4ASDA

Crystal structure of vegfr2 (juxtamembrane and kinase domains) in complex with sorafenib (bay 43-9006)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
312
structure length
305
Chain Sequence
DPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
publication title Molecular Conformations, Interactions, and Properties Associated with Drug Efficiency and Clinical Performance Among Vegfr Tk Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 305
sequence length 312
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4asdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4asdA01
3NDMA 1KWPA 4WA9A 5IQDA 3OMVA 4XG6A 2R0IA 5ICPA 4TYIA 3NCZA 3CQWA 3AOXA 3ODYX 4E7WA 2X4FA 3BE2A 2F7XE 3BHTA 1B6CB 2QOCA 2YN8A 3G6HA 3HZTA 4BFMA 3ULIA 2H9VA 3D83A 3U51A 4HZRA 3SW7A 3VN9A 2O3PA 5IQFA 4UMTA 3RK7A 3DZOA 3KK8A 2UW8A 4IWOA 4QMVA 5CT7A 4O6EA 4YZMA 4XV3A 3I1AA 5EM8A 4GK4A 4G1WA 4EOIA 1WFCA 1IAHA 3DV3A 3UYSA 2WIHA 3AGLA 5CY3A 4I22A 4W9WA 4HVHA 4IAAA 3SRVA 4LRKA 4FG9A 2JBPA 4R5YA 2OG8A 3K5UA 1FOTA 3O71A 2XNBA 4IB1A 3V5WA 5HO6A 3ERKA 4TYHB 4AGUA 1VZOA 5KE0A 4E20A 3ZU7A 4KA3A 4IZ5A 3QQJA 4IAIA 4UEUA 4ZTLA 3FY0A 4S30A 3F69A 2O2UA 5M51A 2NP8A 2QVSE 3GCUA 3FMMA 3TNHA 4CFFA 5J9ZA 2JFLA 5IUGA 3D5VA 4FK3A 4JBQA 5T68A 2WQBA 4DFYA 2CJMA 4JDJA 4TN6A 1DAYA 1W98A 3LXKA 5DBXA 5IQBA 4OTHA 2YCRA 4YZ9A 4FIEA 4HNIA 3OY3A 4TWOA 4DG0E 1OIRA 4FV1A 3D14A 4IIRA 3C4EA 3K5VA 2BDFA 4RFZA 3RZFA 4D2PA 5L6WL 3U6HA 2QU6A 2KTYA 1DS5A 3C4WA 2JDRA 3D4QA 4X3FC 2FGIA 2PPQA 3P7BA 3KRRA 2YFXA 5AAFA 3L9NA 2X9FA 3IW4A 4YZNA 3U4UA 3F5GA 3ZM4A 4FTNA 5L2TA 4FIIA 2GQGA 3NWWA 2YIRA 4QMOA 3QYZA 5D10A 1MQBA 2XYUA 5J95A 2VTQA 3B8RA 2E9OA 3QHRA 2C5VA 3ZXZA 3R6XA 3E92A 4FOCA 4DT9A 2IVTA 2JDTA 4RSSA 5AAEA 3ZHPC 4F7SA 1BL6A 2GMXA 2CSNA 3EN5A 4M12A 2B9HA 3UQGA 4FTAA 4FT7A 4FNZA 1BL7A 3QD4A 1Q61A 1FMOE 5AP5A 4YU2A 5HD4A 3LLAA 3P78A 3RMFA 4GW8A 3UNKA 3OFMA 4QMYA 4UXQA 1J3HA 5DPVA 4UXLA 3QLGA 3W8QA 4C59A 4BIEA 4RJ7A 2ZMCA 3KC3A 1ZMWA 2Z7QA 5FRIA 2RL5A 4BZOA 3PXFA 1PHKA 1Q8TA 4RIYA 4OUCA 4PP7A 2YHVA 3D15A 3BKBA 4O1OA 2ITOA 3R7GA 5EKOA 5HU3A 1O9UA 1H25A 1RDQE 3SGCA 1NY3A 3DDQA 2PVKA 2YERA 3OCSA 4P5ZA 3PXKA 1SVHA 2G1TA 2GTNA 2WQMA 3MPAA 3QU0A 2SRCA 1ZRZA 4XMOA 4Y85A 3QZFA 5CANA 3FHIA 5DI1A 2P33A 2R3NA 2HY81 3MFSA 4XG9A 5GNKA 4EH7A 5IZFA 4XH6A 2OZOA 4D4YA 3ORZA 2YISA 1WVWA 5ETFA 3TUDA 4G34A 4BTKA 4PDOA 4EOLA 3JY0A 2XM8A 4NM7A 3W16A 2NPQA 3W32A 4BHZA 1WMKA 5FQDC 5CALA 3OOMA 5HLWA 4QP2A 4LOPA 3DBQA 3JVSA 2WGJA 1M2QA 4V05A 4GIIA 4NU1A 4AT4A 4EC9A 3NVMB 2C30A 5F20A 4FEXA 4RVKA 4L01A 4BKZA 3SKCA 3VS3A 2X4ZA 4ZTSA 1Q99A 4K11A 3P79A 3BQRA 2C6LA 2O8YA 4F0GA 4CNHA 5J7BA 5J8IA 5LMAA 3MH1A 3R8LA 3QUPA 5CAVA 4EJ7A 3DKGA 3FC1X 4ZTNA 4WD5A 3OWLA 4F64A 4FSMA 2W5AA 3Q9YA 4ITHA 4JAJA 5JQ8A 4TNDA 2QOIA 3C5UA 3CPBA 3HRBA 5F9EA 4K0YA 4RIWB 3HV7A 3C13A 2R9SA 4N70A 4ALVA 3VWAA 4R3RA 1YOMA 1G8AA 1Y91A 4YJQA 5LXMA 5CWZA 4O0WA 3LFDA 4TW9A 4JBVA 5HNBA 4A4LA 2XF0A 3Q4CA 3LFSA 4HZSA 4CFUA 4O81A 4FZDB 4MD7E 3UC4A 3L9PA 3QAME 1I09A 3ACKA 4FT3A 5AP2A 4S31A 4TWCA 4UMUA 3TJDA 2UZNA 5ANDA 1PKGA 3SXRA 3G0EA 4FTQA 4IAYA 4NZWB 1XO2B 2VO6A 3MI9A 2B1PA 5EHLA 2X6DA 5E8XA 4DGMA 2VO3A 3GVUA 2J0IA 2QHMA 5EW9A 3A7FA 3RI1A 4ENXA 4IX5A 3QQLA 3KGAA 3CE3A 3Q6UA 4PPAA 3PP1A 4LMNA 4RRVA 3OF0A 1V0PA 4XOYA 3R7VA 4I24A 4AGDA 4MXAA 5KZ0A 2O5KA 3QCXA 4MXYA 3ACJA 4R3PA 4O2ZA 1WVYA 2BRHA 5TKDA 4FUXA 5EQPA 2A19B 1V0OA 4C35A 4FODA 3O50A 3BCEA 4M15A 4W9XA 4MBJA 4WSQA 4DH1A 2C6OA 4GG7A 4OT6A 5BMSA 3Q4UA 3BYSA 3UIBA 3V6RA 3F3VA 1FGKA 2X7OA 2VTSA 4PMSA 4WG3A 3D7TA 5L2IA 5DA3A 4BZDA 4DTKA 3BEGA 3MV5A 3PG1A 2HZNA 3PA4A 4ZY6A 5HG8A 3GBZA 3ENHA 4NTSA 3ZLXA 4J8NA 3BHUA 4AGCA 3E64A 2BHHA 4YC8A 3KVXA 2C1BA 4GL9A 5KCVA 3VS1A 2XYNA 3KL8A 4BCNA 3WF9A 4E1ZA 1J7IA 3R0TA 1GAGA 3PP0A 3TACA 4OTRA 4PNKA 4F9YA 3GNIB 3W55A 5IEYA 3W33A 3D5WA 1WBVA 4AOTA 2F57A 3W8LA 1TQMA 4GFMA 2BROA 5D7AA 2WQEA 1XBAA 1NVRA 2UW6A 3PVGA 3G90X 3MH0A 3PUPA 4XBRA 1BYGA 3R73A 4L68A 4YZCA 3FLQA 3NUPA 3I6WA 4TT7A 5HBJA 2NO3A 4BDJA 1CTPE 3F66A 3RGFA 4AS0A 3NW6A 3F2RA 4I5MA 3Q52A 2YWPA 1ZAOA 1XH4A 5AX3A 4FZ7A 2QLQA 4YHFA 4IANA 4BDHA 3KCFA 2WZJA 4RWJA 2BZIB 3NS9A 4PV0A 3LFQA 1UU3A 3QQUA 5CT0A 3U4WA 4E6AA 2W1ZA 5BVWA 4E4LA 5KMIA 3PXRA 3V3VA 2QOQA 3CY2A 1H1SA 4U44A 3VS6A 4BYJA 3A8WA 4EKLA 5CEOA 4KIKA 3M42A 2QOKA 2GCDA 4G3GA 4CT2A 4AG8A 5KBQA 1OB3A 5L2SA 5LCJA 2F4JA 4AUAA 3ORKA 3FZ1A 3QRTA 2YCFA 2LGCA 1QL6A 3C1XA 3C4FA 3PG3A 4B4LA 1XHAA 5D1JA 3UP7A 4DH5A 3GFWA 4M13A 4NK9A 4IC8A 3A8XA 3FZRA 4WT6A 5F1ZA 5FXQA 3DT1A 4AOIA 4GV1A 4D2RA 5B2MA 3RBWA 4CRSA 5JRQA 1XH9A 2C0IA 3DTCA 4LOQA 3GU6A 5FG8A 5LVMA 5CI7A 3UDBA 4X6QC 1QPCA 4EOOA 3DGKA 2WTWA 5GHVA 5C27A 3JR1A 4AOJA 1ZOHA 1PXOA 3HNGA 4U45A 4L8MA 5IISA 2VWBA 3ZO3A 4DFBA 2ACXA 2VRXA 5FDPA 3F3UA 2R3IA 2XKFA 4F9AA 4XG7A 3ATSA 2PSQA 5EYDA 3G0FA 2YIQA 1LR4A 3OW3A 2DUVA 2I0HA 2UZOA 3OCBA 1WBTA 4BGQA 1G5SA 4BCKA 4ZZOA 3PIXA 1H1QA 4U6RA 4GG5A 3NYXA 4BKJA 1NA7A 3PA3A 4R3CA 5GJDA 5C26A 2XH5A 3KEXA 4L44A 3RCJA 1OGUA 1WVXA 1P4FA 3VRZA 2B53A 2C3JA 4YBJA 4YURA 5FM3A 1JKSA 5IA0A 4NFNA 4XP2A 