4ASDA

Crystal structure of vegfr2 (juxtamembrane and kinase domains) in complex with sorafenib (bay 43-9006)
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
312
structure length
305
Chain Sequence
DPDELPLDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDFGLARDIYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
publication title Molecular Conformations, Interactions, and Properties Associated with Drug Efficiency and Clinical Performance Among Vegfr Tk Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 102
structure length 305
sequence length 312
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4asdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4asdA01
2XK4A 4I6HA 4ZY6A 4F99A 4EJNA 3TZ9A 5DNRA 3CE3A 1YI3A 2XK9A 3H9RA 2XK3A 4QTAA 3Q96A 5CTPA 5EW9A 4TZRA 4CYIA 3VS5A 3T9IA 1GIHA 4TWCA 3AT2A 2X6EA 4QTDA 5AIKA 3II5A 2CGUA 1YQJA 3WE4A 5C8KA 3H10A 2C6KA 4USEA 1NVQA 2OKRA 3CD3A 3NUNA 1YDSE 3RWPA 4A9TA 4BWPA 4O84A 2CJMA 5BMMA 2R7BA 4BKZA 2ONLC 3OEFX 2VO3A 3C0GA 5KMMA 4YJUA 5BVNA 3LCOA 4MCVA 4NH1A 4OTRA 2QG5A 4F63A 5AR7A 1DAYA 4IAIA 2HZ4A 1OL1A 3FZSA 2I0VA 4CTCA 4G31A 4TYJA 3PA5A 3F3VA 5E8XA 4DTAA 3BE2A 4CNHA 4NKAA 3C0HA 3LXKA 3UIXA 4FSQA 4FKJA 5DFPA 3DNEA 2JIIA 2UW7A 3ORLA 4ASDA 4E8AA 3H9FA 1ZWSA 4D2WA 3FLWA 4AU8A 4NFMA 4BICA 2EU9A 3TG1A 4USFA 4E5AX 3W8LA 2WGJA 1P5EA 3B8RA 4FKRA 5IH6A 3F2RA 3R21A 4MWIA 3E7VA 4U41A 4XV1A 4DG0E 3LQ3A 3AT3A 5BNJA 2CNVA 2JDSA 3Q53A 3RK9A 3LMIA 4FIJA 4D2TA 3BQRA 3VUHA 3O0GA 3OS3A 5ANJA 4E4NA 2EB2A 4FZ6A 1PMVA 2WMVA 4JR3A 2GSFA 4LOQA 2BRNA 2XK7A 1ZZLA 4MQ2A 4C4FA 3AGMA 4QNAA 3FMEA 3FMJA 3S3IA 4ZZMA 3IS5A 4XOYA 5E8VA 3PP0A 2YM3A 3DDPA 2W7XA 1GZKA 4BF2A 5IA3A 4G6LA 4YC6A 2WPAA 4FV2A 5HCZA 4IQ6A 3GP0A 3CSVA 5I9VA 2XB7A 2YAKA 2C6LA 3U9NA 4R7HA 4NM7A 5L6OA 3N4UA 2W5AA 3KFAA 3ZTXA 3ZCLA 5GZAA 3IK3A 1ZMVA 4EOLA 4AZSA 4ZLYA 3MH2A 3QTSA 4USDA 1H24A 2QURA 3ZOSA 1OPJA 2C3LA 3KA0A 5AP6A 2W1EA 3QUEA 3ZO3A 2C3IB 4AGUA 2G2IA 4F4PA 3O8UA 4LI5A 3V8TA 5A4CA 2UZTA 5DOSA 3W18A 5DT4A 1PF8A 2JDRA 3P86A 3DJ5A 4N6ZA 1Q8WA 5HO7A 2QOHA 4C35A 4YC8A 1UU3A 3OWJA 4F0IA 1KSWA 4PNIA 3EJ1A 2YDJA 4FZDB 4O7ZA 3E3BX 4HYIA 2UZWE 3OXIA 2UW9A 5JQ5A 3OP5A 4NJ3A 2W1FA 2NRYA 5KE0A 4YHFA 3PPJA 2YDIA 3PLSA 4LRJA 2WTCA 3VBYA 4K2RA 5CSHA 3P9JA 4XLVA 2PMIA 4G2FA 4QMTA 4XOZA 4DFXE 2XRWA 2FSMX 2OJFE 2YCFA 4CZYB 1M17A 3PJCA 1OZ1A 4M3QA 4OLIA 4ANMA 2WQOA 4A7CA 5LMAA 3EN5A 4QQ5A 4FKSA 3MA6A 4JBOA 4BCGA 3GU8A 2VU3A 4FVQA 4AG8A 3HRBA 5I9WA 5I9ZA 5JFVA 3D5XA 5KHWA 3KRJA 1XQZA 2XCHA 4FEWA 3PY1A 1K3AA 3SD0A 3EFKA 4O22A 3C51A 4K6ZA 1Q3DA 3ITZA 2WEIA 4RFMA 5IA4A 2GFCA 3WF9A 3EFWA 4MD8E 4CFVA 2RL5A 3NWWA 3LFQA 4G9CA 3O17A 3VUMA 4S31A 4MHAA 2C5OA 4PF4A 4ZSJA 2X7GA 3FSKA 4MXAA 4RMZA 4FE2A 2IVTA 2R3OA 3LXPA 1FQ1B 2OSCA 1GY3A 5C1QB 4G3DA 4C4JA 3QTXA 4YNEA 2HY81 4F1TA 2VN9A 2XJ2A 3KRWA 4FL2A 3VF9A 1NT2A 3PVUA 3FLSA 3B2WA 5DEWA 2IVUA 4DITA 2OJ9A 4L53A 3QRKA 4RGJA 1NXKA 4TN6A 3S1HA 4CT2A 2J0JA 2W4OA 4P90A 4ID7A 3W33A 2YJSA 4EQCA 5BPYA 1FBNA 3Q4CA 3D14A 3FL5A 3NUUA 2XYNA 4KSQA 4D9UA 3CTHA 3LMGA 4FYOA 4EBWA 3O8TA 2PL0A 5KMJA 4DCAA 1CTPE 1U59A 4DC2A 3OBJA 4O2PA 3QWKA 2XEZA 4QMSA 3D15A 1PXLA 3CQEA 4R5SA 3SKCA 1SZMA 1XHAA 3ORIA 4I22A 3V6RA 3IW5A 5KMIA 1H4LA 3SGCA 3KN6A 3EQDA 5J1VA 2FSLX 5E1EA 3AG9A 2HWOA 3OOMA 2OH4A 2C0OA 3DGKA 3AT4A 2GHGA 3KK9A 4PTGA 3HA8A 2RFNA 5HG9A 1OBGA 2OJIA 4F64A 3QC9A 1Y6BA 4GFOA 4M13A 1UU7A 2ZMDA 3I7CA 4BR3A 3TNQB 4CYJA 3HV6A 1KE5A 1P14A 4IX5A 5DLSA 5IMEA 2YZAA 4X7QA 4G3EA 3GOPA 5EW3A 3S0OA 4LUDA 2BRMA 2B7AA 2ZVAA 3FY0A 4GFMA 3WIGA 4J1RA 4RJ3A 4YPDA 1U5RA 2WQNA 4D5HA 4ZS4A 4FL1A 3QRJA 5HCXA 4EI4A 1LUFA 4XP2A 5LMBA 3UMWA 3ZLWA 5FEEA 3AMAA 4PTEA 4C58A 1OECA 2JLDA 3BWFA 4GK4A 4BTMA 3BGPA 5AR5A 3EYHA 4D28A 4EH5A 4BTFA 3HA6A 4J8MA 4WD5A 3QD3A 4QMNA 5HX8A 4LYNA 5IDNA 3F69A 5FEDA 4TYIA 2E9PA 3NW5A 2JKOA 5AAFA 5I4NA 4EYJA 3QQFA 3V04A 3EQFA 4X2KA 3UIMA 2BTRA 2GS2A 2QHMA 4ALVA 3D4QA 5CASA 3PSCA 5IUHA 1APME 3DV3A 1NVRA 4KABA 3NZ0A 2WMUA 4F6UA 4I5HA 5E92A 4OTFA 3W32A 4GEOA 3I4BA 3DXQA 3VW6A 2YM6A 4M15A 3ZFXA 2REIA 2GHMA 3HP2A 3G51A 5CENA 3E8NA 3L9LA 3VC4A 4HVDA 5AAGA 4QPAA 1TKIA 2DYLA 3C4FA 1K2PA 2J4ZA 2G9XA 3M2WA 3MY1A 3OWPA 1M7NA 4ZTNA 4FG9A 3ZLSA 4FKQA 2NPQA 1W98A 2UW0A 4KIPA 3G9LX 3HUCA 2X2KA 4NUSA 3G90X 5AUVA 3RNYA 2Z7LA 5FXSA 4O96A 4RG0A 3F2NA 2RSVA 5FD2A 3TZ8A 3ACKA 4CVAA 3LFEA 4O91A 2C68A 3UPZA 4I6BA 4NZWB 3QLFA 3UPXA 3R8MA 3ZC5A 4BCIA 3L8PA 4J53A 3QD0A 5FEQA 3VUGA 2IZTA 1BI8A 5AP3A 2UZLA 3A8WA 3CBLA 4D9TA 4YNOA 1H0VA 5EM8A 4X2FA 3EH9A 2HZ0A 4X2NA 3ZLXA 1GOLA 3D83A 4KUJA 1CSNA 3OMVA 1GAGA 4DEBA 5CX9A 4I6QA 3LFAA 5AV0A 4PMMA 1BL6A 5AWMA 4ANQA 4AF3A 5FTQA 4BTJA 5IKWA 2FUMA 2VTMA 3WF8A 3F82A 4R78A 3PWDA 4QYFA 3DK3A 4XRJA 4A9RA 3R7YA 4N4SA 4FTLA 3O23A 3PE1A 2BCJA 4Q2AA 5BYZA 3BX5A 3V01A 2YIXA 1MRYA 2ZJWA 3WZDA 5A4EA 5CANA 3BLRA 4EC9A 3KXZA 3C50A 5F20A 3AD6A 4RJ8A 5DEYA 1PHKA 4AFEA 4WG3A 2PE1A 5M55A 1YXUA 2FA2A 1RJBA 3TEIA 3V51A 5TE0A 1JAMA 4R7BA 4DGNA 2CSNA 3G0EA 5TOZA 3SXRA 5FBNC 4ANOA 2Y9QA 3LM0A 2C0IA 3QHRA 4BDBA 4M8TA 3C4EA 4U0IA 4BCOA 1ERKA 1UU8A 3DFCB 