3O8UA

Conformational plasticity of p38 map kinase dfg motif mutants in response to inhibitor binding
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
348
structure length
332
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDYGATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Conformational plasticity of p38 MAP kinase DFG motif mutants in response to inhibitor binding
rcsb
source organism Homo sapiens
total genus 99
structure length 332
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3o8uA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3o8uA01
1KOAA 3IQ7A 3ZBFA 2Y0AA 4CQEA 4WD5A 3DPKA 4H1JA 5HIBA 5C4KA 1OL7A 4S30A 2C5NA 5DT0A 5EK7A 4IZ7A 2IZTA 4XLIA 2XIZA 4J97A 2X6EA 4R5SA 4U7ZA 4LV8A 4WNPA 2ZAZA 3BYOA 3RAIA 5CEPA 2VNYA 4RLLA 4D4RA 4Q9ZA 2RFEA 3FLNC 4N57A 1P2AA 1KE7A 1H1QA 3RAHA 3WE8A 4TL0A 4G3DA 2R64A 4ZTMA 3EL7A 2C6OA 3AGMA 4A4XA 4JIKA 4FC0A 1Y6BA 3KY2A 3U6HA 4BI0A 5D7VA 5M57A 3F2NA 3C4ZA 3U87A 2VX1A 3LXKA 3M42A 4IB0A 4N6YA 3JY0A 4ZLZA 4FKGA 3SVVA 2HY81 3NW7A 4YLLA 3NZ0A 4RA5A 4LM5A 5DPVA 4AP7A 2BHHA 2JDSA 3G2FA 5A4CA 2E2BA 4JR3A 4G16A 5EHLA 4BCFA 4MKCA 3VIDA 3D7TA 4ZTQA 4M3QA 2CLXA 2QODA 3GEQA 4JBVA 4TT7A 3RNYA 3SD0A 1P4FA 1H27A 2IW8A 4EEVA 4C3FA 2R3LA 1U54B 3F88A 1Y8GA 4ZLOA 1BLXA 3AOXA 3FXZA 3IW8A 2QOCA 4C4FA 4G31A 1O6YA 4I6QA 5BMSA 5DMZA 4F1MA 2PZ5A 3F7WA 3NX8A 2X2LA 5IA1A 3UZTA 4EC8A 4EBVA 1JKKA 3NPCA 4FTRA 3Q2MA 1SMHA 3UQGA 3VQHA 3EKNA 4C58A 3AD5A 5HE0A 2XNBA 2IWIA 3SG8A 3KXGA 4ANMA 3ODZX 5AP7A 4QO9A 1PJKA 2XKEA 4FV3A 1ZOEA 4H3QA 3AG9A 4HPTE 5IUIA 4ACDA 2REIA 5IG1A 4I6HA 2GQGA 2DS1A 1NA7A 3WZKA 4CRSA 3SG9A 4L6QA 2B0QA 5D9HA 2UZBA 3ZFYA 3HRFA 4C37A 4G6NA 2V22A 4YZMA 3DXQA 1P14A 3AMBA 3FKLA 4IHPA 4BWXA 5DN3A 4O84A 4P7EA 4X3FA 5I9WA 3WIKA 3TZ7A 3TN8A 3UODA 4GVAA 2YZAA 3BYMA 4QQJA 4BR3A 4A9SA 5EI6A 3F9NA 4X6QC 3VJNA 2XK4A 4ANSA 4J1RA 5J87A 5AR5A 2ITTA 4FMQA 2VTTA 4USEA 3QZHA 4RZVA 3AD6A 1PMNA 1YOMA 3QRJA 2NRYA 3OWJA 2YCFA 3KGAA 4NJDA 1DI8A 4PTGA 5KMKA 3FLQA 1LP4A 5EQYA 4QP7A 3OY3A 3DDQA 4U43A 3NAXA 3UP2A 3VW8A 2W17A 3QUEA 3NAYA 4F09A 2HWOA 3HAMA 4NZWB 4CNHA 4I94A 3NVMB 1QCFA 1Q8UA 3L1SA 3ZXTA 3FI2A 5GJDA 4CFMA 3HMMA 2GHLA 4YSJA 2O65A 3LM5A 2IVTA 5IKWA 5B7VA 2VGPA 4R8QA 5JZJA 4D9UA 2RGPA 5HTBA 3PPZA 4YTIA 1STCE 4PDOA 2VNWA 5CY3A 4M84A 4L46A 4MXXA 2NP8A 2YDJA 3O8PA 4BCJA 4W8DA 3HZTA 4FV0A 3HV6A 4PMMA 5HGIA 3HUCA 4AF3A 2O64A 5CAPA 4NM3A 4HVGA 2VAGA 2YM4A 4EZ3A 3DKCA 4CV9A 3UVRA 2G15A 3TACA 1QPJA 3VHKA 4D5HA 1PXOA 2Z02A 4U44A 4B9DA 4ANLA 2CCHA 1XH7A 4IE9A 4TYHB 3QC4A 5CF4A 3NIEA 5K4IA 5AV4A 4IMYA 1L3RE 4RZWA 3QWKA 4FTLA 5KKRB 2XYUA 1TQPA 2XIXA 3VBQA 5AA9A 4BN1A 5H8EA 4JRVA 2ZV8A 2RF9A 1A06A 5KX8A 2NRUA 5EYKA 5M09A 3KK9A 4NKSA 5H3QA 1PMUA 4RIXB 3EMGA 3IK3A 3TKIA 1PXJA 1Y8YA 4C57A 3R22A 4A7CA 2P33A 5FUTA 1AQ1A 1CDKA 5E8TA 3R8MA 4CZTA 2BROA 2VTPA 3ZONA 5JFWA 3R7VA 3QLGA 1YWNA 2OJJA 1URCA 2QOKA 3WYXA 2C30A 2OO8X 4DH3A 1YDRE 3RKBA 2HYYA 4EKLA 2WTDA 3BHHA 3MI9A 5DEWA 1JOWB 5AV0A 1K3AA 2EB3A 5CEOA 1PF8A 4FTJA 5I5ZA 2CGXA 5FP5A 3DXNA 3NCZA 4JAJA 2C6DA 2YWVA 3ZC5A 2ERKA 2V7OA 5CQUA 4AGDA 4ANQA 2F7XE 5EFQA 2Y9QA 3Q4CA 4BDJA 4RWLA 5GZ8A 4FSQA 5EI8A 4QQCA 4RX9A 5DBXA 4FKPA 1MQBA 4QP3A 1VEBA 1HCLA 3QC9A 5ANKA 5IA3A 3JUHA 3TG1A 1I09A 5FTOA 2G01A 3ZRLA 2JD5A 2BFYA 5E91A 3VNTA 3NYXA 2YEXA 3TTIA 2RG5A 4FZFB 2GTMA 5IQBA 4WG5A 3KC3A 4YC6A 3AC4A 4QP6A 2OZOA 4XV9A 4FK3A 5AUVA 3ANRA 4N0SA 4RFYA 4H1MA 4KIPA 4TWPA 4WG4A 1PKDA 3R1SA 4PP7A 5KHXA 2FGIA 1NVRA 4TYIA 3ZDUA 3A60A 3TV4A 4W4VA 3VUTA 4IJPA 5AAEA 4QP1A 3SOAA 5HG8A 3S2PA 2UV2A 3BE2A 4I0TA 2W9ZB 4WBOA 2GNIA 4FKSA 3C5IA 3FI8A 2UZLA 4PP9A 3O8UA 3GCSA 5TR6A 4CQGA 2JKMA 4ALVA 1R39A 4EH2A 4ZOGA 4ZY6A 4FVRA 3WF5A 5LCJA 3QQFA 2VWIA 3MS9A 4LQMA 3TNIA 3THBA 2HXQA 4O0RA 5CI6A 2UZNA 5JMSA 4FVQA 4I6FA 2OJ9A 5A4LA 3RM7A 2CNQA 2WQBA 1R3CA 1Q41A 3LMIA 4FG9A 1W98A 2WKMA 3MB7A 4XV3A 5CNNA 3V8SA 3ZFXA 3PA5A 4KBKA 1OKVA 4X6RA 5AFVA 2XKFA 1E9HA 4I41A 4OTDA 2EWAA 3MFRA 5EW9A 3OWKA 2YWPA 3ZUVA 3QWJA 5BVDA 4DFYA 4CGAA 3P1AA 4CVAA 4JR7A 4A9RA 2B52A 2UZOA 4O27B 4RLKA 2Z7SA 4WG3A 4BICA 3KRXA 2HELA 2YCRA 1GIIA 3HV5A 4BDHA 5EM5A 4RVKA 4BKZA 3COKA 4CTCA 3RPOA 3U9CA 5L6WL 3KQ7A 4XRJA 2LAVA 3Q60A 4Z55A 3TJDA 4FUXA 4IWQA 3UG1A 4D9TA 2XIRA 4XV1A 2X2KA 5BUJA 2ETRA 2I6LA 2ZOQA 4GJ2A 4XP3A 2WB8A 4OW8A 3P5KA 4NTTA 4RJ7A 2CHLA 4U79A 2G2IA 1H24A 1KE6A 3PXQA 4NT4A 4QRCA 4CTBA 1BI8A 4K8AA 4F1OA 2WELA 3BU5A 5CZHA 3UOKA 3VBWA 5IQIA 5AADA 5BVFA 4RIYA 1KE8A 3QXOA 4GIHA 2CMWA 2FSLX 3D9VA 2YM7A 2JKQA 5HD4A 3HL7A 5A4TA 5IH5A 4FE2A 4HCUA 1UNGA 1MRYA 4GT3A 3P78A 1SM2A 5FBNC 3NYVA 3VBYA 4XG2A 3FPQA 3V5PA 3Q4UA 2I40A 2R3JA 3ODYX 3T3UA 5B2MA 3ZM9A 4IX3A 2WMWA 1U5RA 1PY5A 1F0QA 2R5TA 2YM8A 2YA9A 3SQQA 4G5JA 3SHEA 2WTVA 3MFTA 4BCOA 3M2WA 2W1FA 5CTPA 3C4FA 3OTVA 4PNIA 1YI4A 3WF6A 5AEPA 3ZUTA 5CAUA 5DEYA 5FEQA 4GMYA 4XLVA 4O7ZA 2PE0A 2Y6MA 5ANEA 2HW7A 4NCTA 3JR1A 3KXMA 4WT6A 3DKOA 4ZZMA 3W2OA 5KMOA 1M52A 4ZZNA 3DQXA 4FKUA 3R00A 2C0OA 4FOCA 4V05A 1VJYA 3LJ2A 2RIOA 3FLZA 2VWXA 3I7BA 3FV8A 2C69A 4C38A 1GY3A 3R2BA 4G17A 5FM2A 4XYFA 5CXZA 