5LOHA 1WAKA 4CFWA 4H58A 3M1SA 5EW8A 2WTKB 3LFFA 3R01A 4FKOA 4H1MA 4RIXB 4BBMA 3HAMA 3DA6A 2IZTA 3AC1A 5FTGA 2UUEA 3OCTA 3QX4A 4HGLA 2QI8A 4MH7A 4TXCA 3KULA 3NUSA 5AP4A 3ZZWA 4D9UA 3SV0A 4QNAA 3FZOA 2PVFA 3VF9A 4A9RA 2RGPA 4WO5A 5KMOA 4H3QA 3GP0A 3ZUTA 3RNYA 4LL5A 4B9DA 2FVDA 5HLNA 4B6LA 1VYZA 3H30A 4FKJA 4FTOA 4QPSA 3TM0A 2F7EE 4TZRA 3AMBA 3C0GA 4NM5A 3JUHA 1Q24A 2UW5A 3KB7A 4XUFA 1JLUE 3C50A 1XR1A 3FE3A 1M14A 3ORNA 3Q9ZA 4FUYA 3RAWA 4TL0A 3A4PA 4ALWA 4YMJA 5DT0A 3MB6A 3AC5A 4QYFA 5HE1A 4MWHA 5TR6A 4HVDA 3A7IA 2HIWA 3MVMA 4IAFA 5HG7A 3QZIA 4S32A 4O7VA 3KXXA 5CU0A 4M97A 3Q2JA 3WF8A 3R9OA 1UKHA 5JGBA 3DNDA 3HV5A 3A60A 5HCZA 3WZEA 4RX5A 4O0XA 4CT1A 4N0SA 2JITA 2V5QA 4FEUA 2QURA 2I40A 3H9RA 3VF8A 4IB0A 3SLSA 4K1BA 1OKYA 5CU2A 1QCFA 4FKRA 5J1WA 3H0ZA 2AYPA 3KRLA 1JWHA 3BGPA 4I3ZA 5HCYA 3NRMA 4MBLA 4BCMA 5IG1A 4JNWA 2QHNA 3TKIA 3ELJA 4MYGA 4EEVA 2JKQA 3EQDA 2DYLA 3TV7A 4QQTA 4YHJA 3ZH8A 1BLXA 3SOCA 4G6LA 4S34A 4UY9A 1A48A 4KIPA 5HVJA 2Z7RA 4FIJA 2VZ6A 3AXWA 5JN2A 4X2FA 1YVJA 4CYIA 2ITXA 5IUHA 3S1HA 4O0RA 5IH6A 1ZWSA 4G16A 5KKRC 2AC5A 3COMA 4ZP5A 2R3PA 4F7JA 4U80A 4BC6A 4P7EA 4QTAA 5M4CA 1O6KA 3O0GA 2OF2A 4Z9LA 4KKEA 4O7ZA 2OIBA 3HMOA 4ZS0A 3SOAA 4TYEA 3RM6A 2BALA 4TTHB 5FXRA 2IG7A 3QZHA 3VVHA 5JFVA 4O7NA 1UWJA 5J5SA 4RBLA 3NNWA 4FTKA 3MVHA 3AD4A 3ZXTA 1YXXA 3BV3A 4H36A 2NNWB 5CLPA 5A4EA 4N6ZA 4CRLA 4YZBA 4ZS4A 2C3LA 4XX9A 3DLZA 5AR4A 5HBEA 4O7WA 2VU3A 2PVMA 2XK7A 3HDMA 3QQGA 4O38A 4PL4A 1BMKA 3KXNA 3UZPA 3PVUA 2GNGA 3FDNA 4O2PA 4QMPA 4FSZA 4ANMA 2NRYA 5DYJA 3NAYA 5HU9A 4BDAA 1MRVA 1TQPA 3FWQA 2JKKA 5J87A 2PVJA 5FTOA 3FEGA 4MF1A 4PPCA 3ZO1A 5CVHA 2BIYA 3OT3A 4QTEA 2C1AA 2VNWA 3MTLA 3P5KA 1M7NA 2YIWA 4MD9E 2VX1A 2VTAA 2WMRA 3E8DA 4RA5A 3L8SA 5GIOE 1KSWA 3OXZA 3G9NA 2HELA 3CTQA 5C03A 3F6XA 4G2FA 4O0VA 4PMTA 3PY3A 2GS6A 1JQHA 3LW0A 2JDSA 4QQCA 2ZDTA 4EONA 1PXNA 4ANBA 5AV4A 1O6YA 3KMWA 1PMUA 1PXLA 2PVNA 3KU2A 1QMZA 3Q04A 3OVVA 3QTZA 4R1VA 2C6KA 4DG2E 5DE2A 5KUPA 3R9RA 4BZNA 3D2KA 4WKQA 3VQHA 5EDPA 4BCIA 5JSMA 5A46A 2EB2A 2YAKA 3GU8A 3HL7A 1QPJA 4JR7A 4RJ5A 2R7BA 4WBBB 4I94A 3ZO4A 1ZOGA 2J0KA 3LXNA 4J53A 4ASZA 5AEPA 5IDNA 3VUKA 3VULA 3UOLA 3BU5A 3R02A 2QONA 3DY7A 2G2IA 3HRCA 3FHRA 3RZBA 3UGCA 3IDBA 2XBAA 3FI3A 4ITIA 3AT3A 4YTFA 2WD1A 3BGQA 3DCVA 4NKSA 4MQ1A 5T6KA 1YDRE 3PXYA 4EOKA 3KN5A 1H4LA 4BDBA 1FVVA 3FJQE 4NWMA 2RFEA 1FVTA 4EZ5A 4F4PA 3EH9A 4C3PA 2FA2A 2X39A 3TUBA 1KV1A 2QR7A 4PRJA 3IOKA 3TJCA 4TKSA 2WOUA 4J99A 2WO6A 4PDPA 3TCPA 4DEDA 5DFPA 2ZV8A 2XIZA 5HORA 2BTSA 4I5CA 4NSTA 3FI2A 3TZ7A 5BMMA 1Q8WA 3CLYA 1UKIA 2XNEA 1AQ1A 4PWNA 4PY1A 3KMMA 1JKLA 2HAKA 4CEGA 5GINE 2FUMA 3WZKA 5CSXA 4EH6A 2OIQA 3VUIA 3MYGA 3NIEA 5DHJA 4MKCA 1W82A 1EH4A 5IQGA 3HLLA 4X2JA 2E9PA 3I79A 4J97A 4F9CA 4QYHA 4ITJA 4ACHA 4BICA 5IQIA 5CAUA 2W0JA 4XLIA 4AZSA 2J7TA 5KHWA 5AUTA 1H26A 4FOBA 4FV7A 3RK9A 3DBEA 3RAIA 3JY9A 3MBLA 3V8TA 4OTDA 1TKIA 4RGJA 4FL3A 4D9TA 3DK7A 3IW6A 4D2VA 3G2FA 4KS8A 4QP3A 4C3RA 4AZVA 3FKLA 4FL1A 4D1ZA 4LV5A 3OXTA 2X2LA 2XMYA 2YJSA 5AR2A 2WMWA 4CQEA 1P14A 4DGNA 3A7GA 3BBWA 5IEVA 5EI8A 3KF7A 4TWPA 2B9JA 3EZVA 2YLEA 3DKCA 4FV8A 4LGGA 5ANKA 4GT4A 5F95A 2XJ1A 4I4EA 3COKA 1H1WA 3F5UA 3PXQA 4GYIA 2JIIA 5FP6A 4K77A 1G3NA 4CFNA 1R39A 1ZXEA 4DFNA 5IF1A 3ORTA 4FNXA 4U81A 3R00A 3HMNA 5BVFA 4PL5A 5FWKK 4FC0A 3THBA 1ND4A 3D7TB 3U87A 4D58A 1OITA 4YJPA 2Y4IC 3F7WA 5EHYA 3NYNA 2QOLA 5DLSA 5HVKA 1P2AA 4O0YA 2RSVA 1M17A 3BYUA 5EYMA 4MTAA 3ZFMA 1KUTA 4Y73A 5HEZA 4EKKA 3EMGA 5BNJA 1OVEA 2FSOX 1WBNA 5IUIA 2ZB0A 4X6RA 4CTCA 3BBTB 2PUNA 1XKKA 2WMUA 2VWWA 4UWYA 3EN9A 3CJFA 4L45A 3DXPA 5HE2A 2R3MA 3FQSA 2C6TA 5DN3A 4KAOA 2EUFB 2J4ZA 2XNOA 2V0DA 3EL7A 4RLLA 1Q5KA 2WTCA 4DC2A 2RKUA 4O21A 4U3ZA 4DFLA 5LJJA 3TDVA 2OXDA 4OT5A 3Q53A 2ITZA 2O64A 3PFQA 3OTUA 4A4XA 1GY3A 2O65A 4U9AA 4FSYA 2WTJA 3EQPA 2OXYA 3FLSA 4FTJA 4IZAA 4O86A 5HHWA 2EXCX 4CLIA 3QRKA 4D4SA 1ZMVA 3KQ7A 3WBLA 1M7QA 2XEYA 2GNFA 3ZLSA 1VJYA 4N6YA 3PY0A 4MQ2A 5DOSA 2W5HA 5BUIA 2PVLA 3NYOA 4G6NA 3IO7A 4YJRA 2LAVA 4AGWA 3BU6A 4BBEA 2OSCA 4MXXA 2B9FA 3DK6A 2C6IA 2AC3A 1XBCA 4ACCA 2XK4A 5CU6A 2PZRA 2HZ4A 3FMNA 3BLQA 3WILA 1NVSA 4FF8A 1OBDA 1IRKA 2YIXA 3AD6A 4KIKB 3DBFA 3VBWA 1U46A 1U54B 4RVLA 2HK5A 4X3FB 4KRCA 2ZOQA 4XV2A 4YGAA 4KIQA 1PYEA 3REPA 4KBAA 3KVWA 1PMEA 5I9VA 3EJ1A 2JLDA 3MPMA 4KABA 3DOGA 2QKWB 4GMYA 2GPHA 4DFUA 5BPYA 2ZAZA 4QO9A 5DGZA 3B8QA 4FKWA 1AGWA 2BKKA 4FEQA 4FTUA 2CNUA 4BKYA 4AACA 2C6DA 2F9GA 3R1SA 4Y5QA 4LV8A 4QTDA 3VQUA 3OTVA 1OIQA 3O7LB 1YDSE 2PTKA 5CEKA 3QYWA 5AR7A 3I7CA 4O7YA 2E9UA 3D5UA 3PY1A 3C4CA 4YR8A 1YQJA 2UV2A 3ALOA 3N9XA 4AAAA 2ITNA 1OL7A 2IVSA 4EHGA 5AUVA 4JX3A 3EQGA 4O83A 1L3RE 3MFUA 3JS2A 3MH3A 4BWXA 5L6OA 1UWHA 5AMNA 5I9UA 5HG9A 1PXIA 1OL1A 2FSTX 1SNUA 3EN6A 4NW5A 5I9YA 3LXLA 4FV3A 3E3BX 5JKGA 4YLLA 2W17A 3LE6A 3GC9A 4YTHA 4DH7A 1GJOA 3KXZA 4PTGA 5GIPE 4FG7A 4EC8A 5I9WA 4DEEA 3AC3A 3EWHA 3H0YA 1YWNA 3RPYA 3FLYA 3O2MA 3S2PA 2WMXA 4USFA 4PMPA 4DT8A 3NMUF 4ZSLA 3WI6A 2XEZA 2EWAA 2WMQA 3DJ6A 3EYHA 4ZLZA 5L2QA 2CGUA 2P55A 3KULB 1URWA 4C02A 4CFMA 4JLCA 2XRWA 2Z7LA 4DEIA 4UB7A 1VEBA 4O22A 1JKKA 2BHEA 