5JGDA

Crystal structure of human tak1/tab1 fusion protein in complex with ligand 12
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
295
Chain Sequence
GPLHMIDYKEIEVEEVVGRGAFGVVCKAKWRAKDVAIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAEPLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIMWAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQYPCQHSLPPGEDGRVEPYVDFAEFYRLWSVDH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords TAK1 kinase - TAB1 chimera fusion protein
publication title Discovery of a potent and highly selective transforming growth factor beta receptor-associated kinase 1 (TAK1) inhibitor by structure based drug design (SBDD)
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 295
sequence length 306
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2016-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5jgdA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5jgdA01
2WMRA 3VC4A 3HECA 2VAGA 3OWKA 4UMTA 4DTBA 2BPMA 4CEGA 4OTDA 5F1ZA 5CEKA 3W2QA 2CKEA 1OIQA 4EHGA 4O82A 1DI9A 2WTVA 2Z7LA 4IX5A 2J50A 4FEUA 1IR3A 3QZGA 2YZLA 3TV4A 3WZUA 3UPZA 1M52A 3P78A 4YJUA 4JIKA 2YJSA 2C0OA 2X6DA 3KMWA 4DLJA 3LJ2A 4G3GA 2OBJA 4MBJA 4S32A 2C6OA 3D5UA 4C4IA 5C1QB 4E7WA 2QOIA 4NJDA 2F49A 1XR1A 4F9AA 4X2KA 5IH5A 2OH4A 3QZIA 2WTCA 1JQHA 3ZHPC 4UMQA 5LMKA 4PDOA 3B2WA 4G6NA 2F2UA 4ACCA 4DEAA 2YITA 4DTKA 5CSXA 4CZUA 4O81A 3LJ0A 3VQHA 2O63A 1UU7A 4AFJA 3QA0A 3ZDIA 1Q99A 2W1CA 2WU7A 4CQGA 4FUYA 3WIKA 2ITWA 4KNBA 1BMKA 4LYNA 3O17A 4WNKA 2A0CX 2VU3A 1STCE 3V5LA 4EEVA 4R77A 3IGGA 4D4YA 3MA3A 1BI8A 3EWHA 3ZLYA 2UVXA 3MN3A 4FV7A 4EH7A 2ZAZA 1CDKA 4CG8A 3LQ3A 2PZYA 4G3FA 1YI4A 4CYJA 4KSQA 1ZYLA 2JAMA 3BZ3A 3KRJA 4K33A 2V62A 4ZY6A 2R3NA 1XH6A 4S30A 4GVAA 1U54A 4ASXA 5KKRC 2XNNA 4RBLA 4DCAA 2JIVA 4YBKA 3VWAA 4JX3A 4FT0A 3UIUA 1REJA 3UG1A 4EQMA 2B0QA 4NM5A 5CF6A 4OBQA 2R3QA 2BKKA 4RG0A 2Y0AA 2O0UA 1MP8A 1O6LA 2WMAA 4GG7A 5JFXA 1XQZA 2H6DA 5I9YA 2CNVA 4FE2A 5FP6A 3OCGA 2VN9A 2RG6A 4F65A 3SG8A 1ZMVA 2XBJA 3KRLA 4KKHA 4TT7A 4ANMA 5L3AA 3FC2A 2RL5A 4BCIA 3OOMA 2Z8CA 2IO6A 2SRCA 1BKXA 4DFXE 4UEUA 4GYGA 3NUAA 2AC5A 4D0XA 4I5PA 2HXQA 4FTRA 4DH8A 1M2QA 4DEIA 3WE8A 1KV1A 3COKA 3ENHA 4ZSLA 4BYIA 3O8PA 2NP8A 2Z60A 5E8XA 1KOBA 3F5PA 2CCIA 4N6YA 3FWQA 2IZTA 1LEWA 4QP8A 3WBLA 4FTOA 3ZU7A 2VWVA 2QU6A 4ZTSA 3S4QA 5M4FA 4TZRA 5AAEA 3OXTA 4EJNA 3EQBA 4X3JA 3BEGA 4IZYA 2UW5A 4KIOA 4XX9A 3HL7A 2DQ7X 3DT1A 5CAUA 4RIYB 5CT7A 5E1EA 1JOWB 4O7ZA 3BHUA 4XP3A 2B1PA 3QRUA 5AEPA 5LVPA 5J9LA 3WZKA 4AZFA 1IA8A 2QR8A 4IHPA 3NSZA 4IX6A 4YHTA 4EHEA 5HE1A 2QHNA 3POZA 4E5BA 4HVGA 3LFBA 1OIUA 4BCKA 5HIEA 5HU9A 5L8LA 3N51A 1H24A 2RFEA 4FOBA 5LMAA 3UTOA 5CI6A 4AP7A 3KU2A 4I0RA 4U81A 1CM8A 2IZRA 3NUSA 3VJNA 4EH9A 1I09A 2UZOA 3FLZA 4BI2A 4XG9A 2GNGA 4APCA 2IVVA 2HW7A 1T45A 3EFLA 1UWHA 2GNLA 3VF9A 3ZUUA 3AQVA 4FTJA 4XP0A 5FLFA 3E92A 1TVOA 1MRVA 4AGUA 3QZFA 4WNPA 2O64A 3OXIA 4LRKA 4RJ8A 5AV3A 3D5VA 4F64A 3EMGA 3GFWA 5IZFA 5BVEA 4ZJJA 4L01A 4QMLA 5JQ5A 4D1ZA 4YJTA 1H4LA 3IDBA 2PE1A 4FSRA 3PPZA 5AR8A 4DFUA 2ITZA 3D2KA 4JQ8A 2C6LA 4U0IA 1B38A 4R3CA 5KMJA 1XH5A 3CJGA 4ZTNA 4QMYA 5IA4A 3W33A 2KULA 3W16A 3WF5A 5J7BA 4O1PA 3PDTA 4FKQA 1SVGA 1ZZ2A 4O0WA 4W9WA 4ANOA 2VUWA 2XK8A 2WEVA 3KQ7A 3OVVA 4ZP5A 4Z7GA 5JH6A 3LCKA 4EOMA 4MX9A 1PKDA 3RZBA 2WMUA 2R5TA 3VUGA 4FKLA 5HG5A 3TEIA 4JG7A 4EZ3A 4EZ7A 4MXZA 4YBJA 2OICA 4FV6A 5EYMA 4AA5A 4EK5A 3CS9A 1W0XC 5T68A 4CRLA 2W0JA 3F69A 1Z57A 3A7JA 4FTCA 5HE3A 5HD7A 1OBDA 4EK4A 3JVSA 1VJYA 3GEQA 4WUAA 1KOAA 5HO6A 1H8FA 5AJQA 4ZTHA 2BMCA 2CCHA 3P7AA 4DA5A 2IVSA 4IAFA 2E2BA 5AIRA 4A06A 4G31A 1BL6A 2W5AA 3IOKA 4D28A 1JPAA 3DAJA 4MXAA 1PMNA 1ZYJA 5E91A 2OJGA 4B0GA 3FY2A 3OUKA 4HGLA 3E87A 4QTEA 1J7IA 4PQNA 3VBXA 1PJKA 2BR1A 4X7QA 2YM4A 1H1PA 1SYKA 3UGCA 4FKRA 2G15A 2UZLA 4FSUA 3BELA 1WVXA 3R8VA 3AC1A 4G17A 3ZS5A 4K18A 4EOSA 2W4OA 2RSVA 4RX7A 1NW1A 4NH1A 4NWMA 5DWRA 3BIZA 5CSVA 1EH4A 1GZOA 2VGPA 4GU9A 4G3CA 4IB5A 2HZ4A 5FEQA 4UWYA 4HCTA 2J6MA 4XG7A 4ACGA 3N4UA 4XG6A 2W1EA 4I93A 4BCGA 4BVUA 3TUCA 4KBCA 5I0BA 4LUDA 5HIBA 3VQUA 4RWJA 2YCSA 2XS0A 3OFMA 3FMHA 3N9XA 2OH0E 3RGFA 3QD4A 3EB0A 2G2FA 3R71A 4MNEB 4KINA 2V7OA 2VWYA 3AGMA 2BFXA 3H9OA 1XBCA 4AW0A 4IB1A 1KE7A 2OSCA 3EKNA 3CIKA 4QP7A 2R2PA 1ZOEA 4MH7A 3Q9WA 3TV7A 4BF2A 2R3GA 1GIHA 2YIXA 3HYHA 1BL7A 4KD1A 4O1OA 1G8SA 1ATPE 4O2PA 2I7QA 4FKIA 2PMLX 1X8BA 3R1NA 4MTAA 5DHJA 3D7TA 5IEXA 4C4HA 2FO0A 3R63A 4IAYA 4YJRA 4AN9A 4R1YA 3AD4A 2EXEA 2X1NA 3V5PA 4KBAA 1GIIA 5IQHA 1QPJA 3F6XA 4QMNA 3F5GA 4FTKA 5AV1A 1L8TA 4DEEA 2X7OA 5IA1A 5L2WA 3UC4A 5CNNA 2VTJA 4GYIA 3KULA 4RPVA 4ZXTA 2BFYA 2JD5A 4C37A 4ZS4A 4MF1A 3KCFA 5GJFA 4A9SA 2HZNA 4LV8A 4BTFA 4XLVA 3W10A 2J4ZA 5AA8A 2PVHA 2B9IA 3KRRA 5AP0A 5EFQA 5HIDA 3UOKA 3MDYA 1DAWA 5CSWA 1UNHA 3NWWA 4M8TA 3W1FA 3NPCA 5M55A 3MPTA 3LXLA 4I94A 4MWIA 3KF4A 4MXOA 3C4CA 5DYJA 4TNDA 2VRXA 4CFMA 2WOUA 3BU3A 3OMVA 2WEIA 3ZMMA 4RC4A 4XV1A 2W1ZA 3PXQA 1PXNA 3Q5IA 4IXPA 4BFMA 2CLQA 3IDPA 2C1BA 4IM3A 3LJ1A 3BLRA 3LFAA 4FX3A 2OI4X 3VUMA 4LOOA 3R83A 4DH7A 4WOVA 2PE2A 5B2MA 4RIXA 5KMOA 3V5WA 3VN9A 1UKHA 5EHYA 4TWOA 3CQUA 