2WQOA

Structure of nek2 bound to the aminopyridine cct241950
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
277
structure length
242
Chain Sequence
SRAEDYEVLYTIGTGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRLKPANVFLDGKQNVKLGDGTPYYMSPEQMNRNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title An Autoinhibitory Tyrosine Motif in the Cell-Cycle- Regulated Nek7 Kinase is Released Through Binding of Nek9.
pubmed doi rcsb
molecule tags Transferase
total genus 75
structure length 242
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wqoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wqoA01
3VS7A 4EWQA 5ANJA 1S9IA 4GSBA 2OSCA 5KX8A 2V5QA 4BIBA 3OHTA 4JG7A 2ITPA 5DE2A 5KO1A 3NAYA 2C0TA 4OTWA 4L45A 2HENA 4JX7A 1T45A 4L00A 4O1PA 3FAAA 2R5TA 5CEKA 3EN5A 3IK3A 5HNIX 1OVEA 3QD2B 4KSQA 3EYHA 3ZU7A 3DS6A 1OKZA 4TWCA 5BNJA 2JDSA 5IA0A 4I3ZA 3MDYA 4EKLA 3TDWA 2ITVA 4G3GA 2UZUE 2EXEA 2VN9A 3OXIA 4G2FA 4J98A 4JQ8A 5DI1A 4IW0A 5AWMA 3TNHA 4X3FA 3R04A 4D5HA 4GYGA 2V55A 2XBAA 4PTGA 5M09A 3DB6A 5LOHA 3B8RA 5CAUA 3BLHA 3R73A 4ASXA 2V62A 4M97A 3D2IA 4H58A 4GIHA 4PQNA 4A4LA 3VW8A 2B9FA 2O2UA 2YAAA 3V04A 3FJQE 2HZ0A 2IVVA 5AX3A 5DRBA 4G9RA 3ZH8A 3KK9A 4FTQA 5EW8A 4ZTRA 4GKIA 3P7CA 4BDEA 1M14A 1XQZA 3QCQA 4C36A 2I40A 2WMQA 2PZIA 2W96B 4S2ZA 4RC4A 2C1AA 2XA4A 5BVKA 3TNPC 4Z16A 4FSYA 3OY1A 2UW7A 3PVWA 2VTLA 4JDIA 2O8YA 4FT3A 1XHAA 2AC3A 4C57A 4K1BA 4MKCA 4TN6A 5FQDC 3BU3A 4D4RA 4FV2A 2QO7A 2ZV9A 2IZRA 4DLJA 5G6VA 2RF9A 3O7LB 3QTIA 4QOXA 4YLKA 4DEHA 5BVFA 4YP8A 3FKOA 3L8VA 4UN0C 4M3QA 4M67A 3Q3BA 5BYLA 3F6XA 3QRUA 4MWIA 3QYWA 3U51A 3DKOA 4P90A 4IM0A 4FT5A 3QTRA 3RP9A 3RWPA 4ZP5A 4XNEA 5EQEA 3MW1A 4OBOA 2EXMA 2WIHA 3F66A 3DLZA 4JBVA 4ANNA 4LMUA 4MBJA 4OTRA 3EN6A 2R2PA 5KMLA 4LRJA 3ZHPC 2XIXA 3ORLA 4ERWA 2VTJA 4CV8A 3FUPA 4FNXA 3OBGA 4YJRA 4XMOA 3LMIA 1IR3A 4RIYB 3NYNA 4IM2A 4JOAA 4WG5A 5DEWA 3VS2A 3DOGA 3OVVA 1U46A 2YDJA 4D2VA 3LE6A 1A9UA 1YRPA 5C9CA 5JK3A 2UZTA 2IZSA 4EYJA 2WKMA 4C4IA 3PXQA 3WZJA 3PLAE 4OTGA 1OL2A 3GU4A 3PJ2A 4IXPA 4EEVA 4EWHA 5AP6A 2ITNA 4H36A 2PZPA 4LI5A 3DBQA 4XLVA 4V01A 2W7XA 3BYMA 3MH1A 2OH0E 4TYEA 5HESA 3QFVA 4DHFA 1PKDA 1YI3A 1UKHA 5LJJA 3UYTA 3COKA 2PE1A 3DXQA 5BVOA 4LGHA 1NVSA 4IDVA 3NLBA 4EQCA 4I6HA 1U54B 3CD8A 3R8PA 2RG6A 4DH8A 1MRVA 3U9CA 2WMBA 2IVSA 1OL5A 3UG1A 4YNEA 3COMA 1UKIA 3DAEA 3E63A 4FKPA 4Y46A 4FI1A 4FSTA 4L7FA 1PXNA 3CQEA 2C68A 2XJ1A 5JN2A 5TOZA 3K5VA 4ZEGA 3ZRLA 4MXZA 4IDTA 5HI2A 4J52A 3W2OA 3TV6A 4UMPA 1PRYA 3MIAA 4F6SA 3EZRA 4F70A 4FA2A 4ZZOA 4FGBA 4EK4A 2ZDUA 4PUZA 4FICA 3K3JA 4FG7A 4FKTA 4J7BA 4R5YA 4RA4A 2Z7LA 1X8BA 2QU6A 5E8XA 2QKRA 5AUXA 4F64A 2AYPA 4NCTC 4DG0E 1ZZLA 4BCIA 4E1ZA 4N4SA 3N4UA 4IB1A 4KRDA 5K4IA 3PVBA 4QQ5A 2C3IB 2XNOA 2W1ZA 5AR8A 1JKKA 3FSKA 4DINA 3ODZX 5FWKK 3LCKA 1J7LA 2VTOA 1ZY5A 2QO9A 2QVSE 4PRJA 3UNZA 3KFAA 4EOOA 5CU6A 1BX6A 1J7UA 4ANLA 3UIUA 2CNQA 2CGUA 3NR9A 4ZLYA 3FQHA 3EHAA 4M13A 5AIRA 2DQ7X 4EBVA 4O22A 5IMEA 2V0DA 3FI4A 4FKSA 3FHIA 2JC6A 3RM6A 4JAJA 5HU9A 5C8NA 1ZOHA 3MN3A 3FZPA 2QONA 4IZ7A 3VW6A 2V7AA 4DGGA 2W1EA 3OCTA 4EBWA 5CAVA 5LVMA 4ZOGA 4CG9A 4S32A 2VO7A 3MWUA 3VUTA 5HCXA 4EH7A 2BKKA 3EN4A 5HLPA 5KKRB 3PVGA 4CGAA 3AG9A 4U40A 3F69A 4I6FA 4BDIA 3VRYA 3GXLA 2BALA 2OF4A 3G9LX 2QOCA 3FKLA 5JMSA 3CEKA 2CPKE 2XS0A 2PVYA 1REKA 4EORA 4WRSA 4IX5A 4NKSA 3LCTA 4GJ2A 4U80A 3F61A 4BCNA 5DT4A 4KS8A 2EVAA 3NYVA 4NL0A 3U9NA 1RE8A 4FKWA 3FLNC 2WTVA 3FL4A 3IOPA 4CXAA 2C6OA 4QMZA 4O21A 2YERA 2H96A 3C13A 3HA6A 4E6DA 2WPAA 3LOKA 3PWDA 4GMYA 4WO5A 4WOVA 4C34A 3C1XA 4F9YA 1UU9A 1B38A 1IA8A 5ETFA 4D2RA 4RX9A 4LUEA 4Q5HA 5A14A 4WSYA 1BI8A 3R9OA 3ZTXA 2EWAA 2ZYBA 2VWIA 4FOBA 3CY2A 3UO5A 3LQ3A 4EZ3A 3CKXA 3AC4A 5HTCA 3QRIA 4FTAA 2GS7A 3JVSA 4RX7A 5B0XA 4FTIA 4I0SA 3ORTA 4YJUA 4O0UA 1PY5A 2J9MA 4MBLA 4CCBA 4USFA 2YZLA 4CQEA 4CKIA 3G33A 5G1XA 3ZSGA 2WMSA 5HCYA 1KV1A 2P3GX 2W0JA 3AD4A 3ENMA 2GFCA 3FYKX 3DKCA 3FI3A 3Q6WA 4KIPA 4YZCA 2GS6A 4FUYA 3QRJA 5AX9A 3V5LA 4D1ZA 4AN9A 5J1VA 3R7OA 2VGOA 1R78A 3SRVB 3PIXA 4U44A 5FXSA 4NH1A 1CKJA 2XK7A 3DK3A 4C0TA 3GOPA 2JBOA 4F9AA 4DH7A 5B2MA 1PYXA 3NUUA 4G17A 5L6WL 4BC6A 4M66A 1ZYDA 2W4KA 3ZZEA 2GFSA 5EFQA 1Q8ZA 3GCUA 1OL6A 2B52A 3L9MA 4GU6A 4OBPA 3TZ9A 4EI4A 5KKRC 3RNYA 4EC9A 1ZYSA 4Q5EA 5DT0A 4NK9A 4B9DA 3UZPA 1ATPE 1IG1A 3OUKA 4C61A 4WA9A 3RZBA 3R22A 4LV5A 4BF2A 5L2WA 3CSVA 4UY9A 3DBCA 3OCBA 2X2KA 2W5BA 3ZM9A 4G6LA 3BHUA 3EN9A 2GQSA 5EM7A 4HZRA 4YZ9A 3R8ZA 4FEUA 4XV2A 2Y4IB 3PG3A 4E4XA 4II5A 4KB8A 5CU4A 3RJCA 3PIYA 4F08A 4WBBB 4QMUA 4X2NA 1S9JA 3JVRA 3SXRA 4ZMFA 2C6DA 5CYIA 4EH4A 1OPLA 3OWJA 3E3BX 3MSSA 4U79A 1WVYA 2UVXA 4EOJA 3P78A 3ZFXA 4FEXA 5FUTA 2H34A 3V6RA 1PW2A 2WMVA 2YLFA 2Z02A 4AG8A 2UV2A 4EK5A 3Q4ZA 5GJDA 3ZO3A 2H8HA 3O0GA 2XNNA 3UOKA 5IH4A 4XCUA 5DVRA 3CGOA 4C4JA 3FLWA 3LAUA 4AACA 4CZYB 2F7ZE 2ITXA 4A9YA 1QMZA 1LEWA 2YM4A 4FSWA 4YJOA 3TKHA 4WRGA 3C0IA 1BKXA 4UZDA 3NCZA 2R3JA 1DAWA 2SRCA 3PA5A 1R39A 3FPMA 2W1CA 3A62A 4JAIA 3ID6C 3QUDA 1JSTA 4I5CA 4YC3A 3POZA 4O7SA 4YZMA 3DDQA 3I6UA 1L8TA 4CFNA 5AA9A 4YTHA 2F9GA 3QCYA 4NIFB 4NUSA 5CT0A 3LIJA 