3R8VA 4OBQA 3C4ZA 4A9TA 2ETRA 4ZXTA 4Z16A 2ZM3A 2WIPA 2DS1A 3HP5A 3A7HA 5A9UA 3GQIA 4M0YA 1Q97A 2C5OA 5FEQA 3SG8A 3OZ6A 4PPBA 5CXHA 5HBHA 3A7JA 4DYMA 4G9RA 2YZLA 3NUAA 5AIKA 2HCKA 3E8EA 3R7IA 1RW8A 3GC8A 4OGRA 4YNOA 1MQ4A 4JG7A 3ANRA 5BVDA 4USEA 4B8LA 2R4BA 2VN9A 4ZSJA 4QMQA 1PXMA 5M57A 1PJKA 2ZMDA 4OBPA 4RQKA 3II5A 3F2NA 2VNYA 3UVRA 3BE9A 4XV1A 3F9NA 3TV6A 3FZTA 3FSFA 2V22A 4DA5A 1Q8YA 1Q8ZA 4I0SA 5BVNA 1OL2A 1PW2A 3QD3A 3VUHA 4FKTA 4UV0A 5A4TA 4F70A 3E87A 3GC7A 3IGOA 3JVRA 4RZWA 5EM6A 3LMHA 4FTCA 3HMMA 1YXTA 3HV3A 4BGGA 5M4UA 3U54A 4MXZA 3MJ2A 3U8WA 4YTCA 3FMDA 2ZV7A 3L8XA 2VTNA 4R7IA 3VIDA 5K4JA 2VTTA 4L43A 4OBOA 5FEEA 4IE9A 2OI4X 4RPVA 3W2PA 5AR5A 4KS7A 4ENYA 4AA0A 4EL9A 4QPMA 1GIIA 4X21A 1CKPA 1PYXA 3GU5A 4IFCA 4JS8A 3ZEPA 4A9UA 2XNGA 2ZM4A 5HOAA 4L6QA 1F3MC 4ARKA 3RINA 5B2LA 5AUUA 5J7HA 3LQ5A 4F0IA 5AWMA 4CLJA 4U7ZA 5IKWA 2H96A 4EORA 3DJ5A 4MK0A 1KE6A 4DH8A 3BPRA 1RQQA 1OIUA 4FKLA 4ANLA 5BVEA 4HCVA 1E9HA 4UZHA 4HYSA 3AC4A 3E5AA 2UW4A 2ITVA 1UA2A 4JQ8A 3SC1A 4R7HA 3SW4A 3R1YA 2OF4A 5LMBA 2PE2A 4OR5A 5FD2A 3ZSIA 4RJ4A 3LAUA 3CCNA 2OJ9A 3K3IA 5DT4A 4AQCA 4E6DA 4QYEA 1Z5MA 2C0OA 4YJNA 4EWQA 4OTPA 4AT5A 4K6ZA 5IEXA 1UV5A 4YO6A 2ZVAA 3PVBA 5BYZA 2W1CA 4Y5HA 3GU7A 3EN7A 2BZJA 5K0KA 4FTRA 3VAPA 4C33A 4UALA 3QD0A 2ONLC 4QYGA 4RX8A 1CKJA 1YI6A 3D5XA 4USDA 2GDOA 5CZIA 5IQEA 5CEMA 3Q4ZA 4LQMA 4FI1A 3QKLA 4HYUA 2GSFA 3GFEA 5IQCA 4F7LA 3A62A 4FV6A 4G5PA 4X2KA 5D11A 1W0XC 4WOVA 5DEYA 2OWBA 4LUEA 3HYHA 3LM0A 3A99A 1KE9A 3EQHA 5TE0A 5M08A 4YZDA 3V5QA 5JH6A 3F61A 3MSSA 3NNXA 4FNWA 3F88A 4KSPA 3PWYA 4GU6A 4R78A 1JSUA 2PMOX 4OTFA 3T3VA 3FKNA 1YHVA 3R2YA 4YJSA 5D41A 2XRUA 3NNVA 4Y83A 1Q8UA 4QP6A 3TNPC 3Q3BA 1APME 3ZFYA 3DAKA 2QOFA 5AUYA 3UIMA 2X7GA 3Q6WA 4JL9A 4C61A 5BVOA 4NL0A 5FP5A 1W84A 4FTMA 5J5TA 1REJA 5JFWA 1ZYCA 3RVGA 2GS2A 3Q32A 5BX0A 5DMZA 5M53A 2P4IA 4BDGA 4TWNA 3UOHA 3ORMA 3PE1A 2XCHA 2XIRA 3HGKA 1HCLA 5E9EA 3SQQA 4HYIA 5DVRA 3MIAA 4BI2A 3KY2A 3MA6A 2PU8A 4JBOA 5HIEA 1GZ8A 1KE5A 5E8WA 3GOKA 5L8JA 3GUBA 3TNIA 3QRIA 5CQWA 4MNEA 4XBUA 3QFVA 5AP3A 5I3OA 3BX5A 4ORKA 3FMEA 1H0WA 2JDOA 5EM7A 4C8BA 3PRFA 1OZ1A 1H1PA 4JRVA 3PZHA 4UYNA 4QT1A 4FKQA 2I0VA 4K2RA 1OPLA 2XJ0A 3CBLA 1OKZA 3PSCA 3G5DA 5JEBA 5CENA 3OUKA 5JMSA 1VYWA 3TIYA 2VTIA 3TT0A 3FY2A 5CEQA 3JYAA 4QYYA 3H9FA 3RNIA 4F0FA 4BCFA 4QQJA 4G17A 4EK8A 2QC6A 2W1GA 4EHEA 1FMKA 3AC2A 3CKWA 3PWDA 1H01A 3QALE 3LCDA 3VS5A 2W1EA 3HP2A 3F82A 4NFMA 5CQUA 3TEIA 4AW2A 1G8SA 3ODZX 4Z7GA 2OLCA 4IAZA 5AADA 4C4EA 4EYJA 2R64A 3P1AA 4JQEA 4FSWA 4ZOGA 4IVDA 3PVWA 3VBXA 5A4QA 3O8PA 3UZTA 2CKQA 1CDKA 2GNIA 2XNNA 1IR3A 1YWRA 3DJ7A 3ETAA 4L3JA 5AJQA 2VWZA 3P08A 4QMUA 4O96A 3UG1A 2B0QA 4DTBA 4QP9A 4WNKA 2QOBA 3D2IA 4PL3A 1YOJA 3VS2A 4CV9A 1KV2A 3PPKA 4MAOA 5AX9A 1KE7A 1SVGA 2GTMA 2P2IA 2YZAA 3V51A 4F6UA 5BQ0A 4DGGA 2UW3A 4OTWA 1U54A 4X3FA 5CTPA 3SVVA 4LL0A 1GNGA 4DE4A 2YM7A 3D9VA 1M2RA 4I21A 4RA4A 3DB6A 3LKMA 3HUCA 4PX6A 3IDCA 1M52A 2VX0A 2PMIA 3FKOA 4EOQA 5L8LA 2X1NA 5C4KA 4ANNA 4U79A 3UMXA 2IN6A 2RFNA 4OTIA 5D12A 4ACGA 4NM3A 4EHVA 3BEAA 4EQMA 4O7RA 1E1VA 2BZHB 3H4JA 3PTGA 4D28A 4NH1A 4RX9A 3BWJA 3BYOA 4E5WA 1DI8A 3DQXA 2DWBA 2VTJA 3VUGA 4D4RA 4M14A 4GK3A 4DGOA 1IA9A 2Z60A 3VHEA 3VJOA 3CXWA 4ASEA 4BHNA 4ZJIA 3MW1A 5CSVA 3FI8A 3FL4A 4E93A 4JRNA 1JSTA 2C68A 4P2KA 4FZFB 5JRSA 3COHA 5E8YA 3IG7A 4ZEGA 1UNHA 3R30A 4IDTA 4FMQA 3BQCA 3TXOA 2XVDA 3FYJX 4RG0A 3T3UA 4ACDA 1ERKA 4YJVA 2VTLA 2XUUA 4EYMA 3QL8A 5KHXA 3FAAA 3IS5A 4FGRA 4MX9A 1YHWA 4FKVA 4KUJA 1YI4A 4QMNA 1PMNA 1ZYSA 3P9JA 4L67A 3ZC5A 3ZDUA 4D2WA 5GJFA 5J9LA 4LRMA 2OO8X 3WF5A 4F9WA 2VV9A 4BRXA 2W1FA 4ERKA 4YHTA 4FA2A 5KKRB 5LMKC 2QOOA 1H08A 3DBCA 5L3AA 3S95A 5A4CA 4IHPA 2BAKA 3CTHA 4PP9A 3LFEA 5DR9A 2HWPA 5GJGA 4ZK5A 5HD7A 2CPKE 4YLJA 4IVCA 3ZRKA 4XNEA 3NSZA 3QTIA 2R3OA 4C57A 4O7SA 2VX3A 4GS6A 5DH3A 4O1PA 3R22A 4IDVA 4MF0A 2HXLA 5E91A 3VW6A 4BTMA 4JDHA 4X3JA 4YO4A 3CQUA 2VTMA 4GJ3A 5FGKA 2P0CA 3S4QA 4BDDA 4E8AA 5LVPA 5E1EA 5FLFA 1OMWA 2BKZA 3MESA 4QTBA 3RWQA 4DF3A 5DEWA 5FEDA 5DR6A 1LP4A 1MUOA 1OL6A 2YM8A 3NEWA 2C5NA 4FIGA 3V8WA 5TT7A 4ZLOA 2XB7A 5ACBC 2JKMA 5GZ8A 4ZSEA 3CP9A 3UZRA 4I6QA 2IW8A 2ONLA 2PWLA 3CGOA 4NJ3A 4A9SA 3QBNA 4C0TA 3O96A 3ZRLA 4FVPA 5I9XA 1WBSA 3HUBA 1ZY4A 1ZYDA 4ANOA 3NNUA 4EOMA 3WF7A 4QNYA 4HPTE 2OBJA 2PMLX 1JKTA 4M68A 2W1DA 4FKPA 2CGWA 3EFLA 5KMJA 1URCA 2C4GA 1S9IA 5CSPA 3RPVA 4UX9A 3UJGA 3OG7A 5DG5A 3RCDA 3PZEA 3RK5A 5HO7A 3KN6A 5IU2A 3LMGA 4NCTC 1UNLA 3NZ0A 4D2TA 4GH2A 3R7YA 2CCHA 2JD5A 5H9BA 2ZDUA 1P5EA 3O8TA 4RWIA 4BB4A 1STCE 1PXPA 2G2FA 3ENMA 3AT4A 3MY5A 3O17A 3IONA 3V6SA 3CIKA 3CS9A 3FMHA 3GENA 4QMTA 3UE4A 4C4HA 4LFIA 4K9YA 4E5AX 5ETIA 4EOJA 1ZOEA 3UC3A 4F9BA 5HE0A 2CKPA 3TTIA 3RP9A 3FV8A 1F0QA 1OBGA 2C3KA 3F5PA 4V0GA 4YJUA 4F09A 3DPKA 3FXWA 2VTRA 4F6WA 1HOWA 1U5RA 2OK1A 3HKOA 4KIOA 5AP0A 1NW1A 4LRJA 2QR8A 1YI3A 2ZV9A 2QODA 2OW3A 4FKGA 4GSBA 1OKWA 2WMTA 1FVRA 2UZWE 3FLZA 4MNFA 2BVAA 2A4LA 2GHGA 4MXOA 4L9IA 4XG4A 2ITUA 4UMPA 3ATTA 2OICA 3O8UA 4L52A 4CG8A 3Q9XA 3QTXA 2C5XA 1LUFA 3EOCA 3ZTXA 5I3RA 3ZCLA 2P2HA 2HYYA 4QQ5A 3AC8A 1GZOA 1OKVA 2IO6A 