3R2BA 3TCPA 3RWPA 3VS0A 4USDA 5JGBA 2PVJA 4JQ7A 1OPJA 1UV5A 5FM3A 2OJ9A 3R7GA 4Y5QA 5B2KA 4R3RA 3VBQA 4O83A 4FTAA 4K1BA 4IVAA 1DS5A 4QMPA 1H0WA 5D1JA 4EH4A 4RIWA 3VF8A 4EOKA 1JNKA 5IQDA 4EH6A 5CEMA 3QRJA 4MVFA 5HNIX 2VWUA 2J0LA 3GCUA 3RK9A 5JMSA 2IJMA 3UPXA 3WF8A 5E8SA 5EW3A 4NZWB 4YTCA 4O0YA 4GU6A 4WBBB 4BKZA 3RM6A 3L9PA 3UMXA 3PWDA 3LFEA 3MH2A 2BTSA 4QMZA 5IUHA 3Q6UA 1YW2A 4MHAA 4H1JA 2A1AB 3AD5A 4FT7A 2PZRA 4JJRA 4O38A 2WPAA 3SLSA 1TKIA 5HZNA 2W1HA 3FL4A 4FKUA 3FMJA 4NW6A 4WG5A 4H3QA 5JZNA 3QUPA 5BVWA 3WYYA 1XBAA 2UZEA 4F08A 5ETAA 5ANKA 4NEUA 4F7LA 3OBJA 4RJ7A 2E9PA 3MJ2A 3PZHA 3L8XA 5IQAA 4PMSA 1WFCA 4CYIA 2NRYA 5I5ZA 3UE4A 4FK6A 3VUHA 4O7RA 3G51A 4FODA 3MVJA 2X0GA 3LVPA 5AUUA 1H0VA 3FI8A 4NT4A 1PKGA 4W4XA 3VRZA 3VRYA 2YM7A 5FEDA 2YA9A 4P5ZA 4CCUA 1ZOHA 3QXPA 3EFJA 1K9AA 4LUEA 4DEGA 1NXKA 4GT4A 2WHBA 2J9MA 4HW7A 4BIDA 3PXYA 5L2QA 1GY3A 1JBPE 3E93A 3BQCA 3D94A 3FXWA 4XYFA 1G8AA 2B53A 3A8XA 2V0DA 3SVVA 2CGXA 4BI0A 2H9VA 3HP5A 4Q5EA 3QKLA 5DPVA 2ITVA 4HGTA 3F7ZA 3U9NA 1YI6A 1YVJA 2PVRA 3POOA 2I0EA 2YCRA 4RZVA 4FIGA 1M2PA 4JVGA 4MYGA 4FV8A 4FKWA 5IEVA 3FLNC 4QQ5A 1Q41A 4L46A 2I0HA 3ZZWA 4BRXA 4WUNA 3LHJA 2Y4PA 4QOXA 3GBZA 3KL8A 3Q2MA 3QLFA 4PL3A 3OUNB 1IA9A 3DBDA 4CLIA 5K0XA 4XG4A 3NIZA 4NK9A 4U3ZA 4Y73A 5E4HA 4NM3A 3CPCA 4BTKA 4CMUA 4OTHA 3HMMA 2GMXA 5J1WA 3U4UA 4TW9A 4RLKA 3RZFA 1ZWSA 4QMUA 2E9OA 2I0VA 3FMEA 4NFMA 2DWBA 2J2IB 3IW5A 5CZIA 3ZOSA 3D4QA 3SAYA 4FK3A 4WHZA 3ZO1A 3DLSA 4IFCA 4FZAB 3ERKA 5F95A 5TT7A 4HVHA 3OWLA 3Q60A 3GT8A 4FV0A 3FI2A 3Q96A 5CXZA 5CZHA 2ZYBA 4FV5A 3ZBXA 2DUVA 1OKVA 2UZDA 4W9XA 1RW8A 3QRTA 5K3YA 3CY2A 3IS5A 3PSCA 4G6LA 3N4TA 5CAPA 2QO7A 3DFCB 4E4MA 1PHKA 5GNKA 1S9IA 3ULIA 3E7OA 4BL1A 5J9YA 2B54A 1IAJA 2VO3A 3HA8A 4GUBA 4OTFA 1R0PA 3E8CA 3EOCA 4J95A 4RIYA 4U44A 4KKEA 3M11A 5AUTA 2XK9A 3DAKA 4NL0A 1IAHA 4R78A 3R7UA 4FF8A 2P0CA 2PTKA 2W96B 1NVRA 3TKHA 2UZVA 4E26A 1XH4A 1XO2B 3B8RA 3UOHA 4GK3A 2HZIA 4QPMA 1YHWA 4IBMA 3ZM4A 4AF3A 1ZXEA 4I4FA 3DB6A 2C1AA 3LFFA 4GK2A 3R9HA 4FT5A 4ZY4A 3O7LD 4Y85A 3V04A 4GG5A 5DR2A 4C58A 1UVRA 3TKUA 5IISA 5A4CA 4S31A 3SX9A 3ATSA 2OIBA 5HO8A 4DFYA 4KB8A 2YAKA 3LMGA 2CGWA 4DT8A 2JDOA 3MB6A 4JDKA 3FDNA 3DKFA 1Y57A 5J5SA 5C27A 3I5ZA 4EONA 4D1SA 4PPAA 4ZLOA 4BCPA 3EN5A 5HVKA 4FVPA 3QQLA 3MPMA 4FKOA 4PX6A 5E8ZA 5H8GA 2UW6A 4ALUA 4LOPA 4EBWA 3JS2A 3E88A 4A4LA 5KHXA 5JFSA 4BGHA 3ZZEA 1Q61A 4JDHA 1H1RA 3FV8A 1FGIA 2JKOA 4IVCA 1K2PA 4PTCA 2WMQA 1ERKA 3Q32A 3GQLA 4O6LA 4U43A 4ACMA 5LCKA 3QUDA 2VO6A 2PU8A 3NYOA 3RK5A 5DMZA 3AT4A 2UW9A 2ZM4A 3CXWA 4R8QA 4U79A 4C2WA 4EOOA 3CJFA 3M42A 4J1RA 5CU3A 3NUPA 3LXNA 3NYNA 4D2WA 2ZV9A 3JVRA 4W8DA 4NJ3A 2WU6A 4R7HA 3TZMA 4E1ZA 4EH3A 2DYLA 2ZDTA 5F9EA 3T8OA 4CFUA 4L42A 2BDJA 2XNMA 4DFLA 4PMPA 4ZY5A 3MBLA 3ANQA 4DCEA 2PVNA 4YGAA 1A9UA 5DGZA 4EH8A 3TNQB 3FSFA 4D5KA 1TQIA 4ZMFA 3QBNA 4JX7A 4IVBA 5IA0A 5CTPA 4AOIA 2GNIA 3PY3A 3UOJA 4BDJA 5L6OA 5H9BA 4DBXA 3IW7A 3H9FA 2IZUA 3C5UA 5EHOA 2ETRA 4QP4A 4JG8A 4IAKA 5FEEA 4FZ6A 3RHKA 4BYJA 4JAJA 4JT3A 3KA0A 3IG7A 3QLGA 4LOQA 4JBQA 3IECA 4QTCA 4BKJA 2XNOA 2YJRA 5LVNA 3LKMA 4TYIA 3RINA 2YCFA 5I4NA 4M68A 5DRDA 3HRBA 4U80A 4RFMA 2CHLA 4KIKB 3RWQA 1U5RA 3DZOA 4L53A 4BHNA 2HCKA 5EYCA 3R8MA 4BGQA 4QQTA 2RFNA 3C4EA 5C9CA 3PY0A 2PMIA 4L52A 2QLQA 2JDRA 3NCGA 3BE2A 1KE5A 2F7EE 5BNJA 5C4LA 3EQGA 3QRIA 3QD2B 4DGMA 3U55A 2UUEA 4OW8A 4NYEA 2I1MA 4B4LA 2OFUA 4ZS0A 1YXSA 3NVMB 4QYHA 3Q9YA 4YJOA 5HX6A 3R1YA 2QI8A 1OL6A 4O6EA 2C6TA 2VTNA 5M57A 3KY2A 5JQ8A 2ITPA 3P9JA 3P79A 4MNEA 4XLIA 4QMOA 3R73A 5TE0A 3BQRA 4D2VA 1NA7A 4M3QA 4IZ5A 2P2HA 3VW8A 2YM3A 3GU8A 4ZEGA 4B8MA 3C4FA 3ZRMA 4EJ7A 4FV4A 3PIYA 4QNAA 4BCHA 3UDBA 4FKJA 4FTMA 4N4SA 3FMNA 3NX8A 3KXHA 4IQ6A 1O6KA 2OWBA 3F5UA 5EM8A 5AUXA 1OIRA 5HE0A 4FNYA 4CCBA 4M7IA 3DJ7A 5JRSA 1W8CA 2H96A 2EB2A 4FR4A 4DC2A 4QNYA 3KGAA 3WZDA 5FXSA 3V51A 3QGYA 3MSSA 4GK4A 4KIQA 5AR3A 3ZRKA 4LRMA 1PMUA 4JIAA 4Y72A 5CF8A 5CAOA 4BTJA 2V22A 4JI9A 3F9NA 4FIJA 3VBTA 2B7AA 3ROYA 3BYUA 3TNHA 5IQBA 2WNTA 1TQPA 1YXTA 3PPKA 3BE9A 3ZSGA 3MH1A 2UZTA 2R0UA 5CWZA 1CKJA 3MVHA 5DOSA 4AZWA 3A62A 4FTQA 2VTAA 2YM6A 4X3FB 3WF7A 1UKIA 5AIKA 3R1QA 3DFAA 1S9JA 2W06A 4MBIA 2XEYA 2X39A 2Y6OA 3ORZA 3V8WA 5I9UA 3VUDA 3Q3BA 4RWLA 4D1XA 2UVYA 2ETMA 4RX9A 3AXWA 3CBLA 2YN8A 3ELJA 3FZOA 1YI3A 3HEGA 3I6UA 3U87A 1Z9XA 3QWJA 4C36A 4G5PA 2Y4IB 4QYFA 4XG2A 4YJQA 5L8KA 3FY0A 4I22A 3RI1A 3EYGA 3TWJA 2LAVA 2YIQA 1FBNA 1OL1A 2WTKB 1KSWA 4I3ZA 2R3KA 4XJ0A 5D9HA 4ANLA 4F7NA 3NDMA 3G9LX 3R0TA 3NNVA 1JWHA 1YOLA 2EU9A 4FIHA 4IX4A 5EW8A 3O0GA 4R5SA 2BZKB 3W8QA 2XNGA 4FNXA 3VBVA 4OAVB 4I1ZA 4D55A 4Z7HA 2XNBA 3Q5ZA 4HPUE 4FV3A 5CALA 2FGIA 4QMMA 2WMWA 4XV3A 5EI2A 3RAHA 3RPVA 4M67A 1JSUA 3KRXA 3FBVA 3VJOA 3UO6A 3ZCLA 2W99B 3R7VA 1ND4A 3ZTXA 3JXWA 5CYIA 5AUWA 4X2NA 3RKBA 5C01A 4S33A 2WQOA 4W4WA 1QPDA 3ENMA 4CV9A 3NW7A 1B39A 1U5QA 4MXXA 1Y8GA 1SNUA 4JBOA 5HCYA 4NIFB 3SDJA 2QC6A 3GOKA 4CRSA 5L2IA 2HAKA 3TV6A 4AE6A 3MY5A 3JUHA 3NUNA 4L45A 5CS6A 1YXUA 3NCZA 4ZZMA 4F1MA 3QL8A 1MUOA 3FJQE 4M97A 4QMXA 5EOLA 3UVQA 3QCQA 4A07A 4UYAA 2F4JA 4WT6A 5BQ0A 2BHEA 5CVGA 4C4JA 3CD3A 5I9WA 1OVEA 4NTTA 1W82A 4ZMEA 