1URCA 5EYMA 5E8TA 3VJNA 5J9ZA 4FIIA 3I0OA 2XZSA 3LXNA 3ZMMA 4EH3A 1VYZA 3NNUA 5E8UA 4GT4A 2QNJA 4EHGA 5K4JA 3R63A 3UP7A 3UIXA 3KN6A 4B7TA 2PU8A 4UWYA 1DS5A 3RHXA 2IW9A 3VBYA 1IA9A 3LCOA 4K11A 3RAWA 4WSQA 4I1ZA 3GQLA 4IC7A 4AZSA 2Y4IC 3LM5A 2PMNX 2J0MB 3G5DA 3Q5ZA 3ZBXA 1OBGA 5AR7A 4O0XA 5LWMA 3R30A 3NDMA 2JAVA 2UW3A 3SQQA 1A06A 1UU8A 3F82A 1PMUA 3L8XA 4FKLA 3OD6X 4XH6A 4GW8A 4PMSA 5L4QA 4F0FA 1YW2A 2B55A 2F4JA 4G6OA 4O38A 5KHXA 3KY2A 4NM3A 3IONA 4A9TA 4QPAA 4M69B 4M8TA 4YHTA 5M57A 1WAKA 3WOWA 4DE4A 4XS2A 4Z55A 4IFGA 5L2TA 3D5XA 1XH4A 4WT6A 4L68A 5ETIA 4GT5A 4V0GB 4Z3VA 1A48A 5IA2A 4A7CA 3KB7A 3OBJA 1ZMVA 4KIQA 2ZV2A 4L46A 4R78A 4CRSA 4CYIA 3MY5A 4IWQA 1XBAA 2Z8CA 3TUDA 3FZ1A 4YO6A 1Q8TA 3EKNA 1Q4LA 3OY3A 2FH9A 3PXKA 3QQJA 4ANMA 5BVNA 5A4EA 4EKKA 4U41A 5I9WA 3NMUF 4O91A 4KNBA 3F3UA 1NXKA 1XH6A 5E1SA 4FX3A 3ACJA 4O0TA 4LYNA 4BHNA 2J90A 2I1MA 3IQ7A 3MH2A 2W17A 3R28A 2YCSA 2XK4A 4O7VA 4EQMA 1ZARA 2VX0A 1U5RA 3W16A 4G16A 3UP2A 3BBWA 4XUFA 4AXAA 5HG7A 2UZBA 4L6QA 1SNUA 3CY3A 3JY0A 3A2CA 3ZXZA 2HZNA 1W98A 3D5VA 3GC7A 2VTNA 2VWYA 2X8DA 4K8AA 1WBNA 3SW7A 5CXZA 5C8KA 1YVJA 4I0TA 2HWPA 2UW9A 3DY7A 3W8QA 3PY1A 2VTAA 4LM5A 1WBPA 1E9HA 3BLQA 3FKNA 4CZUA 3RK7A 3TKIA 3S4QA 3R83A 1L3RE 3PYYA 2VWWA 3PXYA 4KBCA 4JDHA 2NNWB 5JKGA 3FXWA 3TWJA 4QRCA 5I0BA 5HG9A 4QP9A 4KIKA 2PE0A 4UEUA 5BQ0A 3DPKA 3RM7A 3HKOA 3G15A 2GSFA 2WU6A 3O51A 1WMKA 4L53A 5ETCA 4XX9A 3PY3A 4ZS0A 4C02A 2OLCA 1SVHA 1B39A 4CFVA 3ZLSA 1WBWA 1H1SA 2ITUA 3MB7A 3OS3A 3DBEA 4RFZA 5CSWA 3FI2A 4QYYA 4RX5A 1H1QA 2A4LA 3MFRA 5HTBA 3ZEPA 3F5XA 3JS2A 5HNBA 2OJIA 3KXZA 4FKJA 5KE0A 4AZEA 3Q60A 3KL8A 3QBNA 2OJ9A 3AC1A 3ZO4A 4A9UA 2PVJA 3A4PA 3QZIA 5ITAA 5LVPA 2Q83A 5L8JA 3NSZA 4NU1A 5DR6A 1F3MC 2R64A 2BDJA 4HVGA 4FT9A 3N4TA 5D12A 1O6LA 4C7TA 3D14A 4LGDA 5CVGA 5FXQA 2R3IA 4XOYA 3QWJA 3O96A 3ANQA 4UXLA 5F1ZA 4GCJA 4O86A 2YJSA 3UO4A 2RFEA 3TG1A 3ZLXA 3UOHA 1XH8A 2GS2A 1YXSA 2IJMA 5LARA 4YBJA 4JR7A 3CTJA 1SVGA 3MFUA 1JOWB 3VBQA 5IPJA 5E8WA 5EDPA 3FMMA 4U9AA 5H9BA 2XKEA 2XCKA 3BRBA 4UBAA 4AP7A 1J3HA 5CF5A 2HAKA 4DFLA 5IA3A 2QHNA 3OCGA 1M7NA 2C30A 4MQ1A 5I3OA 2JKKA 2PUNA 4PDYA 2HXQA 5AV0A 4BKJA 3ZFMA 3GB2A 3MIYA 4DCEA 5HZNA 4LOPA 3R1SA 1STCE 1WVXA 2XEYA 2QLQA 2BDWA 4ZTNA 3CQUA 1OGUA 4N0SA 3UG2A 3Q9XA 4L8MA 1ZLTA 3IECA 3WZUA 4USEA 5HBEA 4IQ6A 4QNAA 1YI6A 3F3WA 3MPAA 4YHFA 3VBTA 4AA5A 2C3LA 2F2CB 3P4KA 3NIZA 4LUDA 5GZ9A 3REPA 4YLLA 4K33A 4QTCA 2QD9A 4KKGA 5F94A 1ZOGA 5A4LA 4QMVA 3BEAA 3SVVA 4IVCA 4ZS4A 2F7XE 4MCVA 1PXMA 4IBMA 1ZYCA 4X2KA 3LXKA 3OEFX 3KVXA 3UYSA 4DH3A 4F7SA 5HKMA 4YU2A 3QL8A 4ZSAA 2Z60A 3CJGA 5K0XA 4AW0A 5J79A 1IAHA 4BKZA 4L3PA 1PMVA 4BCQA 4ACGA 4FSQA 2I7QA 4FKVA 2G2IA 3SG8A 2J7TA 3G90X 2YDKA 4PMTA 4YUQA 1FVRA 2WTCA 3BGPA 3CQWA 4JX3A 3UC3A 5AP0A 2ZOQA 4AZTA 3F7ZA 3WZEA 1YHSA 4FSMA 3HLLA 2JDVA 1PXLA 2QKWB 2J5EA 4JR3A 5DOSA 4RJ4A 2W1DA 4QT1A 4AW2A 4JRNA 1TKIA 4XP2A 3NNWA 3R01A 4RGJA 5K5XA 3R7GA 4FT0A 4M15A 2GTMA 5AUWA 4KUJA 1WBVA 3MY0A 3RALA 5HORA 1OUYA 3KA0A 3U4WA 3B2TA 4X6RA 2XNGA 3BBTB 4XYFA 4QYFA 4XRJA 3FXZA 4WIHA 3SAYA 4BWKA 5FTOA 1JKLA 3GEQA 1UV5A 3DJ6A 1W84A 4M7IA 3OWPA 1UNLA 1YDRE 2CN5A 2O64A 3F2RA 2UZLA 5F95A 3RPSA 2JIIA 4XRLA 3V5PA 4YMJA 5HX6A 2VNWA 5DBXA 4PMPA 2UW4A 4MYGA 3CGFA 5JRQA 4GKHA 4CG8A 3DZOA 3R00A 4DT9A 4M14A 4RC2A 3Q4UA 4CCUA 4DFBA 4GS6A 4B8LA 4ACCA 1KOAA 3R8VA 5LWNA 2QLUA 4FV4A 4DH5A 3VULA 2WQOA 3ALNA 4X6QC 5BYZA 2W4OA 4FE2A 2VTIA 4JG8A 1G3NA 2EUFB 4JIKA 5M56A 3KMUA 1P5EA 4L01A 4U6RA 2BZIB 2F7EE 2JAMA 3DJ7A 3FL5A 1Q5KA 3U54A 4O6LA 5K5NA 4CV9A 4MXCA 3K5UA 3FMHA 3NZ0A 4HPUE 4FKQA 4XOZA 2YFXA 2JKMA 1AGWA 4ENYA 2QHMA 4BZDA 2OKRA 1XKKA 2UVYA 4DBNA 2BHEA 2FB8A 2NO3A 1YWVA 2R3HA 4IZ5A 2RSVA 4L9IA 5EHLA 5T68A 3LMHA 3AGLA 1KE7A 4U0IA 5CQUA 2WIPA 4QP6A 1W7HA 2C6TA 1Y8YA 2YM3A 1UVRA 4O81A 4RIWB 1QPCA 4YZNA 1JWHA 4FTMA 4RWKA 5D9HA 1H25A 5C4LA 4G1WA 4AS0A 4DFNA 4OTFA 5JFXA 4FV9A 3GU7A 2PVFA 4I5HA 3GC0A 3PTGA 3ZDUA 5E8SA 3QZHA 4JBQA 4O96A 5D7VA 2J0LA 2XNBA 2VD5A 2XNMA 4IJPA 4YSJA 3AD5A 3EMGA 3LPBA 3W33A 3HYHA 4R77A 4BI1A 1AQ1A 5DHJA 5LMKA 3KXGA 4JQ7A 3NCGA 4O82A 2VTQA 2H9VA 4CMUA 4LG4A 2J6MA 4ZZMA 5AUTA 4PPBA 4ASZA 4O7LA 5DYJA 4ONAA 2X2MA 2BTSA 4FKUA 4IWDA 3KULB 4GJ3A 4U42A 3IO7A 3T3VA 2ONLC 2PVMA 3GU6A 2B54A 4K18A 1KOBA 4QTBA 3RBWA 3LW0A 1Y8GA 4LFIA 1VJYA 4TYHB 2XRWA 4FNWA 4WNKA 3ZRMA 5M07A 3QZFA 1H27A 4XG7A 3EQBA 4ACDA 4E4LA 3EQIA 2Y0AA 2OZAA 4B4LA 4CKJA 2BFYA 4L52A 3SHEA 2BCJA 1OIRA 3QQGA 4KWPA 1H08A 1RDQE 2VZ6A 2WELA 3EB0A 2WMXA 4MAOA 4DN5A 5IDPA 4O0YA 2VWXA 4R3PA 3QA0A 5D7AA 2PSQA 4CMTA 5F9EA 2RGPA 5KMMA 4PL3A 2ACXA 4GUEA 1NW1A 2WMTA 5FTGA 3FV8A 2HWOA 4U45A 3BIZA 3GC9A 4ZJIA 4PNKA 1K2PA 1URWA 3P9JA 4G6NA 2IWIA 4M84A 2ETKA 3Q2MA 4WNPA 3WBLA 2E9PA 4DITA 5E4HA 2JEDA 2YJRA 4K2RA 5ICPA 1IRKA 1WFCA 5M4UA 1OIQA 2HIWA 2NRYA 3KMMA 4BZOA 4L3JA 4C38A 4KSPA 3VS3A 4CT1A 4C2VA 3TN8A 4DAWA 4EK3A 4ZXTA 3I7BA 1VYWA 1PXIA 3G6HA 3PE2A 4R8QA 4AGWA 3ORPA 2XKDA 3ZUUA 1ND4A 4JL9A 4DGLC 3W18A 4ZJVA 2WFYA 5FM2A 2KTYA 1RQQA 3HGKA 4A4XA 3DQWA 4DFYA 5TR6A 3MFSA 3R02A 3QHWA 4MXXA 4G9CA 4EHEA 5HVJA 3H4JA 2R3MA 