1UNGA

Structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
292
structure length
288
Chain Sequence
MQKYEKLEKIYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLANFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords CELL DIVISION PROTEIN KINASE 5
publication title Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 288
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ungA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ungA01
4OBQA 4YP8A 1OMWA 3VAPA 3HMOA 1VJYA 2FGIA 4L43A 5AR8A 4U41A 3C4ZA 4WUNA 1O6KA 5FQDC 4OW8A 3V5LA 4EZ5A 3LFNA 5J9LA 4O1OA 5HE0A 2O63A 3PSDA 4JQEA 5CF5A 2R7IA 2YCQA 3D5WA 5KUPA 1WBWA 2XJ1A 4IMYA 5K0XA 4G6LA 1ZLTA 2QQ7A 4FV3A 5AUVA 1J1BA 3EWHA 3EH9A 3KKVA 3EZVA 1U54B 4BGHA 3OOMA 4G2FA 4HNFA 3T9TA 3S2PA 1Y6BA 4A9SA 2PMNX 3GEQA 3I7CA 3AG9A 3R9DA 5BVKA 1WVXA 4YO4A 4IW0A 4JBQA 5AV0A 4BDCA 4FV7A 3LOKA 4N4SA 3TIYA 3JYAA 3R9OA 4FIFA 1ZOEA 3BHUA 4RBLA 2QOBA 4G3DA 4PRJA 1NXKA 5T68A 4JDKA 4LFIA 4FKTA 2UVZA 3D7TA 3M42A 4FVRA 4FEVA 2YISA 1JKLA 5L2IA 4GK3A 2OO8X 1TKIA 4FIJA 4FV4A 4M67A 3O8TA 4IX3A 5CVHA 3R7EA 4D2WA 3PIZA 3CJGA 4FNYA 3UVPA 1YRPA 3A7JA 3QZHA 1Q8UA 5HE1A 3ZO4A 5F9EA 2BAKA 5FD2A 5LOHA 3WIKA 4JBVA 2F2UA 2ETKA 2ITQA 4YHJA 5L2WA 5B0XA 2OZAA 3G6GA 2C1AA 2GS6A 4D4SA 5GZ9A 4QP3A 3O17A 3PWDA 4X2GA 4AA4A 4YPDA 2QOOA 5TF9A 3RNYA 2W0JA 3D4QA 1JOWB 5AADA 2BUJA 2UW0A 3PLAE 2VUWA 1CKPA 3HV4A 3CCNA 3FXZA 4CQGA 2WOTA 5D9HA 3KN6A 3FLYA 2PTKA 2CKPA 3ENMA 2H8HA 4O0SA 4DFZE 2BDWA 4M69B 3OUKA 3RALA 3UC3A 3ORKA 4R8QA 3QUPA 5KKRB 1OI9A 3GBZA 5I3RA 3AD4A 1OPKA 4O21A 4KIKB 3TIZA 4ANLA 4FKJA 1ZMUA 3MA3A 3C5UA 3D83A 5M4FA 3GFEA 3FXXA 4AFEA 5HU3A 3SA0A 1JSVA 5HNIX 3QTUA 3SGCA 1G8AA 4JOAA 5LMBA 4EHGA 1RDQE 1SVEA 4ZIMA 3C0GA 2XP2A 4FTTA 2UW8A 5L3AA 4L3JA 3L9PA 4J52A 4RZVA 4DEDA 3DBFA 2UW5A 4O0YA 4QTAA 3L8XA 4UYNA 2JC6A 2QLQA 4HGEA 5KZIA 3VS3A 2BRNA 3SXSA 4EOIA 2RGPA 1Q3WA 3POZA 5DT3A 2R9SA 5KCVA 4UZDA 3FAAA 3MI9A 4F70A 3GCUA 4DHFA 5EM5A 3RAWA 4HVGA 4JIAA 2OXYA 4EZ7A 3NNUA 3Q5ZA 3UOJA 1JSTA 4CMOA 3GU6A 3RAHA 3BGQA 3W2SA 2IVVA 2W1GA 3IGOA 4FL1A 4DH7A 3TM0A 4M7IA 3NAXA 3NR9A 3PVBA 3NAYA 4FT3A 1YHWA 5ETAA 4MQ1A 4XYFA 4EBWA 4J96A 2WMRA 1IAJA 4C8BA 3ZYAA 2ITXA 2I1MA 5AUTA 3L8SA 2OJ9A 4QP9A 4AGCA 4FGRA 4YTHA 4IFCA 4GK4A 3UIBA 3A8XA 3LIJA 4O0VA 3R22A 2VNWA 1OPLA 3R1YA 4DFYA 4O7ZA 2JKMA 4PMPA 2QO7A 1U5QA 3OD6X 3NUYA 2XK8A 4OTIA 2EVAA 4UY9A 3VRYA 3ZC5A 1QL6A 3R8VA 2R4BA 3V6SA 5L6PA 3D94A 4ZTQA 5IMXA 2EXMA 3IQ7A 4RFMA 2E9OA 1A48A 5LWNA 4Z55A 5L2QA 4AACA 3QRJA 3QUDA 2FSOX 4ONAA 4EUUA 2FSLX 5J87A 3QCQA 4G5JA 3QALE 5ITAA 4D58A 3ZRKA 4KIQA 2R3HA 4F9AA 2YLFA 4ORKA 5CASA 3VUHA 2A2AA 3VWAA 2YHVA 5E1EA 1T45A 4CMUA 3IECA 3BV3A 3LFDA 3CGFA 1B39A 3KCKA 3NUSA 1FGIA 4MNEB 4MXOA 2G9XA 3ORIA 2CKQA 5H8GA 2I7QA 2R3FA 3V5PA 4C4IA 4JAIA 3R63A 2LGCA 3ZU7A 4TKSA 2E9NA 4QMVA 2V7AA 4RFYA 4AT3A 2EU9A 5FGKA 2OW3A 4FNXA 4BCNA 3QD4A 2WEIA 3QWKA 3TUDA 5JN2A 4AQCA 3EN5A 1KE5A 4NKSA 4NIFA 5AIKA 5AP4A 4CFNA 1AGWA 4IADA 5CNOA 4AXAA 2XNEA 4R3RA 2YITA 3D14A 4XG8A 1LR4A 5ACKA 1KUTA 4YSMA 2XNPA 2VZ6A 3TWJA 3NNVA 3FV8A 4K2RA 2CN5A 4UMRA 5KKRC 4AS0A 4JXFA 5I3OA 4DE4A 3Q4ZA 2QURA 4JIKA 2OICA 3A2CA 4H3QA 3MWUA 3K5VA 4XP2A 3RMFA 3PWYA 5IDNA 1J7LA 3E8CA 4FSWA 4ITHA 3HVCA 4BHNA 5GZAA 3QF9A 4UV0A 3ORMA 5CF8A 4R78A 4O7YA 5KE0A 1K2PA 3SOCA 1YHSA 2XK6A 3OWLA 3DNDA 3HDNA 4AN3A 3ACKA 2ZV2A 1UWJA 3RI1A 4ANOA 5HLNA 1Y8GA 2XEYA 2B9HA 3I1AA 2UZEA 5CS6A 3MS9A 3UJGA 5EH0A 2IJMA 3VUGA 4LUDA 5DRDA 3CPCA 1ZYSA 3UZPA 3H3CA 1OUYA 4RIYA 4C62A 2XBJA 3DBCA 5HE3A 3RTPA 5J95A 3OWKA 4OT5A 3UYSA 5HG7A 5EYDA 3IDPA 4ACHA 2R3OA 3QYWA 3UDBA 5B7VA 4KBCA 2UW7A 2XCHA 3HMNA 2OI4X 4BKZA 1WVYA 5ANDA 1L8TA 4GG7A 2CNVA 3UZRA 2ONLA 4IZYA 4PL4A 5EW3A 4PP9A 1Y8YA 3FLSA 4XRJA 1KOAA 1UU8A 5C26A 5D7AA 1ZMWA 1LEWA 3L9NA 2WHBA 3R2YA 3ZEPA 1V0OA 1XH4A 4NM3A 1SNXA 4MF1A 5DPVA 3WE4A 4CFXA 2VO7A 1TVOA 3NYOA 1Q4LA 5J7HA 3JVSA 4F7NA 4XBRA 1OZ1A 3OCTA 3F61A 3O71A 2HZIA 4JRVA 2G2FA 3QZFA 3T3VA 4NEUA 3TI1A 5IQFA 1GIHA 3M11A 3GCQA 4TWOA 4ASXA 3R8UA 3ZLSA 1JPAA 4EKLA 1R39A 1RW8A 3A62A 5IEYA 2JFLA 2XNMA 3BCEA 3D15A 4R7IA 2JD5A 4FSYA 4U7ZA 4A4LA 4AG8A 4AN2A 4AE9A 4ANQA 5KBRA 3FZSA 1QCFA 4TYJA 4RIWA 5CENA 5EYCA 3TJCA 3FQEA 5EW9A 5CEKA 5JSMA 3LFEA 4HCUA 5IU2A 2P2IA 2ZV9A 4QMUA 5BMSA 3BYMA 4IZAA 2YIRA 1FVRA 2C0OA 3Q5IA 4D5HA 1H0VA 2X7FA 4CMTA 4DTKA 2X9FA 1H00A 4PMSA 3GC0A 3NS9A 5CXZA 1SNUA 3R8ZA 3RZBA 2WU7A 4I4FA 5JGAA 3LJ1A 3Q96A 4YJOA 3QUEA 3RINA 5BQ0A 4ALVA 3FQHA 4EKKA 5HX6A 4XP3A 3VS2A 