1Q8UA 3G33A 4DG3E 4FOCA 4E20A 2UZBA 1DM2A 2XEZA 4CSVA 1YRPA 3QTXA 3VS4A 4LI5A 4QMWA 3ETAA 3HV6A 4DBNA 5HX8A 3DS6A 5AAFA 3TNWA 2QQ7A 4H1MA 4HCVA 4GIIA 1PXPA 3FMLA 4PRJA 5CNOA 4C62A 5IUIA 5E8UA 4BDIA 1Q97A 3F3UA 4ENYA 5A4TA 4C4EA 4UWCA 2V7AA 4FKPA 4QYYA 3OWJA 5HTBA 4K0YA 2JDSA 4YU2A 2J5EA 3ZO4A 4F99A 5GIOE 2C6KA 4E5AX 3P7BA 2R0IA 3WF9A 5JFVA 3GB2A 4X2FA 3DZQA 3BYSA 1OKYA 3HMNA 4I6QA 3WI6A 2VTPA 2YCQA 4M0ZA 5FGKA 4IWQA 2EVAA 2QKWB 4BN1A 3RBWA 3AC4A 4ZSAA 3L8SA 4BZNA 2JEDA 3PLAE 3FI4A 4TN6A 2QODA 2UV2A 1YXXA 4IC7A 5T3QA 5IQCA 4IACA 4J53A 4ZAUA 3I7BA 5HOAA 3DLZA 4M0YA 1OZ1A 3OCSA 5FTQA 3BBTB 3OD6X 2IW8A 5CQWA 3PPJA 3O7LB 5JK3A 3DKOA 4FSQA 3BRBA 4KBKA 3LFDA 3AT2A 2PUPA 3R1SA 3DBCA 3KC3A 3W2PA 4O27B 3Q6WA 5C4KA 4WNOA 5CEPA 3O23A 5E8WA 2YIWA 3FPQA 4RJ4A 4YPDA 1Q8WA 1R0EA 2PULA 3EL7A 5HG7A 3WF6A 4HVDA 1VEBA 4XBRA 4Y83A 3SHEA 5L6WL 4JRVA 3TI1A 4GSBA 3NLBA 4QTAA 2CMWA 1M17A 2Z7SA 4J97A 4QMTA 3ZUVA 2ZMCA 1W98A 5KMKA 1DAYA 4Z9LA 5BYLA 2FSLX 5IKWA 4LL0A 4YSMA 3VUTA 5L2SA 2B9HA 4LGDA 5LCJA 1QL6A 3K5UA 4EH2A 3HDNA 2YEXA 3NYXA 4EWQA 1H07A 3KMMA 2IW9A 4XP2A 3U6JA 3QQKA 1FVRA 2J51A 5ANEA 4EHZA 3TUBA 1HCKA 4BCNA 3PIXA 3EN9A 4YO6A 4EC9A 4YC6A 3BGZA 3PP1A 4L44A 5E90A 4E3CA 1GIJA 3KVXA 3ZONA 3DBQA 5KZIA 4RX5A 4WRSA 4FIIA 3KK8A 4QYGA 1WCCA 2WTJA 4GFOA 4O7SA 3BI6A 2R9SA 4UMPA 3G0EA 1FQ1B 2PE0A 2WTDA 4NKSA 4DH3A 4R6VA 3E3BX 4LQMA 4TL0A 3OY3A 4CNHA 4Y46A 1LEZA 2W1IA 1UU3A 2WTIA 4V04A 1REKA 5A54A 2BTRA 4YJNA 2FH9A 4MEDA 4RQVA 3ORXA 4X6QC 1OGUA 5AR7A 3UP2A 5HO7A 3QHRA 5LVOA 4M69B 4PMMA 4ZIMA 5DH3A 4PNKA 4J99A 3PP0A 4BBEA 1ZAOA 3IGOA 3TIYA 5BX0A 4BDGA 4MXCA 3H30A 3R7IA 1G5SA 4HCUA 5BUJA 2OFVA 2ZDUA 3PXZA 5IMEA 5KMLA 3QALE 2AC3A 4FV2A 3OF0A 1TQMA 4Q2AA 3VO3A 3DCVA 2BAJA 4CV8A 4B9DA 1PYEA 1YWVA 4FNZA 4A9RA 2OU7A 3L8PA 5C8NA 4ENXA 3Q04A 5TR6A 3PTGA 3BKBA 4FTUA 2QOFA 4ZOGA 4EUTA 2B9FA 5EQPA 3AC5A 4IAAA 4NW5A 2XJ2A 3SRVB 4XUFA 2WTWA 4MNFA 3TJCA 4AZTA 3DNEA 4EI4A 5DFPA 4D4RA 3MYGA 3RM7A 2DS1A 4H36A 5AP5A 4K8AA 4G16A 3DK7A 2WIPA 2RFDA 3E8NA 3ORPA 4BBFA 1GAGA 2PVLA 2F57A 2WQEA 5EG3A 3UQGA 3QKMA 1OKZA 1VYZA 3T9IA 3WZJA 3Q53A 5BMSA 1CSNA 2RF9A 3ITZA 3QTRA 3T3UA 4TYEA 3MW1A 4D4SA 4GJ3A 5D41A 4AA4A 2JIIA 3AMAA 5A46A 3C5IA 3ZH8A 3FAAA 2YACA 5AA9A 2ZM3A 5HTCA 3UOLA 5BPYA 1SZMA 3ZFXA 3Q4ZA 4E73A 2HW6A 4DITA 2JAVA 5E1SA 4CTCA 4E6QA 2W5HA 2X4FA 4DFBA 3CCNA 2QOKA 4U5JA 2JITA 2H8HA 3NUXA 4YC3A 3ZFYA 2W9ZB 1R1WA 4CZYB 2WGJA 4YHFA 2JDVA 4CVAA 4EOJA 5AAGA 3P23A 3ZXZA 2P4IA 4X3FC 2C3LA 5AR5A 5JGAA 3TKIA 5ICPA 2HYYA 2ZV8A 5E9EA 4IDTA 4RFYA 1AQ1A 4WNMA 1V0PA 2O5KA 3EQDA 4EZ5A 2IW6A 4BIBA 4DFZE 4O2ZA 2ZM1A 5FDXA 4JDIA 1XH8A 2C3JA 4ASZA 2VO0A 3ZO2A 2REIA 4JBPA 1J7LA 3R6XA 3HZTA 3C7QA 2R3FA 1NVQA 2X9EA 3FYJX 3O8TA 4RT7A 5AWMA 3RHXA 5I9XA 1K3AA 2Y4IC 4I0SA 5HE2A 1ZY4A 2RG5A 5D11A 3AD6A 3LAUA 4M13A 4PDSA 1JSTA 1Q24A 5CQUA 2VNYA 3RPSA 4HOKA 4U41A 5JSMA 4O86A 5IA2A 2WTKC 3OEFX 2VWXA 4I23A 4CKJA 3ZSIA 3UQFA 4Q9ZA 2XK6A 2XRUA 3BU6A 3LCOA 5AUVA 4L3LA 2GHGA 5L6PA 3VS6A 2QOQA 4RLLA 2GS7A 4QRCA 3HV4A 3D9VA 3CY3A 3BX5A 3Q4TA 3NIEA 5AUYA 2BRNA 2C68A 2PMNX 3OG7A 5EOBA 4CQEA 1UA2A 4ZZNA 5IQEA 3UNZA 3WOWA 4X3FA 3C0IA 4TPTA 2HELA 2A4LA 4G6OA 2RFSA 3ZBFA 4BCFA 4DEHA 5IUGA 4N57A 3OZ6A 2FYSA 1HOWA 3IPHA 3GENA 4L43A 2CKPA 2UW8A 4O0TA 5CY3A 3E8DA 5A6OA 3ZM9A 1P5EA 1QPEA 5AP1A 4FIFA 3D5XA 4L3JA 5AX9A 4BICA 3JY0A 3OS3A 2WMBA 2W4JA 3HMIA 3HVCA 3PLSA 5HU3A 1LPUA 5HCXA 4ZSGA 4YO4A 3QC9A 2GU8A 4OT6A 4U6RA 3P4KA 4U42A 1KUTA 3DQWA 3A99A 5HLPA 4JR3A 3VUKA 2Z2WA 3FPMA 4RJ6A 5L4QA 4C02A 3WIGA 4EBVA 4D2PA 2XIZA 5FXRA 1H25A 1KE6A 4FSWA 3GC8A 2O65A 2B4SB 3COMA 2AUHA 3G90X 3IW6A 2PWLA 5FG8A 4UZDA 2HY0A 2BIKB 5IU2A 4FZ7A 4KRDA 1BX6A 4RA5A 2YZAA 5KO1A 5DT0A 4PMTA 5HORA 5M44A 4JAIA 2EB3A 3OWPA 3FUPA 4F0FA 3EZVA 4E6AA 4RC3A 3TM0A 2NO3A 3PWYA 2GPHA 4RFZA 4BZOA 4F7SA 3KRWA 5H8EA 4LV5A 3F82A 4XOYA 4Q9SA 3OW4A 3ZXTA 5M56A 2ZB0A 1YKRA 4I20A 3SQQA 3KCKA 3V6RA 4AUAA 4JS8A 2Y6MA 4A9UA 2I6LA 3A8WA 2RGPA 3QU0A 3RNYA 3GC9A 3TUDA 3BPRA 3CTJA 3P7CA 4XS2A 5IG1A 1AD5A 3V5JA 2WMVA 3DPKA 5H8BA 4WBOA 4A4OA 3LFSA 3LMIA 5DBXA 4XBUA 4AN2A 1E1XA 2ITOA 4YHJA 4ZSJA 4C3RA 2R3HA 4GKHA 4UWBA 4X0MA 4ZTQA 4FL2A 5CX9A 2XNEA 4G9CA 2BDFA 2CSNA 5A4QA 3HRCA 5BVFA 3HV5A 4WSYA 1MRUA 4X2JA 2PVKA 5GJGA 3R9RA 3KK9A 4FKGA 5AADA 3DJ6A 3RCDA 3SW7A 4CFVA 4WO5A 4D2SA 2B9JA 5BVOA 5M4CA 2OW3A 3OT8A 3UIXA 3GCPA 2YM5A 3W55A 4BTMA 3COIA 4FSTA 5AFVA 4NFNA 1LUFA 3LM5A 3DA6A 2BHHA 5ANOA 1FINA 2GTMA 3IW8A 1QCFA 3MV5A 2WFYA 4LGHA 4J96A 4YNEA 2ZV2A 2XUUA 3DK3A 3VAPA 4EHVA 4L3PA 1E9HA 1YDSE 3DJ5A 2C5VA 1FMOE 3LE6A 4K77A 4LG4A 1NVSA 4P4CA 4J7BA 4BDDA 5KNJA 2XKFA 4IZ7A 3PA5A 3GI3A 1J1BA 3BBWA 3DBFA 4JBVA 4C33A 4O7TA 4MWHA 4BDCA 2R3MA 4PP7A 5IQFA 5CXHA 3C4WA 2PZIA 4YZ9A 4CT2A 4QQJA 3S00A 1OMWA 3BEAA 3QTQA 2OZOA 4K9YA 4AE9A 4FC0A 2OIDA 2V5QA 2W5BA 3D2IA 3GGFA 2BRBA 3BLQA 5ANIA 4G3DA 4MAOA 4ARKA 4D4VA 2FSMX 2GNFA 3IQ7A 5ITAA 3H3CA 5CSHA 4IB3A 2XA4A 3NGAA 3W18A 3REPA 4AW1A 4QO9A 5BYYA 4YLKA 1PXIA 2XKEA 3H0ZA 2NNWB 4PTGA 2IVTA 4CKIA 3HMOA 1YDRE 5JT2A 4FL1A 2QVSE 4QD6A 3KXZA 3EQHA 3EQRA 2BKZA 3SOCA 2CNQA 3R8PA 3H4JA 4DH1A 3LFCA 5BUEA 