2WQOA

Structure of nek2 bound to the aminopyridine cct241950
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
277
structure length
242
Chain Sequence
SRAEDYEVLYTIGTGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRLKPANVFLDGKQNVKLGDGTPYYMSPEQMNRNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title An Autoinhibitory Tyrosine Motif in the Cell-Cycle- Regulated Nek7 Kinase is Released Through Binding of Nek9.
pubmed doi rcsb
total genus 75
structure length 242
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wqoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wqoA01
4M3QA 3KXXA 4EEVA 3QXOA 4YJQA 3QQJA 2OXXA 4XS2A 5EM6A 4GKHA 3MIAA 3CKWA 3DBQA 3VF9A 3ZM9A 4EWHA 3OBGA 1JKLA 1CKPA 4QQTA 3AD4A 3KB7A 4XHKB 3AT4A 2PZIA 3OXIA 1STCE 2DS1A 2ITUA 1S9JA 2X8EA 1K3AA 3FWQA 1LP4A 4OTWA 5GZAA 2PVNA 2UZDA 3UYTA 3PJ1A 2R3NA 2ONLA 2G2IA 4OTQA 5BMMA 3TIZA 2W1CA 3DPKA 5CI6A 3U87A 5A4QA 5CF8A 2GHMA 3VUKA 2C5NA 2I0HA 5EKOA 3W33A 3FMMA 4HYSA 2CNVA 5L2WA 4D4SA 4IX5A 4XP0A 3ROCA 4KBAA 3U6HA 5TKDA 1XBCA 3F3UA 4F70A 4RC3A 1OB3A 3PJ2A 2IVUA 1PXNA 4U3ZA 4RX7A 1UWJA 4EH7A 1UU9A 4GVJA 3UOLA 5HU9A 4BCKA 4QP3A 5G1XA 5D7VA 3SW4A 4FT3A 4C62A 3PWDA 3O17A 1XH7A 4XBUA 4EOKA 3IDBA 3UOJA 3LFFA 4PY1A 5EFQA 1F0QA 2A19B 1XH4A 4LUDA 5HOAA 1YOLA 3VBQA 5I9XA 2JDRA 4O21A 3PA4A 4IB1A 4USDA 2OI4X 5E91A 4FT9A 3EQBA 3PXQA 4XG6A 3ZDIA 3SVVA 1TQIA 3KCKA 3O8TA 3Q4ZA 4FMQA 2YWPA 4M12A 2C6TA 4JIAA 4YLJA 3R30A 3RCDA 3O96A 4EH6A 5CASA 2A1AB 2OK1A 4X21A 3V8WA 1GIIA 2ERKA 2RFDA 4KKGA 4HVGA 5IKWA 5M53A 3NMUF 1M17A 3FL4A 5M44A 2GTMA 1ERKA 3WZUA 4NSTA 3BQCA 4B7TA 5IMEA 5HIDA 3P08A 3UZRA 4NW6A 4S34A 3GEQA 1ZYDA 4U9AA 3QGYA 4RWLA 4LOPA 4RIWA 5H8EA 5D12A 4BYJA 4AUAA 3SOCA 5GIOE 2QLQA 2WQEA 3F88A 2W4OA 3C4CA 5HBHA 2VX0A 4Y95A 3W2OA 4XG9A 4E6AA 2JKMA 1Q61A 3C7QA 5CVGA 3GU7A 3OF0A 4F7JA 4U43A 2QQ7A 4E1ZA 2CGUA 3QCQA 3PXZA 4RJ5A 2BAKA 3RPVA 4HVHA 2PE2A 4W4XA 1Q3DA 5I5ZA 4DEHA 3CPBA 3HUBA 2O3PA 1PMNA 3CEKA 3EFKA 3KRRA 2Q0NA 3D5VA 4KIKA 5HGIA 5TT7A 2BHHA 2YABA 4ZLYA 4M66A 3SXSA 3C4ZA 1E1XA 5AUXA 1LUFA 3F6XA 3G0FA 2VTRA 2WTKB 2BKZA 2F7ZE 3IOPA 4A4LA 4RWJA 3OEFX 3RZFA 5IUHA 3TT0A 3MB7A 3ZEPA 4AQCA 1CSNA 4PV0A 2VX3A 4L3PA 4R3CA 3THBA 3QX2A 3ACJA 3UC3A 2ZM1A 2ZVAA 4XBRA 4DG3E 1XKKA 5BVFA 5AX9A 3EIDA 2Y4PA 2XBJA 3IW8A 4K8AA 3RAWA 1OMWA 3CY3A 3V3VA 4S31A 3QGWA 4BC6A 4S2ZA 5IU2A 3IW5A 1SYKA 4WT6A 3CXWA 3NCZA 5FXSA 2OO8X 4OGRA 5KZIA 3ZEWA 2Q0BA 2ZDTA 5DG5A 2WTWA 2ITTA 4EOPA 4F7SA 1R1WA 4NZWB 5FRIA 3W10A 2C3KA 5LVLA 5CEIA 4C7TA 4WNPA 5AUYA 4BICA 2CDZA 2PUNA 3E3BX 4DH3A 1QCFA 3DAJA 1L8TA 4KBCA 4IWPA 4PUZA 4U97A 3UIBA 1W0XC 4UXLA 1H4LA 3TNWA 3P7AA 4O0UA 3UIXA 4ARKA 4QNAA 4DGLC 2ZM4A 2BMCA 4LM5A 3WOWA 1SVGA 3ORLA 3TDVA 3HAVA 3SLSA 2Y0AA 1L3RE 5HHWA 3VNTA 4BWXA 1H1WA 1M2PA 2XNEA 4P90A 4D5HA 3R21A 1R39A 3SXFA 3VS0A 2XVDA 3LCKA 1K9AA 1QL6A 2KTYA 1H28A 4D2PA 4ZS4A 4MEDA 5L2IA 2VTOA 3R8VA 4PPBA 4MAOA 4ZIMA 4QP8A 1PXJA 5E8ZA 5EDQA 5IQFA 2R3JA 5HO6A 3EMGA 2QU5A 4D2VA 3MWUA 5IH5A 2YM7A 3BYVA 5L2TA 2F7XE 2GNJA 3PJ8A 4U41A 3AC2A 5GNKA 3MESA 4I20A 3VS1A 3MV5A 4NIFB 3FMEA 4UXQA 4PPCA 4C4HA 4JG8A 5FTQA 2EUFB 2P3GX 3BI6A 3B2WA 3MFSA 5JFVA 4ZJVA 3LJ0A 4NU1A 5CT7A 5CLPA 4CV9A 4ITJA 2GU8A 3DT1A 2YIQA 5CAOA 4F0GA 4XV9A 2EXEA 3MH1A 4HZRA 3LMGA 3LXPA 4R5SA 4E7WA 4Z9LA 5JMSA 3CTJA 5IQCA 5JGBA 3R6XA 5JGDA 5AR3A 3V5LA 1MRVA 1KV2A 2G2HA 3GU5A 5A14A 2UVZA 3RM6A 3VS6A 5AUZA 3F66A 5BX0A 2REIA 4H36A 4RX5A 4KABA 2J0MB 4FV8A 1Q3WA 2O5KA 2Z7RA 3IGOA 3OWKA 4OBQA 4F9AA 3QD3A 4C58A 4EHGA 5GZ9A 5HIBA 2WQNA 3ZO1A 5BUEA 3QUEA 3VO3A 4FICA 4EK5A 4AFJA 4JDIA 2JAVA 1OVEA 4AZSA 2QOOA 1NXKA 3U9CA 2R64A 3W55A 2ZJWA 1B6CB 4OTRA 5FM3A 4FTNA 4IIRA 4ZSGA 2WU6A 2JC6A 3MDYA 4AT5A 3VUMA 4GG7A 2R3RA 4XRLA 4QT1A 5IUGA 4F1OA 4EYJA 4QP4A 3S95A 4AS0A 4EKLA 4BZNA 4ANLA 3F2AA 4OLIA 3T3VA 1MP8A 2OIBA 4TZRA 1WCCA 5IQEA 3ENMA 3QZIA 4OBOA 2XMYA 1XQZA 4I5HA 3RHKA 5J87A 3R8ZA 4N0SA 4PP7A 4PNKA 3P23A 4IACA 3BYSA 4LG4A 4L9IA 4LGGA 3SW7A 4FYNA 3GFWA 1KUTA 4IAFA 5BNJA 4RWKA 3SRVB 3LJ2A 1OIRA 3GC9A 2UW8A 1OL6A 4PTGA 4PQNA 3ZBFA 2HWOA 2WIPA 2XK7A 3BIZA 3AG9A 2GHGA 3MYGA 3NX8A 4I94A 3S4QA 3F3ZA 5EQEA 4O7ZA 3QFVA 2JEDA 4EH5A 2PU8A 5ANJA 5L8KA 3W2SA 3QQHA 2RFEA 2YZAA 4D4RA 5KNJA 5EHOA 3PUPA 2F2CB 4ONAA 3A60A 4CMTA 2YJSA 4DLJA 5AIKA 5KKRB 2R7BA 2BRNA 3DJ6A 2YIYA 5AADA 4MNFA 5HZNA 1XJDA 2PL0A 2B9HA 3KC3A 3KMUA 4J71A 4BR3A 2C30A 2UUEA 5CSWA 3DA6A 4BDFA 5M08A 1YXTA 3KK9A 2WMVA 1UU8A 4MX9A 2QO2A 4RG0A 3C13A 1BUHA 5K4JA 4FKLA 5FG8A 3I6UA 2PZPA 1CKJA 4UWBA 4I3ZA 3DKFA 3R71A 1GNGA 4EK4A 5A9UA 4YR8A 1URWA 4YPSA 3OTVA 3QCYA 2HZNA 4GG5A 5HCXA 4UZDA 3RAKA 4B4LA 4BCHA 5FEDA 4FEWA 2VD5A 2VN9A 4LV8A 1OL1A 2XNBA 4UMTA 3R2BA 5BVNA 4KBKA 4GSBA 4F7NA 2VWZA 2XA4A 3DJ7A 3A7HA 4CFWA 5AJQA 5JZNA 3UMWA 3KMWA 5HNIX 3LFBA 2C6KA 2HWPA 4XG4A 4JBVA 1IA9A 2ITXA 3I79A 2BIYA 4M67A 4FOBA 3C51A 5E8WA 2G2FA 3KN5A 2OGVA 4AFEA 4X3FB 4CG8A 4O0XA 3R01A 1BKXA 2X9FA 4AT3A 1BX6A 3ZLWA 4QPSA 3JY9A 3AQVA 4FZ7A 4ZY4A 3R2YA 3FSKA 3F5PA 3Q6UA 5CU3A 2UZNA 1T45A 4XYFA 1XH8A 2VTSA 4LL5A 4M97A 3AGLA 2YM4A 4I6BA 3QZFA 