA 3NAXA 2WEVA 3BYUA 5IDNA 1UNLA 4EUTA 3UMWA 2ITWA 3R8ZA 4ASEA 4UMRA 3W2RA 5CEQA 1WBPA 5F20A 3VN9A 2GNJA 5F94A 3F2AA 3OCTA 3HAVA 5HTCA 2FSOX 3HMIA 2R0IA 3UO4A 5EQEA 4BDBA 5DEYA 1OL7A 3Q2MA 3BHUA 2I0EA 1OVEA 3NW7A 5BVEA 4EBVA 2CGUA 4FV4A 1Q8WA 1SMHA 2J51A 2O5KA 4L7SA 4IB3A 3QLGA 2QOHA 4WKQA 3ZM4A 3HNGA 4W4VA 2QG7A 3FWQA 3FMLA 2X2LA 4G17A 4R7IA 4CYIA 3VUDA 4FI1A 4I41A 3U51A 4A7CA 3ZHPC 4PY1A 4GVAA 4P2KA 2JKOA 2P55A 4TZRA 1M17A 3OWPA 4U5JA 5EH0A 3RZFA 5EI6A 2Y4IC 3D14A 4O2PA 4DEIA 5EDQA 3HDNA 1R0PA 2UW3A 1H08A 1OL5A 3QRKA 4XG6A 5GNKA 5IUGA 1LPUA 5EHOA 2R0UA 3TDVA 5ITAA 4PTCA 3AC1A 3PFQA 4DH7A 2BKKA 1KE5A 2YCQA 5IA0A 5IZFA 4DF3A 4GCJA 3R7YA 3SC1A 4AT3A 1ZMVA 5L8JA 2VO3A 5DRBA 5EKOA 3LFBA 1UV5A 3MBLA 4FTUA 1PKDA 5HO8A 3DK3A 3C4ZA 4NW6A 4UBAA 3GXLA 4OGRA 4HCTA 4AZVA 4U80A 1FVVA 2I1MA 4O0TA 3ZFYA 4BCPA 4FSQA 4EK8A 2PUPA 4FE2A 4GUBA 1KE6A 4B0GA 4MXCA 4IZ5A 2AUHA 2F2CB 2WOUA 3P4KA 3FHIA 3V5PA 3LXNA 4AOIA 4OBPA 4R78A 5F1ZA 3SHEA 4RWJA 2C69A 5EYKA 3UZRA 1QPDA 3R63A 1IAHA 5E8WA 3PUPA 2RFSA 2YAKA 4ZTLA 1O6KA 2WZJA 5EG3A 5FBOA 3TM0A 4QMPA 3RPSA 4EQUA 3S0OA 3CTQA 4BKZA 3AMAA 4D28A 3GCQA 3R9HA 4X2GA 2XEZA 4WHZA 4DCEA 1OECA 2HENA 2R9SA 4IWDA 3W18A 3BWJA 3U4UA 1QCFA 4F1MA 2J4ZA 2C5XA 5CXZA 3AC8A 5K4IA 3SVVA 2Z02A 3HAMA 5CSVA 5TO8A 1Q99A 3QWKA 3F7ZA 2PVYA 3AMBA 4IACA 2UW0A 4OTIA 4D1SA 4RX7A 3EMGA 4RSSA 3FLNC 2R4BA 2VTHA 5EYMA 4JQEA 5JFSA 5J87A 2FB8A 2OJJA 2FGIA 3O71A 4J8NA 3FLSA 4UZDA 4LM5A 5CAOA 2QO9A 2YFXA 3QHWA 4JDIA 4C4FA 3WOWA 4GYIA 4XNEA 5L6OA 5LXMA 3DBFA 4XYFA 3A4OX 2VTQA 3BCEA 4TW9A 3F5UA 2C6MA 4U41A 2QOIA 4YC3A 2VN9A 5M57A 2QHMA 5LMKA 1Y8YA 4V01A 3UG2A 4GFMA 2PVMA 1Y6AA 5CAPA 3Q4CA 1Q8TA 4K77A 4EJ7A 4ZZMA 3NCZA 3IDCA 4KNBA 4RLLA 2PZYA 3VQUA 4DG3E 3F3TA 5DFPA 1FQ1B 3VBYA 2ZJWA 1OL6A 4IC8A 1Y57A 3IPHA 3W32A 4QMXA 5JFWA 4ANLA 3ZZWA 4EC9A 1W83A 3E63A 3EYGA 4F70A 4FOCA 4G5JA 3ZMMA 2GS6A 1E1XA 5DOSA 1OZ1A 3BHTA 1YW2A 2R2PA 4J7BA 4BYIA 5J1VA 4BCNA 4CEGA 3G9LX 4KIPA 2JBOA 1EH4A 2B52A 2ERZE 3HA8A 5HVYA 4NM5A 4GL9A 4X3FA 5D1JA 4RFYA 3VHEA 4X7QA 5ANJA 4D2PA 5M4IA 3KVWA 3KXNA 2O64A 3DKOA 4L68A 4QPAA 3LMHA 2OZOA 4CTBA 4X0MA 4DH1A 5ANKA 3QZIA 2XNEA 4FG7A 3QCSA 1U5QA 4F6SA 3BLRA 5E90A 4QQCA 1UWJA 1ZY4A 4FTNA 2VAGA 2W9ZB 3WYXA 3QF9A 1XWSA 4L7FA 4UALA 4A9UA 4G2FA 2R3MA 4KIQA 3VWAA 4BDFA 2PSQA 1KE9A 3K3IA 5L6PA 3W1FA 3ZEPA 3RM7A 4QYFA 4ASZA 1GJOA 4FTAA 4RX5A 5AUTA 3C1XA 4ZMEA 4FT9A 1OIRA 1VZOA 2SRCA 3MW1A 4XG2A 3OMVA 3NWWA 2BTSA 3POZA 3RAKA 1CKJA 4A4XA 5BVFA 4MH7A 4X3FB 1ZRZA 2OGVA 5DNRA 2W7XA 3ZH8A 3TNQB 3FQEA 5CAVA 3COHA 4QYHA 4BDAA 3QTWA 1DI9A 2BFXA 4M0YA 2WQNA 1WBNA 4AN9A 5IEXA 2OJIA 4JG8A 5CZIA 3TEIA 3AC4A 3KULA 4PL5A 2HOGA 3ZSIA 2C5OA 3BQCA 3I5NA 1XKKA 4ZSAA 4WD5A 1OI9A 3ZCLA 3SG9A 2W1EA 3I60A 2FSMX 2I0VA 4OTHA 5HD7A 4UMQA 5IQAA 1K2PA 4YLJA 2OLCA 4HPUE 4FV2A 4DA5A 3VBTA 4FKOA 3EQFA 4A4LA 2VRXA 2OJ9A 2VO7A 5EHLA 2C0IA 3VQHA 5FEDA 3ZO2A 3CPBA 3RHKA 4CVAA 3AG9A 3EQDA 3TKHA 5CU0A 4FNWA 5JGBA 3TI1A 4DBNA 3SOAA 3TCPA 2XM8A 4ENYA 4RG0A 4JBVA 5K5XA 4BZNA 2VWBA 3A2CA 3QWJA 2VWYA 3G51A 2QHNA 3D7TA 