2WQOA

Structure of nek2 bound to the aminopyridine cct241950
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
277
structure length
242
Chain Sequence
SRAEDYEVLYTIGTGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRLKPANVFLDGKQNVKLGDGTPYYMSPEQMNRNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An Autoinhibitory Tyrosine Motif in the Cell-Cycle- Regulated Nek7 Kinase is Released Through Binding of Nek9.
pubmed doi rcsb
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
total genus 75
structure length 242
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wqoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wqoA01
3A62A 3W16A 3HKOA 3TV6A 2OH0E 4X0MA 3AC1A 3OBGA 5HE3A 3GEQA 4NSTA 3DXQA 3R7YA 4GKIA 4U0IA 5FEDA 3O7LD 3Q9XA 1XKKA 2ZJWA 3L1SA 4BDHA 1YOMA 4IAZA 2OK1A 3HMOA 2QURA 3PG1A 3R7GA 3CGFA 3W32A 5FTGA 4YTCA 3BHHA 5FTQA 5DYJA 2XEZA 3RAHA 4TWOA 4UMPA 2YISA 3ODYX 3QQJA 1RDQE 3GFEA 4I5CA 2Z7SA 4O0VA 3LMGA 4RJ8A 3TCPA 4GUBA 4A9RA 1V0PA 4XH6A 5A4CA 1PXOA 4QQJA 4RIWA 4QMXA 3LVPA 4U41A 4AOIA 4FKOA 4ALUA 5D9HA 2J5FA 1JKTA 2XA4A 3QTSA 2F57A 1VYZA 4EOKA 3F3ZA 3Q4ZA 2WMAA 4LYNA 5GHVA 3VS5A 4S32A 3VULA 3FHIA 5CSHA 2GCDA 3ELJA 3AC8A 3KULB 5I9WA 2YZLA 4Y83A 1XH7A 3ALNA 4DYMA 1H1RA 3OWJA 3PIXA 4C61A 4FTOA 1PXLA 1U54A 1Y57A 2P33A 2QOBA 2UW5A 4G3DA 2OW3A 4WNKA 4ZSGA 4H3PA 3SXFA 4JR7A 4FKRA 2O65A 3FZOA 5IEYA 3RM7A 3V01A 4CGAA 4NW5A 2WAJA 4P4CA 5KMIA 4ALVA 1QMZA 3OFMA 2XCHA 3OVVA 3NX8A 3HRBA 3VQHA 4FIJA 3HL7A 2CHLA 4RWLA 3RGFA 4F7NA 4PDPA 1XJDA 3C4XA 1NVSA 1OI9A 2EXEA 2WD1A 3GT8A 4FF8A 4L9IA 4BB4A 3CPCA 2VO6A 5TR6A 5J5SA 3BI6A 5CU3A 3WIKA 2VO0A 4K2RA 4FSWA 5C01A 4IAYA 4HYSA 4EUTA 5JFWA 1QCFA 2UVYA 2BZIB 3D4QA 4O0TA 3TZ8A 4IZ7A 3VJNA 3O8TA 2FSLX 5IA4A 3OXTA 3TJDA 5G1XA 3ZYAA 4ZTHA 5JZJA 1ZY4A 2WB8A 3ZZWA 2QOKA 4CFUA 4LL0A 4BCPA 5GIPE 4PF4A 4MQ1A 3R63A 4H1JA 3V6RA 3WF8A 5AP6A 3ZDIA 4ERKA 5HORA 3A7GA 4RT7A 5CAOA 3V5JA 5I4NA 3NVKI 3DK3A 4FKUA 2YIQA 3ZEWA 2W1IA 3H0YA 3HDNA 4PMTA 2ONLC 5CEPA 4S30A 3JVRA 3EZVA 5AAFA 3R9NA 3AC5A 2B9JA 3G33A 2ESMA 4JBVA 5KMKA 3Q9WA 3I0QA 4MNEA 5J79A 3F6XA 4FNZA 3TEIA 5AP1A 3SDJA 3BGPA 1RW8A 4M0YA 2PVRA 3LW0A 3OG7A 4XV9A 4CRSA 1GNGA 3E3BX 4FG8A 3TN8A 2P2HA 2XYUA 3NPCA 4IW0A 4IBMA 3M11A 2JDVA 3UGCA 3QUPA 1OIQA 3OEZA 4C33A 2B53A 2WFYA 4O0UA 5T3QA 3C50A 4ZS4A 3N51A 3R9OA 2YCFA 3LFEA 3C0GA 5CEKA 4BWPA 3LQ3A 1SYKA 4UY9A 4JBQA 3SA0A 2VTJA 1GIJA 1E1XA 3NRMA 1JBPE 4HGEA 2JEDA 3DT1A 2XH5A 5LCKA 4JQ8A 3OT8A 4ANLA 3ZO4A 4TNDA 4CQGA 4L43A 1Q8UA 2V7OA 4QT1A 1IR3A 3H9FA 4MXCA 5C9CA 4EOJA 3COKA 3E8NA 1TVOA 4FTLA 5JN2A 4A4XA 4FL3A 5HE0A 4EBWA 3KVWA 4JJRA 2A27A 4AN9A 5ETCA 3PIZA 2WO6A 4L53A 5M4IA 2UUEA 3MGYA 3PTGA 3IQ7A 5CNOA 3FQSA 1P2AA 2ITPA 4BCMA 4E1ZA 3ZUUA 5IQDA 4IQ6A 4NKSA 5EYDA 5IDNA 3M42A 4JNWA 4RIXA 4GSBA 4QPMA 4UBAA 4O6EA 2J9MA 3DAKA 3MJ2A 4E73A 2B7AA 3QC4A 4G3CA 4WG4A 4F7LA 3SV0A 1M14A 5HBJA 3WBLA 2C6TA 3IW7A 3CE3A 2XKDA 2YA9A 3KCFA 2IO6A 2IWIA 2XM9A 3KRRA 3BEAA 3U4WA 4DGMA 1SNXA 1KOAA 2FYSA 4FIEA 4J71A 1M52A 3R8ZA 2XNEA 3NNVA 1LEZA 2HZ4A 3PA5A 5LJJA 5DNRA 3ZBXA 3E87A 4QRCA 2G2HA 4O2ZA 3OY1A 4U43A 2VTPA 3RZFA 2JBOA 5HG9A 2IG7A 2OZAB 3F3WA 4M13A 3VBYA 3I0OA 5BUEA 1IASA 3BEGA 2B55A 4W9WA 3POOA 5HIBA 4E6QA 1XH8A 5HTBA 3MB6A 2BALA 4GIIA 3LAUA 2XJ0A 3QTRA 1YXTA 3D5WA 4DEHA 3AMAA 1B38A 5HO6A 2VTRA 5C1QB 2PVNA 3HUCA 2ETKA 3V5QA 5EI6A 2XBJA 3EQBA 5CT0A 4FUYA 5CVFA 5L8JA 4WBOA 4JL9A 3QGYA 4CFMA 3DLSA 1BKXA 4MXOA 2R3RA 1PJKA 3TNHA 5AWMA 3GBZA 4X6RA 4AFEA 4ERWA 4RMZA 3G0FA 5CAVA 4GT5A 4W8DA 4AP7A 3JY9A 1PXKA 2QOCA 4KIKB 4QTCA 4XG4A 1KE5A 5CVGA 4KKGA 1QPJA 2IZTA 4QP7A 3WZKA 1ZOGA 4ASZA 1MUOA 3PJCA 5C03A 4EH7A 4MXAA 4EWQA 3RBWA 3GU5A 4FG7A 4BDBA 3Q9YA 1RQQA 4RIYB 3NYNA 3RKBA 3N4UA 3MIAA 4FT0A 4G5JA 2W1EA 4ITJA 4DGGA 4TKSA 2G1TA 1VJYA 4ANNA 3HA6A 3PP1A 1MQBA 5EM6A 4BDAA 4FGBA 1ZYLA 3KA0A 3FL4A 5H8GA 3GCPA 1ZY5A 3OP5A 4Y72A 5DT0A 3G6GA 4BI1A 1J7LA 4IDTA 3QA0A 4MWIA 1P14A 5KZIA 3LPBA 3NR9A 4CYJA 4R1VA 3KVXA 3C0IA 5L6WL 2CNUA 2W96B 3R28A 2QKWB 5KMLA 4LV8A 5E8VA 4ZS0A 5FM2A 1IEPA 4WSYA 4J98A 2ZV7A 2BKKA 3VWAA 3IDBA 3TT0A 4W4WA 3QTUA 2IW6A 3OWPA 5D11A 2R7BA 3MDYA 3NIZA 2PYWA 3RK5A 1JQHA 3W2SA 3WARA 2QOOA 4O96A 1WBTA 3I5ZA 1WAKA 3PPJA 4YC8A 3NNXA 4B4LA 2YAKA 2VNWA 3RZBA 3BYOA 2ZV9A 4ZTNA 4N6ZA 2J90A 3EQRA 4A4LA 4AAAA 4C7TA 4L00A 5E8SA 1FMOE 2QLUA 2J5EA 5AM6A 2FGIA 4R7IA 4RX9A 2E9NA 1LEWA 5AP3A 4LRKA 3HEGA 3PXRA 3W2QA 5L2QA 4YR8A 3C51A 3VAPA 3HMNA 4JG7A 3OUKA 4BY9E 2A1AB 3OTUA 4QYEA 4GK3A 4J1RA 5CAQA 4AT3A 5AA9A 3CD3A 3FXXA 1YDRE 4HVDA 4DGNA 2XNMA 3EQCA 2PE1A 3EYGA 4ZTRA 3LHJA 4ZSAA 3BYSA 3TZ7A 4MX9A 4E6DA 3F61A 4K18A 4HGSA 2PU8A 3GFWA 5C26A 4C37A 1W82A 4FTRA 4YBJA 4EHZA 4EWHA 4FTKA 4IVCA 4R77A 3S3IA 2KTYA 4WNOA 3TACA 3FZ1A 2WTIA 4O7YA 3MVHA 3PFQA 3U54A 3F2RA 5IQCA 4WA9A 4GCJA 2RGPA 3F66A 4FV0A 3ZM9A 4Z7GA 2G2IA 2ITYA 3A8WA 4J7BA 4KRCA 2OLCA 5HG8A 3PPZA 4JAJA 5EK7A 4EHGA 1H00A 3EIDA 3NWWA 3B8QA 4I4EA 2EU9A 2X39A 4F6UA 3QYWA 1YXXA 3WZUA 1U5RA 4TYHA 3CR0A 4X3FA 3RAIA 2CCHA 3O51A 4JIAA 4QYHA 2ITZA 4IZAA 2WOUA 2YABA 5AM7A 3ZSGA 5IG1A 4DF3A 2OXDA 