2WQOA

Structure of nek2 bound to the aminopyridine cct241950
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
277
structure length
242
Chain Sequence
SRAEDYEVLYTIGTGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRLKPANVFLDGKQNVKLGDGTPYYMSPEQMNRNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title An Autoinhibitory Tyrosine Motif in the Cell-Cycle- Regulated Nek7 Kinase is Released Through Binding of Nek9.
pubmed doi rcsb
molecule tags Transferase
total genus 75
structure length 242
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2wqoA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2wqoA01
2YIXA 5JRQA 3B2WA 4XYFA 4L42A 5K9IA 1XBAA 4FUXA 5BMSA 5M07A 2J4ZA 2WTWA 4O38A 4QMPA 5EKNA 3ZBXA 3BV2A 4DEIA 3PA4A 1G8AA 3ZXZA 1NT2A 4O96A 3A2CA 4J1RA 2BAQA 3CQUA 2XNPA 4GUBA 3VBWA 2QHNA 4FEQA 1H0WA 3DKGA 3JS2A 5IQAA 4BTKA 3K5VA 4FSMA 4WUAA 4R8QA 4KKEA 4GJ2A 5BVNA 5D7VA 1H1RA 4AZTA 3QD0A 3LXLA 5EH0A 3KQ7A 3DV3A 2OU7A 2UW7A 3FLSA 5M56A 4YZBA 2JAVA 1GY3A 2JKKA 4QYEA 3EQIA 3H9RA 5CXHA 2GNJA 3FQHA 4RVKA 3T8OA 4XG4A 4PMTA 4WO5A 3TTIA 3FZPA 3VBTA 3PIYA 3GCSA 4HVDA 5CEPA 5E9EA 4NWMA 4IAIA 3VS6A 3Q9XA 2WD1A 4X21A 1V0PA 2BCJA 2C5NA 1H27A 4M69A 4Q2AA 3LZBA 5IMEA 2PULA 5CEOA 3DY7A 3LJ2A 1ZRZA 3WILA 5HX6A 2OO8X 2WQEA 4BICA 2OF2A 4A7CA 4XG7A 3OEFX 2C0IA 5LXMA 4FK6A 3S3IA 5CU0A 4EC8A 4NCTC 4FG8A 4H3PA 4FG7A 4F65A 4PDSA 3DKFA 3V5JA 4EKLA 3EN5A 2J0IA 2LGCA 3HA8A 4ZSAA 3BYUA 4HYUA 4M12A 3ZXTA 4QMZA 2BRHA 4UWYA 4AOTA 3I5ZA 4JDIA 3N4VA 3WIKA 3F7WA 2UW4A 2GSFA 4DG3E 2OJ9A 2VWWA 4O0TA 4J97A 4NFNA 1DM2A 4G3FA 3PXKA 4L01A 4YJRA 2VNYA 4PMMA 4MXCA 4YPSA 3P7BA 5AR4A 3SC1A 1PYXA 3T3VA 4PP7A 5TOZA 2BROA 4Y73A 2DQ7X 5ETIA 2CSNA 1U5QA 4FV6A 3I60A 5AADA 5E8VA 3MESA 2BILB 3Q96A 4MD7E 4O0SA 2C47A 3O96A 3UIMA 4BDBA 4EORA 2BRNA 4DGMA 4FIFA 4FEVA 2GQGA 2OBJA 2J90A 3GGFA 2ITPA 2HWOA 3VS3A 4E4LA 4AA4A 4BR3A 5KE0A 5AV4A 5AUZA 5AJQA 5I9VA 4X6RA 2GNHA 5J9LA 3MIYA 3RK9A 4ACGA 4DFUA 5B2KA 5DE2A 4D2WA 4RZVA 4TW9A 3COMA 5E4HA 4HYHA 2CMWA 4ITHA 4NFMA 4DFBA 5B7VA 2WIPA 5B2LA 1P4OA 4R5YA 2RSVA 1B38A 2KULA 1OB3A 4QO9A 2IVVA 2WTKB 3KRRA 3KVXA 4LOPA 4MQ2A 3EN4A 2QR8A 3QTWA 3DK7A 4NT4A 4XRLA 5EM5A 5AMNA 3ZLWA 5HIEA 5CY3A 3NLBA 1GZ8A 4U7ZA 1BX6A 4ACDA 3ZHPC 5IA4A 1LR4A 3ENHA 3VULA 5HLNA 5FUTA 2E2BA 5IQEA 2UZVA 4XHKB 2BMCA 5IZFA 2R64A 3NYNA 4LRMA 4YO6A 5LMKC 2X2KA 3OWKA 4R1VA 1UKIA 4FE2A 4C57A 4KUJA 4I20A 4L52A 4XBUA 2WOUA 4O7LA 1CM8A 3C13A 3VBYA 2Y9QA 5ETAA 5DGZA 4QTEA 3EN9A 3D5VA 1A9UA 3RNIA 5JSMA 4HVSA 2X6EA 5J87A 3HUCA 4CTCA 3G2FA 2X8DA 4BCGA 5A54A 3RAKA 1OBDA 4GH2A 4V01A 2PE0A 5HEZA 5M51A 5DN3A 5IPJA 4YNOA 2WTVA 4FF8A 4E6DA 4ZTSA 2ZAZA 2CN8A 3PSCA 4PQNA 2GS2A 3SXFA 3ZO4A 2J0LA 5BVKA 5HU9A 2JLDA 3EWHA 4L8MA 5CT7A 1NW1A 4FKVA 4I4FA 4I5PA 3RM7A 1XQZA 4BL1A 1ZMUA 2WNTA 4JL9A 4JBVA 5IF1A 4BDFA 2XM8A 1VJYA 1BYGA 2ZM4A 4JRVA 4YJVA 4ASEA 3DBCA 5KMMA 2YCSA 3SA0A 4P2KA 4YR8A 2BDWA 3R04A 3FC1X 5HQ0A 2B54A 3MY1A 4XOYA 3C4EA 1UA2A 5AR7A 4RFZA 3BHTA 3R21A 4L53A 4U81A 5GINE 3MDYA 3MIAA 2PZPA 3KRXA 3SRVA 4C2WA 3MI9A 4M15A 5L6OA 4IX3A 5EKOA 3WOWA 4GRBA 3N9XA 3Q5ZA 1ZMVA 2PSQA 3Q5IA 1H24A 3AC1A 4FV1A 2R3KA 3DJ5A 4C0TA 4BF2A 4FKQA 2XIRA 3U4UA 4CQGA 3L9NA 4NIFA 3LXPA 4QMTA 1XH7A 1LPUA 2HZ4A 2BVAA 4GYGA 4FV9A 1R3CA 1PJKA 4J7BA 3P86A 4BKJA 4ZSGA 3QQUA 4K77A 4NW6A 1AQ1A 1OUKA 4FTOA 5J7BA 2OLCA 4MKCA 4D4YA 2XNNA 3OW3A 2YACA 2E9PA 1YVJA 4FK3A 4E93A 3DFCB 3F66A 4LOOA 4Z16A 3ZM9A 3H4JA 1H00A 4BI1A 3M42A 2VO6A 2XA4A 3D83A 2VNWA 3PY3A 4I24A 3QHWA 1KOBA 3KEXA 4FKJA 3UMWA 4CCBA 5HVJA 5J9ZA 5HE1A 2W5AA 4AZFA 4ANQA 3QA0A 3R02A 4X3JA 3RAWA 3GQIA 2OIBA 3PSBA 3CXWA 5CSWA 1RQQA 3UDBA 3MWUA 5HX8A 3DB8A 3TCPA 4PNIA 4YGAA 4HJOA 4NKAA 1IRKA 2VTSA 4EK3A 2HZ0A 3F2AA 4JG7A 1K3AA 3S2PA 2W9ZB 3QA8A 4YJTA 5HO7A 3NS9A 4IB0A 2UZUE 1UNGA 1Y6AA 1DI8A 2WU7A 3F2NA 4X2KA 4Z7HA 3CJFA 4FNXA 3JR1A 3ZEWA 4GSBA 4EJ7A 5HD7A 4RX7A 3AT3A 2W4JA 3DTCA 5C4KA 3L8PA 2ITNA 3NDMA 3O23A 5HIBA 3QQJA 2R3HA 1GZOA 1SM2A 4IB1A 1JKSA 1MQBA 1ZOHA 3DKCA 3HP2A 1R0EA 2PZRA 2YM6A 4I94A 4M69B 4Y72A 2R3QA 3VN9A 4HW7A 3GENA 2XJ1A 2BAKA 3PWDA 4YC3A 2WKMA 1Y8YA 2VUWA 1A06A 3O17A 4KRCA 3DBDA 5KBQA 1UU8A 3NRMA 3K3JA 3V5QA 1R0PA 3ODYX 4CGAA 4FV4A 4ANLA 4HVIA 4BDDA 3IW4A 3IECA 2RKUA 1H0VA 4BGQA 4F63A 2V7AA 3FPMA 2PUUA 4QYHA 3VHKA 1XH5A 4UYAA 4EH6A 4R5SA 4YHFA 4XS2A 4WT6A 3OTVA 4FV0A 5JZJA 3UO5A 4FVPA 4OT5A 4JAIA 2R3LA 3QUPA 4EOIA 3EKKA 4AW2A 1PW2A 1KE8A 3HRBA 2VWYA 4JX3A 3WF8A 1TQIA 4YJUA 4AN3A 3LFAA 1PMUA 2XZSA 3LCSA 3F5UA 3FZRA 3GC8A 4BHZA 4MX9A 2BAJA 4QOXA 3GU6A 3WBLA 4CKIA 4UMUA 2O5KA 3FSFA 1Q8WA 4J96A 4EK5A 2VWXA 2BZIB 3FV8A 4R3PA 2XIZA 3CJGA 3QYZA 4OR5A 3ZZWA 3NIEA 5K0XA 2HOGA 5FP6A 3GU5A 4JQ8A 3I0QA 5L6WL 4ZTHA 4F9CA 5IQFA 5AA9A 4KD1A 1BUHA 5IQIA 2G2FA 5B2MA 5D1JA 4PY1A 2WO6A 3E88A 2H96A 3PZHA 5DRDA 4F9BA 1CSNA 1FMKA 1KE6A 1OL7A 3CQEA 4D4SA 4L3LA 5AP6A 2JDOA 3AD4A 4RVTA 3QZIA 5A14A 2YM5A 4E7WA 3FLNC 5A9UA 2XKDA 2JDRA 4DBNA 5I3RA 1AGWA 5HVYA 2PHKA 5DT0A 3UG1A 2ITUA 5BQ0A 4N6ZA 2ETRA 2VTJA 3QZHA 5AP3A 3TV6A 5LOHA 4BDAA 3GOPA 1EH4A 3EMGA 4I0RA 2W1IA 4D2RA 3DK3A 