3MTLA 3FMEA 1HCLA 1JNKA 2OK1A 5LVLA 4EOLA 1ZWSA 2R3LA 3MFTA 5DR2A 1AD5A 3KRWA 2BZKB 3UODA 4QMNA 4ZTMA 4DEEA 3QRTA 3DFCB 1B6CB 2BRBA 3DT1A 3W2RA 4RIOA 3OTUA 2PVNA 2W5HA 4F1OA 5C8MA 5HO6A 3LFCA 4RJ3A 4F09A 2YN8A 4HGLA 3VF8A 2DWBA 3OMVA 2YIXA 4W9XA 4M12A 3R9NA 4G3CA 4IVBA 3IW6A 4XG3A 3PDTA 4A4OA 1KE9A 4UALA 3QTXA 3G2FA 4YJPA 3U4UA 5AFVA 3M1SA 5A9UA 4BL1A 3HAMA 5AV2A 2E9NA 3F2NA 4E5WA 1JKTA 4L3LA 4F4PA 4GEOA 4OR5A 4DTAA 3HV7A 4YTCA 3DTCA 4O7ZA 4FV3A 4JXFA 2R3PA 4Q2AA 3CTHA 3KRRA 4ITHA 3MPMA 2OIQA 3IW4A 2DUVA 2PY3A 4FC0A 4AE6A 4C35A 3LFBA 5BUEA 4R7BA 3BPRA 5E1EA 4F9CA 5JFVA 4CVAA 3G0EA 4RIXA 5EQYA 2PMOX 5GIPE 3FWQA 2WMUA 3ACKA 3VVHA 2XJ0A 3ZONA 4BDBA 3PSBA 4RJ6A 4DGNA 5C4KA 5M4CA 3E88A 4PF4A 4M68A 1CDKA 2CGWA 5CAQA 3ORMA 2R3OA 2YEXA 2VV9A 3P5KA 5IEYA 1OIUA 4TYJA 3R7UA 3LVPA 5CASA 3R9RA 2Y9QA 2VTMA 4PDPA 3NVKI 3BGQA 4IZAA 3RGFA 3PFQA 2YLEA 5KZ0A 4WUAA 3KVWA 4NFMA 1U4DA 2RFNA 2B9JA 3RVGA 2J0KA 5AP7A 1GY3A 1H0WA 1GZ8A 1QL6A 2C3KA 3Q4TA 1P4OA 4QMPA 4CFUA 3ZS5A 3DQXA 4HOKA 2YM7A 2QOFA 5HD7A 4Y72A 4APCA 2P33A 5DMZA 3OF0A 4Z9LA 4JI9A 4FVQA 2X8IA 2I0HA 5JRSA 3LFDA 2KULA 4JS8A 4D1SA 4BGGA 4V05A 3R1QA 3U8WA 3KC3A 3PWYA 4BDDA 3GGFA 4O0VA 4QTAA 4X3FB 5J9YA 4RLLA 1OB3A 3VS1A 1WCCA 3EFJA 1V0PA 4HYUA 5AMNA 5H3QA 5AAFA 2F2UA 4I20A 4AU8A 3LFSA 2XRUA 3I81A 2F49A 3DNEA 2C5YA 4Q9SA 2C47A 3QYZA 4UMUA 4D9TA 2XCHA 3BYUA 2QOOA 4IX6A 4FYOA 2ITYA 3LCDA 5H8GA 1R1WA 5I3RA 4DA5A 2OICA 3OG7A 3LLAA 4AN2A 2QOHA 3DB8A 4CKRA 2BUJA 2UZWE 3LFAA 5HEZA 2EU9A 2QC6A 4FUXA 4Y5QA 4CRLA 3KF7A 4K0YA 2PK9A 3VQUA 2J50A 5IQCA 3AT2A 4IH8A 3P86A 2ERZE 2FSLX 4W4YA 5DGZA 3T3UA 3QTUA 3ZC5A 4NM5A 3H9FA 3E62A 4BVUA 4DGMA 3ANRA 2Q0BA 5HE1A 3GCPA 5CF4A 2O63A 3DKFA 3BV2A 4QMQA 5T6KA 2R7BA 2WNTA 5IQEA 3VQHA 4P5QA 4YBKA 4ASDA 1ZXEA 1CTPE 5E7RA 5BPYA 2RIOA 2R3RA 1EH4A 2VUWA 3SX9A 4FTRA 4IANA 4IWPA 5CENA 4BCMA 4DG3E 4O84A 2GNLA 2Z7QA 2YABA 4DTBA 5IH6A 3TNQB 5HBHA 4GYIA 2BRHA 3RCDA 4FV5A 3V6SA 3II5A 4C4EA 1Y91A 2CSNA 3AD6A 1M17A 3SDJA 4RVTA 2NRUA 3RK9A 3H30A 4C2WA 4DG2E 2BRNA 4RMZA 2WQNA 5BVDA 3Q32A 4XG2A 4X3FC 4O7WA 3IDBA 1GAGA 2ZJWA 4C37A 3A7HA 4UZHA 3SC1A 2XNEA 5J9LA 3KEXA 4ZSJA 1GIJA 4RG0A 2WTKC 4JQEA 4MXYA 4F99A 4FVPA 4XHKB 4U81A 4FYNA 2IG7A 3UOJA 3CLYA 4JJRA 5EW3A 1YXUA 2VNYA 3UJGA 4EH6A 4IMYA 2CMWA 2OXXA 1Z5MA 3BHYA 2W9ZB 3GUBA 4GFOA 2JGZA 2OJJA 4FK3A 1NT2A 3E87A 3FHRA 3QHRA 4D2SA 4E4NA 4ALVA 4F65A 3FZSA 5A3XA 3V3VA 5HIDA 2G2HA 3COHA 3FBVA 3ZC6A 1TQMA 5IUGA 3N4VA 3FMLA 3ENHA 2QU5A 3BU6A 1FPUA 5A4CA 3DDPA 3LLTA 1GOLA 4QP2A 4FL2A 3BHHA 2HZ4A 3LXPA 2GPHA 1LPUA 4FZDB 3TL8A 2A27A 4RX8A 5CAPA 3THBA 5CTPA 4ACMA 4QP1A 2EB2A 4FSZA 3FPQA 3PA4A 3PZEA 3P0MA 3UQCA 5M08A 4NTSA 4D58A 1PHKA 1O9UA 3ZSIA 3NYOA 3R21A 1Y6AA 2ITZA 4R3RA 5EHYA 4IHPA 1ZY4A 3PE1A 3KK8A 3ZCLA 4FV6A 2Z7SA 4A07A 3NVMB 2FYSA 2UZNA 2AC5A 3FQSA 2XK8A 4I93A 1H07A 1Q61A 5I9YA 3AXWA 3BGZA 3NUXA 3OXTA 5CVHA 3JPVA 3LZBA 3UVQA 1FGKA 2CKQA 3MTFA 5JGBA 3ALOA 5CX9A 3FLSA 1YOLA 3ORNA 4OLIA 4NKAA 4U97A 4EZ5A 4ID7A 2CKPA 4FZ6A 1UA2A 1SNXA 2A19B 2ZM1A 4BCJA 3DTWA 4OTQA 4S30A 3CP9A 4TYGA 4TZRA 2JIUA 2BROA 2ETRA 3QXPA 4YURA 3TKUA 5TE0A 4JNWA 5EG3A 4USDA 3D0EA 2HY81 3C0HA 3BE9A 3C4FA 3QD4A 5HE3A 3UBDA 3S1HA 5K9IA 4QO9A 2G15A 3UIMA 2GHGA 3WF7A 1PMNA 2XIYA 2YACA 3IW8A 5J95A 3ERKA 3HV4A 3FY2A 5ANOA 3VS4A 5EK7A 3QUPA 4BICA 3PXZA 5CNOA 4O0WA 2YA9A 4HVIA 1IAJA 5F4NA 5CU0A 1GZKA 1F5QA 2HK5A 1V0OA 4I92A 4OGRA 4AT4A 2YWVA 5GHVA 2ETMA 4N70A 2PHKA 1WBTA 4W9WA 3O17A 5E8VA 2YIYA 2VWVA 4ZIMA 3VHKA 5JEBA 4GVJA 4JLCA 2PE2A 2E2BA 4IZYA 3W2CA 3ZXTA 2CKEA 4MF1A 1G5SA 1I44A 4EOSA 3R8MA 3VUIA 4IM3A 2C0IA 1YHWA 5HE2A 4HNIA 4YC8A 3BYVA 3WF8A 4J97A 4E6QA 5FDPA 5GIOE 2XYUA 1OI9A 4I0RA 4WG4A 3ZFYA 3EWHA 1WBOA 3ZRKA 4GG5A 4FKOA 4F7LA 4ZTHA 4XV1A 3QQKA 4MNFA 5HOAA 1U5QA 4AA4A 2VTHA 1XBCA 4CFXA 3UIBA 5JFWA 4PV0A 3B2WA 3R8LA 2GQGA 4IAKA 3OUNB 3I5NA 5J8IA 4GRBA 5HIBA 3NW7A 4BDAA 1ERKA 4HPTE 3K54A 1FBNA 2HY0A 3W2PA 3VWAA 3PUPA 4BCGA 5CSPA 3QGYA 4ZY5A 4CD0A 1JPAA 2XB7A 1JAMA 3PA3A 4BCOA 4IJ9A 5ACBC 4AT5A 4CSVA 5L6OA 1J7IA 5J87A 3EQGA 4BI0A 2CCIA 2BRGA 2BIKB 3W2SA 1PXOA 2WQBA 3MY1A 4H3QA 3KRJA 4G3EA 4L67A 4I41A 3WF9A 5CNNA 4BTKA 5A4QA 3CBLA 3D94A 4FIHA 3FLYA 4R5SA 1UWHA 1YKRA 2ERKA 3DNDA 3KCKA 3O8PA 4G3DA 4EK6A 4DFUA 3DJ5A 1UU3A 5J7HA 3PJ8A 2BAJA 2QO2A 4NJ3A 2R3GA 5AM6A 5TO8A 4TL0A 4EONA 3I1AA 4D9UA 3FLQA 1Q3WA 5CQWA 4HVDA 3AC2A 4Y73A 4JIAA 4QPSA 3SV0A 3V8WA 3DXNA 5B2LA 4QMOA 5J5TA 5M53A 2QR7A 5ANGA 3P7AA 2B1PA 5FBNC 2HOGA 4FTKA 1Q3DA 2CDZA 3Q4CA 5FLFA 4KKEA 5D41A 3ROCA 2OJGA 4RVKA 5BVEA 1IEPA 2YITA 5JQ5A 1OUKA 4FR4A 4C3FA 3DXPA 3KN5A 2FGIA 4G5PA 5AAEA 4U3YA 3E8EA 5CLPA 3RAKA 5CZIA 1XR1A 3ZBFA 5A6OA 5JSMA 3TJCA 5IQHA 4QYGA 4RFMA 4BDGA 4MNEA 1FVVA 1REJA 2GMXA 5DEYA 4QP4A 3P08A 3KXMA 3VHEA 4NYEA 3TV4A 2VRXA 2VWUA 2YDIA 5BUIA 5GZ8A 1KWPA 2RKUA 3F3VA 1ZYLA 3EOCA 4JDJA 4JBOA 3A7GA 5FM3A 4ZY6A 5IEXA 4XP0A 3EFKA 4DFZE 1DAYA 1U59A 4X0MA 4EQUA 2HZIA 2UVZA 2Y6MA 4IVAA 5EHOA 3U55A 4IAYA 3UMXA 2P4IA 3T9TA 4C62A 4W4XA 5KMIA 1E1XA 3GI3A 3OP5A 4DGOA 2X6DA 2Z2WA 3L8SA 3TCPA 4O7RA 1JSVA 2C5XA 2VO3A 5C03A 5IQIA 