4MD7E 5CSXA 4HYSA 3BGZA 3EQRA 1PXKA 3MFRA 4IX4A 3F82A 4K33A 3ZUTA 3DBQA 4BDIA 4QMZA 4LL5A 1QL6A 3KULB 3H9FA 1GY3A 2XIYA 3S3IA 3U4WA 1Q3DA 3ZBFA 2WOTA 4JXFA 4S33A 5ACBC 3SAYA 2I40A 4C61A 1NVQA 5AAGA 5EQYA 1ZLTA 3PPJA 4GKIA 4LL0A 2F2UA 4JRNA 1U54A 4RC4A 5C1QB 2WU7A 1WBTA 2CMWA 4GT3A 2YM4A 3KVXA 3L8SA 5ETCA 3R7IA 4YJTA 3C4FA 3RK5A 3CP9A 3Q2JA 2X6EA 1JBPE 4NUSA 4XRJA 3SLSA 3EZRA 1URCA 3COIA 2BZKB 1ATPE 3VHKA 3MA3A 3I81A 1OIUA 3D7TB 4I6QA 4CRLA 2P33A 1CDKA 4GK2A 3OROA 3LCDA 2GTMA 2NPQA 2YM6A 2QKRA 3TNWA 4RJ6A 3D5XA 1CTPE 5IG1A 3C51A 3OG7A 4Z9LA 4H05A 5M56A 3ET7A 3ENHA 4FTKA 1SNUA 3IOPA 4JG6A 4YURA 4C33A 4FGBA 4RJ5A 2X81A 1DM2A 4ZTRA 3DJ6A 3QQGA 1U54B 3UIUA 4GK4A 1VYWA 3DK7A 3NGAA 3FXWA 5ANOA 5JK3A 2FYSA 3ZDIA 3ZSHA 1FBNA 2YWPA 4RQVA 4BY9E 4CKJA 3GU6A 3VC4A 2V62A 2IVTA 3RPOA 3VJOA 3MDYA 4ARKA 5IPJA 3AC3A 2Y0AA 3QXPA 2UW8A 4ZJIA 3COMA 2G15A 2WIPA 4N70A 3VJNA 1KE8A 3WF7A 3RVGA 2VWUA 3C7QA 4EC8A 4NFNA 3KB7A 2XIXA 5DR2A 3E62A 4ZTSA 4M66A 5CY3A 3FI3A 4FV7A 3ZRKA 2YDJA 5DPVA 3DLSA 4GK3A 4GU9A 1XH8A 4ZTNA 4I21A 5C03A 2CKPA 2W5HA 2VGPA 1Y6BA 4FT0A 2VZ6A 4AW5A 3CJGA 2C4GA 3FAAA 1L8TA 4PPCA 3FMKA 4JX7A 5F4NA 2W4OA 4I4EA 4B8MA 3SRVA 3ULIA 4IADA 1TVOA 3KF4A 4QMOA 3KCKA 3NYOA 3ALNA 5LVLA 4O7WA 3TNPC 2J0KA 3R73A 4J53A 4EQCA 5BVDA 4I5MA 2IW8A 2Y6OA 3VUKA 3D94A 4EOMA 5E8TA 4BWKA 4F6WA 4BVUA 3IW7A 1E1VA 1SNXA 2QODA 4KRCA 3RWQA 4EUUA 3CSVA 4ZSGA 4YPDA 3NUXA 3R1SA 1CKPA 2C68A 4A9SA 5HIEA 3F66A 3UO5A 4M13A 4XMOA 5A14A 4DFYA 2WU6A 2YISA 2RGPA 4U8ZA 5HHWA 4DFXE 4QQTA 5FUTA 1OGUA 3KU2A 4I22A 3VUGA 5A4TA 3DY7A 4TWOA 2VTMA 1UWHA 3PJ8A 5IEVA 3SRVB 2BVAA 5CAQA 5EOBA 3EN5A 5LMBA 2C6OA 3BHYA 3HRFA 1XH7A 4UZHA 4FIGA 4R3CA 5CU3A 4EZ5A 4IH8A 3PZHA 5CEIA 2BRMA 3D5WA 4A4OA 2FH9A 4RVTA 4TY1A 4PDSA 5JQ5A 2CNQA 3GB2A 4ZSLA 3QGWA 4U81A 3R9OA 3ROCA 3WI6A 2WTKC 4ZTQA 1P14A 3F61A 4G16A 3MY0A 3LMIA 3E93A 4QP3A 3CGFA 3O51A 4CLJA 3N4VA 3I0OA 3LMGA 4DC2A 3KRXA 2X7OA 2R3NA 3FKOA 4PTEA 4QTDA 2YLEA 4S31A 1P2AA 3PG1A 4FKSA 4EZ3A 4I94A 3A7IA 4C4GA 2BIYA 4CCBA 3DLZA 1H07A 5GJGA 2QO7A 3CPCA 4C3FA 1RW8A 5FEQA 4GU6A 4AQCA 3VUMA 3F5GA 1OIYA 3Q96A 4TNDA 3UJGA 2E2BA 4X21A 4EOQA 3FI8A 2DQ7X 3KEXA 3CBLA 5EYCA 5EW8A 3CQUA 3NW5A 4O91A 3SV0A 3A4PA 3G0EA 3DNEA 3V5LA 1B39A 4TN6A 2XJ2A 5BVKA 4QTEA 4C2VA 2R3FA 1OPLA 2W5AA 2ZM4A 4OTQA 4BIEA 1PKGA 3PE1A 4ASDA 5BYLA 3GUBA 1OKWA 5CF8A 2XRWA 5AA8A 4O6LA 3DAEA 1SZMA 4UX9A 2XKCA 5JKGA 4EOIA 3ULZA 4BDGA 5I4NA 3S1HA 3W33A 2VTAA 1G5SA 3LIJA 4WT6A 2OXXA 4I20A 5FRIA 3QD0A 1XHAA 5D7VA 2HYYA 3VIDA 3QA0A 1ZYSA 5AV0A 2ZMCA 3M11A 4JR3A 1BL6A 4ZLYA 3FLWA 2O63A 3Q60A 4O7LA 3UIMA 3DXNA 4WBBB 1BYGA 2C6IA 3AQVA 2CLQA 4FSRA 3VULA 4UMPA 4XOZA 2YIXA 3V5TA 3LJ2A 4GIIA 4JT3A 3UE4A 5CF6A 4BIBA 3UDBA 1NVRA 1YXUA 2X2MA 3A8WA 3LW0A 3QTUA 5HE1A 4FMQA 2YAAA 4KKGA 3VO3A 3HDMA 5AMNA 3F5XA 1H4LA 4G6OA 1ZMWA 4O0UA 4E5BA 5B7VA 4NL0A 1T45A 4IEBA 3P86A 5ANIA 4K6ZA 4NM0A 3UC4A 4EH4A 3UNKA 2JDSA 2PMNX 4RA5A 1ND4A 2F7ZE 2IN6A 5LVMA 3ZO1A 4F9WA 3FYJX 1Z5MA 2PMOX 4RBLA 5J5TA 1SYKA 4J71A 4BYJA 4FKWA 4YO6A 1V0PA 4UWYA 5JMSA 1J1CA 