4ALWA 4FT9A 4JX3A 5A4EA 1S9IA 2VTQA 4WNPA 3HYHA 1M2QA 3NIEA 4EK6A 1H26A 3GB2A 4PDOA 5A6NA 4KWPA 3U6IA 2WMTA 5DPVA 2RKUA 3FHRA 1K9AA 2ZV8A 4RVTA 2X8DA 5BYZA 4EK8A 5M56A 3ORXA 1XH6A 5HBHA 2R64A 5M4UA 2EXCX 4D4YA 1SM2A 5J9LA 3CJFA 4XS2A 1PY5A 5IDPA 3LM5A 2I40A 3LXPA 4G16A 5LCJA 5D7AA 4D4VA 4FEVA 3VQUA 1CKPA 2QO7A 4MWHA 4FI1A 4V0GB 4X21A 1KSWA 4G3EA 1OKWA 3UOKA 4NTSA 4QP9A 4JX7A 4APPA 4BDGA 4TYEA 1J7UA 5HVYA 4OAVB 3QTXA 4CFFA 5K0XA 4JIKA 4Y8DA 4PUZA 4NM5A 4F09A 3E88A 4BCJA 4U79A 3EQIA 4IACA 4G6OA 3G2FA 2B0QA 5KHXA 3DY7A 3AXWA 1FGIA 2OH4A 5KMMA 3FSFA 3RCDA 2IVVA 4GMYA 5LVNA 4CZUA 4DHFA 3FLQA 4S31A 4ACDA 3PA4A 4RFMA 2YAAA 2YM8A 4NUSA 4BBFA 2JC6A 4UX9A 4DFYA 5CYIA 4MBIA 4FZ6A 2VTMA 4FT5A 2UZBA 4CTBA 4DT8A 2O0UA 2O2UA 4EOLA 1GAGA 3JPVA 4E93A 3C7QA 4XG8A 2C6KA 5IEXA 1YI6A 3SLSA 5HU9A 4IVBA 5ICPA 5F4NA 1QPCA 5CWZA 3II5A 3I4BA 4K1BA 4A7CA 5JSMA 4BN1A 1H0WA 3QTZA 1U54B 4XBRA 3QU0A 1PMEA 2HAKA 2OF2A 4KKHA 1CM8A 5AR5A 4RJ7A 1P4FA 5BMSA 2GQGA 3GI3A 4PMSA 1Q61A 4C3RA 4CTCA 3DKCA 3Q32A 3VUKA 5J5TA 1K2PA 3PSBA 3MPMA 3EZRA 3I6UA 3NCZA 4D58A 5E9EA 3HX4A 3MIYA 3IDPA 3O96A 1J3HA 2LAVA 4RJ3A 2A4LA 3ZEPA 4P5QA 3ZO1A 2GS7A 3GQLA 2YFXA 2H8HA 3LFBA 3OF0A 3BELA 3OHTA 2XKCA 2QHNA 3SOAA 3PVGA 3PE2A 2W1HA 3ANQA 3A8XA 4TRLA 4EYJA 2I7QA 3HRCA 5JRQA 5D12A 3AC2A 4HVSA 1FQ1B 3F7WA 2RFSA 4MXYA 2VUWA 4FMQA 4KINA 4IEBA 4HVIA 1FGKA 1XWSA 4XEYA 1YOLA 5HD7A 2PMNX 3QLFA 4DBXA 1WBPA 4C4HA 3Q5IA 5HLNA 5LARA 3BHUA 5CF6A 5JFXA 4RWIA 1T46A 3O17A 1PXMA 2GNHA 3D7TA 1GZNA 4LI5A 4L3LA 4P90A 4E5AX 2QD9A 2VWVA 1HCKA 3Q53A 4E5WA 4NZWB 2UW6A 3R8MA 1YW2A 2EB2A 4X2FA 5CQUA 5L6PA 3L9LA 4M14A 4NTTA 4FKSA 4F7SA 1VYWA 3FMEA 4AW0A 3BKBA 1NVRA 1Q8YA 2PE2A 2Y6MA 4XV1A 3VNTA 2IZSA 5JFSA 5M06A 2PK9A 3QHWA 1AGWA 2WKMA 3GC8A 3F7ZA 4O7SA 3NVMB 2C69A 2F2UA 5AR4A 3TV4A 4FYNA 3RALA 3P86A 3VW8A 4MHAA 4AOTA 3UZRA 1OECA 2W1FA 1WZYA 3U87A 4UYAA 1JNKA 3HVCA 3KREA 5JQ8A 3FY0A 3PXZA 1Z57A 4WG5A 1O9UA 5LMKA 2PULA 1LUFA 2HY0A 4FBXA 4CV9A 4MTAA 3BWFA 4D55A 4FE2A 5HCYA 4IANA 4BF2A 1YWRA 5AAEA 4EKLA 4GFOA 4GIHA 4U3YA 3P79A 3RNYA 1W0XC 2QODA 4I23A 2NPQA 2Z7LA 3CTJA 4KRDA 1PRYA 2JAMA 4FSRA 3WILA 2VTOA 3SXSA 4JRNA 3R83A 5DLSA 5ANOA 1YXVA 3ENMA 2WQEA 3SHEA 4I6QA 4QPSA 2RL5A 2RG5A 4BGGA 3QQFA 1UVRA 3BHTA 2XJ2A 2W17A 3LIJA 1UNGA 5IA5A 4LMUA 4XP2A 5J95A 2VO7A 4ZZNA 3TUCA 4GW8A 4ZXTA 1YWNA 2JDRA 4QTBA 4DLJA 5DT4A 1XQZA 1H8FA 2QKRA 3VS0A 1ZYDA 3UG2A 5HZNA 3LFSA 3AG9A 4L44A 4MF0A 4HGTA 3VBTA 3MSSA 1FVVA 4AS0A 2WMWA 5HTIA 4NJDA 5HCZA 4CCBA 4EH2A 4TXCA 3QX4A 2W1DA 4KSQA 2VWUA 4MD9E 3LFCA 4AACA 4K0YA 1Y8YA 2XYNA 4F9AA 3UODA 5CANA 3NDMA 4CG8A 3B2TA 3R7VA 3TIYA 2ZAZA 4YLJA 1FVTA 2C6OA 2W5HA 3ROCA 2CLXA 4IIRA 4ITIA 2EB3A 2XNOA 1OKYA 4ZLOA 3U6JA 2R4BA 4BDIA 3D9VA 3NS9A 4BR3A 1JAMA 2PL0A 3F2AA 3W8QA 2XRUA 3ZH8A 4ASXA 4DN5A 4MNFA 3BWJA 1L3RE 3GOKA 5CZIA 3W2OA 4FVRA 3DGKA 5AV0A 5ANDA 4E3CA 3IK3A 1XH4A 2ZB1A 3QD3A 4KD1A 5HNIX 1GZOA 2EWAA 4FTQA 3OMVA 5AV2A 4IJPA 1PYEA 2YIRA 4RC2A 5LVOA 4MXZA 3D5VA 4FICA 4AA4A 5CLPA 1KOBA 4AOJA 4ENXA 5IISA 4D5HA 1W83A 4EK5A 3QQUA 5I9YA 2PE0A 2XIZA 3AD4A 3Q4CA 3CQEA 3LLTA 4I0TA 3I6WA 3MVJA 4MYGA 3T3UA 3F9NA 5M53A 3A7IA 3BPRA 4YJVA 3NW5A 2OXXA 3T9IA 1J91A 4GT3A 1ZXEA 2PZ5A 3DKFA 4PDSA 4QTDA 1DAWA 2FSOX 5HGIA 4I20A 4D2SA 4JDKA 3IPHA 2Z2WA 3COHA 2R0UA 3ZMMA 4USFA 2ZM4A 5EM8A 3U55A 1UV5A 4H39A 4OGRA 4J99A 5DEWA 4FGRA 3KL8A 1PKGA 3RAWA 2BHEA 5BVWA 3MA6A 3EFWA 3SKCA 4O22A 4BHZA 4ACCA 3UTOA 2WXVA 5I9ZA 2C0OA 4I6FA 4ZIMA 4G6NA 2GHMA 3I79A 4X2KA 4EOSA 5CEOA 5J9YA 2PVLA 5CSWA 4OLIA 4DEGA 5DA3A 2QR7A 3EQHA 1H1WA 5AUZA 1EH4A 3RNIA 3VBQA 3UBDA 5F9EA 1REJA 3CKXA 3D83A 4AFJA 4N0SA 4GYGA 3G0EA 2VTTA 2C5VA 3H9RA 5CEMA 4U80A 3WF7A 1UWHA 4FOCA 5IUGA 2B1PA 2QOIA 2V62A 4QMZA 3F5XA 2QO2A 2R3OA 3HMIA 4O7RA 3DFCB 2GNLA 4FK6A 2P2IA 4B9DA 2CKEA 4JVGA 1X8BA 3EQFA 3VUHA 3NAYA 2F49A 2IN6A 2ITWA 4IADA 2BHHA 3VW6A 2XB7A 4QTEA 4GEOA 2XIYA 4IAFA 5BMMA 3KXNA 2PVYA 4UMTA 4IFCA 3E63A 3RWPA 2ONLA 2VGPA 4QMWA 1OB3A 2BPMA 3QWKA 2OO8X 5AJQA 2GHGA 2B9HA 3UIBA 3R9RA 2JLDA 1UNLA 1SVGA 3HZTA 4EJNA 4F64A 5IMXA 5HNBA 2JBPA 3IGGA 3S0OA 3E93A 5I0BA 5IKWA 3EKNA 4ZMEA 1ZWSA 4K77A 1GIHA 3G90X 4OUCA 3LXKA 4E4LA 4D28A 4EHEA 4M84A 4YJTA 4ZK5A 1M17A 4HOKA 3QQHA 2VTNA 4Q5HA 3TTJA 3ZO3A 3EN5A 3QKKA 3TNPC 4RX5A 3V5WA 3TG1A 3C5UA 5B0XA 3QQLA 3L9MA 3TZMA 4YJNA 3DA6A 4U42A 4L67A 3BV3A 4FTAA 2GFCA 1NVQA 2QVSE 3AMYA 2BMCA 3BU5A 3AT4A 1V0BA 3MA3A 4G31A 4CRLA 5LVPA 4F0FA 3Q96A 4FV4A 5JGDA 5CAUA 4ZSJA 3MH1A 2YEXA 3MH2A 3E5AA 3BYMA 3E64A 1JKLA 5HNGA 2XF0A 4NM3A 4XG2A 4ZP5A 2VWXA 4CZYB 4MD7E 2FH9A 3FE3A 2WPAA 3OOMA 4O6LA 2OICA 3FC1X 2V55A 3ID6C 4YNEA 5EM7A 3IECA 3DDQA 2OJ9A 4GU9A 5L3AA 3E3PA 2EXMA 4ZJJA 1CTPE 2XK4A 4RJ4A 4C2VA 2X6DA 3KY2A 4ZZMA 3SVVA 3VS3A 4XV2A 2ITQA 5HX6A 2HENA 1H1QA 2W9FB 2P3GX 3PY0A 4QNYA 5E4HA 4C58A 3IS5A 4IM3A 3UO5A 3PXQA 3A7HA 5K0KA 4F0GA 2XVDA 1F5QA 2R3GA 4QMTA 5FXSA 2YITA 4WRSA 2UZWE 3TKUA 4LGGA 4CEGA 5A46A 5FUTA 1JSTA 5CF4A 4IX5A 1Q5KA 2R3NA 1R1WA 3KU2A 4FV1A 1KE8A 4QTAA 5G6VA 4ZY5A 4EC8A 2C6IA 2R3HA 4BI0A 5EI8A 5M51A 3A7FA 2YHVA 4QMVA 4KS8A 3F5UA 3VHKA 