4ASDA

Crystal structure of vegfr2 (juxtamembrane and kinase domains) in complex with sorafenib (bay 43-9006)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
312
structure length
305
Chain Sequence
DPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
publication title Molecular Conformations, Interactions, and Properties Associated with Drug Efficiency and Clinical Performance Among Vegfr Tk Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 305
sequence length 312
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4asdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4asdA01
2YFXA 4G1WA 4QD6A 2OJJA 4YJQA 3HV7A 4AN2A 1SZMA 3BIZA 4O6LA 3TKHA 4O81A 3H4JA 2RFSA 3ZXTA 4E5WA 3OP5A 3TXOA 3ITZA 4JG7A 4BCMA 2ZM4A 1CKIA 4CGAA 1OB3A 3C4XA 2UZLA 5J9ZA 4G3CA 5L3AA 4XBUA 5AP6A 4EONA 2JLDA 2UZEA 4FG9A 5IQAA 4I0RA 3RTPA 5HCXA 5AM6A 3NAXA 3TN8A 3ZYAA 4FIIA 3O51A 3Q9ZA 2VO6A 3AT3A 3F3UA 3OY1A 4M69A 4MXYA 2GQSA 5IQFA 4H3PA 4ZZMA 1M14A 2R2PA 2Y9QA 2VWZA 5DLSA 4DH8A 5CTPA 4EQUA 1FBNA 3S4QA 5J95A 2P55A 2H8HA 3TZ9A 3TUCA 3DKGA 2WTJA 3VHEA 4L00A 3A61A 2R3IA 4RQKA 2IW6A 2RFDA 4ALVA 4C57A 4FK3A 5AV4A 3RAKA 4FMQA 2YIYA 2FB8A 5EG3A 4ZTLA 3V51A 2WMAA 4ANOA 3DA6A 5B2LA 3FUPA 4DEIA 5EHLA 3AD6A 4DEAA 1KE5A 2ZJWA 4JOAA 4RIWA 4E6CA 3LQ3A 1M7QA 4ZMFA 2GSFA 3C7QA 2FGIA 3D7TB 3RI1A 3F5GA 3E3PA 4BIDA 3SX9A 5KKRB 4OBOA 1OUKA 4FIGA 4FV2A 1ZZ2A 4EH5A 3DGKA 4IM3A 2GNFA 4BKJA 4CSVA 5C1QB 1Z5MA 4UZHA 4B8LA 2PVLA 3BKBA 2XKEA 3Q5IA 3HZTA 4EK8A 3SG9A 2A2AA 2R3HA 4PMMA 3UVRA 2R64A 4PV0A 3V5LA 3PA3A 2AYPA 3O8TA 3W18A 1FPUA 2G2HA 1RE8A 4WOVA 3UO4A 1MP8A 4AW1A 4R3PA 2X2KA 1L8TA 4F6SA 1ZRZA 3CJFA 2NPQA 3PTGA 1ZLTA 4YTFA 4G16A 1IRKA 4JG6A 4ONAA 4E93A 5D7VA 4B99A 4PNIA 4QT1A 4FEWA 3OXIA 3FQHA 5BYYA 1NT2A 3UMWA 2QO9A 3NRMA 4L68A 3DK6A 4RQVA 3DKCA 5DHJA 3SAYA 3II5A 3LLAA 1YOJA 4HPUE 4TWNA 5CU6A 2P33A 2Q83A 3OBJA 2R3MA 4D0WA 1OUYA 3GXLA 2X7FA 3FV8A 4RZVA 5AX3A 2XJ2A 3RCJA 4AP7A 1E9HA 4CZUA 4BDIA 3DK3A 3NX8A 3MESA 4IXPA 3FZTA 3UTOA 5HD7A 4MYGA 4GK3A 3EQDA 4P2KA 2QOQA 4OT5A 1PXPA 2J0MB 2XB7A 3FSFA 5ETAA 1M2RA 1TQIA 2YWPA 3G6HA 3DFAA 4DINA 2XIYA 4DEDA 4EZ3A 5EM8A 1FGKA 1PJKA 2AC5A 5LCJA 2YCQA 2PMLX 4DFZE 4W8EA 3ROYA 3NUSA 4Q9ZA 3D7ZA 2HZNA 3LFSA 3D9VA 3V8SA 4EHVA 2XM8A 3PPJA 5DPVA 4D4RA 3MTLA 4RX5A 3CLYA 3GOPA 1FVTA 5EW8A 1DAYA 4Q2AA 4G5JA 5CAPA 3QCQA 3DLSA 5JRQA 3FLNC 4EKKA 3ZBXA 2JKMA 4GIHA 2UW7A 3QC9A 2CLQA 2B9HA 4EZ7A 4FTCA 4FTLA 4WBBB 3DKOA 3R7YA 2Z8CA 5AEPA 2CN5A 4AE6A 1XH9A 3BHTA 3QTQA 5CEQA 3ZLYA 1QCFA 3GOKA 3PA5A 4ZMEA 3QQHA 2VAGA 2X8EA 4QMWA 2W0JA 4UXLA 3KVXA 4I6QA 3AT2A 3QD0A 3CKXA 2OGVA 4TYHA 4QRCA 1O9UA 4ZTNA 4EC8A 3ZCLA 4EOQA 3LJ1A 3MGYA 3VIDA 2YCFA 1JKTA 3LFDA 3LFNA 4O0WA 4BZOA 3EFKA 3KMUA 4EJNA 4RVMA 4EUUA 4RT7A 3SA0A 1Y8YA 3RMFA 3A4PA 3UIMA 4ZK5A 3KY2A 2C3JA 2GNJA 2YM4A 4IB5A 5E8VA 3UMXA 2JKOA 3AC2A 4F65A 1WZYA 2ZVAA 3FYJX 3ET7A 1H1WA 4D2RA 4D1XA 5F20A 4M14A 4QTCA 3KEXA 4JS8A 4F09A 3QYZA 3OHTA 1IG1A 5EOLA 2I6LA 4AOJA 3BWJA 2YCRA 1YXTA 1BKXA 2IZTA 2V7AA 1IEPA 3N4UA 4BCKA 1JVPP 4GT5A 3HNGA 2QQ7A 2XCKA 5HTIA 4FSQA 2PUUA 2GTNA 1A06A 3RVGA 5IEVA 2QR8A 3QLFA 4TRLA 5AUVA 3W16A 3R7GA 3W2PA 5A6OA 4QP7A 2JDTA 1Q3WA 5AM7A 2HZ4A 4MNEA 4USEA 2BZHB 2ESMA 3NUUA 4L45A 3S2PA 3RGFA 4AA5A 5A4LA 3SXRA 4YZCA 3RZBA 1KSWA 3TDWA 1W7HA 1JQHA 2GNHA 3G6GA 4FKUA 5EM5A 3CXWA 2NRUA 5EI6A 2JIIA 4ZXTA 4PDYA 3O96A 2ZB1A 4IE9A 3CBLA 2XNMA 4ACHA 3FLSA 3PY3A 3IGOA 4JR3A 4H1JA 2OK1A 5EYMA 2ITNA 3FHRA 2F4JA 4EOMA 2PU8A 3PJ2A 3UIUA 4DA5A 2DS1A 2GNIA 5IDPA 3NYXA 4G3GA 3UO6A 4D55A 4L3LA 2PYWA 4QTBA 2YJRA 5HLWA 3I5ZA 4NM7A 4RJ4A 2FUMA 4YHJA 3UOKA 2W96B 4ZJJA 5CU0A 4PDPA 1CKPA 3TACA 2RL5A 5AP3A 2WOTA 5M4UA 4R5SA 5K3YA 3QA0A 4D5KA 5HE1A 1NVSA 4J98A 4N0SA 5M53A 4DTAA 3MB7A 2SRCA 3CPCA 3HMMA 3KL8A 4FTJA 3OS3A 3Q9XA 4ITHA 3QQGA 4A9YA 4D4VA 2NO3A 4OTQA 2HZIA 4DBXA 5EK7A 4TWOA 1SVHA 2CGWA 4E4NA 1WMKA 2WFYA 2R5TA 3IS5A 4FKVA 4JT3A 4BWPA 5BVFA 2VWWA 5LXMA 4E73A 2C5NA 3A4OX 1REJA 4C2VA 4MK0A 2R7BA 5EI2A 2UZUE 2R9SA 3MN3A 4DFBA 4RWIA 4TZRA 2J0LA 3P9JA 1FOTA 4BTKA 1ZY5A 4ZLZA 4LMNA 4AUAA 1XBAA 3RINA 3FLWA 5L6PA 5AP5A 4UXQA 4O1PA 4JQ7A 4A4XA 3IW7A 1U4DA 5CNNA 3TI1A 1FMOE 1LR4A 5DE2A 3DAEA 4HZSA 2BUJA 4II5A 4U3YA 5D1JA 4ACGA 3FQSA 1CMKE 4FG7A 4UX9A 4IM2A 5KHXA 4LUDA 5CY3A 3TCPA 3PVUA 1H00A 3ZOSA 3R02A 2R3OA 5M4FA 4S33A 4YJTA 4OTRA 3CD3A 3MYGA 3PP0A 4YSMA 4CFMA 3R21A 4C8BA 3OROA 4EYJA 4K6ZA 5BQ0A 2VX0A 4MBIA 4EK6A 4C4JA 1LP4A 3EFWA 3MFRA 1NW1A 5HTBA 3IOPA 4KUJA 3TJCA 3QD4A 2QKRA 2PUNA 3LM0A 3PUPA 1OBGA 3VQHA 2QG7A 1OZ1A 4QMQA 5EW9A 2JD5A 2W4JA 4BI1A 4IJPA 3VN9A 3FMEA 3LPBA 1SMHA 2ITZA 5DIAA 5IU2A 3KB7A 2F57A 5EDRA 1MQBA 4QYYA 5FXSA 2J2IB 5I9WA 5AUZA 5BPYA 3KK9A 2QCSA 3D14A 1H1PA 5DG5A 5IA4A 2VTHA 4WNMA 2XJ1A 1IR3A 3TNPC 4CZTA 3UQGA 4DGOA 4UMUA 5CF4A 4UBAA 2XA4A 2ITTA 4XG4A 2G2IA 5LMAA 2ZAZA 2BDJA 4KIQA 3QZFA 3A99A 4EUTA 4A06A 2ONLC 3ZC5A 2QONA 2BZKB 1VYWA 3NSZA 5AJQA 5CWZA 2OH4A 4OAUC 3ATSA 1AQ1A 3R00A 3R8PA 2OBJA 2JBPA 4RZWA 4PWNA 1LEWA 3IW4A 5FEDA 1H25A 5CEMA 2XNNA 4ZTSA 2X7GA 4QNYA 2BKKA 2VTLA 5AMNA 3RPYA 3D4QA 4O7ZA 3QF9A 