2VWWA 4IZAA 2OZAA 3KXHA 3ZYAA 4R3RA 5B2KA 5EM7A 4RIXA 4E4LA 4FC0A 2GSFA 2UZNA 3O0GA 5KMLA 4WG4A 1U5RA 4GYGA 1GOLA 4DEDA 4EJNA 2VD5A 3LXPA 2CDZA 2R7IA 5DA3A 3V8WA 5HIDA 4B7TA 4ZTHA 5BVOA 2EXEA 2VUWA 2OXYA 1ZY5A 4P5QA 1OKVA 5I9ZA 4YZMA 4F64A 1H0VA 4AXAA 4BCJA 2W17A 1CSNA 2XM9A 4X3JA 4RJ8A 2GNIA 2UVXA 3VRYA 2YITA 1R0EA 2XNPA 4EK3A 2ITOA 2GU8A 1XR1A 3E92A 4PMMA 2CKOA 2C47A 3MN3A 4FT7A 2WMWA 2YM3A 3FZ1A 3ZEWA 4AAAA 4HYHA 4F9BA 4D4SA 4XG9A 3WZEA 3PPKA 5HLNA 3HMNA 5DH3A 4WUNA 5CT7A 1IG1A 2OZAB 3NNXA 1PYXA 2JKKA 2VTNA 4RIXB 2XS0A 1PF8A 3P9JA 4TPTA 1IA8A 3B8QA 4FZFB 3VF9A 3IO7A 4YZCA 3KRJA 2VNWA 1HCKA 3CY2A 4CMUA 3DS6A 2WQBA 2P4IA 3Q4ZA 2JIIA 4YPSA 4WG3A 4MQ1A 3PXQA 2OF4A 3P1AA 4ZJJA 4FL2A 4GT5A 2XYNA 4EH9A 2JAVA 1HCLA 2XMYA 4V05A 4KABA 2JAMA 3CQWA 1WBSA 4XLIA 3EHAA 4OTWA 2XA4A 5C8KA 4BTFA 2ZV2A 2GDOA 1F3MC 4ANSA 4NM3A 4FOBA 4AOTA 3MGYA 2J0IA 2C6LA 5I3RA 2BDFA 1GZNA 3MIYA 4HCUA 3RPVA 2WTIA 4D2VA 4Q9ZA 3O7LD 1FINA 3DPKA 4TYGA 4FIHA 4H36A 4U79A 4IVCA 3FC2A 2YLFA 3FSKA 4DINA 3ZRMA 3F6XA 3POOA 4QMSA 4FKTA 3GVUA 2JDOA 4BGGA 4K9YA 3O96A 3R8VA 3UQGA 2A0CX 5JH6A 4XV3A 5HESA 2YDIA 3QC4A 2EVAA 5E91A 2FSLX 4QMLA 4LOQA 3C13A 4GFOA 4I1ZA 5FDPA 3FZSA 4L3LA 4IAAA 3CTHA 2WB8A 2IW9A 3RP9A 4EOPA 4HVDA 3EQHA 1OPJA 4RZVA 5B2LA 2B54A 4EONA 2ITYA 3AD6A 4PRJA 3FMNA 3JS2A 3TL8A 3LXKA 5E8VA 4F7JA 3LLTA 3PJ1A 4FVQA 5EYDA 4GJ3A 4JDJA 4TWPA 5HICA 4JBQA 5IH4A 5AV4A 3N4UA 2J9MA 3QC9A 4ITHA 3DJ7A 4MXAA 3VS6A 2RFEA 4YBJA 4G5PA 1WBVA 3R7GA 4XP2A 3O7LB 3COKA 3FSFA 1U46A 2O8YA 4IMYA 4RX9A 3HKOA 4DFNA 4BZOA 4DFZE 4M68A 3VRZA 4QPSA 3R83A 4U7ZA 2XUUA 3PYYA 5BYZA 3R1QA 4YTIA 5M4FA 3LAUA 3HUCA 3QRUA 5HORA 3BV2A 5T6KA 4C62A 3TZMA 2ACXA 1F5QA 2EUFB 2QO2A 3SXSA 3ZC5A 2GFCA 4AN3A 3FI2A 1BI7A 3KXXA 4W4YA 4E20A 2VTSA 3FMHA 4UN0C 4FKJA 4QNAA 2J90A 4I3ZA 1PXPA 3ROYA 3SW4A 4ZXTA 4ACHA 4BGHA 4B9DA 4GS6A 3ZUVA 2IW6A 4M84A 4RFZA 4TWNA 5TT7A 3DCVA 5JRQA 5HU9A 4M97A 1Q97A 4NK9A 2WMUA 2ITTA 2B0QA 3LHJA 5AADA 4R5YA 4DGLC 2XK3A 4BDJA 2P2IA 2ZV9A 2RG5A 1W8CA 4EH8A 2UZWE 4MNFA 4J1RA 3UIBA 2UV2A 4WOVA 2VWZA 3SKCA 3I6WA 3PSCA 1KE7A 4PQNA 3MFTA 5DR9A 3A7JA 4TTHB 2OWBA 3GT8A 4CZYB 3TTIA 3NVMB 4HPTE 3W2QA 4NJDA 4F0GA 2X1NA 4D9TA 3DZQA 4LGDA 1BKXA 5AR5A 3Q5ZA 2HAKA 3NSZA 4C38A 4Q2AA 4BTKA 3BEAA 4FNXA 4LGGA 3FY2A 1YRPA 5C9CA 5IEYA 2IZUA 3HV6A 2JFMA 4EZ7A 2OICA 1H1WA 2O2UA 3RALA 4ANMA 4FF8A 2Q83A 3W2CA 4CFFA 3ZU7A 3FQHA 3MVMA 4MEDA 3ID6C 3BGQA 1AQ1A 2GFSA 1SVEA 2XIRA 5ETIA 3ZDUA 4BDCA 4L45A 1PY5A 2YIQA 3OXZA 4QP8A 3VBXA 5BVWA 4ZY4A 2YCRA 1PMUA 2VTRA 2B4SB 3EFJA 5L2SA 5AX3A 4AA5A 5KMIA 3FEGA 2RFNA 3FLYA 1H8FA 4H3QA 4ZK5A 5LARA 3Q9WA 4JG7A 1WVYA 2ZDUA 5JFXA 2BFYA 2VTTA 2XK7A 3BKBA 4FTMA 1G3NA 1W7HA 5E8YA 3SD0A 4MK0A 4O38A 2ZYBA 2RKUA 5E1SA 4FODA 4ITIA 3UQFA 4O83A 2R3JA 2HXLA 3BIZA 3TXOA 3DKGA 3FXXA 1R1WA 4G31A 1Q5KA 3IGGA 3VW6A 3K5VA 2GNHA 5AAEA 3KF7A 1XO2B 4U97A 5CT0A 3H9RA 3MS9A 1W84A 3UC3A 3UVQA 4EOKA 3ERKA 2OIDA 1RQQA 3BRBA 2OSCA 5CS6A 4LUDA 5HLPA 4ZZOA 2A27A 3AOXA 3WARA 3QTRA 4PMSA 3CS9A 3LOKA 4O6EA 4ZSJA 1V1KA 3QZFA 3GC7A 3P78A 