3IW7A 4L8MA 4OTQA 4RX7A 3VBTA 4RC3A 4BDKA 1UNGA 4CT2A 4U97A 3KF4A 4EOMA 3U55A 2XB7A 4AZVA 4YC6A 5LVOA 4RVLA 2CGVA 1YQJA 5F4NA 2GFSA 2PVJA 3JXWA 4R7BA 3DZOA 3LVPA 4TY1A 2WTJA 4FKIA 4UZHA 3FKNA 1KE8A 3ENHA 2WELA 3OFMA 1NVRA 1XH7A 3TNPC 3U51A 4UMUA 2R0IA 3P0MA 4D28A 5J7BA 3D7TB 3AC2A 2IZRA 4WT6A 2X2LA 3NYNA 1YOLA 4M8TA 3RPSA 4C2WA 4IDTA 3JUHA 3BWJA 3DAJA 3ORXA 3FUPA 4PTGA 5CI7A 4BWXA 4A7CA 5CSPA 3CE3A 4RJ5A 2X81A 1STCE 4Y5QA 3CY3A 1KSWA 1XH9A 4EC9A 3V5JA 2WTCA 4QP8A 2AUHA 5ANIA 5CEQA 2PE0A 5F95A 3MVMA 2QOKA 2QOFA 4E8AA 4EWHA 2OSCA 4WOVA 2EB2A 3VC4A 5CAQA 3R28A 1OVEA 4ZLZA 3EB0A 2YZAA 4RIXA 3R7VA 5TT7A 3V6RA 2W4OA 1PW2A 1XH6A 1OIQA 2ITZA 1BYGA 2CSNA 3A7FA 3GCSA 3Q53A 3KREA 4IM3A 4EK8A 3KEXA 3W8QA 3VUKA 4E6QA 3NMUF 3NW7A 3ZRLA 4BVUA 4Q9ZA 4N57A 2VNYA 4OAVB 2GHLA 3AT4A 1XKKA 4BI0A 3FKOA 3O8UA 1H4LA 5JQ8A 4AW2A 4DLJA 3UMXA 3G0EA 2XRWA 3UIXA 1JBPE 3U9CA 2CPKE 3QC4A 5BUEA 2BCJA 4QOXA 5FXSA 3SG8A 4CV8A 4QMXA 3WZJA 4KBAA 4OT6A 1H1PA 2C6IA 2X2KA 3CJFA 3PA3A 4TRLA 3TL8A 4XG3A 1UKIA 2CJMA 3NDMA 4GFMA 4MVFA 3VJNA 4GT5A 2CGXA 4JR7A 3A7IA 4FKLA 4KABA 3KXMA 4W4WA 4IVCA 4ANMA 3GCVA 3L9LA 1V0BA 2JDRA 2W5BA 3I7BA 3CQWA 4FOBA 1IG1A 2WIPA 2ZV7A 4JG6A 3NCZA 1Q24A 3EQPA 5J1WA 1FPUA 1SM2A 2C0IA 1FVVA 2BIYA 3QTRA 4PP7A 2OGVA 5LVNA 3F88A 1M14A 2C68A 4O0WA 3IDCA 2XIKA 3ANRA 4ZTRA 2W5HA 4IDVA 5C8NA 5HG9A 4ZSAA 3MFTA 5IQCA 2ITWA 4CKJA 3CD3A 5CSXA 4BIDA 3KK8A 2PE2A 3ACJA 3E3BX 4WBBB 4Y72A 3AMBA 1W84A 4BF2A 4IC8A 2VGPA 4PQNA 4Q2AA 4FSMA 4L3PA 3Q2MA 5HKMA 3TG1A 4CKIA 1UA2A 5L2TA 3QAME 3QXPA 1L3RE 4QMOA 1OBGA 2R3JA 3FY2A 3MH0A 4RLLA 2OH4A 2H96A 4IAFA 2VTLA 5GJGA 1Z5MA 4G3CA 4I0SA 4UN0C 3MA6A 1QPJA 3SHEA 4FZ7A 3LXNA 2W96B 4F9WA 4CG8A 4A9RA 3NGAA 4NM0A 5E91A 1OBDA 3F69A 3P23A 3GOKA 1B38A 4AGDA 3MH2A 5M09A 5ETCA 3MVLA 2W4KA 4TYHB 4ZY5A 1PMUA 1NA7A 2H9VA 4ENYA 4YZMA 4AZWA 4FODA 1RQQA 3V01A 3JPVA 4OTFA 3ID6C 2HIWA 2BVAA 3BU5A 2QOQA 3SX9A 4FTJA 3WF8A 3S1HA 5FG8A 5DYJA 2CDZA 4G9CA 4ZSEA 3HL7A 2GS2A 2YDKA 3DKCA 3HGKA 5ANJA 2VGOA 3HP2A 3P1AA 4P7EA 3ZH8A 4BWKA 4DFXE 3TNIA 3SG9A 1R0PA 4YJNA 1DI9A 5CU3A 4ZMEA 2WMBA 3HV7A 5AUXA 5DIAA 5HEZA 4X2FA 4FKPA 4MYGA 4U3YA 5EW8A 1UU7A 3CQUA 3CQEA 4EJ7A 4RLKA 4EH4A 4O0XA 5AMNA 4LYNA 4CCBA 4KIPA 5D11A 5A6NA 1H8FA 2I0EA 4BN1A 1H1SA 3BPRA 3EFLA 3OG7A 5GIPE 4OBPA 3ZLXA 3Q3BA 4NIFB 3UP7A 3MIAA 5EYKA 3NSZA 3RAKA 2E9UA 4G16A 1Q62A 4YHTA 3PA5A 4ACGA 5G6VA 4GS6A 4R1YA 4CTBA 2R0UA 3FI8A 3P4KA 2GNFA 1AD5A 4BBFA 4EYMA 3VQHA 2W9FB 3DBDA 4D9TA 1B6CB 2QCSA 3MDYA 5EFQA 4ZTLA 4RGJA 1WBNA 4FZDB 3SD0A 2CGWA 1E9HA 2XJ2A 4P2KA 3W16A 5I4NA 4QYFA 2ZJWA 1ZAOA 3EHAA 5I9ZA 4D1ZA 5AAEA 4LMUA 4NL0A 4XLIA 5HIBA 1GAGA 4N6ZA 1QMZA 2V62A 4I0RA 4EQUA 5IQIA 4JL9A 4FG9A 4G3GA 4X21A 4UWCA 3D5VA 2ZM4A 2RL5A 4UWBA 1K9AA 4IM0A 4X6RA 2YERA 3W33A 2VX0A 3I6UA 2IVTA 1REJA 5BVFA 1CDKA 3NEWA 5E1SA 3DU8A 3MFUA 3QGWA 4BKJA 1HCKA 4DGMA 1H24A 2YWPA 2DUVA 4USDA 4AP7A 4EBVA 2OF2A 5KO1A 4FEUA 4J95A 4ACDA 3Q6WA 3TZ9A 3L9MA 2ZM1A 2W1FA 4MD7E 2P0CA 3JY9A 4QMNA 5IQAA 4U79A 2IW8A 1TQIA 4J53A 4QMPA 3G5DA 4BYIA 3F3VA 3DKFA 5IH4A 1ZYLA 4AZEA 1JKTA 5CALA 3AQVA 4C4EA 5DE2A 4IWOA 1E1XA 4B8LA 4BDAA 4EOPA 4XG2A 5FM2A 2R3NA 4IX4A 3II5A 3MJ2A 5AP5A 4EQCA 4D4RA 3NLBA 1H0WA 2YWVA 2NRUA 1KE7A 3PFQA 4APCA 4EEVA 4BR3A 1P4OA 4O7LA 4PDYA 4C02A 3ROCA 3L8PA 1OM1A 4AOIA 5CY3A 1OL7A 3ANQA 4J99A 2X7GA 1YWRA 4RJ6A 4C59A 2R3LA 3H10A 4ASZA 4AU8A 2QKRA 2OG8A 3E92A 3R73A 2C5VA 4BGGA 2PUIA 2X2MA 5TE0A 1JKKA 4FV1A 4NKAA 4ERWA 4TNBA 2EWAA 5CXHA 5DMZA 1UV5A 4Y73A 4YPSA 4F08A 3D9VA 2HY81 1FQ1B 2OZOA 3EN6A 4RVMA 5ETIA 5FTOA 3PSBA 3W2OA 4N0SA 3DJ6A 3TUBA 4RIWB 3FPMA 2VTOA 2UZUE 3DQWA 5GINE 3ULIA 3OY3A 4BC6A 5A4QA 2BKZA 3BU6A 2ITUA 2YLEA 4E6CA 1J7UA 5AR5A 5FLFA 2H6DA 3ZXZA 4ACCA 2QU6A 4KINA 2WTVA 1ZRZA 3BYSA 3PXFA 2I6LA 2OIDA 5IA5A 4ZZOA 4C57A 3BIZA 3F7ZA 4YUQA 2HCKA 4FEWA 4ZP5A 1CTPE 1GZNA 3VHKA 1DI8A 2ZVAA 3QLGA 4HYSA 3VUIA 3LFAA 3FJQE 3HMPA 2PY3A 3R21A 5FM3A 2W17A 3EQFA 4IAAA 4GJ3A 4BDIA 3DJ5A 2XYUA 2QU5A 3CIKA 4YJUA 1PXLA 2NRYA 3U87A 4IH8A 4O7SA 4D9UA 5I9YA 3DLSA 4S33A 4HNIA 4OTWA 1M7QA 3KMWA 1URWA 4D2SA 5M56A 3UPXA 3VBQA 1NY3A 2NO3A 4JJRA 4MK0A 4CVAA 5IUHA 5DR6A 4B99A 3U6HA 3DXNA 3KK9A 2AC3A 2X8IA 2ZB0A 2C6LA 2EXEA 3KC3A 3GU5A 1LEZA 3E8NA 4CRLA 4HVDA 4QQJA 4WNOA 4KWPA 3FMLA 2V55A 1PKGA 4RZWA 2BDFA 3W18A 3A7HA 1NVSA 3VW6A 4YURA 2J0JA 5HLWA 5DFPA 2YM3A 3WI6A 3MH1A 4I23A 4F0IA 4AW1A 3UODA 1YWVA 3IOKA 3SRVB 4NM7A 4BL1A 2JBPA 4G34A 5LWMA 4JT3A 4Q9SA 2C69A 2GPHA 4RIXB 4YC3A 4M66A 5AM7A 2IVUA 4A4OA 