4DLIA 2O63A 4ACMA 3FEGA 4YMJA 3ERKA 4GG7A 3DXPA 3RINA 2QC6A 4ONAA 4O7LA 2B9FA 3HRFA 4TWCA 3RMFA 4LOPA 3K5UA 3D7ZA 1H08A 3PPKA 4FKQA 3NW6A 4B6LA 4D2VA 2C47A 3PRIA 4IX3A 2QHMA 2GFSA 3IGOA 3FLWA 1TQIA 4HYIA 2QNJA 5AR8A 3MBLA 2F2CB 1CKJA 3KEXA 4M15A 2VWWA 3UNZA 2R3QA 2Y4IB 3ANRA 3LXLA 2QO9A 2Z7RA 1FPUA 3KK8A 3ZCLA 2WU6A 3GGFA 2QOQA 2YN8A 2VD5A 1PXPA 4CQEA 3LE6A 4DFUA 4DGOA 2JDOA 2RSVA 3LCSA 3SG9A 4RC4A 5J87A 5DH3A 4YSJA 1YRPA 4A4OA 2GHLA 2LGCA 3BE9A 3PP0A 3K3IA 2Y6OA 4M97A 5KE0A 2VWZA 3LOKA 3NGAA 2V5QA 4C4JA 5J1WA 3E7OA 3HLLA 4FYOA 4GS6A 5BX0A 3W55A 2JIUA 4DTAA 3DXNA 4XJ0A 3TL8A 4NM0A 3IKAA 5DG5A 2UW0A 1VEBA 3QF9A 5IQFA 1WMKA 2UW7A 3R01A 4NK9A 4LV5A 4TYIA 4LM5A 3R04A 4CYIA 4O86A 1TQPA 4ANMA 3MY0A 1G8AA 1YOJA 3TXOA 1JWHA 3PE1A 4M68A 1BMKA 3A4PA 2ERKA 2PTKA 1GIIA 2X7GA 4DEDA 3QCSA 3R1SA 1XH9A 2WTDA 3UE4A 3LFQA 3O2MA 2C5YA 4FTMA 2YCRA 3MWUA 4BCNA 4NCTC 2C5OA 4GUEA 5JMSA 4BCOA 3G9LX 2JIVA 5HX8A 4JRVA 1H1SA 1Q8ZA 3BU3A 2OFUA 2CSNA 4GFGA 4ENYA 3NUAA 3A4OX 1ND4A 3ENHA 2X8IA 3NUSA 4R5SA 4P5ZA 3CLYA 3QWJA 2Z60A 4HCVA 3LFAA 5FTOA 3WZJA 3I7BA 4FEWA 4QOXA 5AUYA 3OROA 1SZMA 4HCTA 3PJ2A 4RZWA 1ZYCA 4IB3A 1Q62A 3SXRA 4BVUA 4E4NA 4MBLA 4EOIA 4AW2A 3DAEA 1CDKA 3MYGA 2NNWB 4A9YA 3KXZA 4BWXA 4DH5A 3Q9ZA 3PLSA 1STCE 5C8NA 5EYMA 5DR9A 3QXOA 3QZHA 4BYIA 3CTQA 5HTCA 3OW3A 4KUJA 2PMIA 4RZVA 3UPXA 4JG6A 5HQ0A 1OPJA 3RPRA 4RVLA 2H34A 3KQ7A 4R7HA 3UIXA 3QYZA 1OPLA 2PZPA 5EKNA 4ANOA 5K4JA 4RQVA 4ZLYA 3DZOA 3BLQA 5FD2A 2QOHA 2OSCA 4R3PA 2IZRA 3PVWA 5AP4A 2E9UA 3OWKA 3ORIA 4YLLA 1A9UA 3KXGA 1OITA 1WBNA 2HK5A 3FLSA 3MH0A 2BCJA 4J96A 3QXPA 4E20A 1ZMWA 4HGLA 5EQEA 5BVOA 4LOOA 2E2BA 2HXQA 3W8LA 4IAKA 5KMOA 4BI2A 2XMYA 1H28A 5AR2A 3T8OA 4BGHA 4G9RA 5ANJA 4YTFA 5HG5A 3V51A 4EJ7A 4DFXE 4GH2A 5HVKA 3U9CA 3BIZA 2XK3A 2VTAA 1F3MC 1URCA 4K9YA 2C0TA 2C4GA 2PVHA 2R3PA 5M08A 3ULIA 2UVZA 4WT6A 5HE2A 5J1VA 2BKZA 4NT4A 3D94A 1XO2B 5LWMA 3EKKA 4FIFA 3Q6WA 4CSVA 3CXWA 5CQWA 3F5PA 5CT7A 5EOLA 4F9YA 4WHZA 3A60A 2PMLX 3C4CA 4GFMA 2WMBA 2FSMX 2BILB 3E62A 3MESA 1W7HA 3Q4UA 2GMXA 3P23A 3RCJA 4GT4A 4JDIA 4R78A 1UA2A 3NSZA 4LGHA 3OXIA 2C6DA 3K2LA 4Y46A 4YGAA 4U6RA 5EW9A 5JK3A 1GOLA 4JDHA 4EI4A 2CKPA 3FMLA 4QMPA 3BYVA 4WUNA 4IX4A 2BAKA 4OTRA 4QMSA 4G17A 2ZMCA 4FL2A 3ITZA 3COIA 4BBEA 3HAMA 3QRJA 2X9EA 4YJUA 3TNIA 4V05A 4BHNA 4FX3A 4F9WA 3R71A 4FKWA 3PY1A 3ZONA 3I60A 1JSUA 3TNWA 4UMUA 3QAME 2REIA 4OTWA 2WQBA 4WRGA 4ANQA 4U9AA 3EN6A 3PY3A 5LMKC 4R6VA 4AW1A 3CEKA 4E5BA 4XRLA 4JBOA 3ZUTA 3VHEA 1OIYA 3G6HA 2VN9A 2P4IA 2C68A 3QALE 3ZUVA 3TM0A 4AF3A 1WVXA 5TE0A 4I94A 3LXNA 3DAJA 4N57A 4AQCA 1GZ8A 4FA2A 4ZTQA 2IPXA 4YC6A 3L8SA 4V04A 4RJ5A 1GJOA 3RK7A 3D7TB 2OKRA 4TPTA 5BNJA 3LCTA 1FBNA 1BLXA 2BDJA 4FKPA 3SD0A 1XBAA 4FIHA 3V5LA 4RFYA 5KKRB 3DB6A 3DTWA 2VV9A 3M2WA 4RA4A 3ZRKA 2YCQA 2J0JA 4EKKA 3NUPA 4N4SA 3NUUA 4CD0A 1MRUA 2WTVA 4J53A 4ZTSA 4U5JA 3ROYA 3FC2A 3IW4A 2DWBA 3FDNA 4DITA 3LQ8A 3JYAA 3W10A 2HIWA 3KF7A 3IDCA 2YLFA 3FMJA 4PDYA 4KB8A 1CKIA 4I5HA 1OL7A 3PJ1A 5CU6A 5AMNA 2IVUA 5GJDA 3FI2A 3WZEA 2XP2A 3FYKX 4USEA 4J8MA 5IEVA 3O8UA 3TI1A 4MVFA 2JDSA 5FDPA 3FLNC 5A3XA 2EUFB 3PZEA 2WEVA 2Y9QA 2HY81 4IDVA 3FWQA 3ZXZA 3C4WA 4FKGA 4C2WA 4EH9A 4N6YA 1JKKA 1GY3A 4L3PA 1QPDA 4TWPA 4CG9A 2F7EE 2IVTA 3RVGA 4IAIA 1NT2A 4AXAA 5DR2A 1IG1A 2FA2A 4FNYA 4FV5A 4UWCA 3DJ6A 5AV4A 3DZQA 4X2NA 4M67A 4Z55A 4JI9A 2F7ZE 5IF1A 4OAUC 3DNDA 3DK7A 5DWRA 1OIRA 2F7XE 2J6MA 1ZMVA 4KIKA 3UC4A 3VUIA 5D1JA 4BCHA 2CGVA 4EBVA 4ZMFA 4XG7A 3NAXA 5CS6A 5IA2A 3PXKA 4GRBA 5H9BA 2AC3A 2A2AA 4YTHA 2PUPA 1BUHA 5L8LA 4GJ2A 3N4TA 3BV2A 4BIEA 4NJ3A 2W4JA 2JITA 3AT3A 3BHYA 3GNIB 3H9OA 4FC0A 3KN6A 3A2CA 4QD6A 3DS6A 3A61A 3UOHA 2ETMA 1G3NA 1Q8TA 1ZZ2A 4HPUE 2X0GA 4WO5A 1ZYJA 3PWYA 3G15A 2HW7A 2W7XA 3R00A 3V8TA 3H30A 4DH8A 4GVAA 4YZBA 3TDVA 3BCEA 4UWYA 4WBBB 3VJOA 3ZBFA 4F63A 3LFDA 4PL4A 3PJ8A 4LOQA 3ZLSA 3PDTA 2O64A 4D1SA 4FEUA 4WUAA 5BVEA 4CMTA 3ORZA 3QKLA 4TY1A 1ATPE 1I44A 4KNBA 2FO0A 3JVSA 3PIYA 1E9HA 3RM6A 2OGVA 3JY0A 3D5UA 2OBJA 1SMHA 2VZ6A 3HECA 3G9NA 3HV3A 5CY3A 3O50A 4OR5A 1ZMUA 3EWHA 3ZLWA 4L46A 4I5PA 2X81A 4XMOA 4DG0E 4F08A 3QCXA 5KCVA 3MVMA 3L8VA 4FT7A 3RTPA 3ZRLA 3LMIA 1SVEA 2PSQA 2R3LA 4I3ZA 5FG8A 4D9TA 1MP8A 4KIOA 5ETIA 2C0IA 3GVUA 3OXZA 4IB0A 4QMQA 4C8BA 2XK8A 3VS2A 4ITHA 5AIRA 1YI4A 4CVAA 4U81A 5EQYA 4M3QA 5BVNA 2FVDA 3MH3A 5M44A 5CSXA 4DCAA 3WIGA 3DNEA 3MY5A 5IA1A 3MFSA 2ITVA 3FZSA 2C1AA 1Q4LA 4KBAA 3LJ2A 4DA5A 3NNUA 4BICA 3ZLYA 4UWBA 4IAAA 4FKTA 5E7RA 1UKHA 3IOPA 5T68A 4XG9A 4FL1A 4LMNA 2QQ7A 2UZTA 1OVEA 2RFNA 3V5TA 4AT4A 2QU6A 3TUDA 1YI3A 4PV0A 3A99A 4EH4A 1NA7A 4QMNA 3Q4TA 3F82A 3Q52A 4W4VA 2UZLA 3BLRA 5DMZA 5EH0A 5GNKA 2ZB0A 3FKLA 4AA0A 4I6BA 2ZDTA 4CZTA 2V22A 4DGLC 5EFQA 2OJGA 3BBWA 4O84A 1AD5A 2BZHB 4W4XA 5E8ZA 5FBOA 5HVJA 3TIZA 4JXFA 4PQNA 5KX8A 3FKNA 3H0ZA 3GC7A 3FMKA 2QONA 1ERKA 2HZIA 4C0TA 5CU0A 3R9HA 4OTGA 5IQHA 4D2WA 2X1NA 4MKCA 2BRGA 1M7NA 2BZJA 2VX3A 3AOXA 4YBKA 3E8DA 4FTJA 2H96A 4PNKA 2UZEA 4B7TA 2DUVA 3OBJA 1OMWA 4NIFB 2IW8A 2WQMA 4HNIA 3KN5A 4X3FB 3BGZA 5EG3A 5KNJA 1HCLA 2UW8A 3FZTA 5E1SA 4DEEA 4XG3A 4U7ZA 2OG8A 3PUPA 3DPKA 