4ASZA 3LFFA 4UALA 4F6SA 2KULA 4QP3A 4APPA 2BAQA 4EOJA 3PJ2A 4RWLA 3EKNA 3F3WA 3U6HA 1PXPA 2GDOA 4GYIA 3KN5A 4LG4A 3QU0A 2R3IA 4IB1A 4O7VA 2HY0A 2CN8A 2OFVA 4DGLC 4YZNA 4L8MA 5CY3A 5T3QA 4U7ZA 3TNIA 2H9VA 4O1PA 3ZC6A 2JC6A 2O2UA 3RP9A 1W82A 4JQ7A 4MTAA 4WRGA 3NNUA 3SG8A 4DGMA 2QHNA 4I20A 3E8EA 1XBBA 4IZ5A 4W9XA 5EHYA 3Q9WA 3D5WA 3Q9YA 4Z55A 3MPTA 4TTHB 5HBJA 2XIYA 3DBCA 5HESA 5CZHA 4MXOA 4RWJA 4IEBA 1BL7A 4UYAA 1H07A 2BALA 4O83A 2C6EA 3GQLA 1M2RA 3HECA 3FE3A 1LP4A 2VX0A 3V5WA 3EZRA 4YBJA 5AV1A 4CFWA 4O7SA 2QODA 5DG5A 4EH3A 1PXOA 5AMNA 2YITA 4NU1A 2ITWA 1VYZA 3OWKA 4KAOA 4KIQA 3TV4A 3FZTA 4DFUA 1XKKA 5A4QA 4FTOA 3N51A 1H1QA 4H39A 4O0WA 3TNWA 4E20A 1KV1A 3E88A 1O6YA 4HZRA 3MB6A 4O81A 2C1AA 3ACJA 2H8HA 5LVLA 3PXZA 3ZXTA 4MWHA 3CEKA 1E9HA 4BZOA 4QO9A 5HNIX 5T68A 4C3RA 3DTCA 4OT6A 3FMLA 4YZDA 2JFMA 3MFUA 3PSBA 1BKXA 2EXEA 4FTAA 5AEPA 3QWJA 1HCKA 4HCVA 5CI7A 4ALUA 3UOHA 3LOKA 2QC6A 4C59A 3Q3BA 4LL5A 3VO3A 4XX9A 4JDIA 3NYXA 4CKJA 3GCUA 1UWJA 3F9NA 2EUFB 4GH2A 1UKHA 3DTWA 3NCZA 4AT4A 4IM0A 3LXLA 4MF0A 4E4LA 4DLJA 2C5XA 2VO0A 4FR4A 3EN6A 5HI2A 3V6SA 3A7GA 1OVEA 4KA3A 2A2AA 2QI8A 3NIEA 5EDRA 3TM0A 5AAEA 3P4KA 3QLGA 2Q0NA 2AYPA 3OCTA 4CFUA 3MN3A 4CLIA 4IZ7A 4N6YA 2QO2A 2R3QA 4GMYA 4X2GA 1UVRA 3RKBA 1H28A 2HYYA 2O5KA 3GC7A 1ZY5A 4FMQA 4PTCA 4R1YA 2QO9A 2HCKA 4UBAA 4I5MA 2UW3A 3CR0A 4UZDA 4L9IA 3ZSIA 3DJ6A 5DR9A 4RLKA 1ZMUA 4BWKA 2BAKA 2Y0AA 4RFZA 5IQDA 3NAXA 2UZUE 3NUYA 1JSTA 4L6QA 3FLZA 4FG8A 3CPCA 4RIOA 4EUUA 3Q9XA 5BVKA 2BZJA 4EK6A 2OZAB 2C0TA 3MB7A 4FNXA 1V0OA 1WBNA 4HGTA 2WMAA 4YUQA 1XH9A 1YDRE 4ANLA 2C5YA 4JQ8A 4YLKA 2ERZE 3V3VA 3VQUA 2PZPA 3LQ8A 3NLBA 4AT3A 4U42A 4NTTA 2X8DA 4TXCA 3QFVA 5A9UA 3GOKA 4FNYA 2XJ0A 5EH0A 5KUPA 5HCYA 2B0QA 2F4JA 2QKWB 3MA3A 5HG5A 3VS7A 5HVJA 4G6NA 3KXNA 2OF4A 4FK3A 4J52A 2W9FB 2Z7SA 2JDVA 3HEGA 4AN3A 2X0GA 3EMGA 4IC8A 2BPMA 4N70A 1Z9XA 4V01A 5TKDA 5TO8A 4FUXA 3GC8A 5D1JA 5H8GA 1R1WA 4AAAA 2P33A 5J87A 4WNKA 2QLUA 5CVHA 4DBNA 1GIJA 3SDJA 3GCVA 2WTKB 3OZ6A 5AA8A 1Y6AA 5IA1A 1ZAOA 4QTEA 3AD4A 2GNJA 4B0GA 4L42A 4UWYA 4PDYA 4EWQA 3EN9A 5HD7A 4ANNA 3BE9A 5BX0A 3JVSA 2O8YA 3ELJA 5DPVA 2XBAA 4CQGA 3ATTA 3ZM9A 1V0BA 3LMHA 4MKCA 3SXSA 3PXRA 4FTMA 2ZMCA 1E1XA 3Q9ZA 3R9OA 5DT0A 1J7LA 4RIXA 1KUTA 4OTQA 3KCFA 2VTLA 4HW7A 5KMOA 4IWQA 4AZFA 4O86A 2B54A 4U45A 1BMKA 3FAAA 5ANGA 4NM0A 3R8VA 5ANKA 4MXYA 5HOAA 2X81A 3RAHA 1URCA 4HVIA 4I92A 2AUHA 4L45A 5C4KA 3MTFA 5CT0A 2R3LA 3PIXA 2PPQA 3GI3A 3UTOA 4GCJA 2IO6A 3W2OA 5EI6A 3S00A 2BRGA 4CKIA 5CF6A 5E7RA 5AUXA 3F88A 2OJJA 2A1AB 4C2WA 3EFLA 4O6EA 3FV8A 3D7ZA 2R4BA 3O7LD 3RCDA 4ZJIA 4HNIA 1U5QA 2BUJA 5A46A 1PW2A 4OAUC 2WIHA 2IVSA 5FQDC 3DXPA 4BFMA 3DAEA 4IAZA 4BDFA 4GK3A 5L2SA 4L00A 3R1YA 4MNEB 1KOAA 1X8BA 3DAKA 3FMNA 2AC3A 5L2QA 4JXFA 4DEDA 4XG3A 1DAWA 3VNTA 2F7XE 4YZ9A 3R71A 5I3OA 2HK5A 1OGUA 4XV3A 3BQCA 3W55A 2PE0A 3E7OA 1K9AA 4JG6A 1BYGA 3HYHA 4ZJJA 2J2IB 4CV9A 4DG2E 5CU0A 4FTIA 2V5QA 3HMPA 3A4OX 4BCHA 4F1MA 5DVRA 4JIAA 4F9YA 3NYVA 4NIFA 3LFBA 3FSFA 4KB8A 4XJ0A 2I40A 4X6RA 4GG5A 3WE8A 1KE7A 4ERWA 2EVAA 3OOGA 4IJ9A 1OIUA 3I60A 4AX8A 2B9IA 4FX3A 4XNEA 1Q8YA 5EG3A 4GJ2A 4V04A 2JKQA 3UVRA 1UNHA 1WVXA 2NRUA 2ZB1A 4DFBA 4ENXA 2F49A 1G5SA 3RPOA 4D2PA 4F0FA 5BVFA 3C5IA 3F61A 3ZDUA 2PVMA 3MW1A 5CSVA 4F6WA 4F9WA 4UN0C 2BFYA 1NY3A 3LFSA 4YZBA 4BYJA 4ZMFA 2UW5A 3D0EA 3CJGA 2YM7A 3VS4A 3DBEA 2OF2A 3BYUA 5JSMA 3NSZA 3PA3A 5CWZA 4BYIA 4E6DA 5KBRA 5HTCA 4LOOA 4FV8A 1H27A 1WZYA 1DI9A 3FI8A 4EJ7A 4EZ5A 3UNZA 1LEWA 2XIZA 5A3XA 4RA4A 5EQYA 1JKKA 2QG7A 3G15A 2CKQA 2DQ7X 3F6XA 3NNXA 1XH4A 4O0TA 4A4OA 4EK5A 2PVFA 1R39A 3BYMA 4XUFA 4G5JA 2ETRA 3ZUTA 4A9YA 3QQJA 2X9FA 2OI4X 3F5UA 3TNHA 5J5SA 5EOBA 3IPHA 5HIDA 3EWHA 4LFIA 3OWLA 4EYMA 5H8BA 5M4UA 5GNKA 3VS1A 2YFXA 4BI2A 4C4EA 5J9YA 2RG6A 3DKOA 4YJSA 2YCRA 2XF0A 3E93A 3FI4A 3LZBA 2PSQA 3IOKA 2YIWA 5IQGA 3PVGA 1O6KA 1WVYA 3OUNB 1FMOE 4I0RA 5BYYA 1OPLA 5HD4A 3CKWA 4K33A 2R3MA 4N57A 4RC2A 2Y6MA 2GQGA 3DKGA 2C1BA 4O2ZA 3MH1A 3WZUA 1XH5A 1OL6A 2QOOA 1LR4A 3B8QA 2C6MA 2FO0A 1U46A 2YN8A 4YJQA 3LFNA 4ZY5A 1GZNA 4PUZA 4U44A 3C4WA 4OTWA 5KMKA 3P7BA 4ORKA 4C37A 1VEBA 2GNIA 1BLXA 3DQWA 4BGGA 4QMVA 4U5JA 3RZFA 5IEVA 3A7FA 2Z02A 4W4VA 5KZ0A 3OY1A 3I6WA 3MJ1A 1UU9A 3EQPA 5FRIA 2QOFA 5GJGA 3W2QA 4FYNA 4U6RA 2WTIA 4EEVA 3R2YA 2RF9A 3QYZA 1CKPA 3ORNA 3KKVA 4U3YA 4ZP5A 4B7TA 1UA2A 3G9NA 3SOAA 4ANBA 3TZMA 4YJRA 4IB5A 5GJFA 3ETAA 4FZ7A 1P4FA 3QXPA 5GZ9A 2WU6A 2CCHA 2IW8A 3TACA 4ZSAA 2F2UA 4D4VA 4JNWA 1MQ4A 5EYCA 4IBMA 1ZXEA 4Z16A 3MDYA 2B53A 3LQ5A 3QKKA 1QPDA 2R3NA 4FV5A 4YTHA 2GNHA 2YISA 2C69A 2A19B 3QKMA 3ORZA 2PULA 2R3GA 1A9UA 3QRIA 5CEQA 1ZYSA 5KMLA 1PXIA 3ZEWA 3ZSHA 4DT8A 4KIKB 3SOCA 4I4EA 4ZZOA 2Q83A 3HUBA 1LEZA 3ORKA 5AX9A 3WZEA 4IAYA 4UMUA 2VNYA 4G1WA 5J7BA 3UQGA 4FNZA 4RRVA 2ZB0A 2QOLA 2YCQA 2IW6A 2WAJA 4QYHA 5AR2A 2J0IA 5D9HA 4K18A 2H34A 3GFWA 3EL8A 2YHVA 3R83A 4EZ7A 4MXXA 4QTBA 2OU7A 1PYEA 4KBCA 3O96A 3RHKA 3RPRA 2HW7A 4QP6A 4EK4A 3IW6A 3A61A 1Y57A 3GU6A 3V8WA 5LCJA 3I5NA 2CKOA 4I0SA 4ZY4A 1F0QA 1TQIA 3Q4ZA 1TVOA 4QQTA 4I24A 3HNGA 4C3PA 5JGDA 2XBJA 2BVAA 4EK3A 2V0DA 4YO6A 1HOWA 4TNBA 4WG5A 4Y72A 