4IVAA 2IO6A 4FC0A 4FYOA 4D1SA 5A4CA 4OAUC 1LP4A 4O7VA 4PPAA 2B54A 5EI2A 1M2PA 2UZVA 2BTSA 2J5EA 2PZ5A 3DBQA 3ERKA 3LFCA 2EXCX 3R1NA 4QYHA 4V04A 3QC9A 4MD9E 3QYZA 2BHEA 2XNNA 2ONLC 3BHVA 3LQ8A 4XV9A 3LXPA 1ZOHA 1PRYA 2YJSA 4DH8A 1CKIA 4NJDA 2QD9A 4EZ3A 2VWWA 2BMCA 3NIZA 4HYHA 5KZ0A 4E4XA 4H36A 4QP4A 5M44A 3K5UA 3VQUA 4MKCA 3LLTA 3MGYA 3SW4A 3N9XA 2PUNA 2ETRA 4C37A 4O0UA 4O7RA 5J5SA 2OXXA 3KGAA 2XNBA 4TZRA 3PXZA 1W98A 2BRMA 4FBXA 1XBBA 4OTDA 2P2HA 3A61A 3KXXA 3C7QA 3G0FA 5IQBA 4W4XA 4UXQA 1PF8A 2PZIA 2GMXA 5GJDA 1IA8A 2B4SB 3QA0A 4D2RA 3AC3A 3CP9A 2XKFA 3K3IA 5LCJA 2YIWA 2WAJA 3UOHA 2WMTA 1WBTA 2XIZA 4FVPA 3BV2A 4QYGA 5CU2A 5F20A 3QRUA 2YA9A 4OBOA 3FZOA 4O1PA 3T9IA 3WE8A 4F0GA 3A4OX 4DH5A 5JGDA 4FKWA 4FTIA 4PX6A 5A4TA 3HYHA 1GNGA 5AWMA 3PP1A 4U80A 1ATPE 4O7TA 4JI9A 4OR5A 2YZLA 4UEUA 4NUSA 3EQIA 3V5QA 3FI3A 2WO6A 3D2IA 3ZUVA 4BZNA 5E8XA 4NCTA 4J7BA 4WG4A 4LGDA 5JZJA 4GU9A 3DAKA 2VWXA 2VO0A 5AUWA 3UYTA 4WG3A 5C8MA 3QTZA 3ZFXA 2W9ZB 4CGAA 4F09A 4WNPA 4EONA 4BTJA 4CNHA 3TN8A 1YDSE 5CSWA 4OUCA 2UW3A 4USFA 2CCIA 4RX5A 2W06A 4MQ2A 4FV6A 4DG0E 3S0OA 4LRMA 4NSTA 1UWHA 4C4GA 2BR1A 4KKEA 5HNGA 4F7JA 3D2KA 4IFGA 2NP8A 4E3CA 3LE6A 3NCGA 5JT2A 5HNBA 4L52A 4UMQA 5EHYA 4EQMA 4JG8A 2R3PA 5C4LA 4NW6A 4AZSA 4I3ZA 5HCZA 4M12A 2CLQA 3LFBA 2HY0A 3PVUA 2X8DA 4IX5A 3GQLA 3AMYA 4HGTA 5M51A 1OL5A 1FMKA 1H28A 5HTCA 4HVIA 3P86A 4DITA 4FTQA 2B7AA 1M7NA 3OCBA 3OS3A 3PYYA 4JBOA 4DH3A 3PJ1A 5M53A 3H0ZA 4N6YA 3R30A 4IIRA 3I6WA 5AX3A 2WIHA 4LMNA 1M2QA 4FSTA 3TV6A 1PKDA 3UG1A 4LV5A 4FTLA 4GU6A 4USEA 2X4FA 2YM8A 4XV3A 2QOHA 5AP1A 3FXWA 5JKGA 2WB8A 3P5KA 3MTLA 1M2RA 1J91A 3RZFA 2JIIA 4ZAUA 1I44A 2BROA 2VAGA 1WVWA 3EFWA 3VF9A 1OITA 5AUUA 3E3PA 1R3CA 2JKKA 2YACA 3P7CA 4BTMA 3A60A 4KIOA 4AZTA 4NJ3A 3TEIA 2B9IA 1DAYA 4IWDA 4GT4A 5DOSA 2F2CB 5CAVA 4QYEA 1BL6A 3TJDA 5AFVA 3CR0A 5ANKA 5LARA 4FTMA 5K4JA 3P7AA 2XNGA 3CSVA 4HCTA 1OL1A 4BZDA 2P33A 4QPAA 3DDQA 4AUAA 1OIYA 4EHEA 5LMKA 2X39A 4FKVA 4UBAA 3SV0A 2VO6A 1ND4A 4J71A 3FZPA 5IH5A 4B4LA 2XK4A 4B8MA 3LMHA 2W7XA 2PVFA 1H07A 4FTRA 2RFSA 2WFYA 3CS9A 3E62A 3Q6UA 4RX9A 4TW9A 4ZEGA 3TT0A 3AOXA 2W4JA 4BB4A 4EK4A 1A9UA 4UX9A 3W2PA 3BQRA 3SW7A 4Z7HA 4XG4A 3O50A 3UC4A 4EHVA 5E92A 5M55A 4F63A 4TN6A 5JK3A 2C6OA 3O2MA 3PVWA 3BZ3A 4R7HA 5IQDA 2XYNA 2QODA 1UKHA 2LAVA 3N4TA 5J9YA 4BKYA 4ANNA 4F65A 3E87A 2JDSA 1LPUA 3CTHA 4UWYA 2B55A 4E20A 3FZRA 2GNLA 3SVVA 1HCLA 4E7WA 3R2BA 1VYZA 2ETMA 1RJBA 3I81A 3E8DA 3C5IA 1F3MC 1OECA 4MBJA 5IQGA 3ZFMA 2VWVA 4J8NA 4E4NA 4YLLA 2XBAA 4DEBA 5IDPA 3MH3A 1H01A 1E1VA 2BFYA 2C30A 2J0KA 2GHMA 2YEXA 4DTAA 2C3KA 2QOCA 5H2UA 4DFLA 5M08A 5IZFA 3GT8A 5ACBC 1REKA 4M0ZA 5GHVA 4I21A 4XHKB 5JRQA 4IVBA 5CSVA 4FX3A 2ZB1A 1JWHA 4XNEA 4GSBA 3BHHA 3H30A 2UW4A 4ZTHA 5AUYA 4YBJA 4YNOA 4AT5A 3C51A 1H1QA 5HVYA 1BKXA 4TPTA 2YABA 2Z7RA 4XV2A 1YXUA 3ZO2A 2A27A 2WQNA 3VHEA 2JLDA 3Q04A 5IG1A 3FMEA 2I0YA 4R3PA 4X2JA 5JFWA 1M17A 4M13A 3EN7A 5K0KA 4YTFA 4C0TA 3ZMMA 3I0QA 4ZSJA 3OHTA 4EH8A 3ODYX 4XLVA 1OL6A 3QA8A 4X3JA 1MRYA 2WQEA 2YIQA 3BU3A 4IB5A 2X1NA 4TNDA 3PG1A 3Q4CA 2PMIA 4FSUA 4LV8A 4G3EA 3R02A 3H0YA 4L6QA 3EJ1A 3EZRA 4QMZA 5AV1A 1P4FA 2YM6A 4FTKA 2GTNA 4YZNA 5HESA 4FIEA 5AP2A 4EOJA 1V1KA 3EQRA 4RJ7A 3U8WA 3TZ7A 5E9EA 1I09A 2WD1A 3HAVA 3EQCA 3FQSA 3BE9A 4I6QA 2R7BA 1BUHA 3C4XA 2VTHA 4GL9A 4MXZA 5KMMA 3QTQA 3Q52A 4ENXA 3ATTA 3PIXA 1UU3A 2BRGA 2GS7A 3PXKA 2HXLA 3BQCA 2Y6MA 2FO0A 4IE9A 4L42A 4XH6A 3REPA 3IG7A 4RVTA 1ERKA 5HE2A 2XZSA 3VBXA 3VNTA 5AR2A 3M2WA 3ZHPC 1H26A 4E4LA 3NUUA 5CF4A 1GIJA 3E7VA 3KXNA 3O51A 3UVQA 4EOKA 4CYJA 3PY3A 3WF7A 3LM5A 1ZXEA 4L46A 5ANEA 4YZBA 4L45A 3U4UA 4FI1A 4PL5A 1S9JA 5EI6A 1WAKA 2GNIA 3HDMA 4FKQA 4PMMA 5BYLA 3MB7A 4ZXTA 2BZIB 4FT7A 4WSQA 4C58A 4R77A 1G3NA 4S32A 3V8WA 4E26A 4CYIA 5JEBA 4NYEA 4DYMA 5CEMA 2C5NA 4GFGA 3NW6A 2VN9A 5E4HA 3FMDA 1LUFA 1Y91A 2C47A 3PZHA 5AUZA 3VS6A 2OJIA 2VRXA 1FGKA 3ZLWA 4DGOA 1PXMA 5GIOE 3UQGA 4FNWA 3QZIA 4C4HA 3VUMA 3FDNA 5IH6A 3UNKA 3WZDA 3POOA 4IEBA 3B8QA 3M1SA 3KRLA 5J79A 4H1MA 5I9VA 3QTSA 3RJCA 3W10A 4FL3A 2ITOA 3G6HA 3VF8A 5CU6A 4Z16A 1XBAA 5A9UA 2B9JA 5K5NA 4TYEA 3QQGA 2C6KA 3H9RA 4JS8A 4ZZNA 4LM5A 3RPVA 4I22A 3C9WA 4L68A 4WBOA 4E4MA 4D2PA 2ITYA 2X9EA 4P5QA 3G9NA 4D0XA 4QPSA 1YXXA 3GVUA 5AP3A 3UO6A 3IGGA 3W2QA 3KRRA 3F5PA 5CZHA 3WZUA 4O84A 1F0QA 1UNHA 4ZK5A 4DFNA 5CF6A 5CNNA 1O6LA 3L1SA 3EQBA 4JLCA 3UOLA 4G1WA 4XV1A 3BGPA 3RK5A 4EH7A 3C0HA 3QQUA 2PUPA 5M06A 5C8KA 4RFZA 1T46A 2P55A 5TR6A 2BIKB 1OKZA 5ANGA 4QPMA 3MVHA 2OZAB 2J5FA 4FV5A 