4P5ZA 5GJGA 5L8JA 3W1FA 3L9PA 4MXZA 5E4HA 4HVIA 5IUHA 3V5LA 4CSVA 3EH9A 3TZ9A 4MF1A 2CGWA 1MP8A 1WMKA 2PVKA 2QCSA 4K2RA 4FTOA 2NNWB 2X9FA 2PUNA 1OI9A 4IWDA 4XH6A 2I0VA 4AGWA 5I0BA 2O8YA 3NGAA 5A4EA 1URWA 3DK3A 5EHOA 1UKIA 4BDGA 2FSMX 3IDCA 4CLIA 2PUUA 1AGWA 2WFYA 5EYCA 3DTWA 1ZMVA 2XNOA 3UNZA 4DGGA 3KXHA 1CSNA 3CD8A 3QRKA 1CKJA 4YJOA 3W55A 2OICA 3KCFA 3OFMA 1WBVA 1R78A 2YAAA 1OIUA 4UMTA 4YPDA 4I0RA 5HLWA 3ULIA 2BAQA 3FZ1A 4BWKA 3QTQA 1SNUA 2UW0A 4N6ZA 2B54A 5CXHA 3W32A 5CLPA 2XEYA 1YI3A 3MA3A 4HGEA 4OTQA 4FKIA 3BQCA 1Q3DA 5CEIA 3R8PA 5HNIX 4KD1A 1J7IA 2HZIA 3G51A 2R2PA 3Q6UA 5IA5A 4YSMA 4UALA 4BTKA 3CEKA 4M67A 5M06A 3LFFA 4QTAA 4BBEA 3L8XA 5DOSA 4D2WA 2OFUA 3UE4A 2WQOA 5CF6A 3CY3A 5ANDA 5GIOE 3BX5A 2VWYA 3SRVA 1SVHA 2GFSA 2XUUA 2XZSA 3UO5A 4ZLYA 4WA9A 4BDIA 4BDDA 3SW7A 5AIRA 1SNXA 2ONLA 1VR2A 3K5UA 4ZSJA 1GZNA 3DBEA 4OGRA 4YHTA 4OBOA 5AP0A 1GOLA 3VUHA 2J5EA 3PVBA 4FIGA 5HI2A 3K5VA 3QALE 5IPJA 3AC2A 5FDPA 1M7NA 3OZ6A 3W8QA 1LEWA 2ITZA 3NVKI 4LL5A 3UZPA 2VTIA 5CU0A 4B99A 1OMWA 4M14A 4PPBA 4LUEA 1TVOA 4C4HA 3C5UA 5FXQA 1W8CA 2GFCA 3LQ5A 4WUAA 3EYGA 3R30A 5E9EA 3PG3A 5TT7A 5LOHA 3S0OA 1FOTA 4J98A 5AWMA 3AC1A 3I7CA 3ZUUA 4O7WA 4DT8A 2QI8A 4DC2A 3QX4A 5ICPA 3IONA 2BZKB 4EOPA 2OZAA 5AR2A 2C5OA 5FBOA 5C9CA 4RX5A 5IF1A 4QP2A 3DS6A 5DHJA 4AE9A 4GG5A 3R28A 2BRGA 5HO6A 3E88A 1ZAOA 1ZRZA 3C4XA 5FP6A 4R77A 4PX6A 3JXWA 3R02A 4KIOA 2I7QA 4AA4A 4LL0A 2O0UA 5HX8A 2ZJWA 3TNPC 3UMWA 3PJ8A 1HOWA 4IB1A 1OUKA 3DBCA 3FUPA 5HCZA 1H1PA 1DS5A 3KRRA 4DFZE 4M69B 4CG8A 4EQCA 3GCUA 4IDTA 2ZV9A 4FODA 4CFUA 1DI9A 2BVAA 3F3ZA 1LR4A 1Q5KA 3ACJA 3ZCLA 2WGJA 4L67A 4E1ZA 4R3RA 3H3CA 4G5PA 3WIGA 5HLPA 2VUWA 2WOTA 4TPTA 2V5QA 2WIPA 2XRUA 2UVXA 3LVPA 5C03A 4DGLC 5L2QA 4YJNA 5J95A 3D5UA 4OTHA 3VVHA 4FSUA 3R7EA 4M68A 3DCVA 4FKLA 4YZ9A 1UU7A 3EKKA 2P2HA 2Z7LA 4ZTNA 4K18A 4RQKA 5IEYA 3FYKX 5HORA 4C3PA 3LFDA 3POOA 3QCSA 4WSYA 1FGIA 4RA4A 4EK4A 1ZOHA 3QGYA 4PDSA 3KRJA 4BGQA 3T9TA 4DEAA 3OHTA 4WNMA 1JKTA 2Z8CA 4FL1A 4H36A 4Z16A 5K9IA 3K3JA 1H07A 2X4ZA 4IJ9A 1YW2A 3OF0A 4C3RA 2OK1A 4E73A 1Y6AA 4EH8A 4AW0A 4EZ5A 1PKGA 2F7ZE 3P0MA 4RWKA 4AW1A 2I1MA 4ZZOA 2WMVA 5BUIA 4PMPA 5I9XA 4R78A 3R9NA 3VQUA 4D2TA 3DTCA 4B6LA 4YURA 2W5BA 3DBFA 2XCKA 4TNDA 3SXSA 3T8OA 3UG2A 5AV1A 3BEGA 4FIIA 3SW4A 3OROA 3SX9A 4EH3A 2GS7A 3B8QA 4ZEGA 2BDJA 2BCJA 3W2CA 2WTIA 3MVMA 5J9ZA 2C5YA 1J91A 1PXIA 3PPJA 4U97A 5FEEA 3QQJA 1PW2A 4IH8A 4PL3A 4YO4A 1OPLA 2W9FB 4NH1A 4CMUA 5HX6A 5IQDA 3VBXA 3A2CA 4XP0A 5AP5A 5HE1A 3TI1A 2C6KA 4U9AA 1GAGA 4C33A 5LVNA 4C4GA 3KF7A 4JX7A 4ZS0A 3AT4A 5HCXA 3MV5A 4DLJA 3EQIA 3CLYA 4IZYA 5FTQA 3GOKA 4O0UA 5CF8A 3P7CA 4W9XA 3P79A 3RNIA 2RFSA 5I3OA 2WIHA 5IQEA 2YDKA 4O6LA 2PMOX 3LXNA 2B9HA 4QTCA 5K0KA 2Y4IC 3AMAA 1BYGA 3FY2A 2WMBA 4BDCA 3KREA 3PXYA 4BGGA 3W2SA 4D58A 3FQSA 3HA6A 3F3TA 4FR4A 3OW4A 4WSQA 3QYZA 4IM2A 4DFXE 4MQ1A 4F9BA 3N4VA 5CAVA 3TXOA 1IAHA 3G15A 3C0HA 4AT5A 1L8TA 4TXCA 3A7GA 4CFXA 2BMCA 3FWQA 3F3WA 5HHWA 3GXLA 3QL8A 4F7JA 3OWLA 4E5AX 3EQHA 2VTMA 1B39A 2F49A 2VWVA 4CV8A 2XKCA 4GH2A 4X3JA 3LE6A 1MUOA 4J7BA 3VRZA 3ZYAA 2CSNA 3PLSA 4XX9A 5EHYA 2CKOA 1BUHA 5KCVA 1FMKA 2WTKC 3W8LA 1M2QA 2X8DA 2J0IA 1O6KA 3OW3A 2B7AA 3RCJA 3PXFA 3I1AA 1OM1A 1UU8A 3GCVA 4I22A 4AZEA 1PYXA 2IO6A 3CTHA 2UUEA 4PY1A 1YQJA 4FGBA 1J1BA 3FZTA 4OTWA 4EYJA 1OVEA 1J1CA 3BE9A 1OZ1A 4JG7A 4R7HA 5EM6A 5FWKK 3DZQA 5IISA 3BRBA 4MNEB 3ROCA 5FXRA 1IA9A 4HGSA 3LXPA 3VULA 3G6GA 3F2AA 1JQHA 3HRBA 3V5JA 4HNFA 4IAYA 5FG8A 3U6JA 4D1XA 5J9LA 2Q0BA 2R7BA 3PG1A 2XCHA 3R8LA 1FBNA 3NUXA 4ANOA 4F6WA 2PWLA 3R2YA 4LRKA 4YJQA 4IACA 3R7GA 2OIBA 1GZKA 2X6DA 3PIXA 3RINA 4ARKA 3N4UA 3OT8A 4FIJA 1LEZA 2WD1A 4MXYA 4RJ4A 5DE2A 4DTAA 4QMXA 5C1QB 1ZYLA 3O23A 3R1QA 4I93A 2PK9A 1ZZ2A 3BYSA 4QP4A 3UOLA 3C13A 2XK8A 4FL2A 3MH2A 4AT4A 1GJOA 4JLCA 3I6UA 4ACHA 1ZWSA 3QTZA 4YR8A 4YBJA 4MH7A 2J9MA 4GU6A 3PA4A 1Z9XA 3MFSA 4F6UA 4QMYA 2ACXA 2V55A 4JBOA 2W1IA 2WNTA 3OMVA 2JAVA 1XH6A 3JYAA 4QMMA 3EQGA 5ACKA 3BKBA 3NYNA 3DLSA 3FZSA 1DAYA 3R6XA 2BUJA 1XQZA 3O50A 3UDBA 2BR1A 3A4OX 2OH0E 4Z7HA 3QA8A 2OXDA 2VTAA 3MYGA 3KL8A 4G3GA 2QC6A 2UZWE 2R3QA 5E8SA 4AACA 4YZNA 4AS0A 1W82A 2QO2A 2R0UA 3DBQA 1Q3WA 2ZDTA 3F5PA 5GJFA 3RHKA 2O5KA 2YN8A 3BCEA 3MESA 3E3PA 1JKSA 4BTFA 4EH4A 2VU3A 3ORMA 2XYNA 4B7TA 2WMSA 4XUFA 1XH9A 2WEIA 2C68A 2WXVA 5M07A 1PYEA 5IH6A 2YIRA 1KWPA 2E9NA 3FC2A 4L7FA 5CZIA 2VTSA 4DEHA 5M4FA 5E8YA 3MA6A 4UN0C 4V0GB 3KRWA 1UV5A 4YJSA 3OUNB 3ALOA 2QG5A 1UWJA 5FM3A 3VS4A 4DA5A 4L3JA 3V01A 3U55A 3GCQA 3KCKA 3B2TA 2YERA 3PXKA 4N4SA 3PZEA 4KAOA 1J3HA 5KO1A 4EHGA 3V8TA 3QTIA 1UU9A 3MBLA 5CANA 1KE9A 2GPHA 4G3FA 1NY3A 3FBVA 1I44A 5CQWA 2A2AA 2VTLA 4FX3A 3UYTA 2BZHB 3CC6A 3ZM4A 1WBOA 5IA4A 4DEBA 5FD2A 3F3VA 2I0HA 3KULA 4DGOA 3OUKA 5GINE 2XF0A 4EOIA 4PMTA 4FV9A 3GP0A 4JL9A 3BEAA 4XG4A 5L2IA 3DGKA 3QQHA 5GNKA 4BCGA 5KE0A 5DNRA 4QOXA 4DHFA 2WO6A 3DDPA 5D7AA 3NW6A 1Z57A 4FT5A 5BX0A 2OIDA 5CENA 2HOGA 5AUZA 3DAJA 3V04A 3EOCA 2XJ1A 1ZMUA 4D1ZA 3PVWA 5EM8A 4J95A 5CF5A 5JZNA 1QPCA 2IZUA 2XS0A 4J71A 3NWWA 4MTAA 5E8WA 3DKFA 4YP8A 3LOKA 3PP1A 3ZDIA 3ZO1A 3KXXA 3UC3A 