5H3QA 4ACDA 4UEUA 2Y4PA 1XH8A 3ZMMA 2XNGA 4I41A 2VX1A 1SYKA 2YIYA 3AC2A 2WNTA 3FZPA 5AIRA 1IRKA 2VRXA 4Q5HA 3FJQE 5HLPA 4IAKA 3IONA 3L8VA 4PV0A 3OCGA 4RVTA 4CG8A 4FT3A 3PZEA 3HV5A 4BHNA 2AC5A 2B55A 3LFDA 3UMXA 5L2TA 1YWNA 2PVLA 3PZHA 5HE1A 1YI6A 3WI6A 3PJ1A 3SW4A 3BHUA 4QTCA 3PJ3A 2O65A 4QYEA 5AV2A 5F9EA 4APCA 4R8QA 4RPVA 1DM2A 4ACMA 4F0GA 5L8JA 1OPKA 3K3JA 4M69A 4QMXA 2W1IA 4W4XA 2BHHA 4YLLA 3SAYA 3W10A 4J71A 4YR8A 4K11A 2P55A 2ESMA 2FH9A 2OZOA 2WMQA 2W4JA 4GSBA 5EK7A 4D0XA 3WF7A 3ODYX 3BV2A 4E1ZA 4CKRA 3LKMA 5K0KA 2VTJA 5FXRA 4YMJA 1M2PA 2Z2WA 3NYNA 3R0TA 5T6KA 3GNIB 5IQAA 3K2LA 3L9NA 4D0WA 3ATSA 2PVYA 5CF5A 4QMYA 5LMKC 5BVWA 5AADA 5CF4A 4IMYA 1MQBA 3NUPA 3OCBA 4GVJA 4QYGA 1YI4A 1JKTA 3ZHPC 4IANA 4WG4A 4M84A 3LCDA 5JKGA 1IA8A 2BDFA 5DN3A 4FEUA 5CEIA 1Z5MA 2GHLA 5HIBA 1XWSA 4WOVA 2BZHB 4ITJA 2V7OA 4JBVA 5L2IA 5DH3A 4FSTA 4EC8A 4PPCA 5J7HA 2YDKA 2X2MA 5E90A 1J91A 3ALOA 4J8NA 5DA3A 3OCSA 4X3FB 4KKEA 3RVGA 4PP9A 3OW4A 4RSSA 2A27A 3FZOA 4D4RA 2B9JA 3E64A 3ENMA 3THBA 3DA6A 3RM7A 1JSUA 4BI0A 4E93A 3RHXA 4E5WA 5HG7A 5AFVA 4L44A 4L43A 5KCVA 4DINA 2I0HA 4BCJA 1PMNA 3FMHA 1AQ1A 1VJYA 3A60A 3MIAA 4C2VA 5CEPA 2QNJA 4U8ZA 2VV9A 3I81A 2XZSA 5M4CA 2WEVA 4G17A 2OIBA 3NW6A 5CXHA 2W5HA 3BGQA 3MFRA 4BRXA 4WA9A 5AUYA 4FA2A 3DCVA 2WIPA 4EOIA 2QR8A 4Z3VA 5DIAA 2RFEA 3QGYA 4E6CA 5FLFA 4FVRA 4HNFA 4DH3A 4O7RA 2ZV9A 4HJOA 4FV6A 2BILB 3C9WA 5EHOA 3RAKA 4ZTMA 5IU2A 1MRUA 4K9YA 2XM9A 1OKZA 4X2JA 1OM1A 1M7QA 4RWIA 4A4XA 4FGRA 1ZOEA 2C6DA 4CFXA 4TWPA 3V5JA 4BIDA 4CMOA 4XRLA 1SMHA 3TDWA 2ZV8A 3FC2A 5D11A 4EH6A 5DGZA 5M44A 2R3PA 2PY3A 5AP1A 1PYXA 1OITA 1REKA 3MFSA 4IVCA 3VVHA 1QMZA 3VUIA 5IEYA 3ZO2A 4Y5QA 4XBUA 2R3FA 4I1ZA 4R3PA 3R7UA 3AC5A 2VD5A 1QPJA 2VTRA 2QOKA 2IN6A 3LW0A 3TJCA 4BC6A 2UVXA 2PWLA 5HTBA 1OIRA 3AQVA 4FKLA 1H1SA 5KKRB 3HAVA 3A4PA 4FC0A 5B0XA 3D5VA 5IPJA 4GFGA 3DB6A 4YZCA 4FG7A 3FXZA 2OK1A 2YJRA 5HU3A 4YSMA 3LJ2A 4L46A 4KRCA 3MV5A 4DH8A 2CNQA 5TT7A 5HVKA 1H1WA 1KWPA 2JKKA 3S2PA 4CT1A 5E8SA 1B6CB 1GIIA 4DE4A 3P0MA 4GT4A 4U43A 3VJNA 4K77A 4CZTA 5BMSA 3WZKA 4ACHA 2PZRA 5D10A 4PNKA 3SW7A 4QMQA 4AUAA 3GUBA 2WMBA 3RALA 4Y46A 4M68A 5E91A 3GVUA 4IWDA 2XS0A 1YXTA 4FGBA 3BBWA 4ZSGA 5JGAA 3NYOA 4FZAB 4DTKA 3CY2A 3KULB 1XH7A 4YJTA 3PXKA 4NK9A 1BUHA 2QOBA 2XKFA 3F3ZA 4FKUA 3R7EA 2R3HA 1STCE 4WSQA 3LE6A 1H08A 3MSSA 2NP8A 3CCNA 4XBRA 4EH8A 5L6PA 3EN4A 2W17A 3SLSA 3NVKI 3KCKA 4G6OA 1ZMWA 3N4VA 1SVHA 3U8WA 3NS9A 4FT0A 3ORXA 4AW1A 2ITUA 4TYEA 3BRBA 4JT3A 3UOJA 1YXXA 1RE8A 3COMA 4HPUE 1P4OA 2J5FA 1CM8A 1GZOA 4G16A 4BDJA 3H0ZA 4J97A 4ZSEA 3R8UA 2GFSA 3SA0A 5CZIA 4R77A 3ZEPA 4KKGA 4TYHB 5J1WA 4JX7A 2OW3A 4MNFA 3RK5A 4UWCA 4NT4A 3Q04A 4G5PA 4DEIA 3UG1A 4YJVA 1WBTA 1OL2A 5AR3A 5M57A 2GMXA 4ITIA 2QVSE 4IWPA 4LGHA 5DYJA 3FPMA 4WHZA 2G2FA 4W4WA 4NFNA 2Y7JA 4CRSA 5CSXA 2VWYA 4IM3A 5FWKK 4QYYA 3TV7A 4ZTSA 3ZSGA 5FGKA 3Q52A 2ONLA 2ZDTA 2W05A 4ZLZA 3Q6WA 2W99B 1E1VA 1ZYCA 1PRYA 3BCEA 4F9BA 4XEYA 5DMZA 4LRMA 2PVRA 2YAAA 1B38A 4KIOA 4KS7A 3T9TA 1L3RE 3D7TB 2W9ZB 3A62A 4H36A 5CAQA 2VAGA 3OT3A 4H3PA 4UMTA 4QQCA 4RJ7A 2I0YA 4MAOA 3ZLYA 1YXSA 2WB8A 3UO5A 5HE2A 3RPYA 4NM3A 1IA9A 3DU8A 4D2RA 1O9UA 4BZNA 2ZV7A 3RAIA 4GKIA 3EHAA 3HAMA 2F7EE 3CY3A 3EQRA 4RIYB 4UXLA 4XG6A 5CQUA 2WMTA 4BBEA 3TDVA 3D94A 4M67A 3UQCA 3B2TA 3OHTA 3MVLA 5CI6A 3F7WA 5CAOA 3W8QA 4A06A 5K4IA 5ANDA 3AXWA 3COHA 2R3RA 4Y8DA 3U6IA 4PPBA 2HENA 3ROCA 4OR5A 4GJ3A 3OW3A 2OGVA 2HZIA 3SHEA 5ICPA 2C6OA 3MFTA 3QX2A 3QCYA 4MK0A 4AOIA 4CMTA 4CZUA 2ZYBA 3MI9A 5DRBA 5EDPA 4B6LA 3KXGA 3WF5A 3UOLA 3QUDA 5HLNA 4BDKA 1DS5A 4O7TA 5FUTA 3C4CA 4WSYA 4FKTA 4PDPA 4D1XA 3LLTA 5C9CA 4BCQA 5IQHA 3LLAA 5A14A 2B4SB 3DKFA 5LVOA 5HHWA 1IAJA 3CIKA 4H1JA 3PLAE 2ERKA 4JG8A 4MEDA 5K9IA 3PA4A 5EM5A 4BCPA 4HCUA 5E8TA 4CCBA 2SRCA 3AC8A 3GC0A 1L8TA 4FTTA 1WBOA 4BCFA 5CAPA 3R2BA 4AE6A 4EZ3A 4IZYA 5BUIA 3IG7A 3KF7A 2EWAA 4M66A 1PMEA 3WOWA 1PXMA 3RMFA 3NVMB 2CGVA 2G15A 3CTQA 3OY3A 4Z9LA 5IQEA 4NIFB 4YTFA 1H00A 4D4YA 2PHKA 3QXOA 5DR6A 3VS6A 4E5BA 3VRYA 4NTSA 1OMWA 2X4ZA 2VWVA 2VWXA 3K54A 3BZ3A 5CU6A 1JNKA 1YXVA 3NR9A 3TT0A 5LVNA 3RM6A 4ZOGA 5I5ZA 4UV0A 4I23A 4TWOA 2W4KA 4IZAA 4X21A 5HTIA 3KEXA 1PXKA 4BGQA 2YWPA 5ETIA 5AP5A 2DS1A 3SX9A 3QTIA 4ASEA 3H0YA 2GNFA 2R2PA 4O38A 1PY5A 1Q4LA 4QP7A 3ULZA 1W84A 3HX4A 4CXAA 4DGGA 4QPMA 4EH2A 3QALE 4HYUA 4RVLA 2QO7A 4Z7GA 4TY1A 3Q2JA 4FKVA 3RNIA 4NL0A 1IR3A 4BIBA 4R3CA 3BGZA 4FKWA 1BI7A 3TZ7A 3DY7A 2FB8A 4DG3E 3U55A 3G6HA 2WTVA 4FTCA 3KU2A 4IE9A 3FMKA 3IW4A 4EQUA 2JEDA 3QQLA 5KHXA 5AM6A 4FBXA 1YHWA 1QCFA 5EDQA 3DBFA 2WOUA 5L6WL 3QQHA 4FKIA 4AT5A 5GIPE 4BGHA 4IDVA 4L3PA 2JIUA 2XNOA 4BIEA 5EM6A 4QNYA 3WYXA 1RW8A 4QPSA 1W0XC 3CD8A 5TF9A 2IVVA 2WQBA 3ZO4A 3OTUA 4DGOA 2P2HA 4G9RA 5DBXA 1YHVA 4FNWA 5CXZA 5IUIA 3UVQA 5HZNA 4BDCA 4IJPA 4V0GB 4BL1A 3RBWA 3CJFA 1NVSA 4C8BA 3DB8A 3E62A 3U51A 3HRFA 2J7TA 2W1ZA 2IWIA 2GCDA 4P5QA 1G8AA 3VWAA 3BV3A 3OBGA 2PVJA 3FL4A 4UWBA 4IXPA 1KV2A 1ATPE 3UNJA 4F65A 1W7HA 2Q0BA 4QP9A 5F94A 5G6VA 3PSDA 3ZFMA 4E73A 2BZIB 3H30A 5JZJA 3DFAA 4YSJA 4NCTC 4JBPA 5LWMA 2PVHA 3VS0A 2R5TA 4IVAA 1PKGA 2EXMA 1OI9A 3D2IA 2QU6A 4QP8A 