5CU0A 2J0IA 2CPKE 4R8QA 5KHWA 2ACXA 4DTKA 2SRCA 4MD9E 4DG2E 1E1VA 3LW0A 2HZIA 3PJCA 4FZAB 3NVMB 2Z2WA 3FMLA 1Q24A 3A7IA 4IJ9A 4B8MA 5AAGA 1XO2B 2NRYA 2YCSA 4I22A 4TY1A 4UEUA 3G9LX 1VYZA 2LAVA 5IH4A 1G8AA 4Y5QA 4DINA 4G31A 3O51A 4F64A 3BWFA 1URCA 2QU6A 3HP2A 4MBJA 4GT4A 4L43A 2GDOA 4FTCA 4EUTA 5BVDA 2C68A 3UNKA 2GNFA 3BWJA 4FTUA 4FTKA 2Z8CA 1YI3A 3GT8A 4Q9SA 1YDRE 4FKVA 4RJ4A 4ZTRA 3DDQA 5DR2A 3UJGA 2R2PA 4UYNA 4A9TA 4A9UA 2OJ9A 5A4TA 2ZMDA 1XHAA 4LL0A 3WYXA 1H1QA 2BROA 3FY2A 3ULZA 5M09A 4IADA 4FTAA 5BYZA 4BI1A 4PNIA 4IVCA 4BBMA 1FGIA 1R0PA 3DFCB 4ACMA 4EOSA 1Q8WA 2G15A 4TWCA 3DAKA 1FGKA 4F08A 4JRNA 5C03A 3DTCA 4S32A 2XKCA 2XJ2A 5DI1A 4FT0A 2OXYA 4F9WA 4FTMA 4I23A 4FBXA 4QYFA 3NUPA 2C47A 1FINA 2PVRA 1WMKA 2JBOA 2WEVA 4O7NA 3PPJA 4QTBA 2QLUA 5HX6A 3PVBA 1OPLA 2WKMA 2C5XA 5I3OA 5F20A 3CTQA 4XOZA 4C4EA 2XBAA 1JAMA 4RJ7A 4A4OA 3S00A 2HENA 1PJKA 2C3JA 3PXYA 4HNFA 4EUUA 5ACKA 4FGBA 5JQ8A 4ZMEA 1YDSE 4K77A 3RPSA 5AP1A 4DLIA 1GOLA 5DH3A 4H39A 3G5DA 1SVHA 3V5WA 2HYYA 2AC3A 5HG9A 2IW8A 4O7RA 3FXXA 4BDDA 4HPTE 2C5YA 3C5UA 2Y7JA 3JYAA 4TPTA 4I41A 5FGKA 3OC1A 3R7OA 2O63A 2YEXA 4PL4A 2R5TA 3I0OA 3VVHA 4JVGA 3QD0A 3QTWA 4F7LA 5E92A 3GCUA 3BLRA 4KNBA 3MBLA 4ANNA 4WA9A 4YHJA 2YM5A 2IVSA 2QOBA 2X6DA 4IFGA 3LOKA 4X6QC 4NKAA 5TF9A 4EOLA 1CKIA 5HG7A 1OKYA 3VBYA 4F0IA 5HI2A 5KCVA 2RL5A 2OH4A 2XK9A 2UZTA 4IVAA 4D4VA 3ORZA 4M0ZA 1AD5A 3F7ZA 4NUSA 2HZ4A 3D15A 2VWXA 4LUEA 2VWIA 3EJ1A 4PDPA 3K5VA 4QPMA 2YAAA 4RIXA 4WNOA 4EJ7A 2QC6A 2Z7SA 4GJ3A 1LR4A 4PL3A 4K33A 5HQ0A 2PVLA 3KMMA 4FKIA 5EQPA 5TR6A 2QVSE 5AV3A 1W83A 3NUAA 3MPAA 4GU6A 4XV1A 4I0TA 4FEUA 3EZRA 3RWQA 5D1JA 1OZ1A 3R8MA 4CLIA 2Y4IB 2BVAA 4YJTA 4R77A 3QRIA 3F3TA 3U6JA 4J7BA 1ZOEA 4DFXE 4AXAA 4YZCA 3UQGA 2XCKA 2ESMA 1XWSA 1P2AA 1PXLA 3C9WA 3UGCA 3IOKA 1RQQA 3S0OA 4JQ8A 4YJSA 5DT0A 3KQ7A 2QO9A 3ELJA 4C8BA 5CXZA 5EI8A 3Q4TA 2IZSA 1O9UA 3BGPA 3FKNA 4IJPA 4KB8A 1QPCA 1SMHA 3H3CA 4L68A 4BTKA 3KXGA 4EWQA 1UA2A 4MQ2A 4Y73A 3CP9A 3WI6A 4KWPA 1PXIA 5FLFA 4BDKA 4DITA 3O71A 4K9YA 4E5AX 3T9TA 2QOCA 4USEA 5J1VA 1NVRA 3NWWA 4O0WA 2PPQA 4LOOA 3QQKA 2OZAB 2OZOA 3EZVA 2V7OA 1GAGA 3TZ7A 3VC4A 4OTHA 3WF5A 2FH9A 3PXFA 3KF7A 1ZYLA 3TNHA 3CLYA 5M4FA 3RK5A 3R7EA 4DEBA 4ENYA 3EHAA 4X3FC 1BI8A 2FB8A 4H05A 4WBBB 3MPMA 4RZWA 1IA8A 2PWLA 3E87A 3EWHA 5TE0A 1ZYCA 4M8TA 4BDBA 4D0XA 4EZ7A 1GZOA 2RFSA 1YI6A 4HYHA 5CI7A 3QWJA 1KOAA 2WOTA 3SQQA 4BKYA 5C4KA 1HCKA 4Y83A 4BFMA 3B2TA 4KKHA 4AA4A 4JOAA 4P7EA 2ZV2A 4QD6A 5ANEA 4GS6A 4I4EA 5AUTA 4RWIA 4WRSA 5HE1A 3RALA 4DCAA 4Y5HA 2OG8A 4TYHA 2YZLA 1OPJA 1J3HA 4MH7A 3W2QA 5BMSA 5J5SA 2PE0A 1TQMA 4KRDA 4ZMFA 5EOBA 1KOBA 2Y8OA 3QX4A 4YO4A 4XOYA 1U5RA 3MA6A 2OLCA 3AD6A 3DU8A 2HCKA 3RINA 3UQCA 4O7YA 2WMTA 4GFMA 4G2FA 4QQ5A 4EH8A 5IEVA 5LMBA 5AV1A 4AGDA 3RKBA 2CGVA 1PXMA 3HRCA 3ZYAA 4GL9A 4E4MA 2RFNA 5A4EA 4R7IA 3AXWA 2W99B 2YN8A 3LCTA 3UC4A 3MY0A 1YWVA 5AR8A 3R04A 3OT8A 4CQEA 1JQHA 4KIOA 3ZOSA 3NW6A 4H58A 2X4ZA 3HDNA 4C4GA 4IMYA 2ZDUA 1TVOA 2QR8A 5H2UA 4YUQA 4BHNA 5CENA 4FG8A 5FBNC 5AX3A 3V8TA 4JAJA 3Q60A 4MQ1A 3COMA 4D5KA 3KRWA 3TUDA 3F3WA 2WIHA 3LQ8A 1WZYA 2J0JA 2ZM3A 4BGHA 5I9ZA 5FEEA 1TQPA 3I60A 5K5NA 3A4OX 3EN9A 4BIDA 2H34A 4CSVA 2P33A 3ZONA 3II5A 3BGQA 1Z9XA 4APPA 4ZY6A 5C1QB 3SOAA 5HD4A 4FUXA 5CAVA 5I0BA 2ITWA 2YAKA 2WFYA 4CZYB 4E4XA 2X6EA 4CRSA 2VUWA 4NFNA 1H25A 3QXPA 5IISA 2IVVA 3GOKA 3VHKA 3IPHA 3SHEA 5CEMA 3QLGA 5M57A 2OBJA 1PXOA 2VO6A 4O83A 5IA1A 4YSMA 2XF0A 4QMYA 4GEOA 2PVMA 2PE1A 2UW3A 2J9MA 4GH2A 2I7QA 5AUWA 4PTEA 4IZ7A 3O50A 5FDPA 5K3YA 1GY3A 3CJGA 3KRXA 4X7QA 2XYNA 3QHWA 4RX8A 4FV7A 1PRYA 4FTQA 4WUAA 4UBAA 5CVFA 3ZLXA 4QMWA 3FV8A 4PTCA 4R5YA 4ZY5A 3DNDA 3VJOA 1OL5A 5EDRA 1Y6BA 4GK4A 3CTHA 4MYGA 3O23A 5HKMA 2XNOA 4BTFA 1QPDA 3RMFA 2CCIA 2RGPA 2CN8A 4E4LA 1GIJA 3ET7A 4BTJA 1ZZ2A 3OMVA 4YJNA 3UOKA 2WXVA 3EN6A 2W4JA 4GRBA 3ZRMA 4NL0A 4B8LA 4QMSA 4PMPA 4JT3A 2FO0A 4JQ7A 1W7HA 3MN3A 4OW8A 2NO3A 3EFWA 4PP9A 2QOQA 3JS2A 3ZSHA 3G51A 4EQCA 1OL2A 1G5SA 3HVCA 3OXZA 4ENXA 5C01A 3KXZA 2CJMA 2Z60A 5BPYA 4DBXA 3QRJA 3FYJX 4HW7A 5IQBA 2BZKB 2OIQA 4QQJA 1WVWA 4LMUA 3DBEA 4LRMA 5L6OA 2UZUE 3QD2B 4N6ZA 1JNKA 4ID7A 3U51A 5DR6A 5AR2A 4MF1A 4AAAA 4CD0A 4F1TA 3MFTA 4GJ2A 4QQCA 1PKDA 4QMQA 2PVJA 4CT2A 5IMXA 2GMXA 1OIQA 4FV9A 4N6YA 4QMXA 5ANKA 5E8SA 2HIWA 1CMKE 2W17A 3E93A 3Q9YA 1FBNA 4E20A 3ZZWA 5HCYA 4DH7A 4FX3A 3ZUTA 4AW2A 4FNXA 4IB3A 3DBDA 3QAME 3U4UA 3MFRA 5ETFA 1CDKA 3DK6A 5AA9A 5D11A 2VGPA 3FZSA 4RVMA 4WNMA 4YLKA 1H0VA 4XG3A 4GW8A 2JFMA 5E1EA 3R9DA 3VS5A 4H3PA 3JR1A 1Q99A 2A0CX 2H96A 2OICA 4GU9A 4DFUA 5JT2A 2E9OA 2JDTA 1XH6A 4L67A 2EVAA 3R28A 3RWPA 3VAPA 5D41A 3R1SA 2OSCA 2W1DA 3QQFA 2XIZA 3QUDA 2BIKB 5KE0A 3VQHA 3OY1A 4C3RA 3U54A 2GS7A 3BYUA 2YJRA 4BYIA 3CJFA 3LLTA 3L9NA 2IZUA 3D2IA 4J98A 4EK3A 5B7VA 1YOJA 3TKHA 1KE7A 2BTSA 2I0VA 2UZWE 2IW6A 4UV0A 4V0GB 3VWAA 1XH5A 4LRJA 3QZGA 3OW3A 5CSHA 2V5QA 3T3UA 4LMNA 4IB5A 5LVMA 3BZ3A 4QTAA 4HYUA 2VTPA 3OUKA 5J7HA 2BDJA 2XS0A 5E90A 2G9XA 3DXNA 4FTOA 5KMLA 3UQFA 4QMLA 4GMYA 2EB2A 3CQEA 4PMMA 1VJYA 2WU7A 3QKKA 4QP7A 4B99A 4H3BA 1PMUA 4RIWB 2WAJA 4I4FA 3CR0A 3OOMA 