4KRCA 4TYJA 4QNAA 4JQEA 4KINA 3PA3A 4XG7A 2GQSA 5EI2A 5HG7A 2J6MA 4DF3A 4ZMFA 2V62A 3PLAE 2C6IA 3D5WA 2WQEA 4EOJA 4KIKA 2ZM3A 1O6LA 4NWMA 3VHEA 4PF4A 3DV3A 2CKPA 4U80A 4WIHA 4OT6A 4ZTHA 3UVPA 5HOAA 4ALWA 3TDVA 5EKNA 3RK7A 3R7UA 3FZPA 3VUDA 4ZAUA 2X8EA 5J9YA 3RVGA 2XH5A 3ZZEA 4EQUA 4QTBA 3TT0A 2C5XA 2Z7RA 3A62A 4IAAA 4WUNA 5EYMA 4O7VA 2Z60A 4XHKB 5JT2A 2CLQA 4DEDA 4X2NA 2VTHA 4PTCA 3DAEA 3POZA 1ZYDA 3ROYA 2XNGA 3KXNA 2XIKA 5D11A 2DUVA 3A4PA 1TQMA 3GC9A 4UWCA 4I5CA 4L52A 4MXAA 4UWYA 4UV0A 4EL9A 2F4JA 3H4JA 4YTFA 4O7LA 2BILB 4ERKA 3BELA 3HKOA 5AP2A 5KMMA 4I21A 4FTCA 1ZYSA 2DWBA 3LFBA 4ZSLA 3D7TB 4QMVA 4I4FA 4RIWA 4Y46A 1ZY4A 5K3YA 3RAWA 1Q24A 3NUAA 1OL5A 2XK6A 2JDTA 3QYWA 2HCKA 3IOPA 4IVCA 3CSVA 5JK3A 3F2RA 2XK3A 3ZSGA 1OIQA 4OUCA 5AUWA 4ZTSA 4BYIA 4CYIA 3G33A 5C27A 2YABA 5KUPA 2XK9A 2V0DA 3R63A 4IVAA 4S33A 5IQAA 2R3KA 3W2PA 3EFKA 4F64A 5CEMA 5JN2A 5L8KA 1J7UA 3A8WA 2ITPA 2VRXA 4JDKA 2XK7A 3D14A 4F6SA 4R7IA 4IB3A 4FV6A 5HD7A 4E4NA 5JGAA 4BYJA 1PRYA 4X2KA 1H1RA 4Z9LA 4QTEA 4U45A 4FT0A 3BHUA 3ZU7A 5JFVA 1QPEA 2R3OA 1U4DA 3WZEA 3ITZA 4XP2A 4E6CA 1Q8WA 2IZSA 3COHA 2VTQA 4MCVA 4R1VA 4QMZA 5HG9A 4AZFA 4QYFA 4KNBA 4BDKA 3IO7A 1VZOA 2J4ZA 2OXYA 2IW6A 4AOJA 5LJJA 5HTIA 3SLSA 3E87A 2ITQA 2V7AA 4X3FB 4DLIA 4AGCA 3ZEPA 4IEBA 3GU8A 3H0YA 4CLJA 2BTSA 3CP9A 3W33A 4ZY4A 5IMXA 2VWWA 3EN7A 2XVDA 1YDSE 2B1PA 3JY9A 4M13A 4X2GA 5AR7A 4EH9A 2R9SA 1H1SA 4NTSA 4UMUA 1WVWA 4LOPA 4QYHA 4F0IA 3PUPA 2PZIA 2IZRA 4C61A 5C4LA 5DR6A 4QQTA 3DAKA 2OSCA 3IDPA 3VS1A 1QMZA 4EUUA 3OCGA 1A48A 3UYSA 4ASDA 4ZS4A 3LZBA 4QYEA 1IAJA 3LFSA 4RFZA 1OL6A 2ZYBA 1FVVA 2VGOA 4DH5A 2PULA 3ANQA 2XNNA 4QMNA 3MB6A 1FPUA 5KMNA 1UA2A 3LFEA 2KULA 4NIFA 2QR7A 1WBWA 3ACKA 3FMDA 4X2FA 3R9HA 2SRCA 1XBBA 4LRMA 4OBQA 3HX4A 4U3ZA 2X9EA 2XB7A 4R5YA 4XJ0A 1H25A 3O17A 5BNJA 4FEXA 5G1XA 5AX3A 1FVTA 4BKJA 5I3RA 2WTJA 3MVJA 3QCXA 4IWPA 4E93A 4L44A 4QMUA 1YWVA 3AXWA 4BCIA 5JQ5A 3VW6A 1JPAA 1M14A 5HESA 4ZP5A 4KRDA 5AA8A 3TUCA 5EG3A 3MN3A 4IAZA 2OU7A 3EHAA 1BMKA 2P4IA 2XJ0A 5JFXA 3HUBA 4FSMA 1WBSA 4IZAA 4D2VA 2UZTA 1H01A 2FSTX 4CFNA 1R1WA 1H0WA 3F82A 1UWHA 4B8LA 3QX2A 4FV5A 5T6KA 4O6EA 2ITUA 4DTBA 3PRFA 2ERZE 2QOFA 4HJOA 4HGLA 4LOOA 2C3IB 4APPA 1XH5A 3KKVA 4QTDA 4RSSA 4F9CA 4V04A 2GNHA 2ZMCA 3OD6X 3Q9ZA 4IVDA 4LFIA 3GC8A 4IADA 4CD0A 3NDMA 2ZV7A 1YHWA 5ETAA 4P2KA 2CKEA 2IVUA 4QPSA 3WARA 4KBCA 1XJDA 5HBEA 4F7SA 3CS9A 5J7HA 1VYWA 3R04A 4K1BA 4TKSA 2VTNA 5EW8A 5AX9A 5BVNA 2R3GA 5GIPE 4HVDA 4Y95A 4BIEA 4I5MA 4FSNA 2GSFA 4GIIA 1OL1A 3A99A 5HG5A 3QF9A 2R3NA 2A4LA 2PZYA 4U42A 3TJCA 4O21A 3QD3A 2PMIA 4HVSA 3I5ZA 4GFOA 4MBIA 4XG8A 5E8ZA 3BWJA 3MVLA 4FYNA 3QFVA 4MF0A 5E90A 1M2PA 5HICA 4D4VA 5EM7A 4JG8A 3I6WA 1ZMWA 4L8MA 3FZOA 2BZIB 4PMSA 2EXMA 2YISA 4PPAA 3HP5A 5LARA 3IW5A 3V3VA 3FYJX 4TWCA 3II5A 1ZOGA 3EN4A 5ACBC 3TNWA 5IQHA 2H9VA 4RVTA 3CGOA 2WQMA 4H3PA 2A27A 3QTXA 3E8CA 3JVRA 4UYAA 3TTJA 4OTGA 4WHZA 5KKRC 3DFCB 4USDA 5EW3A 3UPXA 2PVFA 2XEZA 4JJRA 5L8LA 4RWJA 4ITHA 4CG9A 3AQVA 1EH4A 4D0WA 4U41A 3TCPA 5C8NA 1WVXA 1G8AA 4O2PA 3BHTA 1XH4A 3GCPA 4O7RA 3VS6A 3U6IA 2IG7A 4UB7A 2W1EA 4E4MA 3QZIA 3QQLA 5A14A 2BKZA 5CSWA 4X3FC 4EK6A 5DWRA 3SC1A 4BVUA 2W1HA 1PMEA 2OGVA 5HO8A 3H30A 3UO4A 2JKKA 2YLFA 2CKQA 2PVYA 1H8FA 3CQEA 2B55A 3UP7A 2WTWA 5EYDA 3NLBA 3Q53A 2QOIA 1KOBA 4RX7A 1W7HA 2QD9A 4TZRA 4W4XA 4F1TA 4RGJA 4L45A 1OBGA 3S00A 2J0JA 2WHBA 4O0XA 3E92A 4HYHA 4ACCA 3UIMA 2R3RA 4FUYA 2UVZA 3BBTB 2HIWA 3QU0A 3ATTA 4QNYA 4UZDA 4AN9A 3IW7A 2CGVA 3L9NA 4GKHA 1FQ1B 3D2IA 4C7TA 3A7FA 1WCCA 4MK0A 3LHJA 4QMWA 3UIXA 3VAPA 4F4PA 4GEOA 3R7OA 3S95A 2FVDA 3TKUA 3ZLSA 4A07A 2QLUA 4A4OA 5T68A 2W5AA 5CASA 3R9OA 5GZ9A 3AT2A 4BGHA 2C3JA 5H8BA 3IDBA 4FT3A 3QKKA 4RIYB 5EQEA 3FJQE 3HNGA 3LCKA 4ONAA 3HMPA 4BZDA 4C2VA 5F95A 3EFJA 4UXQA 3H9FA 4GL9A 5AM7A 4RC2A 3NNWA 4MNFA 3MVHA 4R3CA 1S9IA 4ENXA 2AYPA 3ZZWA 3R8VA 4UBAA 2VWZA 4M0ZA 3UIUA 5LMKC 3LKMA 4NKAA 4YHFA 3R1YA 3CCNA 4E6QA 5IA0A 4GJ3A 4I3ZA 3T9IA 3IW6A 1T46A 3LM0A 3OXIA 2R3PA 3MSSA 5J1WA 2BKKA 5K0XA 2OF2A 1QL6A 4NM0A 1JNKA 3EL8A 5K5XA 4IZ5A 2GDOA 4R7BA 5IA2A 3UTOA 1Y91A 3SA0A 4DITA 4GYIA 3OOGA 3EQCA 5HEZA 3SOCA 1YHSA 2PVMA 4NU1A 4FTAA 2F2UA 4YJVA 3JS2A 4ZTRA 4TN6A 3ETAA 5AUXA 4JDHA 4DG2E 4HPUE 3MPTA 5B2LA 3R9DA 5BYYA 3ET7A 5HO7A 4WOVA 2ZM1A 3KRLA 1Q99A 2YM6A 1A9UA 3MTFA 3BPRA 4GYGA 4OTPA 4GU9A 3ZSIA 2IN6A 2XMYA 5HNGA 2E9OA 2BRBA 2X8IA 4AAAA 4ID7A 3UNJA 4BF2A 4EBWA 1TKIA 5FGKA 4F08A 3BLHA 1H26A 3L8PA 4DGNA 3EQFA 4DEIA 2VO7A 3C51A 5M51A 3PIYA 1OKYA 5HKMA 3HV7A 2B4SB 4YC8A 3ZO3A 4O1PA 4BI2A 3GC0A 3IGOA 4AE6A 3D15A 4E5WA 1FGKA 3PWDA 4IW0A 4MBJA 3V5WA 1ZY5A 2R0IA 4EWHA 4DN5A 4EONA 2J0LA 5IZFA 3AD4A 4JBQA 5E1SA 4EI4A 3ATSA 4TWNA 4YBKA 4MBLA 1JLUE 4FKTA 3RK5A 3S3IA 5EDPA 1RW8A 3FMEA 2PUIA 2UW8A 3L9LA 3O2MA 1W83A 4GG7A 4ALUA 3GU4A 4IM0A 1OKWA 3LW0A 4M8TA 4NK9A 1OITA 3O96A 4PL5A 5BPYA 3VS7A 5JQ8A 4J52A 1IG1A 5G6VA 2VX0A 3I4BA 2J2IB 2JIUA 2ITOA 2YJSA 2UZUE 3QTWA 2HZ0A 2VO3A 3CD3A 3GNIB 3A7HA 1JSTA 2BDFA 3E8NA 5CVGA 2W96B 3ORXA 2XJ2A 1ZYJA 4UXLA 2Y8OA 3QD0A 3TKHA 4IIRA 5HVJA 4FA2A 2R3FA 4BWPA 4YJRA 4EZ7A 4AG8A 