5ANDA 2VGOA 2WMSA 4D2WA 4HVGA 1SVEA 3AT4A 4KWPA 4TKSA 3P79A 2WQEA 2X7OA 1SNXA 2WMRA 5T68A 4CCUA 4OTHA 1K9AA 3D0EA 3GU8A 3H3CA 4BDFA 3QTUA 2UZDA 4FKJA 4KBCA 4IFGA 4XMOA 3FI2A 3AC3A 3FMKA 4P90A 2WQMA 4AZEA 1BI7A 2VTMA 1OMWA 5IQGA 3MH0A 4AGCA 4GL9A 4O7LA 1J7UA 4QYEA 3O17A 2BDWA 3AOXA 2XF0A 2IZSA 2W5AA 3DQWA 4HOKA 4USDA 4E6QA 2QHMA 3VC4A 1PF8A 5FWKK 5AFVA 4BI2A 5I9VA 4HCTA 3HRBA 2GS2A 3JPVA 5I4NA 4FZFB 2VWXA 5E92A 2O2UA 2WIHA 4NCTC 1Y6BA 2C5YA 4DH5A 4FSRA 3VUTA 2GNGA 1Q8UA 2E2BA 3NW6A 3PYYA 3F9NA 2VO7A 4XP2A 3R9HA 3VBYA 3FL4A 1R0EA 1ZYSA 5HICA 5CAQA 1U54A 2PE2A 3AC1A 3LCKA 2R0IA 1W82A 3FEGA 4EH4A 3TV6A 3JVSA 3G51A 3ORTA 4G6NA 3C1XA 5JGBA 4IACA 3AXWA 1BX6A 1ZAOA 2JEDA 2YN8A 5E8UA 2IVSA 4CFNA 4CMTA 5GZAA 3H9FA 3PIZA 3ZO1A 1R0PA 4HGSA 2E9NA 4FTUA 1RW8A 2V0DA 4FNZA 3TJDA 5TKDA 3RK5A 1H26A 2ACXA 1OL5A 4QP8A 5IMEA 5KCVA 3ZFXA 4ASZA 2ITYA 2OJFE 4FG8A 3NDMA 5AR8A 1P2AA 4TYJA 5JRSA 4BYIA 1VEBA 3Q4UA 3U87A 1YRPA 3P4KA 3OCTA 3PXQA 2EXEA 4N6YA 1S9IA 5HVYA 5CAUA 3I4BA 3GU5A 3OWJA 5DR9A 3R83A 3BGQA 3DZQA 3GB2A 3LCTA 4FV4A 4JVGA 5HG8A 4UB7A 2EVAA 4WNKA 3BELA 3WIGA 4JDIA 4RC3A 2QNJA 2WTVA 2OU7A 4WSQA 3U4WA 3LXNA 5M4CA 3ZU7A 1YW2A 1WBVA 1BMKA 3Q32A 5J9YA 1OL6A 3E8CA 3BHHA 3O7LD 1B6CB 1F0QA 3HYHA 4MQ2A 2F7XE 2YEXA 4U40A 2HY0A 4UWYA 4QMOA 5CSHA 3WYXA 3A7FA 3EWHA 5DOSA 5EQYA 3F61A 4QMVA 5HNIX 3MFUA 2YHVA 4XH6A 1U5QA 4R1YA 2C6EA 4OAVB 1GAGA 2QVSE 4JL9A 2ERKA 1OL2A 4K0YA 5CVFA 3RPSA 3W2RA 4DC2A 4DTKA 4FE2A 4JNWA 5JZNA 5JFXA 3DKFA 3EQIA 3P08A 4YBJA 5CVGA 4FKWA 4D4YA 5H9BA 2DYLA 2H6DA 4FTKA 5J7HA 5GJFA 3QTZA 2CDZA 2RSVA 3ETAA 2IW8A 4O7VA 3OXZA 2VTNA 1JSUA 3GCVA 3HUBA 1JAMA 2WB8A 5HE3A 3OFMA 4WIHA 3DTCA 3A7IA 4UY9A 2WMTA 4AZFA 4C61A 3MDYA 4EK5A 3SC1A 4BBEA 5E90A 4OBQA 2QLUA 1YHVA 2UVYA 2WMXA 4O6EA 2XK9A 5AUXA 3C0HA 3S00A 4GSBA 4LUEA 3W55A 5FRIA 4C58A 2VN9A 4NIFB 5EQPA 4M3QA 5AP0A 4E5AX 3JS2A 3HMPA 2BVAA 3UYSA 3UNJA 2IVUA 1MUOA 4IAAA 4R6VA 3UZPA 5HD4A 4IVBA 5T6KA 3R7VA 1Q97A 3LJ2A 3QX2A 4XRJA 4PL3A 3ZDIA 1PXKA 1UNLA 1P14A 3BLRA 3E92A 2ITWA 3EQPA 3OD6X 4KD1A 3G5DA 5D10A 1ZWSA 5JT2A 3RALA 4CLIA 4ASDA 5BYZA 4DEEA 4JIKA 1STCE 1H8FA 2XM9A 4KKGA 3MW1A 4YJSA 3PRFA 3UG1A 4BWKA 4BCNA 4DYMA 4F9WA 3D5XA 3MFSA 4D2SA 3ZO4A 3C5IA 3VRZA 5D12A 5KMIA 3IW5A 3SKCA 2BDFA 1IA8A 3BYVA 3E88A 2R0UA 3F7WA 3H9OA 4D2VA 2WTDA 4EOLA 5A14A 4YO4A 2Q0NA 2ETMA 2PZIA 1W83A 3PY0A 4GW8A 2QOBA 4AA0A 1JLUE 3ROCA 4D9TA 3E8DA 4XCUA 5M44A 5ANKA 4IAZA 4TWPA 3NUAA 2X39A 2Y6MA 4BICA 2HXLA 2B0QA 4I23A 4X3FC 5TE0A 4YURA 5FG8A 3GC8A 3N4VA 2IZRA 2OIBA 1PHKA 3L8XA 4QOXA 3ATTA 3DQXA 4FIFA 1YDTE 4V0GA 4GUEA 2HXQA 3FJQE 4ZZNA 3T3VA 3L8SA 4I5HA 4S31A 3HA8A 4NWMA 4C4FA 2PE0A 3LIJA 1PXLA 4BDGA 1A9UA 4I22A 5IPJA 5A3XA 3KRJA 3TUDA 3KK8A 4EK4A 1CKJA 2X9FA 3O8UA 3FMJA 4EH8A 2YABA 5C8NA 3G9NA 3KKVA 2WMUA 5GIOE 3IDCA 2BROA 4O0TA 4AE9A 4J53A 5I9XA 3N9XA 3FMNA 4RC2A 5BVKA 2Q0BA 4MX9A 4IWQA 4FZ6A 1CTPE 2JITA 3OBGA 5FTOA 4F0FA 3SW4A 4LYNA 4ZY5A 1GZKA 3DDPA 3C4ZA 3D5WA 5L8LA 2YZAA 2UW3A 2VZ6A 4YJPA 4G6LA 3GCQA 3VNTA 3DJ7A 4EWQA 4I6BA 1O6LA 3BQCA 3VUGA 4KIKB 4G9CA 3EQFA 4HYIA 2E9OA 2C6OA 4DEBA 5F1ZA 5C26A 3SW7A 5AV0A 3R7EA 3A7HA 1FVVA 1FINA 2PVNA 2XK3A 2XKDA 5F4NA 4RVLA 1Q8TA 3VS0A 3RPOA 4RIYA 4FNYA 5IZFA 1PXOA 3EYGA 4DH1A 5B0XA 4G9RA 3FQEA 3WF8A 1BLXA 3PPKA 3I7BA 2DUVA 2OZAB 3OY3A 4ZSLA 3OCBA 5K4JA 1OL7A 3FY2A 2FVDA 3QKKA 4JAIA 4AQCA 3FZOA 4W8DA 2PVKA 4AOTA 1OPKA 1XHAA 4G6OA 4BYJA 4RA5A 4ZJVA 1YHSA 4AFJA 3PWDA 4IHPA 3CGFA 3VS3A 3LLTA 4MAOA 3CY2A 4GFOA 3WZKA 4CMOA 3BHUA 3ZRKA 2ZYBA 4ZIMA 2W06A 4FODA 4JG8A 3QTRA 4X2NA 2W7XA 4PTCA 1I09A 3NR9A 2UZWE 3UJGA 2BAJA 2B9JA 3SV0A 3TT0A 3ZLSA 4UZDA 2F7EE 4C3PA 1UVRA 1YXSA 3HRFA 3U9NA 4A9SA 4UN0C 3TKIA 4AU8A 5CVHA 4ACCA 2XBJA 3F5XA 3L9LA 4KKEA 3GCPA 4R78A 2OXXA 1OKYA 5CI6A 4FKIA 4O0XA 3KF4A 4I5CA 4RFMA 4BTJA 4IANA 4N70A 4BHZA 4BZNA 5BVNA 4FOCA 3HV3A 4B9DA 3BBTB 3DU8A 4J1RA 2G1TA 1YWVA 1WBNA 4YJNA 5DNRA 3LMGA 4DFUA 5A4CA 4I20A 5DGZA 5IEYA 1PMVA 4ANNA 5M4IA 2PMIA 2GDOA 2J9MA 2REIA 4PPBA 4ANQA 2W99B 2JDVA 4FSTA 5ANEA 3QXOA 2WIPA 5KKRC 3EQRA 3VW8A 2Y8OA 3R8VA 3C4EA 4WRSA 2I7QA 5K5XA 1V0BA 2I0VA 3VO3A 4XRLA 3QD2B 1U54B 4E5BA 2CCHA 1YHWA 3QFVA 4RGJA 4F1OA 1W84A 2W05A 4PL5A 3NCGA 4WO5A 5ANGA 4BKYA 4FC0A 3W8LA 2QKWB 2QOHA 4BB4A 1PYEA 4L01A 4W9XA 3QCYA 1OM1A 2OJIA 2OF4A 5ETCA 4CD0A 1KUTA 1XH7A 3VBWA 4FNXA 4A4OA 2PULA 4G3FA 3RAHA 2VNYA 1NXKA 4H05A 4M0YA 4GJ2A 5H2UA 2OG8A 1WBTA 2R3QA 4I1ZA 4K18A 5KUPA 2CKPA 3R71A 4FSUA 3VBQA 3SOCA 4LMUA 3L9MA 3F3WA 4G3DA 4IQ6A 4X2FA 2OZOA 4I6FA 3C51A 4QQ5A 4FSZA 3POZA 3GUBA 3PXRA 5DT3A 5AR2A 3R9DA 3W33A 4O0VA 2EB3A 4F1TA 1PXNA 4U3ZA 3CQWA 5TR6A 3KQ7A 3UVPA 5HESA 2XNGA 3C0IA 3DZOA 1WBOA 2J6MA 2HZ0A 1CM8A 4ZJIA 1Z9XA 4NM0A 1WAKA 3C0GA 3EQBA 5E7RA 1OL1A 2YM7A 4EH2A 2WZJA 4YPSA 3VAPA 3UPXA 4U43A 4Z16A 3EN4A 3SG8A 4DF3A 4NEUA 3T9TA 4R3RA 3GQIA 4I0TA 5HLPA 5GZ8A 5GHVA 1ZY4A 5DRBA 4NSTA 1T45A 4HJOA 1PMNA 2Z7LA 4ERWA 4XG7A 4A9TA 4JI9A 4DLJA 2B9FA 4C4GA 3CS9A 4HPTE 3C5UA 4R7IA 3VULA 3R2BA 3WIKA 1ND4A 4UWBA 5BVOA 2QURA 2C6KA 2OXYA 1H01A 4X2JA 4J8NA 3T3UA 5L2SA 2BFXA 3HEGA 5AIRA 3ZC6A 