5CVFA 4TXCA 3GNIB 4D4VA 3R01A 3OCSA 5DG5A 4F1TA 4ZMFA 1X8BA 4GV1A 5L4QA 2OFVA 3COIA 4R1VA 2WTIA 5E8UA 4X3FA 4F7SA 3KVXA 4BCOA 3UP2A 3PXQA 5E8TA 4H05A 5L6WL 1JSUA 3QBNA 4KAOA 3A8WA 3OXTA 5C9CA 4JDHA 3FMJA 1QPCA 4U8ZA 3TZ8A 4XG9A 3GQIA 4PMTA 5CTPA 2OU7A 2F7ZE 3QX4A 5HHWA 5BVDA 4FF8A 2GDOA 3NUXA 3GFWA 3WIGA 2NPQA 4P90A 1MUOA 5L2SA 5EHOA 4NTSA 4YTCA 4FZAB 4WRSA 4JAJA 5J5TA 4PTEA 1XBCA 3G9LX 2XK3A 1OB3A 4V01A 3EQGA 3OY1A 4DFUA 4FSZA 3OT3A 4MWHA 4BY9E 4MTAA 4JX7A 4FV0A 5CLPA 1P2AA 3PP0A 1VYWA 2YIXA 2JAMA 2VWUA 4I5HA 4L44A 3WBLA 3CC6A 4DG3E 3GC7A 3PXRA 4L00A 3G90X 5J1VA 4BCGA 3MBLA 3TTIA 1G5SA 2GQGA 3DKOA 3PXYA 4L01A 4L53A 4PF4A 3QQLA 5DEWA 4EC8A 4M97A 4LGHA 3UNJA 3LJ0A 4XBUA 4HZRA 3UG2A 2JDTA 4LOQA 4CT1A 5CAUA 2QVSE 4U40A 3HRCA 3BEGA 2PVHA 4QP6A 2VX1A 4RIOA 3K2LA 2R64A 5CT0A 4HVSA 1ZYJA 4O7NA 2CCHA 4I5CA 2W1ZA 2C3LA 2FH9A 2VTAA 4OLIA 3ZTXA 4C4FA 2FSMX 2GFCA 2R2PA 5CVGA 5LVLA 3GENA 3UNZA 4QMLA 3V5TA 3CKXA 3P78A 4Q5HA 4YSJA 5AIRA 5D7VA 3COKA 3TUCA 3NVKI 4FKSA 2O65A 4QMWA 2OXDA 1H25A 3MPMA 1W0XC 3R71A 5IKWA 3QGYA 4KRDA 4FUYA 3H9OA 2P4IA 4I94A 2F57A 1GY3A 3LXKA 3WF9A 3BEAA 4X2NA 5F1ZA 2ITTA 4S34A 4KS8A 3NX8A 4FT0A 2WXVA 2WU6A 2RFNA 4KRCA 3F2RA 2A4LA 3DB8A 4K18A 2CHLA 4UMTA 1NVQA 4TYIA 4ZZMA 4DBNA 2XJ0A 1FMOE 2UZTA 3OWPA 2PZRA 4FTAA 4NCTC 4QP2A 3S95A 2UVYA 3TACA 1ZYDA 3HRFA 5FEQA 2I40A 5TKDA 4E6AA 4ZTMA 3BLQA 1XH8A 4BCJA 1OIUA 1OKWA 4XJ0A 4E93A 4XOYA 2OJFE 3QHWA 3ZC6A 1J1CA 3GXLA 4FA2A 2AYPA 3FMMA 4BFMA 1PXNA 3ZFYA 4DGGA 4I24A 2YM7A 3UIMA 5HQ0A 4GMYA 4I93A 4PY1A 4M0YA 5FBNC 3AGMA 2WEVA 3AGLA 4WG5A 4ALWA 4LUEA 2VTNA 4ANBA 1XWSA 2YCRA 4MXAA 4DEEA 4FV8A 3I0OA 4UMPA 4QO9A 3G15A 4BCFA 4WNMA 4MXYA 3GOPA 3HAMA 2ZYBA 5I9UA 4TWPA 3DPKA 2BDJA 4FSNA 2CMWA 2XKEA 5HCYA 4A4XA 2WNTA 4R3CA 2XF0A 1WBSA 3OMVA 4K1BA 5AP7A 3TDWA 4F4PA 1ZZLA 5CQWA 3RK7A 5A46A 5EYMA 3VS0A 3V8TA 1WBPA 4PL3A 3IKAA 1SMHA 5JFXA 2HW7A 3SXFA 1ZY5A 2R3RA 5DH3A 2JEDA 4IB1A 3QQJA 3MESA 2QLUA 3F3ZA 4IB3A 2FSTX 2QKWB 3IW8A 5HICA 1R1WA 1Q8TA 5HD4A 2CGUA 3TTJA 2IWIA 1RE8A 4K8AA 1YHVA 3BELA 5E90A 5FUTA 2BFXA 4M69A 4EL9A 2J0IA 3LCTA 3RCDA 3VS7A 3PUPA 4EK3A 1NT2A 1MP8A 4MCVA 1IAHA 2ZAZA 3AT3A 5BMMA 4C7TA 4O96A 2PMOX 2GQSA 4HJOA 4RWIA 4Y95A 5FRIA 3GU7A 4G31A 3R8PA 3MFSA 5EDRA 5A6OA 5L6OA 4FT9A 4JQ8A 2QO2A 3BWFA 3DY7A 4MAOA 5BVWA 3F2AA 4A9TA 2OFUA 3EFJA 4G9RA 5DR2A 4RIYB 3A7GA 2YM5A 5LQFA 1KWPA 4RQVA 3WILA 2YCFA 2Y8OA 2X6DA 4LL0A 2DWBA 3BGZA 3G51A 3BHYA 4YC8A 5ANOA 3F2NA 3DK6A 2Z7LA 4CKRA 3KXHA 3AMAA 1Q8WA 3R8LA 4AW0A 4CG9A 3ZS5A 3F9NA 5IA0A 3DDPA 3F5XA 2C4GA 4RWJA 1OIRA 2G01A 4V0GA 2F7EE 3Q9WA 1Q41A 2IZTA 2PHKA 3SC1A 2XIRA 4O82A 1OGUA 2O5KA 3RAIA 2GSFA 5AAGA 3BBWA 2QR7A 5JGBA 3MVJA 5IF1A 4U5JA 3CTQA 4X0MA 4RJ8A 2XMYA 2X4ZA 5FEDA 3QQKA 2WMUA 4BCIA 5CEOA 5HOAA 3FSFA 2WMSA 5TOZA 5DGZA 3FI4A 5HU9A 2XCKA 3QRIA 4Z7GA 3VS4A 4KKHA 5EK7A 2IZUA 5AX9A 4YZCA 5DNRA 1J3HA 3WYXA 1SVHA 1UU9A 4I6HA 4F6SA 3PPZA 3UO5A 4CV9A 3BYUA 4IANA 1SYKA 1JLUE 1APME 3E7OA 2Y7JA 3IW6A 4I4EA 1MRVA 4U45A 2J7TA 4XOZA 5HZNA 4NFMA 4DT8A 3NNWA 4U0IA 4U3ZA 3UQFA 2VTJA 5H8BA 1U4DA 3VUDA 2J0MB 4PTCA 1BI7A 5JH6A 4AGUA 4RWLA 4YR8A 2QNJA 3OBGA 4IAKA 4MBLA 4A06A 4JVGA 3F3TA 4W9XA 4JR3A 4QNYA 2HWOA 1JNKA 2PK9A 1EH4A 4XG7A 3C4WA 4PNKA 1Q61A 4ASDA 5DEYA 3U6JA 5E8YA 4BGQA 1BLXA 2YCSA 3C0IA 2I0HA 3FI2A 5H8EA 4CFWA 3E88A 3LQ5A 2WMWA 1YI3A 3ZUUA 2HZ0A 3MY1A 5M4CA 4M3QA 4FTNA 2XA4A 3UOKA 4IAZA 1SVGA 3CLYA 3EYGA 2F49A 2C6EA 3BI6A 2P3GX 2HAKA 5EI8A 3SOAA 4F0FA 2Y0AA 3TNHA 2R3MA 2BZHB 3MY5A 4FUXA 4G6OA 3QKKA 4QTCA 1IEPA 3ZLYA 4B0GA 4J8MA 1CSNA 4G6NA 4RVKA 4X2KA 3MFRA 1MQBA 4TT7A 4E1ZA 2IW9A 4BDHA 2OH0E 4XCUA 3DTCA 4BCKA 3WOWA 3R6XA 5IPJA 4P4CA 4K9YA 3D5UA 4IWPA 2FUMA 2OF4A 4FK6A 4GFOA 3D7ZA 3FC2A 4D5KA 4KB8A 3OEFX 4IJPA 2XNOA 3TDVA 2XS0A 3R1QA 5JFVA 4S31A 5HLPA 3KN5A 2BAJA 4X3FB 3PSCA 3F5UA 3FEGA 3FYJX 4UYAA 4GEOA 5AA8A 4QTEA 5DLSA 2QONA 2XIXA 1IASA 2Z2WA 2PYWA 3P08A 4KKGA 2UZOA 4F9CA 4FIGA 3FMKA 5BNJA 1A06A 4RSSA 4DEAA 3KQ7A 3AC1A 3BYOA 4YJTA 3CY2A 4YTIA 3PLSA 3R7YA 3I79A 2C3JA 4IQ6A 3LCOA 1JVPP 4EWQA 3S3IA 5BVOA 2OKRA 2GHGA 2ZDTA 3EFKA 4FEXA 2ITPA 3QKLA 2UZWE 3KXGA 2J0LA 1Q8ZA 4CRSA 2RG6A 3PJ8A 3AC8A 4I5PA 3V8SA 3FMHA 3Q2JA 3UO4A 1FOTA 3QTIA 5D10A 4BTKA 2VV9A 4EH3A 3RPOA 4ITJA 4UB7A 5CEIA 4I1ZA 3FE3A 1YKRA 4RX8A 4YJSA 3R9HA 4O0TA 3R0TA 2J9MA 4ZJVA 3PE2A 4HGLA 5LCKA 5D12A 2QG7A 3QWJA 2PPQA 4DCAA 3PPJA 2UZNA 2QHMA 3Q9YA 4W9WA 4AF3A 4F7LA 3N4UA 4DCEA 5AEPA 2J4ZA 3C4FA 3GP0A 2BRBA 1PMEA 3R83A 3O8PA 5E8ZA 4DEHA 1PJKA 