2HZNA 5ETIA 3SRVB 4FEWA 5LVPA 4CFFA 3OC1A 3QTSA 4NEUA 4OBPA 3QCYA 4JX3A 4FNYA 1YXVA 2ZMDA 5DI1A 3W2RA 3BGZA 4PUZA 4XV2A 4FBXA 3HV4A 2JLDA 3ZRKA 4AA0A 1Q8TA 3NUSA 2FYSA 3E8EA 4N70A 4U3YA 3SXRA 3QLFA 5CVFA 2WMAA 3QD4A 3ORTA 4RRVA 5C8KA 2QOBA 2XRWA 4LMUA 3UO6A 3K54A 4CRLA 3ENHA 4GFMA 2PUPA 1LPUA 3AT3A 3DOGA 1OB3A 2UZDA 3N51A 4FKJA 4RBLA 1SYKA 5DA3A 2XBAA 3GBZA 3BGPA 3UJGA 4UMRA 5A6NA 3OEFX 4RG0A 3RCDA 3CTJA 5DT3A 3CIKA 4A9TA 4NL0A 3VS3A 4FV1A 2YACA 5FQDC 4F63A 2EXEA 4D2RA 1YXUA 1F3MC 2OZAB 2Z7QA 3HYHA 3QUDA 4EH7A 4MVFA 1IRKA 5A9UA 1NXKA 1U5QA 5BYZA 2C4GA 4BCQA 3F5GA 3ERKA 4RT7A 4DH7A 2NO3A 3I60A 4JS8A 4L01A 4EOOA 2OJIA 4GUBA 2JDRA 4APCA 4JG6A 3AGLA 4E3CA 2B9IA 2ITNA 4YNOA 3BLRA 2XM9A 3E5AA 3OCBA 2O3PA 4JI9A 4FKQA 4ZIMA 4CFWA 4ZTLA 1DAWA 5A46A 3ZLYA 3G9LX 4MD8E 2PZRA 3VBTA 4CT2A 2UW9A 5L6PA 3MDYA 2GS6A 4YJTA 3DJ7A 4OR5A 3QRTA 2EB2A 2JEDA 2GNGA 2PY3A 2OJGA 3LLTA 4IX4A 4RQVA 2FO0A 2AC5A 2JIVA 3MY0A 2JDOA 4OT5A 3VF8A 2GNFA 1BI7A 3QZGA 4AN2A 5A6OA 5M4CA 3HLLA 4DYMA 2WMQA 4ZXTA 3BBWA 1JBPE 3FMHA 5BMMA 4DBXA 2WZJA 3KK8A 4F7NA 2OLCA 5EOBA 3CBLA 4UMPA 3EFWA 4LRJA 4BFMA 5HZNA 5L2SA 2RSVA 3H10A 3C4EA 4O91A 1XO2B 4FSWA 1UNHA 1V1KA 3LCTA 3LFAA 3RBWA 4DINA 3FPMA 1OBDA 2XIYA 4LOQA 3F5UA 2C0IA 2ITWA 4USFA 4D0XA 1OUYA 2PPQA 3C1XA 4XOYA 4E4LA 4KSQA 1OECA 3QKMA 1RQQA 2QO7A 4ANBA 1GIHA 1X8BA 3GFWA 5M4UA 5AP1A 3ZC6A 3KMMA 4EORA 1IA8A 4FF8A 4C35A 3FMKA 2WMTA 3RHXA 4AA5A 2W5HA 3OXZA 2F2CB 2W99B 3DBDA 3Q9YA 3ZSHA 5K4JA 3BU3A 2FA2A 5DVRA 4UX9A 1OKZA 5E92A 4JXFA 4WRSA 5CX9A 2JC6A 2R7IA 4CKRA 3LMHA 4IFGA 3CQWA 2FSOX 5HBJA 1FVRA 3TNHA 4G9RA 5M4IA 5IQCA 4D55A 3PXRA 3LFNA 1UVRA 2X39A 2ZV2A 3LFCA 2YAKA 3PRIA 3P7AA 4FYOA 2J0KA 3ZH8A 3DK7A 3V5QA 1Q97A 2JITA 4PQNA 4EQMA 1BL6A 1YXSA 2PMLX 3B2WA 4HOKA 5ANIA 5FEDA 4C0TA 4BRXA 3BHVA 3FLWA 5HIDA 4YMJA 3UQCA 4Q2AA 4YZBA 1H0VA 2XP2A 4ZSAA 4CMTA 3BI6A 5CT0A 4G34A 1ZZLA 2P2IA 3FKNA 3LCOA 5M55A 1CTPE 4IB5A 2QLQA 3MW1A 3QTRA 4FNZA 4EHZA 4CCUA 4MXCA 3R73A 3Q2JA 3NSZA 3OG7A 3FY0A 2PVHA 3MIYA 3KVXA 4GUEA 4I0SA 4G6LA 3RALA 5JEBA 4FTUA 1YDTE 2F7EE 3FHIA 4Q5EA 5CU6A 4QPAA 3FKOA 1H08A 4NM5A 3SXFA 4K0YA 4ANNA 4EOLA 4MQ2A 3PSDA 5CU2A 5A54A 4NJ3A 3D0EA 1E1VA 3GU5A 4WRGA 3CKWA 3ORKA 3F69A 1PXMA 4FTIA 4LMNA 4AZVA 2ONLC 3TZ8A 1OIRA 2JBOA 2YJRA 2ZDUA 4KBAA 4MD9E 4QP9A 5FDXA 3H0ZA 4AGUA 5BYLA 4WNOA 2F57A 4B8MA 2QOQA 2GNLA 3P08A 4DFUA 3F5XA 2ITYA 3LCDA 4ZJJA 3SV0A 4HW7A 2P0CA 1XWSA 2OFVA 3GQIA 3VWAA 4O81A 4ZK5A 5JGBA 3IECA 3GUBA 1ERKA 2VTJA 2BHEA 2W4OA 2R3IA 3C4WA 4U81A 5CS6A 5DH3A 4BC6A 4G2FA 3C7QA 3GVUA 5J8IA 2KTYA 4HNIA 2CNUA 2BRNA 4P4CA 2BTRA 1CKIA 2C6MA 4FOBA 4W9WA 4EK5A 3F61A 2P3GX 3D5VA 3P4KA 5I9ZA 4RJ8A 3P23A 3VC4A 4TYEA 3RZBA 4EH6A 3U51A 3ORZA 5KBQA 5KMIA 3PZHA 3PE2A 4FNWA 4KS7A 4Y85A 2OW3A 4YPSA 4BZOA 4CMOA 4F9YA 1YOJA 3C4CA 3COMA 4O0VA 4RVMA 3VUIA 1U46A 3ELJA 4JT3A 2CCIA 4ITJA 4YLKA 1U54A 4H39A 2EUFB 3QA0A 3Q6WA 4JAIA 2W7XA 3BHYA 1Y57A 5JRSA 3WZJA 1GIJA 5AUYA 2BDWA 2BALA 3PJ2A 4IVBA 2OXXA 4LI5A 4LYNA 2W4JA 4KS8A 4FV7A 3LQ3A 2A19B 4I5PA 4MEDA 4F99A 4YHJA 3ORPA 5LMAA 3U8WA 5HU9A 4GCJA 4FKWA 3ZRMA 1GNGA 4UZHA 5TOZA 3FLYA 3O7LD 4JDJA 4S2ZA 2IVSA 3FI3A 3RMFA 2YIWA 3NUYA 3L8SA 2OF4A 5DR2A 3D7ZA 3FMLA 2YM3A 2WEVA 2PHKA 3IW4A 2GNJA 3AC8A 5LVMA 3GT8A 3HP2A 4FG8A 5TO8A 3N4TA 4O82A 3KXZA 3BGQA 4OTIA 1BX6A 1OGUA 4D2PA 3PDTA 3WBLA 3OTUA 3ZTXA 2H34A 4L42A 1J7LA 2VTRA 3JPVA 5CSXA 1ZXEA 2ZVAA 5IDNA 3BQRA 4TYGA 3O0GA 3WZDA 4YU2A 1MRVA 3MTLA 3VN9A 2X4FA 3GC7A 5CEQA 5AP6A 3T3VA 4YO6A 4BCMA 5AR4A 1WBPA 4HCTA 5J1VA 4M7IA 4F70A 3HMOA 3PY0A 2Z2WA 1KE5A 2CPKE 4O7YA 1PMVA 1RJBA 2G1TA 3DY7A 4O96A 3NNXA 2PL0A 3MH3A 3UPZA 2PZPA 2QVSE 3V6SA 3MIAA 2ITVA 2P55A 5ETCA 3V5TA 3LCSA 4FIFA 2Y7JA 1H4LA 5BVOA 2JFLA 2B9FA 3DB8A 3PJ1A 4F9WA 2VV9A 3MH1A 2UW3A 4H05A 3WF7A 2XBJA 2LGCA 4FSTA 2X81A 3D83A 4U6RA 4BBMA 4F65A 5EQPA 3FSKA 1NVSA 3FMJA 3G90X 2CDZA 1H1WA 2BAJA 4TW9A 2HZ4A 1FMOE 4PDPA 2JKOA 1V0BA 2HWPA 4WO5A 4A9UA 5F4NA 2X7FA 3V51A 3W10A 4MAOA 2HXLA 3WF9A 4D1SA 2QKRA 1GZ8A 3EN5A 4TNBA 4EOQA 3E3BX 3RM6A 4TYHA 2WPAA 4YUQA 4YNEA 3OCTA 5JFSA 2UW7A 2YCSA 4DCAA 3HRCA 3DLZA 2C5VA 2HENA 2BPMA 2YITA 1YI6A 1JAMA 1PXKA 4GK2A 4XMOA 4G6OA 1Q62A 5F20A 4DH8A 3VS0A 1LUFA 3PY3A 4YGAA 3RWQA 3GENA 4Y83A 4K33A 4AUAA 4H3BA 4UYNA 3PVGA 4G3EA 3FDNA 2VTOA 4RIXA 3D2KA 1APME 3RI1A 4MWIA 3VS5A 2C6LA 2GS2A 3G5DA 3MJ1A 3QKLA 3WE4A 3KULB 4EKKA 4B0GA 3ZFMA 4NFMA 3UIBA 2YIXA 3O8TA 4FZ7A 2BFXA 3FI4A 3IKAA 3ZBXA 4AWIA 4BB4A 4ERWA 3LJ1A 4EYMA 2UW6A 3GU7A 4WNKA 5HIEA 4AX8A 2RFDA 4JNWA 3OWPA 2C0TA 2QQ7A 5FXSA 4II5A 3E8DA 3UNKA 5DR9A 2B9JA 3EN9A 3Q52A 4FKOA 1G8SA 4J8MA 5KNJA 2VWUA 2W4KA 2QNJA 4W8EA 2B53A 3GOPA 4BI1A 1MRUA 2Y6OA 3RZFA 4BIBA 4FICA 4BZNA 5LCKA 5AP3A 3VUMA 5ANGA 3R7IA 4KSPA 1P4OA 5IEXA 5EDRA 3FEGA 4EWQA 2ESMA 3PIZA 3EWHA 2A1AB 5AP4A 4S34A 5L3AA 4GK4A 2J51A 2GMXA 4L9IA 5HLNA 4D28A 5CAOA 4NW6A 1YVJA 2IVVA 1YWRA 5TF9A 3H9RA 3OT3A 3FSFA 4KIKB 3RP9A 2NPQA 4FVPA 1T45A 5BQ0A 1M2RA 4O7SA 4MXOA 5LQFA 3DA6A 3FL4A 2YLEA 5AUTA 3ZLWA 5DG5A 3DJ5A 4AXAA 2H6DA 4F0FA 1R0PA 4KA3A 3RWPA 4K77A 4EH5A 3NNVA 2FB8A 