3O8UA

Conformational plasticity of p38 map kinase dfg motif mutants in response to inhibitor binding
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
348
structure length
332
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDYGATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational plasticity of p38 MAP kinase DFG motif mutants in response to inhibitor binding
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
total genus 99
structure length 332
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3o8uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3o8uA01
2X6DA 2I1MA 5LCKA 3NAXA 4DTBA 3QYWA 1MQBA 4JS8A 3EN9A 1OITA 2IW6A 5KZIA 2B9IA 4JRNA 1GZKA 1UV5A 5BPYA 4ZY4A 4KIQA 2C5XA 3D14A 5CAVA 5IH6A 2HW7A 5HE3A 5CEIA 4BDBA 3MIAA 5CASA 3S3IA 4YC6A 4EK6A 4WT6A 3W2CA 4OTQA 5E1SA 4ALWA 4Q9ZA 2OG8A 2YDJA 1H1RA 2YIYA 3BGQA 3RWPA 4AUAA 4F7LA 1U5RA 4RJ4A 5FXQA 2YZAA 3ZRMA 4A9SA 5JFXA 1G8AA 5AV0A 2X81A 3C4WA 4QMYA 5EYKA 4L7FA 3GU6A 3QTUA 5M4IA 4QMLA 4AE9A 5AX9A 4FGRA 5AWMA 4L3PA 4O22A 1QPJA 4JOAA 4KIKB 2PTKA 3MTFA 4C4IA 5GIPE 2W1IA 2H8HA 3PIXA 5IA5A 3VN9A 1DM2A 4V0GA 3CP9A 5J5SA 2WTKC 3R8LA 3TKIA 2CGUA 4DYMA 1UU8A 2BRNA 2BZHB 2CCIA 2R3PA 3N51A 4E6CA 3KB7A 4QOXA 2PVFA 3QTZA 4PUZA 3R83A 2YM7A 4QQCA 4NUSA 4R3RA 4F9WA 2W06A 2X6EA 4YJQA 3N9XA 4X6RA 3FXZA 4UALA 5CANA 5AADA 2W1HA 2PUNA 5A14A 4JIAA 4FSZA 4YHTA 5DOSA 5FWKK 5FBNC 2GTMA 4GFGA 4ITJA 3HA8A 4LOPA 3UZTA 1W0XC 5EYDA 3NEWA 3D83A 4O1OA 4BDKA 2C5NA 3BCEA 3PZEA 2ZM1A 3TWJA 2UW4A 1SM2A 4W4WA 5AR8A 4HGSA 3GQLA 3OROA 3POZA 4G9RA 3HUCA 4M68A 4FT0A 2C3KA 3HMPA 2O8YA 3IOPA 4YJRA 2WTVA 5DNRA 4FNWA 2PU8A 2W4KA 1XWSA 4JQEA 3LLAA 3F2RA 3KXXA 3O50A 5JZJA 5LWNA 2HWPA 3QD3A 4L53A 3UPXA 5A6OA 4QMUA 4JAJA 1FQ1B 1XH9A 1YXTA 3IQ7A 3QQHA 5I9ZA 3ORZA 4XG3A 3ODYX 3P1AA 4RWLA 1A9UA 4NKSA 1WMKA 4AW5A 4G16A 2QKRA 2UZDA 3CTHA 4YJVA 3HMMA 5E91A 3LOKA 2OJJA 4F9YA 4F99A 4XG2A 4FKOA 4DEGA 4F65A 2WHBA 5D9HA 4DG3E 3JY9A 3C13A 3DQXA 4J53A 2XJ2A 5HIDA 2ESMA 2YJRA 4CYIA 5CU0A 4JDIA 4BIDA 5DE2A 3CBLA 3GQIA 2XH5A 2YLFA 1WVXA 4ITIA 1WCCA 2BIYA 5AUWA 3F6XA 4I21A 1L8TA 4IAKA 3N4VA 4UMRA 5L2IA 4ZMFA 3DLZA 1KSWA 4RVMA 4FV9A 4M67A 5EDQA 4BTJA 4PMSA 4KKHA 2GS7A 3BX5A 4XUFA 4BI0A 3EMGA 4O0UA 3NCGA 2VNYA 5H9BA 2BCJA 4Z3VA 5EDRA 3KMWA 4LOOA 2DQ7X 4FTCA 5BUIA 2PZPA 3OEFX 3OW4A 3FBVA 2E9UA 2GQGA 5F9EA 2JGZA 4ZZNA 3GCVA 2OF2A 2F7EE 2JAMA 2OFVA 3RAHA 4CSVA 4C4FA 1W82A 4C38A 5BVFA 4GUEA 3ORIA 2LGCA 3AXWA 3AT2A 1GZ8A 3MFUA 3ULIA 2WTCA 3JPVA 4AGDA 2NNWB 4W4XA 3FSKA 1GZNA 2OZOA 3UG1A 3BYSA 2WTJA 4KIKA 4IZ5A 4NFMA 2REIA 2XIKA 4YP8A 1MQ4A 1O6YA 4L43A 4YJSA 3ZYAA 2C0OA 4E20A 1Q62A 3D2IA 4G17A 4KKGA 1H25A 4XP0A 5D10A 4F9AA 1GJOA 2XM9A 5CT7A 2UZEA 5ANDA 4RIYB 3WZJA 4IXPA 1FOTA 3UNZA 4QQTA 5FXRA 4CGAA 4EOOA 3AT3A 2F57A 1WFCA 4O0TA 2QG7A 4GJ2A 4JNWA 3TV7A 4F7JA 3S0OA 4FTJA 4UXLA 1YXXA 3DLSA 4TNBA 2WD1A 3BV3A 2E2BA 3F9NA 4LL0A 4QPSA 3THBA 3H0ZA 2YHVA 4QMWA 4PL3A 2W9ZB 5HVJA 3LFCA 3NYVA 3OHTA 3EKNA 4BYIA 3DQWA 3QRKA 2I0HA 4MBJA 2OKRA 4QP8A 5JGBA 4RWKA 4EHZA 3LJ0A 4ACHA 3IGOA 1GNGA 2JITA 4O0SA 3G33A 4TYGA 1WZYA 3UVRA 5AUXA 4EOPA 3BPRA 3PXFA 2CSNA 2J51A 5GINE 4F63A 3HRBA 1BI7A 3L8XA 3E8DA 2ITUA 4FT5A 1KE6A 2YIWA 4G5PA 3FMJA 3KRXA 3OXZA 4ITHA 4R7HA 1KE7A 1ZZLA 2RF9A 4RIWA 1OM1A 2CNQA 5DEYA 3VHEA 4M13A 3Q60A 4O96A 5BVOA 1VR2A 3ALOA 4GIIA 3VUTA 4IACA 1XBBA 3CJFA 1Y8GA 4BZNA 4ZZOA 3NS9A 3DAJA 3SHEA 3KU2A 4S30A 2R3RA 1PXKA 4RZWA 3VS5A 4E7WA 3EH9A 3GU4A 4DH3A 5A4LA 1P14A 2XKCA 4A4XA 4XG7A 4ZK5A 2QOOA 4IWQA 4S31A 1Q24A 3UYSA 3LQ3A 4CCBA 4ZJIA 1G8SA 1ZARA 4QMPA 5AR5A 3OCBA 3WARA 3EB0A 4P7EA 4XS2A 1Q3DA 4DT8A 2AC5A 4F9CA 3MESA 3RZFA 4M0ZA 4EK4A 1OGUA 2UW9A 4FEUA 4BF2A 2HXQA 4AZEA 2R3OA 2JDRA 4C33A 2V0DA 3AC3A 2JDSA 3EN4A 4CFXA 3HUBA 1KE5A 4FVRA 3FAAA 4PDOA 2H96A 3O17A 4EKKA 4LQMA 5DGZA 2ZDTA 3NR9A 4WG3A 2UZBA 2QOFA 2VO3A 4G3GA 1SZMA 3BKBA 3PA4A 5HI2A 4CTBA 5I9YA 3QHRA 5L2TA 4JG7A 5CVHA 5IZFA 4IBMA 4DA5A 3OC1A 5KX8A 3SV0A 4JT3A 2R7IA 5C26A 1H24A 2CLQA 3ORPA 4M69B 3NUXA 4H3QA 3FEGA 3CKXA 3PVUA 2OXDA 5LXMA 1U59A 2G2FA 3NX8A 3ZEWA 3RK9A 1KUTA 4U40A 2XNGA 5ETAA 3EN6A 3DXNA 2FSTX 2VX1A 4FBXA 4IWPA 5M51A 4FNYA 3VUHA 3Q32A 4OBPA 4IMYA 1XH4A 2RSVA 3D7ZA 5HVYA 4B8MA 2RL5A 1H1PA 2IW9A 3RCJA 4YC8A 4M84A 3BE2A 4BDGA 4DF3A 4YR8A 4FEWA 2FSMX 2C6TA 1JBPE 3CE3A 3GOKA 5D41A 1TVOA 3HKOA 4FL2A 5C9CA 5HTCA 5L8KA 4A9TA 3RZBA 3HV6A 5CNOA 1XBAA 4D5HA 4YZCA 2RFEA 3AMAA 3P78A 4HGLA 3OOGA 5EHYA 2VTLA 3GNIB 3MTLA 4E5WA 5CNNA 2FB8A 4QTAA 2QQ7A 4RJ3A 5DIAA 1KV1A 4IJPA 5CZIA 3QC4A 3ZZWA 3EFLA 4AGWA 4M97A 3FL5A 4U97A 3Q6UA 5CF8A 4R5SA 4E4NA 4HVIA 3QZHA 3F5UA 3O8TA 1DS5A 3R8ZA 5AP0A 3ZRKA 2QURA 5TR6A 4BCPA 4O7YA 5FG8A 4ZZMA 4ZJJA 4ACMA 2X4ZA 4QRCA 4WG4A 4NFNA 4XRJA 2IN6A 3ZUUA 4BGQA 4FTTA 2OO8X 3QTQA 5HO8A 4F9BA 4F7SA 5A9UA 3Q2JA 4TTHB 4EI4A 2J2IB 3TI1A 1ZYDA 3KXGA 4WNPA 3GCQA 3I81A 2P55A 4CFUA 2Y6MA 4MYGA 2VTSA 2GMXA 3GCPA 3NNVA 2QU6A 3DBDA 2IW8A 3ZO2A 4IDVA 3A2CA 4D2TA 4EL9A 5CSPA 1YOMA 5LVNA 4NKAA 1M14A 2UW5A 3LXNA 2VWBA 3Q9ZA 4W9XA 3ZLYA 3P9JA 4AS0A 4FSYA 3QALE 4CCUA 4F4PA 2J5FA 