3NUNA 4MTAA 1JKTA 4YJPA 3OT3A 5I9UA 5TKDA 4E6DA 4KBAA 4R5SA 5J7BA 4QOXA 5IISA 2F9GA 5FM3A 1JVPP 1LEZA 2VWVA 3BX5A 3AGLA 3C4XA 3CD3A 3H4JA 4IIRA 3FPMA 4QMYA 4UYNA 3RNIA 4BKJA 3FJQE 3P7AA 4DG2E 3VBWA 2PHKA 3ACKA 3ORMA 3QD4A 4L67A 4RVKA 1Q8YA 2R3HA 5L2WA 1Z9XA 3EIDA 4FSUA 4QNYA 3F3UA 4GSBA 3UNJA 2W4JA 5KKRC 3DTWA 4G3CA 3R8UA 3R9NA 2ITZA 4J98A 3TIYA 3VAPA 4QTCA 3BPRA 1IR3A 4U44A 3OEFX 2ZAZA 2XK9A 2HZ4A 3Q53A 4EK6A 2QOBA 4YJVA 2QI8A 2JGZA 5BUJA 3GENA 4CT2A 4ANOA 2HW6A 4CG9A 3LZBA 4H1MA 2B7AA 4IWOA 2C3JA 4K1BA 4CFUA 5KHXA 1YVJA 3BYOA 3IKAA 4FZDB 5AFVA 5IQBA 3QD2B 5JGDA 4FTLA 2EU9A 3PG3A 4I6FA 4U9AA 4FZ6A 3M2WA 3QZHA 3SXRA 2Y9QA 4BZDA 5IA3A 2X6DA 2QU5A 4CV8A 4UWBA 4FSWA 1J7UA 5FM2A 5K9IA 3CGOA 2WMSA 5I9XA 4DGGA 5FWKK 5IQHA 3KK9A 2OF2A 3VNTA 3A62A 1H27A 4H58A 4R8QA 4OAVB 3P5KA 2JITA 5LQFA 1M7NA 1WVXA 3HGKA 2W1GA 3G5DA 3TACA 4J99A 3BYSA 4HVIA 3RAHA 5TOZA 3GCVA 4CT1A 3PJ3A 3QRIA 4DEBA 2VWXA 3BU3A 5L3AA 4AFJA 1P5EA 2UZBA 3C5UA 3F69A 1PYEA 1YI6A 3PA5A 4G9CA 5FGKA 3WIKA 5FXRA 3TNIA 3KGAA 4ACDA 4H39A 4Q5EA 4WNKA 5CLPA 2PYWA 5HX6A 1PMVA 4G6LA 3D2KA 1K9AA 2BAJA 3MPMA 5J9YA 4O22A 3ENMA 4A07A 2VTLA 1JKKA 4I0TA 5DT4A 1VEBA 4L52A 4U3ZA 4EBWA 4ONAA 1MRVA 5FD2A 2XIZA 5IQCA 2UZLA 4O0VA 4I5PA 5J5SA 2GCDA 3PPZA 1YWVA 2PTKA 5CF5A 1UVRA 4JRVA 2OIQA 5F9EA 4FKGA 3E7OA 5IA4A 4WNOA 3IW6A 4Y73A 4CFVA 4M12A 5GIPE 4FKRA 1FMKA 4H3PA 4YBKA 1YXVA 3PJ2A 2CNUA 3QX2A 4BI0A 5HE2A 3R7VA 2XP2A 2W4KA 4W9WA 1TQMA 3PSDA 3P7CA 4KWPA 5IQDA 3ALOA 3LFSA 3DTCA 4DT9A 3PLAE 4JJRA 3FBVA 3UOHA 3JUHA 3PVWA 4M0ZA 5HEZA
chains in the Genus database with same CATH superfamily
3WZUA 4L44A 4IAZA 5D7AA 1A9UA 5FDXA 4AAYA 3TTJA 4CZUA 3PXRA 4XLVA 3GU4A 4KRDA 2W1CA 5JZNA 2AQXA 2ETMA 2JDTA 3GOKA 2KTYA 3G15A 1KWPA 2FVDA 2W05A 4YZDA 4X2KA 4JS8A 1H1SA 4L46A 2J6MA 2UW6A 4PPAA 3RM6A 5HNIX 3F2RA 2ETRA 3WF8A 5KNJA 5KZ0A 3OXTA 4QQ5A 2F4JA 1PXLA 4A9YA 5K3YA 4FEXA 2BR1A 3NVKI 3JYAA 2PL0A 1ZZLA 4F99A 1ZXEA 4ACCA 2DWBA 5HVJA 2OG8A 3VBQA 3KRRA 3ORIA 3OCBA 5C4KA 2OW3A 3QTQA 2IZSA 4IW0A 3QFVA 4E4NA 4RQKA 1XH5A 3PJCA 1SVGA 3DDQA 3L9PA 1BL7A 2XF0A 2Y4IB 3FMEA 3PY1A 5ANDA 2A4LA 4KBKA 5AP3A 5AA9A 5DR6A 2IF8A 2O3PA 4IXPA 5DGZA 2GS2A 2WQEA 5AX9A 4DFLA 3KQ7A 4LUEA 5D10A 3UOLA 2G2FA 4HGTA 3B2TA 2ZB1A 4IAYA 2QCSA 1ZARA 1ST0A 4AN2A 2JKQA 4LRKA 4GMYA 4IDVA 4ID7A 2YZLA 1A48A 4D4VA 3HLLA 5A4LA 1AGWA 2XNOA 2PPQA 5DT3A 3PY0A 3UQCA 2XKEA 3LCKA 3EZVA 5DYJA 3MH0A 4XBRA 4E3CA 2E9PA 4FSZA 4BI2A 4CFWA 4K0YA 4ZEGA 4NM7A 4PL4A 1IEPA 2VTJA 3A8XA 4QT1A 4LV8A 4S32A 4XCUA 5LJJA 3ZLYA 4X2NA 2OXDA 2J50A 4F6UA 1Q8UA 4MBIA 2JIUA 4YJOA 1APME 4DLIA 1W98A 1UA2A 3KRWA 3S95A 4JQ8A 2UZDA 2WTVA 4CV9A 4DTKA 5HU3A 4W9XA 4ZS0A 4RA4A 5CSWA 3IONA 4L8MA 4O81A 4FL3A 2CCHA 5AP7A 5K4JA 5IMEA 4L42A 3U9CA 3ZXZA 1JLUE 4ZY5A 1BX6A 4C3PA 3NPCA 2G2IA 4OTPA 3C5IA 3ODYX 2XZSA 4HVGA 3KREA 2QOQA 4FKLA 4NTSA 2UW7A 4JR7A 3WF9A 4BCKA 5J1WA 2F7XE 3KXMA 4FSTA 4LRMA 3U87A 4OBOA 4QTBA 2WTWA 3TG1A 4GJ2A 4EHVA 3BBTB 2J0JA 3V6SA 4D0WA 1NA7A 4B6LA 1OL1A 3ZC6A 3P23A 3EWHA 2XBJA 4FVPA 3F3ZA 4FKPA 1FOTA 2PZPA 4QP2A 