4NEUA 5EI8A 1OZ1A 2UW6A 3D4QA 3MA3A 5JFSA 3R1NA 4BRXA 3A7IA 3GVUA 5TKDA 5E9EA 5J1WA 2A0CX 4EOMA 2ZM4A 4ALUA 1YI4A 4A06A 3D7TA 3O8UA 2GTNA 2F57A 4ZJJA 4OT6A 3VUHA 1M2PA 1QPJA 1RW8A 3HA8A 4HJOA 2IZTA 4MD9E 4E20A 2R0UA 2OIDA 3VIDA 4RJ5A 3AMYA 2CCHA 4WHZA 1ZRZA 3KREA 4AE9A 5JH6A 4FOCA 2XM9A 4NW6A 4ACHA 5LCKA 3NAXA 3E8NA 3R1YA 4BWXA 3CPCA 5CI7A 3GBZA 4PWNA 3AC8A 1Q8YA 2C0OA 1DM2A 3BKBA 5L6PA 4TW9A 2XNPA 5AR3A 3R7IA 2X9EA 2C4GA 2FA2A 2WB8A 3D15A 2FUMA 3PG1A 3QLFA 4MD7E 2W1FA 2XUUA 3UZTA 3FLZA 5C26A 1VZOA 5HBJA 2J2IB 5IQDA 3F88A 2OI4X 3U87A 1APME 3CS9A 3PRFA 1J91A 4RVMA 4C4GA 1Q8WA 4IX3A 3C4XA 4FIGA 1YHVA 4S34A 3JR1A 3L1SA 2YHVA 4APPA 1YQJA 3R71A 4BBEA 2WEIA 4AF3A 1GIHA 4KABA 4TWPA 2ZVAA 2QOQA 3PRIA 1PXPA 3EZVA 3NUAA 3FYJX 5H2UA 3QTZA 5AUVA 1YWNA 5C1QB 3OTVA 4IEBA 1T46A 2QOIA 5GNKA 2IW8A 3VC4A 4AX8A 4CLIA 3DZQA 4EH5A 3EQRA 4D2PA 4UMRA 2OF2A 3C7QA 3GNIB 2GHLA 4HGEA 4PX6A 5IDNA 2X0GA 4BN1A 3KGAA 5IKWA 5IUIA 4OW8A 3D5WA 1YDSE 5C27A 3SXFA 3ZEWA 4MEDA 4UWBA 3R0TA 3MESA 2W1GA 3BLRA 4YTFA 3R7VA 3RK5A 2I0EA 4L42A 4Y83A 2C6EA 3FC2A 4IB3A 2PUUA 4FV0A 4MX9A 3WYXA 3QCSA 3KMWA 2FO0A 2RL5A 1P2AA 4KIKB 3ULIA 4M0YA 4QTEA 4RWLA 3R7EA 5HCZA 3OT3A 4FZAB 2VTPA 3RMFA 4AA0A 3CTQA 4FG8A 1BI7A 4BCFA 2YCFA 5BUJA 3TJDA 2BAQA 3IW5A 3DBDA 4IC8A 4XBUA 3C9WA 2CNUA 3R2YA 2XH5A 3ORXA 4F9BA 4DEDA 3P1AA 4CLJA 4BR3A 4HGTA 4EH2A 2J51A 4W8DA 5M4FA 2RFDA 4HYHA 4TWNA 2JLDA 5IEVA 5EM8A 3LJ1A 4GFMA 4J53A 4X7QA 3SOCA 4FIFA 1H28A 3H3CA 1QCFA 5DNRA 1PXJA 3MVJA 4DF3A 4EUUA 1JKSA 1Y57A 3QC9A 2RG5A 4WBOA 2AUHA 4ZK5A 5LVOA 5KMJA 4I94A 2WTWA 2WMRA 3WIKA 4K6ZA 4BB4A 3VS5A 5JGDA 5EI2A 3PP0A 3RKBA 2LGCA 4X2JA 3WIGA 2UUEA 3GP0A 2OXDA 2VAGA 3COIA 4QD6A 1LUFA 4CTCA 3HV5A 4F0GA 2XMYA 3F9NA 2EB3A 3LM0A 1Z9XA 5DG5A 5A46A 1ZZ2A 1NA7A 3IGOA 4KRCA 2G2FA 2IVTA 4R1VA 4DC2A 5EDRA 2BHHA 4MHAA 2C5VA 4FTCA 5DIAA 2FVDA 5EH0A 4GL9A 5L2IA 1H1PA 3BV3A 4IAZA 4TY1A 5I9ZA 2LAVA 4GFGA 5AP4A 4BDHA 5CEMA 4YJNA 4MD8E 4DTKA 2R0IA 2Y4PA 3EL7A 4XG8A 4ITJA 4XV9A 4TT7A 2QI8A 3GFEA 4AOIA 2PULA 5JT2A 1CKPA 5EW9A 3QQFA 4HYIA 3SXSA 2WEVA 3C5IA 3FZTA 5JZJA 4KD1A 2UW5A 2W1HA 2XJ2A 1BMKA 1UNHA 3HL7A 3OWLA 5DLSA 5E90A 5HNGA 4BIDA 2IPXA 3O2MA 4J1RA 3C4WA 5CT7A 4YPSA 2ZM3A 2YWPA 4FBXA 2CGVA 2GDOA 2X2LA 4GIIA 4N6YA 4EC8A 2X4ZA 2B9IA 3K2LA 3UOLA 3KRLA 3ZUTA 3NNVA 3ZZWA 4E4MA 4YPDA 2W05A 3P23A 3WYYA 3FC1X 5I9VA 4O2ZA 4EUTA 2WOTA 3V5TA 2A1AB 3QA8A 4CEGA 3HRCA 1ZYJA 1V0BA 2WTIA 3C4EA 4PDSA 1Y6BA 3JYAA 4JG6A 2XVDA 3FXXA 1W82A 3PY0A 4QPMA 5FEQA 4AQCA 2PYWA 4O7TA 4X21A 3UQFA 3KXNA 3W2QA 2O3PA 4UWCA 2A2AA 5K0KA 2YM8A 3GQIA 1XO2B 3ITZA 4ITIA 5TF9A 4PMMA 2PUIA 4F6WA 1Q62A 2GNFA 1Z57A 4NCTA 2OH4A 4RIYA 4YGAA 4XG9A 5HO8A 5I9XA 2CNVA 1FMKA 4GVAA 3VUGA 4OAVB 4QP7A 2JKQA 2BVAA 2ESMA 2X7FA 5HD4A 3O8TA 4J95A 5GJFA 3QX2A 2W5AA 2E9VA 1KE5A 3RAIA 4MF0A 4XG4A 1K3AA 3IDCA 4UMQA 5TT7A 3FMDA 5HU3A 2OGVA 2NPQA 3SD0A 4FF8A 3SA0A 2OXYA 5GJGA 3MB6A 4OT5A 4L44A 2VX3A 3UZRA 5HICA 3EYGA 5CF8A 2QURA 4OTHA 3TDVA 3CC6A 3GU8A 5DPVA 2R7IA 2UZDA 3MGYA 4G31A 2BZJA 4GK2A 4OBQA 3VBXA 4BBMA 4O83A 3MH0A 4TYIA 1U54A 2XIZA 4JT3A 3M42A 4MBIA 3OROA 3E5AA 3MI9A 4IACA 4XJ0A 4RSSA 5AV4A 4TNBA 4IAIA 5AUZA 4ANSA 4BTMA 5F20A 2BFXA 1CM8A 4LV8A 5L8KA 5KMKA 3GT8A 2R4BA 3RHKA 4J8MA 4U8ZA 2HXLA 5M51A 3TZ7A 2Y8OA 4EOKA 4EH8A 5HLWA 3F7WA 4GU9A 4I5MA 4R1YA 4TWOA 1YXXA 4BWPA 3R2BA 3EL8A 4NWMA 3ZYAA 2WHBA 3NPCA 4DH1A 4LGGA 4RLKA 2JBPA 1ZMWA 3R6XA 3RPOA 4ANOA 3QWKA 2JIVA 4U5JA 3JXWA 2ZB0A 3ZO2A 4PPAA 3KCFA 4E8AA 4WG3A 1OIYA 3LCSA 4NT4A 3V5WA 3C4CA 4BTFA 3DAKA 4YJVA 4EK8A 3KQ7A 2QODA 2ZB1A 4RC3A 4WUNA 4ZTQA 4PDOA 5M55A 2YIQA 5LQFA 3HUBA 3ORKA 4FTOA 1JSUA 3R7YA 4BCKA 3QTSA 4D4VA 4B0GA 5EQPA 3C4ZA 3TZMA 2GNHA 1RJBA 3A8WA 4KIOA 4QQTA 3WE8A 1OKWA 2OBJA 2RFSA 4TKSA 4JVGA 3R9HA 4U3ZA 1SM2A 4EYMA 5E92A 3HVCA 2E9UA 4RWJA 3V5QA 3UPZA 4LRMA 4DEGA 3QQLA 1Q41A 3BWFA 2J5FA 5EYKA 4NM7A 2PVLA 3SG9A 4WKQA 5AADA 3NYXA 1H0VA 3EQFA 2VWZA 5IQFA 5CALA 5CU3A 3CD3A 2BTRA 3KRXA 4FKIA 4G34A 3RTPA 5E8ZA 2VTRA 2VWBA 3UE4A 4BZNA 2XF0A 4WNMA 3FDNA 4WNOA 1CSNA 2OIBA 4PP9A 4G3FA 3RWQA 4QMSA 2OZAB 3HECA 3H0ZA 5DH3A 5AR4A 3TTIA 3ZO1A 4F1MA 4N6ZA 4AOJA 1Q99A 4BDFA 4EOQA 3HZTA 3VUKA 2JDRA 4H3BA 4NSTA 2PZ5A 2UW8A 4D4SA 4DBXA 4EHZA 4HVHA 2UZOA 1DI9A 1H26A 2WGJA 2X6EA 4KBAA 3FMKA 1BLXA 3AT4A 5HLNA 5HE0A 4J71A 4YJSA 2YIRA 3FY0A 3LFEA 4H1MA 2CLXA 5CSHA 3KU2A 4BCHA 3BYOA 3JUHA 3LFFA 3V5JA 5KUPA 1IASA 1MUOA 5HHWA 4ZSEA 3WF5A 5AP3A 3C5UA 3NW5A 4DEBA 2OWBA 3QD0A 5AR5A 1R0EA 5DT3A 5HG8A 2B7AA 4FNZA 4BY9E 5IG1A 5CU2A 5M4IA 1PKGA 3W55A 4EH9A 2P2HA 2WTKB 5HVYA 3BE2A 1W83A 2DYLA 1BYGA 3DGKA 4MH7A 3SRVA 4CT2A 4DT8A 1KUTA 2R9SA 5BMSA 3BQCA 3TI1A 1KV2A 4FGRA 5LMKC 1TQIA 4OAUC 4AT3A 3TUCA 2PVHA 2Y6OA 5FXRA 5IA1A 3GOKA 4FL3A 1GZOA 3FMJA 3BEGA 1TVOA 4H3PA 4LMNA 3FZOA 5H8BA 2WMAA 2BPMA 2GNGA 3OXZA 4FTUA 2R3FA 3MJ1A 4D5KA 4FEWA 5IA5A 2B9HA 3W1FA 3A99A 4N57A 2X4FA 4TPTA 5H8EA 3Q2JA 5L8LA 1O6KA 4D2TA 4FIJA 3CIKA 2BR1A 5CEIA 5I4NA 3OEZA 3O23A 3QUEA 3L9NA 2BILB 3MBLA 2X81A 5T3QA 3OFMA 3OOMA 1XH7A 4D28A 2O0UA 2ZMCA 3NRMA 5HIEA 4WD5A 2WXVA 2J4ZA 5FP6A 2OG8A 