2WIHA 2YCRA 5E8YA 1I44A 3PWYA 2QD9A 4J96A 5BVNA 4MK0A 5IU2A 3MB6A 1PKDA 4OR5A 3KMMA 4CXAA 3GENA 4YLLA 3R7UA 3GU8A 4HOKA 3EQPA 4NYEA 1M2PA 4J1RA 4ERKA 4S34A 3ZFXA 3MI9A 2BIKB 2WMQA 3HZTA 5JFSA 4MBIA 5TT7A 2XNBA 4JAIA 4AQCA 4USFA 1KOAA 3I0OA 4WNKA 2YAAA 1BKXA 1NA7A 2PUUA 2QVSE 4N6YA 4WBOA 4BBFA 4O27B 4FKVA 3P4KA 4DLJA 1OMWA 4QTBA 2ZMDA 5GJGA 5TOZA 1R0PA 4FOCA 3W2RA 2BRGA 4AA5A 4BB4A 1OPLA 5EYCA 3W33A 3O7LB 3W2OA 5IDPA 4OLIA 3E92A 3KRRA 3BHTA 4O6EA 3MA6A 2V7AA 4FI1A 3PJ8A 4V01A 5HCZA 5KMLA 2BROA 4ONAA 2X7GA 4XG6A 3BRBA 3EQCA 2JFMA 5CQUA 4E4MA 3CR0A 3PZHA 4YBJA 5IISA 5DYJA 2Q83A 2X8DA 3G0EA 5CI6A 4HVGA 2VO7A 3ZMMA 1F5QA 1QPCA 4FOBA 4MXOA 2XBJA 2HZ4A 3A99A 2XIZA 2ERKA 4XHKB 3LJ1A 1WBOA 1LR4A 2CGWA 2SRCA 2VTJA 3WI6A 4BCQA 4CRSA 3PWDA 2OK1A 4E93A 2HZNA 2VN9A 2C3LA 4ZTQA 2BKKA 2FYSA 2WQBA 3TJDA 5L6OA 4XBRA 5IH4A 4EOSA 5HLPA 3DBFA 3LCSA 4JR7A 3OY3A 3PY0A 3V6SA 3WZEA 1QPEA 1BI8A 3I60A 1E1VA 3F3ZA 3SAYA 4G3CA 4IB3A 4E5AX 1S9IA 1JWHA 2OSCA 1OPKA 4M15A 4BIEA 3UZPA 3Q5ZA 4O2ZA 2BAQA 3O8PA 4P5ZA 2PZIA 1Z5MA 3MGYA 4KKEA 4QMSA 4DLIA 4NIFB 3QHWA 2ITXA 3FI2A 3SXSA 2YDIA 5HD7A 3OFMA 4O0RA 4QP7A 4A4OA 4FSUA 3ZSHA 2HAKA 5AUVA 3RAWA 4I24A 4RMZA 2CMWA 3VAPA 4AX8A 3BHHA 4J8NA 3KK9A 4GSBA 4RLLA 4FTKA 3EQFA 3HL7A 5AX3A 3CTQA 3NMUF 1B39A 3TTJA 5DT4A 1M17A 5DA3A 1M7QA 2GS6A 5FTOA 2VO0A 2XK7A 4C3RA 3DK3A 5JGAA 3UO5A 2WMVA 3KRWA 4WNOA 5A3XA 4FKSA 3VW8A 4KS7A 5E90A 3PFQA 2OBJA 4GU6A 5BUEA 1GIIA 4PDPA 5TKDA 4D1ZA 4XP3A 3LJ2A 4K18A 4K2RA 3C1XA 4XV3A 3S1HA 1SYKA 4ZTSA 2XNEA 3IW8A 4E1ZA 4C36A 5L8LA 4TZRA 2WTWA 1UA2A 3QTXA 4C3PA 4H39A 4X2FA 3NUUA 2DS1A 3ACKA 3ZLSA 3TZ8A 4CV8A 5AEPA 4FKJA 2UVZA 2PVKA 4XV9A 5M07A 2UZWE 2VU3A 1ATPE 4YJUA 5HU3A 5DI1A 4IFCA 1RJBA 3TNIA 4DTKA 4XV2A 1UWHA 2B9FA 1JVPP 4U42A 4CFWA 3SDJA 5ICPA 1Q8WA 4IANA 4X3FB 4D4YA 3PE1A 4GKHA 4DGLC 3ZC5A 2YJSA 5IUIA 4ZSEA 3KN5A 5AV2A 5I9XA 3NWWA 2ETKA 3RAKA 2VZ6A 3CPCA 4BKZA 4RVKA 4YJOA 2WFYA 4BFMA 4UBAA 3OWLA 1FVTA 3KXMA 4FA2A 2PUPA 5FUTA 3SW7A 3I0QA 4L52A 3FKNA 3W32A 5LWMA 5CU4A 4ZAUA 1SNUA 2CPKE 2VX3A 4KSPA 2UZNA 3PPKA 2E9VA 2O0UA 2YM5A 3G6GA 3TN8A 2CLXA 3FMNA 3OUKA 3A4PA 4H1JA 4B8LA 3R04A 4QMXA 4HGTA 2VNWA 5CLPA 1JSUA 2FO0A 3JS2A 5JFWA 1WVYA 1H28A 3D5WA 4BDHA 4Y8DA 2ZV9A 4P2KA 4PL5A 5M53A 2OJ9A 4C35A 4DEDA 4JL9A 4WRSA 4QMZA 1ZXEA 3MPMA 3QRIA 3ZDUA 3D5VA 3D7TA 1ZYJA 3PVBA 3QX4A 1IRKA 4LM5A 4CMUA 4E6QA 5L4QA 5HG9A 4G2FA 3R9OA 2B4SB 2JIIA 2OH0E 1P5EA 4U45A 3PA3A 3BLRA 3EJ1A 4EJNA 5DMZA 2JDOA 1H07A 4MNEB 4HYUA 3L8PA 4MD8E 2R5TA 3W2SA 2UW3A 4FIFA 1W7HA 2XVDA 4GVAA 1TQPA 2PMLX 4C4EA 2UW0A 2Y0AA 2ITTA 3I6WA 3PLAE 3UZRA 3QX2A 1WBVA 4IZYA 3FZOA 4J7BA 4L9IA 4MXZA 4C62A 5DVRA 4R7BA 1YI4A 2UVYA 5J1WA 5IA4A 3HMIA 5CI7A 3JXWA 2HOGA 5M55A 3EFKA 3LMHA 4NK9A 2UV2A 3HVCA 4IQ6A 4MXYA 2R3MA 4O86A 2Q0NA 3ERKA 4FIGA 3ID6C 2HWOA 2PE0A 3O2MA 3FZ1A 1DI9A 4GK2A 3FKLA 4FK6A 4JG6A 3DKGA 3QD2B 5EK7A 3EKKA 2R7BA 1VYWA 5IMEA 2WMSA 4RLKA 3A4OX 5E8TA 4YJNA 3ZRLA 4DE4A 3HMOA 3IW7A 3U8WA 4O0VA 4A7CA 3QLGA 2GFCA 1H00A 2IJMA 2YAKA 4L45A 4JIKA 1NY3A 4ANMA 5CQWA 4C0TA 3SG8A 3E64A 3PXKA 3Q4CA 4RC4A 2YM4A 5KE0A 3TNHA 2PWLA 4RA5A 2XK4A 4W8EA 4ZTHA 2R0IA 4K6ZA 5DEWA 4PDYA 4AT5A 3VRYA 4EHVA 2CGXA 2XUUA 5GZAA 4TWCA 3RPOA 2Y6OA 5DR6A 2EVAA 3UIBA 1DI8A 4A06A 5IQFA 4NU1A 4N0SA 4I92A 1SMHA 3ZZEA 3OOMA 4J97A 4PMTA 3NIEA 3ZUVA 4IFGA 2W1EA 2E9NA 4QMVA 3BU6A 3SC1A 4DBNA 5C1QB 5HBJA 4BTKA 4CG8A 1ZOGA 3DY7A 3HYHA 3ZM9A 4B9DA 5HQ0A 2EB2A 4HNFA 2W1FA 3D2KA 3ZDIA 4F1MA 3UODA 2JEDA 5EKNA 4LMUA 2XS0A 4R3PA 4GS6A 2ETRA 3OXIA 3W2PA 4TYEA 3QRJA 4EH9A 3NRMA 4CKIA 2JDVA 3C0IA 5K4JA 4ARKA 4RIYA 4O7SA 4O0XA 4DGGA 3UDBA 4FZ7A 1BX6A 2GS2A 3NUYA 1CKIA 4HW7A 4IX4A 3FY2A 2RG5A 4NM5A 3RM6A 4BCNA 4JDHA 3KCKA 4Z7GA 2KTYA 2LAVA 4L44A 3UQCA 3RGFA 1ZZ2A 3RNYA 1YOLA 3Q6WA 2PVYA 3E8NA 3MWUA 4BDFA 3C50A 4WSYA 4IM0A 4O38A 4JX7A 5F20A 2YFXA 2ZMCA 3VJNA 3ORNA 4V0GB 4ANSA 4IHPA 2B9HA 3Q3BA 5DT0A 4C4GA 4X2JA 2IVUA 4P90A 4EOQA 5HU9A 3LMIA 3BYOA 4IVDA 2WKMA 3NGAA 4OT6A 2JBPA 4S32A 4BBEA 4Z9LA 5A4CA 2CKPA 2F7ZE 1OKYA 5I4NA 4G5JA 2YEXA 4EUUA 5AA8A 2HK5A 4IEBA 4JBPA 4GV1A 5IQAA 1H27A 4ANQA 3FLQA 3RINA 3U55A 3SRVB 1OI9A 3V01A 3WZDA 1MUOA 3VF9A 2C6OA 2QI8A 2GHLA 5AA9A 5CAOA 3M11A 1SVHA 4NTTA 3TZMA 2VWXA 3EWHA 3OMVA 2QC6A 3VBXA 4EORA 5AFVA 4RA4A 4OTHA 3TNWA 2PE1A 3DFCB 4K1BA 2WNTA 2OFUA 3NW6A 2Y9QA 4BTMA 2PVLA 1PMVA 5KNJA 5DN3A 4BN1A 3IW4A 1EH4A 3GXLA 5HEZA 3ZSGA 4AGCA 4OTGA 4XH6A 4WOVA 2R9SA 2BZJA 4Y73A 5E8SA 4ZJVA 2CCHA 4M0YA 5HNGA 4L3JA 5LARA 2UZVA 3C0HA 1XH7A 3HLLA 3V5QA 4YZBA 2EXEA 4QYEA 1H08A 3REPA 2JAVA 4TRLA 5BX0A 3WZKA 4UYAA 4U43A 2PMIA 2QHNA 3P7BA 4L68A 3UIXA 3DJ5A 3FXWA 4JDJA 1YXVA 3UOJA 4OTRA 4E4XA 3V8WA 3ORXA 4AAAA 4O7VA 5HE0A 1MP8A 2AUHA 3KN6A 4I22A 4AZTA 1BL6A 4X3JA 3QKKA 2QHMA 4E3CA 4GEOA 4CFVA 4HVDA 1LP4A 3A7FA 2WZJA 1ZMWA 3DKFA 3KK8A 2BZKB 3DCVA 3FLYA 4TY1A 5IEXA 4IAAA 4GU9A 4DH7A 3PVWA 1NVQA 5TO8A 2YCSA 4LRKA 5FP5A 1GAGA 3HEGA 5AM6A 3U9NA 4ERWA 4A9UA 3EL7A 2BALA 2PZRA 4ZEGA 4D4VA 2CKQA 3UJGA 4NW5A 3AD4A 4AT4A 4FEVA 4O0YA 5L2QA 4AE6A 2Y8OA 1ZWSA 2ACXA 2Z7RA 1PXPA 3CPBA 3UP2A 2A1AB 