2NRUA 2WTKC 3OWPA 2OJJA 2W4KA 4FV0A 1LEWA 4FK6A 4JIKA 5LVNA 2GHMA 3V04A 2UZLA 3H3CA 3OWKA 4GU9A 4E4NA 1XBBA 3PRIA 3MFTA 3ZO2A 5IA2A 1CM8A 3KRWA 4C62A 2EU9A 2IZSA 3Q4TA 3OUNB 1T46A 4BBFA 3ORIA 3P0MA 4C58A 5EM5A 4LGDA 4DEAA 4DEHA 4TY1A 1H1RA 2BDJA 3VBVA 1PF8A 2BZKB 4DCAA 4FEWA 2BUJA 3TV4A 4IW0A 1A06A 3SA0A 3UBDA 1MP8A 3D7ZA 4N57A 5I0BA 4Q2AA 3E7OA 3V5PA 5A6NA 4O7LA 5BYYA 3LIJA 3BRBA 3OOGA 2EB3A 5HKMA 3QD2B 4L7FA 2Y0AA 4TYGA 3R7EA 1W8CA 3C9WA 3MB7A 2B52A 2WMBA 4AU8A 1XQZA 3WOWA 4BF2A 4EK5A 3UOJA 2XIKA 2XK3A 5HO8A 3O7LD 3WF6A 2R3QA 1GOLA 4QPAA 5HX8A 3LMIA 2YCSA 1XJDA 3OP5A 2ZYBA 3CD8A 3LJ0A 5CSHA 3BWFA 5EOLA 1PRYA 2WMVA 5ANEA 4DLJA 4YC6A 2OU7A 4O0UA 3IECA 1GIHA 2R3FA 2V55A 3FPQA 4MWIA 3SDJA 4Y72A 3NYVA 4OLIA 4IJ9A 4E4MA 2PZYA 3NIZA 3ZM9A 5AFVA 4DHFA 2WU6A 5E8UA 2XJ2A 2YIYA 2BRMA 3T8OA 3ZBFA 4Z3VA 5BYLA 4QP1A 4PDYA 1BX6A 2Y4IB 3KF4A 4JDIA 1Y6AA 1YOLA 2J5FA 4IX4A 3WYYA 3MIYA 3PJCA 4O82A 4E26A 4D5HA 5M4FA 4AE6A 3RPSA 4EUTA 2UW7A 3AGMA 3QTUA 3PLSA 1KE8A 2R0UA 4APPA 4GVAA 4O6LA 3R1NA 3UNJA 3EFKA 5AUZA 2YDJA 1HCKA 4J98A 2PK9A 1DI9A 4ACMA 5M06A 1R78A 2JAVA 2RG5A 3QQFA 4IQ6A 5CS6A 5HG5A 1L8TA 3ZUUA 1Y8GA 1I44A 2CN5A 4C37A 1CSNA 4KB8A 2CGVA 2EXMA 3I7BA 2CMWA 2CNQA 3I4BA 3UG2A 4HW7A 4V01A 4BTFA 4KBCA 2OIDA 1MRYA 3ULZA 4RIYB 4L00A 3LCTA 4E6QA 2WEVA 2JEDA 4U3YA 4ASDA 3GGFA 5LMKA 4CZYB 4BCJA 1FINA 3DBDA 4D1XA 2CLQA 4FT0A 5JK3A 4GCJA 5EH0A 4D55A 3ZRMA 2BILB 4FE2A 1LPUA 1LEZA 2BCJA 3EQCA 5JFXA 4QP4A 4S33A 4YP8A 4WNOA 3OW4A 1ZARA 4BDIA 3PPJA 4XLVA 2IWIA 4HYHA 4FIHA 3KCKA 4UWCA 1E1XA 5E8VA 1UU8A 2XK6A 3F5XA 4GFOA 4CD0A 4KKHA 4EH5A 4XEYA 2XKCA 1QPEA 1XH8A 4FSQA 3QCQA 4Q5EA 5HTBA 4IXPA 3PJ8A 2JIVA 3DB8A 4WUAA 5LVOA 4C4IA 4ZSAA 1YW2A 4X2GA 2Y4PA 2F2CB 3UPXA 3I81A 3AMYA 5B7VA 3QTQA 5K4IA 2J0JA 3L9LA 4QP7A 5HTCA 4P4CA 4FSRA 3VUMA 3TKUA 1BI8A 4Q9SA 3VBYA 4XG3A 4BDCA 1U59A 2JC6A 5CEIA 1SM2A 4MNEB 2V62A 3QQHA 2BFXA 4J96A 2WB8A 3W18A 5ETAA 4WG5A 2B55A 4FYOA 2HXQA 3C7QA 3NCGA 3I5NA 2XZSA 3BYMA 3ZUVA 2Q83A 4KSQA 2WTIA 3IQ7A 5T3QA 4EH4A 4ZTQA 5A4LA 5IH5A 4FKSA 1RJBA 2W1IA 3T9IA 2PUIA 3FUPA 4XRJA 4TYJA 2CHLA 4RVTA 3W10A 3QCSA 4GYGA 4IX3A 5AM7A 5ANOA 3ORLA 1PXJA 2C69A 4RQVA 4YC3A 3SD0A 3FZSA 2J51A 2HW6A 3FQHA 3Q5IA 4QMXA 5ACKA 3B2TA 3LCKA 4WHZA 2C0TA 5HGIA 5AV0A 3DAJA 4BN1A 1OECA 2QG5A 3QLFA 4GKIA 2PYWA 2YABA 3DTWA 5DT3A 5M4IA 4AZEA 2HZ0A 3KXMA 4I6HA 3UO5A 1NXKA 4QMZA 4IB3A 3CEKA 4W4YA 5CSWA 5DRDA 5EK7A 5EYCA 3AQVA 5HVYA 4I5PA 3R71A 3UYTA 3MY0A 3FL5A 4BI1A 4GKHA 5K9IA 3K54A 3KREA 1X8BA 3BI6A 4O91A 4LOOA 3HMIA 5FM2A 4I92A 3ZONA 2B4SB 2XS0A 1IG1A 4GK2A 5KMKA 3CTJA 1P4OA 3LXPA 4FTLA 5IA3A 4P90A 2YDKA 4XV9A 5L6PA 3AG9A 2JGZA 4FKUA 5HTIA 2Z2WA 3GI3A 2I0YA 5EHOA 4OTGA 5E92A 3LM5A 4OAVB 5EG3A 2BAQA 3R7OA 3UO4A 4FV9A 3NLBA 4R5SA 1IAJA 2PVHA 1H00A 3TZ9A 3MWUA 1ZY5A 2ZM1A 3CKXA 3EFJA 3FMLA 4QRCA 3BLHA 5CX9A 3ROCA 4FX3A 1NT2A 3I5ZA 3HX4A 4PMMA 4HOKA 5JQ5A 2PUUA 5C8NA 4DTAA 4HPUE 3ZBXA 3TNWA 4IACA 4AA4A 4RFMA 5ITAA 1WCCA 2V7OA 5E7RA 3O23A 1JSVA 3E63A 3OEZA 4W8DA 4DGLC 3TDWA 4HVIA 4Q9ZA 2VWIA 3PIZA 3C0IA 4V04A 3TWJA 4JQ7A 4IB5A 3GC0A 2XA4A 3POOA 5CNNA 4AN9A 5KMNA 5K5XA 3KRXA 4WNPA 4H05A 4F6SA 1YWVA 4FGBA 3BV2A 2R3LA 4FZAB 4RWLA 3MTFA 1Y8YA 2ZV2A 5HNGA 3VHKA 4FSNA 2CKEA 4GVJA 3EHAA 2O63A 4H3PA 3R83A 5L8KA 3LCSA 1UNGA 2GNJA 1H24A 2I1MA 2R3RA 2R2PA 2X8DA 3IDPA 5EI2A 4LG4A 2Z02A 4B8MA 4IFGA 2XNPA 3OS3A 3WZDA 2OZAA 2W99B 4OTQA 1J1BA 3TI1A 3G9LX 5B2KA 2ETMA 2ITTA 1K9AA 1XH6A 5AM6A 3ZS5A 2PZ5A 1XH7A 3MJ1A 4E4XA 1M2PA 4IC7A 4XOZA 4I23A 4RC4A 2WELA 2OFUA 3IGGA 4K18A 5A6OA 4L42A 5TF9A 1BI7A 4NTTA 1SZMA 3HEGA 3QGYA 5IA5A 4ID7A 3W2CA 2HOGA 5IQAA 2YAAA 5EW3A 3R2BA 4U5JA 4CFXA 4CKIA 3FYKX 2BDWA 4I6FA 4WRSA 5CAOA 5C4LA 2QLUA 2RFSA 3VS7A 3PLAE 4CV8A 4M69B 5CVFA 3RM7A 3ZYAA 1B38A 3FXZA 3DXNA 4FV2A 2GQRA 4WUNA 3DK3A 3R63A 2BMCA 3PJ2A 3NUYA 3TUCA 5AUXA 3TNQB 4EZ3A 5HIBA 4YTIA 2C6MA 4G3DA 4CKJA 4C2VA 2ITYA 2CLXA 2UZVA 5C01A 5BUJA 5H8EA 4J95A 3V5LA 4LI5A 5JFSA 1YXUA 4E73A 3LHJA 2JDVA 5EFQA 3MH2A 2GNHA 3BHVA 3GT8A 1K2PA 2UZTA 4NM0A 3DS6A 2PVRA 1JBPE 2QQ7A 2YLFA 4RC3A 4XG8A 3W2RA 2H6DA 5I4NA 4FL2A 2WKMA 3VNTA 2E2BA 4QD6A 2XKEA 4F99A 2WU7A 5CI6A 2C5YA 3F3WA 3E93A 2E9NA 4KINA 3UIUA 5AIRA 3DDPA 2WTVA 3JXWA 3MN3A 4AFJA 1IEPA 4N4SA 3R9HA 4OAUC 2WTDA 3LQ3A 3DQWA 4YSMA 3H10A 4LGHA 4QP8A 4MXCA 4NKAA 3N4VA 3ZLWA 5FDXA 3SAYA 5CASA 5KMMA 1OI9A 1ZZ2A 4EH8A 4IH8A 2CNVA 3TN8A 4ONAA 2XK8A 4LMUA 2FSLX 3C4XA 4I93A 4X2NA 1JOWB 3ROYA 5DIAA 3UOKA 3QA8A 4M67A 3FI4A 4IWPA 4L3PA 4U43A 3RJCA 4KKGA 3BHYA 2F49A 2W9FB 5EYKA 1Y57A 3D94A 3WE4A 3OEFX 2JBOA 3R21A 4I6BA 3TTJA 2X6EA 5IDPA 4IMYA 5E4HA 2FSMX 2YM6A 5L4QA 4TRLA 4J52A 5DNRA 3HAVA 4RJ8A 4V0GB 4EBVA 3ID6C 3ZOSA 3KK9A 3VUDA 2AUHA 4ASXA 4I1ZA 5CYIA 2QG7A 3FZPA 4U97A 2YEXA 4ZTMA 2QOHA 3QQKA 2QO9A 2W1HA 4CMTA 4YPSA 1Q3DA 2VWVA 5LCKA 4Z7HA 3PSBA 5HICA 2XKDA 4IVAA 3W2QA 4NYEA 4ZJJA 3GU4A 3RAHA 3OBGA 3ZMMA 1ZLTA 4R6VA 3HDNA 3EQBA 3I6UA 2F2UA 2OGVA 3KMUA 3ZSHA 4XYFA 4D4VA 5I5ZA 3FXXA 5M44A 4B7TA 2WOTA 4JDKA 3VW8A 1PMVA 4UYAA 5H8BA 4HVSA 1R1WA 1UU7A 3FMKA 4F7NA 4EK6A 4IWQA 4I0TA 3OXIA 5J79A 