4EHGA 4ZJVA 2OBJA 3AD4A 1HOWA 4RT7A 4HOKA 4UV0A 2RF9A 3VUTA 4BCHA 5CZHA 4NH1A 3NYNA 2O65A 3RNYA 2FO0A 3MFSA 4O7NA 3LCSA 3QQHA 3FLQA 4RC3A 4BCQA 1YKRA 3HMPA 4HVHA 4IVDA 3O17A 3DB8A 3R8MA 3Q52A 4LMUA 4AZFA 5L4QA 3I5ZA 4O4BB 3JPVA 4CCUA 4FTRA 3WZJA 3II5A 4I4FA 1WAKA 3W2SA 2XAMA 2RSVA 3KC3A 4Y85A 1WVWA 2WTCA 4MXXA 4QMMA 4ZS4A 5BMMA 3BU6A 3U6HA 4IWPA 5KX8A 4CXAA 5EQPA 1CKIA 3QA8A 5LWMA 3PRFA 2Z2WA 3BU5A 5IF1A 3M42A 3R01A 2AC5A 4BC6A 2ZB0A 3QL8A 4FKUA 1Q4LA 4PDPA 3FMJA 1ZAOA 4C34A 1DAWA 4KIKA 4I5HA 5CQUA 4EOLA 1VJYA 5AUYA 3P79A 3I1AA 5DG5A 2YCFA 4RJ3A 5AP1A 2IG7A 2PVNA 2V5QA 4R7HA 4RIYA 1FMOE 4QEBA 3NUSA 3KMWA 4F0IA 5K0KA 3ZLWA 3ANQA 2PZIA 3PSBA 5LVOA 4X2JA 5LVNA 4BWXA 4C4HA 3HV5A 4IE9A 3L9MA 2R3PA 4I93A 3OCSA 5M53A 3QHRA 4JLCA 3S2PA 3HEGA 2Z7RA 3A99A 3R9RA 3PDTA 4KIKB 5TE0A 4E7WA 5CTPA 4OTDA 4BF2A 2UVZA 2YDKA 4I0SA 4WO5A 5A6NA 4FV9A 3NS9A 3MJ1A 4NYEA 3AC5A 4E6CA 3IW8A 3NNVA 1MQ4A 3IOKA 4II5A 4UXLA 2WKMA 4RIYB 5H8GA 3UZPA 3VVHA 2X8EA 2BDJA 2C3IB 3R7UA 4GW8A 4E73A 2W06A 3DV3A 4AW2A 2B55A 3N51A 3FLZA 3GU7A 3HV4A 3JVSA 1J7LA 2VV9A 3GEQA 1PXOA 3DKFA 4GG7A 2CN8A 1H24A 4MBJA 4C58A 3GI3A 3HRBA 5CYIA 3ZS5A 4YJRA 3NUPA 4RPVA 4KB8A 2XALA 4BRXA 4M3QA 4G9RA 4Z7HA 3BLAA 3EFLA 2BRGA 3WYYA 4D1ZA 4F63A 4XBUA 4C35A 1WBOA 3BV3A 5C4LA 3TV7A 4DDGA 2C6EA 3BE2A 4GVJA 4AFEA 3SOCA 3BL7A 4EWQA 1NVSA 4IVBA 4FBXA 2WNTA 4YSJA 3QAME 4LGHA 2B9IA 3KN5A 4Q9SA 1DAYA 1KOAA 3PP0A 4B99A 4O7ZA 3E3BX 5IQEA 3BEGA 1LR4A 2X9FA 2ITXA 3JVRA 3QKKA 5LCKA 4AUAA 4BBFA 3MYGA 4E5WA 5FTOA 2WO6A 4DDIA 2WMVA 5E8UA 4DHFA 2I0YA 4FK6A 3LE6A 3Q6UA 4L3PA 3OOMA 3EL8A 4AT4A 4BB4A 4FJVA 2BRBA 3FE3A 4BHNA 2GQRA 5I9YA 5CNOA 3V5QA 4P90A 2JIVA 4DH3A 4XG3A 2R3IA 3R28A 5AP6A 2ONLC 1H1RA 5KCVA 3QTXA 4MUQA 3F3VA 3VS4A 4EKKA 4HZRA 3FY0A 3TV6A 1ZYLA 3R9DA 4AOJA 2WTJA 5HG8A 2R3GA 3KXGA 2BZHB 3SA0A 5DRDA 4Z16A 4NIFA 4D5HA 4LMNA 4DEGA 4O82A 4S34A 5HE3A 5IMXA 3PZEA 5HKMA 2CHLA 4QMNA 3G9NA 4FK3A 1JKLA 1Q8ZA 3KFAA 4O4FA 5IUIA 4F4PA 1FVTA 1NXKA 3D7ZA 4JI9A 4QD6A 3QU0A 3PXFA 3H30A 4DITA 4N0SA 3H10A 3BGPA 4OR5A 2QC6A 3E8CA 3O5AA 2BZIB 3HV3A 3IDPA 5AV1A 1PXIA 1G8SA 3AT3A 4JL9A 3U6IA 4DHIB 2X7FA 3RGFA 3REPA 4K8AA 3S4QA 5CU2A 3BWFA 3PVBA 5KO1A 3V8SA 3ZFXA 4ORKA 3FZTA 5L2TA 3HUBA 3FMDA 4MD9E 4NIFB 1YDTE 2YM5A 2PWLA 5AUXA 4QMUA 3WF5A 3F3WA 3NFGB 4ERWA 4NEUA 2OJGA 4CG8A 3MTFA 4JBPA 5AP5A 2OO8X 2RG6A 3QTZA 4L9IA 3QQLA 3DGKA 5DT0A 5DVRA 5E1EA 4L3JA 4FEWA 3HECA 3R8LA 4Y83A 2VTOA 1XBCA 2PE0A 4BBMA 2HZ0A 4NJ3A 3QCXA 4DH5A 4MXOA 3FI4A 3EKNA 3IW5A 4UEUA 4IB5A 2YJRA 1L3RE 3LFCA 3QUDA 2ITUA 5FTQA 2YIYA 3L8PA 4BL1A 2PVFA 5B2MA 3OHTA 4NFMA 2W1FA 3PE2A 3NEWA 3H0ZA 3ORPA 4FIEA 3PUFC 4N57A 4FNZA 4QMTA 3QTIA 4OUCA 4AE9A 3FC1X 3ORZA 4ZY6A 2X0OA 2BROA 2WTDA 4O2ZA 3D4QA 4NCTC 5BQ0A 3MVLA 5IU2A 4MAOA 1M2QA 3ZONA 4EH5A 3HRCA 4FKVA 1OITA 4S30A 2PZRA 4O96A 4ZP5A 5H8EA 3C4EA 5CANA 4O1OA 4BJJA 4D58A 2ZV7A 2PVRA 3DXPA 3E5AA 1YHWA 5AR8A 3V6RA 2HWOA 3LQ5A 2Y4PA 2H34A 1H1QA 5CU6A 2IVVA 3SDJA 3PIYA 5D9HA 2R3OA 4C36A 4DGMA 4KD1A 2XNBA 3EN6A 2QNJA 4APCA 4QQJA 4YLKA 3TDWA 2ITNA 3ETAA 