4DG2E 3VUDA 4J71A 2X0GA 5LQFA 3DNEA 3W8LA 3SLSA 3D4QA 4BGHA 5JQ5A 3RTPA 3QRTA 5DPVA 2ITOA 5E4HA 3FLZA 5CXHA 4FUYA 4BDJA 4RIWB 1JSTA 4PDSA 4XLIA 3ZONA 2VD5A 1ZY5A 2VTRA 3F7WA 5HESA 4CZYB 2CN5A 3R1SA 3MVJA 1H1SA 3QUPA 4J52A 4IWOA 2W1GA 3R63A 5AP6A 4AN2A 3QGWA 4FIJA 3QAME 1FVRA 3DAEA 3ZO4A 2XJ1A 3KXNA 3AG9A 4YUQA 3QCYA 5AP7A 4CKRA 2QO7A 3DOGA 3FQEA 5FD2A 5LMKC 2WQNA 5F1ZA 5H8EA 2YCQA 3ZH8A 1ZMUA 5FEEA 4A07A 4F08A 4CLIA 5CSXA 3UTOA 3W10A 3C4XA 3D94A 1T45A 2C3JA 4K11A 3DV3A 4LV8A 1OECA 3KF4A 3E87A 3D9VA 4Y72A 4B4LA 5AAEA 4JG8A 5CF5A 2RIOA 2J0JA 4GK3A 3KL8A 3HV3A 4R1VA 4YPDA 5I9UA 4QMNA 4QP2A 4GMYA 4M14A 3FZSA 2GSFA 4UB7A 4FV5A 4QQJA 1XH6A 3OCTA 4BDIA 4MQ1A 2JKMA 4KSQA 4YPSA 3HV5A 4BIBA 5I9WA 3IS5A 2V22A 4GG7A 3SX9A 2HELA 2VWVA 5M4UA 2QLQA 4WBBB 3BYMA 2V55A 3KULA 3TIZA 3A7HA 3I7BA 3RHXA 4BI1A 5E8UA 2PHKA 4FKUA 2P3GX 5CEKA 4K33A 4ASZA 2W7XA 3LFDA 3WBLA 4AZFA 3K3JA 5ETFA 4Q5EA 3VO3A 4JLCA 3P79A 4PTCA 2C69A 5AV1A 5AJQA 1TKIA 3D5UA 4MTAA 3ZSIA 5HIEA 2XF0A 3SVVA 1R1WA 4LGHA 5T3QA 4AT3A 2ITYA 3COHA 4XG9A 4U44A 5GZ9A 5B2LA 5LOHA 3FDNA 5C27A 1R3CA 3JUHA 4WKQA 4NL0A 3RMFA 2UW6A 3DU8A 4TT7A 5BVWA 5J5TA 4D4RA 4DGOA 2OW3A 3GEQA 3NZ0A 3ZOSA 1GIJA 4IC8A 3S2PA 4CTCA 4BY9E 3FSFA 3ENMA 4CLJA 3IDBA 2GNJA 4YTHA 2I0VA 3IECA 3LZBA 5C4LA 5IQDA 3BWJA 4YGAA 5HKMA 4MXXA 5BVEA 5IA0A 3FI8A 4CQGA 4RZVA 2X7FA 4F0FA 3HDNA 4LMNA 4EZ3A 2V5QA 3DKOA 1A06A 3ROCA 4FICA 5CF6A 2R0UA 5LCJA 3LM5A 3MFRA 2ZOQA 3PSDA 3BELA 2NO3A 3OY1A 5CU6A 4FKTA 1WBTA 4I5CA 4YO6A 4ASXA 2JLDA 4B6LA 3W1FA 5EHLA 3DJ6A 2CN8A 3AC2A 5CZHA 4UX9A 1L3RE 3FMDA 5GJFA 3R2YA 5IQHA 3PTGA 4HVHA 1O6LA 2OICA 3TTIA 5DBXA 2VTPA 2WTKB 4EOIA 3D5XA 4ZS4A 3VBYA 2FVDA 3R00A 2Z2WA 2BDWA 1VEBA 3A7IA 5I5ZA 4D2VA 1UU9A 4EOKA 3FZRA 1ZOEA 4OW8A 3NUNA 3WIGA 4MH7A 2OF4A 3DPKA 1QCFA 4H58A 4FKRA 2Z60A 3MJ1A 4N70A 4HYSA 5M09A 1J7LA 4D55A 4EH6A 4L00A 5EOLA 5M4FA 1OIYA 1XHAA 3QYZA 3TNPC 5IEVA 3F3VA 4XBUA 1V0PA 4FV4A 3DGKA 3I4BA 3B2TA 4YSJA 4K9YA 3ZLXA 5C8NA 1YRPA 1BMKA 5GIOE 3F88A 3VUMA 3COKA 3I79A 4MD7E 2O64A 4BR3A 1UVRA 4BZDA 2XRWA 3PJ3A 3EN5A 3VJOA 3IOKA 4IE9A 4O21A 4YZ9A 4I3ZA 3DS6A 4DH8A 4QP1A 3LIJA 5M56A 1S9JA 3BEAA 1VZOA 4EK5A 3HP5A 3DDPA 3ATSA 1KE9A 2BRMA 3F82A 1BLXA 3IGGA 4FT7A 2HENA 4W8DA 4XOZA 5JRSA 3QL8A 1V0OA 2XM8A 4I0TA 3DA6A 3BWFA 3U4WA 4BCKA 5JZNA 3CEKA 1Q3WA 4R7IA 5ANKA 5TF9A 4QTCA 4IAZA 2BFYA 2I40A 2WTDA 3FC2A 4GCJA 5E8XA 2F2UA 4PNIA 4YJPA 3DZOA 5HLWA 2XYUA 3FPQA 3R7IA 2BRHA 3M42A 4BWXA 3PDTA 3TV4A 2E9OA 2XNOA 3LQ5A 2PK9A 4G1WA 2B9JA 3WF8A 4CG9A 3F69A 4LGDA 1NVSA 3L9NA 4I5MA 4CEGA 4ZSAA 1XBCA 5KKRC 4U0IA 4ZSJA 3GC8A 3DAKA 3G51A 2P0CA 2FSLX 4JR3A 4I6HA 4V04A 4RC3A 4BHNA 5LVOA 2VRXA 4LRMA 4L46A 1A48A 5J8IA 2WMTA 5L6WL 5J79A 5KBRA 1OBGA 3OBJA 4RQKA 1G5SA 4L67A 4DFLA 4DEAA 4MF1A 4C58A 5KMJA 1KE8A 2BRBA 5AUYA 3TKUA 2WU7A 3R8MA 3CGFA 3EQGA 3PG3A 5A54A 5BMSA 2J7TA 3F7ZA 3ZUTA 3Q5IA 3AOXA 2BHEA 3FMHA 2C4GA 3WOWA 5CXZA 3GFWA 3KXZA 3G6HA 3DZQA 2A4LA 1JKTA 4BCOA 4AOIA 4IAFA 2ZYBA 3K2LA 3LFSA 2ZJWA 2WIPA 3PYYA 4KAOA 4LOQA 1AGWA 1RW8A 3F3WA 5M06A 4XNEA 2IWIA 3ZFMA 4YSMA 3QGYA 4TYIA 3AC8A 3LCKA 2ETMA 2HZIA 3E63A 4FKPA 4C61A 4X2GA 2XA4A 4GFMA 4M12A 3TDVA 3EOCA 2Y4IB 5ANEA 1YDRE 3FUPA 5DHJA 1YDTE 2E9PA 5EQYA 4KRCA 3UMWA 3QRUA 3VUKA 5K5XA 3FI4A 4ID7A 3HRCA 2PY3A 5TE0A 3WF7A 2R64A 1CTPE 1M52A 5FTQA 4U79A 4XOYA 1WAKA 5BUJA 1J7IA 3WF5A 3CIKA 5BYLA 4MHAA 5CSHA 3UMXA 3QZFA 3KREA 2ONLA 4GYIA 4WUNA 3LLTA 4YMJA 4HPUE 1WBWA 3A7GA 1UNLA 3W55A 1WVWA 1H0VA 3MV5A 3BEGA 3FLWA 3SKCA 2R2PA 4U7ZA 4CMOA 3GC0A 2W0JA 4LL5A 1W83A 4E6AA 5CTPA 3R01A 3LQ8A 2UW7A 3F2NA 4K77A 1OKWA 4OTIA 4TWOA 5FP6A 4I6QA 4J8MA 4YTCA 1IA9A 1QMZA 3E88A 3ELJA 3KVXA 5CVFA 3K5UA 2BPMA 3E8CA 3TG1A 3RPVA 3W8QA 2OZAB 3O96A 3ZTXA 3V6RA 4FSRA 1CM8A 3R7EA 2IO6A 3Q52A 3ZCLA 1PXNA 4GT5A 5CSWA 4XEYA 4M66A 2ZAZA 4M8TA 3I5NA 2VWUA 1MRUA 4PP7A 1Q61A 4BCJA 4XYFA 1F3MC 5HCYA 4GG5A 3VS6A 1YHSA 5HE2A 4AZVA 3DDQA 1IASA 4FG9A 3MS9A 2VWWA 2WMBA 4EHEA 2VO6A 2C5YA 4MD9E 1Y6AA 3B8RA 4A9RA 2W5HA 2O2UA 3P7CA 3EQHA 4QP6A 5HO6A 5IQCA 3GCUA 4RVLA 1MRVA 2W1ZA 4MCVA 2R4BA 4EH3A 4DEEA 4QYGA 4PTEA 1OBDA 1GZOA 3BYUA 1B38A 3C9WA 2XRUA 1P4OA 2QOKA 1PMNA 3R7OA 5JH6A 2ZV7A 4C7TA 4Z7HA 2UZTA 2IVSA 2W5AA 3EN7A 3FPMA 4MAOA 4JBOA 3ZLWA 3CQEA 4C59A 3SA0A 4NJ3A 2B54A 2XNMA 4FTIA 4IB5A 4WHZA 1OPJA 4RRVA 4YNOA 4EONA 3SQQA 3DK6A 5K3YA 1LUFA 4QP3A 4EYMA 3LW0A 3KULB 5FEDA 2GHGA 2X2KA 5B0XA 3MDYA 5HCXA 5HBHA 3R71A 4UMQA 4YURA 2GNHA 2PZYA 5J7BA 3T3UA 1YW2A 2XIRA 3QQFA 4BTFA 4DFNA 5HZNA 5FDXA 3QFVA 2NPQA 1J7UA 3SOCA 1LEWA 3ORLA 3OT3A 2W05A 4IDTA 1YXSA 1FBNA 3RP9A 3JYAA 1KOBA 4IZAA 4EH5A 5A4QA 5G6VA 3DBQA 4U80A 2PVNA 3U9CA 2X8EA 2DUVA 4D9TA 2Y4PA 5IUGA 4DFZE 1BL7A 4AN3A 3R7YA 2J9MA 3AMBA 3CD8A 4QP4A 2JKQA 3DBEA 5FM3A 3QKLA 3FHIA 3FMEA 3HA6A 3K5VA 3MFTA 1IEPA 4ASEA 5A4TA 3TUCA 3HRFA 3ACJA 4IIRA 2VV9A 4OTFA 3KXHA 5FXSA 4CD0A 2BAKA 3FZTA 4ANNA 2BTRA 4I93A 2GNGA 4D1XA 2RG6A 4AFEA 2XIXA 4UEUA 3AQVA 2ITZA 2WAJA 5AR4A 2W96B 3TIYA 1ZOHA 1SNXA 4NT4A 4WNMA 5EYMA 3UO6A 4HZRA 3CC6A 2WGJA 3VBTA 5CX9A 4RJ5A 1ZLTA 3FWQA 3WZUA 4EJ7A 1JAMA 