2R3GA 4G9CA 1U4DA 4RJ6A 5FBOA 1XH5A 2OJFE 3QC9A 3CSVA 4XP0A 2OH4A 1WBPA 4JXFA 5LWMA 4FSTA 5M56A 2F7ZE 1OIYA 2PHKA 2RF9A 3LFNA 5D7VA 3UP2A 3WIGA 5LARA 3EQRA 4NW6A 5AP6A 4NJDA 1PKDA 5EI6A 1UU9A 2GHLA 3OWJA 3KA0A 4AN3A 4IM3A 4D0XA 2WQOA 3DU8A 3IK3A 1UVRA 4XJ0A 4C36A 4C4FA 3KKVA 4C7TA 3QTRA 3I60A 3MY1A 4WNMA 4RC2A 1OUKA 5G1XA 4CSVA 4DFZE 3PIYA 4EOSA 4Y8DA 5ANGA 2XM9A 2W9ZB 2VTPA 4I20A 3QRJA 4DCEA 1H8FA 1PXKA 4ZAUA 2KULA 2YJRA 5CNOA 5CVGA 4ALUA 3UIXA 2X81A 2PE0A 4RLKA 1TVOA 1CKIA 3NVKI 3AT2A 4IVBA 3V8SA 4S2ZA 5IQHA 3QRUA 3T9TA 2QD9A 3COIA 3ITZA 3NGAA 4FBXA 2BAJA 3R9NA 5CZHA 3QWJA 3RHXA 3RHKA 2IW6A 3CQEA 4BCQA 4E5BA 4F65A 3LFCA 4M84A 2CCIA 4R77A 2WFYA 3LZBA 4YLKA 4JT3A 5JZNA 5EKNA 4LUDA 5KX8A 3L1SA 4HGSA 4UWBA 5ANJA 3DLSA 4ZZMA 5FUTA 1BKXA 2BTRA 1ZZLA 4ZZNA 3LJ2A 4YJTA 1WZYA 5JGAA 1J1CA 3OBJA 4CQGA 2QKRA 1J91A 5J1VA 4DBXA 4QMSA 4L53A 3R8ZA 4ZLYA 3R8UA 3QTWA 2UVZA 3GCQA 1W7HA 1J7UA 4AZFA 2YM3A 2W4JA 1O6LA 3LVPA 4NUSA 4HCTA 3UVQA 2Y8OA 2WMAA 1CMKE 1ZYLA 3FLNC 4PTEA 4AZTA 3ZLYA 4RFYA 1YHSA 2VWXA 1U5QA 3AD5A 5JT2A 2IPXA 5CF4A 3DXQA 2HW7A 3VS4A 2W06A 3ZEWA 4FEVA 4X7QA 5AA8A 2W4OA 2G01A 4U42A 5HNIX 3B2WA 3CR0A 3G15A 1ZMUA 3DKFA 4J1RA 1JNKA 4MBIA 4I0RA 2Q0BA 5IMEA 5M07A 5A54A 3EZRA 4JVGA 1S9JA 3OC1A 2Z8CA 4G31A 4WRGA 2UZDA 4QOXA 3NUNA 5IPJA 2XIYA 5IMXA 2PMNX 4KWPA 4G3EA 3OROA 2BFYA 2J50A 5A14A 4AWIA 3NW5A 3ET7A 4K33A 3IOPA 3E88A 4BIBA 2UW9A 2C6EA 2UZEA 3LLTA 3HV4A 3RTPA 3MA3A 4EH3A 3GCPA 4Y95A 5C1QB 2E9VA 2JAMA 3S3IA 2C47A 4IAKA 3RPOA 4JX7A 4IEBA 4EQUA 4YJOA 3Q96A 4A4OA 5L2WA 4IM2A 5AA9A 4GUEA 4D1SA 4NT4A 3O51A 3BLRA 3CD3A 4FICA 4FTTA 2VAGA 3VO3A 2Y7JA 1B39A 3LQ8A 2JKOA 2GU8A 5DWRA 1R0EA 5HIDA 4ZIMA 4UN0C 4PUZA 4ERWA 4F1OA 2VO7A 2J0LA 5H3QA 1AD5A 5HQ0A 2CKOA 2ERKA 2X9EA 5A3XA 5K5NA 2VWYA 4EUUA 3SXFA 5AP1A 3SXSA 5CF5A 4JOAA 2PZIA 4B99A 4CZTA 2UVXA 3F3TA 4D0WA 5FTQA 4AE9A 3WE8A 4GT5A 5C8KA 5I9ZA 1FGIA 4EK3A 5GZAA 2YA9A 4AFEA 4B0GA 2A1AB 4R1YA 4CCBA 2A0CX 4QMWA 4BYIA 5CXZA 1R3CA 4FIFA 3L8VA 1F5QA 2Y9QA 4EBWA 3M2WA 3DZQA 3U9CA 4BWKA 4EK4A 2EXEA 2I7QA 5JGDA 3IPHA 3QGWA 5AAGA 3BU3A 3P23A 3TZ8A 3R8PA 3UVPA 2H34A 3PXZA 3PSDA 4LYNA 4FYNA 4R8QA 3WZJA 2HY0A 2J90A 1JAMA 4NIFB 3MPTA 4MCVA 5F94A 4FTIA 5E90A 2OXXA 3A61A 3NUXA 4IWDA 4DFXE 3N4TA 3DFAA 4R7BA 4GJ2A 3ZDIA 2HWOA 2YM5A 3EIDA 3ORPA 3PJ1A 4YPDA 4HCUA 4M69A 4RMZA 2VTOA 4CKRA 4GIHA 3FBVA 3MVLA 4AA5A 3ALNA 3PJ3A 3CJGA 2OH0E 3HMPA 4JR3A 3GXLA 3R28A 5CF8A 4BCHA 3NAXA 3EKNA 5DR2A 4BCOA 4FV5A 4FKIA 4IM0A 5J9YA 4BI0A 4TYHA 4U40A 3K3JA 4E6CA 5CF6A 5DRBA 3VBQA 4JG8A 1FQ1B 2X8IA 3GB2A 3U9NA 4M0ZA 4L3LA 2WEIA 4FSUA 4FV4A 4TNBA 4KD1A 1KOBA 1FBNA 3P86A 4PTCA 3ZFXA 1K3AA 3OY1A 3VUTA 4L7SA 4JIAA 2X0GA 4EWHA 3Q60A 3IW7A 4II5A 4IBMA 3RPRA 4DEBA 4RJ3A 4FT9A 4EJNA 2YITA 3UODA 3CY3A 4NEUA 1OPKA 1SVEA 3QC4A 2ZB1A 4JAIA 4RWKA 5KBRA 4RZVA 2REIA 3LFBA 4Z55A 5IA1A 1R0PA 4KBKA 2W7XA 1Z57A 2X2KA 4K8AA 5AV2A 3GEQA 3V01A 2JFMA 4XRLA 5E8TA 4CXAA 3FC2A 1YXSA 4O27B 1OUYA 2BR1A 5LWNA 3GCVA 1Q3WA 4WSYA 4DAWA 1Q4LA 2J2IB 2Z7SA 4W4XA 3VJNA 3W1FA 4J7BA 2OZAB 3AMAA 3R04A 1REKA 2WXVA 3E8CA 4F63A 2BPMA 3QTSA 2EVAA 2X7FA 3QUDA 5EDRA 1ZYJA 1WBWA 3E7VA 4CG9A 3FMJA 3HA8A 3VBTA 2G9XA 5E8SA 5BUEA 1A9UA 3UO6A 4JI9A 5HCXA 3RALA 3MFRA 4AP7A 3QZGA 4U41A 3QXOA 5LVLA 3EN4A 4ZY5A 3SX9A 2YACA 3R9DA 4AF3A 4J71A 3M11A 4HGTA 1Q62A 2BRBA 4WIHA 4DBNA 4AT3A 5AV3A 4C3FA 1XWSA 3NW7A 4KNBA 3E3PA 4CVAA 5ANIA 5AR3A 3U55A 3MGYA 2OJGA 3BZ3A 4BDEA 3UQCA 3MDYA 2RG6A 2YWVA 2WHBA 4AZWA 3UPZA 3QKMA 3SRVB 2VGPA 5AV1A 4CMUA 3BGZA 3FSKA 2XCKA 3KFAA 2CGXA 2IVVA 2ITPA 4C4JA 5HI2A 5KO1A 1H28A 4YUQA 3FLWA 1KOAA 2UZBA 2G2HA 5E8ZA 5IA4A 2YDIA 1VR2A 2R7IA 2HENA 3L8PA 4KRDA 1T45A 2X2MA 2OFVA 2WPAA 4XG2A 5CU4A 2PZPA 4BCPA 4G5JA 2ETKA 2XNMA 2GFCA 5FBNC 2GFSA 2WAJA 4CFVA 4F1TA 1YDTE 3I0QA 2FYSA 3A4OX 3EYGA 4UBAA 2PY3A 3V5TA 4A7CA 2PE1A 3U6JA 5EQEA 2ZJWA 4G3FA 3PYYA 5CAPA 4H1JA 3OHTA 3K2LA 3EQIA 3KXGA 4FT5A 4X0MA 4EOPA 3OD6X 3R8MA 4O84A 3JPVA 2IVUA 5CEPA 1OL5A 5ETCA 4A06A 3ZZEA 4QTCA 4AW5A 3TL8A 3V5JA 4C38A 3QX2A 5EOBA 3HRFA 4EI4A 5AR8A 4RIWA 4BVUA 3DNEA 5GZ9A 4ANQA 3P4KA 4MHAA 4AW0A 4CGAA 4UMRA 3ZSGA 4O0SA 3EB0A 3HV6A 4A07A 2CDZA 5LQFA 3G51A 3NX8A 4LM5A 4YSJA 5FXSA 3QWKA 1W83A 2WQNA 1QPDA 4DEGA 4BDKA 5JZJA 1BUHA 2O0UA 1V1KA 4GEOA 4M7IA 3VS0A 3WYXA 3PDTA 4GRBA 4EH9A 2I6LA 4FZ6A 3EFWA 2P3GX 2B9IA 1IA8A 4IZYA 3WARA 3QF9A 2UW0A 3KRJA 2J0MB 3GQLA 4RIOA 4UZDA 4YBKA 1TQIA 1DM2A 3GCSA 3C0HA 3NUUA 4ZTHA 4EH2A 3N4UA 4BIDA 4DG3E 2Q0NA 4CZUA 4AX8A 4MD8E 2OJIA 2IW9A 3QKKA 2IJMA 4BWPA 1ATPE 4M66A 3SHEA 2B54A 1YRPA 3CPCA 4W4VA 2B7AA 5G6VA 4FNYA 2YCQA 5HX6A 1GIJA 2BRGA 3IW5A 2R3JA 3E8NA 4G3CA 2QO2A 5H2UA 4ZJVA 3S00A 4XHKB 4ZMEA 1FPUA 1YKRA 5KMLA 4O7TA 1H27A 3MS9A 5CU3A 2VUWA 3W2OA 4FVRA 4PF4A 4PDSA 5D9HA 3TKHA 2C3IB 4HJOA 4CTBA 5M09A 3Q5ZA 4DINA 5K0XA 4A9YA 3IKAA 4XS2A 4JBPA 4IADA 3RWPA 5K3YA 4C2WA 5EQYA 1H0VA 3HA6A 3MVJA 2PL0A 3LOKA 4HNFA 2OKRA 4CYJA 3HECA 2PVYA 3I0OA 2BRNA 2A27A 2WMSA 3PE2A 3L9MA 4DLIA 3UQFA 5H8GA 4Y46A 4JG6A 2ESMA 2JIUA 4FR4A 1GZKA 5C9CA 2UVYA 3QXPA 4I5HA 4GT3A 4EZ7A 4MEDA 4BGHA 3P7CA 1DAWA 