5GINE 3QKMA 4IM3A 4R1VA 1BI8A 4RX8A 4A9TA 3V3VA 3FMMA 4NT4A 1GZKA 2XCHA 2PMIA 4AACA 2WTKB 2OI4X 4XHKB 3EQIA 3MH1A 5CI7A 4EH6A 5IA1A 2AC3A 1PMNA 1S9JA 4X6QC 4F7SA 3BL9A 2IVSA 2BILB 3ZFMA 3OT8A 5DI1A 2RFDA 3CR0A 4MBLA 4Y46A 4CYJA 3H0YA 5FQDC 3VF8A 4AZWA 4BJJB 1TQIA 1VR2A 4FG9A 4FTCA 3Q5IA 4QP7A 1V0BA 5L6WL 3LJ1A 1MQBA 2X4FA 3ORLA 4K2RA 2BHHA 2BDWA 3LCOA 3L9LA 4UYAA 3Q4UA 3IQ7A 2AEGA 1KSWA 4JAIA 4ZMFA 5M09A 1Y8GA 2C3KA 3DQWA 3VUHA 4BDDA 5HNBA 4JAJA 5AR7A 2R3KA 2HY0A 2GS7A 2X7GA 4BKYA 3UZTA 5DIAA 1FPUA 2CGVA 3PIZA 2YACA 3OZ6A 5AWMA 4CZTA 4WNPA 3G33A 3AXWA 2JEDA 4XEYA 4F0FA 3N4TA 5A46A 5C8NA 3ATSA 1AD5A 2C0OA 3HX4A 4MHAA 2IJMA 5HTIA 1G8AA 5BV3A 4NW5A 1FGKA 5J9LA 5GZ8A 2XKFA 4YO4A 3SG8A 1J3HA 4J8MA 5AV3A 2VWIA 3G90X 1JAMA 1IRKA 4J52A 3HP2A 4D1XA 1ERKA 3F2NA 2GQSA 3RKBA 4F08A 3AC2A 5L2IA 1GIJA 5AM6A 4D9UA 2VX1A 3CQEA 4FUYA 4ITJA 2JC6A 4EI4A 3C0HA 4R3PA 4LRJA 2PUUA 2XK4A 3AMYA 3CY3A 3PIXA 5CF4A 3ACJA 1JSVA 3QQFA 4TYIA 4EK5A 3DK6A 5EFQA 3WE8A 4V0GA 4BCIA 4ZTMA 3D5VA 3CD8A 5CASA 3RWPA 1YXTA 4AZSA 4FEUA 3BYVA 1M2RA 2CKQA 4E6AA 1Q24A 5KMMA 4ZLZA 1TFFA 3UODA 3ELJA 5JT2A 4RWIA 1ZOEA 1ZYJA 2HELA 2JFLA 3OS3A 4PNIA 4TYJA 4ZOGA 5EOLA 4RIWA 3KIOC 4AQKA 4D2SA 3ZM9A 3IG7A 3UPZA 2HIWA 4B8LA 3U54A 3PY3A 5EM5A 3KKVA 3PXZA 2J7TA 3NMUF 1RE8A 2UZVA 5CXHA 1H25A 3K5UA 4FEQA 2PUNA 4AW0A 2OKRA 1YHVA 5ACKA 2GNLA 4FICA 4DLJA 3DBDA 5AUVA 1PJKA 3LPBA 4V0GB 1Q3WA 4YJUA 2Z7LA 1FVRA 3W2OA 2VGOA 5JQ8A 1B6CB 2HWPA 3FL4A 3QUEA 4HGLA 3EYHA 4IX6A 4RFMA 3W16A 4C2WA 2ITQA 4TNBA 2WFYA 5EW9A 4K18A 4F1OA 2OK1A 5CVFA 3W0QA 1OMWA 4HYUA 5HE0A 4UWCA 4OT6A 3ZXTA 3UMXA 5DMZA 4IANA 5CI6A 2EXCX 4EH2A 4O27B 3FKNA 4BICA 5E8XA 4RIWB 4X2FA 3A7HA 4NKSA 4JDKA 3R2YA 4GT4A 3NUUA 3D9VA 3QQUA 4IJPA 1YI3A 3OC1A 2QOOA 4ZLOA 4ASXA 4QDEA 2GPHA 3SXFA 2ERKA 2G1TA 4PDYA 2NRYA 3NLBA 3KCFA 3ZO4A 5HG9A 3N9XA 5CEKA 5DEWA 3BBWA 5DWRA 4ALWA 4BI1A 3DKCA 1IA9A 2QOCA 3FL5A 3I7BA 3I79A 1GIIA 3R00A 4EEVA 3PXKA 3MH3A 4JDHA 4C4JA 3MESA 4YU2A 5EK7A 5FBNC 1Y91A 2NP8A 4IVAA 4LQMA 4YTHA 3RMFA 4EQMA 4DTAA 4HNIA 3C4CA 4N4SA 3BELA 3LLAA 1TQPA 4FX3A 3THBA 4XV9A 4N6YA 2V0DA 4E26A 3RAIA 1GZ8A 2OJFE 2JKMA 3LVPA 4CMOA 4DT8A 2Z7QA 1UU9A 4L6QA 4YSMA 2QKWB 3TKUA 3OVVA 2V7AA 2YN8A 3BE9A 3WF6A 1LEWA 1OL2A 1OBDA 1A06A 2I0HA 3G6GA 4ZSEA 4P4CA 3IGOA 3QD3A 4D5KA 2C6KA 4PP9A 3F9NA 3CC6A 2X8DA 4GKHA 2ZM3A 3R02A 2PVJA 3NFFB 4WSYA 3FXZA 5KMNA 3GQLA 3UVPA 3TJCA 4ANNA 1W82A 5CEOA 1M52A 3TUDA 3T9TA 4ZIMA 4XV2A 5HBEA 3LFQA 3C0IA 5AIRA 5HIBA 4NSTA 2WHBA 4IQ6A 3A7FA 3FPQA 2W1HA 3NYXA 3PLSA 4J97A 4CNHA 5M55A 1JWHA 4FT5A 5EW3A 3B8RA 5T68A 4UMUA 4Z55A 4BR3A 3CE3A 1M7QA 2QD9A 1QPJA 2ZMDA 2UZUE 3IDBA 4YZNA 1XH6A 1OUKA 2H8HA 4E8AA 1BUHA 1OKYA 3LFNA 1WBWA 4MWIA 5DBXA 3TZ7A 1IASA 3ZTXA 5EHYA 3ZLXA 3G2FA 1YQJA 4H1JA 4QP9A 3R1YA 5CQWA 3IW4A 3D15A 5GJDA 3MB7A 3ORTA 3RHXA 4F65A 3UNZA 3JY0A 4I6BA 4AZTA 2X2KA 1STCE 5HG7A 3C9WA 3MSSA 4J95A 5KMOA 4JBOA 4F1TA 2QG5A 4ACGA 5HBHA 5J79A 2YWVA 4HZSA 4A06A 2B9FA 3BLHA 4YZBA 3LQ3A 4MF1A 4DHZA 3T3VA 2O0UA 3EQPA 5HI2A 2YIRA 3OUKA 4RZWA 3W0SA 5I9WA 3W2PA 