3VF8A 5JFWA 3E5AA 3G33A 5LJJA 3ZFYA 3V5TA 1F3MC 4NWMA 4UY9A 2V55A 1ZOGA 2P2IA 2Z7RA 2JGZA 2P3GX 2WTKC 1YW2A 2ITXA 1HCLA 2XNBA 3ZUUA 3BPRA 4O6LA 3VUKA 2ITYA 3UIBA 3ZZWA 2CGWA 5A4TA 4JIKA 2XA4A 4O0VA 5DR2A 5HICA 3NRMA 2F57A 5FP6A 4UX9A 3DT1A 4GS6A 4C4GA 3JS2A 3ZDIA 4AWIA 4Q9ZA 2VTQA 4WO5A 4PL3A 3PXQA 2W1CA 4ZTRA 5FBOA 4O0RA 3LCTA 5C27A 5C8MA 2Z7QA 3GGFA 1AGWA 3DDQA 3R7OA 4AN9A 5HORA 4R1VA 5HQ0A 4JI9A 3RINA 4ZAUA 1H26A 3QCSA 4EOQA 3FBVA 2JAMA 4X6QC 5E8ZA 3QCXA 1YKRA 4UYNA 4PDOA 3F3TA 3DOGA 3MY5A 4FT7A 3VS3A 3TCPA 1IG1A 3AC1A 2UW8A 3VN9A 1KE8A 3DBDA 1Y8YA 2XJ1A 4QP4A 4W4YA 1UKIA 1QL6A 2ETMA 3P08A 4AZVA 1Q41A 3HV4A 4IB3A 1CKJA 5C26A 2OXYA 2X39A 3QTRA 4JL9A 1LPUA 2XP2A 3LJ0A 2NO3A 4QMMA 3H3CA 4ENYA 4JVGA 4GT5A 3WARA 2HAKA 4U80A 3KXMA 3U6JA 1ZYLA 1O6LA 3GCSA 3UODA 2JITA 4FTKA 3QZIA 3ODZX 2VZ6A 3GU4A 4LGDA 2XIXA 4GUEA 3R04A 4QOXA 4F1OA 4I94A 2Y4IB 5B7VA 5M08A 1S9IA 3MPAA 3FPQA 4I21A 1OUKA 5HIEA 3QQGA 4MQ1A 2I0EA 3ZONA 3FMDA 4FV7A 4FEVA 4RIWA 3AC3A 3CQUA 4CEGA 3OXZA 3A7HA 1WMKA 4A9SA 4MYGA 3EQIA 4BHZA 3RJCA 3I1AA 3UC4A 5A54A 2GS7A 4FV3A 5J9LA 5M53A 3M1SA 3RTPA 1XH6A 4DH7A 4DH1A 2FGIA 2J0LA 3NUAA 5L8LA 4MF1A 3A7IA 3P78A 5AJQA 1WVWA 4M69B 4BDDA 1R0EA 3UG2A 4BCMA 4C61A 2YM4A 4OW8A 4FV4A 4XHKB 1AD5A 1RDQE 4LV8A 3W1FA 2X7OA 4O7NA 3H9OA 4RWKA 4LL0A 4FT5A 3LCKA 3QTQA 2PZYA 3I5ZA 4MBIA 2PUNA 3UC3A 4XS2A 2C4GA 4DFNA 4DA5A 5GJDA 5GINE 3BU6A 5AUZA 2XYUA 3ID6C 5KZIA 2ITPA 2QR7A 4G34A 4I5CA 4RZWA 2OIDA 3MTLA 2BRBA 1OL7A 4C02A 5AR4A 4BKJA 1IAHA 2VWUA 3TKUA 1JSVA 1OIYA 3HMNA 2E9NA 2CGXA 2W06A 4RC4A 4M7IA 4DFZE 3NUXA 4D4SA 4EOKA 4BDIA 4JS8A 4YGAA 4YU2A 2WZJA 1H1RA 2Z8CA 2R3KA 2J90A 2HOGA 2BDWA 4AGDA 4KWPA 5K5XA 4QP1A 3C4XA 3FHIA 2JBOA 4XCUA 1R0PA 5FDPA 4XV9A 4U40A 3I0OA 4IM2A 4U3ZA 4F7LA 2X9EA 1QPEA 4DEHA 3DPKA 4AXAA 4HVGA 2P0CA 3POZA 3UNKA 4TYGA 3VS2A 3VRZA 2X6DA 1UNLA 4CV8A 4E6AA 5IMXA 4K0YA 4XG7A 5CNOA 4CG9A 1Q97A 3QCQA 2XKDA 4RVMA 4XP3A 4GV1A 5J79A 5LXMA 4FV0A 4GU6A 3I6UA 5GHVA 3BHTA 1REJA 3W2PA 5JFSA 3ERKA 5H8EA 5IH4A 5K5NA 5HE3A 2VTAA 5EKNA 4E3CA 3PIYA 4OTHA 3PVWA 3S4QA 3TWJA 4ERKA 3MBLA 4OAVB 1VYWA 2XIKA 4O0UA 4D2SA 3V5LA 4O7LA 5HGIA 5HNGA 2VTPA 3MWUA 3UGCA 2C30A 2XNMA 3HV7A 1YWVA 3G5DA 4CFMA 3BU5A 3FXWA 4TRLA 2BRHA 4XYFA 4FKPA 4YTIA 4JBQA 3BHYA 3F2AA 3A8XA 4O0XA 5LARA 3PFQA 3JY0A 1WBVA 2VTSA 3R1NA 5KX8A 5FXQA 3HKOA 4AP7A 5GIOE 3E3PA 2PMOX 2QKRA 3IGOA 4UMQA 4O7YA 2H6DA 5I0BA 2BKKA 3MESA 2C6IA 4BCNA 3KXHA 3DQXA 4FSUA 3UYSA 2R64A 2JFLA 2VTNA 5CS6A 3DZOA 3A2CA 1YHSA 2RKUA 5AP0A 3HRCA 3FY2A 1GZ8A 2Z60A 1ZOHA 4LGGA 3H4JA 2HXQA 2R0IA 2FVDA 3QZHA 4WRSA 4DH5A 5JRSA 4BCKA 5IA2A 2HXLA 2YEXA 2PVKA 3EQCA 1Z57A 1SNUA 3P7AA 4E4MA 4FVPA 3E92A 4AACA 3OC1A 4NW5A 4HGEA 5L2WA 4E4XA 3JYAA 3PE2A 4F09A 3OXTA 2C3KA 3Q60A 1YOLA 4FSRA 4PMPA 1U54A 3PY3A 2OZAA 4H3QA 4RBLA 3LIJA 4LOPA 4O27B 1XBAA 3BU3A 3OF0A 4D58A 4QRCA 2YLEA 4E26A 3BKBA 5FG8A 5CYIA 1DI8A 1FPUA 3JUHA 1JLUE 2VTTA 3DAJA 3O7LB 3QQKA 4KD1A 3T3UA 4FT9A 4GUBA 2YIQA 3BI6A 3QX4A 3EB0A 4LMNA 5E4HA 3MVJA 5HBHA 4BN1A 4QP2A 5C8NA 4TKSA 1FGKA 4HVHA 1JKSA 3M11A 3F5PA 3GU5A 2C47A 3LVPA 4H1MA 3NCGA 4JLCA 5FDXA 4FTJA 5CU3A 5JGBA 4TT7A 4L68A 3VBWA 2F9GA 3QF9A 3QRTA 4JDJA 4BDHA 4ARKA 2ACXA 4R6VA 3W2CA 3PXYA 4AA5A 4EH9A 5IG1A 3U54A 5EYKA 3ZZEA 3PIZA 2FSTX 3PG3A 2XNNA 2R7IA 3NEWA 2XM8A 4F9CA 4CFFA 5IDPA 1TQMA 5M4FA 2FYSA 4QMWA 3POOA 3TKHA 4GIHA 2HELA 4IC7A 2QU5A 3R6XA 5DHJA 4CSVA 2QLQA 4OBOA 4JRVA 4LV5A 4ZK5A 5M07A 3VBVA 4PL4A 2VGOA 5LCKA 3KMWA 1ZYJA 4M12A 5B2MA 4DBXA 3P23A 4C33A 4IFGA 3UIUA 2VO6A 2IPXA 3QKLA 4AOJA 3GEQA 4O0SA 4P2KA 5AM7A 4XP0A 1PXNA 1Q62A 3ORMA 1J7IA 3BYVA 2E9UA 5ACBC 2W1HA 2PK9A 3CQWA 3R63A 4MX9A 3MVMA 4HPTE 2PE2A 3NW7A 5EM7A 1OL5A 4DFYA 2QCSA 3NUSA 1JWHA 3ZBFA 4UZHA 5HG8A 4RJ6A 5BQ0A 3WZJA 3D5UA 4FIEA 5CVGA 1W8CA 2WMXA 2CLXA 3ENHA 3UZTA 4EOPA 4M0YA 4GIIA 3U4WA 1Q5KA 2B9HA 4X3FC 2UW4A 3KXXA 3R8LA 3N9XA 3BBTB 2YA9A 4MNEA 3Q6UA 3MPMA 3VUTA 4CTBA 4PY1A 4L52A 5IQFA 1PKDA 2UV2A 4MD9E 3RWQA 2UZEA 3SC1A 2PTKA 5KBQA 3CS9A 4J7BA 4DEAA 3DS6A 2WQEA 2PYWA 4IFCA 2ZM4A 3TNPC 4QMLA 5A4LA 2GTNA 2GQRA 5ETAA 3QRUA 3NMUF 4ZS0A 2CNUA 3CTJA 1QPCA 2ZM1A 3EQGA 2LAVA 2OG8A 3F66A 4EONA 3BHHA 3KRRA 5JRQA 4BZDA 4L7SA 3QC4A 4ZEGA 3KF4A 4JDKA 4S2ZA 4RA5A 3UZPA 1UV5A 2RGPA 3ROYA 2VX3A 4EORA 4O21A 2E9OA 5IZFA 2XVDA 3FC1X 5FP5A 2CMWA 1I44A 2VO7A 5HNBA 4F9AA 2GPHA 1YVJA 2B9FA 4RLLA 2RFDA 3NGAA 2YERA 2IW9A 3VIDA 2DWBA 5K4JA 2PU8A 1YWRA 1FGIA 1FOTA 3HMMA 4M0ZA 4WIHA 3KMMA 4F70A 2WD1A 3CLYA 5BVEA 3FUPA 1JBPE 1ZRZA 4FIGA 5AA9A 2QOQA 4YJOA 3Q4UA 3ZBXA 4PRJA 4ALWA 1JKLA 4HOKA 4IAFA 3EOCA 2G2HA 3R8PA 4IWOA 2A0CX 4P7EA 2BFXA 4YZMA 2YIRA 5DWRA 3TIYA 5LOHA 3F7ZA 3QAME 3ZO1A 4FODA 5TR6A 4P4CA 5B2KA 5JFXA 3OEZA 4RT7A 3VUDA 4B99A 1Q3WA 4QMOA 5CSPA 3ET7A 5KKRC 3FI3A 2HZNA 3GCPA 4E7WA 2GS6A 3TXOA 4YPSA 5KMNA 4D5KA 4C38A 4F7JA 2RIOA 2XH5A 5J95A 3SRVA 4YURA 3HZTA 4WNPA 2BZKB 5IQIA 4FK6A 2J0MB 4LM5A 4BDGA 4Y85A 3WIKA 2GNGA 4FIFA 3UP7A 2OXDA 3W2RA 4FIIA 4AGCA 5AV4A 2QOIA 3BELA 2WKMA 1SM2A 5JMSA 3EL7A 2G1TA 3OT8A 5LVPA 3NNWA 2PMNX 2PMLX 4FEXA 3DLZA 4DEGA 4JX3A 3CC6A 4YJPA 4A07A 2YLFA 