1PXJA 3BYUA 3P7CA 3NZ0A 5JH6A 4J97A 5JQ5A 3D94A 3HLLA 3K2LA 3KRLA 4BDDA 4GK4A 3DPKA 4IC7A 3U51A 5ACKA 2OJGA 2WXVA 3DK7A 3FKLA 4QMTA 4J7BA 3LFFA 4AZWA 3DLZA 3G90X 3PSDA 3LKMA 4AAAA 4FSWA 4L3PA 2FYSA 1UWHA 3ZFMA 5LJJA 3L9NA 3KXHA 3KA0A 1BL7A 2CGXA 2QOOA 3HRCA 4IX5A 3S95A 2YM8A 3U4UA 2GPHA 2YDIA 1BYGA 5CQWA 3TNWA 4DCAA 1I44A 5IA0A 1GZ8A 3OG7A 2QOIA 4NT4A 4D2TA 4EEVA 5BMMA 5KNJA 3TTJA 3BU6A 2PY3A 4U0IA 1OKZA 3KRRA 4B8MA 3PVGA 3LQ8A 2NRYA 4NK9A 4FL1A 4FR4A 4F4PA 3E7VA 5EYCA 2EU9A 5I9YA 1OIYA 4WBOA 4AOIA 4FVRA 4FVQA 3OVVA 4I3ZA 1TQMA 3UNZA 4YLJA 4GU6A 2ERZE 4UWCA 3Q2JA 4FV9A 3ACKA 4M13A 5FGKA 2JKKA 4FKQA 3ENHA 3ODZX 3DBCA 5K5NA 2GU8A 3QYWA 4QMPA 1REKA 3FC2A 3LHJA 4MWHA 4XOYA 5EH0A 5FBOA 3UOLA 3HAMA 3RPVA 3D83A 3EKKA 2YJSA 2VWBA 4JQEA 4NKAA 3WZDA 3GQLA 2RKUA 3MBLA 5AX9A 2F49A 2VGPA 5CYIA 5FXQA 3BLHA 5CU4A 4O7YA 2JDRA 2LAVA 3ZHPC 5BVWA 4A4LA 2C68A 3W32A 4EJ7A 2LGCA 4FX3A 2VTSA 4EQCA 3HV4A 5LQFA 4TYGA 5CSVA 3FZPA 2OIDA 4FKOA 5AWMA 2ONLA 4FEVA 3R8ZA 4RMZA 2OF2A 4I4FA 2PZRA 4JBVA 3FL5A 4V0GB 3THBA 2IN6A 4TTHB 3AMYA 1YI4A 1Q8ZA 4MD7E 2GCDA 3PXFA 1YKRA 5HU3A 5KMMA 4GG5A 4IX3A 3QUEA 2KULA 5DBXA 4YC3A 4GKIA 3LFQA 4CV8A 4EOKA 3DXQA 5HHWA 5LWMA 4QMMA 5E91A 5T3QA 2JGZA 3QA8A 3DNDA 3F7ZA 2OO8X 5JGDA 4OTPA 3QHWA 4JLCA 2PUIA 3FHIA 2BMCA 5AP2A 5FDPA 3EIDA 4E8AA 4FVPA 3BGPA 3GC0A 3QKLA 5AAEA 5B2MA 2XYNA 4U5JA 4XUFA 4YJOA 5IMXA 2WQBA 2XK8A 4FT0A 2W1IA 1URCA 2O64A 2Y0AA 4C35A 1K2PA 4M7IA 4PRJA 3DOGA 4HYHA 4FV7A 3ORKA 3NPCA 2W1EA 4KNBA 3ZONA 3MFTA 3EQGA 2WGJA 3MVHA 4I0SA 2QC6A 3EH9A 4G3EA 3KXXA 2XK6A 1S9JA 4BCIA 3UODA 1OGUA 1PMEA 2QR7A 2CSNA 3MH2A 4YP8A 5KO1A 3H30A 4FTAA 4D2PA 4NCTA 1FMKA 1ZYCA 3DDQA 1SM2A 2W9FB 1ZMWA 3VBVA 3ULIA 4BN1A 4KIOA 4D28A 4U42A 4KSPA 4DAWA 2WEVA 3EZRA 4PMSA 2F7ZE 4A7CA 4ASEA 4KIPA 3LMHA 2PK9A 3BU5A 3HVCA 3QKMA 3NYOA 2GHGA 4RSSA 4XG9A 3QQJA 4YNOA 3SD0A 4AT4A 4PDOA 2XJ0A 3IDPA 4Q9SA 5HE0A 2PVJA 4NM3A 4C4HA 5BUEA 5K9IA 2GQRA 3ORXA 3QZGA 4GVAA 4YU2A 1J1CA 4J52A 4TYEA 4QYFA 2PUPA 3BLQA 2YIXA 2BAKA 5AV1A 1PXIA 5CALA 4EORA 3OWLA 2BKZA 1JKSA 2V62A 2O8YA 1UNGA 3R1QA 4C34A 3NIEA 2OI4X 4Y73A 3WZEA 2CMWA 1WBSA 1JBPE 4YNEA 3OT3A 2XMYA 2PZYA 5J1WA 3PE1A 3KCFA 4NW5A 5M07A 2V5QA 4IB0A 3P7BA 4PDSA 3JVRA 2XS0A 3R28A 4QP6A 2X2LA 5LCKA 2QOKA 3ZM9A 2HY81 5DN3A 4BR3A 3JXWA 2X8DA 3PDTA 4IX6A 4RX9A 3CTQA 2WD1A 4JAJA 2J5FA 1NVRA 4QQCA 3HGKA 1KOAA 2DWBA 3AC5A 3CJGA 4FGBA 5IA1A 3BX5A 3R01A 1GOLA 1PKGA 3NW5A 4ZSEA 4FL2A 4I24A 3W2OA 4PTGA 4L9IA 3OF0A 4FF8A 2IVVA 3PSCA 4C0TA 4XS2A 1W98A 5DRDA 4KB8A 5IQBA 3VW6A 2X4FA 4Y5QA 4YHTA 5JK3A 5JN2A 3BYSA 1MRUA 2XNOA 2X6EA 3ORMA 4KRDA 5AUYA 4L44A 3ZLXA 3SVVA 3EN5A 3R7IA 3O71A 5AAGA 4Q5EA 3E8NA 5CX9A 4FUXA 4LI5A 3KREA 4DT9A 1Z57A 4GK2A 3F5PA 4C3RA 3SRVA 2XNBA 4M84A 4DE4A 4M69B 4G2FA 4EOIA 1CSNA 3LXKA 3QRIA 5DEYA 4AT5A 5A4EA 3DAKA 5F9EA 3DY7A 4HCUA 4TPTA 4Y83A 3TV7A 3UOJA 3ZO3A 4DG2E 4JIAA 4IZAA 2JDOA 3CC6A 4DEHA 4J99A 1JKLA 4GIIA 2I1MA 2G2FA 4QMXA 5C8MA 3A2CA 4CQEA 3QRTA 1LPUA 1PXMA 4BY9E 4FT5A 1Q8YA 2AUHA 4RFZA 3ORIA 3HKOA 4HVSA 4WA9A 3EQCA 5L6OA 3ERKA 4YJUA 4O7RA 5CAOA 3PXZA 2HAKA 5CZHA 4E20A 4TNDA 4RIWB 4YLKA 5M51A 3FI4A 3L9PA 2R3PA 4NKSA 5EM7A 3A8WA 4ORKA 4DTBA 2JKQA 4P5QA 4IZ5A 3AMAA 4PPCA 2O0UA 1RQQA 4FT7A 3P23A 3TZMA 2UW5A 3W2SA 1QMZA 3ACJA 5KMLA 1LEZA 3VQUA 2OFVA 4AF3A 4ZSJA 1ATPE 3QTIA 3HMIA 3CKWA 3EB0A 4P5ZA 3VRYA 2OW3A 5DT0A 4JBQA 1T46A 1XBCA 1PYXA 1QPCA 5AAFA 3C9WA 4BWXA 1E1XA 3LAUA 3PSBA 5B2KA 5HLNA 3Q52A 3KXZA 1NVQA 4BKZA 4O7TA 3ZS5A 3O7LB 5EDPA 4Y8DA 3I7CA 2WAJA 5FP5A 3ZUTA 3NMUF 1W0XC 1TKIA 2UVZA 2WTKB 5EHOA 4W4WA 4X3FA 3VUHA 4DFNA 4HW7A 5JKGA 5C03A 1H07A 4WSYA 1Q5KA 3OW3A 3FXZA 3QBNA 1O6KA 1YXXA 2EUFB 3QCSA 3R9OA 3TV4A 3R8UA 3AGLA 3NYNA 3UVQA 5AADA 2UW6A 2VX3A 4LM5A 4RG0A 2F2CB 4O1OA 2OJ9A 4MQ1A 4QMNA 4DGMA 4ZOGA 3LM5A 3NNUA 1JPAA 3ORZA 4C59A 2J5EA 4ZTMA 2BCJA 4JRNA 4OTFA 4AACA 1Q4LA 2WTCA 5DYJA 1U5RA 3PP1A 4TY1A 3Q04A 4IDTA 3EKNA 3ORPA 1H28A 1W8CA 3RZFA 2F9GA 4J96A 2R7IA 2CHLA 3MI9A 3GC9A 2XEZA 5M08A 2BILB 3QCXA 5IISA 1WVWA 1WBPA 4ITJA 5E8SA 2CPKE 5I3RA 3UPZA 4FEXA 5DT4A 2XIKA 3ZSHA 2W4KA 4ANLA 5HX8A 3RAWA 2YLFA 4IW0A 3FI8A 3NGAA 2XKFA 2W1GA 2C3IB 4D1ZA 3UDBA 3R1YA 3FXWA 3IONA 2B1PA 3GI3A 4L8MA 3DBFA 4GYIA 2J90A 2HIWA 5LOHA 3UE4A 4FKSA 2B55A 2R3NA 4WUAA 3PJ8A 4FSNA 4AN9A 4CFXA 3A7GA 3MV5A 3TEIA 4IAKA 2BRNA 5JMSA 2ZMCA 4I21A 5CSXA 4R8QA 5DWRA 2QI8A 4IAIA 3IW6A 3F3TA 4KSQA 4TNBA 5DH3A 4UYAA 5I3OA 4BTFA 2YM3A 2JFLA 3V5TA 5CU2A 2UW0A 4BHNA 2V55A 4YZ9A 4U7ZA 5LVPA 2I0HA 3P5KA 1KWPA 2O63A 2WELA 3VJNA 2O3PA 4U44A 4KKHA 4AXAA 3HAVA 4EBVA 3UNKA 2XK7A 4MKCA 5AV2A 4C7TA 4E6AA 2GS7A 2Y6OA 3BYOA 2XEYA 3V3VA 4CLJA 4JBOA 2HCKA 2CJMA 3UG2A 4TYHB 5DR6A 1ZXEA 4C38A 5KZ0A 4YO6A 2Z7SA 4O21A 3OCGA 3LVPA 5CT0A 4FV0A 3GFEA 2JIUA 2X9EA 5CNOA 3EHAA 3HX4A 5FEQA 3MJ2A 2Z7RA 3L1SA 4F08A 4QP4A 5M06A 1KE9A 4X6QC 4F99A 1Q62A 2ZV9A 5EKOA 4DFLA 5KX8A 4HCVA 2C1AA 5J7BA 3SXSA 4GFMA 4ZTHA 3DBDA 5BMSA 3UZTA 5KBQA 4ZLOA 3K3JA 4H1MA 3O2MA 4O38A 3I0OA 5AP1A 3W2QA 3DS6A 1G8SA 2UZVA 4Y5HA 3V6RA 4BDKA 3D7TA 4JDKA 4WG3A 4MEDA 4O0RA 4F7JA 1OI9A 5E1SA 5BX0A 