5IQIA 4U6RA 4S2ZA 4WRSA 2QU6A 1QPEA 5IQGA 3KRLA 2GMXA 4IAIA 2UW5A 1LP4A 4QP6A 4IFCA 3I7CA 3QXOA 4FV3A 4KKHA 3W55A 5AUWA 5LMKC 3R8PA 5CWZA 4D2RA 4EORA 3OTUA 5HNGA 5L2QA 3TZ9A 4USFA 5ICPA 3EB0A 5HO6A 3GU5A 3OD6X 4F9AA 5M07A 2GHLA 3RBWA 1O6YA 5ANGA 2CGWA 2XYUA 1XBBA 4C57A 4C8BA 4DN5A 4NTTA 3LQ8A 2E9NA 3GCPA 4Y72A 2ZDTA 4I92A 3EKKA 5AUZA 3ATTA 5GZAA 4XRLA 4O7RA 5AUUA 3TN8A 3NIZA 1XJDA 3QCQA 2CLXA 3VS7A 3AKJA 4FKIA 3DAJA 2FUMA 2Y6MA 5CSHA 3RTPA 3PP1A 1I09A 3MIAA 4FTOA 5DHJA 2V55A 3H9OA 3IS5A 3G0FA 4FV0A 4O0XA 4W4WA 1URWA 4XX9A 3R0TA 2GQGA 2Z60A 4X3FC 3Q9YA 1YOLA 4I0RA 4L01A 2XB7A 1JQHA 4GFGA 4FTTA 5C01A 3HA6A 3OEZA 3OFMA 3B2WA 4FTQA 4WG5A 4MVFA 5BMSA 4QPMA 3E8NA 5M4CA 2BIKB 2YERA 4Y8DA 5HGIA 4DGNA 1U59A 2OFVA 3O8UA 5AIKA 4ENXA 1ZOHA 5I5ZA 4YR8A 2BRNA 4F9CA 1J7IA 4E1ZA 1W2FA 1KV2A 3EQBA 5EM6A 3PTGA 5CEMA 5KUPA 2DS1A 4EHEA 4J96A 4OT5A 2BMCA 4FTJA 4MWHA 4X6RA 5LWNA 5BYYA 1U4DA 3LFDA 4AZEA 3E64A 4MF0A 5CALA 4DTBA 3OW3A 3L8XA 3UO6A 3FZOA 2H9VA 4O21A 3V04A 3FQSA 3V5JA 4APPA 4EOJA 5IUHA 5JRSA 4CQGA 4LOPA 2RIOA 3R30A 5AAFA 5A6OA 4EWHA 5C26A 1YHSA 3OY1A 3L9NA 4KSPA 5DE2A 2WMTA 4BIDA 1GIHA 2W0JA 3V01A 2E9OA 4OTGA 2BAQA 4V04A 4O7TA 4L53A 3GC9A 4JIAA 3DDPA 5ANEA 4YJNA 2W9FB 2KULA 4G3FA 4PWNA 5I0BA 4PX6A 4USEA 3SW7A 5TF9A 4AGCA 4FA2A 4GEOA 4XG4A 4I6HA 2BALA 3FZRA 5ETAA 3CJFA 5A4EA 4QP1A 4MQ2A 3ORKA 2PY3A 3EL7A 4AT5A 2YIWA 1PRYA 4QMQA 3R1NA 5FP5A 3GFEA 3TUBA 2VU3A 3QQJA 4FV8A 2XJ1A 3MI9A 4CRSA 3I6UA 3RCJA 4HVSA 5BVNA 3QCYA 1KV1A 1BLXA 5FXQA 3NUAA 5KKRB 1WCCA 1G8JA 3A7GA 4PP7A 4YJSA 2WEIA 4TXCA 3TNHA 2VX3A 3DFAA 4P7EA 3GCSA 3MPAA 4AA0A 2C5YA 2R64A 4IX3A 5HG5A 4O0WA 4ERKA 3QKLA 3VS3A 5E9EA 3BZ3A 4WRGA 4Z7GA 4I24A 3HMOA 4RVLA 3QYZA 1MRUA 4DG0E 3PVGA 1GAGA 3NRMA 4FIJA 3SGCA 5L8KA 3FV8A 2QLUA 1FGIA 4O4CA 5DN3A 5AP4A 3JXWA 3RK7A 4EL9A 5JN2A 2PVHA 3CCNA 4USDA 4KBCA 3MFUA 3NAYA 3LKMA 3PRIA 3GCUA 3NDMA 4FZAB 3O50A 2J2IB 2ZOQA 2IZRA 1YDSE 3OBGA 4IX5A 5HX8A 1PHKA 2J5FA 4QP4A 4AP7A 3FYKX 4XJ0A 3R6XA 4QMWA 3E3PA 3T9IA 1Q41A 1Z57A 5FXSA 3Q9XA 3R7OA 3BYMA 5KHWA 4EYJA 4RC2A 3E7VA 4JOAA 5JFVA 3UIXA 3MV5A 4D55A 5HQ0A 4DCAA 3OBJA 3IECA 1J91A 5D41A 3MB6A 4EKLA 4O7SA 3JY9A 1WMKA 4FG8A 4O1PA 4HGEA 5AM7A 2XJ0A 4XG8A 3Q6WA 1R39A 3D5UA 3O8TA 4KS7A 4KS8A 4ALVA 4IM0A 3ZBXA 4FV5A 2C6DA 1F0QA 2X8IA 4IAKA 4C7TA 3LJ0A 5A54A 2WMQA 1OKZA 4WNMA 2XK6A 1YXXA 3EN4A 4TYEA 2IPXA 3D83A 2WIHA 3ODZX 3U55A 2X0PA 3EFKA 5E92A 4RJ7A 5A3XA 4IB1A 2Z8CA 3NUYA 4M15A 4YC8A 5EI2A 4D4RA 2ZM1A 2XIKA 4AF3A 4IWQA 1WFCA 5JEBA 3QUPA 4E6QA 1MUOA 4YNEA 2QOLA 4G3EA 5KMKA 3UTOA 2UUEA 4TT7A 2IEWA 3RCDA 3O2MA 5J95A 4ACMA 5AP2A 2W96B 4PL3A 3W10A 2VO6A 4FV1A 3EJ1A 3L8VA 3AT4A 1YOJA 4Y5QA 3ZZEA 1P4OA 4C3RA 4MXYA 4Y95A 2GNGA 2A19B 4FUXA 2JLDA 3UPXA 4AE6A 4FT3A 4JQ7A 2NNWB 5AR4A 3D2IA 2REIA 3U8WA 4GH2A 2YHVA 5HTBA 1YI4A 4TWCA 5KBQA 1UKHA 3KY2A 2XNGA 4G6NA 4L00A 4KUJA 2WELA 3RAWA 2NRUA 4M14A 4CTCA 5KMJA 3HZTA 4W8DA 4NL0A 4YHTA 4EK4A 5EM8A 3V5WA 5AEPA 4YTCA 4IFGA 3DOGA 2VNYA 3DQXA 4O0SA 4RGJA 4E4MA 2W1DA 3GP0A 3SQQA 4O86A 4DEEA 3MTLA 4EYMA 4CLIA 1H0WA 