4D2TA 4ZY4A 3KCKA 2WEIA 3PJ2A 2R3RA 3PG3A 2ZM3A 3DPKA 4IADA 3DK6A 3GUBA 4DEHA 4EOOA 4DE4A 2PVKA 4C8BA 1S9JA 4CSVA 1JPAA 3BBTB 3F5GA 2A1AB 4AZSA 1L8TA 2PZ5A 3TUBA 3ZCLA 3OUKA 1UKHA 3LFBA 4RQKA 5CNNA 3V8TA 4CCUA 3ZC6A 3D2KA 3R1QA 2XNGA 2BUJA 4IAKA 1DI9A 1GJOA 3NAXA 3PJ1A 4U8ZA 4CRSA 5AM6A 3SGCA 5HICA 4E4NA 4DF3A 5CS6A 4D2VA 5LCJA 4ZJIA 4QTCA 5DA3A 4K0YA 4JG8A 3DBEA 3DNEA 5T68A 4LI5A 3PP1A 3LVPA 3HLLA 4PRJA 4KNBA 2F49A 3UC3A 4JG6A 4GCJA 2VU3A 4ZXTA 2XNMA 4NK9A 3E64A 5DH3A 5AP2A 3SKCA 3QTIA 3FXZA 2YM7A 3F5PA 2R3MA 4BHNA 5CQWA 3KFAA 4FSQA 4EUUA 3OT3A 2VTAA 1SVHA 5BUIA 4BDGA 3SRVB 4G9RA 4AN9A 2X2MA 4EJNA 5A4EA 4O22A 3LE6A 3KN6A 3KKVA 3POOA 4FVQA 4CNHA 2IW9A 4QP4A 3CPCA 4MYGA 4NU1A 5BVFA 2R3NA 5A4LA 4GU6A 4H1MA 2XS0A 3QRUA 4YBKA 4W4VA 2GQRA 5FBNC 2AC3A 2GHMA 5DOSA 2XNEA 4IJPA 2C6KA 3PXFA 3R1YA 2YERA 4L43A 4DA5A 4S33A 4HCTA 4C4HA 3THBA 3QF9A 2FSOX 2SRCA 3BYOA 4EEVA 3ET7A 2C6MA 3E93A 4FGBA 5JQ5A 4FIHA 2BRMA 4BCMA 2OK1A 4GK4A 4XRJA 4FYNA 3KVWA 3QTUA 4E5AX 5AP5A 5HGIA 4AACA 3W16A 4ZLOA 4FKTA 4AFEA 2JKQA 5IUHA 3HUBA 4PPAA 4ZSLA 5IEYA 3OBGA 3GCVA 2WGJA 4IB5A 4MH7A 3RHXA 4C34A 1H08A 3VUMA 5C26A 3EFJA 3ORXA 1ZYJA 4RIWA 5IQDA 4AQCA 4DC2A 5M53A 4IZ7A 3RPYA 3GU8A 3FI3A 2VV9A 4RWKA 4TPTA 5K3YA 5CF8A 3W2PA 3KULA 4L68A 4DGGA 1NVSA 2YN8A 3A7FA 4QQJA 2Z60A 1J7LA 2EU9A 3KMWA 3F88A 3ZRMA 4M3QA 4MXAA 3SVVA 3UMXA 5IA2A 1CKPA 3C7QA 4QMYA 4RJ4A 5GNKA 4EZ5A 3KF7A 5CF4A 3FLQA 5DLSA 2C68A 3A60A 3KXXA 2HCKA 3W2CA 4AX8A 4PNKA 2NRYA 4BY9E 4N70A 3OCBA 1YXUA 3Q4CA 3CR0A 4GK3A 4ZZNA 5F9EA 2RL5A 1REJA 4TWOA 4EOQA 4O7SA 1K2PA 4AZWA 2XKCA 3ORKA 4BBEA 3NUAA 4CV8A 3C4ZA 4C62A 2VWBA 1JWHA 2X1NA 4ZZMA 3HGKA 5FXRA 4YTFA 2C1AA 5HNBA 3MGYA 2BTRA 5LWMA 2Z7QA 3S0OA 2EVAA 2OFUA 5ANJA 4PTCA 3D15A 3PE2A 4JBOA 4QMMA 4WG5A 2V0DA 5AIKA 3VO3A 3ZO3A 4AU8A 3HMNA 3HA6A 3BGZA 3JPVA 4JDJA 5FD2A 3D2IA 5LARA 2Y8OA 2YISA 4LYNA 5IA5A 4F6WA 2R0IA 3OROA 3V3VA 2HAKA 2ZB0A 1JBPE 3ZUTA 2JITA 2WQNA 4MD8E 4AFJA 4O7VA 2R4BA 2UW3A 3RK7A 2O64A 4PF4A 1PKGA 1XKKA 3CE3A 3MN3A 3MVJA 3DZQA 4I6FA 3NPCA 4YZCA 5AP7A 5KO1A 3MJ1A 3FKNA 3OCGA 4EOKA 3DDQA 1BL7A 1RJBA 4EONA 4V05A 4CFWA 3TZ9A 2B4SB 5G1XA 3MH1A 4BGHA 3PY0A 2XKEA 4JLCA 4QTBA 4D28A 5CSPA 4WG4A 3QRKA 3ZFXA 3TUCA 3FI8A 2IZUA 4MF1A 2BZHB 2C6OA 3G0EA 2Y4IB 4FR4A 1WBWA 4NEUA 5M4UA 4Z9LA 4G3GA 5HU3A 4BYJA 5A6OA 4CVAA 4E6CA 5J95A 3BEGA 3RINA 4AXAA 5KKRC 4YC8A 5I4NA 4PPCA 2WMTA 3DKOA 4K2RA 3FZOA 5EYCA 4W9XA 4MXZA 2C6TA 2VD5A 2HY81 4YZMA 2ITVA 2XMYA 1FGKA 4E5WA 5JKGA 3F5XA 5M4FA 3VUTA 1ZARA 5JZNA 3M11A 4KAOA 2Y6MA 2YJSA 2BHEA 4XCUA 2F2CB 4NJ3A 3KCFA 4H36A 3D0EA 5ACKA 3OEZA 4O7NA 4QYYA 4RGJA 3D14A 3MFRA 3PA5A 3R22A 1VZOA 4GL9A 2JFLA 4TNDA 5I9UA 2IVSA 2GNFA 2QQ7A 4I3ZA 5EOBA 3GC9A 4QD6A 3R7UA 4I22A 4U79A 3DBQA 5EOLA 3W1FA 4D2PA 3S1HA 4HZSA 2J7TA 2JEDA 4RZWA 1XH8A 2R9SA 4IVDA 3P5KA 4RVMA 3R7GA 3VIDA 2GQSA 3W2OA 1QCFA 4ZY6A 3L8XA 2J0JA 5BUJA 4ZLZA 3FMHA 3D5WA 3CTJA 5JEBA 2XNOA 5HNIX 2PWLA 3ACJA 3MS9A 1PYEA 5DMZA 5IG1A 4UWCA 4MBJA 3H10A 2J0MB 1URWA 3CPBA 4KBCA 4PL5A 4C4EA 4FKSA 2JGZA 4HVHA 3H9OA 1NA7A 1T46A 5EDQA 4C33A 5LMBA 3QQKA 2J51A 4PTGA 2ZMDA 3OOMA 3ZRLA 4ERWA 3N4TA 3BZ3A 3NW5A 1WBSA 1APME 4YUQA 1SNXA 4KKGA 5AAGA 4F9WA 5GZ9A 5BYYA 4LMUA 4FTIA 3Q2MA 2FB8A 3O8PA 4FTUA 2ESMA 2OW3A 4Y8DA 4BC6A 2F4JA 1PXPA 5IH5A 4ASZA 5JFXA 5L3AA 2PVYA 2ZV8A 4QQCA 3U54A 3AC2A 1OPKA 1P14A 3KMMA 4MNEA 4F08A 3KC3A 2YDJA 4IHPA 2ITWA 2W96B 2JBPA 3NR9A 1XO2B 3OUNB 4RJ7A 4I6QA 4WSYA 3D7ZA 5E8XA 4BBFA 2VX1A 1H01A 2A19B 3GQLA 4IX4A 3W8LA 1T45A 5JGDA 4EHVA 2WMRA 2R3JA 3HEGA 2F2UA 5KMOA 4JXFA 1Q99A 2EWAA 5HTCA 4TY1A 2F7EE 3E3PA 3VBQA 3FKOA 1Q41A 1JSUA 2VN9A 4DEDA 3LCOA 5EYDA 4I0SA 1ZYDA 2QO9A 2PVMA 5CI6A 3FKLA 2IG7A 3O7LB 2BR1A 5L2SA 2RFSA 4O91A 3NNWA 5LWNA 3R01A 4ZAUA 3C50A 3QC9A 2X7FA 4GT3A 4ASXA 4JJRA 4P5QA 3L8SA 4FKWA 4LGHA 4K8AA 4EWHA 3OWLA 3LIJA 1UNLA 4I0TA 2C5VA 2OF4A 3S00A 3UQGA 1SYKA 4OUCA 4PMSA 4HGSA 2BPMA 3PLSA 2YIRA 3HMMA 2WTDA 3HECA 4H1JA 4RG0A 4CT2A 4DLJA 5BYZA 1J1CA 2WTJA 2W9FB 4ZOGA 4H3QA 4QMXA 1PMNA 4U43A 3PXQA 4V0GB 1KV1A 4OTGA 5JK3A 2WMUA 4FTKA 5CQUA 2PPQA 3Q6WA 3R30A 4MVFA 3PRFA 4M67A 3ORIA 4AOJA 3D9VA 5KZ0A 4BBMA 5LVNA 1Q8YA 4KS7A 5C03A 3WZKA 2C6DA 4M66A 2PVHA 3A7HA 3OCSA 4FIJA 5BUEA 2X0GA 2XK3A 4NH1A 2OJFE 3MPMA 3OOGA 1ATPE 3C9WA 5HKMA 3SDJA 5FDPA 2Q83A 2E9NA 3UP7A 3WF6A 3RJCA 4FA2A 2VWIA 5DPVA 5A46A 1J7IA 3GC7A 5AM7A 4F7SA 3P7CA 5DRBA 5AV2A 4XV2A 4NW5A 2G1TA 2W0JA 5H8GA 5I9WA 4HYIA 2R3OA 1CKIA 3HRFA 3HX4A 2W4KA 3I6UA 3DFAA 1XJDA 3VVHA 4CG8A 3UYSA 2X6DA 5HCZA 4QYGA 5HD4A 1NXKA 1XH6A 2UZTA 2W1CA 3D4QA 3TNHA 2Q0BA 4FIGA 4FSYA 3TWJA 5IA1A 3FMKA 2I1MA 4GVJA 5ANEA 3FL5A 4K1BA 5IQHA 4L45A 3FJQE 2PUIA 4FODA 4HCVA 1L3RE 4J98A 5BX0A 5HORA 2XK6A 4JIKA 5E1SA 3FXXA 3OWJA 2FSLX 3A8XA 1ZZLA 2C5XA 3WF9A 3O51A 4QTAA 1J1BA 3FYJX 4DN5A 5J7HA 4FEUA 4XLIA 5C8KA 3G90X 3BI6A 1FBNA 1OZ1A 3VJOA 2WQOA 2QI8A 3UG2A 1W98A 5GJGA 3MTLA 4P4CA 3MY5A 2IZSA 3BBWA 4IVCA 4WRGA 3HKOA 2XK7A 4C4GA 3G9NA 3NCZA 4IX5A 4O7YA 4DEAA 3IOPA 2P33A 4YP8A 3AOXA 5CI7A 4ONAA 3CC6A 3PA3A 4I93A 2X2LA 4X2JA 3KY2A 4ENYA 3IG7A 1U4DA 