3Q96A 3D5VA 4QYGA 5KMNA 5HO8A 1H08A 1WVYA 3V5JA 2EXMA 4L6QA 4MBLA 5FBNC 3WYYA 3PY1A 1UU3A 3LCSA 5B7VA 4R7HA 3GGFA 1H24A 4O27B 5BUJA 2IZUA 1FGIA 2R3LA 4BDEA 4YTHA 3DXPA 2PL0A 4WNOA 4I41A 4EK3A 2BIYA 4HYSA 4MNEB 5BNJA 1H1SA 2YITA 2OFUA 4EH9A 3DJ6A 4FSYA 4ZAUA 2ZM1A 4BCFA 3A62A 1FVRA 3NNWA 3UO5A 1OKVA 4KA3A 3HMOA 2HOGA 4RWJA 1Q8WA 5C9CA 4N57A 5LVOA 4OR5A 1Q24A 2YAAA 3M42A 4ALWA 3UQCA 4HGLA 4CMUA 2B52A 1B39A 2I0EA 2VTOA 3PWYA 4MXCA 3COMA 1XH8A 3FLZA 3MVLA 4JQ8A 3NCZA 3BPRA 4KRCA 2A4LA 5GNKA 4GT4A 4CCBA 2PZPA 1B38A 2HW6A 4LRJA 4XYFA 4QTEA 4GH2A 5TF9A 5IG1A 5ITAA 2ETRA 4RWLA 5IQDA 2PVFA 1IA9A 3AGMA 2JAMA 4O22A 3AD5A 3HDMA 3KN5A 4J71A 4O7NA 2OWBA 4DITA 1ZMVA 1Q61A 5J87A 1SVGA 4WUNA 3HP2A 3EJ1A 3A7JA 2WQNA 2YISA 4USFA 2IPXA 4FT3A 4JRVA 4I5PA 5CS6A 4PMTA 5EOBA 1UV5A 2C6LA 4FNWA 4ERKA 4R3CA 3WE8A 3GCSA 3LE6A 2C30A 4CRLA 3R7UA 3FYKX 1GNGA 2BZJA 4U97A 4V01A 4E3CA 2PTKA 4H58A 3KULA 4IMYA 4Q5HA 1OIUA 4IDVA 3B2WA 4P4CA 2O65A 1OIQA 2PE1A 1AGWA 2XCHA 4OBPA 3U8WA 5EQEA 5L4QA 5HU9A 5L8KA 2RF9A 3MH1A 5CXHA 2GFCA 3P1AA 4IVDA 4PX6A 4F64A 1HCLA 1P4OA 1U46A 4PNKA 4EZ5A 4BIBA 5HIEA 3VHKA 3SRVB 5E9EA 2CNVA 3V5QA 2OICA 2WTWA 4L67A 4S32A 5L2WA 2YAKA 4M8TA 2J4ZA 3DNEA 2PVHA 5HIBA 3RNIA 3QRUA 2GTMA 3ODYX 4DBNA 3NW7A 4YMJA 4Z3VA 3MPAA 1GJOA 1K3AA 4QP1A 4O7SA 4WNPA 5IQCA 1R78A 4O2PA 1WFCA 1V1KA 4WT6A 4OGRA 3REPA 1Y91A 4K77A 3BEGA 3FBVA 1ZYJA 5LMKC 5F95A 5KMJA 3C50A 5AUTA 2W9ZB 4RLKA 3WI6A 4LRKA 5AUWA 5C01A 5KZIA 4OTGA 3LCOA 4QTAA 4UMTA 3PXKA 4YZNA 3PVBA 3W8QA 2VTAA 4QMUA 4G17A 4X0MA 5TT7A 2XP2A 5JZJA 4XG3A 3G33A 4U41A 1JKKA 4XLIA 2QOFA 4XG6A 2DQ7X 3E87A 3Q6WA 5CF6A 4DGNA 4PP9A 5JFVA 4PL4A 5DFPA 3NVKI 4HNFA 4QYHA 3PPZA 2Z02A 1KE7A 2OIQA 4DLIA 5K4IA 3RHKA 3MA6A 3CP9A 1G3NA 3F66A 3R63A 4GEOA 4MXOA 4EHGA 5EDQA 4PMPA 5LWNA 3AG9A 3EZVA 2WO6A 2BHEA 3VJOA 3RPRA 4JDJA 1NA7A 2A1AB 3C4FA 3FSKA 1WCCA 4GV1A 3OW4A 4Z7HA 4FKRA 5FUTA 3OEZA 3Q3BA 5LVMA 4UEUA 3QTWA 3ZRMA 4DFYA 3CR0A 4X2GA 1VR2A 4LGGA 3SDJA 3F6XA 3POOA 4CKRA 2X1NA 4WD5A 3RWQA 3FXXA 3HUCA 3BZ3A 2JC6A 4EOPA 3I81A 3TKUA 2CKEA 4DGLC 3MVJA 1J91A 3NEWA 1H27A 4RLLA 2VTPA 4AX8A 3L8VA 2XNEA 3G2FA 1DAWA 5JSMA 4S2ZA 3QGWA 2WKMA 3B8QA 3MSSA 1J7LA 2WU7A 5CSWA 3PJCA 1R1WA 2CGVA 4RIOA 5FP6A 4DH3A 3ORLA 4DHFA 4IADA 5FM3A 5KE0A 4O0UA 2OKRA 2YIWA 4PUZA 2ITQA 2VTIA 3QLGA 2JBOA 4IJ9A 3R22A 3KMWA 5HG9A 4MBJA 3MA3A 5IDNA 1G5SA 2C3KA 3R04A 3OWPA 4U81A 4O84A 2I40A 3UQFA 3P7AA 5HI2A 4IEBA 2VWYA 3PJ1A 4YJRA 3G0EA 1GY3A 5E1EA 1Y57A 2C47A 2Y4IB 3Q2MA 4NTSA 4OUCA 3BWFA 2RFEA 2ITXA 4C2WA 1A48A 3VVHA 2PMOX 1JSVA 3KRXA 2E9UA 2H9VA 1SYKA 3ORNA 5HE2A 4BCPA 4BL1A 4ZSGA 2WU6A 2UVXA 3MY1A 2QO7A 3LOKA 3NVMB 4LOQA 3H0YA 3ZDUA 4TW9A 2UW8A 3B2TA 4YSJA 4K33A 5J9LA 1J3HA 1O6YA 4FSMA 2W1ZA 4IZ7A 2JIVA 3TWJA 4CTCA 5HCYA 4DEGA 3BV3A 1FQ1B 4FTNA 4APCA 4DGGA 4E6DA 4ENXA 2ETKA 2WMBA 2VV9A 2Z2WA 3M2WA 2XRWA 4FIHA 3TTIA 4F6WA 2XH5A 5I9ZA 4EH3A 4FI1A 1ZARA 1X8BA 4H36A 4MCVA 4O91A 2QHNA 4ZS0A 3UYTA 4W4VA 3WILA 3N4TA 1BUHA 2PVYA 4QMZA 3VS2A 4ITIA 3I79A 5IA5A 4B6LA 5FXRA 3E63A 2HYYA 2C6TA 5AR5A 1DI9A 3G0FA 4RX7A 3TUBA 1MRYA 1YQJA 4YBKA 1KE8A 2FA2A 3PIXA 3EFLA 4HNIA 4YPDA 3QTSA 5FD2A 3PLAE 3F69A 5J5SA 3K5UA 3OOMA 2RIOA 5EFQA 4AA4A 5FEEA 4F7NA 3UP2A 3JYAA 5EYKA 5M09A 1APME 2YDJA 4FV8A 2PPQA 4BIEA 2IVTA 4FEUA 2CKOA 5L8JA 4ZS4A 3RBWA 2YM5A 4R7BA 4H3QA 4RJ6A 4FV6A 3U6HA 3I6WA 4RJ3A 4FKLA 4I94A 4AZSA 4BBMA 2GS6A 4IWPA 5CI7A 2R3GA 3Q9YA 2C69A 4EI4A 1ZZLA 4GT3A 4DT8A 3SXFA 4RVTA 2ZV2A 3I60A 3CY3A 2XVDA 3E93A 1YI6A 3EL7A 3O0GA 4BGQA 4X21A 3FDNA 3ZMMA 4UMRA 3E64A 4QMSA 3CQUA 4H39A 4O96A 4RVKA 5CSPA 4GKHA 3MS9A 3QQFA 4Y46A 5A46A 5GZ9A 3ZUUA 2CNQA 2R3FA 3EN7A 2X2MA 3QZHA 3F2RA 5L2IA 3LMIA 4YC6A 3VS1A 3BQRA 4PY1A 2W1CA 4XV3A 5DA3A 3COKA 3CIKA 5I5ZA 2YACA 4FIEA 2YWVA 3QRJA 4FTOA 1IAHA 3JR1A 2F2UA 3EN9A 4Y95A 3VWAA 3FMHA 4I6HA 3BU3A 4K9YA 5IH6A 1V0OA 2B4SB 5CF8A 3VUIA 2BFYA 3GENA 4MTAA 3R0TA 4JBPA 4CRSA 3KXNA 2V7OA 5L6WL 4U80A 2UW9A 4WHZA 5K0XA 3DJ5A 2C0IA 5FM2A 3FPQA 5LVNA 3FZSA 5CLPA 3R8LA 4MVFA 2XNPA 4ASXA 4AS0A 2VTTA 4ZZOA 3B8RA 2C6MA 4M15A 3WARA 3Q6UA 4DFXE 3HDNA 2UV2A 2VTJA 4XG2A 4BGHA 4S30A 5IA2A 3CE3A 3GU4A 1H1QA 4XJ0A 4ANBA 2W4OA 2KTYA 1J7IA 3FLYA 3BEAA 3QUDA 4F0GA 3COIA 3QQLA 3WF7A 5A9UA 2QU6A 2X0GA 2J0JA 1OIRA 3RCDA 1XWSA 2ZDTA 3UIBA 3T9IA 4L7SA 2QOCA 1PMUA 4BGGA 3GT8A 3ZTXA 3D15A 3LFBA 4BDJA 4CYIA 3RAIA 3FPMA 1Q99A 4YZDA 2ZM3A 4ARKA 3PG1A 4FKPA 4G34A 4K11A 1HCKA 3GC7A 3LQ5A 4MWIA 5AP7A 3NWWA 1M2QA 2HK5A 3C4WA 3NS9A 2J50A 1UU8A 4NTTA 3TZ8A 3ULZA 5A4QA 4U8ZA 3KULB 3ZO2A 3ZRLA 3U55A 3BRBA 3GP0A 5HO6A 1E1VA 2C5OA 4RA4A 3OC1A 4W9WA 4B0GA 3PRIA 4F9BA 3PXYA 1IAJA 5I9UA 3ZXZA 2WMVA 3G9LX 4WKQA 5ETIA 5GIPE 2WNTA 3ZH8A 3AC4A 1MQ4A 2A27A 2R3RA 4AGWA 3MIAA 3GBZA 3KVWA 4I93A 2UZBA 1LUFA 3IK3A 2IJMA 2A19B 3DBEA 4XEYA 4F6UA 4W4YA 3IOKA 3WZUA 2VU3A 4JR7A 4LQMA 4M66A 1QL6A 2EXCX 4UV0A 3LXPA 3NUYA 2J0KA 3DTWA 3UBDA 3E8EA 4EBWA 2V22A 1XO2B 3PZHA 4CG8A 1OPJA 1UNHA 2QLQA 4NM5A 3DXNA 1PW2A 1XQZA 3KCKA 3EMGA 3HA6A 4BDCA 3FKOA 3QD3A 3G15A 1SNUA 2W1DA 4AG8A 5AV3A 2O5KA 3A60A 4FYOA 3ZUVA 3ZZEA 5HQ0A 1XH6A 