2WEIA 4F7NA 2WMAA 3QF9A 3MH0A 1Q4LA 2PMOX 3PP1A 3EIDA 1ZAOA 4F6UA 3V5TA 3NIZA 4O84A 5ANJA 4XG8A 5LJJA 5LVMA 4PRJA 4I5HA 3BI6A 3PP0A 1REJA 2VWIA 4RJ6A 2BFXA 2QR7A 3C0GA 1HOWA 2I6LA 3NUPA 2GQRA 1RQQA 3P86A 2YIRA 5FTGA 3FYKX 5E8WA 3L8VA 4XJ0A 4DEBA 3PSBA 4MF0A 1X8BA 4D9UA 4L6QA 5E1EA 3PUPA 2VAGA 4QMOA 4LUDA 3PY3A 4YZDA 3ZM4A 2RFSA 3NAYA 2OI4X 2J5EA 4DC2A 3R22A 3VBQA 3VS4A 4DTAA 5EFQA 3AT4A 4H05A 3UVQA 2GNLA 3GC9A 2XEYA 4CZTA 1J1BA 3PRFA 4IB1A 5E7RA 5HVKA 4G34A 3UP7A 1ZYLA 2VGPA 5DLSA 3V5LA 2WMRA 2R3GA 1YWVA 5M44A 2P4IA 3PXQA 1XQZA 3GU5A 4UWCA 5F95A 4X2NA 4O83A 1XR1A 2OIQA 2C6DA 4G9CA 2VTAA 1CSNA 3R9NA 4AGUA 3HV7A 3UNKA 3ORKA 2JC6A 5HBEA 3LFEA 4D1SA 4RX5A 4XCUA 1FMKA 4QPAA 2HXLA 4BRXA 3DTCA 1IR3A 4O1PA 1OZ1A 5AIKA 3QZGA 4E8AA 5GNKA 1RE8A 3E7OA 3G0FA 5AM7A 4AG8A 1LEZA 4KINA 4ZP5A 5AP4A 2GU8A 5T68A 4CT2A 5LMAA 5EDPA 3QD4A 3RI1A 3ZHPC 4YHJA 2UW8A 2QOBA 3CCNA 1OB3A 2VWZA 3F5GA 3POOA 3ANQA 4PMPA 3O0GA 4BCGA 4CNHA 4RJ7A 1NT2A 2XK6A 5HTIA 5IMXA 2G2IA 3R0TA 4QTEA 5EKOA 1JLUE 2A2AA 5HORA 3IK3A 3OD6X 2BHHA 3DKCA 4RGJA 5CALA 3UG2A 5E9EA 3WIKA 1JKLA 4RX8A 1CKJA 4ENXA 2QONA 5HG7A 3ZXTA 4BDAA 3NYOA 1B6CB 2JFLA 3CTJA 3NYXA 1UKIA 4FV7A 3QCQA 4D0WA 5K0KA 5BMMA 3RPSA 3CJGA 5FLFA 4AFJA 4Q2AA 3IONA 2OIBA 3L9PA 4QTDA 2GCDA 5L8JA 4BGGA 4GKIA 2H9VA 1PJKA 4Y85A 4UN0C 5DR9A 3SRVA 1TQMA 3I5ZA 4KBCA 1WBNA 3MY0A 2X1NA 2OJFE 4IM2A 4MQ2A 3QLFA 1ZYCA 2XKEA 2CJMA 3LMGA 2X4FA 5AP2A 3V51A 1PMEA 5J95A 4EZ5A 1PXIA 3IW6A 4KUJA 3RNIA 3Q4ZA 5ANIA 4FC0A 4RWIA 3OWKA 3P5KA 1YHWA 4FK3A 4Q9SA 1OIUA 2A19B 3COIA 4U8ZA 2YN8A 2XCKA 2PVHA 4ASDA 4F6SA 2ZB1A 4HZSA 3IDPA 3VQUA 4UZHA 3UO4A 4ZLYA 4H3BA 5EW3A 3JVRA 5FBOA 5HOAA 4FTMA 5BYZA 2PPQA 2YISA 3LCDA 4APCA 4EHGA 1R0EA 4GH2A 4FZFB 3BLHA 3DNDA 4ZMEA 3MW1A 3FE3A 3DTWA 1PXOA 1U5QA 3BBWA 4FZAB 4BL1A 1AD5A 3E8EA 1JNKA 3KY2A 3VW6A 3W18A 1H26A 4CMTA 4HCVA 2BZIB 3TT0A 3VS1A 1HCLA 3MFSA 4ZTMA 4OAVB 4PQNA 5L3AA 2G01A 2BAJA 2A27A 3R9RA 2G2HA 2WMUA 4OGRA 2B53A 4QYFA 3COMA 3H0YA 5JK3A 4Y83A 4DGNA 3U51A 3VF8A 4CYJA 5CT0A 1Q8TA 3UQFA 5C01A 3I1AA 2VTQA 1URCA 3QCSA 2YM8A 3Q4TA 3CLYA 3V5PA 1I09A 3VBWA 4UY9A 3ETAA 4KIOA 3RVGA 3VS3A 4NM7A 4EOJA 4EUTA 4IVAA 2J0KA 5AR2A 3WF6A 4FG8A 3T9TA 2B0QA 5IQEA 1PRYA 3OUNB 3ULZA 3R8PA 4RFMA 1PF8A 1H8FA 3FXXA 3SXFA 4CRLA 2ITPA 3H10A 3VS0A 2UZOA 2C6IA 3VULA 4DFXE 4EZ7A 3PVGA 2PZ5A 3BGPA 3BYVA 4FIHA 5IEYA 3IPHA 4FV1A 3QQJA 4USEA 4FGBA 5J7HA 5A4EA 2CNVA 3DT1A 4AOTA 5IG1A 3IKAA 4TN6A 3LE6A 4O7WA 3GU7A 3TL8A 2FUMA 2YACA 4XLVA 2PUIA 2R3IA 1JPAA 3NUSA 3VBVA 2YITA 4GJ3A 1WBPA 3OCGA 4O7LA 2C6EA 3KEXA 4JRVA 4WRGA 3R73A 4IWDA 5D7AA 1OKZA 3MVLA 4ZTRA 5CF4A 3PJ2A 3W2QA 4C37A 4KBAA 2BDFA 4ZTNA 2GDOA 3G2FA 3LXPA 1ERKA 4FV2A 4IB0A 5BYYA 2W17A 2I0EA 3H9RA 3PXYA 4N4SA 4FSQA 4FSWA 1DAWA 4X21A 3BHUA 5EM8A 3QA8A 5A6NA 4TWPA 3BU5A 3NDMA 3NVKI 3O7LD 3NVMB 4WIHA 4O2PA 4RX7A 3UOKA 4MKCA 3SW4A 3K54A 3VQHA 4NWMA 5E92A 3RK5A 4D2PA 4KB8A 5AMNA 1XO2B 4AW1A 2XBAA 4IVCA 3OXTA 4BCMA 4QPMA 3I6UA 4GT4A 2GPHA 3PSCA 2QR8A 2QLUA 4KD1A 4X2KA 4XX9A 2J50A 4CZUA 3OT8A 4FTNA 4RT7A 5EI6A 2AYPA 3F3TA 4Z16A 4FF8A 2XZSA 3S95A 4O82A 3FY0A 5HD4A 3R1NA 1GOLA 2X9EA 2YWPA 2C1AA 4GT3A 5JKGA 4V05A 5KMOA 3ATTA 4F0GA 4I5PA 4IAYA 2BTSA 5J9LA 3KMUA 1JSVA 3F5XA 4Y5QA 3KC3A 3QQGA 4IAIA 3HAVA 3M1SA 1UKHA 4YLKA 2VGOA 4X7QA 3VIDA 2QOCA 3PRIA 4FKQA 4FX3A 5K4IA 5KCVA 4DCEA 2YERA 4RFYA 3I7CA 3UC3A 1E1XA 1UU7A 2WU6A 3EHAA 1UWJA 3G9NA 3BIZA 3R28A 4NCTA 4G3DA 2BVAA 5DT3A 1K3AA 4BKYA 4FT3A 1PMUA 3CQUA 3MH1A 4TYHA 3VHKA 5IPJA 5CYIA 4X6QC 3GB2A 5KZ0A 1P4FA 4JBVA 4D58A 5KMNA 3C5IA 1YWRA 1ZY4A 5D12A 4D0XA 3NNXA 3MH2A 2NP8A 4H3PA 4DN5A 4E73A 4J98A 2J6MA 3C5UA 3QTSA 4EH2A 5LMKA 4ANOA 4O7TA 2OXYA 4LGGA 3L9LA 2VTHA 3N4UA 5EW8A 3OVVA 4AP7A 5J1VA 4HYHA 3BZ3A 4UMUA 4W4YA 4Q5HA 3Q2MA 3OTUA 4XG4A 3V8SA 5GHVA 3QZIA 5EHOA 5AP3A 2A0CX 4IVBA 5DH3A 3VNTA 2X7OA 4WG5A 4USDA 3L8SA 5DG5A 3O51A 4YO4A 3M2WA 1PW2A 3PIZA 2R3KA 3AC5A 2G1TA 3EQRA 3MY5A 4MBLA 4DH5A 2OIDA 3DBCA 4O0WA 3GGFA 3FLNC 4JX3A 5EM5A 2IG7A 4H1MA 5CEQA 1Q97A 1V0BA 4OTPA 5CAQA 5ITAA 3RJCA 4YHFA 2Y7JA 1W84A 3MSSA 5HGIA 2WQMA 4NTSA 4PX6A 1BUHA 4FVPA 5CWZA 1Y8YA 3BLQA 4LRJA 2IPXA 5AV4A 2KULA 4DHFA 2BDJA 2CKOA 3UOLA 3PPZA 4F64A 3Q4UA 5AV3A 5AP1A 4CFNA 4PL4A 4YZNA 2PULA 3FL4A 2ERZE 2R3FA 4ZSGA 3KRJA 4Y5HA 5ANGA 5IQGA 3Q9YA 4ORKA 2GNIA 4IADA 1WBSA 3H30A 1Y6BA 3QD0A 4O91A 2O63A 1YXUA 3ZBXA 1ND4A 5AUZA 5IA1A 4D5KA 4J99A 3LFQA 1OL5A 3R6XA 1VJYA 3V8TA 4D2RA 2ITVA 5IA2A 5K5NA 4GYGA 4NJDA 3QBNA 3ET7A 3HP2A 2ZV8A 3C4FA 2Z8CA 3QC9A 3R7GA 1YWNA 4A4LA 1PYEA 4NEUA 4FKLA 1KWPA 4I6BA 4BBMA 4EK8A 3EZVA 3EFJA 4YC3A 5AIRA 3OWJA 3TUDA 4HYIA 4QNAA 3B2WA 1XH5A 2CHLA 3MBLA 4XV1A 3HECA 4AW0A 3FMMA 1U54B 3A60A 3EQDA 3IDCA 1T46A 4B7TA 3ODZX 4UMPA 2WPAA 4FL1A 2QG5A 2OXXA 3MVHA 2DWBA 5ETIA 4D4SA 4R78A 3G5DA 4AZSA 2OJIA 4ZY6A 4ZLZA 4U6RA 1F0QA 2YIQA 3AC4A 3E3BX 2BILB 2IZUA 4PPBA 5DWRA 2YM6A 2ZM4A 2FA2A 4FTAA 2F7XE 5HX8A 4AA0A 1NW1A 2UZLA 5T6KA 3E62A 4PY1A 3BU3A 2QU5A 1E9HA 4P4CA 4ACGA 2HY81 3A7JA 4E26A 3GCSA 3LFAA 2JBOA 3C4CA 3TNQB 3ITZA 1Q99A 4EEVA 1YVJA 3C51A 3E3PA 4G3FA 3L9MA 