3C51A 3LFAA 3NPCA 5F4NA 2V7AA 1SYKA 2A2AA 5KNJA 5TOZA 3CGFA 4FVQA 2ERZE 3TG1A 2FH9A 3ANQA 3LPBA 1J7LA 4BL1A 1Q41A 3EQFA 2HZIA 3HVCA 3P7AA 5HE3A 2QU5A 3G33A 4ZTRA 2Y6OA 4HVGA 1NVQA 3BELA 2W05A 3A2CA 1Y6BA 4P5QA 4RVMA 2J6MA 1SNXA 2XK9A 1JVPP 3Q9WA 5HESA 3UNZA 4APCA 4G6OA 2VO0A 3FQEA 4CCUA 4GFGA 3E62A 4AW1A 3C5IA 4WG4A 4YNEA 5TO8A 2UZUE 2I0EA 2VGOA 5BVKA 2QNJA 4UMQA 2XP2A 3ORXA 2J5EA 2WNTA 3W2SA 4IZ7A 4IJPA 3LJ1A 2VD5A 2X8EA 2W96B 4NCTA 4I4FA 3VRYA 1V0BA 3POZA 2G15A 4IX6A 3BYVA 3KXHA 4O0TA 3IW8A 3R7UA 3U6IA 2H8HA 2FB8A 4CMOA 2BIKB 3DFCB 4BY9E 3CC6A 2FO0A 3F7ZA 3GOPA 4PNIA 2ITQA 4Q5HA 4XCUA 5C8MA 4F1MA 4F08A 5KZIA 4ANSA 3F2AA 1PY5A 3RKBA 4J8MA 4M8TA 2CN8A 4OW8A 5EDQA 4BTJA 4ZMFA 1RE8A 4NIFA 3S0OA 1MRUA 3N51A 2Y6MA 3FPMA 4W8EA 2RFDA 1JPAA 2VWUA 3TIZA 4FG8A 1GZNA 3VC4A 4D5KA 3G6GA 4D2SA 3R1QA 2QO7A 4ZSGA 2R5TA 4BDFA 2PUPA 2YM4A 4H3BA 1IASA 5M55A 4PQNA 3Q2MA 4EQCA 4U0IA 4WBOA 5E1SA 1OPJA 1YXVA 4HGEA 4QMLA 3WZUA 3TZMA 4C4GA 3UTOA 2IZUA 3DKOA 4M3QA 4MVFA 5HLPA 5HZNA 4H39A 2W5BA 4AN2A 3OT8A 4QMMA 4U8ZA 3QHWA 1H07A 4DN5A 4L46A 2GNLA 3ZC6A 4RIXA 3PPZA 5B0XA 4XP3A 3RAKA 3NR9A 1Z9XA 3QCYA 4W4WA 4ZY4A 5CAQA 3OCGA 3D0EA 4GUBA 3DAEA 4BCGA 3H9OA 4DH3A 4I41A 2R3KA 3SG9A 5AUWA 3EL8A 4E3CA 4RX7A 2XIXA 3BIZA 4EHZA 1SMHA 2RIOA 2XBJA 2DQ7X 5IH4A 2IZRA 4AXAA 2GS7A 4JJRA 2PULA 3EKKA 3QUEA 3WIKA 1OM1A 2GQSA 3QA0A 4RT7A 3BHHA 1WBOA 4TPTA 3UMWA 4DITA 4BR3A 2ITWA 2VTHA 2QCSA 2R3HA 3PA5A 5AP7A 2J9MA 3LCOA 4C34A 3F3ZA
chains in the Genus database with same CATH superfamily
3NDMA 1KWPA 4WA9A 5IQDA 3OMVA 4XG6A 2R0IA 5ICPA 4TYIA 3NCZA 3CQWA 3AOXA 3ODYX 4E7WA 2X4FA 3BE2A 2F7XE 3BHTA 1B6CB 2QOCA 2YN8A 3G6HA 3HZTA 4BFMA 3ULIA 2H9VA 3D83A 3U51A 4HZRA 3SW7A 3VN9A 2O3PA 5IQFA 4UMTA 3RK7A 3DZOA 3KK8A 2UW8A 4IWOA 4QMVA 5CT7A 4O6EA 4YZMA 4LDTA 4XV3A 3I1AA 5EM8A 4GK4A 4G1WA 4EOIA 1TFFA 1WFCA 1IAHA 3DV3A 3UYSA 2WIHA 3AGLA 5CY3A 4I22A 4W9WA 4HVHA 4IAAA 3SRVA 4LRKA 4FG9A 2JBPA 4R5YA 2OG8A 3K5UA 1FOTA 3O71A 2XNBA 4IB1A 3V5WA 5HO6A 3ERKA 4TYHB 4AGUA 1VZOA 5KE0A 4E20A 3ZU7A 4KA3A 4IZ5A 3QQJA 4IAIA 4UEUA 4ZTLA 3FY0A 4S30A 3F69A 2O2UA 5M51A 2NP8A 2QVSE 3GCUA 3FMMA 3TNHA 4CFFA 5J9ZA 2JFLA 5IUGA 3D5VA 4FK3A 4JBQA 5T68A 2WQBA 4DFYA 2CJMA 4JDJA 4TN6A 1DAYA 1W98A 3LXKA 5DBXA 5IQBA 4OTHA 2YCRA 4YZ9A 4FIEA 4HNIA 3OY3A 4TWOA 4DG0E 1OIRA 4FV1A 3D14A 4IIRA 3C4EA 3K5VA 2BDFA 4RFZA 3RZFA 4D2PA 5L6WL 3U6HA 2QU6A 2KTYA 1DS5A 3C4WA 2JDRA 3D4QA 4X3FC 2FGIA 2PPQA 3P7BA 3KRRA 2YFXA 5AAFA 3L9NA 2X9FA 3IW4A 4YZNA 3U4UA 3F5GA 3ZM4A 4I6LA 4FTNA 5L2TA 4FIIA 2GQGA 3NWWA 2YIRA 4QMOA 3QYZA 5D10A 1MQBA 2XYUA 5J95A 2VTQA 3B8RA 2E9OA 3QHRA 2C5VA 3ZXZA 3R6XA 3E92A 4FOCA 4DT9A 2IVTA 2JDTA 4RSSA 5AAEA 3ZHPC 4F7SA 1BL6A 2GMXA 2CSNA 3EN5A 4M12A 2B9HA 3UQGA 4FTAA 4FT7A 4FNZA 1BL7A 3QD4A 1Q61A 1FMOE 5AP5A 4YU2A 5HD4A 3LLAA 3VONA 3P78A 3RMFA 4GW8A 3UNKA 3OFMA 4QMYA 4UXQA 1J3HA 5DPVA 4UXLA 3QLGA 3W8QA 4C59A 3AKLA 4BIEA 4RJ7A 2ZMCA 3KC3A 1ZMWA 2Z7QA 5FRIA 2RL5A 4BZOA 3PXFA 1PHKA 1Q8TA 4RIYA 4OUCA 4PP7A 2YHVA 3D15A 3BKBA 4O1OA 2ITOA 3R7GA 5EKOA 5HU3A 1O9UA 1H25A 1RDQE 3SGCA 1NY3A 3DDQA 2PVKA 2YERA 3OCSA 4P5ZA 3PXKA 1SVHA 2G1TA 2GTNA 2WQMA 3MPAA 3QU0A 2SRCA 1ZRZA 4XMOA 4Y85A 3QZFA 5CANA 3FHIA 5DI1A 2P33A 2R3NA 2HY81 3MFSA 4XG9A 5GNKA 4EH7A 5IZFA 4XH6A 2OZOA 4D4YA 3ORZA 2YISA 1WVWA 5ETFA 3TUDA 4G34A 4BTKA 4PDOA 4EOLA 3JY0A 2XM8A 4NM7A 4F78A 3W16A 3UDSA 2NPQA 3W32A 4BHZA 1WMKA 5FQDC 5CALA 3OOMA 5HLWA 4QP2A 4LOPA 3DBQA 3JVSA 2WGJA 1M2QA 4V05A 4GIIA 4NU1A 4AT4A 4EC9A 3NVMB 2C30A 5F20A 4FEXA 4RVKA 4L01A 4BKZA 3SKCA 3VS3A 2X4ZA 4ZTSA 1Q99A 4K11A 3P79A 3BQRA 2C6LA 2O8YA 4F0GA 4CNHA 5J7BA 5J8IA 5LMAA 3MH1A 3R8LA 1OGYA 3QUPA 5CAVA 4EJ7A 3DKGA 3FC1X 4ZTNA 4WD5A 3OWLA 4F64A 4FSMA 2W5AA 3Q9YA 4ITHA 4JAJA 5JQ8A 4TNDA 2QOIA 3C5UA 3CPBA 3HRBA 5F9EA 4K0YA 4RIWB 3HV7A 3C13A 2R9SA 4N70A 4ALVA 3VWAA 4R3RA 1YOMA 1G8AA 1Y91A 4YJQA 5LXMA 5CWZA 2X0QA 4O0WA 3LFDA 4TW9A 4JBVA 5HNBA 4A4LA 2XF0A 3Q4CA 3LFSA 4HZSA 4CFUA 4O81A 4FZDB 4MD7E 1W2DA 3L9PA 3QAME 1I09A 3ACKA 4FT3A 5AP2A 3UC4A 4S31A 4TWCA 4UMUA 3TJDA 2UZNA 5ANDA 1XMMA 1PKGA 3SXRA 3G0EA 4FTQA 4IAYA 4NZWB 4O4FA 1XO2B 2VO6A 3MI9A 2B1PA 5EHLA 2X6DA 5E8XA 4DGMA 2VO3A 3GVUA 2J0IA 2QHMA 5EW9A 3A7FA 3RI1A 4ENXA 4IX5A 3QQLA 3KGAA 3CE3A 3Q6UA 4PPAA 3PP1A 4LMNA 4RRVA 3OF0A 1V0PA 4XOYA 3R7VA 4I24A 4AGDA 4MXAA 5KZ0A 2O5KA 3QCXA 4MXYA 3ACJA 4R3PA 4O2ZA 1WVYA 2BRHA 5TKDA 4FUXA 5EQPA 2A19B 1V0OA 4C35A 4FODA 3O50A 3BCEA 4M15A 4W9XA 4MBJA 4WSQA 4DH1A 2C6OA 4GG7A 4OT6A 5BMSA 3Q4UA 3BYSA 3UIBA 3V6RA 3F3VA 1FGKA 2X7OA 2VTSA 4PMSA 4WG3A 3D7TA 5L2IA 5DA3A 4BZDA 4DTKA 3BEGA 3MV5A 3PG1A 2HZNA 3PA4A 4ZY6A 5HG8A 3GBZA 3ENHA 4NTSA 3ZLXA 4J8NA 3BHUA 4AGCA 3E64A 2BHHA 4YC8A 3KVXA 2C1BA 4GL9A 5KCVA 3VS1A 2XYNA 3KL8A 4BCNA 3WF9A 4E1ZA 1J7IA 3R0TA 1GAGA 3PP0A 3TACA 4OTRA 4PNKA 4F9YA 3GNIB 3W55A 5IEYA 3W33A 3D5WA 1WBVA 4AOTA 2F57A 3W8LA 1TQMA 4GFMA 2BROA 5D7AA 2WQEA 1XBAA 1NVRA 2UW6A 3PVGA 3G90X 3MH0A 3PUPA 4XBRA 1BYGA 3R73A 4L68A 4YZCA 3FLQA 3NUPA 3I6WA 4TT7A 5HBJA 2NO3A 3BL7A 4BDJA 1CTPE 3F66A 3RGFA 4AS0A 3NW6A 3F2RA 4I5MA 3Q52A 1VLRA 