2C3KA 3G15A 2PYWA 3R7YA 2XM8A 2PHKA 1GZNA 1OBGA 2VTTA 4NCTC 4DLIA 5HG9A 4BDAA 4TTHB 5E8YA 3UC3A 3I4BA 4KUJA 3TTJA 3QC4A 4U3YA 2W05A 4CLJA 4TKSA 5I9ZA 4TWCA 3D7ZA 1WVYA 3D83A 3PJCA 3QYZA 4FT9A 2OXXA 4FTLA 3GU4A 1JKKA 2QCSA 4H39A 3CLYA 4YUQA 3CGFA 3PSDA 2LGCA 3ORIA 2YABA 3LQ8A 3WARA 4BCOA 4AZEA 3ZC6A 3MJ1A 3UZPA 4CMOA 3QX2A 4O0XA 4L8MA 3ZLXA 5I9VA 2RKUA 3EQFA 3HUCA 3TJDA 2CDZA 5KBRA 1YWRA 1WBPA 2WOTA 2R7IA 2XIYA 4MF0A 3MIYA 4AS0A 2J0IA 4M69A 3DY7A 4IDVA 2YAAA 1L3RE 4FT3A 3CE3A 3F88A 4I6BA 3V8SA 4CT1A 1XH9A 3RJCA 3Q52A 2ZB1A 5ETFA 4ZLZA 1J3HA 2X8IA 4RJ3A 2XK3A 3PJ2A 2VV9A 5ANDA 2Q0NA 4ACHA 2QOOA 1OIYA 5AP7A 4CGAA 1P4FA 2C6IA 4AZSA 4JOAA 5L8JA 5A6NA 4Q5HA 4F09A 4XMOA 2ETKA 1IG1A 5EHLA 2WMXA 3FKLA 4OAUC 5J95A 3KVWA 5GZ9A 4DAWA 3RP9A 4EWHA 2J90A 2YDJA 3FZPA 4FVRA 5FBNC 2ERKA 3SRVA 5GZ8A 2Z02A 3PUPA 1OUYA 5FUTA 5CEIA 3HV7A 3MGYA 5HBHA 3F2NA 3JY9A 4QMQA 5DI1A 5CF4A 4YP8A 3HLLA 1FVVA 3MS9A 2Y8OA 3EIDA 5JGDA 3S1HA 4Y95A 3LXPA 3A7GA 4FEXA 4EUUA 3UNJA 4HVSA 3D14A 4FIEA 3SXSA 1YQJA 1IEPA 4C8BA 2XCHA 2OLCA 4G9RA 2HXLA 3ACKA 2Q0BA 4ONAA 2Y7JA 4FBXA 3UO5A 4J8NA 2WMSA 3QQFA 4FEWA 3CKXA 4D5HA 3PJ1A 4B8LA 2PUIA 1M7QA 2VTMA 1WZYA 3KB7A 3K5VA 2QHMA 4ASEA 3PZEA 3ODZX 3V5QA 5A9UA 2HWPA 3Q2JA 1YOMA 5EH0A 1SVEA 3AOXA 1UNLA 3WILA 3PXFA 4I5MA 3ZEPA 1F3MC 3D0EA 5GINE 1JKSA 3PYYA 2EUFB 3TDWA 4AG8A 4BI1A 4D2RA 3AC8A 4AA0A 4AQCA 3RPYA 4MBLA 2WMTA 3HGKA 4DG2E 3DAEA 2XMYA 4AT3A 4UXLA 4QP2A 4O22A 1NY3A 4FNWA 3RPOA 2VNWA 3UO4A 3G5DA 3F3VA 5B2LA 5KE0A 1PY5A 3TTIA 3CSVA 3A7FA 4BCQA 3FZRA 3O2MA 1PXKA 3OTUA 4ERKA 2CNUA 4G34A 5HBJA 3EN7A 1R78A 4NUSA 3WYXA 4USFA 5CASA 4O21A 3LCTA 5CAQA 2Q83A 3S0OA 4IAIA 3DXNA 2QG5A 2R3LA 4LMNA 4GW8A 4I21A 3AT3A 4CFXA 4YLJA 1ZOGA 3K2LA 4ANNA 5LARA 3SGCA 3BHHA 3FQHA 5EI6A 4RIOA 4BIEA 2OGVA 3GU7A 2YIYA 5FWKK 5K9IA 3NAXA 4WKQA 2HENA 3PXRA 4Y8DA 3FKOA 5H3QA 2FUMA 4BKYA 5BUIA 4BWXA 1YOJA 2YM8A 4RVMA 2V55A 2PUNA 1YDTE 3C50A 5FP5A 1RQQA 2WD1A 5D12A 2W4KA 3IO7A 3T3VA 3FLWA 1H08A 3QTUA 2VD5A 1SVHA 1WBVA 5F4NA 5JKGA 3GP0A 3I0QA 1XKKA 3BYVA 4RWKA 2VTSA 4AX8A 4U7ZA 1Q5KA 3BV2A 2G2HA 5KMIA 2YFXA 4HYUA 2IPXA 4PTEA 1CKIA 2BROA 2UZUE 5LJJA 4A4XA 2F7ZE 4K6ZA 5IDNA 4A9YA 1G3NA 4F0IA 4O96A 2JKMA 2X2MA 4DH5A 3RNIA 1H27A 4RSSA 3UZRA 4RJ5A 5IA3A 1WBNA 2ITTA 5DT3A 3I81A 2OF4A 3NUUA 3EQPA 4ALWA 3PRIA 4FTTA 5CU2A 5DG5A 4F7JA 2OZAB 4CFNA 4NKAA 4EORA 5AM7A 5ETCA 2YDKA 3RALA 3QFVA 4WD5A 3EJ1A 4GH2A 4QP9A 4BC6A 5K5NA 4IEBA 1O9UA 2XVDA 4LGGA 1AGWA 3GQIA 3FQEA 3SXFA 5H2UA 3LQ5A 3F2RA 3COHA 2XK4A 1BI7A 3KF7A 4I5CA 4I0TA 4N6ZA 2B55A 4F4PA 1YXVA 3CPBA 3OXZA 5TKDA 4DGOA 5EQEA 3A7HA 5HTIA 2IN6A 1WMKA 4YJPA 1JSVA 3QYWA 5J8IA 5KBQA 5FTGA 4TWNA 3BWFA 4CFWA 4IJ9A 1Q3DA 4KWPA 4MCVA 2JFMA 3CQWA 3DOGA 3S95A 4H58A 5B7VA 3NNXA 3H0YA 3D7TB 3C13A 2HIWA 3OCTA 1FOTA 1H28A 4FV1A 4D9TA 4YTFA 5M07A 4X2GA 3FLYA 2XP2A 2PY3A 5BMMA 3LW0A 3EH9A 4IW0A 4BWPA 4EOPA 4OT5A 1OB3A 3PA4A 3EQCA 4W8EA 4D2TA 3BLHA 3MY0A 5M53A 2QOBA 3BHTA 4E6CA 3KULB 4L7FA 5BVDA 2XCKA 4C4GA 5HG8A 5IQGA 5TF9A 3PA3A 4NSTA 3MH0A 3E62A 4JR7A 4OBPA 2ITXA 2YIRA 4RA4A 4YZMA 4Z16A 2WIHA 3CC6A 4JRNA 5FXQA 3QTWA 3PE1A 3BYMA 4GIHA 4YZNA 3I60A 3MWUA 1SNXA 3GNIB 3MFRA 3LLAA 4YSJA 3VS1A 3CKWA 1PXOA 4QMSA 2QO9A 2WQBA 4FKTA 4U45A 2XK7A 1P2AA 1V1KA 4FG7A 2O2UA 5F94A 2CKOA 2W9FB 4RC2A 4AOJA 2C47A 1B6CB 1PXJA 3PFQA 2R3PA 3R22A 4MK0A 4FSZA 3PY1A 4XEYA 3TT0A 1CKPA 5TOZA 4GJ2A 4OTRA 5IMXA 2VTLA 5KHWA 3LFQA 3Q4UA 4IZAA 4P90A 5GIPE 5IQIA 1QMZA 4EKLA 4HNIA 5TO8A 3MVLA 2RIOA 4LRJA 3UP7A 2P2IA 2XYNA 4DTAA 5ACBC 1OPKA 3UVPA 5HI2A 4ZZOA 2JBPA 2CLXA 5AP3A 3FLSA 1URWA 5ETIA 4O84A 4HGEA 4V05A 4LL5A 4C59A 4DG0E 4BY9E 4RIWB 3OROA 1V0OA 3A4PA 3DGKA 3I0OA 2IVUA 3I7CA 5CF5A 3FZSA 3QQJA 4G5JA 1XJDA 3LZBA 3QWKA 4XRLA 1PXLA 2VTIA 5KCVA 5T6KA 4F9WA 3OTVA 4E8AA 1PMEA 1VYWA 4RX8A 4FV9A 2PVMA 3FXXA 5DN3A 5D10A 2E9NA 4C57A 3O50A 5J7HA 1IRKA 2WZJA 3VHKA 5LXMA 2XH5A 4UN0C 5JRQA 2GQRA 3DNDA 4C34A 3VS7A 3FZTA 3UBDA 2OIQA 2G9XA 2PL0A 2OXDA 4L00A 2OK1A 3FI3A 5C03A 3PJ8A 3HKOA 4HPTE 1Q8TA 3DDPA 3Q4CA 3KEXA 1ZYSA 2J0MB 3SXRA 4U97A 4FA2A 3RCJA 5ANGA 3QKKA 3W32A 4FMQA 4M15A 2CGVA 3ZRLA 3G6GA 3O96A 3MI9A 1WBSA 3CR0A 3KREA 1FPUA 4F1OA 4PL5A 2PVFA 1UU9A 4WIHA 3UIBA 3TZ7A 2QKRA 2HK5A 2J0JA 3OBGA 5G1XA 2A2AA 3ORLA 5A14A 2GFCA 3HMPA 5HD4A 1KV2A 4MXYA 3W2CA 3CTHA 3MY1A 5DR9A 1PRYA 2JKKA 4FTIA 2YWPA 1F5QA 3ALNA 2CKQA 2UW0A 3UZTA 2ITUA 4ITHA 3G6HA 2X9FA 1OKWA 3GC7A 1PW2A 5DA3A 3QHWA 5E92A 5M51A 5EM6A 4EOIA 3FE3A 5LMBA 4BDKA 4JXFA 3G9NA 3CP9A 3M2WA 3MTLA 3AC2A 2C4GA 3R02A 5I3RA 2BRHA 4HZSA 1H1WA 4R7BA 5GJDA 2C6MA 5FRIA 4XV9A 4KIPA 3ZC5A 2B52A 1R39A 2QOLA 3GUBA 1J91A 4IAZA 4BDFA 3P5KA 1U59A 5K4JA 2CGUA 5M09A 2IWIA 2PVYA 3QQHA 1QPCA 1Q8YA 4E4XA 4IB0A 2NPQA 5C8KA 3DB8A 5FD2A 3VHEA 3FYKX 4XNEA 4OLIA 4ACDA 3R01A 1OL2A 1FVTA 2ZOQA 3Q9ZA 5DEYA 4E93A 5HLWA 4UMUA 1V0BA 4HYHA 2WQMA 2ZVAA 3HA6A 3R30A 1URCA 4HZRA 4IWPA 4FYNA 4I4EA 3R8ZA 2C5YA 2OG8A 4E4NA 3U6HA 4O7WA 3K54A 4KABA 3SV0A 2XYUA 3LIJA 3TG1A 2VTHA 3EN4A 3R00A 2ZJWA 1T46A 4QT1A 3E5AA 4FICA 5AV0A 3KXMA 4GL9A 4M84A 3VS2A 2ZV7A 3CTQA 3A60A 5M08A 2OJIA 4HGSA 4FSNA 3GCVA 3F3ZA 3F5XA 