4YZDA 5EK7A 5KZ0A 4RFZA 2WTIA 4ANOA 1YW2A 4BKZA 3C0GA 3R00A 1T46A 2O65A 2R3QA 3MFUA 2CKPA 4GK2A 5CXHA 4K2RA 5FM2A 3DS6A 2XK3A 2WO6A 4L8MA 3DK7A 4KS7A 4EH3A 3K5UA 3OS3A 2PVHA 3HKOA 2ZV9A 3QTRA 4QMZA 5EYDA 3UPXA 4MBLA 4E6CA 5EW9A 5E1SA 5C26A 1JLUE 2W5AA 5C27A 3RPYA 4IAZA 3GGFA 3VHEA 3ZSIA 4IVBA 2BRHA 5FP6A 2XNPA 4JBQA 4E8AA 3LXLA 3CGFA 4E5BA 3QC9A 2VWYA 4IAKA 5J9YA 5IQHA 3D83A 2WGJA 3QWKA 4BI0A 2V0DA 2WELA 4GVAA 2CCHA 2X7GA 4Y72A 4F63A 3LPBA 1X8BA 2FSMX 3PSDA 3R9NA 2X2KA 2IO6A 3D2KA 3FHIA 3KREA 1P14A 2C1AA 3FKOA 3VQUA 4JX3A 5IA3A 3PLSA 3DOGA 2JITA 4O7WA 4BWPA 4GT3A 2BRGA 4FL1A 4I5CA 2WMXA 5EM8A 3PVGA 1UV5A 4MXYA 1GIHA 3VS4A 4GYIA 5DRDA 1JWHA 2VTQA 2B52A 4Y85A 3V8SA 5KO1A 3QUPA 3IW6A 3KCFA 3O0GA 4J99A 5CQWA 4BDAA 3EN7A 3E8NA 5JGAA 4QP9A 1BI7A 4BRXA 5I3RA 4YURA 3KVWA 2X8IA 3OW4A 4NEUA 4YJUA 2OJGA 5LCJA 3Q3BA 5DT3A 3UZTA 3ZH8A 2OIDA 3QRTA 3O2MA 1V1KA 1JKSA 2BAQA 4IC7A 4QMPA 4XG7A 4RJ8A 3RBWA 4LFIA 2C0TA 2BPMA 1NA7A 3D14A 3D5XA 4I24A 4MNEA 5FWKK 3NYXA 4AGUA 4BDEA 3L9MA 3ETAA 3CSVA 3TNQB 5HBEA 5JZJA 1NY3A 4F9YA 4FKRA 4R78A 2CSNA 3R9RA 3SG8A 3QTSA 3V51A 3V5TA 4DGMA 3ID6C 3I7BA 2AYPA 5C4LA 3IG7A 4YZ9A 4PL5A 3G9NA 3UNJA 5BVKA 3IW4A 3AMYA 4IM2A 3FKLA 5HE0A 4DFLA 4W4YA 4C4FA 1O6YA 1S9IA 3QZHA 1Q8YA 2BILB 4FKWA 1FQ1B 3P1AA 4WRGA 4NJ3A 4QMVA 1VR2A 2CMWA 4NCTC 2XNMA 3TJCA 3OCGA 2PYWA 2C6OA 3MH3A 2I0EA 3Q96A 2UZEA 1JSTA 3TWJA 3A4PA 4IAAA 3EQFA 5HVJA 4NM7A 3NYVA 2P2IA 5E9EA 3V5QA 2WZJA 1FOTA 4CFVA 3HLLA 2IJMA 3UG1A 3OY3A 3ERKA 4KRCA 2X0GA 3RNIA 4G3GA 2G01A 2R4BA 2OKRA 5HE3A 2AC5A 1H1RA 4C02A 4YHTA 2YACA 4YLLA 5L2SA 4CZTA 3ALOA 4ZEGA 4ZZNA 3EL8A 2YIWA 4FTTA 3R73A 4XP3A 5H8GA 4EH4A 4G16A 1ZAOA 1WBPA 4JDJA 4EOOA 4RX9A 3JUHA 3VBTA 1LEZA 1YWNA 4XJ0A 3FI2A 3ZDUA 4RC4A 5CU4A 4ZS0A 3BX5A 1GZKA 4EL9A 4FTJA 3AC8A 5JFSA 1Z57A 3HV4A 3PFQA 2B0QA 4FV4A 2XKEA 4D1ZA 1WBVA 5AV2A 5CY3A 4FIHA 3TNIA 1V0OA 3NUYA 3BELA 3HA8A 4G6OA 4FZDB 4AWIA 5IQDA 3E8DA 3H0ZA 4PMTA 4IZAA 2BRMA 4IX6A 1W8CA 3U6IA 1H01A 4DCEA 2QNJA 2GNHA 3LZBA 4RVLA 4IB0A 2ITVA 4AN3A 3NIZA 3R7UA 2CNQA 4RMZA 3NNVA 3QTXA 1YXSA 4FIIA 4I92A 4TT7A 1REKA 3QLFA 1R3CA 5KBRA 2W9FB 2PVYA 2F49A 2XNNA 3WZKA 3G6HA 4QTCA 3L8SA 3C50A 2Q83A 5HVKA 1P4OA 4EH9A 1Y6AA 4J52A 2VTIA 3EB0A 4UB7A 4LQMA 5ETAA 3HNGA 1J7UA 5HTIA 1YDTE 3D9VA 5KHXA 4CMOA 4JG7A 5L6WL 3MTFA 4MXAA 4TRLA 2UZBA 4AW5A 3RPOA 1YHVA 4G1WA 5BVEA 3T8OA 3F69A 3IK3A 4I0SA 4O0VA 4A9RA 4RT7A 3PRIA 2Z7QA 2FSTX 3ALNA 4YPDA 3UNZA 4G5PA 5JEBA 3I4BA 4JBPA 2C1BA 3UTOA 4A07A 2W1GA 4HZSA 1M2RA 3QD4A 4I6QA 1ZZLA 4DFBA 3E64A 1FMOE 2OJJA 5KMMA 3CS9A 1VEBA 3BRBA 1IAJA 3OROA 2BKKA 3A62A 3Q2JA 5LQFA 3SV0A 4OTGA 1J7IA 3OEZA 4KSQA 3PIZA 5CF5A 4EYMA 4YBJA 1I09A 1SNUA 3PG3A 3WILA 4DG0E 4CFUA 1R0EA 5BVOA 4WHZA 5LWNA 4D55A 3Q5IA 3E8CA 4G3DA 1H1SA 3BPRA 3E3PA 2WHBA 2XJ1A 4MHAA 5M06A 2W06A 3NSZA 1H24A 5ANIA 4JRVA 3ZO3A 3NUNA 1IEPA 5JN2A 1B38A 1ZARA 4PMSA 3R63A 5ANGA 2VV9A 5CF6A 4LV5A 2QO7A 2VO7A 3Q5ZA 5IA4A 4HCVA 3VUDA 4FSYA 1KWPA 5F4NA 5CNOA 4DF3A 2WTKC 5IZFA 3SRVA 4CTCA 3IONA 1V0BA 4R3PA 1VYWA 5DOSA 2ITOA 1Q8TA 4FKSA 4HJOA 3DB6A 3VW6A 5E8YA 4EK6A 3BEGA 4F6SA 4FKUA 1MQBA 3IW7A 2ZV8A 2YDIA 4QNYA 3CIKA 2R3HA 3A8WA 3G0EA 4H1MA 3VS7A 3DLSA 2J4ZA 2J7TA 2QHMA 4FV3A 4S30A 2ZYBA 4PF4A 4IDVA 5AM7A 1IRKA 3ZFYA 4ZOGA 4ANBA 2BFXA 2DUVA 3I7CA 4IZYA 4OTFA 2XUUA 2PUPA 2PULA 1VZOA 4H3QA 3UDBA 3VS2A 4JI9A 4O22A 3EQCA 2QOLA 5F9EA 1WBWA 4JX7A 1V0PA 2E9VA 5BYYA 3GUBA 2X8DA 3BGZA 5HLNA 4EJNA 5K9IA 4KS8A 4DA5A 3TV6A 1JPAA 1JOWB 4B9DA 4RJ6A 4DFZE 5LXMA 1A06A 3FUPA 4O84A 2J5FA 3EKKA 5M51A 3RTPA 2GNLA 4X2FA 2CLQA 4ZLOA 5FD2A 2RKUA 2GS6A 3I1AA 4RIYA 5F94A 4ALVA 4YJRA 4Q9ZA 3HX4A 4Z16A 5HESA 5FUTA 2C5OA 1AQ1A 1ZLTA 4WBOA 3OWPA 4CFMA 4O7VA 2RG5A 3S2PA 1ZYJA 4NWMA 4HCTA 4RVTA 3EYHA 2ITZA 3QQGA 3LXKA 4TYIA 4FSUA 4TYEA 5BUJA 2YCFA 4M69B 4ORKA 5M55A 3DCVA 3OXTA 3TJDA 3OTUA 3JPVA 1IAHA 3ZHPC 4BGGA 2Y9QA 4C2VA 4C34A 5DMZA 4AZFA 3GC7A 2UZLA 3B8QA 3HMIA 3LFSA 3ZBXA 5K0KA 4X3FA 4IDTA 4YO6A 2B1PA 3MW1A 5I4NA 4FSRA 4GT5A 5HX8A 1JSVA 2QOIA 4IAIA 4MVFA 3OG7A 4FV2A 4HCUA 4OBPA 3T9IA 3DQXA 3HDMA 2W5BA 2QOHA 2VO0A 2PUIA 5EQYA 2R0IA 3GCPA 3EFJA 3R1NA 4GK3A 2YDJA 4K0YA 4YZBA 4RGJA 5J9ZA 1PMEA 5JFXA 4X2NA 5CVHA 2ITYA 3VUIA 5LMKC 3HYHA 5CEQA 3KU2A 4DGOA 5FBOA 3N4VA 5C8MA 3G15A 4FV1A 3CQUA 4NK9A 2GFSA 3ZFXA 1KSWA 3M42A 4BF2A 5I9YA 3FHRA 3HZTA 4FIGA 1TKIA 4FV6A 1ZOGA 3WE4A 3W32A 4RA4A 2UZVA 3GU4A 2PTKA 4UWYA 3LMHA 3ZC5A 5E8UA 4MXZA 2HY81 5HNGA 3HRFA 2W1ZA 3N4TA 2PZ5A 4BB4A 4BCMA 3D7TA 4Z55A 4AN2A 2VWUA 3DZOA 3S3IA 5EYCA 5ITAA 5CSVA 3W18A 5DT4A 4ZTLA 3P9JA 5JKGA 1W98A 4JAIA 4O1OA 3E8EA 4J1RA 4EBVA 4ERKA 3WYYA 5K5XA 4FIFA 5KMIA 2YCRA 4L44A 3VBWA 4JNWA 2C6MA 3BHTA 1YI4A 5J1WA 5L4QA 1H27A 3ZC6A 3QQLA 2E2BA 1Q8ZA 2ETMA 2PMIA 2PZYA 3BLHA 4GFGA 2BDFA 4AZTA 4CXAA 4DHFA 3HV3A 4QOXA 4BHZA 3PSBA 1Y91A 4FT7A 4RIXB 3QTZA 5TOZA 2B9JA 3QC4A 3U4WA 3F5XA 2X7FA 2GTNA 3TUCA 5J95A 2JBPA 4JL9A 3UIUA 4YJPA 3F61A 5FTGA 2HOGA 3MS9A 3NUUA 4UZHA 1ZYSA 4YJVA 2FSLX 4G3EA 4XH6A 2UVXA 2VTHA 2C6EA 5HORA 5JSMA 5DIAA 2VWVA 3DKGA 3A2CA 3CC6A 3AC3A 3KVXA 2J2IB 1U46A 2B54A 