2VWBA 4J52A 4BDJA 2Y7JA 3C13A 1LPUA 2R5TA 3MFUA 5AR3A 2ZVAA 4BCKA 3UOJA 2OWBA 3PYYA 2PVJA 2OJFE 3ULZA 4F7JA 2QG7A 1BI7A 2YACA 5EKOA 3MPAA 4IH8A 4AZEA 4L6QA 3VS7A 2JKMA 3NUXA 3OY3A 3BU6A 3DFAA 4LQMA 4MCVA 2ITOA 1IA8A 2VTIA 4I92A 5EHLA 5AV1A 2CNVA 2HOGA 3F88A 5EDPA 4IX6A 3DKOA 3R8VA 3UJGA 4C02A 5CXZA 5DRBA 5L2TA 1UU9A 3ZTXA 4TNBA 3ZFMA 4IVAA 2Q83A 4ZSLA 4CFNA 5HLWA 4DBNA 3OOGA 1A48A 4S2ZA 3ZHPC 3AMBA 5K5XA 3IONA 2OJIA 2WHBA 4TL0A 3FSKA 2IVSA 4I22A 4CNHA 4M7IA 2UVXA 4IB1A 2UW4A 3UVRA 5CXHA 5DEYA 3P7CA 3GU6A 3W2RA 1WVWA 4H36A 5FQDC 1Q41A 2X7FA 4YJRA 4I6HA 5TOZA 5BVKA 3UYSA 2J51A 4NU1A 1JSVA 4NW6A 4AGWA 1FMKA 4F6WA 1VZOA 2I1MA 1XBBA 1ZRZA 3JS2A 3ATSA 4RX7A 1WBWA 2R9SA 3R1YA 4R5YA 4K11A 3CD8A 2WMUA 3FLYA 4PL5A 5HO7A 2ITTA 3D14A 2C6MA 2JKQA 1QPEA 3EFKA 4BIDA 3JUHA 4PP7A 1U5QA 4AZFA 5GZ9A 4IM0A 4XLIA 4AGUA 2YDJA 1CSNA 4ZZOA 1T45A 2C3IB 3TUBA 1YHVA 3R73A 3LZBA 5GINE 3DKGA 4YZNA 3V6SA 4I0RA 5KHWA 5KMNA 4MNEB 5HICA 1Q3WA 4A9UA 5KZ0A 2R3MA 4TYJA 2X8EA 3W18A 4XP0A 4Z16A 2CCIA 4O0SA 5E8TA 3SQQA 3QD0A 1MQ4A 3MJ1A 4IVDA 4Y85A 3EN7A 3GU8A 2NRYA 4IB5A 5GZ8A 4XLVA 2NO3A 4PTEA 3V3VA 5HD4A 1OUYA 4XRJA 2R3FA 1OKZA 1YXSA 4C59A 2IZUA 5HOAA 4FTNA 5IMEA 3ACJA 4C3PA 4HVHA 4ZAUA 2JD5A 4LRMA 5TF9A 2R3JA 5F1ZA 5CF8A 4FTCA 5C4KA 1PW2A 3HV5A 1KV2A 2UW9A 5CEQA 5L2IA 4HPTE 4DEBA 4AUAA 5CSPA 4TW9A 2WEIA 3OC1A 3DQXA 4YZ9A 4E26A 2RFEA 4MF1A 4J8NA 2DS1A 4RLLA 5AUTA 2ZDUA 4PRJA 3HDMA 2C30A 4O82A 4D2TA 4O7ZA 2VGOA 5A4QA 1G5SA 3UMWA 1Q24A 3MN3A 4C36A 1JPAA 1OKVA 5CI7A 3R22A 4MEDA 4YTIA 5A14A 4EOMA 5BYLA 5E8WA 1OL5A 1KWPA 3ZXTA 2YWPA 2CDZA 1URWA 3SAYA 1Y6AA 4GK2A 3FMNA 5IQBA 3QUEA 2YDIA 3UNJA 4RC3A 1KUTA 2B9IA 3DBFA 1OL2A 3S1HA 3EMGA 5KKRC 3TV7A 3S00A 4O7TA 2PZIA 3FI4A 3NCGA 2UZOA 3FKOA 3KXXA 4U44A 2F4JA 1Q8WA 1V1KA 4MD8E 5HCXA 4YJQA 2QI8A 3QCYA 2FSTX 4EH8A 4G5PA 2YM4A 3U6HA 4O1OA 4YUQA 5GZAA 4AZSA 4BDFA 3Q2JA 5JH6A 2RF9A 4C38A 2XCKA 4BCFA 4UZDA 2GSFA 4CLJA 2I0YA 3DBQA 3DB8A 3VUMA 3W2CA 4UMRA 2G9XA 5C4LA 5AP5A 2OF4A 4A9TA 4D0XA 4R8QA 5TO8A 3VN9A 2CN5A 3PXYA 2I0VA 4I93A 4YO4A 3FMMA 3PZHA 1AQ1A 3UG1A 4TYHB 4AWIA 2HWPA 5LMAA 5I9VA 1SNUA 4P7EA 1R39A 5IH5A 2WMQA 4RRVA 1A06A 4CKJA 4KBKA 3ORTA 5IZFA 3LFNA 5L2WA 1FINA 4O7NA 5AAGA 5IQGA 4DFLA 4OT5A 5DFPA 2PUIA 2ZMDA 4OT6A 4OTIA 5B7VA 3GCSA 2ITXA 3JXWA 2QR8A 4FEXA 4FV9A 2XZSA 4XG6A 2NP8A 3EB0A 4P2KA 4BDKA 3AD5A 3LM0A 5HI2A 4EOPA 4AZWA 2Y4PA 3FQHA 3QCQA 4BTFA 2H6DA 2G2FA 5J9ZA 1UU3A 4FOBA 4UN0C 4UV0A 3E7VA 2YIYA 4FIGA 4FKVA 4OW8A 2X4ZA 4UZHA 2BAJA 4FZ7A 3QHRA 4CFVA 4YLKA 3OWLA 2PVKA 2UZNA 5AV3A 3BLHA 2HELA 4BKJA 4CLIA 3SG8A 4F70A 3GOPA 4MBJA 5IU2A 4ZOGA 3OTVA 4M69B 4ANBA 2A0CX 1WBOA 4MH7A 3UO6A 3Q04A 3ORKA 3R8PA 4DEIA 2CGXA 5GJGA 3VBXA 4FSQA 4OBOA 4R3RA 2I0HA 2OXYA 2WMRA 4KS7A 5A4TA 3U8WA 5TKDA 2JKKA 3KC3A 3ORPA 4L7SA 5A54A 5IQEA 3UIMA 2WELA 5I9UA 4ZLZA 4FV8A 3KXMA 3R21A 1OBGA 5M4CA 3CTHA 1WCCA 4QO9A 4YO6A 3I81A 3O7LB 3RP9A 4FVQA 4F0IA 1BL6A 3KRXA 4Q9ZA 4KBCA 2SRCA 1OGUA 3S95A 3PA3A 1H0VA 2C5XA 2P55A 4M66A 3GU7A 1F0QA 4DC2A 5I5ZA 5DRDA 3R7IA 3TDWA 3PSDA 3ORMA 2XKEA 4I41A 3HNGA 4JQ7A 4U97A 2YM3A 3RI1A 4A07A 3P9JA 1OL1A 1M2PA 3KFAA 2PHKA 3O23A 2XRWA 2ZM3A 4BWKA 1NW1A 3E92A 2J2IB 1L8TA 4YPSA 3BE2A 4F6SA 4PPCA 3CSVA 3ATTA 3ZSIA 4ARKA 3KCKA 5HG7A 4CXAA 2VTSA 2JFLA 4R7BA 2FUMA 5FRIA 5CEIA 3VVHA 3WE4A 3D2IA 2GTMA 4BYJA 5I3RA 3K3JA 1H25A 2CLQA 4HZSA 4II5A 2HCKA 3OW4A 4DTKA 2IJMA 5JGBA 4DEAA 5A9UA 5HLPA 4Q9SA 4G3FA 4X2GA 4AE9A 5HESA 3KMUA 5M55A 3VRYA 4DH3A 2E9PA 4H05A 4HNFA 1OPKA 2X7OA 2BFYA 3N9XA 1E1VA 2WQNA 3SOCA 3LLAA 2BFXA 4X3JA 2XIKA 3NEWA 1Q97A 2WMVA 4X6QC 3I7CA 4NFMA 3VS4A 2VWYA 4JQEA 4OTQA 4BCGA 4DT9A 1NXKA 4QQTA 4N70A 4H1MA 5M57A 3OT3A 3EOCA 3I1AA 2JDTA 4QP3A 1TKIA 2UZDA 4TN6A 3KB7A 4FK3A 4FKJA 3A7JA 4CFWA 2WZJA 4D1XA 4C34A 3AGMA 2BIYA 5DIAA 4EORA 2V7AA 2VO3A 3EH9A 3FZRA 3OEFX 2YZAA 2YCSA 2PUNA 5K5NA 4HCUA 4V01A 3DBEA 4DH1A 4L3JA 4IC8A 2VTLA 3P78A 4L42A 4PTGA 4YHFA 3F3UA 5CZHA 3HMPA 5ANIA 5C8MA 4IFGA 4DINA 4H3QA 3KMWA 3SW4A 2PY3A 4EQMA 1O6YA 1ZYSA 4XCUA 4A9SA 3AGLA 3R1NA 4WG3A 4ANSA 2YM5A 2DYLA 5BVFA 1PYXA 1UU7A 2I0EA 2VNYA 3QTQA 3WF5A 3Q5ZA 1IAJA 2I6LA 1LP4A 4RLKA 2BRHA 3WZDA 4GU6A 3V8SA 3VBWA 1ZZLA 2CGUA 3CIKA 4U8ZA 3PSCA 3VO3A 3RPYA 4EQCA 3HP2A 4AZVA 4O1PA 2AUHA 2ACXA 2GU8A 2WTKC 4EHVA 1R0PA 3UP2A 1S9JA 4Y5QA 5DI1A 3WYXA 2WQOA 5ANEA 4PP9A 4KAOA 4EOOA 3S2PA 2Y4IC 3QC9A 2J0MB 4GK4A 4KSPA 4CT1A 4YC3A 2UW3A 4BL1A 1APME 1Z9XA 3MV5A 4UALA 4E8AA 3IG7A 4GG5A 4DFBA 3EQGA 4GJ3A 5CX9A 5ETFA 5AADA 2RFDA 2C3LA 2WMSA 2XEYA 3DBCA 3R6XA 4ZJVA 2XUUA 4BZOA 4FSUA 5CNNA 4D5KA 5CF5A 4I21A 1UWJA 3RHXA 3ZFXA 1KV1A 2X2MA 3IW5A 5HEZA 1OL6A 4FNWA 3CY2A 3NNWA 3POZA 3VF9A 1J1CA 3QL8A 5K9IA 4O7VA 1OZ1A 2A19B 2PWLA 4KIPA 3C1XA 5LWNA 2C3KA 4U40A 4NYEA 3GC9A 1KE6A 1WBSA 2BTRA 2WGJA 2NRUA 2ITUA 2CKOA 2BRMA 2VWIA 5KO1A 3N4VA 3CQUA 5HBEA 2XNNA 4EUUA 3O71A 4QP2A 4BTMA 3IW8A 4IMYA 4RSSA 1YHWA 4C57A 3KRWA 4D2RA 4BTJA 1VR2A 2C6EA 3L9NA 1YVJA 3QBNA 4RIXB 5DHJA 5JRSA 3W2PA 3R1QA 1I09A 3DJ5A 3RJCA 4AG8A 3TNQB 3FLZA 1PXNA 3NYXA 2EVAA 2VU3A 2W1GA 3OCTA 4G2FA 3ZO2A 4FIIA 4ASDA 4E6AA 