2I6LA 4FICA 4IVDA 3COIA 4ANSA 1XJDA 4UMRA 1KOBA 3IO7A 3I79A 2WFYA 4C7TA 3UQFA 3LCSA 5ACKA 2UZVA 1PJKA 3QYWA 3R01A 4XG2A 3E63A 3W2SA 4II5A 3ZH8A 1ZY4A 1WBWA 1OUYA 3O2MA 4CQEA 1MP8A 3JXWA 5ETCA 2G01A 1H1PA 3F5GA 4LMUA 4O7WA 4FI1A 5D7AA 2UZDA 3HMOA 5CEOA 4GT3A 5H2UA 5LVMA 3KY2A 5AP2A 2JD5A 4TPTA 5EI8A 5K3YA 4A9UA 3OD6X 1U4DA 2HIWA 2BR1A 1WBSA 4RC3A 4I93A 3ZRKA 3MS9A 5M4IA 1ZLTA 2O3PA 3AMBA 2X7FA 3FLQA 4FSNA 3KK8A 4B8MA 2JDOA 2W96B 3MYGA 3ALNA 1J1BA 4AE9A 5ETFA 4BDAA 2XNPA 5AV3A 4DAWA 3FQHA 1PXJA 2HWPA 3OROA 4OBPA 4I3ZA 4RQKA 3IDPA 1M14A 4C57A 3Q5IA 4KBKA 4KIKA 3R9NA 5L8KA 1FVVA 3CP9A 3E87A 4HCTA 2OFUA 2X8EA 4Z7HA 1V0PA 3K5VA 3RCJA 4AQCA 5K0XA 4AZTA 4ZTHA 4JRNA 1V1KA 2W1DA 4JOAA 3UO4A 3ZU7A 4C0TA 4O0YA 2VWWA 4PX6A 3BLQA 5E8YA 1FINA 3R9HA 3RI1A 1OBDA 5G1XA 4CD0A 3ANQA 3MIYA 4A4LA 4NEUA 5DRDA 5J5TA 3OG7A 3TTIA 4RVKA 2WMWA 4Y73A 4C34A 5AUTA 4XG4A 3JPVA 3KRXA 2ZAZA 3UP2A 3WBLA 2V7AA 5CSWA 3QL8A 1Q61A 3KMUA 3R7VA 3ZM4A 2Y6OA 4J98A 1T46A 3KRLA 1MRVA 3JVRA 3NX8A 4KS8A 4AW0A 3W16A 5BVOA 4IX4A 4FV1A 5JH6A 1OB3A 3BWJA 1IASA 1SVGA 3GENA 3HMIA 4FSYA 2I1MA 4FV9A 3RK7A 3BYSA 3M42A 4W8DA 1Q24A 2B52A 3FLYA 2BHEA 2J0KA 2E2BA 2P4IA 3DLSA 3UOKA 1UWHA 4U9AA 5EHLA 1J7UA 3C5UA 2UZNA 2UZOA 1R78A 3ANRA 3BYOA 3L9PA 3QTZA 4FZFB 4DEEA 5B2LA 5IUGA 1ZZ2A 3ZS5A 3SV0A 3E8DA 4QMUA 1JOWB 3EQHA 2W0JA 3MH0A 2QONA 4HYSA 2JBPA 2OIQA 1NW1A 2W1GA 3TJDA 2WOTA 2O64A 3Q32A 3O71A 5AR8A 1Q8TA 3PVBA 4FTUA 4MXZA 5CEKA 5M51A 4UMPA 2E9VA 4ZTLA 3KB7A 4RIXB 5CU4A 4Y5HA 3GT8A 2WHBA 1BX6A 4L3LA 1XBCA 3IOPA 5AUUA 4OTGA 2VTOA 4EH7A 3OFMA 2C3JA 3BHVA 2GNLA 1B39A 2XRUA 3FZRA 3FQEA 1H8FA 5HO8A 3UZRA 3P5KA 3QBNA 2UVZA 4YJNA 5HU9A 3FZ1A 1VZOA 3VAPA 3AD5A 3HV3A 4MH7A 1CMKE 2CKPA 4O82A 4L01A 4RX9A 4QQJA 2YABA 1OIQA 5IEXA 4R3RA 4HZSA 3DK7A 4KNBA 3F3UA 5A6OA 4PMTA 4PQNA 4BY9E 1JQHA 4UXQA 2OO8X 1H0WA 5HE0A 3Q4TA 3VW8A 4EHGA 3TUBA 4NYEA 3EIDA 3MH3A 4X3FA 1YOJA 5LMKA 4DT9A 3LHJA 4RIWB 4C4HA 3JR1A 5BYLA 4CCUA 3T3VA 5FTGA 5EYDA 3VQHA 2Y8OA 4DF3A 2BAJA 5AP7A 2O0UA 4LRKA 1M2QA 3QD4A 4PMSA 3DJ7A 3D9VA 3AGLA 3FQSA 5HVYA 4RX7A 3OVVA 4G3FA 4LQMA 3E8CA 3GBZA 2ITOA 4CLJA 3PYYA 1URWA 4S34A 3SXFA 5F4NA 2VTIA 3VHEA 4EOSA 5IQBA 4HGSA 4W8EA 3FWQA 5JT2A 3DK6A 4AZWA 3R22A 4CRLA 4W9WA 4IADA 4O1OA 5EW8A 3QA0A 1G3NA 1Q99A 4FIHA 4X3JA 4GW8A 4B4LA 4BTKA 3ULIA 3SQQA 4EK8A 1IEPA 4OUCA 2PUUA 2ITQA 2WTWA 2UVYA 2J6MA 2XEYA 3F5XA 4IB0A 1I09A 4XLIA 2C6TA 3TUDA 2W5BA 2XIRA 5C03A 3G6GA 2R9SA 2OH0E 4L7FA 5EYMA 2ZDUA 3KVWA 2C5VA 4DTBA 5A6NA 4FF8A 3U4UA 5BUJA 3QTUA 4GVAA 4ZIMA 5JQ8A 4S33A 3TUCA 4FKOA 5AUWA 3AC4A 4NKSA 4FOBA 4ONAA 2ETKA 3P1AA 4JG7A 5KO1A 2QOCA 3GU7A 4IDTA 4NW6A 3RAWA 4EH4A 3HP5A 2A4LA 3DBQA 4P5ZA 5E1SA 4YP8A 4BWXA 3EN7A 4EHEA 5KNJA 4BI1A 3QD2B 5CNNA 1YOMA 2WXVA 5CVFA 4GKHA 4YLJA 1SVEA 2PZIA 1CKIA 2ZV2A 4I0TA 5FM3A 5HX6A 4D55A 5CLPA 4MBJA 4BB4A 2BROA 3FKNA 4PWNA 5J9ZA 4Y95A 2IG7A 1G8SA 5ITAA 3COKA 1J1CA 3FKOA 2IZUA 4H05A 3FKLA 3UBDA 2ZM3A 5HKMA 4YTCA 5DE2A 2VWBA 4PL5A 1WCCA 2QD9A 4BDEA 4EHVA 4M97A 4KRDA 4OGRA 3CGOA 4F08A 1OKWA 4XG8A 3PDTA 2PZ5A 2FSOX 4YHTA 2OBJA 3FI2A 3ZRLA 4I5PA 3FYKX 3PXFA 4IH8A 2JDTA 4EBVA 5ANOA 2O63A 2GQSA 3R1SA 3P79A 4C4IA 1YRPA 2XMYA 5I9UA 4FSZA 4NJDA 2CDZA 3NDMA 4IAAA 4J96A 3HDMA 5CT7A 4JQEA 1A48A 3R02A 5GZ8A 4AW5A 3L1SA 4EWHA 5FTOA 1GNGA 2VWZA 3A99A 4D1SA 5I9YA 1M52A 4ZZNA 5M06A 3KQ7A 2BKZA 3HGKA 4IW0A 4V05A 3IDCA 5IH5A 3QTWA 1YDTE 4U81A 5HLWA 3TIZA 3FLNC 3G0FA 3KULA 4TW9A 4EKKA 2UUEA 3SG9A 2CCIA 4BBFA 2JAVA 3RZBA 4CFNA 3DKCA 5CEMA 2WMRA 5JEBA 2YACA 2X2LA 4FTNA 5E8WA 3RPSA 4BKYA 4FSMA 4TWNA 4JAJA 4F7SA 5E8UA 3RGFA 2PUIA 3QQUA 4IX6A 3BIZA 4FKGA 3VBTA 5L4QA 4GYGA 1XO2B 5EOLA 4AN2A 2R0UA 4ZTQA 2ITZA 4LUEA 4QMPA 4HYHA 3R8ZA 4ACGA 2YCSA 1U54B 2UW6A 3MGYA 4WT6A 3JY9A 3DZQA 4IHPA 3R1QA 4IACA 4J95A 3IKAA 2OWBA 2YZLA 3LJ1A 1WBPA 2PVNA 4TYHA 4U79A 2XCKA 5M56A 3R30A 2WTJA 3TTJA 4C62A 1J3HA 1SNXA 4F7NA 4ZSLA 4R7IA 3GC9A 4RZVA 2PUPA 1H25A 3Q2MA 3TKIA 3EQBA 4PPAA 3U9CA 4PDSA 2VNWA 2J5EA 2Y4IC 4AA0A 3LAUA 4PP7A 4B9DA 3I0QA 4FSWA 4KKHA 4MD7E 3PPZA 3KGAA 4EQMA 3UVPA 5JK3A 3FXXA 5CU2A 3WF6A 4WBOA 4D2VA 4EOOA 4HVSA 5M09A 4ZJVA 2ITVA 2XKEA 4QMZA 3K5UA 3R9RA 3D7TA 2ITNA 1KE9A 3L9MA 4GRBA 3R9DA 2VWIA 1T45A 4Q9SA 3QHWA 3T8OA 2RG5A 3P7CA 2HW6A 4BBMA 4K1BA 2QQ7A 5I3RA 4GK2A 4WUAA 2WU7A 3CGFA 4YC3A 2IZSA 2OICA 3IGGA 3ZRMA 5BVDA 3VULA 5IF1A 4RIYA 1FMKA 2BTSA 3EZVA 3LXNA 3QZFA 3N4TA 3S95A 5C4LA 4GU9A 4CMUA 3UO6A 2C5NA 4CGAA 1FVTA 3C0IA 4OTPA 2XK8A 4R5YA 4XMOA 4ZMEA 3TI1A 5CAVA 4H3BA 4WUNA 3C7QA 1PMUA 2XUUA 2H96A 5EKOA 5CALA 4K8AA 4FUYA 2F7ZE 4MXCA 3I7BA 2X4FA 4ITHA 2XKCA 2XNEA 3FHRA 5IA5A 1OKVA 4XV2A 1R3CA 3UE4A 3NNVA 4JAIA 4EUTA 4EL9A 3LM5A 2UZBA 3SVVA 3IECA 3BEAA 1XR1A 3BLHA 3K3IA 5LWNA 4OTDA 3MJ2A 3V5QA 3ORPA 2WELA 1Y8GA 4IIRA 3FEGA 1WFCA 2X8IA 2OLCA 3CPBA 4DCEA 2WMSA 4U97A 3IW7A 4WNOA 3NIZA 3KVXA 3GQIA 2EXCX 3FDNA 3VBQA 4TNDA 3U87A 4EKLA 5CAUA 3GB2A 3O50A 5HO6A 5DT3A 3ZUVA 1Y91A 3UYTA 4EOMA 3EFJA 3TV6A 4MVFA 2DUVA 2XK6A 3HVCA 2VGPA 4TL0A 1JVPP 2CLQA 4RJ5A 5IQCA 5J8IA 2IZRA 4XG9A 5H9BA 3GXLA 3R73A 2OJGA 3ZXZA 4DLIA 2ZOQA 4ACCA 3Q5ZA 3G2FA 