3K3IA 4IH8A 4AN9A 2J5EA 4JBOA 2O0UA 4ANSA 5J9LA 2H6DA 5H3QA 5LOHA 5EM5A 3R8LA 2YHVA 4E5WA 3PXKA 4CKJA 3BLQA 3M2WA 4FSZA 4D9UA 3P79A 5ANOA 3TUBA 1SM2A 5KKRC 4DEGA 4G17A 3GVUA 3P7BA 5L2QA 4ERWA 2XNGA 2R3MA 2XB7A 3ODYX 2QURA 3KRLA 3ZTXA 5J7BA 1W82A 3DQWA 3PLAE 3VJNA 1UNHA 5IQAA 1M52A 3O8UA 5DNRA 1ZOHA 4CLJA 5EH0A 3TZMA 3ORKA 5M07A 3FE3A 3H9RA 3QCXA 4D4YA 3H0YA 3MY1A 2W1IA 2JAMA 3BEAA 2OJFE 3LFQA 3PY3A 3QHRA 4CRLA 3LQ3A 1KE6A 5AP0A 5A3XA 3F2RA 4R7HA 2I6LA 2WMRA 5HVYA 4ZSEA 1XBAA 2NP8A 4O7TA 1UWHA 2V62A 2A2AA 2WTJA 4ZAUA 3OBJA 2RSVA 4KAOA 3SXRA 3KXNA 1IR3A 4DTAA 3P78A 4FUYA 2CKOA 4IX3A 1WAKA 4FNYA 4N4SA 1OBGA 3Q2MA 4RQVA 3RAIA 3H9OA 3IECA 1OUYA 2BZHB 2WEIA 3FLSA 4FOCA 4QRCA 1JVPP 5AA8A 1FMKA 1PW2A 3F5GA 3P5KA 4CV8A 4UWCA 3BQRA 4KD1A 1DAWA 3MSSA 2R3LA 3FDNA 2BFYA 3WIGA 4QTDA 2X2MA 1SNXA 1UKIA 3FXZA 4U45A 5AWMA 2XM8A 3FMJA 4RSSA 4TYHB 4BBFA 5IA2A 2JDVA 3MVHA 5AP4A 1KE9A 3TIYA 3RHXA 3NAXA 1BL7A 4UY9A 4L6QA 5IPJA 4YZMA 5K0XA 4M0YA 3TKUA 2HXQA 1KE5A 4EZ3A 5A6NA 4ACHA 3TZ8A 3WF7A 3I6WA 2QOFA 4XLIA 3OCSA 4P2KA 1YQJA 5CQUA 3M1SA 3H4JA 3KULB 5FTOA 3R83A 3TV4A 3U9NA 3ZRLA 1H8FA 2PY3A 2XJ0A 3A61A 1YOMA 2R3IA 2W4KA 4M15A 3UMXA 3DXPA 3F3VA 5JK3A 2GSFA 3ANQA 1WFCA 4O1PA 1ZRZA 3FLWA 5LMAA 2BALA 3VBXA 1YWRA 4IXPA 5AIRA 5IUIA 2C69A 5KMNA 3NNXA 3C5IA 3HMMA 3P4KA 4IC8A 4O82A 4FNZA 2GPHA 3I81A 2FUMA 2BCJA 4I6FA 3UZPA 3HAMA 3ORXA 3FZOA 1BLXA 4TN6A 2PMOX 3FLYA 3Q32A 4QPAA 3VBVA 4D2SA 2WB8A 2E9PA 5CU6A 5EI2A 3UBDA 4FVPA 2VTLA 1DI8A 1GZ8A 2R0UA 2IPXA 3IKAA 4L42A 3MJ2A 3FPQA 1FVVA 4FL2A 3LXNA 5CAPA 2W5HA 3ULIA 3ATTA 4MTAA 3VRZA 4QP6A 5DVRA 1OGUA 3DZQA 4TYJA 4BL1A 3RP9A 3EH9A 5AFVA 4U0IA 1U54B 5GINE 4CQGA 1DS5A 3LKMA 1SZMA 2XIKA 1WVYA 2YITA 5M56A 4CYJA 4ZP5A 4BDIA 5KBQA 1BMKA 4L7FA 4X2JA 4HVSA 4YTIA 3VUHA 3FAAA 1OKVA 2VO3A 4QO9A 4CNHA 3I5ZA 5A54A 3CE3A 5CEKA 2QODA 2QR7A 2W1HA 3C4XA 2QKWB 5AUVA 4GUEA 3WF8A 1YXXA 3C1XA 1F5QA 3PRFA 2V55A 1KV1A 1UU3A 2UW0A 5JFWA 1OM1A 3WF9A 4F4PA 3L8XA 2W9ZB 4YTHA 4XG8A 3COIA 4Y46A 1H1PA 3OUNB 3KGAA 4X3JA 3CBLA 5EHLA 5B2KA 4ASEA 5D7AA 3TL8A 3FI3A 4MXCA 5H9BA 4Q2AA 5BVWA 2X2LA 4GIIA 3E7OA 3ZM4A 4EC9A 3BYMA 4WD5A 3F2NA 3R8UA 3NDMA 4UMUA 4YTFA 3O7LB 2CN5A 2Z7LA 4RIOA 2OFUA 5JH6A 3BE9A 4U81A 3ZS5A 2B7AA 2EB3A 3FXWA 3GQIA 4I0RA 3NUXA 3C0HA 3LLAA 3W2PA 1DM2A 3BHUA 4F09A 3OHTA 5B2MA 2J51A 1H07A 1QPEA 2CLXA 4P5ZA 5CF4A 3EKNA 4H1JA 2QONA 3DDPA 3RVGA 4CMUA 3DAEA 3ZZEA 1OIYA 4EORA 1J1BA 2C0OA 2IZRA 3KA0A 3PIXA 4V05A 4ZJJA 4O6LA 2O2UA 3FMHA 5EW3A 3TKIA 3FLNC 4YNOA 4PDSA 5IG1A 1J7LA 2UW7A 1F3MC 4LRKA 5AP2A 2FVDA 2P0CA 4YNEA 4DH1A 5HTBA 3LMIA 3TG1A 4BVUA 4UMPA 4NYEA 3MH0A 1OIUA 2DYLA 3PA3A 4WO5A 5EOLA 3DGKA 5T6KA 3PXRA 4NKSA 3BHHA 2GFCA 4UX9A 1YXVA 1PXPA 2W7XA 1IG1A 1EH4A 3FPMA 3PG1A 3W2CA 2XP2A 2C0IA 4W4WA 5E8TA 3GCQA 2ITPA 2VAGA 4BDGA 4YU2A 5IH6A 2Y4IC 2J6MA 1LEWA 1K2PA 2WMUA 4FYOA 4GV1A 5GIPE 3BU5A 3IDPA 2PK9A 3HMPA 4F9BA 1FPUA 3DY7A 3ANRA 4GIHA 2OJIA 3COKA 2JIIA 2QI8A 3UE4A 4DGNA 3FC2A 3D4QA 3LFAA 3ZSGA 3IS5A 3NEWA 5CEOA 4U8ZA 4ZLZA 5LVPA 4O96A 5LJJA 2NRUA 4Z7HA 4P4CA 3AC5A 4K6ZA 4C4IA 4UYAA 1ATPE 1WBNA 2X81A 5KMJA 5DN3A 4NCTA 3K3JA 5FP5A 2X9EA 4YC6A 5GJFA 2IW9A 3G33A 5DGZA 5HNBA 2JDOA 2E9UA 3BU3A 2GNGA 5C8NA 4D2WA 1UU7A 2VU3A 4W8DA 3R7VA 3BBWA 4EQUA 4FTLA 2XKFA 3SA0A 2YCQA 4RRVA 4TYGA 3KEXA 3UO4A 1PF8A 4NTSA 4P5QA 3R7YA 5LCKA 2F2UA 4CVAA 3DKCA 3V6RA 4F6UA 3GXLA 4J8NA 4E26A 5AUUA 1YXUA 4ZTSA 4HYIA 5IDNA 2JD5A 4FKQA 1JKKA 3GNIB 3OVVA 4BN1A 3DBCA 4FEQA 3WBLA 2YFXA 4OT5A 5EYMA 1KE8A 3ZLSA 5IF1A 1LPUA 4WG3A 4A9YA 3LFNA 2BUJA 3DKOA 5EKNA 2B55A 3LE6A 4ZK5A 1HOWA 4DYMA 3ZMMA 2WMSA 2C4GA 3FJQE 3R0TA 4RC2A 4WKQA 5CT0A 2IVTA 4UN0C 3GENA 4MBIA 3Q9XA 4IM3A 3GB2A 3HGKA 3SG9A 3KFAA 4B6LA 4HGSA 4TWPA 1FVRA 3QRUA 3QRKA 4PWNA 2ZV7A 4JR3A 4XEYA 3VULA 1MRUA 3QF9A 1GZNA 4IZ5A 1H26A 4QMMA 4XX9A 4DH8A 4QMNA 5ANDA 5AP5A 1Q62A 2EXMA 3QTUA 2X39A 2GNIA 2PZRA 4FKJA 3DTWA 3ZU7A 4AOTA 4QYGA 4ASDA 4KIKB 4AW0A 5I9UA 5FXRA 4V0GA 2C3IB 1OKZA 4RQKA 3R7GA 5FDXA 4G3FA 3ACKA 4C61A 3NS9A 3FI4A 3HUCA 4DH5A 3S1HA 5B0XA 5AAEA 2HW7A 3RZBA 3E5AA 4IBMA 4KIQA 3OOGA 4YMJA 4EOQA 3H30A 4LI5A 3A7JA 2UW4A 3GC8A 4G6NA 4BCGA 4YSJA 5LVOA 4XLVA 4MXXA 2OW3A 3ZUUA 3WE8A 3FQSA 4USFA 3P7CA 4IFCA 4U40A 5ICPA 4DE4A 3KF4A 2JDSA 4HGEA 4QTEA 1QMZA 4FC0A 3PE2A 4AZWA 1J91A 5CAQA 2OFVA 5I9WA 3UP7A 4V01A 3MVMA 2B53A 4DT8A 2EWAA 2R3PA 4F1MA 3FQHA 4MNEB 5IA5A 4IWDA 2OF4A 3GCVA 3F7WA 2CHLA 3L9LA 3P86A 4JJRA 2LGCA 4O2PA 4ZSLA 4AG8A 4E93A 3JVRA 4JLCA 2I0YA 3L1SA 4FNWA 4GUBA 5HO7A 4N57A 3HV7A 2XEZA 5DR9A 2VZ6A 4BWKA 4DEEA 5A4LA 4FEXA 5BYLA 2WQMA 5DFPA 3FI8A 2GQRA 2JIUA 4AA0A 4CGAA 3A8XA 4AOIA 4QMUA 3UP2A 2JFLA 3MB6A 4XG2A 4TWOA 1OKWA 3TTJA 5AAFA 5KUPA 1OBDA 4FIEA 3JY0A 4N70A 3QKLA 5IEXA 3FC1X 5DE2A 4O0YA 4DN5A 5AM6A 5AR5A 3VS3A 3W8LA 4UMRA 3NVKI 3HMOA 4FVRA 5K4IA 3OT3A 1APME 3ROYA 4TNBA 3FZPA 2WOUA 5G6VA 5AP3A 2YIXA 1Q97A 2GHLA 2JKKA 4ZZOA 4FK3A 4WG4A 1I44A 5AR7A 1YVJA 4IANA 1B39A 4E4NA 2ITNA 4FKGA 4LYNA 4M7IA 4K18A 4APCA 3DB8A 1YHSA 1FVTA 4UMQA 5DYJA 4V04A 4MF0A 5CNNA 3CD3A 4S33A 1MRYA 4BCNA 2BAJA 4BCJA 3AT3A 