5EDPA 5CVHA 1BUHA 2YLFA 1A48A 3NNUA 3QF9A 4JG6A 3AGLA 4PWNA 2VO7A 4DE4A 2X8EA 4HNFA 4IWDA 4D58A 2VTQA 4F6WA 4S2ZA 4YZBA 3MFTA 3GXLA 5HNBA 1UNGA 3IW4A 3O8UA 3EL8A 5EYKA 4C3FA 2HZ0A 5HQ0A 4PNIA 4FI1A 3ZSHA 1XHAA 3F66A 3RK7A 1H26A 2GS6A 1BYGA 5D7AA 3OOGA 2BUJA 2X2LA 4IE9A 2WKMA 4U8ZA 5CVFA 4KAOA 4J98A 5KUPA 3NEWA 3QQUA 4FYOA 4WG4A 4EK6A 4YURA 4QTDA 1H1QA 1Y6AA 2XIRA 5HICA 4CFFA 4CG9A 2O8YA 4C61A 2ACXA 5FDPA 5CI7A 5LWMA 3MIAA 5CT0A 1PXMA 1YWNA 2R3JA 2P33A 1WAKA 5HVYA 3EN6A 2ITYA 4KIKA 4D0WA 3ZFMA 5CANA 2VWWA 3LCSA 2C69A 5DVRA 5CAVA 3E3PA 2YLEA 4XRJA 5AP6A 3JYAA 4RZWA 3KXNA 3D15A 3NYVA 3R04A 4MKCA 4Z55A 3PE2A 4YC8A 3QA8A 3OC1A 4H3BA 2QO2A 3OY1A 4GVJA 4FZDB 3FL5A 3R8UA 1U46A 1Y8YA 4ALVA 4B6LA 1Q62A 2VX0A 2ZMDA 3E7VA 3E8EA 4HVIA 1GZ8A 2QURA 4QP6A 1UWJA 4OTIA 3SOAA 5JEBA 2XIKA 4WRGA 3UMWA 3BGQA 5CLPA 4RVTA 3SA0A 5LVLA 2FVDA 4D9UA 2VWZA 2JLDA 3O71A 1OI9A 3PVGA 3HNGA 1PF8A 4YZCA 2GSFA 4MQ2A 3HUBA 4TRLA 4BDEA 3E64A 1JKTA 1HCLA 4GEOA 4F0GA 4GKIA 3VBWA 4PY1A 3QRKA 4TYHA 2JIUA 3GU6A 4L6QA 3ORKA 4WG3A 4O7NA 2BRMA 2XBAA 4BB4A 1FGKA 4TYJA 3L9NA 1OUKA 4DEBA 3QD3A 3R28A 3PVBA 5ACKA 4QPAA 4J8MA 5B0XA 5IH6A 3FLQA 4ZTRA 2C30A 4IANA 5BVKA 3FHRA 4C35A 3I1AA 1H01A 3L8VA 3QGWA 4OTWA 5HCZA 3OEZA 4PDPA 4RQKA 2I0YA 2VWIA 1OECA 1A06A 3CGOA 4AAAA 5KZ0A 4CTBA 2FSOX 1NT2A 5EKOA 2OZAA 3ORMA 5EM7A 2X4ZA 3ALOA 3NR9A 4AGWA 1CTPE 4AW5A 2Z7QA 4C0TA 3ZLWA 1PMVA 3CD8A 2R4BA 3FXZA 2C5XA 5IH4A 2J0KA 3BU5A 1JLUE 2UZWE 3AC3A 2EWAA 3MPAA 4RVLA 2JFLA 4IWOA 3W2OA 3NUYA 2EXCX 2C0TA 4O0RA 1ZMWA 3ACJA 4G2FA 3H10A 3ORNA 4HYSA 4RGJA 3TDVA 4TYHB 4JL9A 2WELA 4UX9A 4QYEA 4ZSEA 4ZJIA 4AWIA 5IF1A 3R7OA 4TY1A 5AR2A 3EQIA 3VS5A 4GT5A 2PZPA 1ZRZA 4YR8A 1Q8ZA 3DKCA 5DRBA 3NZ0A 3UVRA 1RDQE 2H34A 4MD8E 5AX3A 3DU8A 2CN5A 2QONA 3EHAA 3VBYA 1CMKE 2QU5A 2C3IB 3L9MA 3BV3A 5EDQA 2FA2A 4X21A 2PPQA 3UNKA 3BGPA 4BGGA 3A2CA 3NW6A 3OT3A 3UJGA 2VX3A 4JNWA 4QP1A 5AP4A 4X6RA 4P7EA 4C2VA 4F9YA 2X8DA 4H3PA 5KMNA 3UODA 3AMYA 2XKCA 4LMUA 4V0GB 4ANSA 1E1VA 2XB7A 3TN8A 4DN5A 2PZ5A 5G6VA 1ZYDA 3EYHA 2ESMA 5E8TA 4UXQA 1XWSA 4II5A 3FC1X 4KRCA 2W7XA 4NM7A 3HX4A 2I40A 4IIRA 1Y6BA 4F9CA 2PK9A 3ZYAA 3VVHA 3BCEA 1ZZLA 3UYSA 2GS2A 4FTNA 3HRFA 4A7CA 4TYGA 4NIFA 3R8LA 4QTBA 5FM2A 5BVNA 3R7EA 4CKRA 1R3CA 4J52A 5CSPA 3A7IA 3DXPA 4USEA 3PSBA 2BRGA 4IVDA 4FKSA 2PSQA 4O7YA 4CD0A 5CEQA 4F6UA 3AMBA 1LR4A 3MFUA 4EQUA 3SG9A 2HY81 5CU6A 4H05A 1BLXA 5BYZA 4L67A 1YHSA 3Q9XA 2BZJA 3LOKA 4FEQA 4BHZA 1WVWA 3SD0A 4AXAA 5J87A 2W1GA 3TIZA 2QLUA 1ZYCA 5AV2A 2PMOX 2PUUA 2EXMA 3HP2A 4YJVA 3PXKA 5A4EA 5FBOA 2XJ1A 2BDWA 2R3OA 2GNJA 3H9RA 5LOHA 3KN5A 3IONA 5C26A 4YMJA 3UYTA 2FB8A 4KS8A 3ZUTA 5M4UA 3C9WA 2R64A 3B2TA 4OGRA 4AGDA 3P86A 4CXAA 2O3PA 4ZJVA 2X81A 2G2IA 4EK8A 5ANJA 2VGOA 1J7UA 4AW2A 3SC1A 3GCQA 4OUCA 4F6SA 4R1VA 3JPVA 4UV0A 3U51A 4XHKB 4DGNA 4U9AA 2W17A 3R9OA 4I6FA 3QZHA 3V3VA 3N4VA 3NMUF 2JGZA 3ORTA 2QOCA 3NVKI 3V6SA 1Z5MA 2G01A 3VW6A 5M06A 2IG7A 2CJMA 5EI8A 4OBOA 4TNBA 3GC0A 4R5YA 1I44A 4GT3A 5CENA 4AGCA 3FMMA 4Z3VA 5EM5A 4APPA 4XV2A 2G1TA 4K11A 3ZEWA 1SM2A 4GUEA 1F0QA 4O91A 2NRUA 1ZY5A 2VTRA 4PL4A 2C6DA 5DEWA 2GCDA 4UY9A 3DQXA 4YTIA 5KMMA 1GJOA 4C7TA 4HYIA 3ULZA 3AG9A 3QTIA 3DXQA 4JLCA 4IM2A 4YPSA 4IADA 3SKCA 3NW5A 4BDBA 3F61A 4PDYA 4IX3A 4LM5A 4UALA 3VULA 3LMHA 1WBOA 5EK7A 3EKKA 5LQFA 3C0GA 5L2TA 3ANRA 4BR3A 4OTQA 4B7TA 1IASA 3FMKA 2GTNA 2VZ6A 4I41A 4E4LA 1DI8A 4YTHA 2BZIB 2Y9QA 3THBA 4GCJA 3C4XA 4FG8A 4C38A 3BHVA 3PVWA 1M2RA 3KXGA 2UW7A 4KA3A 3S2PA 4ANQA 4TXCA 4BCJA 2CPKE 3IOPA 1P4OA 3W2RA 4FSYA 4OTPA 1APME 1XH7A 4YNOA 1W7HA 4NU1A 5JFWA 2XJ0A 3R2YA 5GHVA 2YDIA 4UYNA 4ZTLA 3ZLSA 4IMYA 5AP2A 3RVGA 4XG3A 3A61A 3V01A 3IKAA 1OL7A 2C6EA 3TACA 3TNIA 3QCYA 4I6HA 4O7LA 2JC6A 1U54B 2OF2A 4QQCA 2GDOA 3LXKA 4ID7A 4GMYA 4AT5A 4UMRA 3JR1A 3E63A 3LPBA 4IJPA 2YHVA 3QX4A 3OHTA 1O6YA 1WBTA 1H1SA 2A19B 3K3JA 2JKQA 4E5WA 4BWKA 2JBOA 2JDTA 4FL3A 3ODYX 3PJ3A 1MQ4A 1VZOA 2BCJA 4FKVA 5GZAA 4ERWA 2YERA 5AMNA 3ROCA 1ZLTA 3OP5A 4ORKA 2E9UA 5DNRA 3VS3A 1M7NA 3EFWA 4DYMA 4ZTMA 2BALA 1ZARA 2XKDA 4IFGA 4I92A 2E9VA 5J9ZA 4XCUA 4I5HA 1GNGA 4J71A 4G1WA 5AM6A 4FUXA 3VIDA 4TWPA 3R9NA 4NCTA 3QUEA 1Q3WA 4DHFA 3M1SA 4GS6A 3KKVA 1JVPP 3WZEA 4EL9A 3FKNA 4AACA 3TZ9A 4O0SA 3FSKA 4MD9E 4RVKA 4UZHA 2UW3A 3MA6A 5AUZA 3LCDA 5I3OA 2UW4A 1H00A 3C51A 3GCSA 3U6IA 5KKRB 1KE9A 4YLLA 3MFSA 2GFSA 2ITQA 3U9CA 2XZSA 2ERZE 1J1CA 2BIYA 3GFEA 3QQGA 4FSMA 5FQDC 3NAYA 2OO8X 4DINA 3ZO3A 2ITNA 5EW9A 5J79A 2BILB 3GOPA 2QNJA 5HEZA 3ATTA 3TNPC 3MVMA 3QXOA 4EOLA 3I5NA 3OW3A 3U4WA 3BHYA 3FZ1A 1PYXA 4AZVA 3FEGA 2XIXA 2BAQA 5CEOA 5EQYA 3NS9A 2F9GA 3F2AA 5D7VA 3C0HA 4GRBA 4K2RA 4AT4A 3PG1A 4DGGA 2OJJA 1Y91A 2XF0A 2A27A 3DDQA 4OR5A 4EH5A 2VTOA 4WA9A 1KWPA 2XRWA 3NNWA 4BBMA 3KFAA 3RTPA 5LWNA 3DTCA 3SW4A 4M12A 3R9DA 4FGRA 2R3IA 4IC8A 3L1SA 4PF4A 2YISA 2AYPA 3C1XA 5IEYA 2ONLC 5HESA 4AN3A 3QCXA 4EYJA 4L9IA 4NTSA 5HVJA 3G0FA 3RAWA 2C5NA 2X2KA 1W83A 3PIZA 4GFGA 4RRVA 2BZHB 4G3EA 4N70A 4DF3A 5AV4A 5F20A 4CZTA 3L9LA 2QG7A 4AU8A 4BDHA 2FSTX 1W84A 4XH6A 2BAKA 1UU8A 5HGIA 3K3IA 4U40A 4BCMA 4EKKA 4ITIA 3U8WA 3QTZA 2WQNA 4F9BA 1MRYA 5AR4A 3P1AA 4GV1A 2R7BA 3F3WA 