5M44A 5AM6A 4FTTA 2ZB1A 5DRDA 5CSHA 4KWPA 2UW5A 1BL7A 1NVQA 2O63A 3FQEA 3QUPA 4BDFA 4QT1A 3ZO2A 4C59A 5HQ0A 4MHAA 5LMBA 3TV6A 1WBTA 4TTHB 5JGDA 5LMKA 2IW9A 2BZJA 4ZMEA 3QBNA 3CE3A 3OBJA 2ETKA 3Q3BA 5F1ZA 3Q4TA 3S1HA 5H2UA 3R9RA 4Q9SA 4DEEA 2YHVA 3QQGA 2XKDA 4FSZA 2WMXA 4RC3A 5D10A 4ACMA 2JAMA 4FNXA 4WBBB 4NYEA 4XBUA 2GU8A 3L9MA 2QOOA 3A7IA 3KN6A 4IX5A 3KMUA 4BTMA 2QKWB 3EN6A 4FTQA 4M97A 4RIWB 2C3LA 4X2JA 4BCKA 5LVOA 4FZ6A 2X0GA 1YKRA 3MFUA 3QHWA 4GT4A 5CNOA 3DT1A 1SZMA 3SKCA 4BTJA 5AR8A 3WYYA 3DNDA 4R3PA 5ITAA 3DU8A 5J5SA 2FUMA 3WF8A 3RJCA 3HEGA 1REKA 1H28A 2WU6A 3V6RA 5IEVA 3TM0A 4BHZA 5DFPA 4LUDA 5HE2A 4MYGA 4ASZA 4ORKA 5BVEA 3O7LB 4OTFA 4GKIA 1Q8ZA 2YM5A 4FV8A 4BHNA 5KBRA 3NYOA 3EZRA 4Y5HA 5M56A 4QQ5A 3UZRA 4FG7A 4HCVA 3EJ1A 5AJQA 4QYYA 1SVEA 4BCNA 3CTQA 3M1SA 4ZSGA 3KN5A 4CZUA 4DG3E 3LXLA 3IOKA 2VD5A 3KEXA 4DFLA 2AUHA 3VS2A 4M12A 4M15A 4ENYA 3QQUA 2X2MA 1UU3A 4I4EA 3OBGA 4Q5HA 4QP8A 4JIAA 5AAGA 3E7VA 4H58A 3COIA 1Z5MA 2OKRA 4DH1A 2AC3A 2W0JA 3QCQA 1K2PA 2Y4PA 4JDIA 2HW6A 1ATPE 4GSBA 4BKYA 2OG8A 4E5BA 4NFNA 3HV3A 1H00A 5D1JA 4IM3A 2QU5A 3GU6A 3ID6C 2ITXA 4E7WA 3C9WA 5ANOA 3EQDA 3HMIA 3ZS5A 2XM8A 3NCGA 3OCSA 4O0YA 4O1OA 4DE4A 4O86A 3A61A 4B4LA 1XH8A 4PDYA 5J7BA 1Q61A 4EHVA 4R6VA 4GK3A 2CGUA 2A0CX 3P86A 2QO9A 5CALA 4FT9A 4UEUA 3BLQA 3ZOSA 2IPXA 4RX8A 2R3HA 4EOMA 3HDNA 3QRUA 4GFGA 4NIFB 2YIQA 3GB2A 4TWOA 3M11A 4I6BA 3G6HA 4X0MA 3ZHPC 4EK8A 4F0GA 2GHMA 4M66A 1KV1A 1OPKA 1ND4A 3BV3A 2W05A 2WMRA 2WU7A 3FXXA 1R0EA 3NUNA 4CZYB 4FK6A 4G1WA 3PWYA 4A06A 4EJNA 3QGWA 5LWMA 3DNEA 2X7GA 2XA4A 4KIQA 4DFNA 2OWBA 5FTGA 4IDVA 3BYUA 4CEGA 4CKIA 5F9EA 4IFCA 2RKUA 3C0GA 4I92A 5B2KA 3ALNA 2PMNX 4IC8A 3Q04A 4FL3A 5E8XA 5JRQA 5HE3A 1HCKA 2WQNA 4IWOA 4IQ6A 4YLJA 5L4QA 5AIKA 2XNMA 3GGFA 2DQ7X 3P7BA 4L3PA 3U4UA 4NM7A 3QHRA 2VWBA 3Q9WA 1F5QA 4G9CA 4XG6A 3TNQB 4AOIA 2W1GA 5DRBA 4O7TA 3QRIA 2OJFE 2XNPA 3QXPA 4GV1A 2C6EA 3C50A 3HA8A 4XG9A 5I9UA 3E62A 3F6XA 2YIYA 4FT7A 2ZM4A 2RFNA 4ZJVA 3RPYA 4A9YA 5L2WA 4HVHA 3LMGA 5KZIA 5AMNA 2O2UA 3FLSA 3R83A 3OS3A 2CN5A 4CCBA 3C0IA 5KHWA 1O9UA 1YRPA 1U59A 1V0PA 4EOKA 4YTHA 4FKRA 4RMZA 3UBDA 4A4LA 4FKVA 5KZ0A 1IEPA 4O83A 3KA0A 1NT2A 3GQLA 4FZAB 5L6OA 1XKKA 3VO3A 1JVPP 2G2HA 2BRHA 4FTMA 1NW1A 3I79A 4QMOA 2J50A 5E1EA 4XRLA 1PHKA 3FMMA 3CR0A 3RPSA 5AV2A 2G2FA 4BDEA 2WTCA 1RDQE 4FSYA 3GFEA 5DYJA 4AZSA 2C6TA 4Y72A 4O22A 4G3CA 4I5HA 3R8ZA 2HK5A 3E64A 4FI1A 2QONA 1P5EA 5A3XA 4E26A 3UQFA 4IXPA 2QURA 2R4BA 5H8GA 4C4JA 3PSBA 2DYLA 3KU2A 3NUUA 3R71A 1WAKA 3E7OA 5KMLA 2J7TA 2C3KA 2JBPA 5T3QA 4AN3A 4ZSEA 4FTNA 4PPCA 4YZCA 5ANJA 4EHEA 3FQHA 3CGFA 4FTKA 3TL8A 5JSMA 3ZO4A 5CAQA 2R3MA 4J96A 4GVJA 3K2LA 4L3LA 4FEUA 2QG7A 4BY9E 5C26A 4XS2A 4PNKA 1ZYCA 3UC4A 3NNUA 5CWZA 2UZEA 4MD7E 2PVNA 3LJ0A 3OVVA 4GRBA 3RTPA 3MWUA 3KVWA 5AUUA 4EC9A 4RPVA 3HAVA 5CSPA 1TQIA 1XR1A 4U8ZA 3PE1A 4M69A 4KKEA 3KB7A 3R1NA 3IG7A 2Q83A 3W16A 4IX6A 2PVLA 3R7YA 3EZVA 2UW4A 2J5FA 3EIDA 2IJMA 3RPVA 3ORIA 5TE0A 2RL5A 4WKQA 5IQGA 3NMUF 3NW5A 1XHAA 3D94A 2JDVA 5LVLA 3KFAA 4FZDB 4IC7A 4LGHA 3OY1A 2X1NA 4YC3A 4ASEA 5IMEA 4OAUC 4Y73A 3FXWA 1B38A 3OEZA 4HGTA 3ZMMA 4AZWA 3Q5IA 4JBPA 4O2ZA 3UMXA 3ZEWA 3HMNA 4IAIA 2Y4IB 3VJOA 5I9VA 5GZAA 1W0XC 4FV4A 5H9BA 4AW2A 4FSRA 3WI6A 4KUJA 2WAJA 2OH4A 2QR8A 3FHRA 5CU4A 2BIYA 4IBMA 4QMLA 3RK9A 5KMJA 3E93A 3EYHA 4O7NA 4L53A 3EQPA 3HECA 2H8HA 3O71A 4W4WA 5ETFA 3WZUA 5GHVA 3TIZA 2PE1A 4D4SA 4DCEA 1PXNA 4EUTA 1K9AA 4I20A 4UMQA 3W18A 4IAFA 4IANA 4QD6A 3VUGA 5HCYA 4FEQA 4X7QA 1W84A 2X7OA 3BIZA 2WOUA 1WFCA 3D4QA 4U5JA 3ZLXA 4BDBA 3DJ6A 4YJUA 3IGGA 5CVHA 1RE8A 4W4YA 4EK3A 2YZLA 5FRIA 3BZ3A 1YXTA 4HYSA 1M17A 5BVKA 4DT9A 2WTKB 4AFEA 1WVYA 1BKXA 3MY5A 4Y8DA 3DB6A 1S9JA 2HAKA 3OOMA 3DZOA 3PP0A 3ORLA 3R0TA 3A8XA 3QTUA 3U9NA 2W1ZA 3GI3A 4RJ3A 4AFJA 2PVJA 3CPBA 4KB8A 4LGGA 5AV3A 3N9XA 1YXXA 5K5NA 2E9UA 3B8RA 4TY1A 2W1CA 3PJ3A 3PXZA 5E8VA 3L8VA 2QHMA 3EQBA 3I0OA 2GCDA 3IS5A 2QU6A 2C1BA 1Q8YA 3TEIA 5E8UA 2PU8A 3G9NA 4E4XA 4PTEA 2E9PA 3HDMA 4DFBA 1DM2A 5D41A 4AQCA 3F66A 2PTKA 3FL5A 1VYZA 3IPHA 4O38A 3MGYA 3SGCA 3PFQA 3LPBA 5HNBA 4GW8A 4E20A 4C62A 4JQ7A 4RJ6A 1G3NA 1YOLA 1JKLA 1V0OA 3MJ2A 4QMSA 3REPA 2Q0NA 4QYGA 3TIYA 4BCHA 4D4YA 2J0MB 3Q5ZA 3SDJA 4C36A 2UZVA 2BAKA 3NR9A 5EH0A 3VUKA 5BVWA 3DK6A 3QAME 3AC3A 2VN9A 4C4IA 3I0QA 4EOSA 3R01A 4XCUA 4Y5QA 4DAWA 4YTCA 4RFMA 5J79A 3NEWA 5M08A 1UNLA 4ITIA 5D12A 3DKGA 5HBHA 4CXAA 4J53A 4JVGA 5I9YA 3NS9A 3G0FA 3PJCA 2YFXA 2E9VA 3ORNA 3DQWA 3TUBA 2VX3A 2QOHA 4F9AA 3CKXA 5DIAA 5M53A 3U54A 4L00A 3VBVA 3DXPA 4C2WA 5A4QA 1IR3A 4BL1A 3LIJA 1YHVA 2F9GA 5BUEA 2GTNA 2UVYA 3CJGA 2QOLA 1OPJA 3EQRA 4L7SA 3UGCA 3LLAA 4U0IA 3MPAA 4NCTC 4DEGA 5CI7A 1Q4LA 5CEKA 4FGRA 2JGZA 3ZXZA 3SAYA 3D5XA 4MNEA 3VRYA 1E1XA 1GZOA 3CQUA 4O0SA 3MPMA 5AAFA 5IDPA 2H96A 5CSVA 1UKHA 4K11A 1CM8A 4AU8A 3I81A 5CYIA 4BCPA 5L2TA 4AOTA 1JSVA 3FMNA 2C1AA 1MQ4A 3AMYA 4UY9A 3RGFA 1REJA 4J99A 2J90A 4HYIA 3U4WA 3Q9XA 4PL4A 4DG0E 3QD2B 4DTKA 5TKDA 3QZFA 4JOAA 5I4NA 3BU6A 3PY1A 3NUPA 4KKHA 4BBFA 4S32A 1M7QA 3WILA 2EXCX 2VO0A 3FC1X 4C4EA 4D5KA 5LWNA 4I24A 4FEVA 3CY2A 3UOJA 3P9JA 