5DA3A 3HECA 3HV6A 1A9UA 3CD8A 5L8LA 3PYYA 4G3CA 5CS6A 2WQOA 4WUNA 2QCSA 3NZ0A 4D1XA 2J0KA 3W16A 5KMKA 3DK3A 2H8HA 4AT4A 4OR5A 3PE1A 5HG8A 4GFOA 3BHYA 5DLSA 2P55A 3PA5A 5J5TA 2ONLC 5B2LA 3ZO4A 3KL8A 4NH1A 3U55A 3KKVA 4CFFA 1JBPE 4ITIA 3K2LA 3MIYA 5A4CA 3FLQA 2F9GA 3DFAA 1HCLA 1NT2A 3Q4UA 2VX1A 3AC1A 5AV0A 4IWQA 3OFMA 4D0WA 1M7QA 4OTIA 4PPAA 5E8XA 3KXMA 5L8JA 4Q5EA 1YRPA 4CT1A 4MD7E 1JKTA 2IWIA 4DTBA 4BDHA 1SVEA 2BDWA 4I5PA 1H00A 3R1YA 2XYUA 3IO7A 4EBWA 1BYGA 4MXOA 3WZEA 4ALUA 2KULA 2WTVA 3I5NA 4I6HA 4RLLA 2C6IA 4KUJA 1PHKA 5AV4A 3V01A 4TWNA 3RCJA 2E9NA 4JR7A 1Y57A 4PX6A 4ZTMA 4JS8A 2XIXA 3E7VA 4R3RA 4Z3VA 5IEYA 2WNTA 3AMAA 2FGIA 4IVDA 4XCUA 3GOPA 4YC3A 5CZIA 4K11A 3TM0A 1XR1A 4BCOA 4NIFA 2XKDA 1PXKA 2HELA 3I0QA 5CTPA 3RI1A 3F5UA 4IX4A 2WMBA 4JQEA 4G9CA 1CTPE 5TO8A 4BIBA 3BE2A 3VUTA 4RLKA 2VNYA 3TXOA 5CSPA 4OTPA 4QMTA 5LMKA 4C38A 3F9NA 4EOIA 2NPQA 3EQGA 4Y8DA 3R8PA 3WARA 3FYKX 2J50A 3FL5A 3G6GA 3NRMA 3PPKA 4U6RA 4WNKA 5HTCA 3EQPA 3N4UA 3SC1A 2WMWA 4C35A 4RVKA 3MPTA 4CZUA 4HOKA 1M14A 4BGQA 2XK6A 4FV5A 3BU6A 4Z7GA 3LIJA 2ITQA 2EU9A 4FZ6A 2R3GA 3TNPC 4ALWA 5M4UA 3GQLA 4G5JA 3C4EA 1M7NA 3D5WA 3OP5A 3OZ6A 4NM3A 5GJGA 2YWVA 1OPKA 3GU6A 2UZOA 4PRJA 3IQ7A 4CCUA 4YTCA 4O38A 2PSQA 4AACA 4I21A 1XH9A 3EQHA 2QOKA 2JKQA 3BYOA 3ZFMA 2QG5A 2HXLA 4EC8A 4NW5A 4M68A 4O0SA 3LFEA 3NGAA 4E6DA 2XZSA 2VTTA 1U5QA 2AUHA 3JVSA 4L01A 5IQIA 3PZEA 4M84A 4TTHB 4TNDA 3FQEA 4NJDA 3AGMA 3LJ1A 2VTJA 3D0EA 2R3KA 4A9SA 3PPZA 4I5MA 2YDKA 5KX8A 4WIHA 3GFEA 5AMNA 4II5A 4GCJA 4AGWA 3U8WA 4PDOA 4FTRA 5A6OA 2A4LA 3F82A 3A7FA 1W84A 5IA0A 2X7OA 3C4WA 3FY0A 1MUOA 3A99A 4FK6A 4FR4A 2BRBA 3LCDA 3AOXA 4MD8E 3MH2A 4EH2A 2QG7A 5J79A 4AF3A 3R22A 4D9TA 3BKBA 3UVRA 4YHFA 2XRUA 5HO8A 5BUIA 4RIYB 3NNUA 4W8EA 4RPVA 4BCFA 2NNWB 3NLBA 5E7RA 3VN9A 3G2FA 3Q9ZA 5CWZA 4CFXA 3NW7A 3PZHA 5JRSA 3UO6A 2BZIB 3O7LD 3R02A 4XP2A 1P5EA 5EHYA 3FMNA 3P0MA 4G9RA 2R9SA 3HMNA 3GCSA 4IQ6A 5DWRA 4ZSAA 3EQIA 3SX9A 3KN6A 3ORPA 4C2WA 3AC4A 3PJ3A 3POZA 1OECA 3TTIA 5KMOA 3V5JA 3HL7A 5AEPA 3BBTB 2YM8A 5DHJA 3TACA 2W1EA 4DEIA 4DAWA 2ETRA 1PKGA 3NUSA 1Z5MA 3L8VA 4I1ZA 3D94A 2R3OA 2W0JA 3NPCA 4FSWA 3UVPA 1Y8GA 3FMDA 2CGWA 3EN5A 4L3JA 3MTLA 2UW9A 2C3LA 2XH5A 1R78A 4EKKA 4O27B 3ZCLA 2VWWA 3Q04A 5HE2A 2G1TA 3OD6X 1ND4A 2WMAA 4FODA 2F57A 3N9XA 3QQUA 4FL3A 4AZEA 4CEGA 4F65A 2BHEA 4XMOA 2XIYA 4QMOA 4A4XA 1OI9A 4EQMA 3NAYA 4DEAA 4AGCA 2GQSA 3ZUVA 1RDQE 2CKEA 3EN4A 4I93A 2JIVA 5AR4A 4L52A 4ITHA 4EOMA 2HY0A 3MGYA 1NVQA 2VRXA 5EDPA 3QU0A 4DT9A 3RK9A 3ZXTA 3OWJA 3DV3A 2PMLX 4FSTA 4ZSJA 4ACGA 4D28A 4F6WA 4PDYA 3JXWA 4GKIA 1RE8A 3RAHA 2PMNX 4R1YA 4BZOA 3LAUA 4BDJA 2CNUA 3NNWA 1CM8A 3AD5A 4QP2A 4AE6A 4HGLA 4O86A 3D7TB 3QTQA 4AU8A 4DFNA 5C9CA 1RJBA 2O64A 4BI2A 3R9OA 3SGCA 4C3FA 4HNIA 4M13A 4C33A 3LFDA 2X1NA 4FSMA 3MVJA 4O7SA 3PTGA 4AW1A 4M69A 3DLZA 4D58A 2WQBA 1ZMUA 5CU2A 2YM6A 4X2GA 5E8VA 4CKRA 2BZJA 3NCGA 3W2RA 4TL0A 2UW5A 2JGZA 4YGAA 2BR1A 2HW6A 4CTBA 5CX9A 3WZJA 3V04A 3TEIA 3EL7A 3N51A 2CKQA 4BY9E 4BIEA 4FV0A 4JG6A 5EG3A 5AP6A 3QYZA 5F1ZA 4LGDA 1ZWSA 5C8KA 2OXDA 3CPCA 5H8BA 5HD7A 2OF2A 5HLPA 2WD1A 3UO5A 4LGHA 4K1BA 3Q9WA 2I1MA 5GJDA 2B4SB 3Q6WA 4F9CA 1XBBA 4KA3A 3GC0A 4C59A 3TDWA 4IWOA 3OCTA 4M14A 2QKRA 4HVDA 4YC8A 5EW8A 4KSPA 3LCSA 3RM7A 4OAVB 3UYSA 1O6LA 3QCSA 3QYWA 4OUCA 3HRBA 5F95A 3W8QA 1QPJA 3POOA 2HAKA 4FF8A 5DBXA 5JRQA 2VTNA 4IW0A 3RK7A 5GZ8A 3DNEA 4EONA 3NR9A 1Y8YA 2WTDA 1OITA 2YA9A 4G6LA 3TZ9A 3A7GA 3VW8A 3H9FA 2PUUA 4BCPA 2P2HA 4JDHA 4BTMA 3SKCA 4R7BA 3R1QA 3UG2A 1OUKA 4DBNA 2ERZE 2FYSA 3OWLA 3FSFA 4ACDA 4JXFA 4O6EA 4TXCA 1IASA 3D7ZA 4G34A 4FG9A 3UIMA 2O8YA 5M4IA 5ACBC 5M4CA 4FEVA 4J53A 4B0GA 3NW5A 3PY1A 5BQ0A 3E63A 3BV3A 3L8PA 4ZXTA 3EYGA 4IAYA 4L46A 4CYIA 3KK8A 4C4JA 3PP0A 4EK8A 4CCBA 3BV2A 4FSQA 5EM7A 1UNLA 2PVKA 3HA6A 4CG9A 4MWHA 4BDCA 2FSOX 4L3LA 1YKRA 1REJA 4EHEA 4O0RA 3GBZA 2J0LA 2YERA 4NTTA 4ZTNA 4A06A 4OAUC 4L53A 5D10A 4C37A 5CEPA 4ZTQA 4ZZMA 3PY0A 4F99A 2F7EE 1WBTA 4FTIA 3Q4CA 1PY5A 2V7AA 2W96B 2WTCA 4KKEA 1PMVA 4QP1A 3QALE 4XNEA 4CKIA 3ORTA 3FEGA 2QHNA 3WF6A 3NYOA 4TKSA 4QYHA 3CCNA 5EYKA 4YP8A 2YLFA 2OH0E 5HCZA 4FVQA 5IQGA 4L00A 2YISA 3MVLA 2ZAZA 3RNYA 3GU8A 4GYGA 4OT6A 3NYNA 2H9VA 2J90A 3G90X 4R6VA 3PP1A 5ETIA 5DPVA 3AMBA 2RIOA 1NVSA 3ORIA 5HG5A 2ZB1A 3ZXZA 4MWIA 5CAUA 4W9WA 4FGRA 4XV3A 1NW1A 3PDTA 3GP0A 4NFMA 3TI1A 4HVIA 4DFYA 2W05A 2WMQA 2I40A 5T68A 5A46A 4YBKA 5E4HA 5CYIA 4BBEA 1UNGA 2UW6A 2W1FA 3M11A 2VTAA 4O2ZA 2CGXA 2XIRA 3VRYA 3ORMA 2UVYA 3QL8A 4UALA 4A7CA 1DI9A 1BL6A 4W9XA 4AE9A 3FMKA 4FT5A 2OWBA 3CKXA 1GJOA 1G3NA 3Q53A 5T3QA 4U3YA 5FQDC 1P4FA 2IZTA 4MCVA 4YZNA 2BTRA 5HICA 2QD9A 4FKOA 4MK0A 4FE2A 4RBLA 3B8RA 4XUFA 3FZRA 4IEBA 1G8SA 3E92A 4O0TA 4X6RA 4ANMA 4O91A 1YHWA 4J97A 3PVWA 3QA8A 1ZY5A 4IM0A 3R9HA 2EXCX 4ANQA 4AX8A 2R3FA 4AA5A 4E73A 4XV2A 4BKJA 1JSUA 4HPUE 4IE9A 4BZDA 2HZ0A 2YIRA 2C6DA 4YJOA 2OZAA 4FIJA 1WVXA 3LQ5A 4XRJA 3NIEA 3V6SA 3DBFA 4RZVA 2FA2A 3SD0A 5I9VA 3DXQA 4C57A 3HV5A 4FI1A 4TW9A 1RW8A 4AOJA 1ZMWA 3MY5A 4RJ3A 2UV2A 5IDPA 4QYEA 3WIKA 3ZLYA 4J96A 4FKPA 4OTDA 3VUGA 4AP7A 4RFYA 2VNWA 3IGGA 