2B53A 4PF4A 2BRBA 2XKCA 4IB3A 4F0IA 2Y4PA 4OTWA 2IWIA 4FV5A 4LGHA 4CVAA 4EQMA 3S1HA 3R73A 1JNKA 3D5UA 3ZZWA 3PVWA 4NH1A 3HL7A 3NUNA 4FICA 4FK6A 2ITUA 4RIYB 3COHA 4LOPA 1F3MC 5CAVA 3QTXA 5CU3A 4U9AA 3CPBA 4QQJA 4QP3A 3KXMA 2ITOA 4NJDA 4RJ7A 3R1SA 4NZWB 3EOCA 3QGYA 4IAFA 3WZJA 2PMNX 1ERKA 3Q4ZA 3R1NA 4TXCA 3UC3A 3UC4A 4F7LA 5J1VA 3TM0A 4TN6A 1RDQE 3R9NA 2ZMDA 2UZTA 4F63A 3QC4A 4PQNA 4FV1A 3F3ZA 3HECA 1ZYDA 3NNXA 3VS7A 1OVEA 5BVEA 4MNFA 5HCZA 5D7AA 4FTIA 2XK4A 2FSMX 3LZBA 3OOGA 1KOBA 4MH7A 5AR4A 4M67A 2G15A 1F5QA 4NL0A 1BL6A 4YTCA 2PVMA 4JDHA 3SOAA 3PA4A 4CT2A 5F94A 4CYJA 4BZDA 4MHAA 4LRMA 4BDHA 1YOMA 4HVHA 3Q4CA 3MPTA 4EOSA 4QMLA 2PWLA 2YM6A 3F88A 3T8OA 2NP8A 4JX7A 4NIFA 5ANIA 5HG5A 2BIKB 4DCEA 5LVLA 4O7WA 4O0SA 2C5VA 2X6DA 2QOLA 3VF9A 2VX1A 3FI3A 3MPMA 3QRKA 4MXAA 2G01A 3O23A 2B7AA 1GZOA 1WVXA 3ZSGA 2X8IA 4RPVA 4LV5A 5DR2A 5CXZA 3LCDA 3FMMA 3VUMA 5HNGA 2GQGA 2UUEA 5DI1A 2YA9A 2PSQA 4K2RA 4CFWA 5C27A 4CT1A 4RIXA 2BRHA 4X3JA 5G1XA 4QPAA 4G31A 2BRGA 2RGPA 4V05A 1YDSE 3M11A 5CQUA 3QWJA 2XRUA 5FTQA 4O0YA 2ZV7A 3EL8A 3CTJA 4G5PA 3V5WA 3ANQA 2BPMA 5H8BA 2J7TA 4F7SA 4BCJA 1YXVA 4UMQA 4BCHA 4CTBA 4F9AA 1V0PA 2C3LA 3IGGA 4FKGA 1Y8GA 3FMLA 3JUHA 4ID7A 5AR7A 5GJGA 5M57A 4RJ5A 3K5VA 3PIYA 4L42A 1XR1A 1VYZA 2JDSA 1JSTA 5IUIA 3RJCA 3TG1A 5EW3A 1KV1A 1M52A 4WG4A 2WTKC 3VUKA 3H9RA 3AD4A 1KV2A 2HENA 3KRWA 4AW0A 3CEKA 3RP9A 1UKHA 5J79A 5DMZA 3KN6A 3OXTA 3V8WA 3DV3A 4C4EA 2PHKA 2ZDUA 3NYVA 4FZ7A 3W1FA 3W10A 4ANSA 4E4MA 5HX6A 4OLIA 4OTDA 2BALA 1M2PA 3QQKA 4QTDA 3OMVA 4GVJA 3U6IA 3KGAA 1H0WA 1UU9A 1QPDA 3ANRA 3TNQB 4LV8A 3D2IA 2HWOA 3IKAA 4A07A 2CKQA 4QP2A 1R3CA 4LGDA 2ZB0A 4HYUA 4HZRA 4ZEGA 2XIRA 4E4LA 4D1SA 3HV6A 4B4LA 5HIDA 4O86A 3K54A 3ZBFA 4WRGA 4YHFA 4C3FA 4IX4A 3IDBA 5C4KA 2R3KA 3ZEWA 2P2IA 2VUWA 3E7OA 4MF0A 5FDXA 4M68A 3I6UA 1YDRE 3WOWA 1GIHA 2WOUA 4MF1A 3MY5A 5H8EA 5CEIA 3BGZA 4ZSAA 3P86A 4D5HA 4QO9A 3TDVA 3BE2A 5CENA 3OEFX 1OBDA 4L46A 4IWDA 5J8IA 1TQPA 5HVJA 3GVUA 4AGDA 2GHMA 4D0XA 5EYDA 2X4ZA 2QU5A 5CASA 4D58A 3VS6A 4I4EA 4BF2A 3SQQA 2FH9A 5KMOA 3CCNA 2BTSA 2XIXA 1TVOA 5DEWA 4C4IA 4KIKA 2CCIA 5IA3A 2EB2A 4KINA 2BHHA 4KABA 4BVUA 4DG0E 3P78A 1ZOGA 5AIKA 3V6SA 4OW8A 4BI0A 5CEOA 4BBFA 4XG8A 3EQHA 4XP3A 4L52A 2QG5A 3KFAA 4L3JA 1XH5A 2W1HA 2JFMA 3HV5A 3QUPA 5IUHA 3PE2A 2A0CX 4NFNA 3Q4TA 2PZ5A 4TT7A 5TOZA 4FYNA 2XZSA 4B7TA 2VWUA 4BDAA 5DVRA 3ZEPA 2OZAA 3GCUA 4QPSA 4AT3A 4L53A 3FMDA 4F70A 5IQIA 4FBXA 5A4TA 3F2AA 4MD8E 4AZTA 1H1RA 2YIRA 4EC9A 4EWHA 2XIZA 3IW8A 4FT9A 3L8PA 3OUNB 4OT6A 4CXAA 3C13A 5CZIA 3VS5A 5K0KA 3EN6A 4XV9A 3RK9A 4A9RA 1YVJA 3CD8A 4FEQA 4XOZA 4FOBA 4M12A 5LMKA 2CNUA 4BTMA 4NU1A 2C6DA 2CN8A 1URWA 1H4LA 4CFUA 4JXFA 4CV9A 3WF6A 5CANA 3ALOA 3ELJA 3HMNA 3IPHA 3MY0A 3OTVA 5KMKA 1ZOHA 3W2CA 3CSVA 3KU2A 3WF9A 1AD5A 3TIZA 4Z7GA 5IUGA 4D9UA 4EH6A 4ZY4A 4N4SA 2OSCA 1QPJA 1H0VA 4OTIA 3ZSIA 2GNLA 4GYGA 2YDKA 4FTQA 4U6RA 2H96A 3LFCA 5HEZA 1U59A 5E8YA 4O83A 5GINE 1PKDA 2WMWA 4APPA 5IH5A 4C02A 2Y7JA 3BHYA 2I0YA 1R39A 1P5EA 2BR1A 2P0CA 3MIYA 1XJDA 3OZ6A 4KS8A 4YC8A 4C33A 4CEGA 2P3GX 5CEPA 4HGTA 4CG9A 3D2KA 3WE4A 3IECA 3Q60A 2OLCA 2VTQA 5C8KA 2VTRA 2WQOA 3BYMA 1UWJA 4KS7A 4ACMA 3NUPA 4KAOA 5HVKA 5LMBA 4R77A 2UZNA 2ZV8A 3OT8A 3NNVA 3N51A 4ZTRA 4AN3A 4XP0A 1YOLA 4F1MA 2R4BA 4GS6A 4MXXA 4ZP5A 3A8XA 3R6XA 3RK7A 4F9YA 4YTIA 3BHVA 2IO6A 3OTUA 2BTRA 2E9VA 4R1VA 2FSLX 3MB6A 4RX8A 2WHBA 2YZLA 4F9CA 3KF7A 4A9UA 5H3QA 4FTTA 4FGRA 1OITA 3R9RA 4U45A 4EOOA 4AZVA 5IKWA 3M1SA 4GUBA 3DT1A 5HOAA 5JFWA 3SGCA 3MH3A 2ZOQA 3PLSA 5IH4A 4YR8A 2VO3A 5D9HA 3NUXA 3IG7A 4CFVA 4FZAB 3UZRA 5IQEA 4S34A 4GG7A 4O82A 3GFWA 4IIRA 1RJBA 2BAQA 3O8PA 4ACDA 4I92A 4AFEA 4IH8A 2PVRA 4CKJA 3WBLA 5ICPA 4DH7A 4EL9A 3FLQA 4GRBA 4ANMA 3ALNA 2YCSA 3WF5A 2B54A 2VRXA 3H0ZA 5JEBA 5I0BA 4UALA 3SHEA 3QWKA 3AMBA 5D11A 5E8XA 5HBEA 2VD5A 4FIJA 1QPEA 3AQVA 4FKTA 4AWIA 4E1ZA 1VJYA 3LJ0A 4H3BA 4YZMA 5CF5A 3FZRA 5JQ8A 3QL8A 5E8ZA 4IB1A 5KBRA 4XV2A 3MTFA 1BI8A 3RM7A 3K3IA 4CKIA 1XH4A 4YUQA 1UU7A 5IF1A 2YLEA 2VO0A 2ITPA 3PFQA 5KHWA 5AP4A 4CQGA 4P7EA 2IW9A 3QZIA 2R3JA 3Q5ZA 5ACBC 4IM0A 3RKBA 1GZNA 1KE6A 2WPAA 3UOHA 3UP7A 2Z60A 1Q3DA 3TNHA 3S0OA 2OXDA 2YIQA 4GCJA 3V5PA 2C0TA 2HW7A 3PJ3A 3E5AA 3NLBA 4NFMA 3S3IA 5HBHA 1JWHA 4QMYA 4U79A 3VS4A 2BZIB 2HWPA 5GJDA 3MWUA 1YXUA 2P4IA 3PZEA 4PP7A 3FAAA 1CDKA 4RWKA 4CFFA 1VZOA 1JOWB 3OUKA 3HP5A 4DN5A 2B9IA 4BCOA 5EI8A 3I0QA 1YI3A 5LARA 4D4SA 4EHZA 2CGUA 2GMXA 4ENYA 2BRMA 2RFNA 2WTIA 3ENMA 5M56A 5C4LA 3LFEA 3GU6A 2UZOA 3RNYA 4IZYA 4WG5A 3R7OA 2UW4A 3TNIA 4EHEA 5J5TA 5TO8A 2RG6A 4QQTA 3VUDA 2GHLA 5BVDA 4C62A 5CEKA 4KBAA 1G8AA 4X6RA 4RC4A 5E4HA 2CLXA 4L43A 2C4GA 4X2KA 5ETFA 4BCGA 5E8TA 4EYMA 4NUSA 5HORA 5G6VA 5EM6A 4BC6A 4R5YA 2ITVA 3LW0A 2W17A 4LOOA 4M97A 4PPAA 5HNBA 2GFSA 2C0OA 4BDBA 3BE9A 3EYHA 4ALUA 3BCEA 4NJ3A 3V04A 5FTGA 2HELA 4K1BA 2VWVA 4DG3E 3O50A 4FUYA 5ANJA 2WMQA 4XLVA 5BUIA 4RIXB 5HG7A 3BI6A 4UMPA 3SLSA 3JY0A 4TYIA 3VBTA 5IEXA 4LL5A 4RJ8A 5FLFA 2QODA 3RM6A 3ZLWA 2C5XA 2E9PA 5HBJA 3ZFYA 5HO7A 1OPLA 2XBAA 3DFCB 4J8MA 4CZYB 2P2HA 4QPMA 5ANOA 1ZYLA 1PY5A 4Z9LA 4EH7A 3DBQA 3U6JA 