4F65A 3BBTB 2GS6A 4G6LA 2WTJA 4NEUA 1CMKE 3ZC6A 2J50A 4USDA 3ZU7A 4ORKA 2YM6A 2AC5A 4YJOA 5EOBA 1XR1A 1FOTA 5DE2A 2R3KA 3DU8A 3CKWA 3D15A 4JOAA 4UXQA 3VRZA 4H58A 5ITAA 2XNPA 2YERA 5CU4A 3PVBA 2BIKB 3P08A 4HYUA 4QPAA 5FXQA 4ACGA 3QZIA 5KBQA 2X2KA 3UO4A 2JKOA 1H24A 2OIDA 1OIUA 3Q6UA 4HYHA 4M8TA 3UQCA 4G3GA 2R0IA 4NWMA 4PTCA 4QNAA 3HA8A 4Z9LA 4HW7A 3NUNA 2W5AA 3W33A 4M0ZA 2XJ1A 1H27A 5CI6A 5F20A 4IZYA 5EDQA 2RIOA 2IW9A 1ZOEA 2BRNA 3OUNB 4FR4A 3R7OA 3T9TA 3MI9A 2GNGA 2J4ZA 4GYIA 2YJSA 4IWDA 4GL9A 4CKRA 4APCA 5BQ0A 4O91A 3RWQA 1XHAA 2GNFA 4PMMA 3P4KA 5EYCA 1O6KA 4BFMA 4DH7A 2Y0AA 2CGWA 1JKSA 5HKMA 3KGAA 2P0CA 3DV3A 5AP0A 2Y8OA 4WIHA 2WU7A 3VC4A 3S4QA 1LR4A 2XNBA 2HW6A 4U45A 2GS2A 3GP0A 3REPA 3IW6A 3GCUA 3K54A 4YJPA 3DOGA 3ZS5A 3V5PA 3PLAE 5EYKA 4G9CA 3AQVA 5KMJA 4UB7A 4CV8A 4JS8A 5AX9A 1U46A 2HWOA 3U9NA 2RG6A 5E92A 2CNQA 4BZDA 2ZOQA 5CTPA 5L2SA 3ALOA 3FPMA 3FV8A 3L9PA 4J97A 1OUKA 3C9WA 3VIDA 1YHSA 4G1WA 4PPBA 5L6OA 1M2RA 5K3YA 3SW7A 3C4FA 1PMNA 3PRFA 1Z5MA 3PWDA 2W99B 3Q60A 5GJFA 3TZ9A 3UPZA 3RPVA 4O27B 4YZDA 4DAWA 4QP4A 2GQSA 1YXUA 4FSNA 1O6LA 2QOLA 4U3ZA 4BDDA 2ZM1A 4DFZE 1ZLTA 5DGZA 1QL6A 3OCGA 3HGKA 3F5GA 5A4LA 5B2MA 1KE9A 2GPHA 3NW7A 3IOKA 3LJ0A 5E8YA 4YURA 4RIWB 5B2LA 4DG3E 4W8EA 3UIUA 4C4IA 2BRBA 3ZM4A 3W1FA 4D4RA 1Y8GA 3BHVA 3DK6A 5IUHA 5FP5A 4D2PA 3G51A 4S33A 1PKDA 3QRUA 3QZGA 5LMBA 2WOTA 2XNGA 4OBQA 5HIEA 3FMHA 5DBXA 4EONA 3UC3A 4QYYA 3C0HA 4ZY6A 3VS6A 3UZPA 4L68A 3E8EA 4DTBA 4FZDB 3B8RA 4NKAA 1TQMA 3WF9A 3OS3A 3CP9A 4E7WA 4LUDA 2XK9A 4FZFB 4K6ZA 4C3FA 4O0XA 4FV7A 2X4FA 5KUPA 4EZ5A 3AD6A 1YKRA 1SVHA 4RG0A 4GKHA 4IWOA 5EW3A 4W4YA 3WI6A 4FTIA 3CY3A 3FL5A 3QRKA 5ACBC 4G34A 4F4PA 3H4JA 3RAKA 3R0TA 3CGOA 3FUPA 3NUYA 3GC0A 3R9DA 4AW5A 4CMOA 1IA9A 3KRJA 3UQGA 1H1PA 5AR7A 5LVLA 3BQRA 3CBLA 1FVRA 4XBUA 4AA5A 4O81A 4QMUA 5KBRA 5AUVA 3CCNA 3COMA 3DBDA 1ZOHA 2YJRA 3OCSA 3QRIA 2R2PA 3HV4A 4HZRA 5ETAA 4AGDA 1OBDA 3RHKA 4A06A 4F9BA 4NCTA 2WTWA 2XK7A 3ZZEA 2VAGA 4XNEA 2YIWA 1WVYA 4M69A 2VX1A 3ORNA 4I24A 4L8MA 2PMOX 5CALA 5LQFA 5GIOE 5FXRA 4XHKB 2XK6A 2JFMA 3F3TA 3DDPA 3QLGA 2O5KA 2CN8A 3BX5A 4JG8A 2H9VA 4F1MA 2UV2A 3EL8A 3AC3A 3UMXA 1PF8A 4AU8A 4RFZA 1BX6A 4TZRA 2XIRA 2F9GA 4K8AA 4NFNA 5I9XA 5FGKA 3P0MA 1PXIA 4KABA 1WFCA 3QTWA 2PPQA 1BL7A 3QD2B 3GCVA 2X6EA 4QMMA 5D41A 5HIDA 1JVPP 2XBAA 3BZ3A 1V0OA 2W9ZB 4JDJA 1R78A 1MRVA 2X2LA 4XOZA 4F9CA 2C3JA 5AIKA 2VX0A 3LCDA 4O21A 4ZTLA 3UZTA 5DR6A 5M09A 2E9OA 5HU3A 5LOHA 2R7IA 4AX8A 4O83A 3KF4A 2GDOA 5T6KA 5K4IA 4EQUA 5E90A 2QCSA 3NZ0A 3R8UA 2GTNA 2J0IA 4CT2A 1GZKA 2B54A 3DTCA 2W0JA 5AX3A 4O2PA 3MFRA 3P7AA 3TWJA 3PJ3A 1YDSE 3VBVA 3VUDA 2YDKA 4HVGA 5AP2A 4EEVA 5FDXA 4CKIA 3FI8A 2FB8A 5JT2A 4MK0A 4BDEA 3UVPA 4ZJIA 1XH5A 5FEEA 1B39A 3UQFA 3F2NA 3QQGA 4FV2A 4BCIA 4FEQA 1MRYA 2XKFA 3GQIA 4R1YA 1U4DA 2YLEA 4LUEA 4BKYA 3QRTA 3V04A 4EH6A 3KULA 2J7TA 4DG2E 4ZSEA 2OZAA 5BYYA 5IPJA 1R3CA 3SGCA 2B52A 4GV1A 3QA8A 3OD6X 4K33A 5AP7A 4AE6A 3TKIA 4C4GA 4EK3A 2WTCA 5IA0A 1OM1A 3NYOA 1W98A 1M7QA 3FQEA 4Q2AA 3P7BA 4NM7A 2WMXA 4XV3A 3JR1A 4BZNA 4IE9A 5ANKA 2G15A 3B2WA 4FODA 5HHWA 1PHKA 5TT7A 4ZY4A 4B0GA 3DCVA 3FXZA 3BRBA 4WD5A 5C8KA 1XBCA 2C1BA 2WIHA 4EZ3A 3KMMA 3L8PA 5E1EA 2DQ7X 1R0EA 3CQWA 4BBMA 3DJ7A 3Q2MA 4EC9A 4BTKA 5HO8A 4L52A 3M1SA 4FTUA 2OZOA 4ASEA 4OTDA 3R7UA 2Z02A 2KULA 2XIXA 3SRVA 2HYYA 4YHTA 4O38A 4W9XA 5CU2A 2YM7A 3OZ6A 4BIBA 3KK9A 2BR1A 3BGQA 4Y5HA 1WBVA 4EH3A 3PXFA 4EL9A 2YIXA 2VTHA 4B99A 4D4SA 3HAVA 2V0DA 1K3AA 1KE7A 3ZLXA 5E8XA 2ZYBA 4PY1A 4XP3A 4BC6A 3NMUF 3MPTA 5EHYA 2UZUE 5M4FA 1HOWA 5A6OA 5H3QA 4QQCA 5AA8A 5AUXA 3KRLA 3WOWA 3QD4A 4XX9A 4CCUA 1UNHA 2OJJA 2BAQA 3LQ5A 2BTSA 3EFLA 4IWPA 4OTFA 3FYJX 4RVMA 5H8EA 3C4ZA 4NIFA 3F3VA 3PG3A 4IZ5A 2BDWA 4ID7A 3TJCA 3QQKA 1REKA 2QG5A 2HZ0A 1BI8A 3P5KA 2BDFA 4YJSA 3D0EA 4WNMA 5L8KA 4E6CA 3OCBA 4RX8A 3ZFYA 2HXLA 4F99A 4IXPA 5AUUA 1PMUA 3R30A 3WYYA 2B4SB 1ZARA 4H3BA 1W8CA 4RJ6A 4S34A 3MS9A 3BQCA 4DCEA 4BKZA 3FJQE 4C62A 3UP7A 5DN3A 4O0WA 3EHAA 4C4EA 2W06A 3CS9A 4HJOA 3QKMA 4IHPA 4BDCA 5IH6A 4EZ7A 2X9FA 2ETRA 4QMOA 2BUJA 3ET7A 1H07A 2JAVA 3O0GA 1YDTE 3ZDUA 3RPOA 3UOLA 4EOQA 1JOWB 3ETAA 2WTKB 3FI3A 4QYGA 2YWVA 4AN3A 3KKVA 5F95A 4E4XA 1PMVA 3EL7A 4FSZA 3QFVA 3U4UA 4IWQA 4QYFA 4X2JA 3ZOSA 2QOFA 1RE8A 2OI4X 3PVUA 2ZV2A 2CKQA 5AFVA 2OFVA 3C5IA 5LVMA 4RQKA 3NLBA 3QGWA 4I5MA 4MAOA 4IC7A 5D10A 5E8UA 1YQJA 2WIPA 5DOSA 4AN2A 3MY1A 5EM5A 5EHOA 3SRVB 1DI8A 2OIBA 3FY2A 3THBA 5JQ5A 3ZRMA 5J8IA 3FXWA 1Y91A 5FM3A 1DI9A 4FZAB 3V8WA 5J7HA 2GNIA 3DQWA 3LJ1A 4JLCA 4QQ5A 3WE8A 3HMMA 4M12A 5IH4A 4B8MA 5EQPA 4FUXA 3MTFA 2PUUA 2CJMA 1J7IA 2W4KA 4Z3VA 4ACHA 4FSMA 4FKLA 2W1ZA 4L45A 3AT2A 4QP1A 2R3IA 4QMLA 4RWJA 4YU2A 5ANGA 3EN9A 5JFVA 4LL5A 4KA3A 4RIYA 5L4QA 3LKMA 4NL0A 1YWVA 2W1CA 3RPSA 4C4FA 1P5EA 3GXLA 3D2KA 3QUDA 5EW8A 3RK9A 3HV7A 2W4OA 4FNXA 3MFTA 2HZNA 2O8YA 4X7QA 4KKEA 2G01A 4BGQA 4EK4A 4PNIA 5LXMA 3EQDA 3FPQA 4WSQA 1H01A 3VUGA 1G8SA 4BRXA 4D0WA 3R7EA 2BVAA 3VF8A 3H10A 1DAYA 5EI2A 5FWKK 4NH1A 1UKIA 2PVMA 3P1AA 3QTIA 4O0RA 4PX6A 4UXLA 4DE4A 4MXXA 3HV6A 3UYTA 1Q3DA 4JAIA 3SC1A 4PWNA 3GU4A 3SX9A 1DS5A 