4NK9A 2BZKB 4AW5A 2XUUA 5CX9A 4CFFA 1ZYCA 4PDSA 4BCMA 3DS6A 3PJCA 3RK9A 3IW4A 5A4LA 1ZY4A 4TYGA 3I4BA 3QD0A 4ZTSA 5LMAA 4C38A 5IQEA 4AOTA 4IJ9A 4V05A 3W2RA 4RMZA 3FZTA 4Z3VA 1U5RA 4FGBA 3ZRMA 4DTBA 4J98A 3CKWA 5A4EA 3CEKA 3KMUA 1VZOA 2Y4PA 3DNEA 3HA8A 3NUNA 4F1MA 3CXWA 2BPMA 5EG3A 4ZSGA 1H27A 2ESMA 3GI3A 4PUZA 3V3VA 2YAAA 4O2ZA 1CMKE 4BDEA 5FDXA 3GB2A 2Y9QA 3QRTA 4OGRA 3ZONA 2W1IA 3ALNA 1YXTA 2IZSA 2PUUA 2HYYA 5HG8A 2C6DA 5A3XA 1XO2B 4U6RA 1YI6A 2YDJA 3DCVA 5FDPA 5C4KA 2C5XA 3LQ3A 2XIYA 2QG5A 2QI8A 2V22A 3FYKX 2XH5A 4IM2A 2UW9A 2ZDUA 3KRXA 4YLKA 3RHKA 2XRUA 4BICA 3VBVA 3QKMA 2EB3A 4DN5A 3U6IA 5KMLA 3DFAA 2OJJA 3PG3A 2Z8CA 4ZS4A 2PU8A 2GNHA 4AGWA 1W82A 5BUJA 4EHZA 3NPCA 4OTPA 4QTBA 5AV2A 4Z9LA 3VW8A 1PXJA 4LOOA 5EM6A 5G1XA 2VTQA 2VU3A 3VRZA 4QQCA 4EK5A 1VR2A 2C5OA 3VBWA 4H3BA 4K6ZA 3DTWA 3W1FA 4I6BA 4UALA 4X3FC 2OBJA 4TWNA 4CLIA 3QHRA 4HYUA 1YW2A 2WMQA 3VULA 2WGJA 2W99B 3Q9ZA 3KXZA 2QOLA 3BHTA 4QMSA 3FLZA 3K3JA 5HBHA 3FPQA 3E5AA 3ZDUA 4GG5A 3LFFA 4QP7A 2O2UA 2VWIA 3PDTA 3IOPA 3ZBFA 4YMJA 1Q97A 5TO8A 4E6DA 2PVKA 3AC4A 4HW7A 5BYYA 2Z7QA 3ZSIA 2WTWA 2GTMA 4EH2A 4QP1A 3DBEA 3EN4A 2ZV8A 5HBJA 2RF9A 3B2TA 5AV4A 4CFVA 3HECA 4PDPA 5EKOA 3QXOA 4QQ5A 1OUKA 4CZYB 2GCDA 4QTDA 4MNFA 3UPZA 3SLSA 3E93A 3NYVA 3O0GA 1ZARA 3PPKA 1WMKA 2RG5A 4O27B 2PSQA 2C6MA 2V7OA 3UIUA 5AV3A 4BWPA 4F9YA 5IA2A 4DINA 4GJ2A 1PY5A 4C3RA 4NFNA 3NVMB 4YU2A 2EUFB 4JRNA 3TZMA 4EI4A 1KE9A 2HK5A 2VTPA 4GRBA 4FOCA 4NM5A 4YNEA 4U9AA 3U9NA 3R9RA 2WZJA 3JVRA 2Q0BA 2OK1A 4ASEA 4EH6A 4KA3A 2E9PA 4C34A 3LLAA 3PZEA 5CWZA 3UZTA 2BALA 4F9BA 3MSSA 3DGKA 3QL8A 2IVSA 3OROA 3ROYA 4APPA 3PA4A 3C4EA 5JQ5A 5CI6A 4FZFB 4LI5A 4AA5A 2W1CA 1ZWSA 2VO3A 4B9DA 4EOLA 4WA9A 3P7BA 4H58A 4CZUA 1Q8YA 2CKOA 2AC5A 3KA0A 4BI1A 4MWIA 2WTKB 4B7TA 2ERZE 1OPJA 3GC9A 4L67A 2F7XE 4QYYA 4V0GB 3O7LB 4RJ3A 4XMOA 5FXQA 2CNQA 4FL2A 5HCXA 5L8JA 2CNUA 3DOGA 3R7GA 3PVGA 4E5BA 4YBKA 2HELA 3EQHA 3LMGA 5FEEA 5AAFA 3QRKA 4IX6A 4AE6A 3BE2A 1V0PA 4HPTE 5EM7A 2OIBA 3HZTA 4ZOGA 1IR3A 2VTMA 2R3IA 3HUBA 3ORPA 1AQ1A 4AOJA 1BMKA 4D1XA 5KMJA 1WFCA 4BCHA 3C50A 4A07A 4PDOA 5DT0A 5JZNA 1PMVA 5J8IA 1YXSA 2I0VA 4TYHA 4C36A 3R7IA 4ARKA 2QOIA 2OWBA 3EKKA 2IG7A 4DEGA 4MXXA 3QTWA 3FHIA 4CLJA 3RNIA 4OTGA 1MQ4A 2FYSA 4PPCA 3TKIA 1PYXA 4ZY6A 4C35A 5LJJA 1H1WA 2JKOA 3LW0A 3PTGA 4EOOA 4ZLYA 3C4CA 1YDRE 1YVJA 4H39A 3JR1A 4C61A 3ZM4A 3IPHA 2YJRA 5HI2A 5C1QB 4JBPA 1YDTE 5KX8A 3WYYA 3FLNC 3HLLA 4H3PA 4O7WA 3OEZA 4HPUE 4QD6A 4U44A 5HO7A 2W1DA 4BYJA 3ZZEA 1JQHA 2PULA 3ITZA 3OW4A 4PV0A 5E8SA 3FSKA 4RQKA 5IUGA 3IS5A 1PXIA 4WRGA 4CCUA 2PVNA 2RFEA 1BI8A 3PIYA 3W8LA 4I20A 4L7SA 1UVRA 1XH5A 3F5GA 3IW5A 2JGZA 3ORTA 2V0DA 3V04A 4WHZA 4ERKA 4KBKA 4F99A 3FLQA 5LVPA 5B2KA 4FYNA 4R5YA 2G15A 1OL2A 1CM8A 4O2PA 4QMMA 4RA4A 4WKQA 3QLFA 3MIYA 5I0BA 3BLHA 3KB7A 2BTRA 5EQYA 3RGFA 4XX9A 2A19B 2C5YA 1GOLA 3AXWA 4IXPA 2X0GA 4RPVA 5DN3A 4FTOA 5EHLA 3ZEWA 4D0WA 4D4YA 2FA2A 3NWWA 2VTRA 2CKEA 2VD5A 3EYHA 1TQPA 4CD0A 4A9YA 3QQFA 3W32A 1Q5KA 2E9VA 2WKMA 3DFCB 1GIIA 4IAYA 1OKYA 4Q5EA 3T8OA 3ORLA 4BZOA 5EQPA 3MW1A 4LL5A 5D1JA 2W1HA 3EOCA 2BAQA 4HOKA 3EMGA 2F9GA 4BDGA 1M52A 3JS2A 2ERKA 3EKNA 3QU0A 5F94A 2BHHA 3E63A 3F82A 4XG6A 3AT2A 3O23A 4CQEA 5T6KA 2WMXA 4W4YA 3QQHA 2KTYA 2WQBA 2HENA 2Z02A 3AD6A 4FSQA 4IC7A 1PXKA 4HYIA 2ACXA 2WTKC 3TNQB 2XKCA 3UBDA 3DA6A 4GUBA 1UNLA 4X6QC 5A54A 4KUJA 5EQEA 1O9UA 2H34A 2QO9A 3CPBA 3TNWA 5HVKA 5M57A 4O86A 4JDIA 3AC5A 4O6LA 4FKUA 3QFVA 3KULA 3FC1X 3MPTA 3FMNA 3Q4UA 1FINA 4II5A 1Z9XA 1WBVA 4FSRA 3RKBA 4ZJJA 1HOWA 5DA3A 3R7OA 4ZJIA 4CSVA 5I9WA 5JFSA 3F3WA 5EDPA 4C33A 2JFMA 2JDVA 3TV7A 2DS1A 4WIHA 3H9FA 4HCVA 5AM6A 4DGLC 1YXVA 3KY2A 2VX3A 3HV5A 2VTTA 3TV4A 3F66A 3LZBA 5EM8A 2BZJA 5KMIA 4CZTA 2O3PA 4HGSA 1S9IA 4MXCA 4GW8A 4ZSLA 1MRUA 5FTGA 4IZ5A 3EQDA 4GCJA 5AP6A 4BIEA 1W83A 4IZ7A 3Q4TA 4CEGA 2HXQA 2YFXA 5BUIA 4IB0A 2UZDA 3FLWA 4IBMA 4KSQA 1U46A 4BCPA 1DS5A 3PJ2A 3OUNB 4TWCA 4XUFA 3W55A 4MX9A 3OXIA 4DEIA 4EK6A 2YM4A 5BX0A 4FNZA 3HV3A 4MEDA 2GNJA 3PY1A 3LHJA 5CANA 2BKKA 1Q3DA 4FT5A 3AD5A 3KVWA 2G2IA 5HD7A 2VTSA 3C1XA 3DXPA 2JIVA 3PRFA 3EL7A 3MPAA 4IACA 2RIOA 4I41A 5IEXA 5C03A 2A0CX 1PXPA 1IRKA 3IO7A 4U43A 3RP9A 4BCQA 4E5AX 2R3QA 2GU8A 4FKRA 2E2BA 5GNKA 2RKUA 4LOPA 2OIQA 3PJ3A 4QT1A 4ZTNA 1GZKA 1TQMA 4W8DA 4XS2A 2JDOA 4AN9A 4DAWA 4CXAA 4YJPA 2HZNA 2JKQA 3MB6A 4I0TA 4CFUA 3FY0A 4BDFA 2O0UA 2PZPA 5I5ZA 2DQ7X 1H1RA 1XHAA 1WBOA 2FB8A 3LFSA 4MF0A 4O22A 3UE4A 4C4JA 2G2HA 4GH2A 5E8VA 2B53A 3G33A 4NZWB 2ITNA 4FIHA 3PE1A 4FKOA 5DT4A 