4YZNA 2QOBA 4KIPA 1ZXEA 4GG7A 4G3DA 4U3YA 1QPEA 2XIXA 3NUYA 3A61A 4IBMA 1ZAOA 3SG9A 4FTQA 4E6AA 3TV7A 2ZV9A 2NO3A 4FKGA 5M08A 2J2IB 3RAHA 5C8NA 4Y5HA 3UOLA 3A99A 4IE9A 5KMKA 1WVYA 3SHEA 3O2MA 3UO4A 1LEZA 4O83A 2BFYA 4DCEA 4YLKA 5H9BA 3V6RA 4IC8A 2UVZA 4FTLA 4U42A 2QONA 1E9HA 2WOTA 4WSQA 4LRJA 4E6QA 1G3NA 3C4WA 5IDPA 4DAWA 4EL9A 2PE2A 2DUVA 4IMYA 3FMNA 3JVSA 3PPKA 3QUEA 2Z2WA 4FIIA 5AP1A 2PZIA 5HO8A 3UIXA 1OIRA 2YABA 4QP6A 1M2RA 1Q8UA 3TT0A 3ZUVA 5EM6A 1F0QA 3AMAA 5DEWA 5ANGA 2XNBA 3O7LD 2JFMA 4YURA 2PVRA 4RC3A 4R7BA 2FSTX 3QCYA 3QKMA 3ID6C 1RDQE 3JVRA 5BVOA 4TTHB 5FTQA 2VWUA 3EQPA 5EFQA 3IDPA 5AX9A 3ZMMA 4ITJA 3IGGA 5FXSA 3TJCA 4FTJA 1OMWA 4DGOA 1FVVA 5M55A 2W1DA 3HAVA 1KV2A 3NWWA 4K6ZA 2LAVA 2UVYA 5C01A 3R9OA 4M7IA 3ULIA 4OTQA 1GIHA 3KXHA 1WAKA 5KMNA 3WZJA 5BVDA 4FV3A 2XRWA 1CDKA 5BVEA 4MK0A 4WNKA 2V55A 1PXLA 4F7JA 3FHRA 1OIUA 3AQVA 4G31A 2OJIA 4KSQA 1W0XC 1ND4A 5DHJA 3OXTA 4UYNA 3OVVA 3ATTA 4IM0A 2C6EA 3OD6X 4MNEB 3UNJA 1WVXA 2VRXA 4WOVA 1OKYA 3DBFA 5HTBA 5LVPA 1PY5A 4AWIA 5CX9A 4ZLYA 5T6KA 1WBPA 4QP9A 2ZDTA 4E4MA 1PXIA 2C6LA 3UQFA 4WNMA 3PJ3A 4EYJA 4YO4A 3VS4A 3C1XA 3R63A 3AMBA 1MUOA 2P3GX 2VTMA 5E8YA 4L44A 2C3LA 2QOFA 4RWJA 5A3XA 2VTQA 1MQ4A 1JVPP 1J3HA 4D2SA 5J9YA 1YI4A 1Q8ZA 4XG6A 4BDEA 4MWHA 4GU9A 2BRBA 2RIOA 3HZTA 3QKKA 5CU6A 2XUUA 3PJ8A 1YQJA 5DIAA 2X81A 3O50A 4WNPA 5E8UA 1H8FA 3UOHA 3UVRA 4CMTA 4O7RA 2WAJA 1Q3WA 1R1WA 3R7EA 2R2PA 4QT1A 2REIA 3ZLSA 4FSTA 4A4OA 5FTGA 3FMDA 4J71A 4UMRA 1E1XA 3CKXA 4GIIA 1ZWSA 2F7XE 4K33A 4E26A 3FI2A 4ZJVA 1REKA 5T3QA 3KF4A 3RAIA 3RBWA 4J95A 2WMSA 3PG1A 2PUPA 3S4QA 4FEXA 4BWPA 2HW7A 3OZ6A 4ACHA 2FYSA 3SAYA 4E20A 5AFVA 1GNGA 4FZFB 4NCTA 4FZ6A 4TYIA 4X3FB 2B7AA 3BE2A 3LHJA 4FKIA 1GIIA 5A4TA 3Q9YA 3EL7A 5FWKK 4YJPA 2G9XA 2YIYA 5DI1A 5CAOA 3DS6A 3GEQA 1OUYA 1TQMA 5M57A 2WXVA 3UE4A 3SD0A 4D0XA 4YZDA 3E5AA 2OG8A 2HXQA 4BZNA 3TXOA 4M0YA 3C5UA 4FOCA 4TWCA 3TNWA 1IAHA 5EHYA 2ERKA 1BI7A 4FX3A 4GFOA 4AOIA 3CSVA 3EIDA 4HVGA 1YWVA 3BU6A 3T9IA 3UZTA 3OG7A 5EHLA 1OKVA 3O8TA 4A4XA 3RZBA 4IVAA 1Q4LA 1URCA 3ZO2A 4YTCA 4O0XA 5ICPA 2OH4A 3VW6A 5J5SA 4WIHA 3K54A 3TZMA 5KMIA 5L2IA 4LL5A 4RWIA 3ZSIA 3F3ZA 2QURA 5CVFA 3VF8A 2IWIA 3QL8A 5IH4A 3R28A 4D58A 4C38A 3E62A 3LFCA 4OGRA 2QU5A 3FLZA 3HV4A 4F7LA 1Y57A 2WTCA 5HG8A 2CHLA 3WF5A 3UODA 2AUHA 3QXOA 2HIWA 3RPOA 3SV0A 4G34A 3L9PA 5DVRA 4I23A 2UV2A 4GT5A 2G01A 2YLFA 3BYVA 5DT4A 5AEPA 3LMGA 1OL6A 4FTCA 4N57A 1NY3A 4UN0C 4JR7A 5LMKA 4IW0A 3MVHA 3W33A 1BL6A 3W10A 5I9ZA 4CQEA 3UNKA 3OF0A 4HGEA 3EQHA 4FC0A 4FNYA 1OGUA 3U51A 4UMPA 3MA6A 3ORPA 4TYHA 4FBXA 5EYKA 5C4LA 1XH9A 5HESA 4DH5A 3BRBA 3LXKA 4KINA 3EQGA 3NNUA 2QOLA 1DAYA 2XKFA 4FKRA 3UVPA 4EOPA 5IQCA 4B7TA 4JQ7A 4NM3A 3EQCA 2YAAA 4FT7A 3UZPA 3FMEA 1SVEA 4UZDA 3ZU7A 1LUFA 5CZIA 3ORZA 4BI2A 2WTIA 3Q9WA 4MQ1A 4IX6A 3TKUA 2I0EA 3B8QA 4CLJA 2JAMA 4IC7A 4D5KA 3R8UA 3TZ7A 5FGKA 4CMUA 1ZZ2A 2OH0E 3F82A 3F7ZA 4C3FA 3BYMA 5TT7A 3UJGA 4CEGA 5IQGA 3ENMA 4BZDA 4YBJA 3RWPA 5IMXA 2ACXA 4CFVA 4U44A 3FC2A 5JN2A 4QMOA 2X8IA 3C0HA 4I5CA 2QOQA 4G6OA 3KB7A 4APPA 4O7ZA 4CZYB 2UW6A 5D10A 5HE2A 3R2YA 4DLIA 2R3PA 4IIRA 1H1WA 3MB6A 3I1AA 2QOKA 2DS1A 3ZS5A 4NYEA 3KN5A 4DFXE 4XJ0A 3AC3A 2OXYA 5CTPA 4EI4A 3C5IA 2OICA 4R6VA 4LFIA 3F3TA 3OP5A 4O0WA 4EOSA 4L7FA 4A9RA 2IJMA 3FDNA 4I41A 2QO2A 3DCVA 2QHMA 5I3OA 4ZTNA 1M7QA 4I4EA 2OZOA 2C3KA 3DU8A 3FPQA 4U9AA 3ORNA 4YSMA 2CDZA 4Z7GA 3QTRA 2YM3A 2GS6A 3GFEA 4DHFA 4OAUC 3DXNA 4GT4A 2B52A 1ZYCA 3OW4A 3Q4ZA 4FL1A 4IWDA 4EH9A 4XOZA 2Y0AA 3UPXA 1ZLTA 3ORTA 3C0IA 4BRXA 4FL2A 3BE9A 3FHIA 3PE1A 5M4IA 3FY0A 3PXRA 2W1EA 3QQGA 4QMWA 4ALVA 3CD3A 3LM5A 3CBLA 4D4VA 3TUDA 2HW6A 2I0YA 3BIZA 3IW6A 5K5NA 3FE3A 1UWHA 2C69A 2PMNX 5HG9A 1UU7A 4W4WA 3R00A 2GHGA 4OTRA 4R7HA 4LGDA 1YHSA 3CY2A 4AP7A 3DAJA 5AR3A 1R78A 5EI2A 3TDWA 1KUTA 3PP0A 4MAOA 3PUPA 3E63A 4IM3A 3LFDA 3OCTA 1FINA 1UWJA 1Q61A 4ZS4A 3HMIA 3I79A 2OXDA 2W1HA 2JD5A 3DQXA 4R7IA 4AW1A 2AC5A 2DYLA 2JKOA 3RWQA 2IO6A 3IPHA 4FV2A 4F64A 4XV9A 1YKRA 3H9FA 4O2ZA 3V04A 5GIPE 2YWPA 4JIAA 3R8ZA 4YNEA 4DFLA 4DYMA 4EBVA 4BWKA 1FOTA 3PPJA 4B6LA 4C59A 4CRLA 3LMHA 5LVMA 4C4IA 2CCHA 1ZOEA 4CKJA 3SOAA 4EQUA 3QLFA 1PXOA 2UZNA 3R8MA 3TKIA 5K4JA 4L9IA 3A7JA 4JR3A 4KRDA 4GYIA 2I7QA 3A8WA 4G3EA 4BIBA 3MFSA 5J1WA 2OIDA 3MVLA 4FOBA 3UVQA 4IFGA 4MBIA 5F94A 2PTKA 2R3GA 3MPAA 3VS7A 4HYSA 4KABA 1ZY5A 3DT1A 3QX4A 4NIFB 5L6PA 4ITIA 2W05A 4YJNA 4ACMA 5H8EA 3FMLA 3NUPA 4KIKA 4LQMA 2OJGA 4YTHA 3W2SA 4AG8A 3GCQA 4MD9E 3ZBFA 2W7XA 4OTPA 4UBAA 4HOKA 2B9FA 5FEQA 3E3BX 4HNIA 3TKHA 4DH3A 3IO7A 5FP5A 2OXXA 3ZTXA 1F5QA 2B9IA 1PXNA 2J5EA 3BLHA 5TR6A 3GFWA 1U5RA 3IDCA 4UMTA 3LKMA 4BN1A 5CEIA 3SW4A 5L8LA 4A9YA 5KMLA 2VTHA 2QOIA 2YM8A 3VBVA 4H3BA 4O21A 5CVGA 3VHEA 4A4LA 2XEYA 4EZ3A 3TNPC 3C0GA 4UV0A 4RJ8A 3ULZA 2P0CA 5CLPA 5AP0A 4JVGA 2CCIA 4AGWA 1OKWA 3VS5A 4U97A 4QPMA 4AW0A 3UC4A 2UW0A 4C35A 4V04A 3FQEA 4O82A 3P7AA 2HZIA 1Y8GA 4YHJA 3Q52A 1H4LA 3WE4A 5AA8A 5M06A 5E90A 4JS8A 1BMKA 2W17A 1BKXA 1Q24A 2WTKC 2ONLC 1QPJA 1YDSE 3FZ1A 3R71A 4FTMA 3I5NA 4D0WA 4FMQA 1B6CB 2C3IB 3GCPA 3IONA 3NNXA 4APCA 3NMUF 1YOMA 3FSKA 5CU4A 5FBOA 