3II5A 4QMVA 3R21A 4KSPA 3DKGA 5HHWA 4R3PA 3RMFA 3FHIA 3T9TA 3V8TA 4F70A 1RJBA 3GU5A 4B99A 2P3GX 3PVUA 1KE8A 3MTFA 1RE8A 1P14A 1U4DA 4XG8A 4BZDA 4DGLC 3KN6A 2R3RA 5J5TA 4DEDA 1Q4LA 5DIAA 3O51A 3TZ8A 5A4LA 5IDPA 2WXVA 5IA5A 2W1FA 2KTYA 4FGBA 3TL8A 2GHMA 2QR7A 3QCSA 4KS7A 4CMTA 2HWOA 3GVUA 4I24A 4PP9A 4PUZA 3WE4A 1OITA 4JQEA 4EYMA 3DK6A 4FEVA 3DTWA 1XBBA 3IK3A 4C3PA 2ONLA 2GNHA 2WB8A 3BYOA 3LFNA 1JAMA 1YHVA 3EZRA 3V5TA 4ASDA 2XNPA 3EFKA 3FQSA 3KMUA 1WBWA 4O0VA 4HJOA 1OL5A 4GFMA 4OTGA 5EYDA 1OM1A 3A4OX 4FVQA 4ITJA 4Y5HA 2HOGA 2QD9A 4DT9A 2UZNA 3MESA 3P0MA 4S34A 3I79A 4C4FA 4O7VA 4PPBA 3VUIA 4RMZA 5JN2A 3UG2A 2GQSA 5K0KA 4UBAA 4V0GA 3QD0A 3MH3A 3DV3A 3HDMA 3TXOA 3W2SA 5J1VA 3F3TA 3RAKA 4AOTA 2P55A 3HV3A 4L68A 2OKRA 4YZDA 4YJSA 4XOZA 1MQBA 3PG3A 4F1TA 2BVAA 4UB7A 5HBEA 2X6EA 3U54A 3RPRA 1SMHA 4P2KA 4L7SA 3MB7A 2J7TA 4ZK5A 1GZKA 5HNGA 2GHLA 4KKGA 2F7XE 4MD7E 1VR2A 4EQCA 3S3IA 5EKNA 4RWIA 3CEKA 3CQEA 4E6DA 5KX8A 5LVMA 3HAMA 5E7RA 3VNTA 4PV0A 3OCBA 2C5OA 2X7FA 2VX1A 3PRFA 1ZMUA 3RAIA 2F2CB 4V01A 3W8LA 4EC8A 2GQGA 3QTSA 3ZDUA 4EOQA 2QOHA 3QAME 2CN8A 2WO6A 2OXYA 5EDRA 5E8VA 4QPSA 5DR6A 4PPCA 2VWBA 2C0IA 3G2FA 4M14A 4N0SA 4NM0A 5HKMA 4EK3A 5CU0A 3NRMA 3LM0A 3F7WA 2X7GA 4ZLYA 2YWVA 4P5QA 4F63A 4O0UA 2OJFE 3BWJA 2IZSA 5FTOA 3HAVA 4MQ1A 3B8QA 4W4YA 5C8MA 2WAJA 4JDJA 5K4IA 5DE2A 4ANBA 3D5WA 5DT4A 2W1DA 1JKLA 4IH8A 3KXXA 3IDCA 3ID6C 3C4ZA 3UQCA 3FMDA 3ET7A 5LMKC 2Z7RA 5K5XA 3I6WA 4RIXB 5CU4A 4DFNA 3P08A 3LLTA 1OPLA 4FZFB 3UIMA 1LP4A 2J5FA 5A3XA 4A9TA 5IPJA 4R7IA 4W4VA 3DBEA 1GOLA 4WSQA 4IM0A 4AFEA 4QP3A 1FMKA 4LFIA 4M66A 2XM9A 5M4IA 5JZJA 2UVZA 4FG9A 1M14A 5DLSA 5HLNA
chains in the Genus database with same CATH superfamily
2WMRA 3VC4A 3HECA 2VAGA 3OWKA 4UMTA 4DTBA 2BPMA 4CEGA 4OTDA 5F1ZA 5CEKA 3W2QA 2CKEA 1OIQA 4EHGA 4O82A 1DI9A 2WTVA 2Z7LA 4IX5A 2J50A 4FEUA 1IR3A 3QZGA 2YZLA 3TV4A 3WZUA 3UPZA 1M52A 3P78A 4YJUA 4JIKA 2YJSA 2C0OA 2X6DA 3KMWA 4DLJA 3LJ2A 4G3GA 2OBJA 4MBJA 4S32A 2C6OA 3D5UA 4C4IA 5C1QB 4E7WA 2QOIA 4NJDA 2F49A 1XR1A 4F9AA 4X2KA 3BL9A 5IH5A 2OH4A 3QZIA 2WTCA 1JQHA 3ZHPC 4UMQA 5LMKA 4PDOA 3B2WA 4G6NA 2F2UA 4ACCA 4DEAA 2YITA 4DTKA 5CSXA 4CZUA 4O81A 3LJ0A 3VQHA 2O63A 1UU7A 4AFJA 3QA0A 3ZDIA 1Q99A 2W1CA 2WU7A 4CQGA 4FUYA 3WIKA 2ITWA 4KNBA 1BMKA 4LYNA 3O17A 4WNKA 2A0CX 2VU3A 1STCE 3V5LA 4EEVA 4R77A 3IGGA 4D4YA 3MA3A 1BI8A 3EWHA 3ZLYA 2UVXA 3MN3A 4FV7A 4EH7A 2ZAZA 1CDKA 4CG8A 3LQ3A 2PZYA 4G3FA 1YI4A 4CYJA 4KSQA 1ZYLA 2JAMA 3BZ3A 3KRJA 4K33A 2V62A 4ZY6A 2R3NA 1XH6A 4S30A 4GVAA 1U54A 4ASXA 5KKRC 2XNNA 4RBLA 4DCAA 2JIVA 4YBKA 3VWAA 4JX3A 4FT0A 3UIUA 1REJA 3UG1A 4EQMA 2B0QA 4NM5A 5CF6A 4OBQA 2R3QA 2BKKA 4RG0A 2Y0AA 2O0UA 1MP8A 1O6LA 2WMAA 4GG7A 5JFXA 1XQZA 2H6DA 5I9YA 2CNVA 4FE2A 5FP6A 3OCGA 2VN9A 2RG6A 4F65A 3SG8A 1ZMVA 2XBJA 3KRLA 4KKHA 4TT7A 4ANMA 5L3AA 3FC2A 3BLAA 2RL5A 4BCIA 3OOMA 2Z8CA 2IO6A 2SRCA 1BKXA 4DFXE 4UEUA 4GYGA 3NUAA 2AC5A 4D0XA 4I5PA 2HXQA 4FTRA 4DH8A 1M2QA 4DEIA 3WE8A 1KV1A 3COKA 3ENHA 4ZSLA 4BYIA 3O8PA 2NP8A 2Z60A 5E8XA 1KOBA 3F5PA 2CCIA 4N6YA 3FWQA 2IZTA 1LEWA 4QP8A 3WBLA 4FTOA 3ZU7A 2VWVA 2QU6A 4ZTSA 3S4QA 5M4FA 4TZRA 5AAEA 3OXTA 4EJNA 3EQBA 4X3JA 3BEGA 4IZYA 2UW5A 4KIOA 4XX9A 2XAOA 3HL7A 2DQ7X 3DT1A 5CAUA 4RIYB 5CT7A 5E1EA 1JOWB 4O7ZA 3BHUA 4XP3A 2B1PA 3QRUA 5AEPA 5LVPA 5J9LA 3WZKA 4AZFA 1IA8A 2QR8A 4IHPA 3NSZA 4IX6A 4YHTA 4EHEA 5HE1A 2QHNA 3POZA 4E5BA 4HVGA 3LFBA 1OIUA 4BCKA 5HIEA 5HU9A 5L8LA 3N51A 1H24A 2RFEA 4FOBA 5LMAA 3UTOA 5CI6A 4AP7A 3KU2A 4I0RA 4U81A 1CM8A 2IZRA 3NUSA 3VJNA 4EH9A 1I09A 2UZOA 3FLZA 4BI2A 4XG9A 2GNGA 4APCA 2IVVA 2HW7A 1T45A 3EFLA 1UWHA 2GNLA 3VF9A 3ZUUA 3AQVA 4FTJA 4XP0A 5FLFA 3E92A 1TVOA 1MRVA 4AGUA 3QZFA 4WNPA 2O64A 3OXIA 4LRKA 4RJ8A 5AV3A 3D5VA 4F64A 3EMGA 3GFWA 5IZFA 5BVEA 4ZJJA 4L01A 4QMLA 5JQ5A 4D1ZA 4YJTA 1H4LA 3IDBA 2PE1A 4FSRA 3PPZA 5AR8A 4DFUA 2ITZA 3D2KA 4JQ8A 2C6LA 4U0IA 1B38A 4R3CA 5KMJA 1XH5A 3CJGA 4ZTNA 4QMYA 5IA4A 3W33A 2KULA 3W16A 3WF5A 5J7BA 4O1PA 3PDTA 4FKQA 1SVGA 1ZZ2A 4O0WA 4W9WA 4ANOA 2VUWA 2XK8A 2WEVA 3KQ7A 3OVVA 4ZP5A 4Z7GA 5JH6A 3LCKA 4EOMA 4MX9A 1PKDA 3RZBA 2WMUA 2R5TA 3VUGA 4FKLA 5HG5A 3TEIA 4JG7A 4EZ3A 4EZ7A 4MXZA 4YBJA 2OICA 4FV6A 5EYMA 4AA5A 4EK5A 3CS9A 1W0XC 5T68A 4CRLA 2W0JA 3F69A 1Z57A 3A7JA 4FTCA 5HE3A 5HD7A 1OBDA 4EK4A 4AXFA 3JVSA 1VJYA 3GEQA 4WUAA 1KOAA 5HO6A 1H8FA 5AJQA 4ZTHA 2BMCA 2CCHA 3P7AA 4DA5A 2IVSA 4IAFA 2E2BA 5AIRA 4A06A 4G31A 1BL6A 2W5AA 4AQKA 3IOKA 4D28A 1JPAA 3DAJA 4MXAA 1PMNA 1ZYJA 5E91A 2OJGA 4B0GA 3FY2A 3OUKA 4HGLA 3E87A 4QTEA 1J7IA 4PQNA 3VBXA 1PJKA 2BR1A 4X7QA 2YM4A 1H1PA 1SYKA 3UGCA 4FKRA 2G15A 2UZLA 4FSUA 3BELA 1WVXA 3R8VA 3AC1A 4G17A 3ZS5A 4K18A 4EOSA 2W4OA 2RSVA 4RX7A 1NW1A 4NH1A 4NWMA 5DWRA 3BIZA 5CSVA 1EH4A 1GZOA 2VGPA 4GU9A 4G3CA 4IB5A 2HZ4A 5FEQA 4UWYA 4HCTA 2J6MA 4XG7A 4ACGA 3N4UA 4QEBA 4XG6A 2W1EA 4I93A 4BCGA 4BVUA 3TUCA 4KBCA 5I0BA 4LUDA 5HIBA 3VQUA 4RWJA 2YCSA 2XS0A 3OFMA 3FMHA 3N9XA 2OH0E 3RGFA 3QD4A 3EB0A 2G2FA 3R71A 4MNEB 4KINA 2V7OA 2VWYA 3AGMA 2BFXA 3H9OA 1XBCA 4AW0A 4IB1A 1KE7A 1TFFA 2OSCA 3EKNA 3CIKA 4QP7A 2R2PA 1ZOEA 4MH7A 3Q9WA 3TV7A 4BF2A 2R3GA 1GIHA 2YIXA 3HYHA 1BL7A 