2AYPA 5LOHA 3HMMA 4DEAA 1REJA 3U6JA 2ZV8A 1SM2A 3EQGA 2BZJA 2WMRA 3HP5A 5J8IA 3KN6A 4HYIA 1PW2A 3WILA 1VYZA 2C0TA 3OY3A 1JKSA 3E88A 2G2HA 4NU1A 2QOFA 3L1SA 4BN1A 4EH7A 4CGAA 3BI6A 3E8DA 3NR9A 2HCKA 5IDPA 5E7RA 3GBZA 5EKNA 2R3QA 2PK9A 3QYWA 5E8SA 4FKQA 4YP8A 3PA4A 5A4QA 4CKIA 1JSTA 4FVRA 4XP3A 2YA9A 1XBAA 5CVGA 2VTIA 3JR1A 4JVGA 4BDEA 3VBVA 4IBMA 5CVHA 5LVPA 4DFUA 2F57A 3HV7A 3OUNB 3M1SA 3PVUA 4U3YA 4Z3VA 4KSQA 1KOBA 1PXJA 4UY9A 4BGQA 4IZ7A 3UOJA 1W0XC 3NYVA 3GC0A 3MH2A 5A4CA 2DUVA 3FUPA 4FNYA 2BHEA 1O9UA 3NX8A 4XV1A 4DEHA 3TJDA 2VO0A 2BPMA 4EHZA 5M44A 4C02A 2QVSE 4G34A 4CQEA 3P7BA 2ETKA 3GQIA 2R3LA 3CLYA 4FR4A 4OTFA 4XS2A 3TWJA 4EOSA 4FEVA 2R5TA 1OM1A 2XNNA 3DBCA 5G6VA 5IH6A 4KAOA 4U0IA 1GNGA 4PMPA 3UG1A 3NIEA 4E5AX 4FSMA 1JNKA 3MVJA 3RI1A 4U45A 5HCYA 4EOOA 5HLWA 2QQ7A 3Q32A 3CKWA 4D0XA 2BKZA 1JPAA 3W8QA 3KXZA 3VS2A 2W5BA 2X39A 4IHPA 2Q0BA 1CM8A 1UU3A 4RMZA 5AR3A 3F88A 2C5NA 5LMAA 4D4YA 4BBEA 3TKIA 4C4EA 4B4LA 4XP0A 1W2DA 3LCTA 4KINA 4IC7A 4FTIA 1I44A 2W1IA 1OIQA 4QYEA 3VS1A 4FIFA 3Q3BA 1H00A 4AGWA 2IO6A 3BQRA 2EB2A 4C4IA 1ZZ2A 2F7EE 4OAUC 3NW6A 1MRYA 2YABA 2CN5A 3TV4A 4AG8A 2YM7A 5LCJA 1UKIA 3WZDA 3QTSA 4R7BA 2QONA 5AR2A 5CEPA 4F7LA 4O7YA 2XCKA 5GJFA 5FEEA 4BDHA 4NZWB 5BUIA 1O6LA 4G3DA 3F5PA 3PXYA 4OW8A 3V51A 3RZBA 3AKLA 3TMOA 4RWKA 1R78A 3VS0A 5KZIA 1QPCA 5EDRA 2PU8A 4FSYA 3UVRA 3TZ8A 3MWUA 4CD0A 1H28A 3R2BA 4HNFA 1QMZA 3GGFA 3QGYA 3C0GA 4FZ7A 4PV0A 4F09A 4QO9A 1JSUA 5JSMA 1XQZA 3Q9ZA 2GTNA 1M2PA 3PWDA 5IA2A 4OLIA 2X0QA 3MY1A 3NZ0A 4WUAA 2E9VA 1KUTA 3O8PA 3DZOA 4K11A 2QR7A 3PWYA 3QBNA 3K3JA 4KKEA 3Q04A 4AS0A 3LM5A 2A2AA 4H3BA 4MCVA 1TKIA 2IZTA 2Z7SA 3OWJA 4LV5A 4CFXA 3LFAA 3TUCA 4BCFA 1DS5A 2BCJA 1CMKE 4XUFA 3FDNA 3KMUA 3BHHA 4AW1A 2BUJA 2X4ZA 3EFWA 3IK3A 3EQCA 3KL8A 2HY81 3WZKA 4ZAUA 4RJ4A 1XH9A 3ORNA 4IJ9A 4RLKA 4U42A 5FP6A 2PULA 3DBEA 2HZNA 5M4UA 4AXCA 3ZSGA 1UU8A 2X0GA 4M8TA 2P2HA 2Y8OA 4YGAA 3V8TA 2H96A 2WPAA 3DJ5A 3MVHA 5HO7A 4O7VA 3RINA 2OFUA 5H9BA 3ANRA 3O23A 3TIZA 1PXMA 5BUEA 4DE4A 3UDZA 2V7OA 3UGCA 1LUFA 1E9HA 3TYKA 5J9ZA 2GHGA 4PMTA 4YMJA 5BNJA 5AP0A 2EXMA 1RJBA 4HCVA 4GRBA 5TR6A 2C3LA 2WMXA 4YC6A 4C37A 4YZ9A 2WD1A 3CEKA 2CNVA 4JMQA 3ZO3A 4FYOA 2XEYA 4BTMA 5HCXA 4JX3A 3RPRA 3AD5A 2C1BA 4GG5A 5GZ9A 3R22A 4YNOA 2R3RA 2FSTX 3ZRLA 3HVCA 4DYMA 4PDOA 1K3AA 2PE2A 2JDRA 3ITZA 2ONLA 2VTPA 2RL5A 3QRJA 4MD8E 4ANBA 2WGJA 5IQFA 4TYHA 4IZYA 2CJMA 3DFCB 3OWKA 3MJ2A 5CU4A 2XVDA 1H1PA 3F7WA 5HD4A 2X9EA 4Y5HA 3FKLA 4FYNA 5C27A 4UB7A 4NKAA 4PNKA 5FG8A 4WIHA 3GNIB 4ANQA 5M06A 5M08A 3DT1A 5JZJA 4YHJA 1OPKA 2IVUA 5G1XA 5IKWA 4PF4A 4LYNA 1JOWB 5E4HA 3P0MA 5IA5A 2HZIA 3I0QA 3W0RA 3FZPA 4YJQA 4YHFA 4TKSA 4BTJA 3RK9A 2BAKA 3OP5A 5ETFA 5CX9A 3EOCA 3GOPA 2B1PA 2FA2A 3CKXA 2H6DA 4TRLA 3E8EA 2A1AB 4NWMA 3MPTA 3FHRA 4XH6A 3T8OA 4TYHB 3W8LA 2W99B 2BRHA 4A9RA 3NNUA 4DBXA 1OB3A 4LI5A 2OIBA 4R1YA 2W1ZA 4AXEA 2WXVA 1Q61A 1P4FA 1X8BA 4AGDA 2OH4A 3DA6A 3KA0A 4RVMA 1R3CA 3LFEA 4O0YA 2XRUA 4AWIA 1WZYA 4FL1A 1MP8A 4BDKA 4FV6A 3EN7A 3WE4A 5FLFA 1TZDA 2Y7JA 5H2UA 4U40A 5GIOE 1YDRE 2B9JA 2XNMA