4I6QA 2PUPA 3DBFA 3E64A 3E7OA 3AC3A 2I0YA 3MA6A 5CY3A 2R3KA 3AQVA 3V01A 5JZNA 1BL7A 4O27B 5ANEA 4FV7A 4FG9A 3GCQA 1GJOA 4PTCA 2WQEA 2XEZA 5ACKA 4BYJA 4IVDA 4FTNA 3PSCA 4IAFA 3GC8A 3MVLA 5AP2A 5CWZA 3QKLA 1H8FA 2UZEA 4B6LA 5CAOA 3N9XA 4R6VA 4RZWA 5HGIA 4HVSA 4CMOA 2W1IA 3QKMA 3FSFA 4GUBA 4RA5A 3Q5IA 3LXLA 3ET7A 2C69A 3E93A 2HW7A 4LOOA 5B2KA 3I0QA 4FMQA 3ZLWA 4QQJA 2FSMX 2VX1A 3MS9A 3O71A 4RIXB 3UPXA 5KNJA 3NX8A 2O5KA 1YWRA 1GNGA 3NUYA 3Q52A 3RI1A 1M52A 2XYNA 3LMGA 4AFEA 3WZDA 3LJ0A 5LCJA 1XBBA 4MWHA 3WF6A 5DRDA 4I22A 4R7HA 1PJKA 3Q9YA 4NTTA 4X3JA 5IA4A 5ANDA 3HUCA 4O7NA 1I09A 3QALE 4NFNA 3A8XA 4KINA 4R3CA 3CCNA 3TNIA 4D55A 4E5AX 3TUBA 4HCVA 4E73A 3NEWA 2XIRA 3VN9A 5BVWA 3UNKA 4RJ8A 5KMOA 4KAOA 4K9YA 4NIFA 4ENXA 1VEBA 2C6IA 3QTWA 4CFFA 3UDBA 3A7JA 4HYSA 4C4HA 5LMBA 1OL1A 3D83A 2G1TA 3EQPA 4P5ZA 4QYEA 1GZNA 5FEDA 5C01A 2CGXA 3B8QA 4PPCA 3HMIA 3QQHA 1CMKE 4XG6A 1W8CA 2B0QA 2YCRA 5FBOA 1GIIA 5AR2A 5FEEA 3Q6UA 4QTDA 4GK3A 4XEYA 5AP5A 2JFLA 3ATSA 3ATTA 2VO0A 3QTQA 4QP3A 2C5NA 5CEPA 5I9UA 2X39A 3E3PA 4C33A 4RBLA 5I5ZA 2HCKA 1UU7A 4GG7A 2C6KA 4BCPA 3H9OA 4QMYA 3SOAA 2FSOX 2JFMA 2PL0A 5CF6A 5KBRA 3RPYA 1XH5A 5LVNA 3VNTA 3HEGA 4M69A 5K3YA 4F1TA 2BMCA 2HW6A 3A61A 3P79A 3QXOA 4RPVA 4Z7HA 5AAGA 1MP8A 3KXHA 5KCVA 4XP3A 5DN3A 3SGCA 2BRMA 2W4JA 4FEQA 3H9RA 4UMTA 4YJQA 5L2QA 3NIEA 4HW7A 4ZTSA 3IOKA 4V0GA 4RJ7A 4Y85A 3DU8A 2YISA 3E7VA 1KSWA 3OOGA 3PZHA 3HMNA 3PPJA 4IIRA 4BDJA 4Y5HA 1WBSA 4I6BA 2XK9A 2WMWA 3ORIA 4V04A 1J1BA 2WZJA 4LOQA 3A7FA 5IUHA 1Q8UA 2C3JA 5AUUA 2ZMDA 4G5JA 4C3PA 4AWIA 4EZ7A 4CYJA 3C50A 4BHZA 3S00A 4DLIA 5EOBA 1O6YA 2REIA 3MYGA 4MXAA 3LFQA 2WU7A 1OMWA 4ZAUA 3OCSA 3CPBA 4OTPA 3UTOA 1QPEA 4E93A 3QD3A 5DA3A 2V22A 4PL5A 2I6LA 3DK7A 3PLSA 4PY1A 3VS0A 5GZAA 2QCSA 3C51A 4DEIA 3HMOA 2G01A 3PXFA 4I21A 1FVTA 4ANQA 2X9FA 3VBWA 3KXXA 2PTKA 3RAHA 4HCUA 2O65A 4IADA 3MH3A 3T8OA 3OWKA 2Q0NA 4AGUA 5CZHA 2Z7RA 2HELA 3VBVA 1F0QA 1H00A 3AC5A 3I7CA 4E26A 3U6HA 3HV3A 3VAPA 1SVEA 3BZ3A 4KKHA 3ZM4A 3BELA 4F63A 3BWJA 3CE3A 5GINE 3EQHA 4JBPA 2ITTA 3ODYX 3SKCA 1PF8A 1OPJA 3M2WA 3NS9A 3G0FA 4FZFB 1YOJA 3EN7A 5EYDA 4IAAA 4BGQA 3OW4A 3F2AA 4F0IA 2W9FB 4IE9A 5E8YA 5HG5A 5JGAA 2GNIA 4CTBA 3HP2A 3CJFA 3TEIA 4BGHA 4O0RA 4H39A 4BFMA 2CN8A 5EKOA 1P14A 1H24A 2CLQA 4C8BA 3MV5A 5B7VA 2JITA 3D9VA 4AUAA 1VR2A 3VO3A 4FV8A 2QOLA 3D2KA 3AOXA 3CXWA 3FI8A 4E5BA 3HRFA 3BI6A 3UO6A 4X2GA 4RRVA 1HOWA 5M44A 4LL0A 3VS6A 3WE4A 3HX4A 3UQGA 3UVPA 4ZLOA 1H01A 2QOKA 4E6AA 1ZMUA 3FMNA 3N51A 3QF9A 5EM6A 2GCDA 5CANA 5J5SA 2I0VA 2VU3A 3EFWA 3NNXA 3IPHA 5D10A 3MJ2A 4O7YA 4Y95A 3QKKA 1MQ4A 2X1NA 4AZWA 3VUMA 3JY9A 1OECA 3NUPA 3GU5A 4FIEA 4IFCA 4E7WA 3F5PA 4AZVA 4CNHA 3BCEA 4U7ZA 4AGDA 5KBQA 4Q9ZA 1FGIA 4UB7A 3H10A 5A6NA 1JLUE 4JRVA 2YCQA 3W32A 4L7SA 1WVWA 5BX0A 3GENA 3G51A 1JQHA 5AM7A 4RZVA 1PXKA 2GHMA 3LQ8A 4O1OA 3AGMA 4IB5A 4J96A 3TV7A 3LKMA 3G9NA 4J8NA 2PVKA 3DV3A 2ITQA 2OO8X 4DEAA 3ZLYA 3E8DA 3PJ1A 5EM5A 4FKGA 1M2QA 1WZYA 3TIYA 1Q24A 1PYEA 1SZMA 3QC4A 4AN3A 4D4YA 3OT8A 5IQBA 5LXMA 3W8LA 5HQ0A 4I5PA 4FK6A 4QP8A 3FZRA 4FSRA 4UXQA 5DWRA 4EL9A 4FKRA 3EFLA 3ORZA 2PWLA 4QQCA 3IKAA 3ETAA 1H1RA 2B4SB 2P0CA 5L2SA 5CSXA 2XK6A 4EHVA 3I4BA 5FTQA 1FINA 3DK6A 2PPQA 4XLIA 2H6DA 1M2RA 1BL6A 1XJDA 3WI6A 2YM5A 3NUSA 4YO4A 3L9LA 3FEGA 1YOMA 3O50A 3IDPA 4YZDA 1M7QA 2P2IA 3O7LD 3TZ8A 4FT7A 3TIZA 1PMEA 2PMIA 2X7GA 5CVFA 3BYSA 3BU5A 2OW3A 1LP4A 2J0JA 2OJFE 2E9OA 3ELJA 3QU0A 3TACA 3V8SA 4UX9A 3W10A 3FQEA 3IW7A 5IZFA 3F5UA 5L3AA 5CS6A 4QMXA 3ROYA 2GQRA 4BDCA 2XM8A 1CKIA 3QZGA 4KS7A 4QYHA 3KKVA 2NP8A 4TNDA 4ZZNA 3HMPA 2WTDA 3NW6A 1OKVA 5A54A 4D1XA 2QOBA 5FDXA 2EXCX 2W06A 4MQ2A 5BYYA 2WD1A 2BDFA 4L43A 3TTJA 3EKKA 4F7NA 3I5ZA 4D2WA 3VF9A 3CKWA 4RFYA 4F6UA 4CFMA 2GNJA 1YDTE 2ZAZA 4YTIA 4A9RA 3K3IA 5IQAA 4FSUA 3F3TA 3UVRA 4ZY4A 5HX8A 2DS1A 4DYMA 5AA8A 2ONLA 4HZSA 5JQ8A 3OC1A 4XBRA 2QG5A 3HNGA 4QMWA 3D7ZA 4QNYA 2VTTA 4P7EA 3MPTA 5EOLA 3V51A 4AAAA 2BAKA 4CFWA 4D0WA 4C58A 3NGAA 4OTIA 2BIYA 3EH9A 2CHLA 3ZDIA 3RCJA 2HYYA 2UZVA 4D0XA 3QRKA 1R0PA 2VO6A 4FSNA 3MVHA 2R3QA 2JKOA 5DFPA 2YIWA 4F7JA 5AUYA 4W4WA 3OZ6A 2PVRA 1FOTA 1HCKA 3E8CA 3LFNA 3QAME 4CZTA 4B99A 2Y7JA 5ANKA 3I79A 3IS5A 4GV1A 2IN6A 2PMLX 4PNIA 2QQ7A 4XV3A 3S95A 4C3RA 4ERKA 2YZAA 4NW5A 4I4EA 3WILA 4K77A 4B8MA 2YM6A 2V7OA 3DKGA 2IZUA 5HO7A 5CI6A 2C1BA 2VTSA 3OW3A 3WARA 4AW1A 3RNIA 3RPVA 2C6MA 4AGCA 3RPRA 2PZYA 4CQGA 4RIWA 2G9XA 2J0IA 4FTTA 4RVLA 4GK4A 2VGPA 1J1CA 3S3IA 3PJCA 4GH2A 2C6LA 3SLSA 1P4FA 2IO6A 4IB0A 3AMAA 3QCXA 1H4LA 3ZUVA 3PIZA 5AV1A 2OFVA 2QR8A 2XP2A 5E91A 3UGCA 3Q53A 3TT0A 1KE8A 2WO6A 4MNEB 2WTJA 3KF4A 4FZ7A 4BKYA 4YSMA 4EOPA 3D5UA 4I4FA 5CSVA 4OTDA 3Q9ZA 5IH5A 5ANIA 5ETAA 1LR4A 4JDKA 3GFWA 3RZFA 5BMMA 2FSTX 4BI2A 3ULZA 4ORKA 4LQMA 1JBPE 1MRUA 4H05A 3ZSHA 3KULA 1OM1A 1ZAOA 4ZLZA 4AOTA 1NVRA 4RQKA 1MQBA 4KA3A 4TXCA 4MTAA 1OL7A 3UC4A 3QGWA 4AFJA 3AT3A 4TYHA 5AV3A 4BIEA 4S31A 2OFUA 2CJMA 3S0OA 3G6GA 1R3CA 1KE6A 4HGSA 3DAJA 2P55A 5D11A 4O6EA 2JD5A 4IX4A 1NY3A 4Z7GA 3CR0A 5AEPA 3A60A 3I60A 1Q97A 3F5GA 4UV0A 3QQUA 2WOUA 3Q04A 1K9AA 4S33A 5DR9A 1DI8A 5HVKA 3EQCA 1OITA 