1W83A 2R3JA 3TL8A 3NAYA 3HL7A 4E6QA 5CF8A 3KL8A 3UDBA 1MUOA 4BVUA 3V5PA 5JN2A 3C13A 2VUWA 4AZEA 2VTHA 5EQEA 4RJ4A 2YM5A 2RFSA 2WTDA 2I7QA 1OKYA 2JKMA 3FMMA 3VBXA 3O8PA 4WKQA 4AOTA 4M14A 3R00A 3WYYA 4AGWA 4ZLOA 3DNDA 1KE6A 4NSTA 4AA4A 4AFJA 4I6FA 5F95A 5C01A 4DFLA 4YO4A 2GTMA 3KREA 1P2AA 4S32A 5D7VA 4AW2A 4UB7A 3O51A 5D12A 1H01A 1ZYDA 3PUPA 5IISA 1EH4A 5HBEA 2NNWB 3VHKA 4HGLA 2LGCA 1Q8UA 5I9XA 1NA7A 4DHFA 3FYJX 4EHZA 5ANEA 4C3FA 4IX3A 4OTIA 4OBQA 2BIYA 3QZGA 4Y83A 4I4FA 5FM2A 5HEZA 3EYGA 4L67A 2EB3A 4FOCA 4J99A 3AMYA 5BUEA 4FTQA 3PTGA 1CDKA 1WAKA 3LPBA 4XH6A 4IVBA 4RX8A 1ZARA 4RQVA 4QD6A 1FVRA 2WQMA 3PY0A 2CHLA 2OXXA 3R28A 2V22A 3MVHA 4AS0A 3V8SA 2F2CB 2J9MA 3PG1A 4RX5A 4KSPA 2WO6A 5AX3A 3GCQA 2B1PA 1VR2A 4JDHA 4DN5A 4X0MA 5AP4A 3A7JA 3KC3A 2J51A 3ORTA 5ANIA 3SRVB 5DI1A 4GL9A 3REPA 5D41A 3IDBA 3LFCA 3EKKA 3MY0A 3L8SA 3L8XA 4V0GA 3TN8A 2V62A 4JR7A 3PRIA 3HLLA 4FTRA 2X1NA 4YBKA 4N0SA 4MBLA 3OUKA 4YHJA 5F1ZA 4DYMA 2J50A 5L3AA 5LQFA 1A06A 5EQPA 2BDJA 2BMCA 5CQWA 3UJGA 5IA0A 3ZYAA 2CN5A 3C4ZA 3DXNA 2BIKB 3BEGA 1Q8ZA 4KBAA 4GG7A 3IW8A 3CKXA 2YWVA 1GJOA 3CXWA 1TQPA 1S9JA 3QGWA 4D1ZA 4RFYA 3D2KA 2CKEA 2KTYA 3PRFA 3QUPA 3GFEA 4OT5A 4QT1A 5E9EA 3AOXA 4NM5A 4S30A 5EI2A 1F5QA 4ASXA 5EFQA 3R7IA 5JZNA 3OTVA 3PJ8A 4H58A 3VJOA 3WILA 3QA8A 2GU8A 2CPKE 4WBBB 4ZXTA 1JPAA 3NPCA 2ITTA 4WNMA 4Q5EA 3R7GA 4C36A 2JIVA 3PP1A 4FEQA 1UNGA 1RQQA 3PWYA 4JJRA 3HDNA 4G3CA 3IQ7A 3PPKA 4FL3A 4KINA 2YM8A 4G3GA 4B8LA 3C1XA 4NCTA 3RPVA 1ND4A 4L3JA 2IJMA
chains in the Genus database with same CATH superfamily
2XK4A 4I6HA 4ZY6A 4F99A 4EJNA 3TZ9A 5DNRA 3CE3A 1YI3A 2XK9A 3H9RA 2XK3A 4QTAA 3Q96A 5CTPA 5EW9A 4TZRA 4CYIA 3VS5A 3T9IA 1GIHA 4TWCA 3AT2A 2X6EA 4QTDA 5AIKA 3II5A 2CGUA 1YQJA 3WE4A 5C8KA 3H10A 2C6KA 4USEA 1NVQA 2OKRA 3CD3A 3NUNA 1YDSE 3RWPA 4A9TA 4BWPA 4O84A 2CJMA 5BMMA 2R7BA 4BKZA 2ONLC 3OEFX 2VO3A 3C0GA 5KMMA 4YJUA 5BVNA 3LCOA 4MCVA 4NH1A 4OTRA 2QG5A 4F63A 3AKJA 5AR7A 1DAYA 4IAIA 2HZ4A 1OL1A 3FZSA 2I0VA 4CTCA 4G31A 4TYJA 3PA5A 3F3VA 5E8XA 4DTAA 3BE2A 4CNHA 4NKAA 3C0HA 3LXKA 3UIXA 4FSQA 4FKJA 5DFPA 3DNEA 2JIIA 2UW7A 3ORLA 4ASDA 4E8AA 3H9FA 1ZWSA 3W0QA 4D2WA 3FLWA 4AU8A 4NFMA 4BICA 2EU9A 3TG1A 4USFA 4E5AX 3W8LA 2WGJA 1P5EA 3B8RA 4FKRA 5IH6A 3F2RA 3R21A 4MWIA 3E7VA 4U41A 4XV1A 4DG0E 3LQ3A 3AT3A 5BNJA 2CNVA 2JDSA 3Q53A 3RK9A 3LMIA 4FIJA 4D2TA 3BQRA 4DDGA 3VUHA 3O0GA 3OS3A 5ANJA 4E4NA 2EB2A 4DHZA 4FZ6A 1PMVA 2WMVA 4JR3A 2GSFA 4LOQA 2BRNA 2XK7A 1ZZLA 4MQ2A 4C4FA 3AGMA 4QNAA 3FMEA 3FMJA 3S3IA 4ZZMA 3IS5A 4XOYA 5E8VA 3PP0A 2YM3A 3DDPA 2W7XA 1GZKA 4BF2A 5IA3A 4G6LA 4YC6A 2WPAA 4FV2A 5HCZA 4IQ6A 3GP0A 3CSVA 5I9VA 2XB7A 2YAKA 2C6LA 3U9NA 4R7HA 4NM7A 5L6OA 3N4UA 2W5AA 3KFAA 3ZTXA 3ZCLA 5GZAA 3IK3A 1ZMVA 4EOLA 4AZSA 4ZLYA 3MH2A 3QTSA 4USDA 1H24A 2QURA 3ZOSA 1OPJA 2C3LA 3KA0A 5AP6A 2W1EA 3QUEA 3ZO3A 2C3IB 4AGUA 2G2IA 4F4PA 3O8UA 4LI5A 3V8TA 5A4CA 2UZTA 5DOSA 3W18A 1VLRA 5DT4A 1PF8A 2JDRA 3P86A 3DJ5A 4N6ZA 1Q8WA 5HO7A 2QOHA 4C35A 4YC8A 1UU3A 3OWJA 4F0IA 1KSWA 4PNIA 3EJ1A 2YDJA 4FZDB 4O7ZA 3E3BX 4HYIA 2UZWE 3OXIA 2UW9A 5JQ5A 3OP5A 4NJ3A 2W1FA 2NRYA 5KE0A 4YHFA 3PPJA 2YDIA 3PLSA 4LRJA 2WTCA 3VBYA 4K2RA 5CSHA 3P9JA 4XLVA 2PMIA 4G2FA 4QMTA 4XOZA 4DFXE 2XRWA 2FSMX 2OJFE 2YCFA 4CZYB 1M17A 3PJCA 1OZ1A 4M3QA 4OLIA 4ANMA 2WQOA 4A7CA 5LMAA 3EN5A 4QQ5A 4FKSA 3MA6A 4JBOA 4BCGA 3GU8A 2VU3A 4FVQA 4AG8A 3HRBA 5I9WA 5I9ZA 5JFVA 3D5XA 5KHWA 3KRJA 1XQZA 2XCHA 4FEWA 3PY1A 1K3AA 3SD0A 3EFKA 4O22A 3C51A 4K6ZA 1Q3DA 3ITZA 2WEIA 4RFMA 5IA4A 1W2DA 2GFCA 3EFWA 3WF9A 4MD8E 4CFVA 2RL5A 3NWWA 3LFQA 4G9CA 3O17A 3VUMA 4S31A 4MHAA 2C5OA 4PF4A 4ZSJA 2X7GA 3FSKA 4MXAA 4RMZA 4FE2A 2IVTA 2R3OA 3LXPA 1FQ1B 2OSCA 1GY3A 5C1QB 4G3DA 4C4JA 3QTXA 4YNEA 2AEGA 2HY81 4F1TA 2VN9A 2XJ2A 3KRWA 4FL2A 3VF9A 1NT2A 3PVUA 1ST0A 3FLSA 3B2WA 5DEWA 2IVUA 4DITA 2OJ9A 4L53A 3QRKA 4RGJA 1NXKA 1W2FA 4TN6A 3S1HA 4CT2A 2J0JA 2W4OA 4P90A 4ID7A 3W33A 2YJSA 4EQCA 5BPYA 1FBNA 3Q4CA 3D14A 3FL5A 3NUUA 2XYNA 4KSQA 4D9UA 3CTHA 3LMGA 4FYOA 4EBWA 3O8TA 2PL0A 5KMJA 4DCAA 1CTPE 1U59A 4DC2A 3OBJA 4O2PA 3QWKA 2XEZA 4QMSA 3D15A 1PXLA 3CQEA 4R5SA 3SKCA 1SZMA 1XHAA 3ORIA 4I22A 3V6RA 3IW5A 5KMIA 1H4LA 3SGCA 3KN6A 3EQDA 5J1VA 2FSLX 5E1EA 3AG9A 2HWOA 3W0NA 3OOMA 2OH4A 2C0OA 3DGKA 3AT4A 2GHGA 3KK9A 4PTGA 3HA8A 2RFNA 5HG9A 1OBGA 2OJIA 4F64A 3QC9A 1Y6BA 4GFOA 4M13A 1UU7A 2ZMDA 3I7CA 4BR3A 3TNQB 4CYJA 3HV6A 1KE5A 1P14A 4IX5A 5DLSA 5IMEA 2YZAA 4X7QA 4G3EA 3GOPA 5EW3A 3S0OA 4LUDA 2BRMA 2B7AA 2ZVAA 3FY0A 4GFMA 3WIGA 4J1RA 4RJ3A 4YPDA 1U5RA 2WQNA 4D5HA 4ZS4A 4FL1A 3QRJA 5HCXA 4EI4A 1LUFA 4XP2A 5LMBA 3UMWA 3ZLWA 5FEEA 3AMAA 4PTEA 4C58A 1OECA 2JLDA 3BWFA 4GK4A 4BTMA 3BGPA 5AR5A 3EYHA 4D28A 4EH5A 4BTFA 3HA6A 4J8MA 4WD5A 3QD3A 4QMNA 5HX8A 4LYNA 5IDNA 3F69A 5FEDA 4TYIA 2E9PA 3NW5A 2JKOA 5AAFA 5I4NA 4EYJA 3QQFA 3V04A 3EQFA 4X2KA 3UIMA 2BTRA 2GS2A 2QHMA 4ALVA 3D4QA 5CASA 3PSCA 5IUHA 1APME 3DV3A 1NVRA 4KABA 3NZ0A 3W0PA 2WMUA 4F6UA 4I5HA 5E92A 4OTFA 3W32A 4GEOA 3I4BA 3DXQA 3VW6A 2YM6A 4M15A 3ZFXA 2REIA 2GHMA 3HP2A 3G51A 5CENA 3E8NA 3L9LA 3VC4A 4HVDA 5AAGA 4QPAA 1TKIA 2DYLA 3C4FA 1K2PA 2J4ZA 2G9XA 