4KD1A 4O1OA 1G8SA 1ATPE 4O2PA 2I7QA 4FKIA 2PMLX 1X8BA 3R1NA 4MTAA 5DHJA 3D7TA 5IEXA 4C4HA 2FO0A 3R63A 4IAYA 4YJRA 4AN9A 4R1YA 3AD4A 2EXEA 2X1NA 3V5PA 4KBAA 1GIIA 5IQHA 1QPJA 3F6XA 4QMNA 3F5GA 3PFYA 4FTKA 5AV1A 1L8TA 4DEEA 2X7OA 5IA1A 5L2WA 3UC4A 5CNNA 2VTJA 4GYIA 3KULA 4RPVA 4ZXTA 2BFYA 2JD5A 4C37A 4ZS4A 4MF1A 3KCFA 3W0MA 5GJFA 4A9SA 2HZNA 4LV8A 4BTFA 4XLVA 3W10A 2J4ZA 5AA8A 2PVHA 2B9IA 3KRRA 5AP0A 5EFQA 5HIDA 3UOKA 3MDYA 1DAWA 5CSWA 1UNHA 3NWWA 4M8TA 3W1FA 3NPCA 5M55A 3MPTA 3LXLA 4I94A 4MWIA 3KF4A 4MXOA 3C4CA 5DYJA 4TNDA 2VRXA 4CFMA 2WOUA 3BU3A 3OMVA 2WEIA 3ZMMA 4RC4A 4XV1A 2W1ZA 2ZFYA 4DHJA 3PXQA 1PXNA 3Q5IA 4F78A 4IXPA 4BFMA 2CLQA 3IDPA 2C1BA 4IM3A 3LJ1A 3BLRA 3LFAA 4FX3A 2OI4X 3VUMA 4LOOA 3R83A 4DH7A 4WOVA 2PE2A 5B2MA 4RIXA 5KMOA 3V5WA 3VN9A 1UKHA 5EHYA 4TWOA 3CQUA 4O4EA 3R2BA 3TCPA 3RWPA 3VS0A 4USDA 5JGBA 2PVJA 4JQ7A 1OPJA 1UV5A 5FM3A 2OJ9A 3R7GA 4Y5QA 5B2KA 4R3RA 3VBQA 4O83A 4FTAA 4K1BA 4IVAA 1DS5A 4QMPA 1H0WA 5D1JA 4EH4A 4RIWA 3VF8A 4EOKA 1JNKA 5IQDA 4EH6A 5CEMA 3QRJA 4MVFA 5HNIX 3BL7A 2VWUA 2J0LA 3GCUA 3RK9A 5JMSA 2IJMA 3UPXA 3WF8A 5E8SA 5EW3A 4NZWB 4YTCA 4O0YA 4GU6A 4WBBB 4BKZA 3RM6A 3L9PA 3UMXA 3PWDA 3LFEA 3MH2A 2BTSA 4QMZA 5IUHA 3Q6UA 1YW2A 4MHAA 4H1JA 2A1AB 3AD5A 4FT7A 2PZRA 4JJRA 4O38A 2WPAA 3SLSA 1TKIA 5HZNA 2W1HA 3FL4A 4FKUA 3FMJA 4NW6A 4WG5A 4H3QA 5JZNA 3QUPA 5BVWA 3WYYA 1XBAA 2UZEA 4F08A 5ETAA 5ANKA 4NEUA 4F7LA 3OBJA 4RJ7A 2E9PA 3MJ2A 3PZHA 3L8XA 5IQAA 4PMSA 1WFCA 4CYIA 2NRYA 5I5ZA 3UE4A 4FK6A 3VUHA 4O7RA 4AAYA 3G51A 4FODA 3MVJA 2X0GA 3LVPA 5AUUA 1H0VA 3FI8A 4NT4A 4AXEA 1PKGA 4W4XA 3VRZA 3VRYA 2YM7A 5FEDA 2YA9A 4P5ZA 4CCUA 1ZOHA 3QXPA 3EFJA 1K9AA 4LUEA 4DEGA 1NXKA 4GT4A 2WHBA 2J9MA 4HW7A 4BIDA 3PXYA 5L2QA 1GY3A 1JBPE 3E93A 3BQCA 3D94A 3FXWA 4XYFA 1G8AA 2B53A 3A8XA 2V0DA 3SVVA 2CGXA 4BI0A 2H9VA 3HP5A 4Q5EA 3QKLA 5DPVA 2ITVA 4HGTA 3F7ZA 3U9NA 1YI6A 1YVJA 2PVRA 3POOA 2I0EA 2YCRA 4RZVA 4FIGA 1M2PA 4JVGA 4MYGA 4FV8A 4FKWA 5IEVA 3FLNC 4QQ5A 1Q41A 4L46A 2I0HA 4O4DA 3ZZWA 4BRXA 4WUNA 3LHJA 2Y4PA 4QOXA 3GBZA 3KL8A 3Q2MA 3QLFA 4PL3A 3OUNB 1IA9A 3DBDA 4CLIA 5K0XA 4XG4A 3NIZA 4NK9A 4U3ZA 4Y73A 5E4HA 4NM3A 3CPCA 4BTKA 4CMUA 4OTHA 3HMMA 2GMXA 5J1WA 3U4UA 4TW9A 4RLKA 3RZFA 1ZWSA 4QMUA 2E9OA 2I0VA 3FMEA 4NFMA 2DWBA 2J2IB 3IW5A 5CZIA 3ZOSA 3D4QA 3SAYA 4FK3A 4WHZA 3ZO1A 3DLSA 4IFCA 4FZAB 3ERKA 5F95A 5TT7A 4HVHA 3OWLA 3Q60A 3GT8A 4FV0A 3FI2A 3Q96A 5CXZA 5CZHA 2ZYBA 4DHIB 4FV5A 3ZBXA 2DUVA 1OKVA 2UZDA 4W9XA 1RW8A 3QRTA 5K3YA 3CY2A 3IS5A 3PSCA 4G6LA 3N4TA 5CAPA 2QO7A 3DFCB 4E4MA 1PHKA 5GNKA 1S9IA 3ULIA 3E7OA 4BL1A 5J9YA 2B54A 1IAJA 2VO3A 3HA8A 4GUBA 4OTFA 1R0PA 3E8CA 3EOCA 4J95A 4RIYA 4U44A 4KKEA 3M11A 5AUTA 2XK9A 3DAKA 4NL0A 1IAHA 4R78A 3R7UA 1G8KA 4FF8A 2P0CA 2PTKA 2W96B 1NVRA 3TKHA 2UZVA 4E26A 1XH4A 1XO2B 3B8RA 3UOHA 4GK3A 2HZIA 4QPMA 1YHWA 4IBMA 3ZM4A 4AF3A 1ZXEA 4I4FA 3DB6A 2C1AA 3LFFA 4GK2A 3R9HA 4FT5A 4ZY4A 3O7LD 4Y85A 3V04A 4GG5A 5DR2A 4C58A 1UVRA 3TKUA 5IISA 5A4CA 4S31A 3SX9A 3ATSA 2OIBA 5HO8A 4DFYA 4KB8A 2YAKA 3LMGA 2CGWA 4DT8A 2JDOA 3MB6A 4JDKA 3FDNA 3DKFA 1Y57A 5J5SA 5C27A 3I5ZA 4EONA 4D1SA 4PPAA 4ZLOA 4BCPA 3EN5A 5HVKA 2A98A 3QQLA 3MPMA 4FKOA 4FVPA 4PX6A 5E8ZA 2UW6A 5H8GA 4ALUA 4LOPA 4EBWA 3JS2A 3E88A 4A4LA 5KHXA 5JFSA 2IEWA 4BGHA 3ZZEA 1Q61A 4JDHA 1H1RA 3FV8A 1FGIA 2JKOA 4IVCA 1K2PA 4PTCA 2WMQA 1ERKA 3Q32A 3GQLA 4O6LA 4U43A 4ACMA 5LCKA 3QUDA 2VO6A 2PU8A 3NYOA 3RK5A 5DMZA 3AT4A 2UW9A 2ZM4A 3CXWA 4R8QA 4U79A 4C2WA 4EOOA 3CJFA 3M42A 4J1RA 5CU3A 1XMMA 3NUPA 3LXNA 3NYNA 4D2WA 2ZV9A 3JVRA 4W8DA 4NJ3A 2WU6A 4R7HA 3TZMA 4E1ZA 4EH3A 2DYLA 2ZDTA 5F9EA 3T8OA 4CFUA 4L42A 2BDJA 2XNMA 4DFLA 4PMPA 4ZY5A 3MBLA 3ANQA 4DCEA 2PVNA 4YGAA 1A9UA 5DGZA 4EH8A 3TNQB 3FSFA 4D5KA 1TQIA 4ZMFA 3QBNA 4JX7A 4IVBA 5IA0A 5CTPA 4AOIA 2GNIA 3PY3A 3UOJA 4BDJA 5L6OA 5H9BA 4DBXA 3IW7A 3H9FA 2IZUA 3C5UA 5EHOA 2ETRA 4QP4A 4JG8A 4IAKA 5FEEA 4FZ6A 3RHKA 4BYJA 4JAJA 4JT3A 3KA0A 3IG7A 3QLGA 4LOQA 4JBQA 3IECA 4QTCA 4BKJA 2XNOA 2YJRA 5LVNA 3LKMA 4TYIA 3RINA 2YCFA 5I4NA 4BJJA 4M68A 5DRDA 3HRBA 4U80A 4RFMA 2CHLA 4KIKB 3RWQA 1U5RA 3DZOA 4L53A 4BHNA 2HCKA 5EYCA 3R8MA 4BGQA 4QQTA 2RFNA 3C4EA 5C9CA 3PY0A 2PMIA 4L52A 2QLQA 2JDRA 3NCGA 3BE2A 1KE5A 2F7EE 5BNJA 5C4LA 3EQGA 3QRIA 3QD2B 4DGMA 3U55A 2UUEA 4OW8A 4NYEA 2I1MA 4B4LA 2OFUA 4ZS0A 1YXSA 3NVMB 4QYHA 3Q9YA 4YJOA 5HX6A 3R1YA 2QI8A 1OL6A 4O6EA 2C6TA 2VTNA 5M57A 3KY2A 5JQ8A 2ITPA 3P9JA 3P79A 4MNEA 4XLIA 4QMOA 3R73A 5TE0A 3BQRA 1G8JA 4D2VA 1NA7A 4M3QA 4IZ5A 2P2HA 3VW8A 2YM3A 3GU8A 4ZEGA 4B8MA 3C4FA 3ZRMA 4EJ7A 4FV4A 3PIYA 4QNAA 4BCHA 3UDBA 4FKJA 4FTMA 4N4SA 3FMNA 3NX8A 3KXHA 4IQ6A 1O6KA 2OWBA 3F5UA 5EM8A 5AUXA 1OIRA 5HE0A 4FNYA 4CCBA 4M7IA 3DJ7A 5JRSA 1W8CA 2H96A 2EB2A 4FR4A 4DC2A 4QNYA 3KGAA 3WZDA 5FXSA 3V51A 3QGYA 3MSSA 4GK4A 4KIQA 5AR3A 4LV7A 3ZRKA 4LRMA 1PMUA 4JIAA 4Y72A 5CF8A 5CAOA 4BTJA 3O5AA 2V22A 4JI9A 3F9NA 4FIJA 3VBTA 2B7AA 3ROYA 3BYUA 3TNHA 5IQBA 2WNTA 1TQPA 1YXTA 3PPKA 3BE9A 3ZSGA 3MH1A 2UZTA 2R0UA 5CWZA 1CKJA 3MVHA 5DOSA 4AZWA 3A62A 4FTQA 2VTAA 2YM6A 4X3FB 3WF7A 1UKIA 5AIKA 3R1QA 3DFAA 1S9JA 2W06A 4MBIA 2XEYA 2X39A 2Y6OA 3ORZA 3V8WA 5I9UA 3VUDA 3Q3BA 