3ZO1A 1K3AA 2W5AA 3RM7A 4K11A 4OTHA 4UXLA 4F1OA 2C1BA 4LGGA 3FKLA 3LMIA 5ETFA 5C01A 5IMEA 4BDDA 4RJ4A 3UVRA 2YN8A 5FTQA 4QNAA 3SRVA 1GZ8A 2WPAA 3HNGA 5BPYA 3ALOA 4FTUA 4I5MA 4I92A 1KE6A 5KMOA 3NYXA 2XM8A 3VBYA 5CZIA 4AA0A 2DYLA 3GU8A 3VUTA 4IVDA 3D0EA 4O81A 3ZDIA 3FZ1A 4ZLOA 4BI2A 2W05A 2J51A 5JRSA 3HUCA 2WMVA 3GGFA 4YHFA 3C13A 4YO6A 4WNKA 5KMKA 4QMTA 1U59A 3OWJA 2OJGA 5CU4A 3EIDA 3HRBA 3VIDA 3ZXTA 4NH1A 5AR7A 4FEQA 4EOQA 4O0RA 5HGIA 3RM6A 3W2CA 2JAVA 2Y6OA 3LCKA 3BRBA 4FG8A 3S00A 3SXRA 5K4IA 3ET7A 2VTIA 3D5XA 1QPDA 4G5PA 2WMAA 2ZOQA 1JKSA 2HOGA 3EL8A 5BVNA 4L7FA 1BL7A 3F3UA 1XJDA 1H08A 4QQTA 3OT8A 4NU1A 3R04A 3LJ2A 5AJQA 5A14A 4GYGA 2PZYA 3VO3A 5LXMA 2PL0A 2PVLA 4GVAA 5H3QA 3LM0A 2HZ4A 5B2MA 3ODZX 4C3PA 5IA4A 2J90A 4FZ6A 3THBA 3DZQA 2WOUA 3BYVA 3HA6A 3OZ6A 3WF6A 3P9JA 4ITIA 3HP5A 4D2TA 5BYZA 2PMLX 5AA9A 5IEVA 1U54A 4AX8A 5EKNA 4CFMA 3PY0A 5IISA 2HWPA 5CAPA 3GCPA 2A1AB 4Y83A 4GIHA 3ZOSA 3ATSA 2R3KA 3RBWA 3RPYA 1CKJA 2REIA 3QTXA 5IUIA 3L8VA 4P5ZA 3TKHA 2PVYA 4DG2E 3COMA 3ELJA 5K3YA 3EN9A 1DAWA 3MY0A 2R5TA 4FTCA 5D41A 3UQCA 1KOBA 3DLZA 3OW3A 4YLJA 5CQUA 4RC4A 2JBOA 1IA9A 4PWNA 3U4WA 4D2VA 3OF0A 1KV2A 5DVRA 3RHXA 4YZDA 3ZUTA 2QHNA 4AZFA 3CGOA 5HORA 3QCXA 3GU4A 4GVJA 3MTFA 3DT1A 3LXLA 3KCFA 5CT7A 2HW6A 5EDQA 1P5EA 4DH1A 4E73A 1JAMA 2C3IB 2QC6A 4EJNA 3ZZWA 4ALUA 3A4PA 3F7WA 4MD8E 2Q0NA 3GUBA 4MHAA 1R78A 2RFDA 4LQMA 3VVHA 3ZCLA 4F6UA 2XM9A 5FBOA 2BRHA 2JITA 3WARA 3K54A 5HVJA 3UGCA 5M07A 1QPEA 4U81A 3QD3A 3FL4A 1FBNA 5HO6A 2FVDA 3ZSHA 2C6TA 2RSVA 1DM2A 4W4VA 5KMNA 4ZY4A 4OTRA 3A99A 4QMYA 5GJFA 3HMIA 5M4IA 5DWRA 5I9XA 2GNGA 3DB6A 4FG7A 3VN9A 1SZMA 3OVVA 3QD2B 3OCGA 4BDBA 5CSHA 5HTIA 5T3QA 3SAYA 1NW1A 5B2LA 5HIEA 4FV9A 4WD5A 2CLXA 4F64A 4XEYA 2IPXA 3H4JA 4NT4A 2X6EA 2PVRA 3KRJA 4XP0A 3DAEA 4S2ZA 2ZMDA 1BX6A 3DJ7A 3HV6A 5DRBA 4O6EA 4KIKA 2XKDA 3IONA 4ZS0A 3NUPA 4X7QA 4BBEA 2IN6A 2VWYA 3OOGA 3LFQA 4JQ7A 4ID7A 4K0YA 2KULA 5FP5A 4DF3A 3O7LD 2JIUA 3ORNA 3ZM9A 4GKHA 2SRCA 3BLRA 4Y8DA 5EOLA 1F5QA 2VWBA 3RWPA 3IDBA 4FICA 3BKBA 4RC2A 4EOSA 2X8EA 1R0EA 3ZO3A 4K77A 2Y4IB 2XEZA 5L8KA 4WO5A 5KNJA 1Q99A 4TTHB 3DK3A 3O96A 5DI1A 4KSPA 4LG4A 4DBXA 3CTJA 3NRMA 3UTOA 3SKCA 3FBVA 3DXQA 1Y57A 3CD8A 1Y6AA 4FMQA 3OP5A 4BTFA 2NNWB 2ITVA 4YJVA 4EYJA 3LPBA 2WQMA 5CU0A 1GJOA 3I5NA 3ORZA 3DK7A 4FIIA 2GQRA 1OKVA 4DLIA 5LMKC 3LCSA 3FWQA 5LVMA 4KD1A 3DQXA 3R7UA 2OLCA 5HBEA 2ZM3A 4GT3A 3R8MA 4JX3A 2J2IB 2Z7SA 4GK2A 4H1JA 4R6VA 2R3GA 1YOJA 2J6MA 4L9IA 2VWZA 3R00A 2IW6A 3WZKA 4XRLA 3V51A 4A9UA 4CTCA 5EOBA 2W1EA 2ZMCA 3HKOA 4J97A 4W8EA 5GZ8A 1WZYA 2Z60A 3B8RA 2YIYA 3G2FA 5H9BA 3DV3A 5HTBA 1PYEA 3E64A 2B52A 3MN3A 3KULB 4S30A 3Q9XA 4J1RA 4FR4A 4Y5HA 3KFAA 2WTDA 3OTUA 3RVGA 3MJ1A 3I5ZA 4AFJA 2B9FA 5KHXA 3U54A 5HIDA 1WCCA 3E8EA 1KV1A 3B2WA 4G3FA 5DHJA 5J9ZA 5E8WA 1ZOGA 3MYGA 1VEBA 4PPBA 5CEPA 5M4UA 5K5XA 5FP6A 3HEGA 3RCJA 2PVMA 4ANSA 5AP0A 5CAOA 4PNIA 1URCA 4D55A 4ACMA 4GIIA 3FL5A 3P79A 5DR9A 3NZ0A 4KNBA 4MNEA 4BRXA 5K9IA 2WQOA 3T3UA 4O83A 3Q32A 3KU2A 3VS1A 4EH9A 4NW5A 3SQQA 3LKMA 4KS7A 5JMSA 4G17A 4JNWA 4O38A 3ULZA 2C0TA 1J7IA 3NW5A 3DKGA 3BBTB 4NTTA 1O6YA 1GZOA 2O64A 5KBQA 4DT9A 3R1SA 5FWKK 5AR3A 4E5WA 5KHWA 3QCYA 4M14A 3F6XA 4RT7A 3PRIA 2V5QA 5ICPA 5IA3A 4IWQA 3WF5A 4M84A 1XQZA 3FHRA 4RG0A 3NNXA 4RWKA 2YDIA 4LRJA 4QMQA 1YI4A 4GYIA 4IHPA 2XK7A 3TXOA 3OTVA 3VJOA 4C3FA 4DFBA 4LRKA 4WSYA 4DA5A 4IAIA 5DBXA 1PHKA 4I6FA 2YAKA 1PMNA 4EUTA 4GUEA 2QR8A 2XVDA 4B6LA 4NWMA 4O91A 1ZZ2A 2B1PA 4BIBA 3N51A 4HZSA 4QRCA 4TL0A 3Q60A 4YJQA 3JY0A 4F6WA 3KL8A 2F4JA 4YGAA 4L3LA 4K33A 4FV2A 5BVEA 4R5SA 1YOMA 2O8YA 4AWIA 3RPRA 2UUEA 4DGNA 3OBJA 3TKUA 3UMWA 3S4QA 3VS5A 4MBIA 2Y4IC 3CBLA 5HX8A 3V5WA 2BILB 2G1TA 2PWLA 3BX5A 2UW6A 3KRWA 3COHA 4FK3A 1FVTA 3LCDA 2X7OA 5CYIA 3MV5A 3GC8A 3ETAA 4RRVA 5AR4A 3LAUA 2UZLA 4M68A 2UV2A 1Z57A 3QZGA 1W8CA 2CN8A 4BBMA 4DC2A 4EORA 5FXRA 1YWNA 5L8LA 4BHZA 3ZBXA 3WZEA 3OXZA 3SDJA 4RA5A 2Q83A 3KF7A 1PXOA 2UVXA 4YZ9A 3HMMA 3TCPA 4MH7A 3R9NA 4HVHA 5IA1A 3N4VA 3IK3A 1ZMVA 4AT4A 4AAAA 3ZSGA 4U42A 4JDJA 4GKIA 3QCSA 5E7RA 2J50A 3KMMA 2UZBA 1XR1A 3HX4A 1P14A 3I60A 3OC1A 1G8SA 5IQHA 3QX2A 4FVQA 4FE2A 4M15A 4C2VA 4JG7A 4BDJA 2XK9A 2PE1A 4WUAA 4YJRA 2B0QA 5C27A 1W7HA 4EH5A 4Y46A 5HO8A 4N70A 3NUAA 5HG5A 4FKGA 4Y85A 3NIEA 3RWQA
chains in the Genus database with same CATH superfamily