3PWYA 1Q5KA 2WMQA 3LLAA 1RE8A 4IFCA 4MBLA 5IQBA 3PYYA 3JYAA 5FEEA 4F7NA 2CJMA 4KSPA 3U6JA 3QGYA 4AT4A 1PRYA 3G15A 2XK8A 3OWPA 2UZOA 5GJDA 5EW9A 1FMOE 2WMAA 1K9AA 4QMVA 4UB7A 3NVMB 4QYFA 4R3CA 5H8BA 2GNGA 4ZJJA 3VUKA 3FXWA 2UZWE 4Z3VA 1VYWA 4I6HA 4FT0A 4JX7A 5CSXA 5D7AA 3ZZEA 4RA5A 4AT5A 2VGOA 5HBHA 4RX9A 4FKOA 4TYHB 5J8IA 5CAQA 2B9HA 4DH1A 3ZH8A 3TJDA 1IR3A 4ID7A 5CEKA 3Q32A 3R9NA 3HMPA 1JOWB 3BLRA 2BHHA 2P2HA 1W83A 4DT8A 3ZRKA 5DNRA 1X8BA 4WG3A 4XG9A 4DEBA 2X8EA 3DGKA 3LMIA 2O0UA 3OBJA 3WZDA 4IQ6A 1QL6A 4YU2A 5FRIA 5EYMA 3OHTA 2YCRA 5JGAA 4MCVA 3EOCA 2O65A 4Y95A 3UO6A 2CKPA 4NJDA 4IZAA 2ZJWA 5CNOA 3FMJA 3H30A 4JDKA 5GHVA 2GFCA 3R83A 2XF0A 1WBTA 3MA3A 3R7VA 3U9NA 4Y85A 4EK4A 5IISA 2GFSA 4EZ7A 4LV5A 4TYJA 3FYKX 1DAWA 1HOWA 2OFVA 2ITOA 2PK9A 1Z5MA 2QC6A 3AC4A 1I09A 3TNIA 5AV1A 4S30A 3G33A 2XYUA 5CU3A 4M8TA 2XCKA 4IWPA 3BU3A 5JGBA 3JUHA 3PSDA 4GUEA 4TWNA 4A9SA 2R5TA 4C02A 3MB7A 2C6IA 2WU6A 5JFVA 5HG7A 3QU0A 5CANA 4PTEA 3GU7A 5BVWA 3AG9A 4MXXA 1ZYLA 2Q0NA 3ACKA 1O6LA 1XR1A 2GNLA 4PWNA 4QRCA 3BGPA 2G15A 2WMBA 4RLKA 5EI6A 5LQFA 1MP8A 2PE1A 4EOJA 2PVJA 2XEZA 4GVAA 4AN2A 3WIGA 5L8KA 3LQ3A 4YMJA 1UVRA 2YEXA 4I92A 4FZAB 4ZSEA 3I7BA 5BNJA 5CF5A 2J50A 4K18A 3R7IA 5K5XA 2JDSA 2QVSE 3C51A 3SX9A 3TEIA 4BVUA 4F9YA 5CALA 5L2WA 4XV1A 2YAKA 4J52A 4GFMA 5FM3A 3G9LX 2RFEA 4KA3A 3NYOA 3OC1A 5KMJA 3Q9ZA 2Y4PA 1SVGA 3A4OX 2O3PA 2YDIA 3TZ8A 3ZONA 2HWPA 4YPDA 5E8ZA 4AW5A 3TG1A 3LLTA 2VTOA 2ITZA 3UPZA 2FVDA 4QMQA 4RSSA 4ASDA 4EH5A 1A48A 1H25A 2CKEA 3R1NA 3TNQB 4ZIMA 3OMVA 4USEA 4CZUA 2KTYA 1SNUA 4ZEGA 4C2VA 4R3RA 2E9VA 3KMUA 3QGWA 2HK5A 2J5FA 3LFFA 3BHYA 3MSSA 4JBPA 4N0SA 4USFA 3MH0A 3P08A 1JQHA 4BCIA 4PP9A 3ODZX 3Q53A 4USDA 3ZDUA 3GBZA 4XMOA 2ONLA 4XNEA 4BDJA 4PMPA 4L00A 1H1PA 3IOKA 4TN6A 4EHEA 1J91A 2OSCA 4R1YA 4II5A 5M44A 3JXWA 4MF0A 4C4FA 2GHLA 4EHZA 4TYGA 4FTTA 3ZC5A 2GTMA 4UALA 4F0GA 3ZFMA 4CFNA 1O6KA 3IW8A 5IUGA 5FG8A 4TYEA 4CD0A 5AIRA 4ANNA 2CLQA 3ZLYA 3IS5A 5DG5A 4CXAA 1FPUA 4DCAA 4F1TA 5HE0A 1TVOA 2VGPA 3EFKA 3ERKA 5HOAA 3QCSA 3R6XA 3ANRA 3Q6UA 4WKQA 5HI2A 4D4RA 3PXZA 4IWOA 3EB0A 2H6DA 4OBQA 2HXLA 4WRSA 2YCFA 2PMIA 4I6BA 4TXCA 2VTIA 4DT9A 3EH9A 4AGCA 3GI3A 3FZTA 4C4JA 4DFZE 3KREA 4DGNA 4AT3A 1Q8TA 2A2AA 4Z55A 3T3UA 4DH7A 5FXQA 4CFFA 4EOMA 4E8AA 4RIWB 5DWRA 3ZSGA 3F2RA 5HG5A 4BCKA 3DA6A 4RJ6A 3GOKA 3RI1A 2E9UA 3R8LA 3PLAE 4U6RA 3KULB 3UIBA 2UZDA 4LUEA 1PMEA 3LFQA 4J8NA 5E8WA 2IW8A 2C0TA 3LXNA 1RW8A 3BHHA 4OTWA 3DJ7A 4ZSJA 2BKKA 5CEQA 2XP2A 2NNWB 3HP5A 4LL0A 2E9OA 1B39A 1YWRA 4ZTQA 2BIKB 3VWAA 2WMXA 3U6IA 5EQPA 4O6EA 3WZEA 2IVUA 2R7IA 3EZRA 5F95A 2JKMA 3SOCA 4A06A 2XK4A 1YRPA 2XB7A 1W84A 1Y6BA 4JNWA 4BDCA 4GMYA 3TI1A 2VTNA 3COIA 4F9AA 2ZVAA 3TACA 3RHKA 3I0OA 3P23A 3PJCA 4FSNA 4XLVA 4BCPA 4O7WA 1HCLA 2VO7A 3PVWA 3NCGA 5L2TA 4IVBA 4AF3A 1U54A 3B2TA 3LW0A 2X4ZA 3CS9A 4U40A 3R8VA 4RWLA 4CMOA 3QUDA 4ORKA 4W9WA 4FSZA 1FQ1B 2JC6A 1W8CA 2JIUA 3R73A 4YJOA 3VC4A 3MVMA 1WVWA 2QU6A 5JH6A 4M14A 3QC4A 5I9XA 4JQEA 3R9DA 2OJJA 3ATSA 5H3QA 1ZYSA 3F61A 3HV3A 2UZBA 4NZWB 3NSZA 4OTIA 3V5TA 3ZSHA 4AS0A 1PF8A 1SMHA 1U46A 2W5BA 5J1VA 3BU5A 3QD4A 3KL8A 1NVQA 1J7UA 3LOKA 3DAKA 5FM2A 5L2QA 5HZNA 3QTZA 5IDNA 3II5A 3R2BA 2OIQA 3VUHA 5LMAA 2O8YA 2X4FA 4FGRA 3RTPA 2I0HA 1Y91A 4FI1A 3DLSA 5CWZA 3FY2A 3LCDA 4IEBA 4IAYA 5JQ8A 4MNFA 4G3CA 3REPA 3F3UA 2C1BA 4ERKA 4M68A 3COHA 3HYHA 5HVKA 4CG9A 5AR2A 4CYIA 5A6NA 4Q5EA 1W7HA 3PVGA 4R78A 3OFMA 3QX2A 3V8WA 2BFXA 2IW6A 4D1ZA 3PDTA 4IH8A 2VO0A 1SZMA 2BDJA 1LP4A 3NIZA 3WI6A 4ANMA 2QG5A 3TV4A 3EQFA 3I7CA 2RFDA 3SXSA 3EHAA 3WF7A 1M2PA 2QKWB 3NYXA 4L6QA 3KGAA 2UVXA 4BCFA 5CU2A 2XCHA 4S2ZA 1OBGA 4EHGA 2CNQA 2A27A 2X7GA 2XH5A 3G51A 3VQHA 2ITXA 4KKHA 1P5EA 3FLWA 3CTHA 4WBBB 5GZ8A 3TIZA 4MHAA 5HIDA 1QPCA 2V22A 3ORLA 4FG9A 1S9IA 1U59A 1JKLA 4EH3A 2B55A 4RVLA 5GZAA 3WE8A 2P4IA 4L7SA 3BPRA 3ANQA 4FKLA 4OT6A 4UZHA 4WBOA 1M14A 4EQCA 1VEBA 1WBNA 3NUNA 3S95A 2XJ2A 4G5JA 4TNBA 5DYJA 4KIQA 2W1FA 3AD6A 5AUYA 2GPHA 3W2QA 1JSVA 4QP8A 3SW7A 3D94A 5C27A 4JDHA 3IKAA 3BCEA 4MEDA 3LM0A 4O0VA 2O2UA 1Z57A 2ZB1A 4P7EA 4QMLA 4RX8A 3ZLXA 5HBEA 5AR5A 4C7TA 3UTOA 3UZRA 4Y46A 2F9GA 4FKUA 4CFXA 4ZY5A 3LFNA 2CNUA 2J0KA 3K5UA 4BB4A 4FSWA 4J8MA 3KXMA 2P2IA 2PVFA 4EH8A 1M7NA 1P4FA 2IZTA 3OY3A 4QP7A 5IKWA 3RPVA 3QWJA 3H0YA 4KIOA 2Z7SA 4FV7A 4AZEA 4ZMFA 3RALA 3JY0A 4W8DA 3E87A 4IWQA 5G6VA 5ANIA 5AUXA 4C36A 4FTAA 4HZRA 1W82A 4XBRA 1CTPE 3IQ7A 4CV9A 5JMSA 4TZRA 3CP9A 4YLLA 4FL3A 4YSJA 2QODA 3E8NA 3QALE 4GEOA 4QP2A 4FV8A 3U8WA 1QMZA 3VUIA 5CZHA 4A9UA 4C37A 4I5HA 3QKLA 5D41A 5C8MA 2QCSA 3HDMA 4GW8A 1ZMWA 2RG5A 5F20A 5HNGA 3P78A 4LMNA 3F3VA 5A4QA 5IEVA 4RQVA 2QD9A 3P9JA 4HGLA 2OZAA 3LPBA 5E1EA 1JSTA 4NSTA 4BTJA 3CY3A 3WZUA 3TL8A 2RGPA 2W1ZA 3FQSA 4FT5A 5EG3A 3F6XA 3F9NA 1OPJA 1YDTE 2Z7RA 4KWPA 2QOHA 3QTQA 1Q3DA 1TQPA 3PIXA 5E7RA 4RT7A 1PHKA 4W4YA 3GB2A 3ROCA 4N4SA 2XYNA 3PTGA 3U87A 2RF9A 5AAFA 3RCDA 1O6YA 3UP2A 2C3JA 4JOAA 1KE9A 4B8MA 4C3PA 4UMQA 3NUXA 4CLIA 1H26A 3F69A 3FL4A 3HV7A 3Q60A 3QWKA 4L3JA 3UIUA 4ALUA 4B9DA 4U41A 4NM7A 4BDHA 4EC9A 4RX5A 4M84A 5AUUA 4KBKA 2Y4IC 4DBXA 3VQUA 4GV1A 