1HOWA 2VNWA 1DS5A 1GIIA 5AA9A 5A54A 3CTHA 4BCQA 3DB6A 3MJ1A 5E8WA 5AUUA 3QXPA 3V01A 4FL3A 4E26A 3ZM4A 3VF8A 1GIJA 5FQDC 5D41A 3ID6C 3FZ1A 1M7NA 3DB8A 4EOJA 1DM2A 4XHKB 4ZTQA 3CGOA 1XKKA 4FV3A 3V8TA 4NW6A 1YWRA 4IBMA 3QAME 3FY0A 1IASA 2G9XA 4IC8A 5A6NA 5CT7A 4FTMA 4BRXA 4YJVA 4AGUA 5HGIA 5EHYA 2XYUA 1MRVA 2W5BA 4V04A 4W4XA 4L7FA 4GU9A 1ZMUA 5AR3A 5JFSA 4IFCA 2EWAA 3OCSA 3R8MA 3U9CA 2OH0E 4FTRA 3FE3A 4AW2A 4X7QA 4YZBA 3TIYA 4FZDB 3F2NA 2IG7A 3VBXA 3MVMA 4IWOA 4EKLA 4Y72A 3RWPA 2W1FA 2WEIA 1P4FA 1DI8A 4UYNA 4FA2A 3R30A 2Y4IC 4GMYA 3UIXA 3JY9A 4IVCA 2C1BA 4O2ZA 4C37A 4J95A 4KBKA 4TWCA 3QQUA 5L2QA 3GEQA 2FO0A 3E62A 1EH4A 5L2TA 3QX4A 3H10A 4HVDA 4Z55A 3OWKA 3P0MA 2X81A 4TL0A 3KXGA 4HGEA 3LFAA 4YGAA 4ZLYA 2QD9A 4X3FB 4CNHA 3FC1X 3KC3A 3FKNA 4E4XA 3EFJA 4GFGA 4QNAA 4GJ3A 2J0IA 3TZ7A 2NNWB 4XV1A 3R2YA 5H8GA 2YERA 4YLLA 2QO2A 2VWIA 5HKMA 3QALE 4E7WA 5IQHA 4JX3A 4IAYA 5JGAA 3AC8A 3BBWA 1M17A 3F5UA 4C36A 4XNEA 4PTEA 3IO7A 2H34A 3LXLA 3KMMA 3GU7A 3I1AA 3IQ7A 5M55A 2RG5A 2W5HA 1Y6AA 4AW5A 5HTCA 3CQEA 4XBRA 3BV2A 3E3BX 4LFIA 4M0ZA 3GNIB 3NAYA 3FWQA 1XBBA 4N6ZA 1ZOEA 4HVIA 4LL0A 1L3RE 5AA8A 3C4CA 4Y85A 3QU0A 3Q53A 3UGCA 4I5MA 1Q41A 4JJRA 3QHRA 1YWNA 4K8AA 1OECA 3RHXA 5BYLA 5EKNA 1UA2A 4ZY6A 4QP9A 1UKIA 3I5NA 2JAVA 4XX9A 2AC3A 2C6IA 3F82A 1WBWA 2J51A 1PRYA 3TL8A 2FSOX 4MXZA 4BFMA 1NY3A 3U54A 1OKWA 2XUUA 3DAJA 3F3VA 3PG3A 4RBLA 5HZNA 4NYEA 3NIZA 2Z7QA 1J1BA 4IVAA 3Q9WA 3DCVA 4RFYA 4RRVA 4MD9E 4LG4A 2FSTX
chains in the Genus database with same CATH superfamily
2YFXA 4G1WA 4QD6A 2OJJA 4YJQA 3HV7A 4AN2A 1SZMA 3BIZA 4O6LA 3TKHA 4O81A 3H4JA 2RFSA 3ZXTA 4E5WA 3OP5A 3TXOA 3ITZA 4JG7A 4BCMA 2ZM4A 1CKIA 4CGAA 1OB3A 3C4XA 2UZLA 5J9ZA 4G3CA 5L3AA 4XBUA 5AP6A 4EONA 2JLDA 2UZEA 4FG9A 5IQAA 4I0RA 3RTPA 5HCXA 5AM6A 3NAXA 3TN8A 3ZYAA 4FIIA 3O51A 3Q9ZA 2VO6A 3AT3A 3F3UA 3OY1A 4M69A 4MXYA 2GQSA 5IQFA 4H3PA 4ZZMA 1M14A 2R2PA 2Y9QA 2VWZA 5DLSA 4DH8A 5CTPA 4EQUA 1FBNA 3S4QA 5J95A 2P55A 2H8HA 3TZ9A 3TUCA 3DKGA 2WTJA 3VHEA 4L00A 3A61A 2R3IA 4RQKA 2IW6A 2RFDA 3PUFC 4ALVA 4C57A 3UDTA 4FK3A 5AV4A 3RAKA 4FMQA 2YIYA 2FB8A 5EG3A 4ZTLA 3V51A 2WMAA 4ANOA 3DA6A 5B2LA 3FUPA 4DEIA 5EHLA 3AD6A 4DEAA 1KE5A 2ZJWA 4JOAA 4RIWA 4E6CA 3LQ3A 1M7QA 3NFFB 4ZMFA 2GSFA 3C7QA 2FGIA 3D7TB 3RI1A 3F5GA 3E3PA 4BIDA 3SX9A 5KKRB 4OBOA 1OUKA 4FIGA 4FV2A 1ZZ2A 4EH5A 3DGKA 4IM3A 2GNFA 4BKJA 4CSVA 5C1QB 4FJVA 1Z5MA 4UZHA 4B8LA 2PVLA 3BKBA 2XKEA 3Q5IA 3HZTA 4EK8A 3SG9A 2A2AA 2R3HA 4PMMA 3UVRA 2R64A 4PV0A 3V5LA 3PA3A 2AYPA 3O8TA 3W18A 1FPUA 2G2HA 1RE8A 4WOVA 4QDEA 3UO4A 1MP8A 4AW1A 4R3PA 2X2KA 1L8TA 4F6SA 1ZRZA 3CJFA 2NPQA 3PTGA 1ZLTA 4YTFA 4G16A 1IRKA 4JG6A 4ONAA 4E93A 5D7VA 4B99A 4PNIA 4QT1A 4FEWA 3OXIA 3FQHA 5BYYA 1NT2A 3UMWA 2QO9A 3NRMA 4L68A 3DK6A 4RQVA 3DKCA 5DHJA 3SAYA 3II5A 3LLAA 1YOJA 4HPUE 4TWNA 5CU6A 2P33A 2Q83A 3OBJA 2R3MA 4D0WA 1OUYA 3GXLA 2X7FA 3FV8A 4RZVA 5AX3A 2XJ2A 3RCJA 4AP7A 1E9HA 4CZUA 4BDIA 3DK3A 3NX8A 4LV7A 3MESA 4IXPA 3FZTA 3UTOA 5HD7A 4MYGA 4GK3A 3EQDA 4P2KA 2QOQA 4OT5A 1PXPA 2J0MB 2XB7A 3FSFA 5ETAA 1M2RA 1TQIA 2YWPA 3G6HA 3DFAA 4DINA 2XIYA 4DEDA 4EZ3A 5EM8A 1FGKA 1PJKA 2AC5A 5LCJA 2YCQA 2PMLX 4DFZE 4W8EA 3ROYA 3NUSA 4Q9ZA 3D7ZA 2HZNA 3LFSA 3D9VA 3V8SA 4EHVA 2XM8A 3PPJA 5DPVA 2IF8A 4D4RA 3MTLA 4RX5A 3CLYA 3GOPA 1FVTA 5EW8A 1DAYA 4Q2AA 4G5JA 5CAPA 3QCQA 3DLSA 5JRQA 3FLNC 4EKKA 3ZBXA 2JKMA 4GIHA 2UW7A 3QC9A 2CLQA 2B9HA 4EZ7A 4FTCA 4FTLA 4WBBB 3DKOA 3R7YA 2Z8CA 5AEPA 2CN5A 4AE6A 1XH9A 3BHTA 3QTQA 5CEQA 3ZLYA 1QCFA 3GOKA 3PA5A 4ZMEA 3QQHA 2VAGA 2X8EA 4QMWA 2W0JA 4UXLA 3KVXA 4I6QA 3AT2A 3QD0A 3CKXA 2OGVA 4TYHA 4QRCA 1O9UA 4ZTNA 4EC8A 3ZCLA 4EOQA 3LJ1A 3MGYA 3VIDA 2YCFA 1JKTA 3LFDA 3LFNA 4O0WA 4BZOA 3EFKA 3KMUA 4EJNA 4RVMA 4EUUA 4RT7A 3SA0A 1Y8YA 3RMFA 3A4PA 3UIMA 4ZK5A 3KY2A 2C3JA 2GNJA 2YM4A 4IB5A 5E8VA 3UMXA 2JKOA 3AC2A 4F65A 1WZYA 2ZVAA 3FYJX 3ET7A 1H1WA 4D2RA 4D1XA 5F20A 4M14A 4QTCA 3KEXA 4JS8A 4F09A 3QYZA 3OHTA 1IG1A 5EOLA 2I6LA 4AOJA 3BWJA 2YCRA 1YXTA 1BKXA 2IZTA 2V7AA 3P5JC 1IEPA 3N4UA 4BCKA 3AKKA 1JVPP 4GT5A 3HNGA 2QQ7A 2XCKA 5HTIA 4FSQA 2PUUA 2GTNA 1A06A 3RVGA 5IEVA 2QR8A 3QLFA 4TRLA 5AUVA 3W16A 3R7GA 3W2PA 5A6OA 4QP7A 3W0PA 2JDTA 1Q3WA 5AM7A 2HZ4A 4MNEA 4USEA 2BZHB 2ESMA 3NUUA 4L45A 3S2PA 3RGFA 4AA5A 3ML1A 5A4LA 3SXRA 4YZCA 3RZBA 1KSWA 3TDWA 1W7HA 1JQHA 2GNHA 3G6GA 4FKUA 5EM5A 3CXWA 2NRUA 5EI6A 2JIIA 4ZXTA 4PDYA 3O96A 2ZB1A 4IE9A 3CBLA 2XNMA 4ACHA 3FLSA 3PY3A 3IGOA 4JR3A 4H1JA 2OK1A 5EYMA 2ITNA 3FHRA 2F4JA 4EOMA 2PU8A 3PJ2A 3UIUA 4DA5A 2DS1A 2GNIA 5IDPA 3NYXA 4G3GA 3UO6A 4D55A 4L3LA 2PYWA 4QTBA 2YJRA 5HLWA 3I5ZA 4NM7A 4RJ4A 2FUMA 4YHJA 3UOKA 2W96B 4ZJJA 5CU0A 4PDPA 1CKPA 3TACA 2RL5A 5AP3A 2WOTA 5M4UA 4R5SA 5K3YA 3QA0A 4D5KA 5HE1A 1NVSA 4J98A 4N0SA 5M53A 4DTAA 3MB7A 2SRCA 3CPCA 3HMMA 3KL8A 4FTJA 3OS3A 3Q9XA 4ITHA 3QQGA 4A9YA 4D4VA 2NO3A 4OTQA 2HZIA 4DBXA 5EK7A 4TWOA 1SVHA 2CGWA 4E4NA 3NFGB 1WMKA 2WFYA 2R5TA 3IS5A 4FKVA 4JT3A 4BWPA 5BVFA 2VWWA 5LXMA 4E73A 2C5NA 3A4OX 1REJA 4C2VA 4MK0A 2R7BA 5EI2A 2UZUE 2R9SA 3MN3A 4DFBA 4RWIA 4TZRA 2J0LA 3P9JA 1FOTA 4BTKA 1ZY5A 4ZLZA 4LMNA 4AUAA 1XBAA 3RINA 