3NWWA 4RT7A 5FD2A 3HRBA 3LHJA 4YZBA 3DA6A 3TM0A 5AJQA 3BHTA 3VJOA 3VRZA 4IWOA 2ZV8A 5M06A 3GCSA 4FODA 4HNFA 3T9IA 3GCVA 4FVRA 4QMTA 5FRIA 5KHWA 2BZHB 3D7TB 3L8PA 1W0XC 2WAJA 4UYAA 4ZTLA 4EJ7A 1V1KA 3SW4A 3PP1A 2JDOA 3VUDA 1OBDA 5CEOA 4QMLA 4YNOA 3I6WA 5IU2A 3LQ5A 3UMWA 4YLJA 4Y8DA 5AP1A 5LMAA 3PPKA 2JDTA 4FTLA 4I24A 2BKZA 3HV6A 5EYCA 1SMHA 4C59A 1XWSA 1E1VA 3EQDA 5CXHA 4DFXE 3HAVA 4ARKA 4LL5A 4BYIA 5EKNA 4R7IA 5FP5A 1XH9A 2OZOA 1UNGA 2ITWA 3LJ2A 4X2FA 5CEQA 4C4FA 1YXVA 4W8EA 5J7BA 1ZOEA 4BTJA 4ZSGA 3BQRA 4NJDA 5IISA 3FE3A 4MK0A 3BX5A 2ZDTA 2C5OA 1BUHA 3WZKA 4OUCA 4P2KA 3U6IA 5HTIA 3HDNA 5D1JA 1FMOE 1QPDA 3QX4A 4H1JA 4MVFA 4U43A 4W4VA 3V8TA 4F9WA 2ITOA 2W99B 4YHJA 2WQMA 2CKOA 4ZMEA 2OU7A 4ANBA 3HMMA 4LRKA 3DLSA 4FL1A 3S2PA 2ZV7A 1YXTA 3AMBA 4YC6A 3R9DA 4TRLA 3P7BA 4E6CA 2XK3A 2UW0A 3A4OX 3L9PA 3BHVA 4FV1A 4ZSLA 2XIKA 4EJNA 4YJTA 4FTJA 1JVPP 4FEVA 2QG7A 4I23A 2YAKA 3HDMA 4KBKA 1G8AA 1MRYA 2PZRA 4TTHB 1OKYA 4QMMA 1TQPA 3PPZA 3Q96A 5EDQA 3Q9WA 4M0ZA 3R8UA 4ALWA 4AW5A 2XBJA 3F3ZA 4NZWB 4PTEA 2IVUA 1UWJA 4ASEA 2X7OA 4E3CA 3TXOA 2X8EA 5FGKA 2XKCA 5IF1A 3HP5A 3DFAA 4RQVA 5EI6A 3H0YA 5IQGA 4HCTA 4YR8A 4FNYA 3PSDA 3TNWA 3POOA 4NM0A 1FQ1B 1OPKA 5A4TA 3EIDA 3QLGA 1G8SA 3NUNA 4DCAA 1SYKA 4P4CA 1NVQA 3IGGA 3MVMA 3DCVA 3PVUA 3PJ3A 2R3NA 3E92A 2XKFA 4A9SA 4AZFA 5KMNA 3U6JA 5KZIA 4PP7A 4PL4A 3UNJA 1H1WA 2B53A 4BDKA 1LEZA 4J99A 3ZOSA 4RWIA 3PXRA 3EJ1A 4EOIA 4O2PA 2IW6A 3C0GA 5FG8A 3M11A 5AIKA 4MXOA 2GU8A 4O0SA 4BBFA 5IMXA 4GT3A 3RINA 4UYNA 3IG7A
chains in the Genus database with same CATH superfamily
3VS7A 4EWQA 5ANJA 1S9IA 4GSBA 2OSCA 5KX8A 2V5QA 4BIBA 3OHTA 2ZFYA 4JG7A 2ITPA 5DE2A 5KO1A 3NAYA 2C0TA 4OTWA 4L45A 2HENA 4JX7A 1T45A 4L00A 4O1PA 3FAAA 2R5TA 5CEKA 3EN5A 3IK3A 5HNIX 1OVEA 3QD2B 4KSQA 3EYHA 3ZU7A 3DS6A 1OKZA 4TWCA 5BNJA 2JDSA 5IA0A 4I3ZA 3MDYA 4EKLA 3TDWA 2ITVA 4G3GA 2UZUE 2EXEA 2VN9A 3OXIA 4G2FA 4J98A 4JQ8A 5DI1A 4IW0A 5AWMA 3TNHA 4X3FA 3R04A 4D5HA 4GYGA 2V55A 2XBAA 4PTGA 5M09A 3DB6A 5LOHA 3B8RA 5CAUA 3BLHA 3R73A 4ASXA 2V62A 4M97A 3D2IA 4H58A 4GIHA 4PQNA 4A4LA 3VW8A 2B9FA 2O2UA 2YAAA 3V04A 3FJQE 2HZ0A 2IVVA 5AX3A 5DRBA 4G9RA 3ZH8A 3KK9A 4FTQA 5EW8A 4ZTRA 4GKIA 3P7CA 4BDEA 1M14A 1XQZA 3QCQA 4C36A 2I40A 2WMQA 2PZIA 2W96B 4S2ZA 4RC4A 2C1AA 2XA4A 5BVKA 3TNPC 4Z16A 4FSYA 3OY1A 2UW7A 3PVWA 2VTLA 4JDIA 2O8YA 4FT3A 1XHAA 2AC3A 4C57A 4K1BA 4MKCA 4TN6A 5FQDC 3BU3A 4D4RA 4FV2A 2QO7A 2ZV9A 2IZRA 4DLJA 5G6VA 1XMLA 2RF9A 3O7LB 3QTIA 4QOXA 4YLKA 4DEHA 5BVFA 4YP8A 3FKOA 3L8VA 4UN0C 4M3QA 4M67A 3Q3BA 5BYLA 3F6XA 3QRUA 4MWIA 3QYWA 3U51A 3DKOA 4P90A 4IM0A 4FT5A 3QTRA 3RP9A 3RWPA 4ZP5A 4XNEA 5EQEA 3MW1A 4OBOA 2EXMA 2WIHA 3F66A 3DLZA 4JBVA 4ANNA 4LMUA 4MBJA 4OTRA 3EN6A 2R2PA 5KMLA 4LRJA 3ZHPC 2XIXA 3ORLA 4ERWA 2VTJA 4CV8A 3FUPA 4FNXA 3OBGA 4YJRA 4XMOA 3LMIA 1IR3A 4RIYB 3NYNA 4IM2A 4JOAA 4WG5A 5DEWA 3VS2A 3DOGA 3OVVA 1U46A 2YDJA 4D2VA 3LE6A 1A9UA 1YRPA 5C9CA 5JK3A 2UZTA 2IZSA 4EYJA 2WKMA 4C4IA 3PXQA 3WZJA 3PLAE 4OTGA 1OL2A 3GU4A 3PJ2A 4IXPA 4EEVA 4EWHA 5AP6A 2ITNA 4H36A 2PZPA 4LI5A 3DBQA 4XLVA 4V01A 2W7XA 3BYMA 3MH1A 2OH0E 4TYEA 5HESA 3QFVA 4DHFA 1PKDA 1YI3A 1UKHA 5LJJA 3UYTA 3COKA 2PE1A 3DXQA 5BVOA 1W2DA 4LGHA 1NVSA 4IDVA 3NLBA 4EQCA 3TMOA 4I6HA 1U54B 3CD8A 3R8PA 2RG6A 4DH8A 1MRVA 3U9CA 2WMBA 2IVSA 1OL5A 3UG1A 4YNEA 3COMA 1UKIA 3DAEA 3E63A 4FKPA 4Y46A 4FI1A 4FSTA 4L7FA 1PXNA 3CQEA 2C68A 2XJ1A 5JN2A 5TOZA 3K5VA 4ZEGA 3ZRLA 4MXZA 4IDTA 5HI2A 4J52A 3W2OA 3TV6A 4UMPA 1PRYA 3MIAA 4F6SA 3EZRA 4F70A 4FA2A 4ZZOA 4FGBA 4EK4A 2ZDUA 4PUZA 4FICA 3K3JA 4FG7A 4FKTA 4J7BA 4R5YA 4RA4A 2Z7LA 1X8BA 2QU6A 5E8XA 2QKRA 5AUXA 4F64A 2AYPA 4NCTC 4DG0E 1ZZLA 4BCIA 4E1ZA 4N4SA 3N4UA 4IB1A 4KRDA 5K4IA 3PVBA 4QQ5A 2C3IB 2XNOA 2W1ZA 5AR8A 1JKKA 3FSKA 4DINA 3ODZX 5FWKK 3LCKA 1J7LA 2VTOA 3BLAA 1ZY5A 2QO9A 2QVSE 4PRJA 3UNZA 3KFAA 4EOOA 5CU6A 1BX6A 1J7UA 4ANLA 3UIUA 2CNQA 2CGUA 3NR9A 4ZLYA 3FQHA 3EHAA 4M13A 5AIRA 2DQ7X 4EBVA 4O22A 5IMEA 2V0DA 3FI4A 4FKSA 3FHIA 2JC6A 2X0OA 4JAJA 3RM6A 5C8NA 1ZOHA 3MN3A 5HU9A 3FZPA 2QONA 4IZ7A 3VW6A 2V7AA 4DGGA 2W1EA 3OCTA 4EBWA 5CAVA 5LVMA 4ZOGA 4CG9A 4S32A 3PFYA 2VO7A 3MWUA 3VUTA 5HCXA 4EH7A 2BKKA 3EN4A 5HLPA 5KKRB 3PVGA 4CGAA 3AG9A 4U40A 3F69A 4I6FA 4BDIA 3VRYA 3GXLA 2BALA 2OF4A 3G9LX 2QOCA 3FKLA 5JMSA 3CEKA 2CPKE 2XS0A 2PVYA 1REKA 4EORA 4WRSA 4IX5A 4NKSA 3LCTA 4GJ2A 4U80A 3F61A 4BCNA 5DT4A 4KS8A 2EVAA 3NYVA 4NL0A 3U9NA 1RE8A 4FKWA 3FLNC 2WTVA 3FL4A 3IOPA 4CXAA 2C6OA 4QMZA 4O21A 2YERA 2H96A 3C13A 3HA6A 4E6DA 2WPAA 3LOKA 3PWDA 4GMYA 4WO5A 4WOVA 4C34A 3C1XA 4F9YA 1UU9A 1B38A 1IA8A 5ETFA 4D2RA 4RX9A 4LUEA 4Q5HA 5A14A 4WSYA 1BI8A 3R9OA 3ZTXA 2EWAA 2ZYBA 2VWIA 4FOBA 3CY2A 3UO5A 3LQ3A 4EZ3A 3CKXA 1VLRA 3AC4A 5HTCA 3QRIA 4FTAA 2GS7A 3JVSA 4RX7A 5B0XA 4FTIA 4I0SA 3ORTA 4YJUA 4O0UA 1PY5A 2J9MA 4MBLA 4CCBA 4USFA 2YZLA 4CQEA 4CKIA 3G33A 5G1XA 3ZSGA 2WMSA 5HCYA 1KV1A 2P3GX 2W0JA 3AD4A 3ENMA 2GFCA 3FYKX 3DKCA 3FI3A 3Q6WA 4KIPA 4YZCA 2GS6A 4FUYA 3QRJA 5AX9A 3V5LA 4D1ZA 4AN9A 5J1VA 3R7OA 2VGOA 1R78A 3SRVB 3PIXA 4U44A 5FXSA 4NH1A 1CKJA 2XK7A 3DK3A 4C0TA 3GOPA 2JBOA 4F9AA 4DH7A 