3M2WA 3MY1A 3OWPA 1M7NA 4ZTNA 4FG9A 3ZLSA 4FKQA 2NPQA 1W98A 2UW0A 4KIPA 3G9LX 3HUCA 2X2KA 4NUSA 3G90X 5AUVA 3RNYA 2Z7LA 5FXSA 4O96A 4RG0A 3F2NA 2RSVA 5FD2A 3TZ8A 3ACKA 4CVAA 3LFEA 4O91A 2C68A 3UPZA 4I6BA 4NZWB 3QLFA 3UPXA 3TMOA 3R8MA 3ZC5A 4QEBA 4BCIA 3L8PA 4J53A 3QD0A 5FEQA 3VUGA 2IZTA 1BI8A 5AP3A 2UZLA 3A8WA 3CBLA 4D9TA 4YNOA 1H0VA 5EM8A 4X2FA 3EH9A 2HZ0A 4X2NA 3ZLXA 1GOLA 3D83A 2XAMA 4KUJA 1CSNA 3OMVA 1GAGA 4DEBA 5CX9A 4I6QA 3LFAA 5AV0A 4PMMA 1BL6A 5AWMA 4ANQA 4AF3A 5FTQA 4BTJA 5IKWA 2FUMA 2VTMA 3WF8A 3F82A 4R78A 3PWDA 4QYFA 3DK3A 4XRJA 4A9RA 3R7YA 2XAOA 4N4SA 4FTLA 3O23A 3PE1A 2BCJA 4Q2AA 5BYZA 3BX5A 3V01A 2YIXA 1MRYA 2ZJWA 3WZDA 5A4EA 5CANA 3BLRA 4EC9A 3KXZA 3C50A 5F20A 3AD6A 4RJ8A 5DEYA 1PHKA 4AFEA 4WG3A 2PE1A 5M55A 1YXUA 2FA2A 1RJBA 3TEIA 3V51A 5TE0A 1JAMA 4R7BA 4DGNA 2CSNA 3G0EA 5TOZA 3SXRA 5FBNC 4ANOA 2Y9QA 3LM0A 2C0IA 3QHRA 4BDBA 4M8TA 3C4EA 4U0IA 4BCOA 1ERKA 1UU8A 3DFCB 4ASZA 3LFFA 4UALA 4F6SA 2KULA 4QP3A 4DHJA 4APPA 2BAQA 4EOJA 3PJ2A 4RWLA 3EKNA 3F3WA 3U6HA 1PXPA 2GDOA 4GYIA 3KN5A 4LG4A 3QU0A 2R3IA 4IB1A 4O7VA 2HY0A 2CN8A 2OFVA 4DGLC 4YZNA 4L8MA 5CY3A 5T3QA 4U7ZA 3TNIA 2H9VA 4O1PA 3ZC6A 2JC6A 2O2UA 3RP9A 4BJJB 1W82A 4JQ7A 4MTAA 4WRGA 3NNUA 3SG8A 4DGMA 2QHNA 4I20A 3E8EA 1XBBA 4IZ5A 4W9XA 5EHYA 3Q9WA 3D5WA 3Q9YA 4Z55A 3MPTA 2IEWA 4TTHB 5HBJA 2XIYA 3DBCA 5HESA 5CZHA 4MXOA 4RWJA 4IEBA 1BL7A 4UYAA 1H07A 2BALA 4O83A 2C6EA 3GQLA 1M2RA 3HECA 3FE3A 1LP4A 2VX0A 3V5WA 3EZRA 4YBJA 5AV1A 4CFWA 4O7SA 2QODA 5DG5A 4EH3A 1PXOA 5AMNA 2YITA 4NU1A 2ITWA 1VYZA 3OWKA 4KAOA 4KIQA 3TV4A 3FZTA 1OGYA 4DFUA 1XKKA 5A4QA 4FTOA 3N51A 1H1QA 4H39A 4O0WA 3TNWA 4E20A 1KV1A 3E88A 1O6YA 4HZRA 3MB6A 4O81A 2C1AA 3ACJA 2H8HA 5LVLA 3PXZA 3ZXTA 4MWHA 3CEKA 1E9HA 4BZOA 4QO9A 5HNIX 5T68A 4C3RA 3DTCA 4OT6A 3FMLA 4YZDA 2JFMA 3MFUA 3PSBA 1BKXA 2EXEA 4FTAA 5AEPA 3QWJA 1HCKA 4HCVA 5CI7A 4ALUA 3UOHA 3LOKA 2QC6A 4C59A 3Q3BA 4LL5A 3VO3A 4XX9A 3ML1A 4JDIA 3NYXA 4CKJA 3GCUA 1UWJA 3F9NA 2EUFB 4GH2A 1UKHA 3DTWA 3NCZA 4AT4A 4IM0A 3LXLA 4MF0A 4E4LA 4DLJA 2C5XA 2VO0A 4FR4A 3EN6A 5HI2A 3V6SA 3A7GA 1OVEA 4KA3A 2A2AA 2QI8A 3NIEA 5EDRA 3TM0A 5AAEA 3P4KA 3QLGA 2Q0NA 2AYPA 3OCTA 4CFUA 3MN3A 4CLIA 4IZ7A 4N6YA 2QO2A 2R3QA 4GMYA 4X2GA 1UVRA 3RKBA 1H28A 2HYYA 2O5KA 3GC7A 1ZY5A 4FMQA 4PTCA 1XMMA 4R1YA 2QO9A 2HCKA 4UBAA 4I5MA 2UW3A 3CR0A 4UZDA 4L9IA 3ZSIA 3DJ6A 5DR9A 4RLKA 1ZMUA 4BWKA 2BAKA 2Y0AA 4RFZA 5IQDA 3NAXA 2UZUE 3NUYA 1JSTA 4L6QA 3FLZA 4FG8A 3CPCA 4RIOA 4EUUA 3Q9XA 5BVKA 2BZJA 4EK6A 2OZAB 2C0TA 3MB7A 4FNXA 1V0OA 1WBNA 4HGTA 2WMAA 4YUQA 1XH9A 1YDRE 4ANLA 2C5YA 4JQ8A 4YLKA 2ERZE 3V3VA 3VQUA 2PZPA 3LQ8A 3NLBA 4AT3A 4U42A 4NTTA 2X8DA 4TXCA 3QFVA 5A9UA 3GOKA 4FNYA 2XJ0A 5EH0A 5KUPA 5HCYA 2B0QA 2F4JA 2QKWB 3MA3A 5HG5A 3VS7A 5HVJA 4G6NA 3KXNA 2OF4A 4FK3A 4J52A 2W9FB 2Z7SA 2JDVA 3HEGA 4AN3A 2X0GA 3EMGA 4IC8A 2BPMA 4N70A 1Z9XA 4V01A 5TKDA 5TO8A 4FUXA 3GC8A 5D1JA 5H8GA 1R1WA 4AAAA 1G8KA 2P33A 5J87A 4WNKA 2QLUA 5CVHA 4DBNA 1GIJA 3SDJA 3GCVA 2WTKB 3OZ6A 5AA8A 4JMQA 1Y6AA 5IA1A 1ZAOA 4QTEA 3AD4A 2GNJA 4B0GA 4L42A 4UWYA 4PDYA 4EWQA 3EN9A 5HD7A 4ANNA 3BE9A 5BX0A 3JVSA 4LDTA 2O8YA 3ELJA 5DPVA 2XBAA 4CQGA 3ATTA 3ZM9A 3W0RA 1V0BA 3LMHA 3AKLA 4MKCA 3SXSA 3PXRA 4FTMA 2ZMCA 1E1XA 3Q9ZA 3R9OA 5DT0A 1J7LA 4RIXA 1KUTA 4OTQA 3KCFA 2VTLA 4HW7A 5KMOA 4IWQA 4O4CA 4AZFA 2B54A 4O86A 4U45A 1BMKA 3FAAA 5ANGA 4NM0A 3R8VA 5ANKA 4MXYA 5HOAA 2X81A 3RAHA 1URCA 4HVIA 4I92A 2AUHA 4L45A 5C4KA 3MTFA 5CT0A 2R3LA 3PIXA 2PPQA 3GI3A 3UTOA 4GCJA 2IO6A 3W2OA 5EI6A 3S00A 2BRGA 4CKIA 5CF6A 5E7RA 5AUXA 3F88A 2OJJA 2A1AB 4C2WA 3EFLA 4O6EA 3FV8A 3D7ZA 2R4BA 3O7LD 3RCDA 4ZJIA 4HNIA 1U5QA 2BUJA 5A46A 1PW2A 4OAUC 2WIHA 2IVSA 5FQDC 3DXPA 1W2CA 4BFMA 3DAEA 4IAZA 4BDFA 4GK3A 5L2SA 4L00A 3R1YA 4MNEB 1KOAA 1X8BA 3DAKA 3FMNA 4QDEA 3KIOC 2AC3A 5L2QA 4JXFA 4DEDA 4XG3A 1DAWA 3VNTA 2F7XE 4YZ9A 3R71A 5I3OA 2HK5A 1OGUA 4XV3A 3BQCA 3W55A 2PE0A 3E7OA 1K9AA 4JG6A 1BYGA 3HYHA 4ZJJA 2J2IB 4CV9A 4DG2E 5CU0A 4FTIA 2V5QA 3HMPA 3A4OX 4BCHA 4F1MA 5DVRA 4JIAA 4F9YA 3NYVA 4NIFA 3LFBA 3FSFA 4KB8A 4XJ0A 2I40A 4X6RA 4GG5A 3WE8A 1KE7A 4ERWA 2EVAA 3OOGA 4IJ9A 1OIUA 3I60A 4AX8A 2B9IA 4FX3A 4XNEA 1Q8YA 5EG3A 4GJ2A 4V04A 2JKQA 3UVRA 1UNHA 1WVXA 2NRUA 2ZB1A 4DFBA 4ENXA 2F49A 1G5SA 3RPOA 4D2PA 4F0FA 5BVFA 3C5IA 3F61A 3ZDUA 2PVMA 3MW1A 5CSVA 4F6WA 4F9WA 4UN0C 2BFYA 1NY3A 3LFSA 4YZBA 4BYJA 4ZMFA 2UW5A 3D0EA 3CJGA 2YM7A 3VS4A 3DBEA 2OF2A 3BYUA 5JSMA 3NSZA 3PA3A 5CWZA 4BYIA 4E6DA 5KBRA 5HTCA 4LOOA 4FV8A 1H27A 1WZYA 1DI9A 3FI8A 4EJ7A 4EZ5A 3UNZA 1LEWA 2XIZA 5A3XA 4RA4A 5EQYA 1JKKA 2QG7A 3G15A 2CKQA 2DQ7X 3F6XA 3NNXA 1XH4A 4O0TA 4A4OA 4EK5A 2PVFA 1R39A 3BYMA 4XUFA 4G5JA 2ETRA 3ZUTA 4A9YA 3QQJA 2X9FA 2OI4X 3F5UA 3TNHA 5J5SA 5EOBA 3IPHA 5HIDA 3EWHA 4LFIA 3OWLA 4EYMA 5H8BA 5M4UA 5GNKA 3VS1A 2YFXA 4BI2A 4C4EA 5J9YA 2RG6A 3DKOA 4YJSA 2YCRA 2XF0A 3E93A 3FI4A 3LZBA 2PSQA 3IOKA 2YIWA 5IQGA 3PVGA 1O6KA 1WVYA 3OUNB 1FMOE 4I0RA 5BYYA 1OPLA 2AQXA 5HD4A 3CKWA 4K33A 2R3MA 4N57A 4RC2A 2Y6MA 2GQGA 3DKGA 2C1BA 4O2ZA 3MH1A 3WZUA 1XH5A 1OL6A 2QOOA 1LR4A 3B8QA 2C6MA 2FO0A 1U46A 2YN8A 4YJQA 3LFNA 4ZY5A 1GZNA 4PUZA 