4FV2A 2YCQA 2PE2A 2PVRA 3EB0A 4M0YA 1G5SA 4C34A 1CMKE 5E7RA 5HTCA 1WBNA 3S4QA 1OIYA 2BRMA 3TZMA 1JSUA 3MY1A 4XOZA 2ETMA 4CKJA 4FIEA 2VZ6A 4OTRA 2HY0A 3FZRA 4AZTA 2I0EA 4HZRA 3RPRA 2EVAA 3R21A 4J8NA 4PV0A 3ULZA 1FINA 5F94A 4I1ZA 4DBNA 5C8MA 3RAKA 4ZY5A 5IU2A 1PXPA 4KABA 4P90A 4QPMA 2GHGA 3QQKA 2BIKB 4O0WA 4S31A 5J5TA 3EFLA 4X21A 5IQFA 3TV7A 4E6DA 2JIIA 4XBRA 3PTGA 5EKOA 3W2QA 2CNVA 3OP5A 4JRNA 3TWJA 4AT3A 1OL2A 4L68A 3LAUA 4DGMA 3OXTA 4PWNA 2PYWA 2OIQA 4LV5A 4ASXA 4C8BA 4CFVA 5JH6A 5JKGA 4C02A 4R1YA 5LXMA 3LQ8A 2WMUA 4V0GA 3LFQA 5FLFA 4NUSA 5DGZA 3JVSA 3R8UA 2C47A 4MX9A 3FAAA 4MWHA 1JWHA 3BV2A 3F7ZA 2CN8A 5IUGA 4RC4A 4RVLA 4GS6A 3VF9A 4XG3A 3O51A 3Q32A 4Z7GA 4YJPA 2OI4X 4AW5A 1PXLA 2FH9A 4NW5A 4BIDA 4XNEA 3TUDA 3TDWA 3ENMA 5DT4A 5C01A 5EOLA 4L43A 3PSCA 4K6ZA 2GQRA 2YDIA 2VO6A 4HYUA 4CYJA 1WZYA 5IH4A 4EJ7A 1SVGA 4BDAA 3HGKA 4QMQA 4QMTA 4CT1A 3H9OA 3NRMA 5CT7A 4OAVB 3CXWA 4PRJA 5AR3A 3KF4A 4IAKA 4O0TA 4TRLA 5EDQA 3WOWA 4YZDA 1XBAA 4LG4A 5DLSA 3PYYA 3UVQA 3NIZA 1QPDA 1B6CB 3CJFA 3I5NA 3MH0A 4LGDA 3E63A 1KUTA 1IASA 3V8WA 4OLIA 2EU9A 1XBCA 5HU3A 3Q96A 4UWBA 3CPCA 3K3IA 4ZJIA 3UOHA 2RG6A 3AC5A 4HZSA 4ACGA 3Q4ZA 4NSTA 2W06A 4RJ5A 4KKGA 4RIOA 2XNEA 4RWIA 4JQ8A 1KSWA 5B0XA 2OBJA 1AD5A 2ZB0A 3PVUA 3G0EA 3A7JA 5HVYA 4QMPA 3PPKA 1KV2A 2G9XA 1ZLTA 2W1DA 3F3UA 4U40A 2PSQA 4V01A 4E6AA 4E8AA 2JFMA 3KMWA 4XEYA 4Z3VA 2I0YA 4GT5A 3BYVA 4F7LA 2CJMA 3BWFA 5HVKA 4P5QA 4FIHA 4I23A 3FE3A 1ZARA 2QHNA 1CKPA 3HVCA 5CU3A 3DFAA 4K9YA 4D2SA
chains in the Genus database with same CATH superfamily
1KOAA 3IQ7A 3ZBFA 2Y0AA 4CQEA 4WD5A 3DPKA 4H1JA 5HIBA 5C4KA 1OL7A 4S30A 2C5NA 5DT0A 5EK7A 3NFFB 4IZ7A 2IZTA 4XLIA 2XIZA 4J97A 2X6EA 4R5SA 4U7ZA 4LV8A 4WNPA 2ZAZA 3BYOA 3RAIA 5CEPA 2VNYA 4RLLA 4D4RA 4Q9ZA 2RFEA 3FLNC 4N57A 1P2AA 1KE7A 1H1QA 3RAHA 3WE8A 4TL0A 4F78A 4G3DA 2R64A 4ZTMA 3EL7A 2C6OA 3AGMA 4A4XA 4JIKA 4FC0A 1Y6BA 3KY2A 3U6HA 4BI0A 5D7VA 5M57A 3F2NA 3C4ZA 3U87A 2VX1A 3LXKA 3M42A 4IB0A 4N6YA 3JY0A 4ZLZA 4FKGA 3SVVA 2HY81 3NW7A 4YLLA 3NZ0A 4RA5A 4LM5A 5DPVA 4AP7A 2BHHA 2JDSA 3G2FA 5A4CA 2E2BA 4JR3A 4G16A 5EHLA 4BCFA 4MKCA 3VIDA 3D7TA 4ZTQA 4M3QA 2CLXA 2QODA 3GEQA 4JBVA 4TT7A 5BV3A 3RNYA 3SD0A 2XALA 1P4FA 1H27A 2IW8A 4EEVA 4C3FA 2R3LA 1U54B 3F88A 1Y8GA 4ZLOA 1BLXA 3AOXA 3FXZA 3IW8A 2QOCA 4C4FA 4G31A 1O6YA 4I6QA 5BMSA 5DMZA 3BL7A 4F1MA 2PZ5A 3F7WA 3NX8A 2X2LA 5IA1A 3UZTA 4EC8A 4EBVA 1JKKA 3NPCA 4FTRA 3Q2MA 1SMHA 3UQGA 3VQHA 3EKNA 4C58A 3AD5A 5HE0A 2XNBA 2IWIA 3SG8A 3KXGA 4ANMA 3ODZX 5AP7A 4QO9A 1PJKA 2XKEA 4FV3A 1ZOEA 4H3QA 3AG9A 4HPTE 5IUIA 4ACDA 2REIA 5IG1A 4I6HA 2GQGA 2DS1A 1NA7A 3WZKA 4CRSA 3SG9A 4L6QA 2B0QA 5D9HA 2UZBA 3ZFYA 3HRFA 4C37A 4G6NA 2V22A 4YZMA 3DXQA 1P14A 3AMBA 3FKLA 4IHPA 4BWXA 5DN3A 4O84A 4P7EA 4X3FA 5I9WA 3WIKA 3TZ7A 3TN8A 3UODA 4GVAA 2YZAA 3BYMA 4QQJA 4BR3A 4A9SA 5EI6A 3F9NA 4X6QC 3VJNA 2XK4A 4ANSA 4J1RA 5J87A 5AR5A 2ITTA 4FMQA 2VTTA 4USEA 3QZHA 4RZVA 3AD6A 1PMNA 1YOMA 3QRJA 2NRYA 3OWJA 2YCFA 3KGAA 4NJDA 1DI8A 4PTGA 5KMKA 3FLQA 1LP4A 5EQYA 4QP7A 3OY3A 3DDQA 4U43A 3NAXA 3UP2A 3VW8A 2W17A 3QUEA 3NAYA 4F09A 2HWOA 3HAMA 4NZWB 4CNHA 4I94A 3NVMB 1QCFA 1Q8UA 3L1SA 3ZXTA 3FI2A 5GJDA 4CFMA 3HMMA 2GHLA 4YSJA 2O65A 3LM5A 2IVTA 5IKWA 5B7VA 2VGPA 4R8QA 5JZJA 4D9UA 2RGPA 5HTBA 3PPZA 4YTIA 1STCE 4PDOA 2VNWA 5CY3A 4M84A 4L46A 4MXXA 2NP8A 2YDJA 3O8PA 4BCJA 4W8DA 3HZTA 4FV0A 3HV6A 4PMMA 5HGIA 3HUCA 4AF3A 2O64A 5CAPA 4NM3A 4HVGA 2VAGA 2YM4A 4EZ3A 4JMQA 3DKCA 4CV9A 3UVRA 2G15A 3TACA 1QPJA 3VHKA 4D5HA 1PXOA 2Z02A 4U44A 4B9DA 4ANLA 2CCHA 1XH7A 4IE9A 4TYHB 3QC4A 5CF4A 3NIEA 5K4IA 5AV4A 4IMYA 1L3RE 4RZWA 3QWKA 4FTLA 5KKRB 2XYUA 1TQPA 2XIXA 3VBQA 5AA9A 4BN1A 5H8EA 4JRVA 2ZV8A 2RF9A 1A06A 5KX8A 2NRUA 5EYKA 3PFYA 5M09A 3KK9A 4NKSA 5H3QA 1PMUA 4RIXB 3EMGA 3IK3A 3TKIA 1PXJA 1Y8YA 4C57A 3R22A 4A7CA 2P33A 5FUTA 1AQ1A 1CDKA 5E8TA 3R8MA 4CZTA 2BROA 2VTPA 3ZONA 5JFWA 3R7VA 3QLGA 1YWNA 2OJJA 1URCA 2QOKA 3WYXA 2C30A 2OO8X 4DH3A 1YDRE 3RKBA 2HYYA 4EKLA 1XMLA 2WTDA 3BHHA 3MI9A 5DEWA 1JOWB 5AV0A 1K3AA 2EB3A 5CEOA 1PF8A 4FTJA 5I5ZA 2CGXA 5FP5A 3DXNA 3NCZA 4JAJA 2C6DA 2YWVA 3ZC5A 2ERKA 2V7OA 5CQUA 4AGDA 4ANQA 2F7XE 5EFQA 2Y9QA 3Q4CA 4BDJA 4RWLA 5GZ8A 4FSQA 5EI8A 4QQCA 4RX9A 5DBXA 4FKPA 1MQBA 4QP3A 1VEBA 1HCLA 3QC9A 5ANKA 5IA3A 3JUHA 3TG1A 1I09A 1W2CA 2G01A 5FTOA 2JD5A 2BFYA 5E91A 3VNTA 3ZRLA 3NYXA 2YEXA 3TTIA 2RG5A 4FZFB 2GTMA 5IQBA 4WG5A 3KC3A 4YC6A 3AC4A 4QP6A 2OZOA 4XV9A 4FK3A 5AUVA 3ANRA 4N0SA 4RFYA 4H1MA 4KIPA 4TWPA 4WG4A 1PKDA 3R1SA 4PP7A 5KHXA 2FGIA 1NVRA 4TYIA 3ZDUA 3A60A 3TV4A 4W4VA 3VUTA 4IJPA 5AAEA 4QP1A 3SOAA 5HG8A 3S2PA 2UV2A 3BE2A 4I0TA 2W9ZB 4WBOA 2GNIA 4FKSA 3C5IA 3FI8A 2UZLA 4PP9A 3O8UA 3GCSA 5TR6A 4CQGA 2JKMA 4ALVA 1R39A 4EH2A 4ZOGA 4ZY6A 4FVRA 3WF5A 5LCJA 3QQFA 2VWIA 3MS9A 4LQMA 3TNIA 3THBA 2HXQA 4O0RA 5CI6A 2UZNA 5JMSA 4FVQA 4I6FA 2OJ9A 5A4LA 3RM7A 2CNQA 2WQBA 1R3CA 1Q41A 3LMIA 4FG9A 1W98A 2WKMA 3MB7A 4XV3A 5CNNA 3V8SA 3ZFXA 3PA5A 4KBKA 1OKVA 4X6RA 5AFVA 2XKFA 1E9HA 4I41A 4OTDA 2EWAA 3MFRA 5EW9A 3OWKA 2YWPA 3ZUVA 3QWJA 5BVDA 4DFYA 4CGAA 3P1AA 4CVAA 4JR7A 4A9RA 2B52A 