4O2PA 5IU2A 1OIQA 3FUPA 4XP3A 5CENA 2WZJA 2PMOX 3WYYA 2FO0A 4C3RA 5I9YA 1FVRA 1HCKA 2A0CX 3GXLA 3NNVA 2H8HA 4Q9SA 4K11A 2ITQA 5E8TA 4G2FA 4BCQA 5KKRB 4L46A 5GIOE 2EXCX 2YITA 4FNWA 4LRKA 4F0IA 4GKHA 4NTTA 1I44A 3NAYA 4TWPA 5TE0A 4DH8A 5EDRA 2CKOA 4WA9A 2CKQA 5M09A 4C61A 4O7TA 2YHVA 2W5HA 1GAGA 3LQ5A 1Z9XA 5AUTA 2O63A 3TM0A 4F09A 4KB8A 5B0XA 2VX3A 4G1WA 2ZDUA 4Q9ZA 4YLJA 4TRLA 3HV5A 3RNYA 2BZKB 1YWNA 3ORMA 4DITA 2UUEA 3BLQA 4HCUA 4IAAA 5AV0A 5HTIA 1U54B 4AA5A 5HE3A 5KNJA 4UXLA 2YZAA 2RFNA 2HELA 3F3WA 4XUFA 3VRYA 4NM0A 3GCUA 3L1SA 4TT7A 3LFEA 2V62A 3ROYA 4RIXA 5E91A 1KE5A 5KUPA 2WELA 2YFXA 3BKBA 4M0ZA 2VWZA 2PZYA 3BWJA 3E8CA 4KBAA 2YDKA 4OW8A 4QPSA 4DTAA 3NW7A 3EJ1A 3N4UA 3VNTA 3EN6A 3R1SA 2EXMA 1JKKA 2Y6OA 3C4FA 4QNAA 3OXZA 2ETMA 2ZYBA 1H28A 4RFMA 5DFPA 3DAEA 4UEUA 3V8SA 4WD5A 4YC6A 4EYMA 2ETKA 1OKZA 2HENA 3AD5A 3EYHA 3TDVA 4AGDA 2H34A 3HV6A 4DTBA 3AC5A 2BTSA 3L9MA 3G0FA 5D11A 2ITTA 4O27B 4AE9A 3M2WA 4GKIA 3L8VA 5C1QB 4EH4A 4RJ5A 4DEEA 3ALOA 5EQYA 5CYIA 4IANA 3HL7A 2B53A 4ALWA 2ZOQA 2GS7A 3SG8A 3BHVA 3IDBA 2UZLA 3CD8A 4TL0A 5E8SA 5BPYA 3AT4A 3KRWA 5K0KA 3VBXA 3D7TA 4G9CA 1KWPA 3CKWA 3R0TA 3RCJA 2XJ0A 3M1SA 4MWIA 4AAAA 4NUSA 4JI9A 4X7QA 1H1QA 1JKTA 2X9EA 5ACBC 3COKA 5KBRA 5F4NA 3QRIA 3NZ0A 4G16A 3MPTA 4YJSA 4F99A 3R9RA 2QR7A 3NW6A 5DEYA 1PXKA 4O84A 1ERKA 4DINA 2VX0A 3U55A 3VS2A 3UOKA 5IEXA 3ZDIA 3H0ZA 4PX6A 3QQHA 2F57A 4HPTE 4K9YA 4NTSA 3UYTA 1IA9A 1Q62A 4BIDA 4I1ZA 3ALNA 4RA4A 4W8EA 2QKRA 4X2FA 5DBXA 3RM6A 4QPAA 2JDTA 5JRSA 2QLQA 2GNIA 2CNVA 4B4LA 4D1SA 1MRUA 1G8SA 4O81A 3PZEA 4HNFA 4N6YA 1E1VA 3CGOA 4EQMA 4WHZA 4S34A 4F0FA 4S31A 3EKNA 4X0MA 1NVRA 2G2IA 1MRVA 5GJFA 2PYWA 2FH9A 2R7BA 3HAMA 1DS5A 1XBBA 2WQBA 3DJ6A 1GOLA 2OGVA 3H3CA 4RPVA 3DNDA 1OI9A 4ENXA 1OL5A 2J9MA 2XVDA 3CTQA 4P90A 2YZLA 3DLZA 2CGUA 1G5SA 3LCKA 3P1AA 5ITAA 4IAZA 3V51A 3QBNA 4RIOA 2WQMA 1PKDA 3DDPA 5HCXA 3RZFA 4AUAA 4RJ3A 4B0GA 2YCQA 4QQ5A 3GP0A 3KRLA 5CT0A 4RC2A 4UY9A 3GNIB 5ETFA 4BCNA 5CSHA 3VRZA 3I81A 3D5XA 3EN7A 4BTMA 4NKSA 4BWXA 2ITYA 1H07A 2WEVA 3TN8A 3EL8A 4BI0A 4EH2A 3IK3A 5KHXA 3V5LA 5DR9A 4FVRA 3QCQA 3C4XA 2PU8A 1YW2A 2PY3A 1ZY4A 1XH4A 4ZP5A 4FTNA 1WZYA 3QCXA 3QQFA 4BYIA 5CASA 3AXWA 5KCVA 4XH6A 4PL4A 4QMUA 3CCNA 4PDYA 5DR2A 1YXTA 2YWVA 2C5OA 2V5QA 5H2UA 4R77A 4UWBA 1ZOGA 3BGQA 2OZAB 2GCDA 2EUFB 4XV3A 2EXEA 2XIKA 4EUTA 3C4CA 4YTIA 4MXOA 4DFYA 5JFWA 5HHWA 4GS6A 2VTTA 4EBWA 3SLSA 1H1SA 2XBAA 4J99A 3NYVA 4DFNA 3EQDA 4P5ZA 4O0RA 4QP3A 3P4KA 3RMFA 1YDRE 2VTPA 4X6QC 2GTNA 2Z7LA 4CT1A 1P2AA 3DXPA 4IZYA 4EKKA 3TTJA 3FLYA 5KX8A 2JIVA 3LFSA 3MJ2A 4O0UA 1M17A 4W4XA 3K3IA 3W2RA 5HLWA 1VYZA 2BDFA 2FA2A 4DG2E 1OPLA 3AGMA 1OL1A 4B8LA 2ERZE 1VR2A 3NGAA 4EWQA 2YJRA 4XG2A 3Q04A 4FZ7A 1F3MC 3BELA 4LM5A 4AZVA 4A9TA 4B99A 4BDKA 2YIQA 3CGFA 4CTBA 4OBOA 4RFYA 5EQEA 1JLUE 3BQCA 4I5MA 2ZM1A 2FGIA 1CMKE 2GDOA 3AC8A 3BQRA 4IZ5A 4PUZA 4RIYA 5CAUA 3JY9A 5D9HA 5FLFA 4EK6A 5FQDC 4FIEA 4F6UA 2I6LA 4M97A 5AAEA 2UW9A 4BCJA 3KK8A 4IB3A 3E8DA 3EZVA 3QHRA 3POZA 1FVTA 2PVNA 2VWVA 4E73A 4E5BA 3O71A 5AUVA 5J79A 2BRGA 2OKRA 3V5PA 5M4CA 4AA0A 4FTRA 4ARKA 3ZFYA 1WMKA 4IJ9A 4O0YA 4BCHA 1PXMA 2X39A 3MTFA 4PPBA 3KXNA 2CPKE 2QOCA 2WIHA 4RC4A 5EM8A 1Q97A 3QQLA 2PUNA 1OVEA 4FT3A 4GFGA 3BX5A 4O6LA 3QZGA 4RIXB 4DGLC 3BHUA 1YXVA 4EOLA 1YOLA 2CGXA 3SQQA 1JNKA 5TO8A 2W99B 4S32A 5I0BA 4BZOA 3FI4A 3PPZA 4U0IA 2HYYA 4U5JA 3LCTA 3O8UA 4H58A 4BDIA 2X9FA 3BYSA 4WNOA 2BKZA 1YXXA 4XP2A 4BGGA 4RBLA 3RVGA 4FV5A 2NPQA 3R9HA 3QTXA 2UW8A 2NP8A 5ANDA 2BALA 2WB8A 3Q4TA 2QG7A 3CIKA 4QTDA 3G6GA 4FKPA 3E92A 3DOGA 3PIZA 3LAUA 4TKSA 3EYGA 4GG5A 3UOJA 2GMXA 2UZEA 2CGWA 3PXYA 2AYPA 4Q5HA 5BMMA 4V0GA 2I40A 3OTUA 4U3ZA 2BZJA 2XIYA 3ITZA 4ANBA 4EH7A 2X7OA 5J5TA 3RPRA 3UBDA 4CZTA 5JT2A 3N51A 3MYGA 3KU2A 3V01A 3D7TB 3ZYAA 3AT2A 3UNZA 3NVKI 5EW3A 5AUWA 3W18A 3QYWA 2P55A 1KSWA 3BEAA 1MRYA 2C30A 2HZNA 2ZV2A 4M13A 3CEKA 5C9CA 5LJJA 3KXZA 2JDVA 4D9TA 3QZFA 2NRUA 3R8PA 2VZ6A 2IN6A 3Q3BA 4NL0A 4IDTA 3RKBA 4D1XA 4H05A 4G5PA 5KHWA 3OY1A 4ZK5A 1V0OA 2QOOA 3OT8A 3NUUA 4FZDB 4JRNA 2C4GA 3NUSA 1YHVA 3VW8A 1O9UA 2CLXA 5K4IA 2DWBA 3GU4A 4XG3A 4XP0A 4GK2A 2F7ZE 4HGTA 4O1PA 4ZTLA 5TF9A 2VAGA 3OXIA 4EK8A 4OAVB 5IA0A 4O1OA 4U45A 5LVOA 3ZM4A 2OWBA 2QO7A 1KOAA 5BYLA 4NM5A 3RPSA 2B1PA 3R7OA 3EFWA 3I6WA 5CEMA 1OITA 3G5DA 3ZUUA 4RMZA 2Y7JA 5L8JA 2QLUA 3QD3A 3FEGA 5KZIA 4JBQA 5IA3A 3G6HA 2FSMX 5ETCA 4L67A 4MTAA 4BIEA 3EQRA 3UGCA 5CF6A 2XK9A 5CVHA 4ZS0A 2WMWA 1IG1A 3FMMA 3ZEPA 4XX9A 3GVUA 3PVUA 4AGUA 3HDNA 4ZZOA 3IW7A 4BTFA 3QAME 3BV3A 2B9JA 2C5YA 2W06A 4X2GA 2HY0A 2PMLX 5DT3A 3TIYA 4UXQA 3ETAA 5EHOA 3VJNA 4GIHA 4CKRA 3EQBA 4LG4A 1BI8A 1STCE 3PVBA 2A4LA 3QFVA 4X3FC 4C58A 5F1ZA 3QTSA 4ZMEA 4D9UA 3W32A 4PL3A 5A4CA 3VS0A 1R39A 5IH6A 3ELJA 1M52A 4OTFA 1YXSA 2I0VA 2WPAA 5AX3A 1YI3A 4ZTRA 3KXGA 5ANOA 4O86A 3E7VA 3MFTA 5LVLA 1PXJA 1OM1A 4QMSA 4E4XA 2H9VA 1XWSA 4E1ZA 1BLXA 5LCKA 2JBOA 4G6LA 4Y5QA 3W8QA 4LOQA 4YZ9A 3RGFA 5JFSA 3UQCA 3DQWA 1IASA 4FICA 1UNHA 1TKIA 1UV5A 2R3FA 3DTWA 3HMOA 3WYXA 4AE6A 3MY0A 5HBJA 4JAJA 5FTOA 2G2HA 3VAPA 5EDPA 1LEWA 4FEWA 3L9LA 5CSVA 4QNYA 4BFMA 3CQWA 