5HBJA 3RPRA 4WG5A 1A48A 3LFCA 4CFNA 2ETKA 4FSNA 4C36A 1M2QA 2IN6A 3L9PA 3LCOA 4U42A 5DEYA 3KULA 3AT2A 4HGTA 5DRBA 2JKOA 2VTMA 3OCBA 3SAYA 3ATSA 4W4VA 4JDKA 3CY2A 3C4FA 2VGOA 3MJ1A 3PIYA 5AP7A 3REPA 5L6PA 1UKHA 2XRWA 2C5VA 3PWYA 4L7SA 4RA5A 1ZMVA 2PVFA 5LVNA 2Y6OA 4X2KA 4ACCA 4U80A 2P4IA 4F0FA 3ENHA 4EHVA 3MI9A 2YM3A 3RGFA 2GS2A 4D2RA 2ZB0A 5CZHA 3VIDA 2RG6A 2B9FA 3IDCA 2XCHA 4Q5HA 1ZXEA 4FKTA 3TN8A 2RF9A 4ZTHA 3KY2A 3BHVA 3TV7A 3K54A 4ZJIA 2XK4A 1U4DA 1H08A 3ODZX 3E88A 4LOQA 3ZO2A 4EI4A 3EFLA 3QKMA 3VF8A 1PYXA 4U79A 3H10A 4ASZA 4C3PA 5HIEA 3O8PA 3PSCA 2VWBA 5ETCA 3EOCA 4D2TA 3R7IA 2XM9A 3TCPA 1Q4LA 2R7IA 3LM5A 4WSYA 1UVRA 1AGWA 5FXQA 4KINA 2DWBA 1OL7A 4O81A 2F4JA 2HK5A 3KXHA 1U54A 4U44A 3Q52A 2Y6MA 3UVQA 1Q5KA 3UPZA 1ZY4A 2YLEA 3C0IA 3COHA 2DQ7X 4JIKA 3DJ5A 3EQRA 3UOHA 3LM0A 4EOJA 4KIPA 3D5UA 5JQ5A 2OU7A 2GQGA 3UODA 3V5PA 3QA0A 2GCDA 4NM5A 5L3AA 3FLZA 3MA3A 3PVUA 1E9HA 1DAYA 4RFMA 4DC2A 4MKCA 3GI3A 2ZMCA 4ASXA 1Q8UA 4EHZA 3E62A 4NM0A 4O7LA 5CSXA 4IHPA 2C6LA 5J8IA 2WPAA 2IG7A 3LVPA 3HP5A 5GHVA 3BCEA 1U59A 4E6QA 3FBVA 3CQWA 3ORNA 3FZTA 5EI6A 5LARA 4EZ5A 2XK8A 3EQDA 1WBOA 3QBNA 4U7ZA 5D9HA 4BCIA 3ITZA 4R1VA 1H0WA 1WBSA 5LWMA 3FZ1A 3CGOA 4E3CA 1MQ4A 4FZFB 4NT4A 3RJCA 5FEQA 2PHKA 5HLWA 4L45A 2B9IA 3WZDA 2X4FA 4DEDA 5DEWA 3W1FA 4DGGA 4FG7A 2A27A 3SDJA 3KRJA 4U5JA 2JLDA 4FA2A 3HEGA 5HU3A 4J95A 4BCQA 4C0TA 5CALA 1J1CA 2XEYA 4WSQA 1O6KA 5HEZA 3ZRKA 3QTIA 4QYYA 1PYEA 3LHJA 2ZOQA 4AZVA 1Q41A 2V22A 4J8MA 5CANA 2Z02A 4X0MA 4WOVA 4D1SA
chains in the Genus database with same CATH superfamily
4M3QA 3KXXA 4EEVA 3QXOA 4YJQA 3QQJA 2OXXA 4XS2A 5EM6A 4GKHA 3MIAA 3CKWA 3DBQA 3VF9A 3ZM9A 4EWHA 3OBGA 1JKLA 1CKPA 4QQTA 3AD4A 3KB7A 4XHKB 3AT4A 2PZIA 3OXIA 1STCE 2DS1A 2ITUA 1S9JA 2X8EA 1K3AA 3FWQA 1LP4A 4OTWA 5GZAA 2PVNA 2UZDA 3UYTA 3PJ1A 2R3NA 2ONLA 2G2IA 4OTQA 5BMMA 3TIZA 2W1CA 3DPKA 5CI6A 3U87A 5A4QA 5CF8A 2GHMA 3VUKA 2C5NA 2I0HA 5EKOA 3W33A 3FMMA 4HYSA 2CNVA 3AKJA 5L2WA 4D4SA 4IX5A 4XP0A 3ROCA 4KBAA 3U6HA 3KIOC 5TKDA 1XBCA 3F3UA 4F70A 4RC3A 1OB3A 3PJ2A 2IVUA 1PXNA 4U3ZA 4RX7A 1UWJA 4EH7A 1UU9A 4GVJA 3UOLA 5HU9A 4BCKA 4QP3A 5G1XA 5D7VA 3SW4A 4FT3A 4C62A 3PWDA 3O17A 1XH7A 4XBUA 4EOKA 3IDBA 3UOJA 3LFFA 4PY1A 5EFQA 1F0QA 2A19B 1XH4A 4LUDA 5HOAA 3NFGB 4DDGA 1YOLA 3VBQA 5I9XA 2JDRA 4O21A 3PA4A 4IB1A 4USDA 2OI4X 5E91A 4FT9A 3EQBA 3PXQA 4XG6A 3ZDIA 3SVVA 1TQIA 3KCKA 3O8TA 3Q4ZA 4FMQA 2YWPA 4M12A 2C6TA 4JIAA 4YLJA 3R30A 3RCDA 3O96A 4EH6A 5CASA 2A1AB 2OK1A 4X21A 3V8WA 1GIIA 2ERKA 2RFDA 4KKGA 4HVGA 5IKWA 5M53A 3NMUF 1M17A 3FL4A 5M44A 2GTMA 1ERKA 3WZUA 4NSTA 3BQCA 4B7TA 5IMEA 5HIDA 3P08A 3UZRA 4NW6A 4S34A 3GEQA 1ZYDA 4U9AA 3QGYA 4RWLA 4LOPA 4RIWA 5H8EA 5D12A 4BYJA 4AUAA 3SOCA 5GIOE 2QLQA 2WQEA 3F88A 2W4OA 3C4CA 5HBHA 2VX0A 4Y95A 3W2OA 4XG9A 4E6AA 2JKMA 1Q61A 3C7QA 5CVGA 3GU7A 3OF0A 4F7JA 4U43A 2QQ7A 4E1ZA 2CGUA 3QCQA 3PXZA 4RJ5A 2BAKA 3RPVA 4HVHA 2PE2A 4W4XA 1Q3DA 5I5ZA 4DEHA 3CPBA 3HUBA 2O3PA 1PMNA 3CEKA 3EFKA 3KRRA 2Q0NA 3D5VA 4KIKA 5HGIA 5TT7A 2BHHA 2YABA 4ZLYA 2XANA 4M66A 3SXSA 3C4ZA 1E1XA 5AUXA 1LUFA 3F6XA 3G0FA 2VTRA 2WTKB 2BKZA 2F7ZE 3IOPA 4A4LA 4RWJA 3OEFX 3RZFA 5IUHA 3TT0A 3MB7A 2NYAA 3ZEPA 4AQCA 1CSNA 4PV0A 2VX3A 4L3PA 4R3CA 3THBA 3QX2A 3ACJA 3UC3A 2ZM1A 2ZVAA 4XBRA 4DG3E 1XKKA 5BVFA 5AX9A 3EIDA 2Y4PA 2XBJA 3IW8A 4K8AA 3RAWA 1OMWA 3CY3A 3V3VA 4S31A 3QGWA 4BC6A 4S2ZA 5IU2A 3IW5A 1SYKA 4WT6A 3CXWA 3NCZA 5FXSA 2OO8X 4OGRA 5KZIA 3ZEWA 2Q0BA 2ZDTA 5DG5A 2WTWA 2ITTA 4EOPA 4F7SA 1R1WA 4NZWB 5FRIA 3W10A 2C3KA 5LVLA 5CEIA 4C7TA 4WNPA 5AUYA 4BICA 2CDZA 1OGYA 2PUNA 3E3BX 4DH3A 1QCFA 3DAJA 2ZFYA 1L8TA 4KBCA 4IWPA 4PUZA 4U97A 3UIBA 1W0XC 4UXLA 1H4LA 3TNWA 3P7AA 4O0UA 3UIXA 4ARKA 4QNAA 4DGLC 2ZM4A 2BMCA 4LM5A 3WOWA 1SVGA 3ORLA 3TDVA 3HAVA 3SLSA 2Y0AA 1L3RE 5HHWA 3VNTA 4BWXA 1H1WA 1M2PA 2XNEA 4P90A 4D5HA 3R21A 1R39A 3SXFA 3VS0A 2XVDA 3LCKA 1K9AA 1QL6A 2KTYA 1H28A 4D2PA 4ZS4A 4MEDA 5L2IA 2VTOA 3R8VA 4PPBA 4MAOA 4ZIMA 4QP8A 1PXJA 5E8ZA 5EDQA 5IQFA 2R3JA 5HO6A 3EMGA 2QU5A 4D2VA 3MWUA 5IH5A 2YM7A 3BYVA 5L2TA 2F7XE 2GNJA 3PJ8A 4U41A 3AC2A 5GNKA 3MESA 4I20A 3VS1A 3MV5A 4NIFB 3FMEA 4UXQA 4PPCA 4C4HA 4JG8A 5FTQA 2EUFB 2P3GX 3BI6A 3B2WA 3MFSA 5JFVA 4ZJVA 3LJ0A 4NU1A 5CT7A 5CLPA 4CV9A 4ITJA 2GU8A 3DT1A 2YIQA 5CAOA 4F0GA 4XV9A 2EXEA 3MH1A 3UDSA 4HZRA 3LMGA 3LXPA 4R5SA 4E7WA 4Z9LA 5JMSA 3CTJA 5IQCA 5JGBA 3R6XA 5JGDA 5AR3A 3V5LA 1MRVA 1KV2A 2G2HA 3GU5A 5A14A 2UVZA 3RM6A 4FRFA 3VS6A 5AUZA 3F66A 5BX0A 2REIA 4H36A 4RX5A 4KABA 2J0MB 4FV8A 1Q3WA 2O5KA 2Z7RA 3IGOA 3OWKA 4OBQA 4F9AA 3QD3A 4C58A 4EHGA 5GZ9A 5HIBA 2WQNA 3ZO1A 5BUEA 3QUEA 3VO3A 4FICA 4EK5A 4AFJA 4JDIA 2JAVA 1OVEA 4AZSA 2QOOA 1NXKA 3U9CA 2R64A 4O4CA 3W55A 2ZJWA 1B6CB 4OTRA 5FM3A 4FTNA 4IIRA 4ZSGA 2WU6A 2JC6A 3MDYA 4AT5A 3VUMA 4GG7A 2R3RA 4XRLA 4QT1A 5IUGA 4F1OA 4EYJA 4QP4A 3S95A 4AS0A 4EKLA 4BZNA 4ANLA 3F2AA 1VLRA 4OLIA 3T3VA 1MP8A 2OIBA 4TZRA 1WCCA 5IQEA 3ENMA 3QZIA 4OBOA 2XMYA 1XQZA 4I5HA 3RHKA 5J87A 3R8ZA 4N0SA 4PP7A 4PNKA 3P23A 4IACA 3BYSA 4LG4A 4L9IA 4LGGA 3SW7A 4FYNA 3GFWA 1KUTA 4IAFA 5BNJA 4RWKA 3SRVB 3LJ2A 1OIRA 3GC9A 2UW8A 