2YWPA 1ZAOA 1XH4A 5AX3A 4FZ7A 2QLQA 4YHFA 4IANA 4BDHA 3KCFA 2WZJA 4RWJA 2BZIB 3NS9A 4PV0A 3LFQA 1UU3A 3QQUA 5CT0A 3U4WA 4E6AA 2W1ZA 5BVWA 4E4LA 5KMIA 3PXRA 3V3VA 2QOQA 3CY2A 1H1SA 4U44A 3VS6A 4BYJA 2NYAA 3A8WA 4EKLA 5CEOA 4KIKA 3M42A 2QOKA 2GCDA 4G3GA 4CT2A 4AG8A 5KBQA 1OB3A 5L2SA 5LCJA 4LV7A 2F4JA 4AUAA 3ORKA 3FZ1A 3QRTA 2YCFA 2LGCA 1QL6A 3C1XA 3C4FA 3PG3A 4B4LA 1XHAA 5D1JA 3UP7A 4DH5A 3GFWA 4M13A 4NK9A 4IC8A 3A8XA 3FZRA 4WT6A 5F1ZA 5FXQA 3DT1A 4AOIA 4GV1A 4D2RA 5B2MA 3RBWA 4CRSA 5JRQA 1XH9A 2C0IA 3DTCA 4LOQA 3GU6A 5FG8A 5LVMA 5CI7A 3UDBA 4X6QC 1QPCA 4EOOA 3DGKA 2WTWA 5GHVA 5C27A 3JR1A 4AOJA 1ZOHA 2ZFYA 4DHZA 1PXOA 3HNGA 4U45A 4L8MA 5IISA 2VWBA 3ZO3A 4DFBA 2ACXA 2VRXA 5FDPA 3F3UA 2R3IA 2XKFA 4F9AA 4XG7A 3ATSA 2PSQA 5EYDA 3G0FA 4AAYA 2YIQA 1LR4A 3OW3A 2DUVA 2I0HA 2UZOA 3OCBA 1WBTA 4BGQA 1G5SA 4BCKA 4ZZOA 3PIXA 1H1QA 4U6RA 4GG5A 3NYXA 4BKJA 1NA7A 3PA3A 4R3CA 5GJDA 5C26A 2XH5A 3KEXA 4L44A 3RCJA 1OGUA 1WVXA 1P4FA 3VRZA 2B53A 2C3JA 4YBJA 4YURA 5FM3A 1JKSA 5IA0A 4NFNA 4XP2A 5LOHA 1WAKA 4CFWA 4H58A 3M1SA 5EW8A 2WTKB 3LFFA 3R01A 4FKOA 4H1MA 4RIXB 4BBMA 3HAMA 3DA6A 2IZTA 3AC1A 5FTGA 2UUEA 3OCTA 3QX4A 4HGLA 2QI8A 4MH7A 4TXCA 3KULA 3NUSA 5AP4A 3ZZWA 4D9UA 3SV0A 4QNAA 3FZOA 2PVFA 3VF9A 4A9RA 2RGPA 4WO5A 5KMOA 4H3QA 3GP0A 3AKKA 3ZUTA 3RNYA 4LL5A 4B9DA 2FVDA 5HLNA 4B6LA 1VYZA 3H30A 4FKJA 4FTOA 4QPSA 3TM0A 2F7EE 4TZRA 3AMBA 3C0GA 4NM5A 3JUHA 1Q24A 2UW5A 3KB7A 4XUFA 1JLUE 3C50A 1XR1A 3FE3A 1M14A 3ORNA 3Q9ZA 4FUYA 3RAWA 4TL0A 2X0OA 3A4PA 4ALWA 4YMJA 5DT0A 3MB6A 3AC5A 4QYFA 5HE1A 4MWHA 5TR6A 4HVDA 3A7IA 2HIWA 3MVMA 4IAFA 5HG7A 3QZIA 4S32A 4O7VA 3KXXA 5CU0A 4M97A 3Q2JA 3WF8A 3R9OA 1UKHA 5JGBA 3DNDA 3HV5A 3A60A 5HCZA 3WZEA 1G8JA 4RX5A 4O0XA 4CT1A 4N0SA 2JITA 2V5QA 4FEUA 2QURA 2I40A 3H9RA 3VF8A 4IB0A 3SLSA 4K1BA 1OKYA 5CU2A 1QCFA 4FKRA 5J1WA 3H0ZA 2AYPA 3KRLA 1JWHA 3BGPA 4I3ZA 5HCYA 3NRMA 4MBLA 4BCMA 5IG1A 4JNWA 2QHNA 3TKIA 3ELJA 4MYGA 4EEVA 2JKQA 3EQDA 2DYLA 3TV7A 4QQTA 4YHJA 3ZH8A 1BLXA 3SOCA 4G6LA 4S34A 4UY9A 1A48A 4KIPA 5HVJA 2Z7RA 4FIJA 2VZ6A 3AXWA 5JN2A 4X2FA 1YVJA 4CYIA 2ITXA 5IUHA 3S1HA 4O0RA 5IH6A 1ZWSA 4G16A 5KKRC 2AC5A 3COMA 4ZP5A 2R3PA 4F7JA 4U80A 4BC6A 4P7EA 4QTAA 5M4CA 1O6KA 3O0GA 2OF2A 4Z9LA 4KKEA 4O7ZA 2OIBA 3HMOA 4ZS0A 3SOAA 4TYEA 3RM6A 2BALA 4TTHB 5FXRA 2IG7A 3QZHA 3VVHA 5JFVA 4O7NA 1UWJA 5J5SA 4RBLA 3NNWA 4FTKA 3MVHA 3AD4A 3ZXTA 1YXXA 3BV3A 4H36A 2NNWB 5CLPA 5A4EA 4N6ZA 4CRLA 4YZBA 4ZS4A 2C3LA 4XX9A 3DLZA 5AR4A 5HBEA 3W0MA 4O7WA 2VU3A 2PVMA 2XK7A 3HDMA 3QQGA 4O38A 4PL4A 1BMKA 3KXNA 3UZPA 3PVUA 2GNGA 3FDNA 4O2PA 4QMPA 4FSZA 4ANMA 2NRYA 5DYJA 3NAYA 5HU9A 4BDAA 1MRVA 1TQPA 3FWQA 2JKKA 5J87A 2PVJA 5FTOA 3FEGA 4MF1A 4PPCA 3ZO1A 5CVHA 2BIYA 3OT3A 4QTEA 2C1AA 2VNWA 3MTLA 3P5KA 1M7NA 2YIWA 4MD9E 2VX1A 2VTAA 2WMRA 3E8DA 4RA5A 3L8SA 5GIOE 1KSWA 3OXZA 3G9NA 2HELA 3CTQA 5C03A 3F6XA 4G2FA 4O0VA 4PMTA 3PY3A 2GS6A 1JQHA 3LW0A 2JDSA 4QQCA 2ZDTA 4EONA 1PXNA 4ANBA 5AV4A 1O6YA 3KMWA 1PMUA 1PXLA 2PVNA 3KU2A 1QMZA 3Q04A 3OVVA 3QTZA 4O4DA 2C6KA 4R1VA 5DE2A 4DG2E 5KUPA 4BZNA 3D2KA 4WKQA 3VQHA 5EDPA 3R9RA 4BCIA 5JSMA 5BV3A 5A46A 2EB2A 2YAKA 3GU8A 3HL7A 1QPJA 4JR7A 4RJ5A 2R7BA 4WBBB 4I94A 3ZO4A 1ZOGA 2J0KA 3LXNA 4J53A 4ASZA 5AEPA 5IDNA 3VUKA 3VULA 3UOLA 3BU5A 3R02A 2QONA 3DY7A 2G2IA 3HRCA 3FHRA 3RZBA 3UGCA 3IDBA 2XBAA 3W0QA 3FI3A 4ITIA 3AT3A 4YTFA 2WD1A 3BGQA 3DCVA 4NKSA 4MQ1A 5T6KA 1YDRE 3PXYA 4EOKA 3KN5A 1H4LA 4BDBA 1FVVA 3FJQE 4NWMA 2RFEA 1FVTA 4EZ5A 4F4PA 3EH9A 4C3PA 2FA2A 2X39A 3TUBA 1KV1A 2QR7A 4PRJA 3IOKA 3TJCA 4TKSA 2WOUA 4J99A 2WO6A 4PDPA 3TCPA 4DEDA 5DFPA 2ZV8A 2XIZA 5HORA 2BTSA 4I5CA 4NSTA 3FI2A 3TZ7A 5BMMA 1Q8WA 3CLYA 1UKIA 2XNEA 1AQ1A 4PWNA 4PY1A 3KMMA 1JKLA 2HAKA 4CEGA 5GINE 2FUMA 3WZKA 5CSXA 4EH6A 2OIQA 3VUIA 3MYGA 3NIEA 5DHJA 4MKCA 1W82A 1EH4A 5IQGA 3HLLA 4X2JA 2E9PA 3I79A 4J97A 4F9CA 4QYHA 4ITJA 4ACHA 4BICA 5IQIA 5CAUA 2W0JA 4XLIA 4AZSA 2J7TA 5KHWA 5AUTA 1H26A 4FOBA 4FV7A 3RK9A 3DBEA 3RAIA 3JY9A 3MBLA 3V8TA 4OTDA 1TKIA 4RGJA 4FL3A 4D9TA 3O5AA 3DK7A 3IW6A 4D2VA 3G2FA 4KS8A 3KIOC 4QP3A 4C3RA 4AZVA 3FKLA 4FL1A 4D1ZA 4LV5A 3OXTA 2X2LA 2XMYA 2YJSA 5AR2A 2WMWA 4CQEA 1P14A 4DGNA 3A7GA 4QEBA 3BBWA 5IEVA 5EI8A 3KF7A 4TWPA 2B9JA 3EZVA 4BJJA 2YLEA 3DKCA 4FV8A 4LGGA 5ANKA 4GT4A 5F95A 2XJ1A 4I4EA 3COKA 1H1WA 3F5UA 3PXQA 4GYIA 2JIIA 5FP6A 4K77A 1G3NA 4CFNA 1R39A 1ZXEA 4DFNA 5IF1A 3ORTA 4FNXA 4U81A 3R00A 3HMNA 5BVFA 4PL5A 5FWKK 4FC0A 3THBA 1ND4A 3D7TB 3U87A 4D58A 1OITA 4YJPA 2Y4IC 3F7WA 5EHYA 3NYNA 2QOLA 5DLSA 5HVKA 1P2AA 4O0YA 2RSVA 1M17A 3BYUA 5EYMA 4MTAA 3ZFMA 1KUTA 4Y73A 5HEZA 4EKKA 3EMGA 5BNJA 1OVEA 2FSOX 1WBNA 5IUIA 2ZB0A 4X6RA 4CTCA 3BBTB 2PUNA 1XKKA 2WMUA 2VWWA 4UWYA 3EN9A 3CJFA 4L45A 3DXPA 5HE2A 2R3MA 3FQSA 2C6TA 5DN3A 4KAOA 2EUFB 2J4ZA 2XNOA 2V0DA 3EL7A 4RLLA 1Q5KA 2WTCA 4DC2A 2RKUA 4O21A 4U3ZA 4DFLA 5LJJA 3TDVA 2OXDA 4OT5A 3Q53A 2ITZA 2O64A 3PFQA 3OTUA 4A4XA 1GY3A 2O65A 4U9AA 4FSYA 2WTJA 1W2CA 3EQPA 2OXYA 4AXDA 3FLSA 4FTJA 4IZAA 4O86A 5HHWA 2EXCX 4CLIA 3QRKA 4D4SA 1ZMVA 3PFYA 3KQ7A 3WBLA 1M7QA 2XEYA 2GNFA 3ZLSA 1ST0A 1VJYA 4N6YA 3PY0A 4MQ2A 5DOSA 2W5HA 5BUIA 