3FLWA 5L6PA 5AP5A 4UXQA 4O1PA 4JQ7A 4A4XA 3IW7A 1U4DA 5CNNA 3TI1A 1FMOE 1LR4A 5DE2A 3DAEA 4HZSA 2BUJA 4II5A 4U3YA 5D1JA 4ACGA 3FQSA 1CMKE 4FG7A 4UX9A 4IM2A 5KHXA 4LUDA 5CY3A 3TCPA 3PVUA 1H00A 3ZOSA 3R02A 2R3OA 5M4FA 4S33A 4YJTA 4OTRA 3CD3A 3MYGA 3PP0A 4YSMA 4CFMA 3R21A 4C8BA 3OROA 4EYJA 4K6ZA 5BQ0A 2VX0A 4MBIA 4EK6A 4C4JA 1LP4A 3EFWA 3MFRA 1NW1A 5HTBA 3IOPA 4KUJA 3TJCA 3QD4A 2QKRA 2PUNA 3LM0A 3PUPA 1OBGA 3VQHA 2QG7A 1OZ1A 4QMQA 5EW9A 2JD5A 2W4JA 4BI1A 4IJPA 3VN9A 3FMEA 3LPBA 1SMHA 2ITZA 5DIAA 5IU2A 3KB7A 2F57A 5EDRA 1MQBA 4QYYA 5FXSA 2J2IB 5I9WA 5AUZA 5BPYA 3KK9A 2QCSA 3D14A 1H1PA 5DG5A 5IA4A 2VTHA 4WNMA 2XJ1A 1IR3A 3TNPC 4CZTA 3UQGA 4DGOA 4UMUA 5CF4A 4UBAA 2XA4A 2ITTA 4XG4A 2G2IA 5LMAA 2ZAZA 2BDJA 4KIQA 3QZFA 3A99A 4EUTA 4A06A 2ONLC 3ZC5A 2QONA 2BZKB 1VYWA 3NSZA 5AJQA 5CWZA 2OH4A 4OAUC 3ATSA 1AQ1A 3R00A 3R8PA 2OBJA 2JBPA 4RZWA 4PWNA 1LEWA 3IW4A 5FEDA 1H25A 5CEMA 2XNNA 4ZTSA 2X7GA 4QNYA 2BKKA 2VTLA 5AMNA 3RPYA 3D4QA 4O7ZA 3QF9A 5ANDA 2VGOA 2WMSA 4D2WA 4HVGA 1SVEA 3AT4A 4KWPA 4TKSA 4DHJA 3P79A 2WQEA 2X7OA 1SNXA 2WMRA 5T68A 4CCUA 4OTHA 1K9AA 3D0EA 3GU8A 3H3CA 4BDFA 3QTUA 2UZDA 4FKJA 4FRFA 4KBCA 4IFGA 4XMOA 3FI2A 3AC3A 3FMKA 4P90A 2WQMA 4AZEA 1BI7A 2VTMA 1OMWA 5IQGA 3MH0A 4AGCA 4GL9A 4O7LA 1J7UA 4QYEA 3O17A 2BDWA 3AOXA 2XF0A 2IZSA 2W5AA 3DQWA 4HOKA 4USDA 4E6QA 2QHMA 3VC4A 1PF8A 5FWKK 5AFVA 4BI2A 5I9VA 4HCTA 3HRBA 2GS2A 3JPVA 5I4NA 4FZFB 2VWXA 5E92A 2O2UA 2WIHA 4NCTC 1Y6BA 2C5YA 4DH5A 4FSRA 3VUTA 2GNGA 1Q8UA 2E2BA 3NW6A 3PYYA 3F9NA 2VO7A 4XP2A 3R9HA 3VBYA 3FL4A 1R0EA 1ZYSA 5HICA 5CAQA 1U54A 2PE2A 2XANA 3AC1A 3LCKA 2R0IA 1W82A 2AQXA 3FEGA 4DHIB 4EH4A 3TV6A 3JVSA 3G51A 3ORTA 4G6NA 3C1XA 5JGBA 4IACA 4O4BB 3AXWA 1BX6A 1ZAOA 2JEDA 2YN8A 5E8UA 2IVSA 4CFNA 4CMTA 5GZAA 3H9FA 3PIZA 3ZO1A 1R0PA 4HGSA 2E9NA 4FTUA 1RW8A 2V0DA 4FNZA 3TJDA 5TKDA 3RK5A 1H26A 2ACXA 1OL5A 4QP8A 5IMEA 5KCVA 3ZFXA 4ASZA 2ITYA 2OJFE 4FG8A 3NDMA 5AR8A 1P2AA 4TYJA 1W2DA 5JRSA 4BYIA 1VEBA 3Q4UA 3U87A 1YRPA 3P4KA 3OCTA 3PXQA 2EXEA 4N6YA 1S9IA 5HVYA 5CAUA 3I4BA 3GU5A 3OWJA 5DR9A 3R83A 3BGQA 3DZQA 3GB2A 3LCTA 4FV4A 4JVGA 5HG8A 4UB7A 2EVAA 4WNKA 3BELA 3WIGA 4JDIA 4RC3A 2QNJA 2WTVA 2OU7A 4WSQA 3U4WA 3LXNA 5M4CA 3ZU7A 1YW2A 1WBVA 1BMKA 3Q32A 5J9YA 1OL6A 3E8CA 3BHHA 3O7LD 1B6CB 1F0QA 3HYHA 4MQ2A 2F7XE 2YEXA 4U40A 2HY0A 4UWYA 4QMOA 5CSHA 3WYXA 3A7FA 3EWHA 5DOSA 5EQYA 3F61A 4QMVA 5HNIX 3MFUA 2YHVA 4XH6A 1U5QA 4R1YA 2C6EA 4OAVB 1GAGA 2QVSE 4JL9A 2ERKA 1OL2A 4K0YA 5CVFA 3RPSA 3W2RA 4DC2A 4DTKA 4FE2A 4JNWA 5JZNA 5JFXA 3DKFA 3EQIA 3P08A 4YBJA 5CVGA 4FKWA 4D4YA 5H9BA 2DYLA 2H6DA 2A98A 4FTKA 5J7HA 5GJFA 3QTZA 2CDZA 2RSVA 3ETAA 2IW8A 4O7VA 3OXZA 2VTNA 1JSUA 3GCVA 3HUBA 1JAMA 2WB8A 5HE3A 3OFMA 4WIHA 3DTCA 3A7IA 4UY9A 2WMTA 4AZFA 4C61A 3MDYA 3W0MA 4EK5A 3SC1A 4BBEA 5E90A 4OBQA 2QLUA 1YHVA 2UVYA 2WMXA 4O6EA 2XK9A 5AUXA 3C0HA 3S00A 4GSBA 4LUEA 3W55A 5FRIA 4C58A 2VN9A 4NIFB 5EQPA 4M3QA 5AP0A 4E5AX 3JS2A 3HMPA 2BVAA 3UYSA 3UNJA 2IVUA 1MUOA 4IAAA 4R6VA 3UZPA 5HD4A 4IVBA 5T6KA 3R7VA 1Q97A 3LJ2A 3QX2A 4XRJA 4PL3A 3ZDIA 1PXKA 1UNLA 1P14A 3BLRA 3E92A 2ITWA 3EQPA 3OD6X 4KD1A 3G5DA 5D10A 1ZWSA 5JT2A 3RALA 4CLIA 4ASDA 5BYZA 4DEEA 4JIKA 1STCE 1H8FA 2XM9A 4KKGA 3MW1A 4YJSA 3PRFA 3UG1A 4BWKA 4BCNA 4DYMA 4F9WA 3D5XA 3MFSA 4D2SA 3ZO4A 3C5IA 3VRZA 5D12A 5KMIA 3IW5A 3SKCA 2BDFA 1IA8A 3BYVA 3E88A 2R0UA 3F7WA 3H9OA 4D2VA 2WTDA 4EOLA 5A14A 4YO4A 2Q0NA 2ETMA 2PZIA 1W83A 3PY0A 4GW8A 2QOBA 4AA0A 1JLUE 3ROCA 4D9TA 3E8DA 4XCUA 5M44A 5ANKA 4IAZA 4TWPA 3NUAA 2X39A 2Y6MA 4BICA 2HXLA 2B0QA 4I23A 4X3FC 5TE0A 4YURA 5FG8A 3GC8A 3N4VA 2IZRA 2OIBA 1PHKA 3L8XA 4QOXA 3ATTA 3DQXA 4FIFA 1YDTE 4V0GA 4GUEA 2HXQA 3FJQE 4ZZNA 3UDSA 3T3VA 3L8SA 4I5HA 4S31A 3HA8A 4NWMA 4C4FA 2PE0A 3LIJA 1PXLA 4BDGA 1A9UA 4I22A 5IPJA 5A3XA 3KRJA 3TUDA 3KK8A 4EK4A 1CKJA 2X9FA 3O8UA 3FMJA 4EH8A 2YABA 5C8NA 3G9NA 3KKVA 2WMUA 5GIOE 3IDCA 2BROA 4O0TA 4AE9A 4J53A 5I9XA 3N9XA 3FMNA 4RC2A 5BVKA 2Q0BA 4MX9A 4IWQA 4FZ6A 1CTPE 2JITA 3OBGA 5FTOA 4F0FA 3SW4A 4LYNA 4ZY5A 1GZKA 3DDPA 3C4ZA 3D5WA 5L8LA 2YZAA 2UW3A 2VZ6A 4YJPA 4G6LA 3GCQA 3VNTA 3DJ7A 4EWQA 4I6BA 1O6LA 3BQCA 3VUGA 4KIKB 4G9CA 3EQFA 4HYIA 2E9OA 2C6OA 4DEBA 5F1ZA 5C26A 3SW7A 5AV0A 3R7EA 3A7HA 1FVVA 1FINA 2PVNA 2XK3A 2XKDA 5F4NA 4RVLA 1Q8TA 3VS0A 3RPOA 4RIYA 4FNYA 5IZFA 1PXOA 3EYGA 4DH1A 5B0XA 4G9RA 3FQEA 3WF8A 1BLXA 3PPKA 3I7BA 2DUVA 2OZAB 3OY3A 4ZSLA 3OCBA 5K4JA 1OL7A 3FY2A 2FVDA 3QKKA 4JAIA 4AQCA 3FZOA 4O4EA 4W8DA 2PVKA 4AOTA 1OPKA 1XHAA 4G6OA 4BYJA 4RA5A 4ZJVA 1YHSA 4AFJA 3PWDA 4IHPA 3CGFA 3VS3A 3LLTA 4MAOA 3CY2A 4GFOA 3WZKA 4CMOA 3BHUA 3ZRKA 2ZYBA 1XMLA 4ZIMA 2W06A 4FODA 4JG8A 3QTRA 4X2NA 2W7XA 4PTCA 1I09A 3NR9A 2UZWE 3UJGA 2BAJA 2B9JA 3SV0A 3TT0A 3ZLSA 4UZDA 2F7EE 4C3PA 1UVRA 1YXSA 3HRFA 3U9NA 3KIOC 4A9SA 4UN0C 3TKIA 4AU8A 5CVHA 4ACCA 2XBJA 3F5XA 3L9LA 4KKEA 3GCPA 4R78A 2OXXA 1OKYA 5CI6A 4FKIA 4O0XA 3KF4A 4I5CA 4RFMA 4BTJA 4IANA 4N70A 4BHZA 4BZNA 5BVNA 4FOCA 3HV3A 4B9DA 3BBTB 3DU8A 4J1RA 2G1TA 1YWVA 1WBNA 4YJNA 5DNRA 3BL7A 3LMGA 4DFUA 5A4CA 4I20A 5DGZA 5IEYA 1PMVA 4ANNA 5M4IA 2PMIA 2GDOA 2J9MA 2REIA 4PPBA 4ANQA 2W99B 