5B2MA 1PYXA 3NUUA 4G17A 5L6WL 4BC6A 4M66A 1ZYDA 2W4KA 3ZZEA 2GFSA 5EFQA 1Q8ZA 3GCUA 1OL6A 2B52A 3L9MA 4GU6A 4OBPA 3TZ9A 4EI4A 5KKRC 3RNYA 4EC9A 1ZYSA 4Q5EA 5DT0A 4NK9A 4B9DA 3UZPA 1ATPE 1IG1A 3OUKA 4C61A 4WA9A 3RZBA 3R22A 4LV5A 4BF2A 5L2WA 3CSVA 4UY9A 3DBCA 3OCBA 2X2KA 2W5BA 3ZM9A 4G6LA 3BHUA 3EN9A 2GQSA 5EM7A 4HZRA 4YZ9A 3R8ZA 4FEUA 4JMQA 4XV2A 2Y4IB 3PG3A 4E4XA 4II5A 4KB8A 5CU4A 3RJCA 3PIYA 4F08A 4WBBB 4QMUA 4X2NA 1S9JA 3JVRA 3SXRA 4ZMFA 2C6DA 5CYIA 4EH4A 1OPLA 3OWJA 3E3BX 3MSSA 4U79A 1WVYA 2UVXA 4EOJA 3P78A 3ZFXA 4FEXA 5FUTA 2H34A 3V6RA 1PW2A 2WMVA 2YLFA 2Z02A 4AG8A 2UV2A 4EK5A 3Q4ZA 5GJDA 3ZO3A 2H8HA 3O0GA 2XNNA 3UOKA 5IH4A 4XCUA 5DVRA 3CGOA 4C4JA 3FLWA 3LAUA 4AACA 4CZYB 2F7ZE 2ITXA 4A9YA 1QMZA 1LEWA 2YM4A 4FSWA 4YJOA 3TKHA 4QEBA 4WRGA 3C0IA 1BKXA 4UZDA 3NCZA 2R3JA 1DAWA 2SRCA 3PA5A 1R39A 3FPMA 2W1CA 3A62A 4JAIA 1TFFA 3ID6C 3QUDA 1JSTA 4I5CA 4YC3A 3POZA 4O7SA 4YZMA 3DDQA 3I6UA 1L8TA 4CFNA 5AA9A 4YTHA 2F9GA 3QCYA 4NIFB 4NUSA 5CT0A 4LDTA 3LIJA 1URCA 5EYMA 5E8TA 3VJNA 5J9ZA 4FIIA 3I0OA 2XZSA 3LXNA 3ZMMA 4EH3A 1VYZA 3NNUA 5E8UA 4GT4A 2QNJA 4EHGA 5K4JA 3R63A 3UP7A 3UIXA 3KN6A 4B7TA 2PU8A 4UWYA 1DS5A 3RHXA 2IW9A 3VBYA 1IA9A 3LCOA 4K11A 3RAWA 4WSQA 4I1ZA 3GQLA 4IC7A 4AZSA 2Y4IC 3LM5A 2PMNX 2J0MB 3G5DA 3Q5ZA 3ZBXA 1OBGA 5AR7A 4O0XA 5LWMA 3R30A 3NDMA 2JAVA 2UW3A 3SQQA 1A06A 1UU8A 3F82A 2AEGA 1PMUA 3L8XA 4FKLA 3OD6X 4XH6A 4GW8A 4PMSA 5L4QA 4F0FA 1YW2A 2B55A 2F4JA 4G6OA 4O38A 5KHXA 3KY2A 4NM3A 3IONA 4A9TA 4QPAA 4AXCA 4M69B 4M8TA 4YHTA 5M57A 1WAKA 3WOWA 4DE4A 4XS2A 4Z55A 4IFGA 5L2TA 3D5XA 1XH4A 4WT6A 4L68A 5ETIA 4GT5A 4V0GB 4Z3VA 1A48A 5IA2A 4A7CA 3KB7A 3OBJA 1ZMVA 4KIQA 2ZV2A 4L46A 4R78A 4CRSA 4CYIA 4F78A 3MY5A 4IWQA 1XBAA 2Z8CA 3TUDA 3FZ1A 4YO6A 1Q8TA 3EKNA 1Q4LA 3OY3A 2FH9A 3PXKA 3QQJA 4ANMA 5BVNA 5A4EA 4EKKA 4U41A 5I9WA 3NMUF 4O91A 4KNBA 3F3UA 1NXKA 1XH6A 5E1SA 4FX3A 3ACJA 4O0TA 4LYNA 4BHNA 2J90A 2I1MA 3IQ7A 3MH2A 2W17A 3R28A 2YCSA 2XK4A 4O7VA 4EQMA 1ZARA 2VX0A 1U5RA 3W16A 4G16A 3UP2A 3BBWA 4XUFA 4AXAA 5HG7A 2UZBA 4L6QA 1SNUA 3CY3A 3JY0A 3A2CA 3ZXZA 2HZNA 1W98A 3D5VA 3GC7A 2VTNA 2VWYA 2X8DA 4K8AA 1WBNA 3SW7A 5CXZA 5C8KA 1YVJA 4I0TA 2HWPA 2UW9A 3DY7A 3W8QA 3PY1A 2VTAA 4LM5A 1WBPA 1E9HA 3BLQA 3FKNA 4CZUA 3RK7A 3TKIA 5BV3A 3S4QA 3R83A 1L3RE 3PYYA 2VWWA 3PXYA 4KBCA 4JDHA 2NNWB 5JKGA 3FXWA 3TWJA 4QRCA 5I0BA 5HG9A 4QP9A 4KIKA 2PE0A 4UEUA 5BQ0A 3DPKA 3RM7A 3HKOA 3G15A 2GSFA 2WU6A 3O51A 1WMKA 4L53A 5ETCA 4XX9A 3PY3A 4ZS0A 4C02A 2OLCA 1SVHA 1B39A 4CFVA 3ZLSA 1WBWA 1H1SA 2ITUA 3MB7A 3OS3A 3DBEA 4RFZA 5CSWA 1OGYA 3FI2A 1XMMA 4QYYA 4RX5A 1H1QA 2A4LA 3MFRA 5HTBA 3ZEPA 3F5XA 3JS2A 5HNBA 2OJIA 3KXZA 4FKJA 5KE0A 4AZEA 3Q60A 3KL8A 3QBNA 2OJ9A 3AC1A 3ZO4A 4A9UA 2PVJA 3A4PA 3QZIA 5ITAA 5LVPA 2Q83A 5L8JA 3NSZA 4NU1A 5DR6A 1F3MC 2R64A 2BDJA 4HVGA 4FT9A 3N4TA 5D12A 1O6LA 4C7TA 3D14A 4LGDA 5CVGA 5FXQA 2R3IA 4XOYA 3QWJA 3O96A 3ANQA 4UXLA 5F1ZA 4GCJA 4O86A 2YJSA 3UO4A 2RFEA 3TG1A 3ZLXA 3UOHA 1XH8A 2GS2A 1YXSA 2IJMA 5LARA 4YBJA 4JR7A 3CTJA 1SVGA 3MFUA 1JOWB 3VBQA 5IPJA 5E8WA 5EDPA 3FMMA 4U9AA 5H9BA 2XKEA 2XCKA 3BRBA 4UBAA 4AP7A 1J3HA 5CF5A 2HAKA 4DFLA 5IA3A 2QHNA 3OCGA 1M7NA 2C30A 4MQ1A 5I3OA 2JKKA 2PUNA 4PDYA 2HXQA 5AV0A 4BKJA 3ZFMA 3GB2A 3MIYA 4DCEA 5HZNA 4LOPA 3R1SA 4AXEA 1STCE 1WVXA 2XEYA 2QLQA 2BDWA 4ZTNA 3CQUA 1OGUA 4N0SA 3UG2A 3Q9XA 4L8MA 1ZLTA 3IECA 3WZUA 4USEA 4DHIB 5HBEA 4IQ6A 4QNAA 1YI6A 3F3WA 3MPAA 4YHFA 3VBTA 4AA5A 2C3LA 2F2CB 3P4KA 3NIZA 4LUDA 5GZ9A 3REPA 4YLLA 4K33A 4QTCA 2QD9A 4KKGA 5F94A 1ZOGA 5A4LA 4QMVA 3BEAA 3SVVA 4IVCA 4ZS4A 2F7XE 4MCVA 1PXMA 4IBMA 1ZYCA 4X2KA 3LXKA 3OEFX 3KVXA 3UYSA 4DH3A 4F7SA 5HKMA 4YU2A 3QL8A 4ZSAA 2Z60A 3CJGA 5K0XA 4AW0A 5J79A 1IAHA 4BKZA 4L3PA 1PMVA 4BCQA 4ACGA 4FSQA 2I7QA 4FKVA 2G2IA 3SG8A 2J7TA 3G90X 2YDKA 4PMTA 4YUQA 1FVRA 2WTCA 3BGPA 3CQWA 4JX3A 3UC3A 5AP0A 2ZOQA 4AZTA 3F7ZA 3WZEA 3TYKA 1YHSA 4FSMA 3HLLA 2JDVA 1PXLA 2QKWB 2J5EA 4JR3A 5DOSA 4RJ4A 2W1DA 4QT1A 4AW2A 4JRNA 1TKIA 4XP2A 3NNWA 3R01A 4RGJA 5K5XA 3R7GA 4FT0A 4M15A 2GTMA 5AUWA 4KUJA 1WBVA 3MY0A 3RALA 5HORA 1OUYA 3KA0A 3U4WA 3B2TA 4X6RA 2XNGA 3BBTB 4XYFA 4QYFA 4XRJA 3FXZA 4WIHA 3SAYA 4BWKA 5FTOA 4AXDA 1JKLA 3GEQA 1UV5A 3DJ6A 1W84A 4M7IA 3OWPA 1UNLA 1YDRE 2CN5A 2O64A 3F2RA 2UZLA 5F95A 3RPSA 2JIIA 4XRLA 3V5PA 4YMJA 5HX6A 2VNWA 5DBXA 4PMPA 2UW4A 4MYGA 3CGFA 5JRQA 4GKHA 4CG8A 3DZOA 3R00A 4DT9A 4M14A 4RC2A 3Q4UA 4CCUA 4DFBA 4GS6A 4B8LA 4ACCA 1KOAA 3R8VA 5LWNA 2QLUA 4FV4A 4DH5A 3VULA 2WQOA 3ALNA 4X6QC 5BYZA 2W4OA 4FE2A 2VTIA 4JG8A 2A98A 1G3NA 2EUFB 4JIKA 5M56A 3KMUA 1P5EA 4L01A 4U6RA 2BZIB 2F7EE 2JAMA 3DJ7A 3FL5A 1Q5KA 3U54A 4O6LA 5K5NA 4CV9A 4MXCA 3K5UA 3FMHA 3NZ0A 4HPUE 4FKQA 4XOZA 2YFXA 2JKMA 1AGWA 4ENYA 2QHMA 4BZDA 2OKRA 1XKKA 2UVYA 4DBNA 2BHEA 2FB8A 2NO3A 1YWVA 2R3HA 4IZ5A 2RSVA 4L9IA 5EHLA 5T68A 3LMHA 3AGLA 1KE7A 4U0IA 5CQUA 2WIPA 4QP6A 1W7HA 2C6TA 1Y8YA 2YM3A 1UVRA 4O81A 4RIWB 1QPCA 4YZNA 1JWHA 4FTMA 4RWKA 5D9HA 1H25A 5C4LA 4G1WA 4AS0A 4DFNA 4OTFA 5JFXA 4FV9A 3GU7A 2PVFA 4I5HA 3GC0A 3PTGA 3ZDUA 5E8SA 3QZHA 4JBQA 4O96A 5D7VA 2J0LA 2XNBA 2VD5A 2XNMA 4IJPA 4YSJA 