3CLYA 1M2QA 3IW5A 3KRJA 3GC0A 3MBLA 3MH2A 2B0QA 2FUMA 3VUGA 4ANOA 5TKDA 4D5HA 5AV3A 3PY1A 2Z8CA 3MH3A 2W4OA 3U9CA 2PL0A 5DR6A 3BWFA 4XEYA 4CFMA 3KA0A 4RRVA 5I5ZA 4PDOA 2GU8A 4FYOA 4F4PA 3MW1A 4F1MA 1IAJA 3MV5A 4MXYA 1UU3A 2PVLA 2V7OA 2WMVA 4G17A 4LUDA 3D5UA 2YM4A 3Q2JA 3ZO1A 1OIYA 4ACCA 4G6NA 5FEDA 3DZOA 2XBJA 2C0OA 4L3PA 3HRCA 3WARA 3Q4UA 3P79A 3EFLA 4FT9A 3O0GA 3GT8A 4YJQA 3LJ1A 1GZNA 3QD2B 1YOJA 4ZTMA 5HCYA 3R7YA 2VO3A 4H39A 3RK5A 4CFUA 3DXQA 1OL2A 3OS3A 5CXZA 3P0MA 1FGIA 2VTRA 3VS1A 2WFYA 5E92A 3NX8A 4HPUE 2OI4X 2CN5A 5AR8A 3E7OA 3PFQA 1PMVA 2VTLA 4GJ3A 4KIKB 4RIYB 4QMNA 3QLGA 4Y83A 3AGLA 2YIWA 3FBVA 1AD5A 4DEGA 3VF9A 3A7GA 2WHBA 4JT3A 1IEPA 4LGGA 5AP4A 4QP1A 2R3IA 2CGVA 2J6MA 5FDXA 2W1GA 3VUDA 3A7IA 4OLIA 2R0UA 4D55A 4F1OA 4J53A 5IUIA 4BKZA 1YI6A 3QXPA 4F70A 1V0BA 2BIYA 5L4QA 2JIIA 3U4WA 4A07A 5CAVA 1WFCA 5AWMA 3RP9A 4ANSA 4FNZA 4FSUA 4LV8A 4PDPA 2ZMCA 3FAAA 3MFUA 5EI8A 3W55A 4F6SA 3U6HA 3V5WA 4E3CA 3K2LA 1XBCA 3HNGA 3QRTA 4OTDA 4IM2A 4PV0A 4QQTA 3ZOSA 2RG6A 3E8EA 1YHWA 1V1KA 3PRIA 1WCCA 4KS8A 4OTHA 2IPXA 4WUNA 2EB3A 1GZKA 1UU9A 2YA9A 4XG8A 3SXRA 3T9TA 3B8RA 3LJ0A 4DG0E 3A4PA 2QNJA 2EB2A 5ANKA 1JAMA 2IZRA 1XHAA 4BCOA 3AMYA 5EK7A 2IVTA 3NEWA 5HLPA 4YHTA 4IDVA 1KE7A 1IA8A 1WBVA 3FWQA 4OBPA 1CKJA 5HO6A 3I4BA 3KK9A 2YLEA 4I21A 1QPDA 4FUYA 4UX9A 2ZV7A 4BKYA 2XM9A 4U80A 4CYJA 3FZSA 3HVCA 3A62A 3LQ8A 4IXPA 5EM7A 5EW8A 3V6SA 4FSRA 5D12A 2XRUA 4IACA 4DTKA 4X2NA 1GIJA 4X3FA 3IGOA 2Z02A 2UW5A 3DB6A 5CAPA 3QRJA 1WBOA 1OECA 4RLLA 4IAFA
chains in the Genus database with same CATH superfamily
2YIXA 5JRQA 3B2WA 4XYFA 4L42A 5K9IA 1XBAA 4FUXA 5BMSA 5M07A 2J4ZA 2WTWA 4O38A 4QMPA 5EKNA 3ZBXA 3BV2A 4DEIA 3PA4A 1G8AA 3ZXZA 1NT2A 4O96A 3A2CA 4J1RA 2BAQA 3CQUA 2XNPA 4GUBA 3VBWA 4O4EA 2QHNA 4FEQA 1H0WA 3DKGA 3JS2A 5IQAA 4BTKA 3K5VA 4FSMA 4WUAA 4R8QA 4KKEA 1XMLA 4GJ2A 5BVNA 5D7VA 1H1RA 4AZTA 3QD0A 3LXLA 5EH0A 3KQ7A 3DV3A 2OU7A 2UW7A 3FLSA 5M56A 4YZBA 2JAVA 1GY3A 2JKKA 4QYEA 3EQIA 3H9RA 5CXHA 2GNJA 3FQHA 4RVKA 3T8OA 3ML1A 1TFFA 4XG4A 4PMTA 4WO5A 3TTIA 3FZPA 3VBTA 3PIYA 3GCSA 4HVDA 5CEPA 5E9EA 4NWMA 4IAIA 3VS6A 3Q9XA 2WD1A 4X21A 1V0PA 2BCJA 2C5NA 1H27A 4M69A 4Q2AA 3LZBA 5IMEA 2PULA 5CEOA 3DY7A 3LJ2A 1ZRZA 3WILA 5HX6A 2OO8X 2WQEA 4BICA 2OF2A 4A7CA 4XG7A 3OEFX 2C0IA 5LXMA 4FK6A 4O4FA 3S3IA 2AQXA 5CU0A 4EC8A 4NCTC 4FG8A 4H3PA 4FG7A 4F65A 4PDSA 3DKFA 3V5JA 4EKLA 3EN5A 2J0IA 2LGCA 3HA8A 4ZSAA 3BL7A 3BYUA 4HYUA 4M12A 3ZXTA 4QMZA 2BRHA 4UWYA 4AOTA 3I5ZA 4JDIA 3N4VA 3WIKA 3F7WA 2UW4A 2GSFA 4DG3E 2OJ9A 2VWWA 4O0TA 4J97A 4NFNA 1DM2A 4G3FA 3PXKA 4L01A 4YJRA 2VNYA 4PMMA 4MXCA 4AAYA 4YPSA 3P7BA 5AR4A 3SC1A 1PYXA 3T3VA 4PP7A 5TOZA 2BROA 4Y73A 2DQ7X 5ETIA 2CSNA 1U5QA 4FV6A 3I60A 5AADA 5E8VA 3MESA 2BILB 3Q96A 4MD7E 4O0SA 2C47A 3O96A 3UIMA 4BDBA 4EORA 2BRNA 4DGMA 4FIFA 4FEVA 2GQGA 2OBJA 2J90A 3GGFA 2ITPA 2HWOA 3VS3A 4E4LA 4AA4A 4BR3A 5KE0A 5AV4A 5AUZA 5AJQA 5I9VA 4X6RA 2GNHA 5J9LA 3MIYA 3RK9A 4ACGA 4DFUA 5B2KA 5DE2A 4D2WA 4RZVA 4TW9A 3COMA 5E4HA 4HYHA 2CMWA 4ITHA 4NFMA 4DFBA 5B7VA 2WIPA 5B2LA 1P4OA 4R5YA 2RSVA 1B38A 2KULA 1OB3A 4QO9A 2IVVA 2WTKB 3KRRA 3KVXA 4LOPA 4MQ2A 3EN4A 2QR8A 3QTWA 3DK7A 4NT4A 4XRLA 5EM5A 5AMNA 3ZLWA 5HIEA 5CY3A 3NLBA 1GZ8A 4U7ZA 1BX6A 4ACDA 3ZHPC 5IA4A 1LR4A 3ENHA 3VULA 5HLNA 5FUTA 2E2BA 5IQEA 2UZVA 4XHKB 2BMCA 5IZFA 2R64A 3NYNA 4LRMA 4YO6A 5LMKC 2X2KA 3OWKA 4R1VA 1UKIA 4FE2A 4C57A 4KUJA 4I20A 4L52A 4XBUA 2WOUA 4O7LA 1CM8A 3C13A 3VBYA 2Y9QA 5ETAA 5DGZA 4QTEA 3EN9A 3D5VA 1A9UA 3RNIA 5JSMA 4HVSA 2X6EA 5J87A 3HUCA 4CTCA 3G2FA 2X8DA 4BCGA 5A54A 3RAKA 1OBDA 4GH2A 4V01A 2PE0A 5HEZA 5M51A 5DN3A 5IPJA 4YNOA 2WTVA 4FF8A 4E6DA 4ZTSA 2ZAZA 2CN8A 3PSCA 4PQNA 2GS2A 3SXFA 3ZO4A 2J0LA 5BVKA 5HU9A 2JLDA 3EWHA 4L8MA 5CT7A 1NW1A 4FKVA 4I4FA 4I5PA 3RM7A 1XQZA 4BL1A 1ZMUA 2WNTA 4JL9A 4JBVA 5IF1A 4BDFA 2XM8A 1VJYA 1BYGA 2ZM4A 4JRVA 4YJVA 4ASEA 3DBCA 5KMMA 2YCSA 3SA0A 4P2KA 4YR8A 2BDWA 3R04A 3FC1X 5HQ0A 2B54A 3MY1A 4XOYA 3C4EA 1UA2A 5AR7A 4RFZA 3BHTA 3R21A 4L53A 4U81A 5GINE 3MDYA 3MIAA 2PZPA 3KRXA 2AEGA 3SRVA 4C2WA 3MI9A 4M15A 5L6OA 4IX3A 5EKOA 3WOWA 3KIOC 4GRBA 3N9XA 3Q5ZA 1ZMVA 2PSQA 3Q5IA 1H24A 3AC1A 4FV1A 2R3KA 3DJ5A 4C0TA 4BF2A 4FKQA 2XIRA 3U4UA 4CQGA 3L9NA 4NIFA 3LXPA 4QMTA 1XH7A 1LPUA 2HZ4A 2BVAA 4GYGA 4FV9A 1R3CA 1PJKA 4J7BA 3P86A 4BKJA 4ZSGA 3QQUA 4K77A 4NW6A 1AQ1A 1OUKA 4FTOA 5J7BA 2OLCA 4MKCA 4D4YA 2XNNA 3OW3A 2YACA 2E9PA 1YVJA 4FK3A 4E93A 3DFCB 3F66A 4LOOA 4Z16A 3ZM9A 3H4JA 1H00A 4BI1A 3M42A 2VO6A 2XA4A 3D83A 2VNWA 3PY3A 4I24A 3QHWA 1KOBA 3KEXA 4FKJA 3UMWA 4CCBA 5HVJA 5J9ZA 3VONA 5HE1A 2W5AA 4AZFA 4ANQA 3QA0A 3R02A 4X3JA 3RAWA 3GQIA 2OIBA 3PSBA 3CXWA 5CSWA 1RQQA 3UDBA 3MWUA 5HX8A 3DB8A 3TCPA 4PNIA 4YGAA 3PUFC 4HJOA 4NKAA 1IRKA 2VTSA 4EK3A 2HZ0A 3F2AA 4JG7A 1K3AA 3S2PA 2W9ZB 3QA8A 4YJTA 5HO7A 3NS9A 4IB0A 2UZUE 1UNGA 1Y6AA 1DI8A 2WU7A 3F2NA 4X2KA 4Z7HA 3CJFA 4FNXA 3JR1A 3ZEWA 4GSBA 4EJ7A 5HD7A 4RX7A 3AT3A 2W4JA 3DTCA 5C4KA 3L8PA 2ITNA 3NDMA 3O23A 5HIBA 3QQJA 2R3HA 1GZOA 1SM2A 4IB1A 1JKSA 1MQBA 1ZOHA 3DKCA 3HP2A 1R0EA 2PZRA 2YM6A 4I94A 4M69B 4Y72A 2R3QA 3VN9A 4HW7A 