4OBQA 4YP8A 1OMWA 3VAPA 3HMOA 1VJYA 2FGIA 4L43A 5AR8A 4U41A 3C4ZA 4WUNA 1O6KA 5FQDC 4OW8A 3V5LA 4EZ5A 3LFNA 5J9LA 4O1OA 5HE0A 2O63A 3PSDA 4JQEA 5CF5A 2R7IA 2YCQA 3D5WA 5KUPA 1WBWA 2XJ1A 4IMYA 5K0XA 4G6LA 1ZLTA 2QQ7A 4FV3A 5AUVA 1J1BA 3EWHA 3EH9A 3KKVA 3EZVA 1U54B 4BGHA 3OOMA 4G2FA 4HNFA 3T9TA 1W2CA 3S2PA 2XALA 1Y6BA 4A9SA 2PMNX 3GEQA 3I7CA 3AG9A 3R9DA 4DHZA 5BVKA 1WVXA 4YO4A 4IW0A 4JBQA 5AV0A 4BDCA 4FV7A 3LOKA 4N4SA 3TIYA 3JYAA 3R9OA 4FIFA 1ZOEA 3BHUA 4RBLA 2QOBA 4G3DA 4PRJA 1NXKA 5T68A 4JDKA 4LFIA 4FKTA 2UVZA 3D7TA 3M42A 4FVRA 4FEVA 2YISA 1JKLA 5L2IA 4GK3A 2OO8X 1TKIA 4FIJA 4FV4A 4M67A 3O8TA 4IX3A 5CVHA 3R7EA 4D2WA 3PIZA 3CJGA 4FNYA 3UVPA 1YRPA 3A7JA 3QZHA 1Q8UA 5HE1A 3ZO4A 5F9EA 2BAKA 5FD2A 5LOHA 3WIKA 4JBVA 2F2UA 2ETKA 2ITQA 4YHJA 5L2WA 5B0XA 2OZAA 3G6GA 2C1AA 2GS6A 4D4SA 5GZ9A 4QP3A 3O17A 3PWDA 4X2GA 4AA4A 4YPDA 2QOOA 5TF9A 3RNYA 2W0JA 3D4QA 1JOWB 5AADA 2BUJA 2UW0A 3PLAE 2VUWA 1CKPA 3HV4A 3CCNA 3FXZA 4CQGA 2WOTA 5D9HA 3KN6A 3FLYA 2PTKA 2CKPA 3ENMA 2H8HA 4O0SA 4DFZE 2BDWA 4M69B 3OUKA 3RALA 3UC3A 3ORKA 4R8QA 3QUPA 5KKRB 1OI9A 3GBZA 5I3RA 3AD4A 1OPKA 4O21A 4KIKB 3TIZA 4ANLA 4FKJA 1ZMUA 3MA3A 3C5UA 3D83A 5M4FA 3GFEA 3FXXA 4AFEA 5HU3A 3SA0A 1JSVA 5HNIX 3QTUA 3SGCA 1G8AA 4JOAA 5LMBA 4EHGA 1RDQE 1SVEA 4ZIMA 3C0GA 2XP2A 4FTTA 2UW8A 5L3AA 4L3JA 3L9PA 4J52A 4RZVA 4DEDA 3DBFA 2UW5A 4O0YA 4QTAA 3L8XA 4UYNA 2JC6A 2QLQA 4HGEA 5KZIA 3VS3A 2BRNA 3SXSA 4EOIA 2RGPA 1Q3WA 3POZA 5DT3A 2R9SA 5KCVA 4UZDA 3FAAA 3MI9A 4F70A 3GCUA 4DHFA 5EM5A 3RAWA 3W0PA 4HVGA 4JIAA 2OXYA 4EZ7A 3NNUA 3Q5ZA 3UOJA 1JSTA 4CMOA 3GU6A 3RAHA 3BGQA 3W2SA 2IVVA 2W1GA 3IGOA 4FL1A 4DH7A 3TM0A 4M7IA 3NAXA 3NR9A 3PVBA 3NAYA 4FT3A 1YHWA 5ETAA 4MQ1A 4XYFA 4EBWA 4J96A 2WMRA 1IAJA 4C8BA 3ZYAA 2ITXA 2I1MA 5AUTA 3L8SA 2OJ9A 4QP9A 4AGCA 4FGRA 4YTHA 4IFCA 4GK4A 3UIBA 3A8XA 3LIJA 4O0VA 3R22A 2VNWA 1OPLA 3R1YA 4DFYA 4O7ZA 2JKMA 4PMPA 2QO7A 1U5QA 3OD6X 3NUYA 2XK8A 4OTIA 2EVAA 4UY9A 3VRYA 3ZC5A 1QL6A 3R8VA 2R4BA 3V6SA 5L6PA 3D94A 4ZTQA 5IMXA 2EXMA 3IQ7A 4RFMA 2E9OA 1A48A 5LWNA 4Z55A 5L2QA 4AACA 3QRJA 3QUDA 2FSOX 4ONAA 4EUUA 2FSLX 5J87A 3QCQA 4G5JA 3QALE 5ITAA 4D58A 3ZRKA 4KIQA 2R3HA 4F9AA 2YLFA 4ORKA 5CASA 3VUHA 2A2AA 3VWAA 2YHVA 5E1EA 1T45A 4CMUA 3IECA 3BV3A 3LFDA 3CGFA 1B39A 3KCKA 2XAMA 3NUSA 1FGIA 4MNEB 4MXOA 2G9XA 3ORIA 2CKQA 5H8GA 2I7QA 2R3FA 3V5PA 4C4IA 4JAIA 3R63A 2LGCA 3ZU7A 4TKSA 2E9NA 4QMVA 2V7AA 4RFYA 4AT3A 2EU9A 5FGKA 2OW3A 4FNXA 4BCNA 3QD4A 2WEIA 3QWKA 3TUDA 5JN2A 4AQCA 3EN5A 1KE5A 4NKSA 4NIFA 5AIKA 5AP4A 4CFNA 1AGWA 4IADA 5CNOA 4AXAA 2XNEA 4R3RA 2YITA 3D14A 4XG8A 1LR4A 5ACKA 1KUTA 4YSMA 2XNPA 2VZ6A 3TWJA 3NNVA 3FV8A 4K2RA 2CN5A 4UMRA 5KKRC 4AS0A 4JXFA 5I3OA 4DE4A 3Q4ZA 3PUFC 2QURA 4JIKA 1ST0A 2OICA 3A2CA 4H3QA 3MWUA 3K5VA 4XP2A 3RMFA 3PWYA 5IDNA 1J7LA 3E8CA 4FSWA 4ITHA 3HVCA 4BHNA 5GZAA 3QF9A 4UV0A 3ORMA 5CF8A 4R78A 4O7YA 5KE0A 1K2PA 3SOCA 1YHSA 2XK6A 3OWLA 2XANA 3DNDA 3HDNA 4AN3A 3ACKA 2ZV2A 1UWJA 3RI1A 4ANOA 5HLNA 1Y8GA 2XEYA 2B9HA 3I1AA 2UZEA 5CS6A 3MS9A 3UJGA 5EH0A 2IJMA 3VUGA 4LUDA 5DRDA 3CPCA 1ZYSA 3UZPA 3H3CA 1OUYA 4RIYA 4C62A 2XBJA 3DBCA 5HE3A 3RTPA 5J95A 3OWKA 4OT5A 3UYSA 5HG7A 5EYDA 3IDPA 4ACHA 2R3OA 3QYWA 3UDBA 5B7VA 4KBCA 2UW7A 2XCHA 3HMNA 2OI4X 4BKZA 1WVYA 5ANDA 1L8TA 4GG7A 2CNVA 3UZRA 2ONLA 4IZYA 4PL4A 5EW3A 4PP9A 1Y8YA 3FLSA 4XRJA 1KOAA 1UU8A 5C26A 5D7AA 1ZMWA 1LEWA 3L9NA 2WHBA 3R2YA 3ZEPA 1V0OA 1XH4A 4NM3A 1SNXA 4MF1A 5DPVA 3WE4A 4CFXA 2VO7A 1TVOA 3NYOA 1Q4LA 5J7HA 3JVSA 4F7NA 4XBRA 1OZ1A 3OCTA 3F61A 3O71A 2HZIA 4JRVA 2G2FA 3QZFA 3T3VA 4NEUA 3TI1A 5IQFA 1GIHA 3M11A 3GCQA 4TWOA 4ASXA 3R8UA 3ZLSA 1JPAA 4EKLA 1R39A 1RW8A 3A62A 5IEYA 2JFLA 2XNMA 3BCEA 3D15A 4R7IA 2JD5A 4FSYA 4U7ZA 4A4LA 4AG8A 4AN2A 4AE9A 4ANQA 5KBRA 3FZSA 1QCFA 4TYJA 4RIWA 5CENA 5EYCA 3TJCA 3FQEA 5EW9A 5CEKA 5JSMA 3LFEA 4HCUA 5IU2A 2P2IA 4FJVA 2ZV9A 4QMUA 5BMSA 3BYMA 4IZAA 2YIRA 1FVRA 2C0OA 3Q5IA 4D5HA 1H0VA 2X7FA 4CMTA 4DTKA 2X9FA 1H00A 4PMSA 3GC0A 3NS9A 5CXZA 1SNUA 3R8ZA 3RZBA 2WU7A 4I4FA 5JGAA 3LJ1A 3Q96A 4YJOA 3QUEA 3RINA 5BQ0A 4ALVA 3FQHA 4EKKA 5HX6A 4XP3A 3VS2A 3IW7A 4L8MA 4OTQA 4RX7A 3VBTA 4RC3A 4BDKA 1UNGA 4CT2A 4U97A 3KF4A 4EOMA 3U55A 2XB7A 4AZVA 4YC6A 5LVOA 4RVLA 2CGVA 1YQJA 5F4NA 2GFSA 2PVJA 3JXWA 4R7BA 3DZOA 3LVPA 4TY1A 2WTJA 4FKIA 4UZHA 3FKNA 1KE8A 3ENHA 2WELA 3OFMA 1NVRA 1XH7A 3TNPC 3U51A 4UMUA 2R0IA 3P0MA 4D28A 5J7BA 3D7TB 3AC2A 2IZRA 4WT6A 2X2LA 3NYNA 1YOLA 4M8TA 3RPSA 4C2WA 4IDTA 3JUHA 3BWJA 3DAJA 3ORXA 3FUPA 4PTGA 5CI7A 4BWXA 4A7CA 5CSPA 3CE3A 4RJ5A 2X81A 1STCE 4Y5QA 3CY3A 1KSWA 1XH9A 4EC9A 3V5JA 2WTCA 4QP8A 2AUHA 5ANIA 5CEQA 2PE0A 5F95A 3MVMA 2QOKA 2QOFA 4E8AA 4EWHA 2OSCA 4WOVA 2EB2A 3VC4A 5CAQA 3R28A 1OVEA 