4XYFA 1J1BA 5EDRA 3DLZA 3R02A 5C27A 5CSVA 5J7BA 4FT3A 4AT5A 3GCQA 1JLUE 4Q5EA 4CFXA 3BYUA 3KXHA 4C35A 4LRJA 3EN4A 3ZC5A 5FLFA 4D9UA 3ZSHA 2E9VA 2ITNA 4FSYA 5BPYA 4RGJA 4RVKA 4WKQA 5FEQA 4B8LA 4LGDA 3L8XA 1W84A 5FP6A 3ODZX 4V0GA 5AEPA 3UVQA 3R2YA 4Y95A 4RIOA 2CMWA 3EQPA 3CJGA 4R3CA 5CVHA 5JEBA 4TT7A 3GENA 5H2UA 4O7WA 5ACKA 5E91A 2BROA 1ZAOA 5JGAA 4KIQA 4FKIA 4AGCA 2AYPA 4WOVA 4PL3A 2QU5A 3HUBA 2QLQA 4UYNA 3O8PA 2J0LA 3MTLA 4Y73A 4QP8A 5BVDA 3UNKA 4YZMA 1Q99A 3FBVA 3E8CA 4L7FA 5IQIA 3T3VA 4QMYA 4UEUA 4O0YA 2O3PA 3K5VA 5F94A 1U59A 2PVFA 3FZPA 4ZEGA 4FVPA 5BUJA 4IM2A 4OTPA 5AUWA 3LMHA 4FSTA 2XS0A 4AZTA 4FTTA 4DFNA 3MW1A 3EJ1A 3QZFA 2Q0BA 4FG9A 1BYGA 3LCKA 3NYVA 2OU7A 4YZCA 5BUIA 3C4EA 1NY3A 2XM8A 2Q0NA 4OTHA 2ERZE 4J95A 3EYHA 3IO7A 3LCOA 4JT3A 3VS1A 4GVJA 4CMUA 3LFFA 3GUBA 5B2KA 5CASA 2PZYA 3Q3BA 3R2BA 4JR3A 2PZRA 3AC4A 1DM2A 3TTIA 4EH5A 5JKGA 4JBPA 4UMQA 2WNTA 2UZVA 4LFIA 3U51A 2Z8CA 4YP8A 3EFJA 5JZNA 4PMPA 4LG4A 2CPKE 5M07A 4F1TA 4D1ZA 4F1OA 4E4MA 3FMDA 2C6LA 3G5DA 2GNJA 4I1ZA 3VUTA 4Z7HA 1IRKA 4EYMA 3UDBA 2Z7QA 1B6CB 1UU8A 3WF6A 4RPVA 3TKHA 4PPAA 3R8LA 4FV3A 2J0KA 3FAAA 2W05A 1PXJA 4X3FC 3I5NA 4I0SA 4TWNA 3MB7A 4RBLA 1IAHA 2GQRA 1H4LA 4RA5A 2JIIA 4FV6A 4XUFA 5CAPA 2OIQA 2W5BA 4YHJA 5HE1A 5DVRA 3ACKA 3D5XA 5IA3A 5FBNC 4MQ2A 3HP5A 5IUIA 3CC6A 2BZKB 4I4FA 3H3CA 4RWKA 4YPDA 3ORLA 2VRXA 2JGZA 5DT3A 4OBPA 5CENA 1RJBA 2C5NA 3MVLA 4TYGA 1P4OA 1Y6BA 3QX2A 4IJ9A 4XOYA 4L01A 4ZTMA 5I3OA 5D7VA 3CPBA 5H8BA 4YSMA 4TTHB 4BCQA 5IQAA 4QP6A 4YNOA 3F69A
chains in the Genus database with same CATH superfamily
3A62A 3W16A 3HKOA 3TV6A 2OH0E 4X0MA 3AC1A 3OBGA 5HE3A 3GEQA 4NSTA 3DXQA 3R7YA 4GKIA 1G8JA 4U0IA 5FEDA 3O7LD 3Q9XA 1XKKA 2ZJWA 3L1SA 4BDHA 1YOMA 4IAZA 2OK1A 3HMOA 2QURA 3PG1A 3R7GA 3CGFA 3W32A 5FTGA 4YTCA 3BHHA 5FTQA 5DYJA 2XEZA 4FRFA 3RAHA 4TWOA 4UMPA 2YISA 3ODYX 3QQJA 1RDQE 3GFEA 4I5CA 2Z7SA 4O0VA 3LMGA 4RJ8A 3TCPA 4GUBA 4A9RA 1V0PA 4XH6A 5A4CA 1PXOA 4QQJA 4RIWA 4QMXA 3LVPA 4U41A 4AOIA 4FKOA 4ALUA 5D9HA 2J5FA 1JKTA 2XA4A 3QTSA 2F57A 1VYZA 4EOKA 3F3ZA 3Q4ZA 2WMAA 4LYNA 5GHVA 3VS5A 4S32A 3VULA 3FHIA 5CSHA 1W2FA 3BL9A 2GCDA 3ELJA 3AC8A 3KULB 5I9WA 2YZLA 4Y83A 1XH7A 3ALNA 4DYMA 1H1RA 3OWJA 3PIXA 4C61A 4FTOA 1PXLA 1U54A 1Y57A 2P33A 2QOBA 2UW5A 4G3DA 2OW3A 4WNKA 4ZSGA 4H3PA 3SXFA 3NFGB 4JR7A 4FKRA 2O65A 3FZOA 5IEYA 3RM7A 3V01A 4CGAA 4NW5A 2WAJA 4P4CA 5KMIA 3W0MA 4ALVA 1QMZA 3OFMA 2XCHA 3OVVA 3NX8A 3HRBA 3VQHA 4FIJA 3HL7A 2CHLA 4DHJA 4RWLA 3RGFA 4F7NA 4PDPA 1XJDA 3C4XA 1NVSA 1OI9A 2EXEA 2WD1A 3GT8A 4FF8A 4L9IA 4BB4A 3CPCA 2VO6A 5TR6A 5J5SA 3BI6A 5CU3A 3WIKA 2VO0A 4K2RA 4FSWA 5C01A 4IAYA 4HYSA 4EUTA 5JFWA 1QCFA 2UVYA 2BZIB 3D4QA 4O0TA 3TZ8A 4IZ7A 3VJNA 3O8TA 2FSLX 5IA4A 3OXTA 3TJDA 5G1XA 3ZYAA 4ZTHA 5JZJA 1ZY4A 2WB8A 3ZZWA 2QOKA 4CFUA 4LL0A 4BCPA 5GIPE 4PF4A 4MQ1A 3R63A 4H1JA 3V6RA 3WF8A 5AP6A 3ZDIA 4ERKA 5HORA 3A7GA 4RT7A 5CAOA 3V5JA 5I4NA 3NVKI 3DK3A 4FKUA 2YIQA 3ZEWA 2W1IA 3H0YA 3HDNA 4PMTA 2ONLC 5CEPA 4S30A 3JVRA 3EZVA 5AAFA 1TZDA 3AC5A 2B9JA 3G33A 2ESMA 4JBVA 3R9NA 5KMKA 3Q9WA 3I0QA 4MNEA 5J79A 3F6XA 4FNZA 3TEIA 5AP1A 3SDJA 3BGPA 1RW8A 4M0YA 2PVRA 3LW0A 3OG7A 4XV9A 4CRSA 1GNGA 3E3BX 4FG8A 3ML1A 3TN8A 2P2HA 2XYUA 3NPCA 4IW0A 4IBMA 3M11A 2JDVA 3UGCA 3QUPA 1OIQA 3OEZA 4C33A 2B53A 2WFYA 4O0UA 5T3QA 3C50A 4ZS4A 3N51A 3R9OA 2YCFA 3LFEA 3C0GA 3UDTA 5CEKA 4BWPA 3LQ3A 1SYKA 4UY9A 4JBQA 3SA0A 2VTJA 1GIJA 1E1XA 3NRMA 1JBPE 4HGEA 2JEDA 3DT1A 2XH5A 5LCKA 4JQ8A 3OT8A 4ANLA 3ZO4A 4TNDA 4CQGA 4L43A 4BJJB 1Q8UA 2V7OA 4QT1A 1IR3A 3H9FA 4MXCA 5C9CA 4EOJA 3COKA 3E8NA 1TVOA 4FTLA 5JN2A 4A4XA 4FL3A 5HE0A 4EBWA 3KVWA 4JJRA 2A27A 4AN9A 5ETCA 3PIZA 2WO6A 4L53A 5M4IA 2UUEA 3MGYA 3PTGA 3IQ7A 5CNOA 3FQSA 1P2AA 2ITPA 4BCMA 4E1ZA 3ZUUA 5IQDA 4IQ6A 4NKSA 5EYDA 5IDNA 3M42A 4JNWA 4RIXA 4GSBA 4QPMA 3NFFB 4UBAA 4O6EA 2J9MA 3DAKA 3MJ2A 4E73A 2B7AA 3QC4A 4G3CA 4WG4A 4F7LA 3SV0A 1M14A 5HBJA 3WBLA 2C6TA 3IW7A 3CE3A 2XKDA 2YA9A 3KCFA 2IO6A 2IWIA 2XM9A 3KRRA 3BEAA 3U4WA 4DGMA 1SNXA 1KOAA 2FYSA 4FIEA 4J71A 1M52A 3R8ZA 2XNEA 3NNVA 1LEZA 2HZ4A 3PA5A 5LJJA 5DNRA 3ZBXA 3E87A 4QRCA 2G2HA 4O2ZA 3OY1A 4U43A 2VTPA 3RZFA 2JBOA 5HG9A 2IG7A 2OZAB 3F3WA 4M13A 3VBYA 3I0OA 5BUEA 1IASA 3BEGA 2B55A 4W9WA 3POOA 5HIBA 4E6QA 1XH8A 5HTBA 3MB6A 2BALA 4GIIA 3LAUA 2XJ0A 3QTRA 1YXTA 3D5WA 4DEHA 1ST0A 3AMAA 1B38A 4O4EA 2VTRA 5HO6A 5C1QB 2PVNA 3HUCA 2ETKA 3V5QA 5EI6A 2XBJA 3EQBA 5CT0A 4FUYA 5CVFA 5L8JA 4WBOA 4JL9A 3QGYA 4CFMA 3DLSA 1BKXA 4MXOA 2R3RA 1PJKA 3TNHA 5AWMA 3W0QA 3GBZA 4X6RA 4AFEA 3TMOA 4ERWA 4RMZA 3G0FA 5CAVA 4GT5A 4W8DA 4AP7A 3JY9A 1PXKA 2QOCA 4KIKB 4QTCA 4XG4A 1KE5A 5CVGA 2NYAA 4KKGA 1QPJA 2IZTA 4QP7A 3WZKA 1ZOGA 4ASZA 1MUOA 4DHZA 3PJCA 5C03A 4EH7A 4MXAA 4EWQA 3RBWA 3GU5A 4FG7A 4BDBA 3Q9YA 1RQQA 4RIYB 3NYNA 3RKBA 3N4UA 3MIAA 4FT0A 4G5JA 2W1EA 4ITJA 4DGGA 4TKSA 2G1TA 1VJYA 4ANNA 3HA6A 3PP1A 1MQBA 5EM6A 4BDAA 4FGBA 1ZYLA 3KA0A 3FL4A 5H8GA 3GCPA 1ZY5A 3OP5A 4Y72A 5DT0A 3G6GA 4BI1A 1J7LA 4IDTA 3QA0A 4MWIA 1P14A 3UDSA 5KZIA 3LPBA 3NR9A 4CYJA 4R1VA 3KVXA 3C0IA 5L6WL 2CNUA 2W96B 3R28A 2QKWB 5KMLA 4LV8A 5E8VA 4ZS0A 5FM2A 