2PVLA 3NYOA 4G6NA 3IO7A 4YJRA 2LAVA 4AGWA 3BU6A 4BBEA 2OSCA 4MXXA 2B9FA 3DK6A 2C6IA 2AC3A 1XBCA 4ACCA 2XK4A 5CU6A 2PZRA 2HZ4A 3FMNA 3BLQA 3WILA 1NVSA 4FF8A 1OBDA 1IRKA 2YIXA 3AD6A 4KIKB 3DBFA 3VBWA 1U46A 1U54B 4RVLA 2HK5A 4X3FB 4KRCA 2ZOQA 4XV2A 4YGAA 4KIQA 1PYEA 3REPA 4KBAA 3KVWA 1PMEA 5I9VA 3EJ1A 2JLDA 3MPMA 4KABA 3DOGA 2QKWB 4GMYA 2GPHA 4DFUA 5BPYA 2ZAZA 4QO9A 5DGZA 3B8QA 4FKWA 1AGWA 2BKKA 4FEQA 4FTUA 2CNUA 4BKYA 4AACA 2C6DA 2F9GA 3R1SA 4Y5QA 4LV8A 4QTDA 3VQUA 3OTVA 1OIQA 3O7LB 1YDSE 2PTKA 5CEKA 3QYWA 5AR7A 3I7CA 4O7YA 2E9UA 3D5UA 3PY1A 3C4CA 4YR8A 1YQJA 2UV2A 3ALOA 3N9XA 4AAAA 2ITNA 1OL7A 2IVSA 4EHGA 5AUVA 4JX3A 3EQGA 4O83A 1L3RE 3MFUA 3JS2A 3MH3A 4BWXA 5L6OA 1UWHA 5AMNA 5I9UA 5HG9A 1PXIA 1OL1A 2FSTX 1SNUA 3EN6A 4NW5A 5I9YA 4QDEA 3LXLA 4FV3A 3E3BX 5JKGA 4YLLA 2W17A 3LE6A 3GC9A 4YTHA 4DH7A 1GJOA 2XAOA 3KXZA 4PTGA 5GIPE 2A98A 4FG7A 4EC8A 5I9WA 4DEEA 3AC3A 3EWHA 3H0YA 1YWNA 3RPYA 3FLYA 3O2MA 3S2PA 2WMXA 4USFA 4PMPA 4DT8A 3NMUF 4ZSLA 3WI6A 2XEZA 2EWAA 2WMQA 3DJ6A 3EYHA 4ZLZA 5L2QA 2CGUA 2P55A 3KULB 1TZDA 1URWA 4C02A 4CFMA 4JLCA 2XRWA 2Z7LA 4DEIA 4UB7A 1VEBA 4O22A 1JKKA 2BHEA 3R8VA 4OBQA 3C4ZA 4A9TA 3AKJA 2ETRA 4ZXTA 4Z16A 2ZM3A 2WIPA 2DS1A 3HP5A 3A7HA 5A9UA 3GQIA 4M0YA 1Q97A 2C5OA 5FEQA 3SG8A 3OZ6A 4PPBA 5CXHA 5HBHA 3A7JA 4DYMA 4G9RA 2YZLA 3NUAA 5AIKA 2HCKA 3E8EA 3R7IA 1RW8A 3GC8A 4OGRA 4YNOA 1MQ4A 4JG7A 3ANRA 5BVDA 4USEA 4B8LA 2R4BA 2VN9A 4ZSJA 4QMQA 1PXMA 5M57A 1PJKA 2ZMDA 4OBPA 4RQKA 3II5A 3F2NA 2VNYA 3UVRA 3BE9A 4XV1A 3F9NA 3TV6A 3FZTA 3FSFA 2V22A 4DA5A 1Q8YA 1Q8ZA 4I0SA 5BVNA 1OL2A 1PW2A 3QD3A 3VUHA 4FKTA 4UV0A 5A4TA 4F70A 3E87A 3GC7A 3IGOA 3JVRA 4RZWA 5EM6A 3LMHA 4FTCA 3HMMA 1YXTA 3HV3A 4BGGA 5M4UA 3U54A 4MXZA 3MJ2A 3U8WA 3W0SA 4YTCA 3FMDA 2ZV7A 3L8XA 2VTNA 4R7IA 3VIDA 5K4JA 2VTTA 4L43A 4OBOA 5FEEA 4IE9A 2OI4X 4RPVA 3W2PA 5AR5A 4KS7A 4ENYA 4AA0A 4EL9A 4QPMA 1GIIA 4X21A 1CKPA 1PYXA 3GU5A 4IFCA 4JS8A 3ZEPA 4A9UA 2XNGA 2ZM4A 5HOAA 4L6QA 1F3MC 4ARKA 3RINA 5B2LA 5AUUA 5J7HA 3LQ5A 4F0IA 5AWMA 4CLJA 4U7ZA 5IKWA 2H96A 4EORA 3DJ5A 4MK0A 1KE6A 4DH8A 3BPRA 1RQQA 1OIUA 4FKLA 4ANLA 5BVEA 4HCVA 1E9HA 4UZHA 4HYSA 3AC4A 3E5AA 2UW4A 2ITVA 1UA2A 4JQ8A 3SC1A 4R7HA 3SW4A 3R1YA 2OF4A 5LMBA 2PE2A 4OR5A 5FD2A 3ZSIA 4RJ4A 3LAUA 3CCNA 2OJ9A 3K3IA 5DT4A 4AQCA 4E6DA 4QYEA 1Z5MA 2C0OA 4YJNA 4EWQA 4OTPA 4AT5A 4K6ZA 5IEXA 1UV5A 4YO6A 2ZVAA 3PVBA 5BYZA 2W1CA 4Y5HA 3GU7A 3EN7A 2BZJA 5K0KA 4FTRA 3VAPA 4C33A 4UALA 3QD0A 2ONLC 4QYGA 4RX8A 1CKJA 1YI6A 3D5XA 4USDA 2GDOA 5CZIA 5IQEA 5CEMA 3Q4ZA 4LQMA 4FI1A 3QKLA 4HYUA 2GSFA 3GFEA 5IQCA 4F7LA 3A62A 4FV6A 4G5PA 4X2KA 5D11A 1W0XC 4WOVA 5DEYA 2OWBA 4LUEA 3HYHA 3LM0A 3A99A 1KE9A 3EQHA 5TE0A 4QDVA 5M08A 4YZDA 3V5QA 5JH6A 3F61A 3MSSA 3NNXA 4FNWA 3F88A 4KSPA 3PWYA 4GU6A 4R78A 1JSUA 2PMOX 4OTFA 3T3VA 3FKNA 1YHVA 3R2YA 4YJSA 5D41A 2XRUA 3NNVA 4Y83A 1Q8UA 4QP6A 3TNPC 3Q3BA 1APME 3ZFYA 3DAKA 2QOFA 2IF8A 5AUYA 3UIMA 2X7GA 3Q6WA 4JL9A 4C61A 5BVOA 4NL0A 5FP5A 1W84A 4FTMA 5J5TA 1REJA 5JFWA 1ZYCA 3RVGA 2GS2A 3Q32A 5BX0A 5DMZA 5M53A 2P4IA 4BDGA 4TWNA 3UOHA 3ORMA 3PE1A 2XCHA 2XIRA 3HGKA 1HCLA 5E9EA 3SQQA 4HYIA 5DVRA 3MIAA 4BI2A 3KY2A 3MA6A 2PU8A 4JBOA 5HIEA 1GZ8A 1KE5A 5E8WA 3GOKA 5L8JA 3GUBA 3TNIA 3QRIA 5CQWA 4MNEA 4XBUA 3QFVA 5AP3A 5I3OA 3BX5A 4ORKA 3FMEA 1H0WA 2JDOA 5EM7A 4C8BA 3PRFA 1OZ1A 1H1PA 4JRVA 3PZHA 4UYNA 4QT1A 4FKQA 2I0VA 4K2RA 1OPLA 2XJ0A 3CBLA 1OKZA 3PSCA 3G5DA 5JEBA 5CENA 3OUKA 5JMSA 1VYWA 3TIYA 2VTIA 3TT0A 3FY2A 5CEQA 3JYAA 4QYYA 3H9FA 3RNIA 4F0FA 4BCFA 4QQJA 4G17A 4EK8A 2QC6A 2W1GA 4EHEA 1FMKA 3AC2A 3CKWA 3PWDA 4JMQA 1H01A 3QALE 3LCDA 3VS5A 2W1EA 3HP2A 3F82A 4NFMA 5CQUA 3TEIA 4AW2A 1G8SA 3ODZX 4Z7GA 2OLCA 4IAZA 5AADA 4C4EA 4EYJA 2R64A 3P1AA 4JQEA 4FSWA 4ZOGA 4IVDA 3PVWA 3VBXA 5A4QA 3O8PA 3UZTA 2CKQA 1CDKA 2GNIA 2XNNA 1IR3A 1YWRA 3DJ7A 3ETAA 4L3JA 5AJQA 2VWZA 3P08A 4QMUA 4O96A 3UG1A 2B0QA 4DTBA 4QP9A 4WNKA 2QOBA 3D2IA 4PL3A 1YOJA 3VS2A 4CV9A 1KV2A 3PPKA 4MAOA 5AX9A 1KE7A 1SVGA 2GTMA 2P2IA 2YZAA 3V51A 4F6UA 5BQ0A 4DGGA 4BJJB 2UW3A 4OTWA 1U54A 4X3FA 5CTPA 3SVVA 4LL0A 1GNGA 4DE4A 2YM7A 3D9VA 4AXCA 1M2RA 4I21A 4RA4A 3DB6A 3LKMA 3HUCA 4PX6A 4AXFA 3IDCA 1M52A 2VX0A 2PMIA 3FKOA 4EOQA 5L8LA 2X1NA 5C4KA 4ANNA 4U79A 3UMXA 2IN6A 2RFNA 4OTIA 5D12A 4ACGA 4NM3A 4EHVA 3BEAA 4EQMA 4O7RA 1E1VA 2BZHB 3H4JA 3PTGA 4D28A 4NH1A 4RX9A 3BWJA 3BYOA 4E5WA 1DI8A 3DQXA 2DWBA 2VTJA 3VUGA 4D4RA 4M14A 4GK3A 4DGOA 1IA9A 2Z60A 3VHEA 3VJOA 3CXWA 4ASEA 4BHNA 4ZJIA 3MW1A 5CSVA 3FI8A 3FL4A 4E93A 4JRNA 1JSTA 2C68A 4P2KA 4FZFB 5JRSA 3COHA 5E8YA 3IG7A 4ZEGA 1UNHA 3R30A 4IDTA 4FMQA 3BQCA 3TXOA 2XVDA 3FYJX 4RG0A 3T3UA 4ACDA 1ERKA 4YJVA 2VTLA 2XUUA 4EYMA 3QL8A 5KHXA 3FAAA 3IS5A 4FGRA 4MX9A 1YHWA 4FKVA 4KUJA 1YI4A 4QMNA 1PMNA 1ZYSA 3P9JA 4L67A 3ZC5A 3ZDUA 4D2WA 5GJFA 5J9LA 4LRMA 2OO8X 3WF5A 4F9WA 2VV9A 4BRXA 2W1FA 4ERKA 4YHTA 4FA2A 5KKRB 5LMKC 2QOOA 1H08A 3DBCA 5L3AA 3S95A 5A4CA 4IHPA 2BAKA 3CTHA 4PP9A 3LFEA 5DR9A 2HWPA 5GJGA 4ZK5A 5HD7A 2CPKE 4YLJA 4IVCA 3ZRKA 4XNEA 3NSZA 3QTIA 2R3OA 4C57A 4O7SA 2VX3A 4GS6A 5DH3A 4O1PA 3R22A 4IDVA 4MF0A 2HXLA 5E91A 3VW6A 4BTMA 4JDHA