1OL6A 4PTGA 4PQNA 3ZBFA 2HWOA 2WIPA 2XK7A 3BIZA 3AG9A 2GHGA 3MYGA 3NX8A 4I94A 3S4QA 3F3ZA 5EQEA 4O7ZA 3QFVA 2JEDA 4EH5A 2PU8A 5ANJA 5L8KA 3W2SA 3QQHA 2RFEA 2YZAA 4D4RA 5KNJA 5EHOA 3PUPA 2F2CB 4ONAA 3A60A 4CMTA 2YJSA 4DLJA 5AIKA 2A98A 5KKRB 2R7BA 2BRNA 3DJ6A 2YIYA 5AADA 4MNFA 5HZNA 1XJDA 2PL0A 2B9HA 3KC3A 3KMUA 4J71A 4BR3A 2C30A 2UUEA 5CSWA 3DA6A 4BDFA 3PUFC 5M08A 1YXTA 3KK9A 2WMVA 1UU8A 4MX9A 2QO2A 4RG0A 3C13A 1BUHA 5K4JA 4FKLA 5FG8A 3I6UA 2PZPA 1CKJA 4AXCA 4UWBA 4I3ZA 3DKFA 3R71A 1GNGA 4EK4A 5A9UA 4YR8A 1URWA 4YPSA 3OTVA 3QCYA 2HZNA 4GG5A 5HCXA 4UZDA 3RAKA 4B4LA 4BCHA 5FEDA 4FEWA 2VD5A 2VN9A 4LV8A 3TMOA 1OL1A 2XNBA 4UMTA 3R2BA 5BVNA 4KBKA 4GSBA 4F7NA 2VWZA 2XA4A 3DJ7A 3A7HA 4CFWA 5AJQA 5JZNA 3UMWA 3KMWA 5HNIX 3LFBA 2C6KA 2HWPA 4XG4A 4JBVA 1IA9A 2ITXA 3I79A 2BIYA 4M67A 4FOBA 3C51A 4O4DA 2G2FA 3KN5A 2OGVA 5E8WA 4X3FB 4AFEA 1ST0A 4CG8A 4O0XA 3R01A 1BKXA 2X9FA 4AT3A 1BX6A 3ZLWA 4QPSA 3JY9A 3AQVA 4FZ7A 4ZY4A 3R2YA 3FSKA 3F5PA 3Q6UA 5CU3A 2UZNA 1T45A 4XYFA 1XH8A 2VTSA 4LL5A 4M97A 3BLAA 3AGLA 2YM4A 4I6BA 3QZFA 5CU0A 2J0IA 2CPKE 4R8QA 5KHWA 2ACXA 4DTKA 2SRCA 4MD9E 4DG2E 1E1VA 3LW0A 2HZIA 3PJCA 4FZAB 3NVMB 2Z2WA 3FMLA 1Q24A 3A7IA 4IJ9A 4B8MA 5AAGA 1XO2B 2NRYA 2YCSA 4I22A 4TY1A 4UEUA 3G9LX 1VYZA 2LAVA 5IH4A 1G8AA 4Y5QA 5BV3A 4DINA 4G31A 3O51A 4F64A 3BWFA 1URCA 2QU6A 3HP2A 4MBJA 4GT4A 4L43A 2GDOA 4FTCA 4EUTA 5BVDA 2C68A 3UNKA 2GNFA 3BWJA 4FTUA 4FTKA 2Z8CA 1YI3A 3GT8A 4Q9SA 1YDRE 4FKVA 4RJ4A 4ZTRA 3DDQA 5DR2A 3UJGA 2R2PA 4UYNA 4A9TA 4A9UA 2OJ9A 5A4TA 2ZMDA 1XHAA 4LL0A 3WYXA 1H1QA 2BROA 3FY2A 3ULZA 5M09A 4IADA 4FTAA 5BYZA 4BI1A 4PNIA 4IVCA 4BBMA 1FGIA 1R0PA 3DFCB 4ACMA 4EOSA 1Q8WA 2G15A 4TWCA 3DAKA 1FGKA 4F08A 4JRNA 5C03A 3DTCA 4S32A 2XKCA 2XJ2A 5DI1A 2IF8A 4FT0A 2OXYA 4F9WA 4FTMA 4I23A 4FBXA 4QYFA 3NUPA 2C47A 1FINA 2PVRA 1WMKA 2JBOA 2WEVA 4O7NA 3PPJA 4QTBA 2QLUA 5HX6A 3PVBA 1OPLA 2WKMA 2C5XA 5I3OA 5F20A 3CTQA 4XOZA 4C4EA 2XBAA 1JAMA 4RJ7A 4A4OA 3S00A 2HENA 1PJKA 2C3JA 3PXYA 4HNFA 4EUUA 5ACKA 4FGBA 5JQ8A 4ZMEA 1YDSE 4K77A 3RPSA 5AP1A 4DLIA 1GOLA 5DH3A 4H39A 3G5DA 1SVHA 3W0SA 3V5WA 2HYYA 2AC3A 5HG9A 2IW8A 4O7RA 3FXXA 4BDDA 4HPTE 2C5YA 3C5UA 2Y7JA 3JYAA 4TPTA 4I41A 5FGKA 3OC1A 3R7OA 2O63A 2YEXA 4PL4A 2R5TA 3I0OA 3VVHA 4JVGA 3QD0A 3QTWA 4F7LA 5E92A 3GCUA 3BLRA 4KNBA 3MBLA 4ANNA 4WA9A 4YHJA 2YM5A 2IVSA 2QOBA 2X6DA 4IFGA 3LOKA 4X6QC 4NKAA 5TF9A 4EOLA 1CKIA 5HG7A 1OKYA 3VBYA 4F0IA 5HI2A 5KCVA 2RL5A 2OH4A 2XK9A 2UZTA 4IVAA 4D4VA 3ORZA 4M0ZA 1AD5A 3F7ZA 4NUSA 2HZ4A 3D15A 2VWXA 4LUEA 2VWIA 3EJ1A 4PDPA 3K5VA 4QPMA 2YAAA 4RIXA 4WNOA 4EJ7A 2QC6A 2Z7SA 4GJ3A 1LR4A 4PL3A 4K33A 5HQ0A 2PVLA 3KMMA 4FKIA 5EQPA 3NFFB 5TR6A 2QVSE 5AV3A 1W83A 3NUAA 3MPAA 4GU6A 4XV1A 4I0TA 4FEUA 3EZRA 3RWQA 5D1JA 1OZ1A 3R8MA 4CLIA 2Y4IB 2BVAA 4YJTA 4R77A 3QRIA 3F3TA 3U6JA 4J7BA 1ZOEA 4DFXE 4AXAA 3W0NA 4YZCA 3UQGA 2XCKA 2ESMA 1XWSA 1P2AA 1PXLA 3C9WA 3UGCA 3IOKA 1RQQA 3S0OA 4JQ8A 4YJSA 5DT0A 3KQ7A 2QO9A 3ELJA 4C8BA 5CXZA 5EI8A 3Q4TA 2IZSA 1O9UA 2AQXA 3BGPA 3FKNA 4IJPA 4KB8A 1QPCA 1SMHA 3H3CA 4L68A 4BTKA 3KXGA 4EWQA 4AXEA 1UA2A 4MQ2A 4Y73A 3CP9A 3WI6A 4KWPA 1PXIA 5FLFA 4BDKA 4DITA 3O71A 4K9YA 4E5AX 3T9TA 2QOCA 4USEA 5J1VA 1NVRA 3NWWA 4O0WA 2PPQA 4LOOA 3QQKA 2OZAB 2OZOA 3EZVA 2V7OA 1GAGA 3TZ7A 3VC4A 4OTHA 3WF5A 2FH9A 3PXFA 3KF7A 1ZYLA 3TNHA 3CLYA 5M4FA 3RK5A 3R7EA 4DEBA 4ENYA 3EHAA 4X3FC 1BI8A 2FB8A 4H05A 4WBBB 3MPMA 4RZWA 1IA8A 2PWLA 3E87A 3EWHA 5TE0A 1ZYCA 4M8TA 4BDBA 4D0XA 4EZ7A 1GZOA 2RFSA 1YI6A 4HYHA 5CI7A 3QWJA 1KOAA 2WOTA 3SQQA 4BKYA 5C4KA 1HCKA 4Y83A 4BFMA 3B2TA 4KKHA 4AA4A 4JOAA 4P7EA 2ZV2A 4QD6A 5ANEA 4GS6A 4I4EA 5AUTA 4RWIA 4WRSA 5HE1A 3RALA 4DCAA 4Y5HA 2OG8A 4TYHA 2YZLA 1OPJA 1J3HA 4MH7A 3W2QA 5BMSA 5J5SA 2PE0A 1TQMA 4KRDA 4ZMFA 5EOBA 1KOBA 2Y8OA 3QX4A 4YO4A 4XOYA 1U5RA 3MA6A 2OLCA 3AD6A 3DU8A 2HCKA 3RINA 3UQCA 4O7YA 2WMTA 4GFMA 4G2FA 4QQ5A 4EH8A 5IEVA 5LMBA 4F78A 5AV1A 4AGDA 3RKBA 2CGVA 1PXMA 3HRCA 3ZYAA 4GL9A 4E4MA 3ML1A 2RFNA 5A4EA 4R7IA 3AXWA 2W99B 2YN8A 3LCTA 3UC4A 3MY0A 1YWVA 5AR8A 3R04A 3OT8A 4CQEA 1JQHA 4KIOA 3ZOSA 3NW6A 4H58A 2X4ZA 3HDNA 4C4GA 4IMYA 2ZDUA 1TVOA 2QR8A 5H2UA 4YUQA 4BHNA 5CENA 4FG8A 5FBNC 5AX3A 3V8TA 4JAJA 3Q60A 4MQ1A 3COMA 4D5KA 3KRWA 3TUDA 3F3WA 2WIHA 3LQ8A 1WZYA 2J0JA 2ZM3A 4BGHA 5I9ZA 5FEEA 1TQPA 3I60A 5K5NA 3A4OX 3EN9A 4BIDA 2H34A 3W0OA 4QDVA 4CSVA 2P33A 3ZONA 3II5A 3BGQA 1Z9XA 4APPA 4ZY6A 5C1QB 3SOAA 5HD4A 4FUXA 5CAVA 5I0BA 2ITWA 2YAKA 2WFYA 4CZYB 4E4XA 2X6EA 4CRSA 2VUWA 4NFNA 1H25A 3QXPA 5IISA 4LV7A 2IVVA 3GOKA 3VHKA 3IPHA 3SHEA 5CEMA 3QLGA 5M57A 2OBJA 1PXOA 2VO6A 1G8KA 4O83A 5IA1A 4AQKA 4YSMA 2XF0A 4QMYA 4GEOA 2PVMA 2PE1A 2UW3A 2J9MA 4GH2A 2I7QA 5AUWA 4PTEA 4IZ7A 3O50A 5FDPA 5K3YA 1GY3A 3CJGA 3KRXA 4X7QA 2XYNA 3QHWA 4RX8A 4FV7A 1PRYA 4FTQA 4WUAA 4UBAA 5CVFA 3ZLXA 4QMWA 3FV8A 4PTCA 4R5YA 4ZY5A 3DNDA 3VJOA 1OL5A 5EDRA 1Y6BA 4GK4A 3CTHA 4MYGA 3O23A 5HKMA 2XNOA 4BTFA 1QPDA 3RMFA 2CCIA 2RGPA 2CN8A 4E4LA 1GIJA 3ET7A 4BTJA 1ZZ2A 3OMVA 4YJNA 3UOKA 2WXVA 3EN6A 2W4JA 4GRBA 3ZRMA 4NL0A 4B8LA 4QMSA 4PMPA 4JT3A 2FO0A 4JQ7A 1W7HA 3MN3A 4OW8A 2NO3A 3EFWA 4PP9A 