1IEPA 4WSYA 4J98A 2ZV7A 2BKKA 3VWAA 3IDBA 3TT0A 4W4WA 3QTUA 2IW6A 3OWPA 5D11A 2R7BA 3MDYA 3NIZA 2PYWA 3RK5A 1JQHA 3W2SA 3WARA 2QOOA 4O96A 1WBTA 3I5ZA 1WAKA 3PPJA 4YC8A 3NNXA 4B4LA 2YAKA 2VNWA 3RZBA 3BYOA 2ZV9A 4ZTNA 4N6ZA 4DDIA 2J90A 3EQRA 4A4LA 4AAAA 4C7TA 4L00A 5E8SA 1FMOE 2QLUA 2J5EA 5AM6A 2FGIA 4R7IA 4RX9A 2E9NA 1LEWA 5AP3A 4LRKA 3HEGA 3PXRA 3W2QA 5L2QA 4YR8A 3C51A 3VAPA 3HMNA 2XALA 4QDVA 4JG7A 3OUKA 4BY9E 2A1AB 3OTUA 4QYEA 4GK3A 4J1RA 5CAQA 4AT3A 5AA9A 3CD3A 3FXXA 1YDRE 4HVDA 4DGNA 2XNMA 3EQCA 4AXCA 2PE1A 3EYGA 3W0SA 4ZTRA 3LHJA 4ZSAA 3BYSA 3TZ7A 4MX9A 4E6DA 3F61A 4K18A 4HGSA 2PU8A 3GFWA 5C26A 4C37A 1W82A 4FTRA 4YBJA 4EHZA 4EWHA 4FTKA 4IVCA 4R77A 3S3IA 2KTYA 4WNOA 3TACA 3FZ1A 2WTIA 4O7YA 3MVHA 3PFQA 3U54A 3F2RA 5IQCA 4WA9A 4GCJA 2RGPA 3F66A 4FV0A 3ZM9A 4Z7GA 2G2IA 2ITYA 3A8WA 4J7BA 4KRCA 2OLCA 5HG8A 3PPZA 4JAJA 2XARA 5EK7A 4EHGA 1H00A 3EIDA 3NWWA 3B8QA 4I4EA 2EU9A 2X39A 4F6UA 3QYWA 1YXXA 3WZUA 1U5RA 4TYHA 3CR0A 4X3FA 3RAIA 2CCHA 3O51A 4JIAA 4QYHA 2ITZA 4IZAA 2WOUA 2YABA 5AM7A 3ZSGA 5IG1A 4DF3A 2OXDA 4AQKA 4ALWA 4FT9A 4JX3A 5A4EA 1S9IA 2VTQA 4WNPA 3HYHA 1M2QA 3NIEA 4EK6A 1H26A 3GB2A 4PDOA 5A6NA 4KWPA 3U6IA 2WMTA 5DPVA 2RKUA 3FHRA 1K9AA 4LDTA 2ZV8A 4RVTA 2X8DA 5BYZA 4EK8A 5M56A 3ORXA 1XH6A 5HBHA 2R64A 5M4UA 2EXCX 4D4YA 1SM2A 5J9LA 3CJFA 4XS2A 1PY5A 5IDPA 3LM5A 2I40A 3LXPA 4G16A 5LCJA 5D7AA 4D4VA 4FEVA 3VQUA 1CKPA 2QO7A 4MWHA 4FI1A 4V0GB 4X21A 1KSWA 4G3EA 1OKWA 3UOKA 4NTSA 4QP9A 4JX7A 4APPA 4BDGA 4TYEA 1J7UA 5HVYA 4OAVB 3QTXA 4CFFA 5K0XA 4JIKA 4Y8DA 4PUZA 4NM5A 4F09A 3E88A 4BCJA 4U79A 3EQIA 4IACA 4G6OA 3G2FA 2B0QA 5KHXA 3DY7A 3AXWA 1FGIA 2OH4A 5KMMA 3FSFA 3RCDA 2IVVA 4GMYA 5LVNA 4CZUA 4DHFA 3FLQA 4S31A 4ACDA 3PA4A 4RFMA 2YAAA 2YM8A 4NUSA 4BBFA 2JC6A 4UX9A 4DFYA 5CYIA 4MBIA 4FZ6A 2VTMA 4FT5A 2UZBA 4CTBA 4DT8A 2O0UA 2O2UA 4EOLA 1GAGA 3JPVA 4E93A 3C7QA 4XG8A 2C6KA 5IEXA 1YI6A 3SLSA 5HU9A 4IVBA 5ICPA 5F4NA 1QPCA 5CWZA 3II5A 3I4BA 4K1BA 4A7CA 5JSMA 4BN1A 1H0WA 3QTZA 1U54B 4XBRA 3QU0A 1PMEA 2HAKA 2OF2A 4KKHA 1CM8A 5AR5A 4RJ7A 1P4FA 5BMSA 2GQGA 3GI3A 4PMSA 1Q61A 4C3RA 4CTCA 3DKCA 3Q32A 3VUKA 5J5TA 1K2PA 3PSBA 3MPMA 3EZRA 3I6UA 3NCZA 4D58A 5E9EA 3HX4A 3MIYA 3IDPA 3O96A 1J3HA 2LAVA 4RJ3A 2A4LA 3ZEPA 4P5QA 3ZO1A 2GS7A 3GQLA 2YFXA 2H8HA 3LFBA 3OF0A 3BELA 3OHTA 2XKCA 2QHNA 3SOAA 3P5JC 3PVGA 3PE2A 2W1HA 3ANQA 3A8XA 4TRLA 4EYJA 2I7QA 3HRCA 5JRQA 5D12A 3AC2A 4HVSA 1FQ1B 3F7WA 2RFSA 4MXYA 2VUWA 4FMQA 4KINA 4IEBA 4HVIA 1FGKA 1XWSA 4XEYA 1YOLA 5HD7A 2PMNX 3QLFA 4DBXA 1WBPA 4C4HA 3Q5IA 5HLNA 5LARA 3BHUA 5CF6A 5JFXA 4RWIA 1T46A 3O17A 1PXMA 2GNHA 3D7TA 1GZNA 4LI5A 4L3LA 4P90A 3KIOC 4E5AX 2QD9A 2VWVA 1HCKA 3Q53A 4E5WA 4NZWB 2UW6A 3R8MA 1YW2A 2EB2A 4X2FA 5CQUA 5L6PA 3L9LA 4M14A 4NTTA 4FKSA 4F7SA 1VYWA 3FMEA 4AW0A 3BKBA 1NVRA 1Q8YA 2PE2A 2Y6MA 4XV1A 3VNTA 2IZSA 5JFSA 5M06A 2PK9A 3QHWA 1AGWA 2WKMA 3GC8A 3F7ZA 4O7SA 3NVMB 2C69A 2F2UA 5AR4A 3TV4A 4FYNA 3RALA 3P86A 3VW8A 2XANA 4MHAA 4AOTA 3UZRA 1OECA 2W1FA 1WZYA 3U87A 4UYAA 1JNKA 3HVCA 3KREA 5JQ8A 3FY0A 3PXZA 1Z57A 4WG5A 1O9UA 5LMKA 2PULA 1LUFA 2HY0A 4FBXA 4CV9A 4MTAA 3BWFA 4D55A 4FE2A 5HCYA 4IANA 4BF2A 1YWRA 5AAEA 4EKLA 4GFOA 4GIHA 4U3YA 2XAOA 3P79A 3RNYA 1W0XC 2QODA 4I23A 2NPQA 2Z7LA 3CTJA 4KRDA 1PRYA 2JAMA 4FSRA 3WILA 2VTOA 3SXSA 4JRNA 3R83A 5DLSA 5ANOA 1YXVA 3ENMA 2WQEA 3SHEA 4I6QA 4QPSA 2RL5A 2RG5A 4BGGA 3QQFA 1UVRA 3BHTA 2XJ2A 2W17A 3LIJA 1UNGA 5IA5A 4LMUA 4XP2A 5J95A 2VO7A 4ZZNA 3TUCA 4GW8A 4ZXTA 1YWNA 2JDRA 4QTBA 4DLJA 5DT4A 1XQZA 1H8FA 2QKRA 3VS0A 1ZYDA 3UG2A 5HZNA 3LFSA 3AG9A 4L44A 4MF0A 4HGTA 3VBTA 3MSSA 1FVVA 4AS0A 2WMWA 5HTIA 4NJDA 5HCZA 4CCBA 4EH2A 4TXCA 3QX4A 2W1DA 4KSQA 2VWUA 4MD9E 3LFCA 4AACA 4K0YA 1Y8YA 2XYNA 4F9AA 3UODA 5CANA 3NDMA 4CG8A 3B2TA 3R7VA 3TIYA 2ZAZA 4YLJA 1FVTA 2C6OA 2W5HA 3ROCA 2CLXA 4IIRA 4ITIA 2EB3A 2XNOA 1OKYA 4ZLOA 3U6JA 2R4BA 4BDIA 3D9VA 3NS9A 4BR3A 1JAMA 2PL0A 3F2AA 3W8QA 2XRUA 3ZH8A 4ASXA 4DN5A 4MNFA 3BWJA 1L3RE 3GOKA 5CZIA 3W2OA 4FVRA 3DGKA 5AV0A 5ANDA 4E3CA 3IK3A 1XH4A 2ZB1A 3QD3A 4KD1A 5HNIX 1GZOA 2EWAA 4FTQA 3OMVA 5AV2A 4IJPA 1PYEA 2YIRA 4RC2A 5LVOA 4MXZA 4MUQA 3D5VA 4FICA 4AA4A 5CLPA 1KOBA 4AOJA 4ENXA 5IISA 4D5HA 1W83A 4EK5A 3QQUA 5I9YA 2AEGA 2PE0A 2XIZA 3AD4A 3Q4CA 3CQEA 3LLTA 4I0TA 3I6WA 3MVJA 4MYGA 3T3UA 3F9NA 5M53A 3A7IA 3BPRA 4YJVA 3NW5A 2OXXA 3T9IA 1J91A 4GT3A 1ZXEA 2PZ5A 3DKFA 4PDSA 4QTDA 1DAWA 2FSOX 5HGIA 4I20A 4D2SA 4JDKA 3IPHA 2Z2WA 3COHA 2R0UA 3ZMMA 4USFA 2ZM4A 5EM8A 3U55A 1UV5A 4H39A 4OGRA 4J99A 5DEWA 4FGRA 3KL8A 1PKGA 3RAWA 2BHEA 5BVWA 3MA6A 3EFWA 3SKCA 4O22A 4BHZA 4ACCA 3UTOA 2WXVA 5I9ZA 2C0OA 4I6FA 4ZIMA 4G6NA 2GHMA 3I79A 4X2KA 4EOSA 5CEOA 5J9YA 2PVLA 5CSWA 4OLIA 4DEGA 5DA3A 2QR7A 3EQHA 1H1WA 5AUZA 1EH4A 3RNIA 3VBQA 3UBDA 5F9EA 1REJA 3CKXA 3D83A 4AFJA 4N0SA 4GYGA 3G0EA 2VTTA 2C5VA 3H9RA 5CEMA 4U80A 3WF7A 1UWHA 4FOCA 5IUGA 2B1PA 2QOIA 2V62A 4QMZA 3F5XA 2QO2A 2R3OA 3HMIA 4O7RA 3DFCB 2GNLA 4FK6A 2P2IA 4B9DA 2X0PA 2CKEA 4JVGA 1X8BA 3EQFA 3VUHA 3NAYA 2F49A 2IN6A 2ITWA 4IADA 2BHHA 3VW6A 2XB7A 4QTEA 4GEOA 2XIYA 4IAFA 5BMMA 3KXNA 2PVYA 4UMTA 4IFCA 3E63A 3RWPA 2ONLA 