4NW6A 1OKVA 5EW9A 4F1TA 3OEZA 4U41A 4E4LA 5I9VA 2PSQA 4EKLA 5B7VA 4II5A 5CU2A 5KMKA 4QO9A 2J0LA 4JQ7A 4C4JA 5H3QA 3QTWA 2HZ0A 3DB6A 4KNBA 2ONLC 3A61A 3Q9WA 4BHZA 5LVLA 2BR1A 2YDKA 1Q5KA 1XJDA 1REKA 3KVWA 5EQPA 3R1QA 5C8MA 5F94A 5EI2A 3KKVA 2J0IA 4BC6A 2QOLA 2Z7SA 3CY2A 3FQHA 3VRZA 1Q8UA 4BICA 5J87A 5JEBA 2PVRA 3BQRA 4K8AA 2QKWB 3LVPA 2OH4A 2WMXA 3QTIA 4IZ7A 2XK3A 4L7SA 5EQEA 5I0BA 2BUJA 2WOTA 3FKOA 2WQOA 1YI6A 4E5BA 1FVVA 2XJ0A 4UXQA 5AAGA 3MJ2A 4I4EA 4F6WA 3EFWA 3T3VA 4ZSLA 3L1SA 4PF4A 5LVPA 2X39A 4MWIA 3E7VA 4MXAA 4WUAA 3R9DA 1JKKA 3UVPA 3ANRA 5L2SA 2HW6A 2XEZA 2R3JA 2G15A 2EWAA 2PE2A 4FKWA 1W8CA 3H4JA 5HICA 2BKZA 4BWKA 1OVEA 4FKIA 2P2IA 3O8UA 1XKKA 3KGAA 4ENYA 4YTFA 2XK8A 2RFDA 5FDPA 4DBXA 5DR2A 2GFSA 3ZS5A 4EBWA 3A8WA 3BQCA 3U6JA 3UYTA 1OL7A 4JJRA 4R3CA 2VTNA 1Q8ZA 4C02A 5M08A 2VTTA 3GFEA 4BDCA 4EH4A 4DAWA 4FMQA 4FZ6A 4FYOA 4IW0A 3RKBA 3SOAA 4HJOA 4KA3A 2O65A 4EOMA 5J9YA 3LXLA 3MPTA 3GP0A 2VX0A 3Q04A 4QNYA 3PJCA 5EOBA 3NSZA 1OL1A 2CGVA 2JIVA 4RX9A 1YKRA 3FV8A 1U4DA 3UIMA 4YZMA 3CKWA 3ENHA 4BDEA 5IUHA 4FR4A 2OGVA 1IAJA 5D11A 1Z57A 4ACDA 4L01A 4GK4A 1RDQE 2WXVA 4GVJA 5AR7A 1STCE 1OIQA 4FIIA 4D2SA 4CQEA 3V5JA 2CNUA 4DT9A 4DCAA 4I6FA 3OG7A 4JVGA 3G90X 3V04A 5CAUA 5HLNA 4OUCA 2ITNA 1XH8A 5KHXA 2EUFB 3NUAA 4PTGA 2XB7A 4I1ZA 4EOLA 1PYXA 2RKUA 3DFAA 3QUDA 4CFFA 4UV0A 3LKMA 4WA9A 5EI8A 2WEVA 3HGKA 2ZM3A 1YDSE 5JQ8A 3SXRA 1K2PA 1UU3A 3FZPA 4HPTE 3ORTA 4U81A 4KRDA 2XKFA 5H8BA 5FGKA 4ZIMA 2Y4IC 3RK7A 4FNXA 4M3QA 1MRYA 4KBKA 3BBTB 4GRBA 2F9GA 3SD0A 3R7VA 4M7IA 5JN2A 3EL8A 4U5JA 4PWNA 4O81A 3VC4A 1YQJA 4ACCA 2QO2A 2ITQA 5I3OA 4D2WA 1FINA 3C7QA 3DXQA 1H0WA 3QTRA 5GZ8A 1NVRA 4F09A 3AD5A 1OUYA 2PVMA 3G9LX 4I23A 2B55A 2XNPA 4ZLOA 3GVUA 5C8KA 2F2CB 3TZ7A 4AA4A 3WYXA 5GJDA 4QMMA 2JKKA 5L2WA 2V62A 5FM2A 4OTWA 3R30A 4RWJA 3U6HA 4ANBA 4F0IA 3TV6A 5CEPA 5JFVA 2Z7QA 4FNZA 2R3NA 1OIRA 4KABA 5AR3A 4OAUC 1PY5A 3FLSA 4FT9A 4MXCA 4D28A 2QODA 3KCFA 1HCKA 1CKPA 3AGMA 1OUKA 3F3UA 1J91A 3KQ7A 2C5VA 4Y46A 4R8QA 4L42A 4FV8A 2FSOX 3HDMA 5E8VA 3OCSA 1IA8A 4O6LA 3RHKA 2XCHA 4TPTA 3OZ6A 4C2WA 4R1YA 3WE4A 2JIUA 2WB8A 4TYJA 5FQDC 4DINA 3QU0A 4RQVA 4CVAA 2YIXA 5CEMA 4NM0A 3QCXA 4AXAA 2XKDA 4U3ZA 3QQUA 3RCDA 4FV0A 5HIBA 4X3FC 3UNJA 5D7VA 4DITA 4RJ8A 3FMKA 3R2BA 4EQUA 2W5BA 3VWAA 5JSMA 2YLEA 3T9IA 3BGZA 2ITWA 4QD6A 4O7ZA 4HCTA 3OF0A 2H6DA 3U4UA 4LYNA 2CKEA 3ZC6A 3AMYA 3PJ1A 4FV6A 2PL0A 2NRYA 2R3QA 4DEHA 3PXZA 4QMQA 2UVXA 3MN3A 2ZVAA 4JXFA 5ACKA 4ZY5A 5KUPA 4TKSA 4QQ5A 3MIYA 3TACA 3LHJA 3TM0A 5CVGA 4GFOA 3E93A 3MY1A 4R6VA 5CY3A 3QXPA 4G6LA 1H1WA 4IJ9A 4BZOA 5F4NA 5D1JA 4M69A 2X8IA 4J95A 4BCIA 2EXCX 4YLJA 2C3IB 2QOHA 2O5KA 4WSQA 3OWPA 5IQIA 4EK3A 1FGKA 2I7QA 2UUEA 1CDKA 4FYNA 4EH8A 3ZO3A 3ROYA 3EQBA 4UZDA 4AACA 2O3PA 3NW5A 2YM3A 4MNFA 3PE2A 3WYYA 1J3HA 5IKWA 5IH5A 1IG1A 4BKJA 2J0MB 5M4CA 3QWJA 4I0RA 4EQCA 3PPJA 3RWQA 4L8MA 3NYNA 2W1DA 4RIXB 3T8OA 2C68A 3P7AA 3DB8A 5BVKA 3S4QA 5ACBC 2C6KA 1Q41A 2CDZA 4PP9A 1YI3A 2F49A 4HCUA 4X3FA 3BHYA 5CSVA 5EG3A 3SGCA 3JR1A 4PV0A 4S33A 3CQWA 3BHVA 3WF9A 4C8BA 1FMOE 3AGLA 4YBKA 4QYHA 2JD5A 4EH7A 3KF7A 2W99B 3CGOA 1YOJA 4CV9A 3MH3A 5E8ZA 5HX6A 1M2RA 3FYJX 3MA3A 3TJCA 3CSVA 4RFZA 2B52A 3O23A 3IO7A 3H9OA 4YU2A 4HNIA 5HTBA 5JRQA 3TUBA 3ZU7A 3WE8A 4G6NA 4BI2A 2W4JA 2C47A 1ZRZA 3KRLA 3MB7A 4IM3A 4TYHB 5FEQA 3NNWA 3H3CA 3LXKA 4W4VA 4FSTA 4ZTLA 2ZV2A 4BVUA 4RG0A 4DGMA 4I41A 3R9HA 3RAIA 4RBLA 1Z9XA 2GHMA 3R1YA 2W9FB 2C0IA 4FEQA 1G3NA 3D7TB 1JKSA 1OL6A 2YA9A 4TWNA 4XMOA 5B2KA 3WILA 5CEOA 2W4OA 2PYWA 2JDTA 5EM7A 5DFPA 4Z55A 4KIPA 2HYYA 4ZXTA 1URWA 3AD6A 5IF1A 1H4LA 2P2HA 3FMLA 4MNEA 4F70A 5KMIA 4RIOA 3BE9A 3RPRA 4BYJA 4FVQA 2G9XA 3QWKA 4JDKA 4QMTA 1DAYA 3GOPA 3RPYA 1M2QA 4WO5A 1W98A 1CMKE 1GY3A 2FH9A 2IVVA 2W1CA 3NW7A 4FKGA 4GW8A 4Y95A 5DRBA 3KA0A 2YCFA 4PPCA 2OZAA 2OJGA 3R02A 4AW2A 2I0YA 2XP2A 3FJQE 2P33A 3JVSA 3UPZA 1O9UA 3V5WA 1NXKA 2FGIA 2IVTA 4PPAA 3QKMA 4LV5A 2YWVA 2JKOA 4FV3A 5CENA 3A62A 4YTIA 4MEDA 5BVDA 4AZWA 2R3HA 3DK7A 4FUXA 4RVTA 4FTRA 5C03A 3N4TA 2X9FA 3EQIA 3OP5A 4JBQA 3PXRA 3Q9XA 3QQLA 3LFFA 4GIHA 4HGEA 4C34A 1QPDA 4FEXA 3QUEA 2WO6A 3F61A 4RPVA 1K9AA 2QO9A 5H8GA 2HY0A 2C0TA 4LG4A 2C5OA 2HIWA 3HV4A 5CAPA 2EU9A 2VTMA 2Z02A 2H34A 3HMNA 2C30A 1U46A 5LMBA 4NH1A 4IC7A 1Y57A 2VTIA 4UMTA 3R8UA 2C1BA 4QT1A 3F66A 3RBWA 4ANLA 2VWYA 4IH8A 4X0MA 1P2AA 2WOUA 4U3YA 3UIUA 4RIXA 4BCFA 4IX3A 3U54A 4KWPA 4FSMA 2EXMA 2XMYA 4ALUA 1PXMA 3PA5A 4O7RA 1JQHA 5HG8A 1TQIA 2Q0BA 2QOIA 4MWHA 1APME 1BYGA 3A8XA 3OS3A 3NPCA 3FHRA 4H36A 5EH0A 3VS7A 5K9IA 4RC2A 3LCTA 2J90A 4AWIA 3Q96A 2WTIA 4OBQA 5EM6A 1LPUA 5M57A 3LFNA 3TDWA 3O71A 4LUEA 3CY3A 2GNFA 3ZEPA 5HE1A 4B99A 4EC9A 5B2MA 3NCZA 5JGDA 3GUBA 4ZOGA 2Z7LA 3ZBFA 2XNNA 4F1OA 5HNBA 2XK9A 3R21A 4FL3A 4N6ZA 4ZS0A 4BDDA 1FPUA 4TNDA 4I4FA 4DFUA 2RFNA 3B8QA 1U54A 3PIYA 4NM3A 4BCHA 4CKJA 4FG7A 5L6PA 2YZLA 3UBDA 3LM0A 4NIFA 5CU3A 4A9YA 4TL0A 2WELA 1UNGA 2PVJA 4EWQA 4B0GA 4EBVA 2XYNA 4P5QA 5C4KA 4C2VA 4PNKA 4OBOA 3P08A 3ZO1A 4L3LA 2ZDUA 4QYYA 5BQ0A 4TW9A 5I3RA 5AUUA 4C3FA 3GBZA 4DH1A 4LI5A 1AQ1A 5HO7A 5KBQA 1IAHA 4DFBA 4CFMA 3II5A 