2X0PA 2QOQA 3JS2A 3ZSHA 3G51A 4EQCA 1OL2A 1G5SA 3HVCA 3OXZA 4ENXA 5C01A 3KXZA 2CJMA 2Z60A 5BPYA 4DBXA 3QRJA 3FYJX 4HW7A 5IQBA 2BZKB 2OIQA 4QQJA 1WVWA 4LMUA 3DBEA 4LRMA 5L6OA 2UZUE 3QD2B 4N6ZA 1JNKA 4ID7A 3U51A 5DR6A 5AR2A 4MF1A 4AAAA 4CD0A 4F1TA 3MFTA 4GJ2A 4QQCA 1PKDA 4QMQA 2PVJA 4CT2A 5IMXA 2GMXA 1OIQA 4FV9A 4N6YA 4QMXA 5ANKA 5E8SA 2HIWA 1CMKE 2W17A 3E93A 3Q9YA 1FBNA 4E20A 3ZZWA 5HCYA 4DH7A 4FX3A 3ZUTA 4AW2A 4FNXA 4IB3A 3DBDA 3QAME 3U4UA 3MFRA 5ETFA 1CDKA 3DK6A 5AA9A 5D11A 2VGPA 3FZSA 4RVMA 4WNMA 4YLKA 1H0VA 4XG3A 4GW8A 2JFMA 5E1EA 3R9DA 3VS5A 4H3PA 3JR1A 1Q99A 2A0CX 2H96A 2OICA 4GU9A 4DFUA 5JT2A 2E9OA 2JDTA 1XH6A 4L67A 2EVAA 3R28A 3RWPA 3VAPA 5D41A 3R1SA 2OSCA 2W1DA 3QQFA 2XIZA 3QUDA 2BIKB 5KE0A 3VQHA 3OY1A 4C3RA 3U54A 2GS7A 3BYUA 2YJRA 4BYIA 3CJFA 3LLTA 3L9NA 2IZUA 3D2IA 4J98A 4EK3A 5B7VA 1YOJA 3TKHA 1KE7A 2BTSA 2I0VA 2UZWE 2IW6A 4UV0A 4V0GB 3VWAA 1XH5A 4LRJA 3QZGA 3OW3A 5CSHA 2V5QA 3T3UA 4LMNA 4IB5A 5LVMA 3BZ3A 4QTAA 4HYUA 2VTPA 3OUKA 5J7HA 2BDJA 2XS0A 5E90A 2G9XA 3DXNA 4FTOA 5KMLA 3UQFA 4QMLA 4GMYA 2EB2A 3CQEA 4PMMA 1VJYA 2WU7A 3QKKA 4QP7A 4B99A 4H3BA 1PMUA 4RIWB 2WAJA 4I4FA 3CR0A 3OOMA 4YZDA 5EK7A 5KZ0A 4RFZA 2WTIA 4ANOA 1YW2A 4BKZA 3C0GA 3R00A 1T46A 2O65A 2R3QA 3MFUA 2CKPA 4GK2A 5CXHA 4K2RA 5FM2A 3DS6A 2XK3A 2WO6A 4L8MA 3DK7A 4KS7A 4EH3A 3K5UA 3OS3A 2PVHA 3HKOA 2ZV9A 3QTRA 4QMZA 5EYDA 3UPXA 4MBLA 4E6CA 5EW9A 5E1SA 5C26A 1JLUE 2W5AA 5C27A 3RPYA 4IAZA 3GGFA 3VHEA 3ZSIA 4IVBA 2BRHA 5FP6A 2XNPA 4JBQA 4E8AA 3LXLA 3CGFA 4E5BA 3QC9A 2VWYA 4IAKA 5J9YA 5IQHA 3D83A 2WGJA 3QWKA 4BI0A 2V0DA 2WELA 4GVAA 2CCHA 2X7GA 4Y72A 4F63A 3LPBA 1X8BA 2FSMX 3PSDA 3R9NA 2X2KA 2IO6A 3D2KA 3FHIA 3KREA 4DHJA 1P14A 2C1AA 3FKOA 3VQUA 4JX3A 5IA3A 3PLSA 3DOGA 2JITA 4O7WA 4BWPA 4GT3A 2BRGA 4FL1A 4I5CA 2WMXA 5EM8A 1W2FA 3PVGA 1UV5A 4MXYA 1GIHA 3VS4A 4GYIA 5DRDA 1JWHA 2VTQA 2B52A 4Y85A 3V8SA 5KO1A 3QUPA 3IW6A 3KCFA 3O0GA 4J99A 5CQWA 4BDAA 3EN7A 3E8NA 5JGAA 4QP9A 1BI7A 4BRXA 5I3RA 4YURA 3KVWA 2X8IA 3OW4A 4NEUA 4YJUA 2OJGA 5LCJA 3Q3BA 5DT3A 3UZTA 3ZH8A 2OIDA 3QRTA 3O2MA 1V1KA 1JKSA 2BAQA 4IC7A 4QMPA 4XG7A 4RJ8A 3RBWA 4LFIA 2C0TA 2BPMA 1NA7A 3D14A 3D5XA 4I24A 4MNEA 5FWKK 3NYXA 4AGUA 4BDEA 3L9MA 3ETAA 3CSVA 3TNQB 5HBEA 5JZJA 1NY3A 4F9YA 4FKRA 4R78A 2CSNA 3R9RA 3SG8A 3QTSA 3V51A 3V5TA 4DGMA 3ID6C 3I7BA 2AYPA 5C4LA 3IG7A 4YZ9A 4PL5A 3G9NA 3UNJA 5BVKA 3IW4A 2IEWA 3AMYA 4DDIA 4IM2A 3FKLA 5HE0A 4DFLA 4W4YA 4C4FA 1O6YA 1S9IA 3QZHA 1Q8YA 2BILB 4FKWA 1FQ1B 3P1AA 4WRGA 4NJ3A 4QMVA 2XARA 1VR2A 2CMWA 4NCTC 2XNMA 3TJCA 3OCGA 2PYWA 2C6OA 3MH3A 2I0EA 3Q96A 2UZEA 1JSTA 3TWJA 3A4PA 4IAAA 3EQFA 5HVJA 4NM7A 3NYVA 2P2IA 5E9EA 3V5QA 2WZJA 1FOTA 4CFVA 3HLLA 2IJMA 3UG1A 3OY3A 3ERKA 4KRCA 2X0GA 3RNIA 4G3GA 2G01A 2R4BA 2OKRA 5HE3A 2AC5A 1H1RA 4C02A 4LDTA 4YHTA 2YACA 1TFFA 4YLLA 5L2SA 4CZTA 3ALOA 4ZEGA 4ZZNA 3EL8A 2YIWA 4FTTA 3R73A 4XP3A 5H8GA 4EH4A 4G16A 1ZAOA 1WBPA 4JDJA 4EOOA 4RX9A 3JUHA 3VBTA 1LEZA 1YWNA 4XJ0A 3FI2A 3ZDUA 4RC4A 5CU4A 4ZS0A 3BX5A 1GZKA 4EL9A 4FTJA 3AC8A 5JFSA 1Z57A 3HV4A 3PFQA 2B0QA 4FV4A 2XKEA 4D1ZA 1WBVA 5AV2A 5CY3A 4FIHA 3TNIA 1V0OA 3NUYA 3BELA 3HA8A 4G6OA 4FZDB 4AWIA 5IQDA 3E8DA 3H0ZA 4PMTA 4IZAA 2BRMA 4IX6A 1W8CA 3U6IA 1H01A 4DCEA 2QNJA 2GNHA 3LZBA 4RVLA 4IB0A 2ITVA 4AN3A 3NIZA 3R7UA 2CNQA 4RMZA 3NNVA 3QTXA 1YXSA 4FIIA 4I92A 4TT7A 1REKA 3QLFA 1R3CA 5KBRA 2W9FB 2PVYA 2AEGA 2F49A 2XNNA 3WZKA 3G6HA 4QTCA 3L8SA 3C50A 2Q83A 5HVKA 1P4OA 4EH9A 1Y6AA 4J52A 2VTIA 3EB0A 4UB7A 4LQMA 5ETAA 3HNGA 1J7UA 5HTIA 1YDTE 3D9VA 5KHXA 4CMOA 4JG7A 5L6WL 3MTFA 4MXAA 4TRLA 2UZBA 4AW5A 3RPOA 3W0MA 1YHVA 4G1WA 5BVEA 3T8OA 3F69A 3IK3A 4I0SA 4O0VA 4A9RA 4RT7A 3PRIA 2Z7QA 2FSTX 3ALNA 4YPDA 3UNZA 4G5PA 5JEBA 3I4BA 4JBPA 2C1BA 3UTOA 4A07A 2W1GA 4HZSA 1M2RA 3QD4A 4I6QA 1ZZLA 4DFBA 3E64A 1FMOE 2OJJA 5KMMA 3CS9A 1VEBA 3BRBA 1IAJA 3OROA 2BKKA 3A62A 3Q2JA 5LQFA 3SV0A 4OTGA 1J7IA 3OEZA 4KSQA 3PIZA 5CF5A 4EYMA 4YBJA 1I09A 1SNUA 3PG3A 3WILA 4DG0E 4CFUA 1R0EA 5BVOA 4WHZA 5LWNA 4D55A 3Q5IA 3E8CA 4G3DA 1H1SA 3BPRA 3E3PA 2WHBA 2XJ1A 4MHAA 5M06A 2W06A 3NSZA 1H24A 5ANIA 4JRVA 3ZO3A 3NUNA 1IEPA 5JN2A 1B38A 1ZARA 4PMSA 3R63A 5ANGA 2VV9A 5CF6A 4LV5A 2QO7A 2VO7A 3Q5ZA 5IA4A 4HCVA 3VUDA 4FSYA 1KWPA 5F4NA 5CNOA 4DF3A 2WTKC 5IZFA 3SRVA 4CTCA 3IONA 1V0BA 4R3PA 1VYWA 5DOSA 2ITOA 1Q8TA 4FKSA 4HJOA 3DB6A 3VW6A 5E8YA 4EK6A 3BEGA 4F6SA 4FKUA 4AAYA 1MQBA 3IW7A 2ZV8A 2YDIA 4QNYA 3CIKA 2R3HA 3A8WA 3G0EA 4H1MA 3VS7A 3DLSA 2J4ZA 2J7TA 2QHMA 4FV3A 4S30A 2ZYBA 4PF4A 4IDVA 5AM7A 1IRKA 3ZFYA 4ZOGA 4DHIB 4ANBA 2BFXA 2DUVA 3I7CA 4IZYA 4OTFA 2XUUA 2PUPA 2PULA 1VZOA 4H3QA 3UDBA 3VS2A 4JI9A 4O22A 3EQCA 2QOLA 5F9EA 1WBWA 4JX7A 1V0PA 2E9VA 5BYYA 3GUBA 2X8DA 3BGZA 5HLNA 4EJNA 5K9IA 4KS8A 4DA5A 3TV6A 1JPAA 1JOWB 4B9DA 4RJ6A 4DFZE 5LXMA 1A06A 3FUPA 4O84A 2J5FA 3EKKA 5M51A 3RTPA 2GNLA 4X2FA 2CLQA 4ZLOA 5FD2A 2RKUA 2GS6A 3I1AA 4RIYA 5F94A 4ALVA 4YJRA 4Q9ZA 3HX4A 4Z16A 5HESA 5FUTA 2C5OA 1AQ1A 1ZLTA 4WBOA 3OWPA 4CFMA 4O7VA 2RG5A 3S2PA 1ZYJA 4NWMA 4HCTA 4RVTA 3EYHA 2ITZA 3QQGA 3LXKA 4TYIA 4FSUA 4TYEA 5BUJA 2YCFA 4M69B 4ORKA 5M55A 3DCVA 1W2DA 3OXTA