2JDVA 4FSTA 5ANEA 3QXOA 2WIPA 5KKRC 3EQRA 3VW8A 2Y8OA 3R8VA 3C4EA 4WRSA 2I7QA 5K5XA 1V0BA 2I0VA 3VO3A 4XRLA 3QD2B 1U54B 4E5BA 2CCHA 1YHWA 3QFVA 4RGJA 4F1OA 1W84A 2W05A 4PL5A 3NCGA 4WO5A 5ANGA 4BKYA 4FC0A 3W8LA 2QKWB 2QOHA 4BB4A 1PYEA 4L01A 4W9XA 3QCYA 1OM1A 2OJIA 2OF4A 5ETCA 4CD0A 1KUTA 1XH7A 3VBWA 4FNXA 4A4OA 2PULA 4G3FA 3RAHA 2VNYA 1NXKA 4H05A 4M0YA 4GJ2A 5H2UA 2OG8A 1WBTA 2R3QA 4I1ZA 4K18A 5KUPA 2CKPA 3R71A 4FSUA 3VBQA 4I6LA 3SOCA 4LMUA 3L9MA 3F3WA 4G3DA 4IQ6A 4X2FA 2OZOA 4I6FA 3C51A 4QQ5A 4FSZA 3POZA 3GUBA 3PXRA 5DT3A 5AR2A 3R9DA 3W33A 4O0VA 2EB3A 4F1TA 1PXNA 4U3ZA 3CQWA 5TR6A 3KQ7A 3UVPA 5HESA 2XNGA 3C0IA 3DZOA 1WBOA 2J6MA 2HZ0A 1CM8A 4ZJIA 1Z9XA 4NM0A 1WAKA 3C0GA 3EQBA 5E7RA 1OL1A 2YM7A 4EH2A 2WZJA 4YPSA 3VAPA 3UPXA 4U43A 4Z16A 3EN4A 3SG8A 4DF3A 4NEUA 3T9TA 4R3RA 3GQIA 4I0TA 5HLPA 5GZ8A 5GHVA 1ZY4A 5DRBA 4NSTA 1T45A 4HJOA 1PMNA 2Z7LA 4ERWA 4XG7A 4A9TA 4JI9A 4DLJA 2B9FA 4C4GA 3CS9A 4HPTE 3C5UA 4R7IA 3VULA 3R2BA 3WIKA 1ND4A 4UWBA 5BVOA 2QURA 2C6KA 2OXYA 1H01A 4X2JA 4J8NA 3T3UA 5L2SA 2BFXA 3HEGA 5AIRA 3ZC6A 1PXJA 3BYUA 3P7CA 3NZ0A 5JH6A 4J97A 5JQ5A 3D94A 3HLLA 3K2LA 3KRLA 4BDDA 4GK4A 3DPKA 4IC7A 3U51A 5ACKA 2OJGA 2WXVA 3DK7A 3FKLA 4QMTA 4J7BA 3LFFA 4AZWA 3DLZA 3G90X 3PSDA 3LKMA 4AAAA 4FSWA 4L3PA 2FYSA 1UWHA 3ZFMA 5LJJA 3L9NA 3KXHA 3KA0A 1BL7A 2CGXA 2QOOA 3HRCA 4IX5A 3S95A 2YM8A 3U4UA 2GPHA 2YDIA 1BYGA 5CQWA 3TNWA 4DCAA 1I44A 5IA0A 1GZ8A 3OG7A 2QOIA 4NT4A 4D2TA 4EEVA 5BMMA 5KNJA 3TTJA 3BU6A 2PY3A 4U0IA 1OKZA 3KRRA 4B8MA 3PVGA 3LQ8A 2NRYA 4NK9A 4DDIA 4FL1A 4FR4A 4F4PA 3E7VA 4BJJA 5EYCA 2EU9A 5I9YA 1OIYA 4WBOA 4AOIA 4FVRA 4FVQA 3W0QA 3OVVA 4I3ZA 1TQMA 3UNZA 4AXEA 4YLJA 4GU6A 2ERZE 4UWCA 3Q2JA 4FV9A 3ACKA 4M13A 5FGKA 2JKKA 4FKQA 3ENHA 3ODZX 3DBCA 5K5NA 2GU8A 3QYWA 4QMPA 1REKA 3FC2A 3LHJA 4MWHA 4XOYA 5EH0A 5FBOA 3UOLA 3HAMA 3RPVA 3D83A 3EKKA 2YJSA 2VWBA 4JQEA 4NKAA 3WZDA 3W0NA 3GQLA 2RKUA 2IEWA 3MBLA 5AX9A 2F49A 2VGPA 5CYIA 5FXQA 3BLHA 5CU4A 4O7YA 2JDRA 2LAVA 3ZHPC 5BVWA 4A4LA 2C68A 3W32A 4EJ7A 2LGCA 4FX3A 2VTSA 4EQCA 3HV4A 5LQFA 4TYGA 5CSVA 3FZPA 2OIDA 4FKOA 5AWMA 2ONLA 4FEVA 3R8ZA 4RMZA 2OF2A 4I4FA 2PZRA 4JBVA 3FL5A 4V0GB 3THBA 2IN6A 4TTHB 3AMYA 1YI4A 1Q8ZA 4MD7E 2GCDA 3PXFA 1YKRA 5HU3A 5KMMA 2X0QA 4GG5A 4IX3A 3QUEA 2KULA 5DBXA 4YC3A 4GKIA 3LFQA 4CV8A 4EOKA 3DXQA 5HHWA 5LWMA 4QMMA 5E91A 5T3QA 2JGZA 3QA8A 3DNDA 3F7ZA 2OO8X 5JGDA 4OTPA 3QHWA 4JLCA 2PUIA 3FHIA 4DHZA 2BMCA 5AP2A 5FDPA 3EIDA 4E8AA 4FVPA 3BGPA 3GC0A 3QKLA 5AAEA 5B2MA 2X0PA 3BL9A 2XYNA 4U5JA 4XUFA 4YJOA 5IMXA 2WQBA 2XK8A 4FT0A 2W1IA 1URCA 2O64A 2Y0AA 4C35A 1K2PA 4M7IA 4PRJA 3DOGA 4HYHA 4FV7A 3ORKA 3NPCA 2W1EA 4KNBA 3ZONA 3MFTA 3EQGA 2WGJA 3MVHA 4I0SA 2QC6A 3EH9A 4G3EA 3KXXA 2XK6A 1S9JA 4BCIA 3UODA 1OGUA 1PMEA 2QR7A 2CSNA 3MH2A 4YP8A 5KO1A 3H30A 4FTAA 4D2PA 4NCTA 1FMKA 1ZYCA 2XARA 3DDQA 1SM2A 2W9FB 1ZMWA 3VBVA 3ULIA 4BN1A 4KIOA 4D28A 4U42A 4KSPA 4DAWA 2WEVA 3EZRA 4PMSA 2NYAA 2F7ZE 4A7CA 4ASEA 4KIPA 3LMHA 2PK9A 3BU5A 3HVCA 3QKMA 3NYOA 2GHGA 4RSSA 4XG9A 3QQJA 4YNOA 3SD0A 4AT4A 3BLAA 4PDOA 2XJ0A 3IDPA 4Q9SA 5HE0A 2PVJA 4NM3A 4C4HA 5BUEA 5K9IA 2GQRA 3ORXA 3QZGA 4GVAA 4YU2A 1J1CA 4J52A 4TYEA 4QYFA 2PUPA 3BLQA 2YIXA 3TMOA 2BAKA 5AV1A 1PXIA 3UDZA 5CALA 4EORA 3OWLA 2BKZA 1JKSA 2V62A 2O8YA 1UNGA 3R1QA 4C34A 3NIEA 2OI4X 4Y73A 3WZEA 2CMWA 1WBSA 1JBPE 4YNEA 3OT3A 2XMYA 2PZYA 5J1WA 3PE1A 3KCFA 4NW5A 5M07A 2V5QA 4IB0A 3P7BA 4PDSA 3JVRA 2XS0A 3R28A 4QP6A 2X2LA 5LCKA 2QOKA 3ZM9A 2HY81 5DN3A 4BR3A 3JXWA 2X8DA 3PDTA 4IX6A 4RX9A 3CTQA 2WD1A 4JAJA 2J5FA 1NVRA 4QQCA 3HGKA 1KOAA 2DWBA 3AC5A 3CJGA 4FGBA 5IA1A 3BX5A 3R01A 1GOLA 1PKGA 3NW5A 4ZSEA 4FL2A 4I24A 3W2OA 4PTGA 4L9IA 3OF0A 4FF8A 2IVVA 3PSCA 4C0TA 4XS2A 1W98A 5DRDA 4KB8A 5IQBA 3VW6A 2X4FA 4Y5QA 4YHTA 5JK3A 5JN2A 3BYSA 1MRUA 2XNOA 2X6EA 3ORMA 4KRDA 5AUYA 4L44A 3ZLXA 3SVVA 3EN5A 3R7IA 3O71A 5AAGA 4Q5EA 3E8NA 5CX9A 4FUXA 4LI5A 3KREA 4DT9A 1Z57A 4GK2A 3F5PA 4C3RA 3SRVA 2XNBA 4M84A 4DE4A 4M69B 4G2FA 4EOIA 1CSNA 3LXKA 3QRIA 5DEYA 4AT5A 5A4EA 3DAKA 5F9EA 3DY7A 4HCUA 4TPTA 4Y83A 3TV7A 3UOJA 3ZO3A 4DG2E 4JIAA 4IZAA 2JDOA 3CC6A 4O4FA 4DEHA 4J99A 4QEBA 1JKLA 4GIIA 2I1MA 2G2FA 4QMXA 5C8MA 3A2CA 4CQEA 3QRTA 1LPUA 1PXMA 4BY9E 4FT5A 1Q8YA 2AUHA 4RFZA 3ORIA 3HKOA 4HVSA 4WA9A 3EQCA 5L6OA 3ERKA 4YJUA 4O7RA 5CAOA 3PXZA 2HAKA 5CZHA 4E20A 4TNDA 4RIWB 4YLKA 5M51A 3FI4A 3L9PA 2R3PA 4NKSA 5EM7A 3A8WA 4ORKA 4DTBA 2JKQA 4P5QA 4IZ5A 3AMAA 4PPCA 2O0UA 1RQQA 4FT7A 3P23A 3TZMA 2UW5A 3W2SA 1QMZA 3ACJA 5KMLA 1LEZA 3VQUA 2OFVA 4AF3A 4ZSJA 1ATPE 3QTIA 3HMIA 3CKWA 3EB0A 4P5ZA 3VRYA 2OW3A 5DT0A 4JBQA 1T46A 1XBCA 1PYXA 1QPCA 5AAFA 3C9WA 4BWXA 1E1XA 3LAUA 3PSBA 5B2KA 5HLNA 3Q52A 3KXZA 1NVQA 4O4DA 4BKZA 4O7TA 3ZS5A 3O7LB 5EDPA 4Y8DA 3I7CA 2WAJA 5FP5A 3ZUTA 3NMUF 1W0XC 1TKIA 2UVZA 2WTKB 5EHOA 4W4WA 4X3FA 3VUHA 4DFNA 4HW7A 5JKGA 5C03A 1H07A 4WSYA 1Q5KA 3OW3A 3FXZA 3QBNA 1O6KA 1YXXA 2EUFB 3QCSA 3R9OA 3TV4A 3R8UA 3AGLA 3NYNA 3UVQA 5AADA 2UW6A 2VX3A 4LM5A 4RG0A 2F2CB 4O1OA 2OJ9A 4MQ1A 4QMNA 4DGMA 4ZOGA 3LM5A 3NNUA 1JPAA 3ORZA 4C59A 2J5EA 4ZTMA 2BCJA 4JRNA 4OTFA 4AACA 1Q4LA 2WTCA 5DYJA 1U5RA