2UZOA 4O27B 4O4DA 2Z7SA 4RLKA 4WG3A 4BICA 3KRXA 2HELA 4O4CA 2YCRA 1GIIA 3HV5A 4BDHA 2X0OA 4RVKA 5EM5A 4BKZA 4QDVA 3COKA 4CTCA 3RPOA 3U9CA 5L6WL 3KQ7A 4XRJA 2LAVA 3Q60A 4Z55A 3TJDA 4FUXA 4IWQA 3UG1A 4D9TA 2XIRA 4XV1A 2X2KA 5BUJA 2ETRA 2I6LA 2ZOQA 4GJ2A 4XP3A 2WB8A 4OW8A 3P5KA 4NTTA 4RJ7A 2CHLA 4U79A 2G2IA 1H24A 1KE6A 3PXQA 4NT4A 4QRCA 4CTBA 1BI8A 4K8AA 4F1OA 2WELA 3BU5A 5CZHA 3UOKA 3VBWA 5IQIA 5AADA 5BVFA 4RIYA 1KE8A 3BL9A 3QXOA 4GIHA 2CMWA 2FSLX 3D9VA 2YM7A 2JKQA 5HD4A 3HL7A 5A4TA 5IH5A 4FE2A 4HCUA 1UNGA 1MRYA 4GT3A 3P78A 1SM2A 5FBNC 3NYVA 3VBYA 4XG2A 3FPQA 3V5PA 3Q4UA 2I40A 2R3JA 3ODYX 3T3UA 5B2MA 3ZM9A 4IX3A 2WMWA 1U5RA 1PY5A 1F0QA 2R5TA 2YM8A 2YA9A 3SQQA 4G5JA 3SHEA 2WTVA 3MFTA 4BCOA 3M2WA 2W1FA 5CTPA 3C4FA 3OTVA 4PNIA 1YI4A 3WF6A 1W2DA 3ZUTA 5AEPA 5DEYA 5CAUA 5FEQA 4DHIB 4GMYA 4XLVA 4O7ZA 2PE0A 2Y6MA 5ANEA 2HW7A 4NCTA 3JR1A 3KXMA 4WT6A 3DKOA 4ZZMA 3W2OA 5KMOA 1M52A 4ZZNA 3DQXA 4FKUA 3R00A 2C0OA 4FOCA 4V05A 1VJYA 3LJ2A 4BJJA 2RIOA 3FLZA 2VWXA 3I7BA 3FV8A 2C69A 4C38A 1GY3A 3R2BA 4G17A 5FM2A 4XYFA 5CXZA 4P5ZA 5GJGA 5L8JA 3W1FA 3L9PA 4MXZA 5E4HA 4HVIA 5IUHA 3V5LA 4CSVA 3EH9A 3TZ9A 4MF1A 2CGWA 1MP8A 1WMKA 2PVKA 2QCSA 4K2RA 4FTOA 2NNWB 2X9FA 2PUNA 1OI9A 4IWDA 4XH6A 2I0VA 4AGWA 5I0BA 2O8YA 3NGAA 3KIOC 5A4EA 1URWA 3DK3A 5EHOA 1UKIA 4BDGA 2FSMX 3IDCA 4CLIA 2PUUA 1AGWA 2WFYA 5EYCA 3DTWA 1ZMVA 2XNOA 3UNZA 4DGGA 3KXHA 1CSNA 3CD8A 3QRKA 1CKJA 4YJOA 3W55A 2OICA 3KCFA 3OFMA 1WBVA 1R78A 2YAAA 1OIUA 4UMTA 4YPDA 4I0RA 5HLWA 3ULIA 2BAQA 3FZ1A 4BWKA 3QTQA 1SNUA 2UW0A 4N6ZA 2B54A 5CXHA 3W32A 5CLPA 2XEYA 1YI3A 3MA3A 4HGEA 4OTQA 4FKIA 3BQCA 1Q3DA 5CEIA 3R8PA 5HNIX 4KD1A 1J7IA 2HZIA 3G51A 2R2PA 3Q6UA 5IA5A 4YSMA 4UALA 4BTKA 1G8KA 3CEKA 4M67A 5M06A 3LFFA 4QTAA 4BBEA 3L8XA 5DOSA 4D2WA 2OFUA 3UE4A 2WQOA 5CF6A 3CY3A 5ANDA 5GIOE 3BX5A 2VWYA 3SRVA 1SVHA 2GFSA 2XUUA 2XZSA 3UO5A 3W0OA 4ZLYA 4WA9A 4BDIA 4BDDA 3SW7A 5AIRA 1SNXA 2ONLA 1VR2A 3K5UA 4ZSJA 1GZNA 3DBEA 4OGRA 4YHTA 4OBOA 5AP0A 1GOLA 3VUHA 2J5EA 3PVBA 4FIGA 5HI2A 3K5VA 3QALE 5IPJA 3AC2A 5FDPA 1M7NA 3OZ6A 3W8QA 1LEWA 2ITZA 3NVKI 4LL5A 3UZPA 2VTIA 5CU0A 4B99A 1OMWA 4M14A 4PPBA 4LUEA 1TVOA 4C4HA 3C5UA 5FXQA 1W8CA 2GFCA 1ST0A 3LQ5A 4WUAA 3EYGA 3R30A 5E9EA 3PG3A 5TT7A 5LOHA 3S0OA 1FOTA 4J98A 5AWMA 3AC1A 3I7CA 3ZUUA 4O7WA 4DT8A 2QI8A 4DC2A 3QX4A 5ICPA 3IONA 2BZKB 4EOPA 2OZAA 5AR2A 2C5OA 5FBOA 5C9CA 4RX5A 5IF1A 4QP2A 3DS6A 5DHJA 4AE9A 4GG5A 3R28A 2BRGA 5HO6A 3E88A 1ZAOA 1ZRZA 3C4XA 5FP6A 4R77A 4PX6A 3JXWA 3R02A 4KIOA 2I7QA 4AA4A 4LL0A 2O0UA 5HX8A 2ZJWA 3TNPC 3UMWA 3PJ8A 1TFFA 1HOWA 4IB1A 1OUKA 3DBCA 3FUPA 5HCZA 1H1PA 1DS5A 3KRRA 4DFZE 4M69B 4AXEA 4CG8A 4EQCA 3GCUA 4IDTA 2ZV9A 4FODA 4CFUA 1DI9A 2BVAA 3F3ZA 1LR4A 1Q5KA 3ACJA 3ZCLA 2WGJA 4L67A 4E1ZA 4R3RA 3H3CA 4G5PA 3WIGA 5HLPA 2VUWA 2WOTA 4TPTA 2V5QA 2WIPA 2XANA 2XRUA 2UVXA 3LVPA 5C03A 4DGLC 5L2QA 4YJNA 4AAYA 5J95A 3D5UA 4OTHA 3VVHA 4FSUA 3R7EA 4M68A 3DCVA 4FKLA 4YZ9A 1UU7A 3EKKA 2P2HA 2Z7LA 4ZTNA 4K18A 4RQKA 5IEYA 3FYKX 5HORA 4C3PA 3LFDA 3POOA 3QCSA 4WSYA 1FGIA 4RA4A 4EK4A 1ZOHA 3QGYA 4PDSA 3KRJA 4BGQA 3T9TA 4DEAA 3OHTA 4WNMA 1JKTA 2Z8CA 4FL1A 4H36A 4Z16A 5K9IA 3K3JA 1H07A 4LV7A 2X4ZA 4IJ9A 1YW2A 3OF0A 4C3RA 2OK1A 4E73A 1Y6AA 4EH8A 4AW0A 4EZ5A 1PKGA 2F7ZE 3P0MA 4RWKA 4AW1A 2I1MA 4ZZOA 2WMVA 5BUIA 4PMPA 5I9XA 4R78A 3R9NA 3VQUA 4D2TA 3DTCA 4B6LA 4YURA 2W5BA 3DBFA 2XCKA 4TNDA 3SXSA 3T8OA 3UG2A 5AV1A 3BEGA 4FIIA 3SW4A 3OROA 3SX9A 4EH3A 2GS7A 3B8QA 4ZEGA 2BDJA 2BCJA 3W2CA 2WTIA 3MVMA 5J9ZA 2C5YA 1J91A 1PXIA 3PPJA 4U97A 5FEEA 3QQJA 1PW2A 4IH8A 4PL3A 4YO4A 1OPLA 2W9FB 4NH1A 4CMUA 5HX6A 5IQDA 3VBXA 3A2CA 4XP0A 5AP5A 5HE1A 3TI1A 2C6KA 4U9AA 1GAGA 4C33A 5LVNA 4C4GA 3KF7A 4JX7A 4ZS0A 3AT4A 5HCXA 3MV5A 4DLJA 3EQIA 3CLYA 4IZYA 5FTQA 3GOKA 4O0UA 5CF8A 3P7CA 4W9XA 3P79A 3RNIA 2RFSA 5I3OA 2WIHA 5IQEA 2YDKA 4O6LA 2PMOX 3LXNA 2B9HA 4QTCA 5K0KA 2Y4IC 3AMAA 1BYGA 3FY2A 2WMBA 4BDCA 3KREA 3PXYA 4BGGA 3W2SA 4D58A 3FQSA 3HA6A 3F3TA 4FR4A 3OW4A 4WSQA 3QYZA 4IM2A 4DFXE 4MQ1A 4F9BA 3N4VA 5CAVA 3TXOA 1IAHA 3G15A 3C0HA 4AT5A 1L8TA 4TXCA 3A7GA 4CFXA 2BMCA 3FWQA 3F3WA 5HHWA 3GXLA 3QL8A 4F7JA 3OWLA 4E5AX 3EQHA 2VTMA 1B39A 2F49A 2VWVA 4CV8A 2XKCA 4GH2A 4X3JA 3LE6A 1MUOA 4J7BA 3VRZA 3ZYAA 2CSNA 3PLSA 4XX9A 5EHYA 2CKOA 1BUHA 5KCVA 1FMKA 2WTKC 3W8LA 1M2QA 2X8DA 2J0IA 1O6KA 3OW3A 2B7AA 3RCJA 3PXFA 3I1AA 1OM1A 1UU8A 3GCVA 4I22A 4AZEA 1PYXA 2IO6A 3CTHA 2UUEA 4PY1A 1YQJA 4FGBA 1J1BA 3FZTA 4OTWA 4EYJA 1OVEA 1J1CA 3BE9A 1OZ1A 4JG7A 4R7HA 5EM6A 5FWKK 3P5JC 3DZQA 5IISA 3BRBA 4MNEB 3ROCA 5FXRA 1IA9A 4HGSA 1G8JA 3LXPA 3VULA 3G6GA 3F2AA 1JQHA 3HRBA 3V5JA 4HNFA 4IAYA 5FG8A 3U6JA 4D1XA 5J9LA 2Q0BA 2R7BA 3PG1A 2XCHA 3R8LA 1FBNA 3NUXA 4ANOA 4F6WA 2PWLA 3R2YA 4LRKA 4YJQA 4IACA 3R7GA 2OIBA 1GZKA 2X6DA 3PIXA 3RINA 4ARKA 3N4UA 3OT8A 4FIJA 1LEZA 2WD1A 4MXYA 4RJ4A 5DE2A 4DTAA 4QMXA 5C1QB 1ZYLA 3O23A 3R1QA 4I93A 2PK9A 1ZZ2A 3BYSA 4QP4A 3UOLA 3C13A 2XK8A 4FL2A 3MH2A 4AT4A 1GJOA 4JLCA 3I6UA 4ACHA 1ZWSA 3QTZA 4YR8A 4YBJA 4MH7A 2J9MA 4GU6A 4AXCA 3PA4A 1Z9XA 3MFSA 4F6UA 4QMYA 2ACXA 2V55A 4JBOA 2W1IA 2WNTA 3OMVA 2JAVA 