4QEBA 3GENA 2XJ1A 2BAKA 3PWDA 4YC3A 2WKMA 1Y8YA 2VUWA 1A06A 3O17A 4KRCA 3DBDA 5KBQA 1UU8A 3NRMA 3K3JA 3V5QA 1R0PA 3ODYX 4CGAA 4FV4A 4ANLA 4HVIA 4BDDA 3IW4A 3IECA 2RKUA 1H0VA 4BGQA 2X0QA 4F63A 2V7AA 3FPMA 2PUUA 4QYHA 3VHKA 1XH5A 4UYAA 4EH6A 4R5SA 4YHFA 4XS2A 4WT6A 3OTVA 4FV0A 5JZJA 3UO5A 4FVPA 4OT5A 4JAIA 2R3LA 3QUPA 4EOIA 3EKKA 4AW2A 1PW2A 1KE8A 3HRBA 2VWYA 4JX3A 3WF8A 1TQIA 4YJUA 4AN3A 3LFAA 1PMUA 2XZSA 3LCSA 3F5UA 3FZRA 3GC8A 4BHZA 4MX9A 2BAJA 4QOXA 3GU6A 3WBLA 4CKIA 4UMUA 2O5KA 3FSFA 1Q8WA 4J96A 4EK5A 2VWXA 2BZIB 3FV8A 4R3PA 2XIZA 3CJGA 3QYZA 4OR5A 3ZZWA 3NIEA 5K0XA 4DDGA 2HOGA 5FP6A 3GU5A 4JQ8A 3I0QA 5L6WL 4ZTHA 4F9CA 5IQFA 5AA9A 4KD1A 1BUHA 5IQIA 2G2FA 5B2MA 5BV3A 5D1JA 4PY1A 2WO6A 3E88A 2H96A 3PZHA 5DRDA 4F9BA 1CSNA 1FMKA 1KE6A 1OL7A 3CQEA 4D4SA 3W0MA 4L3LA 5AP6A 2JDOA 3AD4A 4RVTA 3QZIA 5A14A 2YM5A 4E7WA 3FLNC 5A9UA 2XKDA 2JDRA 4DBNA 5I3RA 1AGWA 5HVYA 2PHKA 5DT0A 3UG1A 2ITUA 5BQ0A 4N6ZA 2ETRA 2VTJA 3QZHA 5AP3A 3TV6A 5LOHA 4BDAA 3GOPA 1EH4A 3EMGA 4I0RA 2W1IA 4D2RA 3DK3A 4D2TA 4ZY4A 3KCKA 2WEIA 3PJ2A 2R3RA 3PG3A 2ZM3A 3DPKA 4IADA 3DK6A 3GUBA 4DEHA 4EOOA 4DE4A 2PVKA 4C8BA 1S9JA 4CSVA 1JPAA 3BBTB 3F5GA 2A1AB 4AZSA 1L8TA 2PZ5A 3TUBA 3ZCLA 3OUKA 1UKHA 3LFBA 4RQKA 5CNNA 3V8TA 4CCUA 3ZC6A 3D2KA 3R1QA 2XNGA 2BUJA 4IAKA 1DI9A 1GJOA 3NAXA 3PJ1A 4U8ZA 4CRSA 5AM6A 3SGCA 5HICA 4BJJB 4E4NA 4DF3A 5CS6A 4D2VA 2IF8A 5LCJA 4ZJIA 4QTCA 5DA3A 4K0YA 4JG8A 3DBEA 3DNEA 5T68A 4LI5A 3PP1A 3LVPA 3HLLA 4PRJA 4KNBA 2F49A 3UC3A 4JG6A 4GCJA 2VU3A 4ZXTA 2XNMA 4NK9A 3E64A 5DH3A 5AP2A 3SKCA 3QTIA 3FXZA 2YM7A 3F5PA 2R3MA 4BHNA 5CQWA 3KFAA 4FSQA 4EUUA 3OT3A 2VTAA 1SVHA 5BUIA 4BDGA 3SRVB 4G9RA 4AN9A 2X2MA 4EJNA 5A4EA 4O22A 3W0QA 3LE6A 3KN6A 3KKVA 3POOA 4FVQA 4CNHA 2IW9A 4QP4A 3CPCA 4MYGA 4NU1A 5BVFA 2R3NA 5A4LA 4GU6A 4H1MA 2XS0A 3QRUA 4YBKA 4W4VA 2GQRA 5FBNC 2AC3A 2GHMA 5DOSA 2XNEA 4IJPA 2C6KA 3PXFA 3R1YA 2YERA 4L43A 4DA5A 4S33A 4HCTA 4C4HA 3THBA 3QF9A 2FSOX 2SRCA 3BYOA 4EEVA 3ET7A 2C6MA 3E93A 4FGBA 5JQ5A 4FIHA 2BRMA 4BCMA 2OK1A 4GK4A 4XRJA 4FYNA 3KVWA 3QTUA 4E5AX 5AP5A 5HGIA 4AACA 3W16A 4ZLOA 4FKTA 4AFEA 2JKQA 5IUHA 3HUBA 4PPAA 4ZSLA 5IEYA 3OBGA 3GCVA 2WGJA 4IB5A 4MH7A 3RHXA 4C34A 1H08A 3VUMA 5C26A 1XMMA 3EFJA 3ORXA 1ZYJA 4RIWA 5IQDA 4AQCA 4DC2A 5M53A 4IZ7A 3RPYA 3GU8A 3FI3A 2VV9A 4RWKA 4TPTA 5K3YA 5CF8A 3W2PA 3KULA 4L68A 4DGGA 1NVSA 2YN8A 3A7FA 4QQJA 2Z60A 1J7LA 2EU9A 3KMWA 3F88A 3ZRMA 4M3QA 4MXAA 3SVVA 3UMXA 5IA2A 1CKPA 3C7QA 4QMYA 4RJ4A 5GNKA 4EZ5A 4LV7A 3KF7A 5CF4A 3FLQA 5DLSA 2C68A 3A60A 3KXXA 2HCKA 3W2CA 4AX8A 4PNKA 3W0PA 2NRYA 4BY9E 4N70A 3OCBA 1YXUA 3Q4CA 3CR0A 4GK3A 4ZZNA 5F9EA 2RL5A 1REJA 4TWOA 4EOQA 4O7SA 1K2PA 4AZWA 2XKCA 3ORKA 4BBEA 3NUAA 4CV8A 3C4ZA 4C62A 2VWBA 1JWHA 2X1NA 4ZZMA 3HGKA 5FXRA 4YTFA 2C1AA 5HNBA 3MGYA 2BTRA 5LWMA 2Z7QA 3S0OA 2EVAA 2OFUA 5ANJA 4PTCA 3D15A 3PE2A 4JBOA 4QMMA 4WG5A 2V0DA 5AIKA 3VO3A 3ZO3A 4AU8A 3HMNA 3HA6A 3BGZA 3JPVA 4JDJA 5FD2A 3D2IA 5LARA 2Y8OA 2YISA 4LYNA 5IA5A 4F6WA 2R0IA 3OROA 3V3VA 2HAKA 2ZB0A 1JBPE 3ZUTA 2JITA 2WQNA 4MD8E 4AFJA 4O7VA 2R4BA 2UW3A 3RK7A 2O64A 4PF4A 1PKGA 1XKKA 3CE3A 3MN3A 3MVJA 3DZQA 4I6FA 3NPCA 4YZCA 5AP7A 5KO1A 3MJ1A 3FKNA 3OCGA 4EOKA 3DDQA 1BL7A 1RJBA 4EONA 4V05A 4CFWA 3TZ9A 2B4SB 5G1XA 3MH1A 4BGHA 3PY0A 2XKEA 4JLCA 4QTBA 4D28A 5CSPA 4WG4A 3QRKA 3ZFXA 3TUCA 3FI8A 2IZUA 4MF1A 2BZHB 2C6OA 3G0EA 2Y4IB 4FR4A 1WBWA 4NEUA 5M4UA 4Z9LA 4G3GA 5HU3A 4BYJA 5A6OA 4CVAA 4E6CA 5J95A 3BEGA 3RINA 4AXAA 5KKRC 4YC8A 5I4NA 4PPCA 1W2FA 2WMTA 3DKOA 4K2RA 3FZOA 5EYCA 4W9XA 4MXZA 2C6TA 2VD5A 2HY81 4YZMA 2ITVA 2XMYA 1FGKA 4E5WA 5JKGA 3F5XA 5M4FA 3VUTA 1ZARA 5JZNA 3M11A 4KAOA 2Y6MA 2YJSA 2BHEA 4XCUA 2F2CB 4NJ3A 3KCFA 4H36A 3D0EA 5ACKA 3OEZA 4O7NA 4QYYA 4RGJA 3D14A 3MFRA 3PA5A 3R22A 1VZOA 4GL9A 2JFLA 4TNDA 5I9UA 2IVSA 2GNFA 2QQ7A 4I3ZA 5EOBA 3GC9A 4QD6A 3R7UA 4I22A 4U79A 3DBQA 5EOLA 3W1FA 4D2PA 3S1HA 4HZSA 2J7TA 2JEDA 4RZWA 1XH8A 2R9SA 4IVDA 3P5KA 4RVMA 3R7GA 3VIDA 2GQSA 3W2OA 1QCFA 4ZY6A 3L8XA 2J0JA 5BUJA 4ZLZA 3FMHA 3D5WA 3CTJA 5JEBA 2XNOA 5HNIX 2PWLA 3ACJA 3MS9A 1PYEA 5DMZA 5IG1A 4UWCA 4MBJA 3O5AA 3H10A 2J0MB 1URWA 3CPBA 4KBCA 4PL5A 4C4EA 4FKSA 2JGZA 4HVHA 3H9OA 1NA7A 1T46A 5EDQA 4C33A 5LMBA 3QQKA 2J51A 4PTGA 2ZMDA 3OOMA 3ZRLA 4ERWA 3N4TA 3BZ3A 3NW5A 1WBSA 1APME 4YUQA 1SNXA 4KKGA 5AAGA 4F9WA 5GZ9A 5BYYA 4LMUA 4FTIA 3Q2MA 2FB8A 3O8PA 4FTUA 2ESMA 2OW3A 4Y8DA 4BC6A 2F4JA 1PXPA 5IH5A 4ASZA 5JFXA 5L3AA 2PVYA 2ZV8A 4QQCA 3U54A 3AC2A 1OPKA 1P14A 3KMMA 4MNEA 4F08A 3KC3A 3UDZA 2YDJA 4IHPA 2ITWA 2W96B 2JBPA 3NR9A 1XO2B 3OUNB 4RJ7A 4I6QA 4WSYA 3D7ZA 5E8XA 4BBFA 2VX1A 1H01A 2A19B 3GQLA 4IX4A 3W8LA 1T45A 5JGDA 4EHVA 2WMRA 2R3JA 3HEGA 2F2UA 5KMOA 4JXFA 1Q99A 2EWAA 5HTCA 4TY1A 2F7EE 3E3PA 3VBQA 3FKOA 1Q41A 1JSUA 2VN9A 4DEDA 3LCOA 5EYDA 4I0SA 1ZYDA 2QO9A 1TZDA 2PVMA 5CI6A 3FKLA 2IG7A 3O7LB 2BR1A 5L2SA 2RFSA 4O91A 3NNWA 5LWNA 3R01A 4ZAUA 3C50A 3QC9A 2X7FA 4GT3A 4ASXA 4JJRA 4P5QA 3L8SA 4FKWA 4LGHA 4K8AA 4EWHA 3OWLA 3LIJA 1UNLA 4I0TA 2C5VA 2OF4A 3S00A 3UQGA 1SYKA 4OUCA 4PMSA 4HGSA 2BPMA 3PLSA 2YIRA 3HMMA 2WTDA 3HECA 4H1JA 4RG0A 4CT2A 4DLJA 