2VGPA 4QMWA 1OB3A 2BPMA 3QWKA 2OO8X 5AJQA 2GHGA 2B9HA 3UIBA 3R9RA 2JLDA 1UNLA 1SVGA 3HZTA 4EJNA 4F64A 5IMXA 5HNBA 2JBPA 3IGGA 3S0OA 3E93A 5I0BA 5IKWA 3EKNA 4ZMEA 1ZWSA 4K77A 1GIHA 3G90X 4OUCA 3LXKA 4E4LA 4D28A 4EHEA 4M84A 4YJTA 4ZK5A 1M17A 4HOKA 3QQHA 2VTNA 4Q5HA 3TTJA 3ZO3A 3EN5A 3QKKA 3TNPC 4RX5A 3V5WA 3TG1A 3C5UA 5B0XA 3QQLA 3L9MA 3TZMA 4YJNA 3DA6A 4U42A 4L67A 3BV3A 4FTAA 2GFCA 1NVQA 2QVSE 3AMYA 2BMCA 3BU5A 3AT4A 1V0BA 3MA3A 4G31A 4CRLA 5LVPA 4F0FA 3Q96A 4FV4A 5JGDA 5CAUA 4ZSJA 3MH1A 2YEXA 3MH2A 3E5AA 3BYMA 3E64A 1JKLA 5HNGA 2XF0A 4NM3A 4XG2A 4ZP5A 2VWXA 4CZYB 4MD7E 2FH9A 3FE3A 2WPAA 3OOMA 4O6LA 2OICA 3FC1X 2V55A 3ID6C 4YNEA 5EM7A 3IECA 3DDQA 2OJ9A 4GU9A 5L3AA 3E3PA 2EXMA 4ZJJA 1CTPE 2XK4A 4RJ4A 4C2VA 2X6DA 3KY2A 4ZZMA 3SVVA 3VS3A 4XV2A 2ITQA 5HX6A 3PFYA 2HENA 1H1QA 2W9FB 2P3GX 3PY0A 4QNYA 5E4HA 4C58A 3IS5A 4IM3A 3UO5A 3PXQA 3A7HA 5K0KA 4F0GA 2XVDA 1F5QA 2R3GA 4QMTA 5FXSA 2YITA 4WRSA 2UZWE 3TKUA 4LGGA 4CEGA 5A46A 5FUTA 1JSTA 5CF4A 4IX5A 1Q5KA 2R3NA 1R1WA 3KU2A 4FV1A 1KE8A 4QTAA 5G6VA 4ZY5A 3PUFC 4EC8A 2C6IA 2R3HA 4BI0A 5EI8A 5M51A 3A7FA 2YHVA 4QMVA 4KS8A 3F5UA 3VHKA 4DLIA 2O63A 4ACMA 3FEGA 4YMJA 3ERKA 4GG7A 3DXPA 3RINA 2QC6A 4ONAA 4O7LA 2B9FA 3HRFA 4TWCA 3RMFA 4LOPA 3K5UA 3D7ZA 1H08A 3PPKA 4FKQA 3NW6A 4B6LA 4D2VA 2C47A 3PRIA 4IX3A 2QHMA 2GFSA 3IGOA 4O4DA 3FLWA 1TQIA 4HYIA 2QNJA 5AR8A 3MBLA 2F2CB 1CKJA 3KEXA 4M15A 2VWWA 3UNZA 4JMQA 2R3QA 2Y4IB 3ANRA 3LXLA 2QO9A 2Z7RA 1FPUA 3KK8A 3ZCLA 2WU6A 3GGFA 2QOQA 2YN8A 2VD5A 1PXPA 3W0RA 4CQEA 3LE6A 4DFUA 4DGOA 2JDOA 2RSVA 3LCSA 3SG9A 4RC4A 5J87A 5DH3A 4YSJA 1YRPA 4A4OA 2GHLA 2LGCA 3BE9A 3PP0A 3K3IA 2Y6OA 4M97A 5KE0A 2VWZA 3LOKA 3NGAA 2V5QA 4C4JA 5J1WA 3E7OA 3HLLA 4FYOA 4GS6A 5BX0A 3W55A 2JIUA 4DTAA 3DXNA 4XJ0A 3TL8A 4NM0A 3IKAA 5DG5A 2UW0A 1VEBA 3QF9A 5IQFA 1WMKA 2UW7A 3R01A 4NK9A 4LV5A 4TYIA 4LM5A 3R04A 4CYIA 4O86A 1TQPA 4ANMA 3MY0A 1G8AA 1YOJA 3TXOA 1JWHA 3PE1A 4M68A 1BMKA 3A4PA 2ERKA 2PTKA 1GIIA 2X7GA 4DEDA 3QCSA 4AXDA 3R1SA 1XH9A 2WTDA 3UE4A 3LFQA 3O2MA 2C5YA 4FTMA 2YCRA 3MWUA 4BCNA 4NCTC 2C5OA 4GUEA 5JMSA 4BCOA 3G9LX 2JIVA 5HX8A 4JRVA 1H1SA 1Q8ZA 3BU3A 2OFUA 2CSNA 4GFGA 4ENYA 3NUAA 3A4OX 1ND4A 3ENHA 2X8IA 3NUSA 4R5SA 4P5ZA 3CLYA 3QWJA 2Z60A 4HCVA 3LFAA 5FTOA 3WZJA 3I7BA 4FEWA 4QOXA 5AUYA 3OROA 1SZMA 4HCTA 3PJ2A 4RZWA 1ZYCA 4IB3A 1Q62A 3SXRA 4BVUA 4E4NA 4MBLA 4EOIA 4AW2A 3DAEA 1CDKA 3MYGA 2NNWB 4A9YA 3KXZA 4BWXA 4DH5A 3Q9ZA 3PLSA 1STCE 5C8NA 5EYMA 5DR9A 3QXOA 3QZHA 4BYIA 3CTQA 5HTCA 3OW3A 4KUJA 2PMIA 4RZVA 3UPXA 4JG6A 5HQ0A 1OPJA 3RPRA 4RVLA 2H34A 3KQ7A 3TYKA 4R7HA 3UIXA 3QYZA 1OPLA 2PZPA 5EKNA 4ANOA 5K4JA 4RQVA 4ZLYA 3DZOA 3BLQA 5FD2A 2QOHA 2OSCA 4R3PA 2IZRA 3PVWA 5AP4A 2E9UA 3OWKA 3ORIA 4YLLA 1A9UA 3KXGA 1OITA 1WBNA 2HK5A 3FLSA 3MH0A 2BCJA 4J96A 3QXPA 4E20A 1ZMWA 4HGLA 5EQEA 5BVOA 4LOOA 2E2BA 2HXQA 3W8LA 4IAKA 5KMOA 4BI2A 2XMYA 1H28A 5AR2A 3T8OA 4BGHA 4G9RA 5ANJA 4YTFA 5HG5A 3V51A 4EJ7A 4DFXE 4GH2A 5HVKA 3U9CA 3BIZA 2XK3A 2VTAA 1F3MC 1URCA 4K9YA 2C0TA 2C4GA 2PVHA 2R3PA 5M08A 3ULIA 2UVZA 4WT6A 5HE2A 5J1VA 2BKZA 4NT4A 3D94A 1XO2B 5LWMA 3EKKA 4FIFA 3Q6WA 4CSVA 3CXWA 5CQWA 3F5PA 5CT7A 5EOLA 4F9YA 4WHZA 3A60A 2PMLX 3C4CA 4GFMA 2WMBA 2FSMX 2BILB 3E62A 3MESA 1W7HA 3Q4UA 2GMXA 3P23A 3RCJA 3BLAA 4GT4A 4JDIA 4R78A 1UA2A 3NSZA 4LGHA 3OXIA 2C6DA 3K2LA 4Y46A 4YGAA 4U6RA 5EW9A 5JK3A 1GOLA 4JDHA 4EI4A 2CKPA 3FMLA 4QMPA 3BYVA 4WUNA 4IX4A 2BAKA 4OTRA 4QMSA 4G17A 2ZMCA 4FL2A 3ITZA 3COIA 4BBEA 3HAMA 3QRJA 2X9EA 4YJUA 3TNIA 4V05A 4BHNA 4FX3A 4F9WA 3R71A 4FKWA 3PY1A 3ZONA 3I60A 1JSUA 3TNWA 4UMUA 3QAME 2REIA 4OTWA 2WQBA 4WRGA 4ANQA 4U9AA 3EN6A 3PY3A 5LMKC 4R6VA 4AW1A 3CEKA 4E5BA 4XRLA 4JBOA 3ZUTA 3VHEA 1OIYA 3G6HA 2VN9A 2P4IA 2C68A 3QALE 3ZUVA 3TM0A 4AF3A 1WVXA 5TE0A 4I94A 3LXNA 3DAJA 4N57A 4AQCA 1GZ8A 4FA2A 4ZTQA 2IPXA 4YC6A 3L8SA 4V04A 4RJ5A 1GJOA 3RK7A 3D7TB 2OKRA 4TPTA 5BNJA 3LCTA 1FBNA 1BLXA 2BDJA 4FKPA 3SD0A 1XBAA 4FIHA 3V5LA 4RFYA 5KKRB 3DB6A 3DTWA 2VV9A 3M2WA 4RA4A 3ZRKA 2YCQA 2J0JA 4EKKA 3NUPA 4N4SA 3NUUA 4CD0A 1MRUA 2WTVA 4J53A 4ZTSA 4U5JA 3ROYA 3FC2A 3IW4A 2DWBA 3FDNA 4DITA 3LQ8A 3JYAA 3W10A 2HIWA 3KF7A 3IDCA 2YLFA 3FMJA 4PDYA 4KB8A 1CKIA 4I5HA 1W2CA 1OL7A 3PJ1A 5CU6A 5AMNA 2IVUA 5GJDA 3FI2A 3WZEA 2XP2A 3FYKX 4USEA 4J8MA 5IEVA 3O8UA 3TI1A 4MVFA 2JDSA 5FDPA 3FLNC 5A3XA 2EUFB 3PZEA 2WEVA 2Y9QA 2HY81 4IDVA 3FWQA 3ZXZA 3C4WA 4FKGA 4C2WA 4EH9A 4N6YA 1JKKA 1GY3A 4L3PA 1QPDA 4TWPA 4CG9A 2F7EE 2IVTA 3RVGA 4IAIA 1NT2A 4AXAA 5DR2A 1IG1A 2FA2A 4FNYA 4FV5A 4UWCA 3DJ6A 5AV4A 3DZQA 4X2NA 4M67A 4Z55A 4JI9A 2F7ZE 5IF1A 4OAUC 3DNDA 3DK7A 5DWRA 1OIRA 2F7XE 2J6MA 1ZMVA 4KIKA 3UC4A 3VUIA 5D1JA 4BCHA 2CGVA 4EBVA 4ZMFA 4XG7A 3NAXA 5CS6A 5IA2A 3PXKA 4GRBA 5H9BA 2AC3A 2A2AA 4YTHA 2PUPA 1BUHA 5L8LA 4GJ2A 3N4TA 3BV2A 4BIEA 4NJ3A 2W4JA 2JITA 3AT3A 3BHYA 3GNIB 3H9OA 4FC0A 3KN6A 3A2CA 1W2DA 4QD6A 3DS6A 3A61A 3UOHA 2ETMA 1G3NA 1Q8TA 1ZZ2A 4HPUE 2X0GA 4WO5A 1ZYJA 3PWYA 3G15A 2HW7A 2W7XA 3R00A 3V8TA 3H30A 4DH8A 4GVAA 4YZBA 3TDVA 4O4BB 3BCEA 4UWYA 4WBBB 3VJOA 3ZBFA 4F63A 3LFDA 4PL4A 3PJ8A 4LOQA 3ZLSA 3PDTA 2O64A 4D1SA 4FEUA 4WUAA 5BVEA