1XH6A 3JYAA 4QMMA 3EQGA 5ACKA 3BKBA 3NYNA 3DLSA 3FZSA 1DAYA 3R6XA 2BUJA 1XQZA 3O50A 3UDBA 2BR1A 3A4OX 2OH0E 4Z7HA 3QA8A 2OXDA 2VTAA 3MYGA 3KL8A 4G3GA 2QC6A 2UZWE 2R3QA 5E8SA 4AACA 4YZNA 4AS0A 1W82A 2QO2A 2R0UA 3DBQA 1Q3WA 2ZDTA 3F5PA 5GJFA 3RHKA 2O5KA 2YN8A 3BCEA 3MESA 3E3PA 1JKSA 4BTFA 4EH4A 2VU3A 3ORMA 2XYNA 4O4BB 2WMSA 4XUFA 4B7TA 1XH9A 2WEIA 2C68A 2WXVA 5M07A 1PYEA 5IH6A 2YIRA 1KWPA 2E9NA 3FC2A 4L7FA 5CZIA 2VTSA 4DEHA 5M4FA 4DDIA 5E8YA 4AXFA 3MA6A 4UN0C 4V0GB 3KRWA 1UV5A 4YJSA 3OUNB 3ALOA 2QG5A 1UWJA 5FM3A 3VS4A 4DA5A 4L3JA 3V01A 3U55A 3GCQA 3KCKA 3B2TA 2YERA 3PXKA 4N4SA 3PZEA 4KAOA 1J3HA 5KO1A 4EHGA 3V8TA 3QTIA 1UU9A 3MBLA 5CANA 1KE9A 2GPHA 4G3FA 1NY3A 3FBVA 1I44A 5CQWA 2A2AA 2VTLA 4FX3A 3UYTA 2BZHB 3CC6A 3ZM4A 1WBOA 5IA4A 4DEBA 5FD2A 3F3VA 2I0HA 3KULA 4DGOA 3OUKA 5GINE 2XF0A 4EOIA 4PMTA 4FV9A 3GP0A 4JL9A 3BEAA 4XG4A 5L2IA 3DGKA 3QQHA 5GNKA 4BCGA 5KE0A 5DNRA 4QOXA 4DHFA 2WO6A 3DDPA 5D7AA 3NW6A 1Z57A 4FT5A 5BX0A 2OIDA 5CENA 2HOGA 5AUZA 3DAJA 3V04A 3EOCA 2XJ1A 1ZMUA 4D1ZA 3PVWA 5EM8A 4J95A 5CF5A 5JZNA 1QPCA 2IZUA 2XS0A 4J71A 3NWWA 4MTAA 5E8WA 3DKFA 4YP8A 3LOKA 3PP1A 3ZDIA 3ZO1A 4QDEA 3KXXA 3UC3A 4KRCA 4TYJA 4QNAA 4JQEA 4KINA 3PA3A 4XG7A 2GQSA 5EI2A 5HG7A 2J6MA 4DF3A 4ZMFA 2V62A 3PLAE 2C6IA 3W0QA 3D5WA 2WQEA 4EOJA 4KIKA 2ZM3A 1O6LA 4NWMA 3VHEA 4PF4A 3DV3A 2CKPA 4AQKA 4U80A 4WIHA 4OT6A 4ZTHA 3UVPA 5HOAA 4ALWA 3TDVA 5EKNA 3RK7A 3R7UA 3FZPA 3VUDA 4ZAUA 2X8EA 5J9YA 3RVGA 2XH5A 3ZZEA 4EQUA 4QTBA 3TT0A 2C5XA 2Z7RA 3A62A 4IAAA 4WUNA 5EYMA 4O7VA 2Z60A 4XHKB 5JT2A 2CLQA 4DEDA 4X2NA 2VTHA 4PTCA 3DAEA 3POZA 1ZYDA 3ROYA 2XNGA 3KXNA 2XIKA 5D11A 2DUVA 3A4PA 1TQMA 3GC9A 4UWCA 4I5CA 4L52A 4MXAA 4UWYA 4UV0A 4EL9A 2F4JA 3H4JA 4YTFA 4O7LA 2BILB 4ERKA 3BELA 3HKOA 5AP2A 5KMMA 4I21A 4FTCA 1ZYSA 2DWBA 3LFBA 4ZSLA 3D7TB 4QMVA 4I4FA 4RIWA 4Y46A 1ZY4A 5K3YA 3RAWA 1Q24A 3NUAA 1OL5A 2XK6A 2JDTA 3QYWA 2HCKA 3IOPA 4IVCA 3CSVA 5JK3A 3F2RA 2XK3A 3ZSGA 1OIQA 4OUCA 5AUWA 4ZTSA 4BYIA 4CYIA 3G33A 5C27A 2YABA 5KUPA 2XK9A 2V0DA 3R63A 4IVAA 4S33A 5IQAA 2R3KA 3W2PA 3EFKA 4F64A 5CEMA 5JN2A 5L8KA 1J7UA 3A8WA 2ITPA 2VRXA 4JDKA 2XK7A 3D14A 4F6SA 4R7IA 4IB3A 4FV6A 4O4EA 5HD7A 4E4NA 5JGAA 4BYJA 1PRYA 3UDSA 4X2KA 1H1RA 4Z9LA 4QTEA 4U45A 4FT0A 3BHUA 3ZU7A 5JFVA 1QPEA 2R3OA 1U4DA 3WZEA 3ITZA 4XP2A 4E6CA 1Q8WA 2IZSA 3COHA 2VTQA 4MCVA 4R1VA 4QMZA 2XAMA 5HG9A 4AZFA 4QYFA 4KNBA 4BDKA 3IO7A 1VZOA 2J4ZA 2OXYA 2IW6A 4AOJA 5LJJA 5HTIA 3SLSA 2XARA 3E87A 2ITQA 2V7AA 4X3FB 4DLIA 4AGCA 3ZEPA 4IEBA 3GU8A 3H0YA 4CLJA 2BTSA 3CP9A 3W33A 4ZY4A 5IMXA 2VWWA 3EN7A 2XVDA 1YDSE 2B1PA 3JY9A 4M13A 4X2GA 5AR7A 4EH9A 2R9SA 1H1SA 4NTSA 4UMUA 1WVWA 4LOPA 4QYHA 4F0IA 3PUPA 2PZIA 2IZRA 4C61A 5C4LA 5DR6A 4QQTA 3DAKA 2OSCA 3IDPA 3VS1A 1QMZA 4EUUA 3OCGA 1A48A 3UYSA 4ASDA 4ZS4A 3LZBA 4QYEA 1IAJA 3LFSA 4RFZA 1OL6A 2ZYBA 1FVVA 2VGOA 4DH5A 2PULA 3ANQA 2XNNA 4QMNA 3MB6A 1FPUA 5KMNA 1UA2A 3LFEA 2KULA 4NIFA 2QR7A 1WBWA 3ACKA 3FMDA 4X2FA 3R9HA 2SRCA 1XBBA 4LRMA 4OBQA 3HX4A 4U3ZA 2X9EA 2XB7A 4R5YA 4XJ0A 1H25A 3O17A 5BNJA 4FEXA 5G1XA 5AX3A 1FVTA 4BKJA 5I3RA 2WTJA 3MVJA 3QCXA 4IWPA 4I6LA 4E93A 4L44A 4QMUA 1YWVA 3AXWA 4BCIA 5JQ5A 4DHJA 3VW6A 1JPAA 1M14A 5HESA 4ZP5A 4KRDA 5AA8A 3TUCA 2A98A 5EG3A 3MN3A 4IAZA 2OU7A 3EHAA 1BMKA 2P4IA 2XJ0A 5JFXA 3HUBA 4FSMA 1WBSA 4IZAA 4D2VA 2UZTA 1H01A 2FSTX 4CFNA 1R1WA 1H0WA 3F82A 1UWHA 4B8LA 3QX2A 3W0RA 4FV5A 5T6KA 4O6EA 2ITUA 4DTBA 3PRFA 2ERZE 2QOFA 4HJOA 4HGLA 4LOOA 2C3IB 4APPA 1XH5A 3KKVA 4QTDA 4RSSA 4F9CA 4V04A 2GNHA 2ZMCA 3OD6X 3Q9ZA 4IVDA 4LFIA 3GC8A 4IADA 4CD0A 3NDMA 2ZV7A 1YHWA 5ETAA 4P2KA 2CKEA 2IVUA 4QPSA 3WARA 4KBCA 1XJDA 5HBEA 4F7SA 3CS9A 5J7HA 1VYWA 3R04A 4K1BA 4TKSA 2VTNA 5EW8A 5AX9A 5BVNA 2R3GA 5GIPE 4HVDA 4Y95A 4BIEA 4I5MA 4FSNA 2GSFA 4GIIA 1OL1A 3A99A 5HG5A 3QF9A 2R3NA 2A4LA 2PZYA 4U42A 3TJCA 4O21A 3QD3A 2PMIA 4HVSA 3I5ZA 4GFOA 4MBIA 4XG8A 5E8ZA 3BWJA 3MVLA 4FYNA 3QFVA 4MF0A 5E90A 1M2PA 5HICA 4D4VA 5EM7A 4JG8A 3I6WA 1ZMWA 4L8MA 3FZOA 2BZIB 4PMSA 2EXMA 2YISA 4PPAA 3HP5A 5LARA 3IW5A 3V3VA 3FYJX 4TWCA 3II5A 1ZOGA 3EN4A 5ACBC 3TNWA 5IQHA 2H9VA 4RVTA 3CGOA 2WQMA 4H3PA 2A27A 3QTXA 3TYKA 3E8CA 3JVRA 4UYAA 3TTJA 4OTGA 4WHZA 5KKRC 3DFCB 4USDA 5EW3A 3UPXA 2PVFA 2XEZA 4JJRA 5L8LA 4RWJA 4ITHA 4CG9A 3AQVA 1EH4A 4D0WA 4U41A 3TCPA 5C8NA 1WVXA 1G8AA 4O2PA 3BHTA 1XH4A 3GCPA 4O7RA 3VS6A 3U6IA 2IG7A 4UB7A 2W1EA 4E4MA 3QZIA 3QQLA 5A14A 2BKZA 5CSWA 4X3FC 4EK6A 5DWRA 3SC1A 4BVUA 2W1HA 1PMEA 2OGVA 5HO8A 3H30A 3UO4A 2JKKA 2YLFA 2CKQA 2PVYA 1H8FA 3CQEA 2B55A 3UP7A 2WTWA 5EYDA 3NLBA 3Q53A 2QOIA 1KOBA 4RX7A 1W7HA 2QD9A 4TZRA 4W4XA 4F1TA 4RGJA 4L45A 1OBGA 3S00A 2J0JA 2WHBA 4O0XA 3E92A 4HYHA 4ACCA 3UIMA 2R3RA 4FUYA 2UVZA 3BBTB 2HIWA 3QU0A 3ATTA 4QNYA 4UZDA 4AN9A 3IW7A 2CGVA 3L9NA 4GKHA 1FQ1B 3D2IA 4C7TA 3A7FA 1WCCA 4MK0A 3LHJA 4QMWA 3UIXA 3VAPA 4F4PA 4GEOA 3R7OA 3S95A 2FVDA 3TKUA 3ZLSA 4A07A 2QLUA 4A4OA 5T68A 2W5AA 5CASA 3R9OA 5GZ9A 3AT2A 4BGHA 2C3JA 5H8BA 3IDBA 4FT3A 3QKKA 3AKKA 4RIYB 5EQEA 3FJQE 3HNGA 3LCKA 4ONAA 3HMPA 4BZDA 4C2VA 5F95A 3EFJA 4UXQA 3TMOA 3H9FA 4GL9A 5AM7A 4RC2A 3NNWA 4MNFA 3MVHA 3W0NA