4RWLA 4D1XA 2UVYA 2ETMA 1TZDA 4RX9A 3AXWA 3CBLA 2YN8A 3ELJA 3FZOA 1YI3A 3HEGA 3I6UA 3U87A 1Z9XA 3QWJA 2IF8A 4C36A 4G5PA 2X0QA 2Y4IB 4QYFA 4XG2A 4YJQA 5L8KA 3FY0A 4I22A 3RI1A 3EYGA 3TWJA 2LAVA 2YIQA 1FBNA 1OL1A 2WTKB 1KSWA 4I3ZA 2R3KA 4XJ0A 5D9HA 4ANLA 4F7NA 3NDMA 3G9LX 3R0TA 3NNVA 1JWHA 1YOLA 2EU9A 4FIHA 4IX4A 5EW8A 3O0GA 4R5SA 2BZKB 3W8QA 2XNGA 4FNXA 3VBVA 4OAVB 4I1ZA 4D55A 4Z7HA 2XNBA 3Q5ZA 4HPUE 4FV3A 5CALA 2FGIA 4QMMA 2WMWA 4XV3A 5EI2A 3RAHA 3RPVA 4M67A 1JSUA 3KRXA 3FBVA 3VJOA 3UO6A 3ZCLA 2W99B 3R7VA 1ND4A 3ZTXA 3JXWA 5CYIA 5AUWA 4X2NA 3RKBA 5C01A 4S33A 2WQOA 4W4WA 1QPDA 3ENMA 4CV9A 3NW7A 1B39A 1U5QA 4MXXA 1Y8GA 1SNUA 4JBOA 5HCYA 4NIFB 3SDJA 2QC6A 3GOKA 4CRSA 5L2IA 2HAKA 3TV6A 4AE6A 3MY5A 3JUHA 3NUNA 4L45A 5CS6A 1YXUA 3NCZA 4ZZMA 4F1MA 3QL8A 1MUOA 3FJQE 4M97A 4QMXA 5EOLA 3UVQA 1ST4A 3QCQA 4A07A 4UYAA 2F4JA 4WT6A 5BQ0A 2BHEA 5CVGA 4C4JA 3CD3A 5I9WA 1OVEA 4NTTA 1W82A 4ZMEA 1Q8UA 3G33A 4DG3E 4FOCA 4E20A 2UZBA 1DM2A 2XEZA 4CSVA 1YRPA 3QTXA 3VS4A 4LI5A 4QMWA 3ETAA 3HV6A 4DBNA 5HX8A 3DS6A 5AAFA 3TNWA 2QQ7A 4H1MA 4HCVA 4GIIA 1PXPA 3FMLA 4PRJA 5CNOA 4C62A 5IUIA 5E8UA 4BDIA 1Q97A 3F3UA 4ENYA 5A4TA 4C4EA 4UWCA 2V7AA 4FKPA 4QYYA 3OWJA 5HTBA 4K0YA 2JDSA 4YU2A 2J5EA 3ZO4A 4F99A 5GIOE 2C6KA 4E5AX 3P7BA 2R0IA 3WF9A 5JFVA 3GB2A 4X2FA 3DZQA 3BYSA 1OKYA 3HMNA 4I6QA 3WI6A 2VTPA 2YCQA 4M0ZA 5FGKA 4IWQA 2EVAA 2QKWB 4BN1A 3RBWA 3AC4A 4ZSAA 3L8SA 4BZNA 2JEDA 3PLAE 3FI4A 4TN6A 2QODA 2UV2A 1YXXA 4IC7A 5T3QA 5IQCA 4IACA 4J53A 4ZAUA 3I7BA 5HOAA 3DLZA 4M0YA 1OZ1A 3OCSA 5FTQA 3BBTB 3OD6X 2IW8A 5CQWA 3PPJA 3O7LB 5JK3A 3DKOA 4FSQA 3BRBA 4KBKA 3LFDA 4MUQA 3AT2A 2PUPA 3R1SA 3DBCA 3KC3A 3W2PA 4O27B 3Q6WA 5C4KA 4WNOA 5CEPA 3O23A 5E8WA 2YIWA 3FPQA 4RJ4A 4YPDA 1Q8WA 1R0EA 2PULA 3EL7A 5HG7A 3WF6A 4HVDA 1VEBA 4XBRA 4Y83A 3SHEA 5L6WL 4JRVA 3TI1A 4GSBA 3NLBA 4QTAA 2CMWA 1M17A 2Z7SA 4J97A 4QMTA 3ZUVA 2ZMCA 1W98A 5KMKA 1DAYA 4Z9LA 5BYLA 2FSLX 5IKWA 4LL0A 4YSMA 3VUTA 5L2SA 2B9HA 4LGDA 5LCJA 1QL6A 3K5UA 4EH2A 3HDNA 2YEXA 3NYXA 4EWQA 1H07A 3KMMA 2IW9A 4XP2A 3U6JA 4QDVA 3QQKA 1FVRA 2J51A 5ANEA 4EHZA 3TUBA 1HCKA 4BCNA 3PIXA 3EN9A 4YO6A 4EC9A 4YC6A 3BGZA 3PP1A 4L44A 5E90A 4E3CA 1GIJA 3KVXA 3ZONA 3DBQA 5KZIA 4RX5A 4WRSA 4FIIA 3KK8A 4QYGA 1WCCA 2WTJA 4GFOA 4O7SA 3BI6A 2R9SA 4UMPA 3G0EA 1FQ1B 1VLRA 2PE0A 2WTDA 4NKSA 4DH3A 4R6VA 3E3BX 4LQMA 4TL0A 3OY3A 4CNHA 4Y46A 1LEZA 2W1IA 1UU3A 2WTIA 4V04A 1REKA 5A54A 2BTRA 4YJNA 2FH9A 4MEDA 4RQVA 3ORXA 4X6QC 1OGUA 5AR7A 3UP2A 5HO7A 3QHRA 5LVOA 4M69B 4PMMA 4ZIMA 5DH3A 4PNKA 4J99A 3PP0A 4BBEA 1ZAOA 3IGOA 3TIYA 5BX0A 4BDGA 4MXCA 3H30A 3R7IA 1G5SA 4HCUA 5BUJA 2OFVA 2ZDUA 3PXZA 5IMEA 5KMLA 3QALE 2AC3A 4FV2A 3OF0A 1TQMA 4Q2AA 3VO3A 3DCVA 2BAJA 4CV8A 4B9DA 1PYEA 1YWVA 4FNZA 4A9RA 2OU7A 3L8PA 5C8NA 4ENXA 3Q04A 5TR6A 3PTGA 3BKBA 4FTUA 2QOFA 4ZOGA 4EUTA 2B9FA 5EQPA 3AC5A 4IAAA 4NW5A 2XJ2A 3SRVB 4XUFA 2WTWA 4MNFA 3TJCA 4AZTA 3DNEA 4EI4A 5DFPA 4D4RA 3MYGA 3RM7A 2DS1A 4H36A 5AP5A 4K8AA 4G16A 3DK7A 2WIPA 2RFDA 3E8NA 3ORPA 4BBFA 3W0NA 1GAGA 2PVLA 2F57A 2WQEA 5EG3A 3UQGA 3QKMA 1OKZA 1VYZA 3T9IA 3WZJA 3Q53A 5BMSA 1CSNA 3AKLA 2RF9A 3ITZA 3QTRA 3T3UA 2XAMA 4TYEA 3MW1A 4D4SA 4GJ3A 5D41A 4AA4A 2JIIA 3AMAA 5A46A 3C5IA 3ZH8A 3FAAA 2YACA 5AA9A 2ZM3A 5HTCA 3UOLA 5BPYA 1SZMA 3ZFXA 3Q4ZA 4E73A 2HW6A 4DITA 2JAVA 5E1SA 4CTCA 4E6QA 2W5HA 2X4FA 4DFBA 3CCNA 2QOKA 4U5JA 2JITA 2H8HA 3NUXA 4YC3A 3ZFYA 2W9ZB 1R1WA 4CZYB 2WGJA 4YHFA 2JDVA 4CVAA 4EOJA 5AAGA 3P23A 3ZXZA 2P4IA 4X3FC 2C3LA 5AR5A 5JGAA 3TKIA 5ICPA 2HYYA 2ZV8A 5E9EA 4IDTA 4RFYA 1AQ1A 4WNMA 1V0PA 2O5KA 3EQDA 4EZ5A 2IW6A 4BIBA 4DFZE 4O2ZA 2ZM1A 5FDXA 4JDIA 1XH8A 2C3JA 4ASZA 2VO0A 3ZO2A 2REIA 2AEGA 4JBPA 1J7LA 3R6XA 3HZTA 3C7QA 2R3FA 1NVQA 2X9EA 3FYJX 3O8TA 4RT7A 5AWMA 3RHXA 5I9XA 1K3AA 2Y4IC 4I0SA 5HE2A 1ZY4A 2RG5A 5D11A 3AD6A 3LAUA 4M13A 4PDSA 1JSTA 1Q24A 5CQUA 2VNYA 3RPSA 4HOKA 4U41A 5JSMA 4O86A 4O4FA 5IA2A 2WTKC 3OEFX 2VWXA 4I23A 4CKJA 3ZSIA 3UQFA 4Q9ZA 2XK6A 2XRUA 3BU6A 3LCOA 5AUVA 4L3LA 2GHGA 5L6PA 3VS6A 2QOQA 4RLLA 2GS7A 4QRCA 3HV4A 3D9VA 3CY3A 3BX5A 3Q4TA 3NIEA 5AUYA 2BRNA 2C68A 2PMNX 3OG7A 5EOBA 4CQEA 1UA2A 4ZZNA 5IQEA 3UNZA 3WOWA 4X3FA 4JMQA 3C0IA 4TPTA 2HELA 2A4LA 4G6OA 2RFSA 3ZBFA 4BCFA 4DEHA 5IUGA 4N57A 3OZ6A 2FYSA 1HOWA 3IPHA 3GENA 4L43A 2CKPA 2UW8A 4O0TA 5CY3A 3E8DA 5A6OA 3ZM9A 1P5EA 1QPEA 5AP1A 4FIFA 3D5XA 4L3JA 5AX9A 4BICA 3JY0A 3OS3A 2WMBA 2W4JA 3HMIA 3HVCA 3PLSA 5HU3A 1LPUA 5HCXA 4ZSGA 4YO4A 3QC9A 2GU8A 4OT6A 4U6RA 3P4KA 4U42A 1KUTA 3DQWA 3A99A 5HLPA 4JR3A 3VUKA 2Z2WA 3FPMA 4RJ6A 1W2CA 4C02A 5L4QA 3WIGA 4EBVA 4D2PA 2XIZA 5FXRA 1H25A 1KE6A 4FSWA 3GC8A 2O65A 2B4SB 3COMA 2AUHA 3G90X 3IW6A 2PWLA 5FG8A 4UZDA 2HY0A 2BIKB 5IU2A 4FZ7A 4KRDA 1BX6A 4RA5A 2YZAA 5KO1A 5DT0A 4PMTA 5HORA 5M44A 4JAIA 2EB3A 3OWPA 3FUPA 4F0FA 3EZVA 4E6AA 4RC3A 3TM0A 2NO3A 3PWYA 2GPHA 4RFZA 4BZOA 4F7SA 3KRWA 5H8EA 4LV5A 3F82A 4XOYA 4Q9SA 3OW4A 3ZXTA 5M56A 2ZB0A 1YKRA 4I20A 3SQQA 3KCKA 3V6RA 4AUAA 4JS8A 2Y6MA 4A9UA 2I6LA 3A8WA 2RGPA 3QU0A 3RNYA 3GC9A 3TUDA 3BPRA 3CTJA 3P7CA 4XS2A 5IG1A 1AD5A 3V5JA 2WMVA 3DPKA 5H8BA 4WBOA 4A4OA 3LFSA 3LMIA 5DBXA 4XBUA 4AN2A 1E1XA 2ITOA 4YHJA 4ZSJA