3TEIA 3TCPA 5IDNA 3UC4A 2F4JA 4AU8A 2J4ZA 5AAFA 4MVFA 5AUTA 2X2LA 4EYJA 3OBGA 1VYZA 3CXWA 4UWYA 1PKGA 4AN9A 3JY0A 5DRDA 2DYLA 3IG7A 2GTNA 2R3LA 2C6LA 3C4ZA 5J9ZA 2XIYA 5ANOA 5KO1A 3H9FA 4IX6A 5IA3A 4FTUA 4FTQA 4EQMA 3U87A 4R77A 5JT2A 2UZUE 5A46A 5BNJA 3TKHA 2ZB0A 3BV2A 4DG0E 2QOQA 4S2ZA 2EB3A 3VVHA 1Q8YA 2VUWA 3MYGA 1SVGA 5H2UA 3UOHA 3QXOA 4YJTA 4NZWB 3HNGA 4G3EA 1QL6A 4G31A 3LCOA 4TXCA 2OWBA 3GI3A 5K0XA 1SVEA 4FTOA 5HHWA 3W16A 4FE2A 3OTVA 4EWHA 4FIEA 4UWBA 3VUGA 4BWPA 3U6IA 4JQ8A 3DJ7A 5FRIA 1PXLA 4RSSA 3UQGA 5JMSA 3KFAA 3DXPA 3E5AA 1V1KA 2YABA 3RALA 4GUBA 5HNIX 2V7OA 4NSTA 2NRUA 2IZTA 3VS2A 2PMNX 4R5YA 3ZXZA 4YNEA 4HVSA 4NCTC 3PY1A 3P23A 4DEIA 4MX9A 3Q53A 4FZDB 4OTDA 1PXJA 4KS8A 3CD3A 3FQSA 3LPBA 4PMMA 4G6OA 1O6KA 3D15A 4C4HA 4N57A 2IZRA 5AP5A 2OU7A 1GIHA 3MPAA 5CS6A 1J1CA 3V3VA 4W9WA 3GT8A 2RGPA 2AC3A 3TXOA 3G15A 4FSNA 1PHKA 4XP2A 3UE4A 4CT1A 1Y91A 4WD5A 4AOJA 3GC7A 2B1PA 3FI3A 2IZSA 5IQBA 1UNHA 5KMMA 3FC1X 3ZFYA 3CS9A 4APPA 1FGIA 3NLBA 4O7NA 3PG1A 3ALNA 3C4EA 3VUIA 3LAUA 4IX5A 3AC1A 4UYNA 1R78A 3D0EA 3EYHA 3HX4A 4FODA 4FTLA 2OLCA 4XRLA 4I20A 4C57A 5KKRB 2C6MA 4EC8A 3QA0A 3OW3A 2VTOA 2HCKA 4K0YA 3PLSA 1OL2A 3QQKA 4JI9A 5HG5A 5KHWA 3F5PA 4I0SA 1R39A 4LFIA 3LFBA 2WQEA 3F2AA 1H01A 4ALVA 3SG9A 3NNUA 3MVMA 3IW5A 3ORMA 4U9AA 5ETCA 5G1XA 2GQSA 3S00A 1JOWB 3HAMA 3TZ9A 3UGCA 4I94A 2QNJA 1H1QA 1ZMVA 4AF3A 3P0MA 3RM7A 3K3IA 2QCSA 3EYGA 2X2MA 1M7NA 2B7AA 1ZYSA 3EZRA 3R8VA 4DFYA 1YHVA 2BMCA 4E6DA 4GL9A 1KV2A 4QP9A 2WMWA 4OT5A
chains in the Genus database with same CATH superfamily
2X6DA 2I1MA 5LCKA 3NAXA 4DTBA 3QYWA 1MQBA 4JS8A 3EN9A 1OITA 2IW6A 5KZIA 2B9IA 4QEBA 4JRNA 1GZKA 1UV5A 5BPYA 4ZY4A 4KIQA 2C5XA 3D14A 5CAVA 5IH6A 2HW7A 5HE3A 5CEIA 4BDBA 3MIAA 5CASA 3S3IA 4YC6A 4EK6A 4WT6A 3W2CA 4OTQA 5E1SA 4ALWA 4Q9ZA 2OG8A 2YDJA 1H1RA 2YIYA 3BGQA 3RWPA 4AUAA 4F7LA 1U5RA 2XAMA 4RJ4A 5FXQA 2YZAA 3ZRMA 4A9SA 5JFXA 1G8AA 5AV0A 2X81A 3C4WA 4QMYA 5EYKA 4L7FA 3GU6A 3QTUA 5M4IA 4QMLA 4AE9A 5AX9A 4FGRA 5AWMA 4L3PA 4O22A 1QPJA 4JOAA 4KIKB 2PTKA 3MTFA 4C4IA 5GIPE 2W1IA 2H8HA 3PIXA 5IA5A 3VN9A 1DM2A 4V0GA 3CP9A 5J5SA 2WTKC 3R8LA 3TKIA 2CGUA 4DYMA 1UU8A 2BRNA 2BZHB 2CCIA 2R3PA 3N51A 4E6CA 3KB7A 4QOXA 2PVFA 3QTZA 4PUZA 3KIOC 3R83A 2YM7A 4QQCA 4NUSA 4R3RA 4F9WA 2W06A 2X6EA 4YJQA 3N9XA 4X6RA 3FXZA 4UALA 5CANA 5AADA 3UDSA 2W1HA 2PUNA 5A14A 4JIAA 4FSZA 4YHTA 5DOSA 5FWKK 5FBNC 2GTMA 4GFGA 1TZDA 4ITJA 3HA8A 4LOPA 3UZTA 1W0XC 5EYDA 3NEWA 3D83A 4O1OA 4BDKA 2C5NA 3BCEA 3PZEA 2ZM1A 3TWJA 2UW4A 1SM2A 4W4WA 5AR8A 4HGSA 3GQLA 3OROA 3POZA 4G9RA 3HUCA 4M68A 4FT0A 2C3KA 3HMPA 2O8YA 3IOPA 4YJRA 2WTVA 5DNRA 4FNWA 2PU8A 2W4KA 1XWSA 4JQEA 3LLAA 3F2RA 3KXXA 3O50A 5JZJA 5LWNA 2HWPA 3QD3A 4L53A 3UPXA 5A6OA 4QMUA 4JAJA 1FQ1B 1XH9A 1YXTA 3IQ7A 3QQHA 5I9ZA 3ORZA 4XG3A 3ODYX 3P1AA 4RWLA 1A9UA 4NKSA 1WMKA 4AW5A 4G16A 2QKRA 2UZDA 3CTHA 4YJVA 3HMMA 5E91A 3LOKA 2OJJA 4F9YA 4F99A 4XG2A 4FKOA 4DEGA 4F65A 2WHBA 5D9HA 4DG3E 3JY9A 3C13A 3DQXA 4J53A 2XJ2A 5HIDA 2ESMA 2YJRA 4CYIA 5CU0A 4JDIA 4BIDA 5DE2A 3CBLA 3GQIA 2XH5A 2YLFA 1WVXA 4ITIA 1WCCA 2BIYA 5AUWA 3F6XA 4I21A 1L8TA 4IAKA 3N4VA 4UMRA 5L2IA 4ZMFA 3DLZA 1KSWA 4RVMA 4FV9A 4M67A 5EDQA 4BTJA 4PMSA 4KKHA 2GS7A 3BX5A 4XUFA 4BI0A 3EMGA 4O0UA 3NCGA 2VNYA 5H9BA 2BCJA 4Z3VA 5EDRA 3KMWA 4LOOA 2DQ7X 4FTCA 5BUIA 2PZPA 3OEFX 3OW4A 3FBVA 2E9UA 2GQGA 5F9EA 2JGZA 4ZZNA 3GCVA 2OF2A 2F7EE 2JAMA 2OFVA 3RAHA 4CSVA 4C4FA 1W82A 4C38A 5BVFA 4GUEA 3ORIA 2LGCA 3AXWA 3AT2A 1GZ8A 3MFUA 3ULIA 2WTCA 3JPVA 4AGDA 2NNWB 4W4XA 3FSKA 1GZNA 2OZOA 3UG1A 3BYSA 2WTJA 4KIKA 4IZ5A 4NFMA 2REIA 2XIKA 4YP8A 1MQ4A 1O6YA 4L43A 4YJSA 3ZYAA 2C0OA 4E20A 4AXEA 1Q62A 3D2IA 4G17A 4KKGA 1H25A 4XP0A 5D10A 4F9AA 1GJOA 4DHJA 2XM9A 5CT7A 2UZEA 5ANDA 4RIYB 3WZJA 4IXPA 4I6LA 1FOTA 3UNZA 4QQTA 5FXRA 4CGAA 4EOOA 3AT3A 2F57A 1WFCA 4O0TA 2QG7A 4GJ2A 4JNWA 3TV7A 4F7JA 3S0OA 4FTJA 4UXLA 1YXXA 3DLSA 4TNBA 2WD1A 3BV3A 2E2BA 3F9NA 4LL0A 4QPSA 3THBA 3H0ZA 2YHVA 4QMWA 4PL3A 2W9ZB 5HVJA 3LFCA 3NYVA 3OHTA 3EKNA 4BYIA 3DQWA 3QRKA 2I0HA 4MBJA 2OKRA 4QP8A 5JGBA 4RWKA 4EHZA 3LJ0A 4ACHA 3IGOA 1GNGA 2JITA 4O0SA 3G33A 4TYGA 1WZYA 3UVRA 5AUXA 4EOPA 3BPRA 3PXFA 2CSNA 2J51A 5GINE 4F63A 3HRBA 1BI7A 3L8XA 3E8DA 2ITUA 4FT5A 1KE6A 2YIWA 4G5PA 3FMJA 3KRXA 3OXZA 4ITHA 4R7HA 1KE7A 1ZZLA 2RF9A 4RIWA 1OM1A 2CNQA 5DEYA 3VHEA 4M13A 3Q60A 4O96A 5BVOA 1VR2A 3ALOA 4GIIA 3VUTA 4IACA 1XBBA 3CJFA 1Y8GA 4BZNA 4ZZOA 4BJJA 3NS9A 3DAJA 3SHEA 3KU2A 4S30A 2R3RA 1PXKA 4RZWA 3VS5A 4E7WA 3EH9A 3GU4A 4DH3A 5A4LA 1P14A 2XKCA 4A4XA 4XG7A 4ZK5A 4AXDA 2QOOA 4IWQA 4S31A 1Q24A 3UYSA 3LQ3A 4CCBA 4ZJIA 1G8SA 1ZARA 4QMPA 5AR5A 3OCBA 3WARA 3EB0A 4P7EA 4XS2A 1Q3DA 4DT8A 2AC5A 4F9CA 3MESA 3RZFA 4M0ZA 4EK4A 1OGUA 2UW9A 4FEUA 4BF2A 2HXQA 4AZEA 2R3OA 2JDRA 4C33A 2V0DA 3AC3A 4JMQA 2JDSA 3EN4A 4CFXA 3HUBA 1KE5A 4FVRA 3FAAA 4PDOA 2H96A 3O17A 4EKKA 4LQMA 5DGZA 2ZDTA 3NR9A 4WG3A 2UZBA 2QOFA 2VO3A 4G3GA 1SZMA 3BKBA 3PA4A 5HI2A 4CTBA 5I9YA 3QHRA 5L2TA 4JG7A 5CVHA 5IZFA 4IBMA 3W0SA 4DA5A 3OC1A 5KX8A 3SV0A 4JT3A 2R7IA 5C26A 1H24A 2CLQA 3ORPA 4M69B 3NUXA 4H3QA 3FEGA 3CKXA 