5BYZA 1J1CA 2WTJA 2W9FB 4ZOGA 4H3QA 4QMXA 1PMNA 4U43A 3PXQA 4V0GB 1KV1A 4OTGA 5JK3A 2WMUA 4FTKA 5CQUA 2PPQA 3Q6WA 3R30A 4MVFA 3PRFA 4M67A 3ORIA 4AOJA 3D9VA 5KZ0A 4BBMA 5LVNA 1Q8YA 4KS7A 5C03A 3WZKA 2C6DA 4M66A 2PVHA 1G8JA 3A7HA 4AXFA 3OCSA 4FIJA 5BUEA 2X0GA 2XK3A 4NH1A 2OJFE 3MPMA 3OOGA 1ATPE 3C9WA 5HKMA 3SDJA 5FDPA 2Q83A 2E9NA 3UP7A 3WF6A 3RJCA 4FA2A 2VWIA 5DPVA 5A46A 1J7IA 3GC7A 5AM7A 4F7SA 3P7CA 5DRBA 5AV2A 4XV2A 3BLAA 4NW5A 2G1TA 2W0JA 5H8GA 4C37A 5I9WA 4HYIA 2R3OA 1CKIA 3HRFA 3HX4A 2W4KA 3I6UA 3DFAA 1XJDA 3VVHA 4CG8A 3UYSA 2X6DA 5HCZA 4QYGA 5HD4A 2XAMA 1NXKA 1XH6A 2UZTA 2W1CA 3D4QA 3TNHA 2Q0BA 4FIGA 4FSYA 3TWJA 5IA1A 3FMKA 2I1MA 4GVJA 5ANEA 3FL5A 4K1BA 5IQHA 4L45A 3FJQE 2PUIA 4FODA 4HCVA 1L3RE 4J98A 5BX0A 5HORA 2XK6A 4JIKA 5E1SA 3FXXA 3OWJA 2FSLX 3A8XA 1ZZLA 2C5XA 3WF9A 3O51A 4QTAA 1J1BA 3FYJX 4DN5A 5J7HA 4FEUA 4XLIA 5C8KA 3G90X 3BI6A 1FBNA 1OZ1A 3VJOA 2WQOA 2QI8A 3UG2A 1W98A 5GJGA 3MTLA 4P4CA 3MY5A 2IZSA 3BBWA 4IVCA 4WRGA 3HKOA 2XK7A 4C4GA 3G9NA 3NCZA 4IX5A 4O7YA 4DEAA 3IOPA 2P33A 4YP8A 3AOXA 5CI7A 4ONAA 3CC6A 3PA3A 4I93A 2X2LA 4X2JA 3KY2A 4ENYA 3IG7A 1U4DA 4YZNA 2QOBA 4KIPA 1ZXEA 4GG7A 4G3DA 4U3YA 1QPEA 2XIXA 3NUYA 3A61A 4IBMA 1ZAOA 3SG9A 4FTQA 4E6AA 3TV7A 2ZV9A 2NO3A 4FKGA 5M08A 2J2IB 4FRFA 3RAHA 5C8NA 4Y5HA 3UOLA 3A99A 4IE9A 5KMKA 1WVYA 3SHEA 3O2MA 3UO4A 1LEZA 4O83A 2BFYA 4DCEA 4YLKA 5H9BA 3V6RA 4IC8A 2UVZA 4FTLA 4U42A 2QONA 1E9HA 2WOTA 4WSQA 4LRJA 4E6QA 1G3NA 3C4WA 5IDPA 4DAWA 4EL9A 2PE2A 2DUVA 4IMYA 3FMNA 3JVSA 3PPKA 3QUEA 2Z2WA 4FIIA 5AP1A 2PZIA 5HO8A 3UIXA 1OIRA 2YABA 4QP6A 1M2RA 1Q8UA 3TT0A 3ZUVA 5EM6A 1F0QA 3AMAA 5DEWA 5ANGA 2XNBA 3O7LD 2JFMA 4YURA 1VLRA 2PVRA 4RC3A 4R7BA 2FSTX 3QCYA 3QKMA 3ID6C 1RDQE 3JVRA 5BVOA 4TTHB 5FTQA 2VWUA 3EQPA 5EFQA 3IDPA 5AX9A 3ZMMA 4ITJA 3IGGA 5FXSA 3TJCA 4FTJA 1OMWA 4DGOA 1FVVA 5M55A 2W1DA 3HAVA 1KV2A 3NWWA 4K6ZA 2LAVA 2UVYA 5C01A 3R9OA 4M7IA 3ULIA 4OTQA 1GIHA 3KXHA 1WAKA 1G8KA 5KMNA 3WZJA 5BVDA 4FV3A 2XRWA 1CDKA 5BVEA 4MK0A 4WNKA 2V55A 1PXLA 4F7JA 3FHRA 1OIUA 3AQVA 4G31A 2OJIA 4KSQA 1W0XC 1ND4A 5DHJA 3OXTA 4UYNA 3OVVA 3ATTA 4IM0A 2C6EA 3OD6X 4MNEB 3UNJA 1OGYA 1WVXA 2VRXA 4WOVA 1OKYA 4JMQA 3DBFA 5HTBA 5LVPA 1PY5A 4AWIA 2XAOA 5CX9A 4ZLYA 5T6KA 1WBPA 4QP9A 2ZDTA 4E4MA 1PXIA 2C6LA 3UQFA 4WNMA 3PJ3A 4EYJA 4YO4A 3VS4A 3C1XA 3R63A 3AMBA 1MUOA 2P3GX 2VTMA 5E8YA 4L44A 2C3LA 2QOFA 4RWJA 5A3XA 2VTQA 1MQ4A 1JVPP 1J3HA 4D2SA 5J9YA 1YI4A 1Q8ZA 4XG6A 4BDEA 4MWHA 4GU9A 2BRBA 2RIOA 3HZTA 3QKKA 5CU6A 2XUUA 3PJ8A 1YQJA 5DIAA 2X81A 3O50A 4WNPA 5E8UA 1H8FA 3UOHA 3UVRA 4CMTA 4O7RA 2WAJA 1Q3WA 1R1WA 3R7EA 2R2PA 4QT1A 2REIA 3ZLSA 4FSTA 4A4OA 5FTGA 3FMDA 4J71A 4UMRA 1E1XA 3CKXA 4GIIA 1ZWSA 2F7XE 4K33A 4E26A 3FI2A 4ZJVA 1REKA 5T3QA 3KF4A 3RAIA 3RBWA 4DDIA 4J95A 2WMSA 3PG1A 2PUPA 3S4QA 4FEXA 4BWPA 2HW7A 3OZ6A 4ACHA 2FYSA 3SAYA 4E20A 5AFVA 1GNGA 4FZFB 4NCTA 4FZ6A 4TYIA 4X3FB 2B7AA 3BE2A 3LHJA 4FKIA 1GIIA 5A4TA 3Q9YA 3EL7A 5FWKK 4YJPA 2G9XA 2YIYA 5DI1A 5CAOA 3DS6A 3GEQA 1OUYA 1TQMA 5M57A 2WXVA 3UE4A 3SD0A 4D0XA 4YZDA 3E5AA 2OG8A 2HXQA 4BZNA 3TXOA 4M0YA 3C5UA 4FOCA 4TWCA 3TNWA 1IAHA 5EHYA 2ERKA 1BI7A 4FX3A 4GFOA 4AOIA 3CSVA 3EIDA 4HVGA 1YWVA 3BU6A 3T9IA 3UZTA 3OG7A 5EHLA 1OKVA 3O8TA 4A4XA 3RZBA 4IVAA 1Q4LA 1URCA 3ZO2A 4YTCA 4O0XA 5ICPA 2OH4A 3VW6A 5J5SA 4WIHA 3K54A 3TZMA 5KMIA 5L2IA 4LL5A 4RWIA 3ZSIA 3F3ZA 2QURA 5CVFA 3VF8A 2IWIA 3QL8A 4MUQA 5IH4A 3R28A 4D58A 4C38A 3E62A 3LFCA 4OGRA 2QU5A 3FLZA 3HV4A 4F7LA 1Y57A 2WTCA 5HG8A 2CHLA 3WF5A 3UODA 2AUHA 3QXOA 2HIWA 3RPOA 3SV0A 4G34A 3L9PA 5DVRA 4I23A 2UV2A 4GT5A 2G01A 2YLFA 3BYVA 5DT4A 5AEPA 3LMGA 1OL6A 4FTCA 4N57A 1NY3A 4UN0C 4JR7A 5LMKA 4IW0A 3MVHA 3W33A 1BL6A 3W10A 5I9ZA 4CQEA 3UNKA 3OF0A 4HGEA 3EQHA 4FC0A 4FNYA 1OGUA 3U51A 4UMPA 3MA6A 3ORPA 4TYHA 4FBXA 5EYKA 5C4LA 1XH9A 5HESA 4DH5A 3BRBA 3LXKA 4KINA 3EQGA 3NNUA 2QOLA 1DAYA 2XKFA 4FKRA 2IEWA 3UVPA 4EOPA 5IQCA 4B7TA 4JQ7A 4NM3A 3EQCA 2YAAA 4FT7A 3UZPA 3FMEA 1SVEA 4UZDA 3ZU7A 1LUFA 5CZIA 3ORZA 4BI2A 2WTIA 3Q9WA 4MQ1A 4IX6A 3TKUA 2I0EA 3B8QA 4CLJA 2JAMA 4IC7A 4D5KA 3R8UA 3TZ7A 5FGKA 4CMUA 1ZZ2A 2OH0E 3F82A 3F7ZA 4C3FA 3BYMA 5TT7A 3UJGA 4CEGA 5IQGA 3ENMA 4BZDA 4YBJA 3RWPA 5IMXA 2ACXA 4CFVA 4U44A 3FC2A 5JN2A 4QMOA 2X8IA 3C0HA 4I5CA 2QOQA 4G6OA 3KB7A 4APPA 4O7ZA 4CZYB 2UW6A 5D10A 5HE2A 3R2YA 4DLIA 2R3PA 4IIRA 1H1WA 3MB6A 3I1AA 2QOKA 2DS1A 3ZS5A 4NYEA 3KN5A 4DFXE 4XJ0A 3AC3A 2OXYA 5CTPA 4EI4A 3C5IA 2OICA 4R6VA 4LFIA 3F3TA 3OP5A 4O0WA 4EOSA 4L7FA 4A9RA 2IJMA 3FDNA 4I41A 2QO2A 3DCVA 2QHMA 5I3OA 4ZTNA 1M7QA 4I4EA 2OZOA 2C3KA 3DU8A 3FPQA 4U9AA 3ORNA 4YSMA 2CDZA 4Z7GA 3QTRA 2YM3A 2GS6A 3GFEA 4DHFA 4OAUC 3DXNA 4GT4A 2B52A 1ZYCA 3OW4A 3Q4ZA 4FL1A 4IWDA 4EH9A 4XOZA 2Y0AA 3UPXA 1ZLTA 3ORTA 3C0IA 4BRXA 4FL2A 3BE9A 3FHIA 3PE1A 5M4IA 3FY0A 3PXRA 2W1EA 3QQGA 4QMWA 4ALVA 3CD3A 3LM5A 3CBLA 4D4VA 3TUDA 2HW6A 2I0YA 3BIZA 3IW6A 5K5NA 3FE3A 1UWHA 2C69A 2PMNX 5HG9A 1UU7A 4W4WA 3R00A 2GHGA 4OTRA 4R7HA 4LGDA 1YHSA 3CY2A 4AP7A 3DAJA 5AR3A 1R78A 5EI2A 3TDWA 1KUTA 3PP0A 4MAOA 3PUPA 3E63A 4IM3A 3LFDA 3OCTA 1FINA 1UWJA 1Q61A 4ZS4A 3HMIA 3I79A 2OXDA 2W1HA 2JD5A