4U44A 3C4WA 4OTWA 5KMKA 3P7BA 4ORKA 4C37A 1VEBA 2GNIA 1BLXA 3DQWA 3O5AA 4BGGA 4QMVA 4U5JA 3RZFA 5IEVA 3A7FA 2Z02A 4W4VA 5KZ0A 3OY1A 3I6WA 3MJ1A 1UU9A 3EQPA 5FRIA 2QOFA 5GJGA 3W2QA 4FYNA 4U6RA 2WTIA 4EEVA 3R2YA 2RF9A 3QYZA 1CKPA 3ORNA 3KKVA 4U3YA 4ZP5A 4B7TA 1UA2A 3G9NA 3SOAA 4ANBA 3TZMA 4YJRA 4IB5A 5GJFA 3ETAA 4FZ7A 1P4FA 3QXPA 5GZ9A 2WU6A 2CCHA 2IW8A 3TACA 4ZSAA 2F2UA 4D4VA 4JNWA 1MQ4A 5EYCA 4IBMA 1ZXEA 4Z16A 3MDYA 2B53A 3LQ5A 3QKKA 1QPDA 2R3NA 4FV5A 4YTHA 2GNHA 2YISA 2C69A 2A19B 3QKMA 3ORZA 2PULA 2R3GA 1A9UA 3QRIA 5CEQA 1ZYSA 5KMLA 1PXIA 3ZEWA 3ZSHA 4DT8A 4KIKB 3SOCA 4I4EA 4ZZOA 2Q83A 3HUBA 1LEZA 3ORKA 5AX9A 3WZEA 4IAYA 4UMUA 2VNYA 4G1WA 5J7BA 3UQGA 4FNZA 4RRVA 2ZB0A 2QOLA 2YCQA 2IW6A 2WAJA 4QYHA 5AR2A 2J0IA 4O4BB 4K18A 2H34A 3GFWA 3EL8A 2YHVA 5D9HA 3R83A 4EZ7A 4MXXA 4QTBA 2OU7A 1PYEA 4KBCA 3O96A 3RHKA 3RPRA 2HW7A 4QP6A 4EK4A 3IW6A 3A61A 1Y57A 3GU6A 3V8WA 5LCJA 3I5NA 2CKOA 4I0SA 4ZY4A 1F0QA 1TQIA 3Q4ZA 1TVOA 4QQTA 4I24A 3HNGA 4C3PA 5JGDA 2XBJA 2BVAA 4EK3A 2V0DA 4YO6A 1HOWA 4TNBA 4WG5A 4Y72A 5H3QA 4ACDA 4UEUA 2Y4PA 1XH8A 3ZMMA 2XNGA 4I41A 2VX1A 1SYKA 2YIYA 3AC2A 2WNTA 3FZPA 5AIRA 1IRKA 2VRXA 4Q5HA 3FJQE 5HLPA 4IAKA 3IONA 3L8VA 4PV0A 3OCGA 4RVTA 4CG8A 4FT3A 3PZEA 3HV5A 4BHNA 2AC5A 2B55A 3LFDA 3UMXA 5L2TA 1YWNA 2PVLA 3PZHA 5HE1A 1YI6A 3WI6A 3PJ1A 3SW4A 3BHUA 4QTCA 3PJ3A 2O65A 4QYEA 5AV2A 5F9EA 4APCA 4R8QA 4RPVA 1DM2A 4ACMA 4F0GA 5L8JA 1OPKA 3K3JA 2X0QA 4M69A 2W1IA 4QMXA 2BHHA 4W4XA 4YLLA 3SAYA 4J71A 3W10A 4YR8A 4K11A 2P55A 2ESMA 2FH9A 2OZOA 2WMQA 2W4JA 4GSBA 5EK7A 4D0XA 3WF7A 3ODYX 3BV2A 4E1ZA 4CKRA 3LKMA 5K0KA 2VTJA 5FXRA 4YMJA 1M2PA 2X0OA 2Z2WA 3NYNA 3R0TA 5T6KA 3GNIB 5IQAA 3K2LA 3L9NA 4D0WA 3ATSA 2PVYA 5CF5A 4QMYA 5LMKC 5BVWA 5AADA 5CF4A 4IMYA 1MQBA 3NUPA 3OCBA 4GVJA 4QYGA 1YI4A 1JKTA 3ZHPC 4IANA 3BL9A 4WG4A 4M84A 3LCDA 5JKGA 1IA8A 2BDFA 5DN3A 4FEUA 5CEIA 1Z5MA 2GHLA 5HIBA 1XWSA 4WOVA 2BZHB 4ITJA 2V7OA 4JBVA 5L2IA 5DH3A 4FSTA 4EC8A 4PPCA 5J7HA 2YDKA 1XMLA 2X2MA 5E90A 1J91A 3ALOA 4J8NA 5DA3A 3OCSA 4X3FB 4KKEA 3RVGA 4PP9A 3OW4A 4RSSA 2A27A 3FZOA 4D4RA 2B9JA 3E64A 3ENMA 3THBA 3DA6A 3RM7A 1JSUA 4BI0A 4E93A 3RHXA 4E5WA 5HG7A 5AFVA 4L44A 4L43A 5KCVA 4DINA 2I0HA 4BCJA 1PMNA 3FMHA 1AQ1A 1VJYA 3A60A 3MIAA 4C2VA 5CEPA 2QNJA 4U8ZA 2VV9A 3I81A 2XZSA 5M4CA 2WEVA 4G17A 2OIBA 3NW6A 5CXHA 2W5HA 3BGQA 3MFRA 4BRXA 4WA9A 5AUYA 4FA2A 3DCVA 2WIPA 4EOIA 2QR8A 4Z3VA 5DIAA 2RFEA 3QGYA 4E6CA 5FLFA 4FVRA 4HNFA 4DH3A 4O7RA 2ZV9A 4HJOA 4FV6A 2BILB 3C9WA 5EHOA 3RAKA 4ZTMA 5IU2A 1MRUA 4K9YA 2XM9A 1OKZA 4FRFA 4X2JA 1OM1A 1M7QA 4RWIA 4A4XA 4FGRA 1ZOEA 2C6DA 4CFXA 4TWPA 3V5JA 4BIDA 4CMOA 4XRLA 1SMHA 3TDWA 2ZV8A 3FC2A 5D11A 4EH6A 5DGZA 5M44A 2R3PA 2PY3A 5AP1A 1PYXA 1OITA 1REKA 3MFSA 4IVCA 4O4DA 1QMZA 3VVHA 3VUIA 3ZO2A 5IEYA 4Y5QA 4XBUA 2R3FA 4I1ZA 4R3PA 3R7UA 3AC5A 2VD5A 1QPJA 2VTRA 2QOKA 2IN6A 3LW0A 3TJCA 4BC6A 2UVXA 2PWLA 5HTBA 1OIRA 3AQVA 4FKLA 1H1SA 5KKRB 3HAVA 3A4PA 4LV7A 4FC0A 5B0XA 3D5VA 5IPJA 4GFGA 3DB6A 4YZCA 4FG7A 3FXZA 2OK1A 2YJRA 5HU3A 4YSMA 3LJ2A 4L46A 4KRCA 3MV5A 4DH8A 2CNQA 5TT7A 5HVKA 1H1WA 1KWPA 2JKKA 3S2PA 4CT1A 5E8SA 1B6CB 1GIIA 4DE4A 3P0MA 4GT4A 4U43A 3VJNA 4K77A 4CZTA 1G8JA 5BMSA 3WZKA 4ACHA 2PZRA 5D10A 4PNKA 3SW7A 4QMQA 4AUAA 3GUBA 2WMBA 3RALA 4Y46A 4M68A 5E91A 3GVUA 4IWDA 2XS0A 1YXTA 4FGBA 3BBWA 4ZSGA 5JGAA 3NYOA 4FZAB 4DTKA 3CY2A 3KULB 1XH7A 4YJTA 3PXKA 4NK9A 1BUHA 2QOBA 2XKFA 3F3ZA 4FKUA 3R7EA 2R3HA 1STCE 4WSQA 3LE6A 1H08A 3MSSA 2NP8A 3CCNA 4XBRA 4EH8A 5L6PA 3EN4A 2W17A 3SLSA 3NVKI 3KCKA 4G6OA 2XALA 1ZMWA 3N4VA 1SVHA 3U8WA 3NS9A 4FT0A 3ORXA 4AW1A 2ITUA 4TYEA 3BRBA 4JT3A 3UOJA 1YXXA 1RE8A 3COMA 4HPUE 1P4OA 2J5FA 1CM8A 1GZOA 4G16A 4BDJA 3H0ZA 4J97A 4ZSEA 3R8UA 2GFSA 3SA0A 5CZIA 4R77A 3ZEPA 4KKGA 4TYHB 5J1WA 4JX7A 2OW3A 4MNFA 3RK5A 4UWCA 4NT4A 3Q04A 4G5PA 4DEIA 3UG1A 3W0MA 4YJVA 1WBTA 1OL2A 5AR3A 5M57A 2GMXA 4ITIA 2QVSE 4IWPA 4LGHA 5DYJA 3FPMA 4WHZA 2G2FA 4W4WA 3TYKA 4NFNA 2X0PA 2Y7JA 5CSXA 2VWYA 4IM3A 5FWKK 4QYYA 3TV7A 4ZTSA 3ZSGA 5FGKA 3Q52A 2ONLA 2ZDTA 2W05A 4ZLZA 3Q6WA 2W99B 1E1VA 1ZYCA 1PRYA 3BCEA 4F9BA 4XEYA 5DMZA 4LRMA 2PVRA 2YAAA 1B38A 4KIOA 4KS7A 3T9TA 1L3RE 3D7TB 2W9ZB 3A62A 4H36A 5CAQA 2VAGA 3OT3A 4H3PA 4UMTA 4QQCA 4RJ7A 2I0YA 4MAOA 3ZLYA 1YXSA 2WB8A 3UO5A 5HE2A 3RPYA 4NM3A 1IA9A 3DU8A 4D2RA 1O9UA 4BZNA 2ZV7A 3RAIA 4GKIA 3EHAA 3HAMA 2F7EE 3CY3A 3EQRA 4RIYB 4UXLA 4XG6A 5CQUA 2WMTA 4BBEA 3TDVA 3D94A 4M67A 3UQCA 3B2TA 3OHTA 3MVLA 5CI6A 3F7WA 5CAOA 3W8QA 4A06A 5K4IA 5ANDA 3AXWA 3COHA 2R3RA 4Y8DA 3U6IA 4PPBA 2HENA 3NFGB 3ROCA 4OR5A 4GJ3A 3OW3A 2OGVA 2HZIA 3SHEA 5ICPA 2C6OA 3MFTA 3QX2A 3QCYA 4MK0A 4AOIA 4CMTA 4CZUA 2ZYBA 3MI9A 5DRBA 5EDPA 4B6LA 3KXGA 3WF5A 3UOLA 3QUDA 5HLNA 4BDKA 1DS5A 1TFFA 4O7TA 5FUTA 3C4CA 4WSYA 4FKTA 4PDPA 4D1XA 3LLTA 5C9CA 4BCQA 5IQHA 3LLAA 5A14A 2B4SB 3DKFA 5LVOA 5HHWA 1IAJA 3CIKA 4H1JA 3PLAE 2ERKA 4JG8A 4MEDA 5K9IA 3PA4A 5EM5A 4BCPA 4HCUA 5E8TA 4CCBA 2SRCA 3AC8A 3GC0A 1L8TA 4FTTA 1WBOA 4BCFA 5CAPA 3R2BA 4AE6A 4EZ3A 4IZYA 5BUIA 3IG7A 3KF7A 2EWAA 4M66A 1PMEA 3WOWA 1PXMA 3RMFA 3NVMB 2CGVA 2G15A 3CTQA 3OY3A 4Z9LA 5IQEA 4NIFB 4YTFA 1H00A