3PVUA 2OXDA 5LXMA 1U59A 2G2FA 3NX8A 3ZEWA 3RK9A 1KUTA 4U40A 2XNGA 5ETAA 3EN6A 3DXNA 2FSTX 2VX1A 4FBXA 4IWPA 5M51A 4FNYA 3VUHA 3Q32A 4OBPA 4IMYA 1XH4A 2RSVA 3D7ZA 5HVYA 4B8MA 2RL5A 1H1PA 2IW9A 3RCJA 4YC8A 4M84A 3BE2A 4BDGA 4DF3A 4YR8A 4FEWA 2FSMX 2C6TA 1JBPE 3CE3A 3GOKA 5D41A 1TVOA 3HKOA 4FL2A 5C9CA 5HTCA 5L8KA 3UDZA 4A9TA 3RZBA 3HV6A 5CNOA 1XBAA 4D5HA 4YZCA 2RFEA 3AMAA 3P78A 4HGLA 3OOGA 5EHYA 2VTLA 3GNIB 3MTLA 4E5WA 5CNNA 2FB8A 4QTAA 2QQ7A 4RJ3A 5DIAA 1KV1A 4IJPA 5CZIA 3QC4A 3ZZWA 3EFLA 4AGWA 4M97A 3FL5A 4U97A 3Q6UA 5CF8A 4R5SA 4E4NA 4HVIA 3QZHA 3F5UA 3O8TA 1DS5A 3R8ZA 5AP0A 3ZRKA 2QURA 5TR6A 4BCPA 4O7YA 5FG8A 4ZZMA 4ZJJA 4ACMA 3TMOA 2X4ZA 4QRCA 4WG4A 4NFNA 4XRJA 2IN6A 3ZUUA 4BGQA 4FTTA 2OO8X 3QTQA 5HO8A 4F9BA 4F7SA 5A9UA 3Q2JA 4TTHB 4EI4A 2J2IB 3TI1A 1ZYDA 3KXGA 4WNPA 3GCQA 3I81A 2P55A 4CFUA 2Y6MA 4MYGA 2VTSA 2GMXA 3GCPA 3NNVA 2QU6A 3DBDA 2IW8A 3ZO2A 4IDVA 3A2CA 4D2TA 4EL9A 5CSPA 1YOMA 5LVNA 4NKAA 1M14A 2UW5A 3LXNA 2VWBA 3Q9ZA 4W9XA 3ZLYA 3P9JA 4AS0A 4FSYA 3QALE 4CCUA 4F4PA 2J5FA 2WIHA 2YCRA 5E8YA 1I44A 3PWYA 2QD9A 4J96A 5BVNA 4MK0A 5IU2A 3MB6A 1PKDA 4OR5A 3KMMA 4CXAA 3GENA 4YLLA 3R7UA 3GU8A 4HOKA 3EQPA 4NYEA 1M2PA 4J1RA 4ERKA 4S34A 3ZFXA 3MI9A 2BIKB 2WMQA 3HZTA 5JFSA 4MBIA 5TT7A 2XNBA 4JAIA 4AQCA 4USFA 1KOAA 3I0OA 4WNKA 2YAAA 1BKXA 1NA7A 2PUUA 2QVSE 4N6YA 4WBOA 4BBFA 3UDTA 4O27B 4FKVA 3P4KA 4DLJA 1OMWA 4QTBA 2ZMDA 5GJGA 5TOZA 1R0PA 4FOCA 3W2RA 2BRGA 4AA5A 4BB4A 1OPLA 5EYCA 3W33A 3O7LB 3W2OA 5IDPA 4OLIA 3E92A 3KRRA 3PUFC 3BHTA 4O6EA 3MA6A 2V7AA 4FI1A 3PJ8A 4V01A 5HCZA 5KMLA 2BROA 4ONAA 2X7GA 4XG6A 3BRBA 3EQCA 2JFMA 5CQUA 4E4MA 3CR0A 3PZHA 4YBJA 5IISA 5DYJA 2Q83A 2X8DA 3G0EA 5CI6A 4HVGA 2VO7A 3ZMMA 1F5QA 1QPCA 4FOBA 4MXOA 2XBJA 2HZ4A 3A99A 2XIZA 2ERKA 4XHKB 3LJ1A 1WBOA 1LR4A 2CGWA 2SRCA 2VTJA 3WI6A 4BCQA 4CRSA 3PWDA 2OK1A 4E93A 2HZNA 2VN9A 2C3LA 4ZTQA 2BKKA 2FYSA 2WQBA 3TJDA 5L6OA 4XBRA 5IH4A 4EOSA 5HLPA 3DBFA 3LCSA 4JR7A 3OY3A 3PY0A 3V6SA 3WZEA 1QPEA 1BI8A 3I60A 1E1VA 3F3ZA 3SAYA 4G3CA 4IB3A 4E5AX 1S9IA 1JWHA 2OSCA 1OPKA 4M15A 4BIEA 4QDEA 3UZPA 3Q5ZA 4O2ZA 2BAQA 3O8PA 4P5ZA 2PZIA 1Z5MA 3MGYA 4KKEA 4QMSA 4DLIA 4NIFB 3QHWA 2ITXA 3FI2A 3SXSA 2YDIA 5HD7A 3OFMA 4O0RA 4QP7A 4A4OA 4FSUA 3ZSHA 2HAKA 5AUVA 3RAWA 4I24A 4RMZA 2CMWA 3VAPA 4AX8A 3BHHA 4J8NA 3KK9A 4GSBA 4RLLA 4FTKA 3EQFA 3HL7A 5AX3A 3CTQA 3NMUF 1B39A 3TTJA 5DT4A 1M17A 5DA3A 1M7QA 2GS6A 5FTOA 2VO0A 2XK7A 4C3RA 3DK3A 5JGAA 3UO5A 2WMVA 3KRWA 4WNOA 5A3XA 4FKSA 3VW8A 4KS7A 5E90A 3PFQA 2OBJA 4GU6A 5BUEA 1GIIA 4PDPA 5TKDA 4D1ZA 4XP3A 3LJ2A 4K18A 4K2RA 3C1XA 4XV3A 3S1HA 1SYKA 4ZTSA 2XNEA 3IW8A 4E1ZA 4C36A 5L8LA 4TZRA 2WTWA 1UA2A 3QTXA 4C3PA 4H39A 4X2FA 3NUUA 2DS1A 3ACKA 3ZLSA 3TZ8A 3VONA 4CV8A 5AEPA 4FKJA 2UVZA 2PVKA 4XV9A 5M07A 2UZWE 2VU3A 1ATPE 4YJUA 5HU3A 5DI1A 4IFCA 1RJBA 3TNIA 4DTKA 4XV2A 1UWHA 2B9FA 1JVPP 4U42A 4CFWA 3SDJA 5ICPA 1Q8WA 4IANA 4X3FB 4D4YA 3PE1A 4GKHA 2XANA 4DGLC 3ZC5A 2YJSA 5IUIA 4ZSEA 3KN5A 5AV2A 5I9XA 3NWWA 2ETKA 3RAKA 2VZ6A 3CPCA 4BKZA 4RVKA 4YJOA 2WFYA 4BFMA 4UBAA 3OWLA 1FVTA 3KXMA 4FA2A 2PUPA 5FUTA 3SW7A 3I0QA 4L52A 3FKNA 3W32A 5LWMA 5CU4A 4ZAUA 1SNUA 2CPKE 2VX3A 4KSPA 2UZNA 3PPKA 2E9VA 2O0UA 2YM5A 3G6GA 3TN8A 2CLXA 3FMNA 3OUKA 3A4PA 4H1JA 4B8LA 3R04A 4QMXA 4HGTA 2VNWA 5CLPA 1JSUA 2FO0A 3JS2A 5JFWA 1WVYA 1H28A 3D5WA 4BDHA 4Y8DA 2ZV9A 4P2KA 4PL5A 5M53A 2OJ9A 4C35A 4DEDA 4JL9A 4WRSA 4QMZA 1ZXEA 3MPMA 3QRIA 3ZDUA 3D5VA 3D7TA 1ZYJA 3PVBA 3QX4A 1IRKA 4LM5A 4CMUA 4E6QA 5L4QA 5HG9A 4G2FA 3R9OA 2B4SB 2JIIA 2OH0E 1P5EA 4U45A 3PA3A 3BLRA 3EJ1A 4EJNA 5DMZA 2JDOA 1H07A 4MNEB 4HYUA 3L8PA 4MD8E 2R5TA 3W2SA 2UW3A 4FIFA 1W7HA 2XVDA 4GVAA 1TQPA 2PMLX 4C4EA 2UW0A 2Y0AA 2ITTA 3I6WA 3PLAE 3UZRA 3QX2A 1WBVA 4IZYA 3FZOA 4J7BA 4L9IA 4MXZA 4C62A 5DVRA 4R7BA 1YI4A 2UVYA 5J1WA 5IA4A 3HMIA 5CI7A 3JXWA 2HOGA 3NFFB 5M55A 3EFKA 3LMHA 4NK9A 2UV2A 3HVCA 4IQ6A 4MXYA 2R3MA 4O86A 2Q0NA 3ERKA 4FIGA 3ID6C 2HWOA 2PE0A 3O2MA 3FZ1A 1DI9A 4GK2A 3FKLA 4FK6A 4JG6A 3DKGA 3QD2B 5EK7A 3EKKA 2R7BA 1VYWA 5IMEA 2WMSA 4RLKA 3A4OX 5E8TA 4YJNA 3ZRLA 4DE4A 3HMOA 3IW7A 3U8WA 4O0VA 4A7CA 3QLGA 2GFCA 1H00A 2IJMA 2YAKA 4L45A 4JIKA 1NY3A 4ANMA 5CQWA 4C0TA 3SG8A 3E64A 3PXKA 3Q4CA 4RC4A 2YM4A 5KE0A 3TNHA 2PWLA 4RA5A 2XK4A 4W8EA 4ZTHA 2R0IA 4K6ZA 5DEWA 4PDYA 4AT5A 3VRYA 4EHVA 2CGXA 2XUUA 5GZAA 4TWCA 3RPOA 2Y6OA 5DR6A 2EVAA 3UIBA 1DI8A 4A06A 5IQFA 4NU1A 4N0SA 4I92A 1SMHA 3ZZEA 3OOMA 4J97A 4PMTA 3NIEA 3ZUVA 4IFGA 2W1EA 2E9NA 4QMVA 3BU6A 3SC1A 4DBNA 5C1QB 5HBJA 4BTKA 4FJVA 4CG8A 1ZOGA 3DY7A 3HYHA 3ZM9A 4B9DA 5HQ0A 2EB2A 4HNFA 2W1FA 3D2KA 3ZDIA 4F1MA 3UODA 2JEDA 5EKNA 4LMUA 2XS0A 4R3PA 4GS6A 2ETRA 3OXIA 3W2PA 4TYEA 3QRJA 4EH9A 3NRMA 4CKIA 2JDVA 3C0IA 5K4JA 4ARKA 4RIYA 4O7SA 4O0XA 4DGGA 3UDBA 4FZ7A 1BX6A 2GS2A 3NUYA 1CKIA 4HW7A 4IX4A 3FY2A 2RG5A 4NM5A 3RM6A 4BCNA 4JDHA 2XAOA 3KCKA 4Z7GA 2KTYA 2LAVA 4L44A 3UQCA 3RGFA 1ZZ2A 3RNYA 1YOLA 3Q6WA 2PVYA 3E8NA 3MWUA 4BDFA 3C50A 4WSYA 4IM0A 4O38A 4JX7A 5F20A 2YFXA 2ZMCA 3VJNA 3ORNA 4V0GB 4ANSA 4IHPA 2B9HA 3Q3BA 5DT0A 4C4GA 4X2JA 2IVUA 4P90A 4EOQA 5HU9A 3LMIA 3BYOA 4IVDA 2WKMA 3NGAA 4OT6A 