3AD5A 3EMGA 3LPBA 3W33A 3HYHA 4R77A 4BI1A 1AQ1A 5DHJA 5LMKA 3KXGA 4JQ7A 3NCGA 4O82A 2VTQA 2H9VA 4CMUA 4LG4A 2J6MA 4ZZMA 5AUTA 4PPBA 4ASZA 4O7LA 5DYJA 4ONAA 2X2MA 2BTSA 4FKUA 4IWDA 3KULB 4GJ3A 4U42A 3IO7A 3T3VA 2ONLC 2PVMA 3GU6A 2B54A 4K18A 1KOBA 4QDVA 4QTBA 3RBWA 3LW0A 1Y8GA 4LFIA 1VJYA 4TYHB 2XRWA 4FNWA 4WNKA 3ZRMA 5M07A 3QZFA 1H27A 4XG7A 3EQBA 4ACDA 4E4LA 3EQIA 2Y0AA 2OZAA 4B4LA 4CKJA 2BFYA 4L52A 3SHEA 2BCJA 1OIRA 3QQGA 4KWPA 1H08A 1RDQE 2VZ6A 2WELA 3EB0A 2WMXA 4MAOA 4DN5A 5IDPA 4O0YA 2VWXA 4R3PA 3QA0A 5D7AA 2PSQA 4CMTA 5F9EA 2RGPA 5KMMA 4PL3A 2ACXA 4GUEA 1NW1A 2WMTA 5FTGA 3FV8A 2HWOA 4U45A 3BIZA 3GC9A 4ZJIA 4PNKA 1K2PA 1URWA 3P9JA 4G6NA 2IWIA 4M84A 2ETKA 3Q2MA 4WNPA 3WBLA 2E9PA 4DITA 5E4HA 2JEDA 2YJRA 4K2RA 5ICPA 1IRKA 1WFCA 5M4UA 3AKLA 1OIQA 2HIWA 2NRYA 3KMMA 4BZOA 4L3JA 4C38A 4KSPA 3VS3A 4CT1A 4C2VA 3TN8A 4DAWA 4EK3A 4ZXTA 3I7BA 1VYWA 1PXIA 3G6HA 3PE2A 4R8QA 4AGWA 3ORPA 2XKDA 3ZUUA 1ND4A 4JL9A 4DGLC 3W18A 4ZJVA 2WFYA 5FM2A 2KTYA 1ST4A 1RQQA 3HGKA 4A4XA 3DQWA 4DFYA 5TR6A 3MFSA 3R02A 3QHWA 4MXXA 4G9CA 4EHEA 5HVJA 3H4JA 2R3MA 3MTLA 3FMEA 1HCLA 1JNKA 2OK1A 5LVLA 4EOLA 1ZWSA 2R3LA 3MFTA 5DR2A 1AD5A 3KRWA 2BZKB 3UODA 4QMNA 4ZTMA 4DEEA 3QRTA 3DFCB 1B6CB 2BRBA 3DT1A 3W2RA 4RIOA 3OTUA 4BJJA 2PVNA 2W5HA 4F1OA 5C8MA 5HO6A 3LFCA 4RJ3A 4F09A 2YN8A 4HGLA 3VF8A 2DWBA 3OMVA 2YIXA 4W9XA 4M12A 3R9NA 4G3CA 4IVBA 3IW6A 4XG3A 3PDTA 4A4OA 1KE9A 4UALA 3QTXA 3G2FA 4YJPA 3U4UA 5AFVA 3M1SA 5A9UA 4BL1A 3HAMA 5AV2A 2E9NA 3F2NA 4E5WA 1JKTA 4L3LA 4F4PA 4GEOA 4OR5A 4DTAA 3HV7A 4YTCA 3DTCA 4O7ZA 4FV3A 4JXFA 2R3PA 4Q2AA 3CTHA 3KRRA 4ITHA 3MPMA 2OIQA 3IW4A 2DUVA 2PY3A 4FC0A 4AE6A 4C35A 3LFBA 5BUEA 4R7BA 3BPRA 5E1EA 2NYAA 4F9CA 5JFVA 3W0RA 4CVAA 3G0EA 4RIXA 5EQYA 2PMOX 5GIPE 3FWQA 2WMUA 3ACKA 3VVHA 2XJ0A 3ZONA 4BDBA 3PSBA 4RJ6A 4DGNA 5C4KA 5M4CA 3E88A 4PF4A 4M68A 1CDKA 2CGWA 5CAQA 3ORMA 2R3OA 2YEXA 2VV9A 3P5KA 5IEYA 1OIUA 4TYJA 3R7UA 3LVPA 4AQKA 5CASA 3R9RA 2Y9QA 2VTMA 4PDPA 2XANA 3NVKI 3BGQA 4IZAA 3RGFA 3PFQA 2YLEA 5KZ0A 4WUAA 3KVWA 4NFMA 1U4DA 2RFNA 2B9JA 3RVGA 2J0KA 5AP7A 1GY3A 1H0WA 1GZ8A 1QL6A 2C3KA 3Q4TA 3AKJA 1P4OA 4QMPA 4CFUA 3ZS5A 3DQXA 3P5JC 4HOKA 2YM7A 2QOFA 5HD7A 4Y72A 4APCA 2P33A 5DMZA 3OF0A 4Z9LA 4JI9A 4FVQA 3KIOC 2X8IA 2I0HA 5JRSA 3LFDA 2KULA 4JS8A 4D1SA 4BGGA 4V05A 3R1QA 3U8WA 3KC3A 3PWYA 4BDDA 3GGFA 4O0VA 4QTAA 4X3FB 5J9YA 4RLLA 1OB3A 3VS1A 1WCCA 3EFJA 1V0PA 4HYUA 5AMNA 5H3QA 5AAFA 2F2UA 4I20A 4AU8A 3LFSA 2XRUA 2X0PA 3I81A 2F49A 3DNEA 2C5YA 4Q9SA 2C47A 3QYZA 4UMUA 4D9TA 2XCHA 3BYUA 2QOOA 4IX6A 4FYOA 2ITYA 3LCDA 5H8GA 1R1WA 5I3RA 4DA5A 2OICA 3OG7A 3LLAA 4AN2A 4I6LA 2QOHA 3DB8A 4CKRA 2BUJA 2UZWE 3LFAA 5HEZA 2EU9A 2QC6A 4FUXA 4Y5QA 4CRLA 3KF7A 4K0YA 2PK9A 3VQUA 2J50A 5IQCA 3AT2A 4IH8A 3P86A 2ERZE 2FSLX 4W4YA 5DGZA 3T3UA 3QTUA 3ZC5A 4NM5A 3H9FA 3E62A 4BVUA 4DGMA 3ANRA 2Q0BA 5HE1A 3GCPA 5CF4A 2O63A 1W2FA 3DKFA 3BV2A 4QMQA 5T6KA 2R7BA 2WNTA 5IQEA 3VQHA 4P5QA 4YBKA 4ASDA 1ZXEA 1CTPE 5E7RA 5BPYA 2RIOA 2R3RA 1EH4A 2VUWA 3SX9A 4FTRA 4IANA 4IWPA 5CENA 4BCMA 4DG3E 4O84A 2GNLA 2Z7QA 2YABA 4DTBA 5IH6A 3TNQB 5HBHA 4GYIA 2BRHA 3RCDA 4FV5A 3V6SA 3II5A 4C4EA 1Y91A 2CSNA 3AD6A 1M17A 3SDJA 4RVTA 2NRUA 3RK9A 3H30A 4C2WA 4DG2E 2BRNA 4RMZA 2WQNA 5BVDA 3Q32A 4XG2A 4X3FC 4O7WA 3IDBA 1GAGA 2ZJWA 4C37A 3A7HA 4UZHA 3SC1A 2XNEA 5J9LA 3KEXA 4ZSJA 1GIJA 4RG0A 2WTKC 4JQEA 4MXYA 4F99A 4FVPA 4XHKB 4U81A 4FYNA 2IG7A 3UOJA 3CLYA 4FRFA 4JJRA 5EW3A 1YXUA 2VNYA 3UJGA 4EH6A 4IMYA 2CMWA 2OXXA 1Z5MA 3BHYA 2W9ZB 3GUBA 4GFOA 2JGZA 2OJJA 4FK3A 1NT2A 3E87A 3FHRA 3QHRA 4D2SA 4E4NA 4ALVA 4F65A 3FZSA 3W0OA 5A3XA 3V3VA 5HIDA 2G2HA 3COHA 3FBVA 3ZC6A 1TQMA 5IUGA 3N4VA 3FMLA 3ENHA 2QU5A 3BU6A 1FPUA 5A4CA 3DDPA 3LLTA 1GOLA 4QP2A 4FL2A 3BHHA 2HZ4A 3LXPA 2GPHA 1LPUA 4FZDB 3TL8A 2A27A 4RX8A 5CAPA 3THBA 5CTPA 4ACMA 4QP1A 2EB2A 4FSZA 3FPQA 1G8JA 3PA4A 3PZEA 3P0MA 3UQCA 5M08A 4NTSA 4D58A 1PHKA 1O9UA 3ZSIA 3NYOA 3R21A 1Y6AA 2ITZA 4R3RA 5EHYA 4IHPA 1ZY4A 3PE1A 3KK8A 3ZCLA 4FV6A 2Z7SA 4A07A 3NVMB 2FYSA 2UZNA 2AC5A 3FQSA 2XK8A 4I93A 1H07A 1Q61A 5I9YA 3AXWA 3BGZA 3NUXA 3OXTA 5CVHA 3JPVA 3LZBA 3UVQA 1FGKA 2CKQA 3MTFA 5JGBA 3ALOA 5CX9A 3FLSA 1YOLA 3ORNA 4OLIA 4NKAA 4U97A 4EZ5A 4ID7A 2CKPA 4FZ6A 1UA2A 1SNXA 2A19B 2ZM1A 4BCJA 3DTWA 4OTQA 4S30A 3CP9A 4TYGA 4TZRA 1TZDA 2JIUA 2BROA 2ETRA 3QXPA 4YURA 3TKUA 5TE0A 4JNWA 5EG3A 2IEWA 4USDA 3D0EA 2HY81 3C0HA 3BE9A 3C4FA 3QD4A 5HE3A 3UBDA 4AXFA 3S1HA 5K9IA 4QO9A 2G15A 3UIMA 2GHGA 3WF7A 1PMNA 2XIYA 2YACA 3IW8A 5J95A 3ERKA 3HV4A 3FY2A 5ANOA 3VS4A 5EK7A 3QUPA 4BICA 3PXZA 5CNOA 4O0WA 2YA9A 4DDIA 2XALA 4MUQA 4HVIA 1IAJA 5F4NA 5CU0A 1GZKA 1F5QA 2HK5A 1V0OA 4I92A 4OGRA 4AT4A 2YWVA 5GHVA 2ETMA 4N70A 2PHKA 1WBTA 4W9WA 3O17A 5E8VA 2YIYA 2VWVA 4ZIMA 3VHKA 5JEBA 4GVJA 4JLCA 2PE2A 2E2BA 4IZYA 3W2CA 3ZXTA 2CKEA 4MF1A 1G5SA 1I44A 4EOSA 3R8MA 3VUIA 4IM3A 2C0IA 1YHWA 5HE2A 4HNIA 4YC8A 3BYVA 3WF8A 4J97A 4E6QA 5FDPA 5GIOE 2XYUA 1OI9A 4I0RA 4WG4A 3ZFYA 3EWHA 1WBOA 3ZRKA 4GG5A 4FKOA 4F7LA 4ZTHA 4XV1A 3QQKA 4MNFA 5HOAA 1U5QA 4AA4A 2VTHA 1XBCA 4CFXA 3UIBA 5JFWA 4PV0A 3B2WA 3R8LA 2GQGA 4IAKA 3OUNB 3I5NA