2JBPA 4S32A 4BBEA 4Z9LA 5A4CA 2AEGA 2CKPA 2F7ZE 1OKYA 5I4NA 4G5JA 2YEXA 4EUUA 5AA8A 2HK5A 4IEBA 4JBPA 4GV1A 5IQAA 1H27A 4ANQA 3FLQA 3RINA 3U55A 3SRVB 1OI9A 3V01A 3WZDA 1MUOA 3VF9A 2C6OA 2QI8A 2GHLA 5AA9A 5CAOA 3M11A 1SVHA 4NTTA 3TZMA 2VWXA 3EWHA 3OMVA 2QC6A 3VBXA 4EORA 5AFVA 4RA4A 4OTHA 3TNWA 2PE1A 3DFCB 4K1BA 2WNTA 2OFUA 3NW6A 2Y9QA 4BTMA 2PVLA 1PMVA 5KNJA 5DN3A 4BN1A 3IW4A 1EH4A 3GXLA 5HEZA 3ZSGA 4AGCA 4OTGA 4XH6A 4WOVA 2R9SA 2BZJA 4Y73A 5E8SA 4ZJVA 1TFFA 2CCHA 4M0YA 5HNGA 4L3JA 5LARA 3W0RA 2UZVA 3C0HA 1XH7A 3HLLA 3V5QA 4YZBA 2EXEA 4QYEA 1H08A 3REPA 2JAVA 4TRLA 5BX0A 3WZKA 4UYAA 4U43A 2PMIA 2QHNA 3P7BA 4L68A 3UIXA 3DJ5A 3FXWA 4JDJA 1YXVA 3UOJA 4OTRA 4E4XA 3V8WA 3ORXA 4AAAA 4O7VA 5HE0A 1MP8A 2AUHA 3KN6A 4I22A 4AZTA 1BL6A 4X3JA 3QKKA 2QHMA 4E3CA 4GEOA 4CFVA 4HVDA 1LP4A 3A7FA 2WZJA 1ZMWA 3DKFA 3KK8A 2BZKB 3DCVA 4FRFA 3FLYA 4TY1A 5IEXA 4IAAA 4GU9A 4DH7A 3PVWA 1NVQA 5TO8A 2YCSA 4LRKA 5FP5A 1GAGA 3W0MA 3HEGA 5AM6A 3U9NA 4ERWA 4A9UA 3EL7A 2BALA 2PZRA 4ZEGA 4D4VA 2CKQA 4LV7A 3UJGA 4NW5A 3AD4A 4AT4A 4FEVA 4O0YA 5L2QA 4AE6A 2Y8OA 1ZWSA 3W0OA 2ACXA 2Z7RA 1PXPA 3CPBA 3UP2A 2A1AB 4DG2E 3VUDA 4J71A 2X0GA 5LQFA 3DNEA 3W8LA 3SLSA 3D4QA 4BGHA 5JQ5A 3RTPA 3QRTA 5DPVA 2ITOA 5E4HA 3FLZA 5CXHA 4FUYA 4BDJA 4RIWB 1JSTA 4PDSA 4XLIA 3ZONA 2VD5A 1ZY5A 2VTRA 3F7WA 5HESA 4CZYB 2CN5A 3R1SA 3MVJA 1H1SA 3QUPA 4J52A 4IWOA 2W1GA 3R63A 5AP6A 4AN2A 3QGWA 4FIJA 3QAME 1FVRA 3DAEA 3ZO4A 2XJ1A 3KXNA 3AG9A 4YUQA 3QCYA 5AP7A 4CKRA 2QO7A 3DOGA 3FQEA 5FD2A 5LMKC 4AXFA 2WQNA 5F1ZA 5H8EA 2YCQA 3ZH8A 1ZMUA 5FEEA 4A07A 4F08A 4CLIA 5CSXA 3UTOA 3W10A 3C4XA 3D94A 1T45A 2C3JA 4K11A 3DV3A 4LV8A 1OECA 3KF4A 3E87A 3D9VA 4Y72A 4B4LA 5AAEA 4JG8A 1W2CA 5CF5A 2RIOA 2J0JA 4GK3A 3KL8A 3HV3A 4R1VA 4YPDA 5I9UA 4QMNA 4QP2A 4GMYA 4M14A 3FZSA 2GSFA 4UB7A 4FV5A 4QQJA 1XH6A 3OCTA 4BDIA 4MQ1A 2JKMA 4KSQA 4YPSA 3HV5A 4BIBA 5I9WA 3IS5A 2V22A 4GG7A 3SX9A 2HELA 2VWVA 5M4UA 2QLQA 4WBBB 3BYMA 2V55A 3KULA 3TIZA 3A7HA 3I7BA 3RHXA 4BI1A 5E8UA 2PHKA 4FKUA 2P3GX 5CEKA 4K33A 4ASZA 2W7XA 3LFDA 3WBLA 4AZFA 3K3JA 5ETFA 4Q5EA 3VO3A 4JLCA 3P79A 4PTCA 2C69A 5AV1A 5AJQA 1TKIA 3D5UA 4MTAA 3ZSIA 5HIEA 2XF0A 3SVVA 1R1WA 4LGHA 5T3QA 4AT3A 2ITYA 3COHA 4XG9A 4U44A 5GZ9A 5B2LA 5LOHA 3FDNA 5C27A 1R3CA 3JUHA 4WKQA 4NL0A 3RMFA 2UW6A 3DU8A 4TT7A 5BVWA 5J5TA 4D4RA 4DGOA 2OW3A 3GEQA 3NZ0A 3ZOSA 1GIJA 4IC8A 3S2PA 4CTCA 4BY9E 3FSFA 3ENMA 2A98A 3IDBA 2GNJA 4CLJA 4YTHA 2I0VA 3IECA 3LZBA 5C4LA 5IQDA 3BWJA 4YGAA 4DDGA 5HKMA 4MXXA 5BVEA 5IA0A 3FI8A 4CQGA 4RZVA 1OGYA 2X7FA 4F0FA 3HDNA 4LMNA 4EZ3A 2V5QA 3DKOA 1A06A 3ROCA 4FICA 5CF6A 2R0UA 5LCJA 3LM5A 3MFRA 2ZOQA 3PSDA 3BELA 2NO3A 3OY1A 5CU6A 4FKTA 1WBTA 4I5CA 4YO6A 4ASXA 2JLDA 4B6LA 3W1FA 5EHLA 3DJ6A 2CN8A 3AC2A 5CZHA 4UX9A 1L3RE 3FMDA 5GJFA 3R2YA 5IQHA 3PTGA 4HVHA 1O6LA 2OICA 3TTIA 5DBXA 2VTPA 2WTKB 4EOIA 3D5XA 4ZS4A 3VBYA 2FVDA 3R00A 2Z2WA 2BDWA 1VEBA 3A7IA 5I5ZA 4D2VA 1UU9A 2IEWA 4EOKA 1G8KA 3FZRA 1ZOEA 4OW8A 3NUNA 3WIGA 4MH7A 2OF4A 3DPKA 1QCFA 4H58A 4FKRA 2Z60A 3MJ1A 4N70A 4HYSA 5M09A 1J7LA 4D55A 4EH6A 4L00A 5EOLA 5M4FA 1OIYA 1XHAA 3QYZA 3TNPC 5IEVA 3F3VA 4XBUA 1V0PA 4FV4A 3DGKA 3I4BA 3B2TA 4YSJA 4K9YA 3ZLXA 5C8NA 1YRPA 1BMKA 5GIOE 3F88A 3VUMA 3COKA 3I79A 4MD7E 2O64A 4BR3A 1UVRA 4BZDA 2XRWA 3PJ3A 3EN5A 3VJOA 3IOKA 4IE9A 4O21A 4YZ9A 4I3ZA 3DS6A 4DH8A 4QP1A 3LIJA 5M56A 1S9JA 3BEAA 1VZOA 4EK5A 3HP5A 3DDPA 3ATSA 1KE9A 2BRMA 3F82A 1BLXA 3IGGA 4FT7A 2HENA 4W8DA 4XOZA 5JRSA 3QL8A 1V0OA 2XM8A 4I0TA 3DA6A 3BWFA 3U4WA 4BCKA 5JZNA 3CEKA 1Q3WA 4R7IA 5ANKA 5TF9A 4QTCA 4IAZA 2BFYA 2I40A 2WTDA 3FC2A 4GCJA 5E8XA 2F2UA 4PNIA 4YJPA 3DZOA 5HLWA 2XYUA 3FPQA 3R7IA 2BRHA 3M42A 4BWXA 3PDTA 3TV4A 4AQKA 2E9OA 2XNOA 3LQ5A 2PK9A 4G1WA 2B9JA 3WF8A 4CG9A 3F69A 4LGDA 1NVSA 3L9NA 4I5MA 4CEGA 4ZSAA 1XBCA 5KKRC 4U0IA 4ZSJA 3GC8A 3DAKA 3G51A 2P0CA 2FSLX 4JR3A 4I6HA 4V04A 4RC3A 4BHNA 5LVOA 2VRXA 4LRMA 4L46A 1A48A 5J8IA 2WMTA 5L6WL 5J79A 5KBRA 1OBGA 3OBJA 4RQKA 1G5SA 4L67A 4DFLA 4DEAA 4MF1A 4C58A 5KMJA 1KE8A 2BRBA 5AUYA 3TKUA 2WU7A 3R8MA 3CGFA 3EQGA 3PG3A 5A54A 5BMSA 2J7TA 3F7ZA 3ZUTA 3Q5IA 3AOXA 2BHEA 3FMHA 2C4GA 3WOWA 5CXZA 3GFWA 3KXZA 3G6HA 3DZQA 2A4LA 1JKTA 4BCOA 4AOIA 4IAFA 2ZYBA 3K2LA 3LFSA 2ZJWA 2WIPA 3PYYA 4KAOA 4LOQA 1AGWA 1RW8A 3F3WA 5M06A 4XNEA 2IWIA 3ZFMA 4YSMA 3QGYA 4TYIA 3AC8A 3LCKA 2ETMA 2HZIA 3E63A 4FKPA 4C61A 4X2GA 2XA4A 4GFMA 4M12A 3TDVA 3EOCA 2Y4IB 5ANEA 1YDRE 3FUPA 5DHJA 1YDTE 2E9PA 5EQYA 4KRCA 3UMWA 3QRUA 3VUKA 4DHIB 5K5XA 3FI4A 4ID7A 3HRCA 2PY3A 5TE0A 3WF7A 2R64A 1CTPE 1M52A 5FTQA 4U79A 4XOYA 1WAKA 5BUJA 1J7IA 3WF5A 3CIKA 5BYLA 4MHAA 5CSHA 3UMXA 3QZFA 3KREA 2ONLA 4GYIA 4WUNA 3LLTA 4YMJA 4HPUE 1WBWA 3A7GA 1UNLA 3W55A 1WVWA 1H0VA 3MV5A 3BEGA 3FLWA 3SKCA 2R2PA 4U7ZA 4CMOA 3GC0A 2W0JA 4LL5A 1W83A 4E6AA 5CTPA 3R01A 3LQ8A 2UW7A 3F2NA 4K77A 1OKWA 4OTIA 4TWOA 5FP6A 4I6QA 4J8MA 4YTCA 1IA9A 1QMZA 3E88A 3ELJA 3KVXA 5CVFA 3K5UA 2BPMA 3E8CA 3TG1A 3RPVA 3W8QA 2OZAB 3O96A 3ZTXA 3V6RA 4FSRA 1CM8A 3R7EA 2IO6A 3Q52A 3ZCLA 1PXNA 4GT5A 5CSWA 4XEYA 4M66A 2ZAZA 4M8TA 3I5NA 2VWUA 1MRUA 4PP7A 1Q61A 4BCJA 4XYFA 1F3MC 5HCYA