4ZLZA 3EB0A 2YZAA 4RIXA 3R7VA 5TT7A 3V6RA 2W4OA 1PW2A 1XH6A 1OIQA 2ITZA 1BYGA 2CSNA 3A7FA 3GCSA 3Q53A 1ST4A 3KREA 4IM3A 4EK8A 3KEXA 3W8QA 3VUKA 4E6QA 3NMUF 3NW7A 3ZRLA 4BVUA 4Q9ZA 4N57A 2VNYA 4OAVB 2GHLA 3AT4A 1XKKA 4BI0A 3FKOA 3O8UA 1H4LA 5JQ8A 4AW2A 4DLJA 3UMXA 3G0EA 2XRWA 3UIXA 1JBPE 3U9CA 2CPKE 3QC4A 5BUEA 2BCJA 4QOXA 5FXSA 4LV7A 3SG8A 4CV8A 4QMXA 3WZJA 4KBAA 4OT6A 1H1PA 2C6IA 2X2KA 2A98A 3CJFA 3PA3A 4TRLA 4XG3A 3TL8A 1UKIA 2CJMA 3NDMA 4GFMA 4MVFA 3VJNA 4GT5A 2CGXA 4JR7A 3A7IA 4FKLA 4KABA 3KXMA 4W4WA 4IVCA 4ANMA 3GCVA 3L9LA 1V0BA 2JDRA 2W5BA 3I7BA 3CQWA 4FOBA 1IG1A 2WIPA 2ZV7A 4JG6A 3NCZA 1Q24A 3EQPA 5J1WA 1FPUA 1SM2A 2C0IA 1FVVA 2BIYA 3QTRA 4PP7A 2OGVA 5LVNA 3F88A 1M14A 2C68A 4O0WA 3IDCA 2XIKA 3ANRA 4ZTRA 2W5HA 4IDVA 5C8NA 4QDEA 5HG9A 4ZSAA 1G8KA 3MFTA 5IQCA 2ITWA 4CKJA 3CD3A 5CSXA 4BIDA 3KK8A 2PE2A 3ACJA 3E3BX 4WBBB 4Y72A 3AMBA 1W84A 4BF2A 4IC8A 2VGPA 4PQNA 4Q2AA 4FSMA 4L3PA 3Q2MA 5HKMA 3TG1A 4CKIA 1UA2A 5L2TA 3QAME 3QXPA 1L3RE 4QMOA 1OBGA 2R3JA 3FY2A 3MH0A 4RLLA 2OH4A 2H96A 4IAFA 2VTLA 5GJGA 1Z5MA 4G3CA 4I0SA 4UN0C 3MA6A 1QPJA 3SHEA 4FZ7A 3LXNA 2W96B 4F9WA 4CG8A 4A9RA 3NGAA 4NM0A 5E91A 1OBDA 3F69A 3P23A 3GOKA 1B38A 4AGDA 3MH2A 5M09A 5ETCA 3MVLA 2W4KA 4TYHB 4ZY5A 1PMUA 1NA7A 2H9VA 4ENYA 4YZMA 4AZWA 4FODA 1RQQA 3V01A 3JPVA 4OTFA 3ID6C 2HIWA 2BVAA 3BU5A 2QOQA 3SX9A 4FTJA 3WF8A 3S1HA 5FG8A 5DYJA 2CDZA 4G9CA 4ZSEA 3HL7A 2GS2A 2YDKA 3DKCA 3HGKA 5ANJA 2VGOA 3HP2A 3P1AA 4P7EA 3ZH8A 4BWKA 4DFXE 3TNIA 3SG9A 1R0PA 4YJNA 1DI9A 5CU3A 4ZMEA 2WMBA 3HV7A 5AUXA 5DIAA 5HEZA 4X2FA 4FKPA 4MYGA 4U3YA 5EW8A 1UU7A 3CQUA 3CQEA 4EJ7A 4RLKA 4EH4A 4O0XA 5AMNA 4LYNA 4CCBA 4KIPA 5D11A 5A6NA 1H8FA 2I0EA 4BN1A 1H1SA 3BPRA 3EFLA 3OG7A 5GIPE 4OBPA 3ZLXA 3Q3BA 4NIFB 3UP7A 3MIAA 5EYKA 3NSZA 3RAKA 3BLAA 2E9UA 4G16A 1Q62A 4YHTA 3PA5A 4ACGA 5G6VA 4GS6A 4R1YA 4CTBA 2R0UA 3FI8A 3UDZA 3P4KA 2GNFA 1AD5A 4BBFA 4EYMA 3VQHA 2W9FB 3DBDA 4D9TA 1B6CB 2QCSA 3MDYA 5EFQA 4ZTLA 4RGJA 1WBNA 4FZDB 3SD0A 1G8JA 2CGWA 1E9HA 2XJ2A 4P2KA 3W16A 5I4NA 4QYFA 3BL9A 2ZJWA 1ZAOA 3EHAA 5I9ZA 4D1ZA 5AAEA 4LMUA 4NL0A 4XLIA 5HIBA 1GAGA 4N6ZA 1QMZA 2V62A 4I0RA 4EQUA 5IQIA 4AXEA 4JL9A 4FG9A 4G3GA 4X21A 4AQKA 4UWCA 3D5VA 2ZM4A 2RL5A 4UWBA 1K9AA 4IM0A 4X6RA 2YERA 3W33A 2VX0A 3I6UA 2IVTA 1REJA 5BVFA 1CDKA 3NFGB 3NEWA 5E1SA 3DU8A 3MFUA 3QGWA 4BKJA 1HCKA 4DGMA 1H24A 2YWPA 2DUVA 4USDA 4AP7A 4EBVA 2OF2A 5KO1A 4FEUA 4J95A 4ACDA 3Q6WA 3TZ9A 3L9MA 2ZM1A 2W1FA 4MD7E 2P0CA 3JY9A 4QMNA 5IQAA 4U79A 2IW8A 1TQIA 4J53A 4QMPA 3G5DA 4BYIA 3F3VA 3DKFA 5IH4A 1ZYLA 4AZEA 1JKTA 5CALA 3AQVA 4C4EA 5DE2A 4IWOA 1E1XA 4B8LA 4BDAA 4EOPA 4XG2A 5FM2A 2R3NA 4IX4A 3II5A 3MJ2A 5AP5A 4EQCA 4D4RA 3NLBA 1H0WA 2YWVA 2NRUA 1KE7A 3PFQA 4APCA 4EEVA 4BR3A 1P4OA 4O7LA 4PDYA 4C02A 3ROCA 3L8PA 1OM1A 4AOIA 5CY3A 1OL7A 3ANQA 4J99A 2X7GA 1YWRA 4RJ6A 4C59A 2R3LA 3H10A 4ASZA 4AU8A 2QKRA 2OG8A 3E92A 3R73A 2C5VA 4BGGA 2PUIA 2X2MA 5TE0A 1JKKA 4FV1A 4NKAA 4ERWA 4TNBA 2EWAA 5CXHA 5DMZA 1UV5A 4Y73A 4YPSA 4F08A 3D9VA 2HY81 1FQ1B 2OZOA 3EN6A 4RVMA 5ETIA 5FTOA 3PSBA 3W2OA 4N0SA 3DJ6A 3TUBA 4RIWB 1TZDA 2VTOA 2UZUE 3DQWA 3FPMA 5GINE 3ULIA 3OY3A 4BC6A 5A4QA 2BKZA 3BU6A 2ITUA 2YLEA 4E6CA 1J7UA 5AR5A 5FLFA 2H6DA 3ZXZA 4ACCA 2QU6A 4KINA 2WTVA 1ZRZA 3BYSA 3PXFA 2I6LA 2OIDA 5IA5A 4ZZOA 2ZFYA 4C57A 3BIZA 3F7ZA 4YUQA 2HCKA 4FEWA 4ZP5A 1CTPE 1GZNA 3VHKA 1DI8A 2ZVAA 3QLGA 4HYSA 3VUIA 3LFAA 3FJQE 3HMPA 2PY3A 3R21A 5FM3A 2W17A 3EQFA 4IAAA 4GJ3A 4BDIA 3DJ5A 2XYUA 2QU5A 3CIKA 4YJUA 1PXLA 2NRYA 3U87A 4IH8A 4O7SA 4D9UA 5I9YA 3DLSA 4S33A 4HNIA 4OTWA 1M7QA 3KMWA 1URWA 4D2SA 5M56A 3UPXA 3VBQA 1NY3A 2NO3A 4JJRA 4MK0A 4CVAA 5IUHA 5DR6A 4B99A 3O5AA 3U6HA 3DXNA 3KK9A 2AC3A 2X8IA 2ZB0A 2C6LA 2EXEA 3KC3A 3GU5A 1LEZA 3E8NA 4CRLA 4HVDA 4QQJA 4WNOA 4KWPA 3FMLA 2V55A 1PKGA 4RZWA 2BDFA 3W18A 3A7HA 1NVSA 3VW6A 4YURA 2J0JA 5HLWA 5DFPA 2YM3A 3WI6A 3MH1A 4I23A 4F0IA 4AW1A 3UODA 1YWVA 3IOKA 3SRVB 4O4DA 4NM7A 4BL1A 2JBPA 4G34A 5LWMA 4JT3A 4Q9SA 2C69A 2GPHA 4RIXB 4YC3A 4M66A 5AM7A 2IVUA 4A4OA 4IVAA 2IO6A 4FC0A 4FYOA 4D1SA 5A4CA 4OAUC 1LP4A 4O7VA 4PPAA 2B54A 5EI2A 1M2PA 2UZVA 2BTSA 2J5EA 2PZ5A 3DBQA 3ERKA 3LFCA 2EXCX 3R1NA 4QYHA 2XARA 4V04A 3QC9A 4MD9E 3QYZA 2BHEA 2XNNA 2ONLC 3BHVA 3LQ8A 4XV9A 3LXPA 1ZOHA 1PRYA 2YJSA 4DH8A 1CKIA 4NJDA 2QD9A 4EZ3A 2VWWA 2BMCA 3NIZA 4HYHA 5KZ0A 4E4XA 4H36A 4QP4A 5M44A 3K5UA 3VQUA 4MKCA 3LLTA 3MGYA 3SW4A 3N9XA 2PUNA 2ETRA 4C37A 4O0UA 4O7RA 5J5SA 2OXXA 3KGAA 2XNBA 4TZRA 3PXZA 1W98A 2BRMA 4FBXA 1XBBA 4OTDA 2P2HA 3A61A 3KXXA 3C7QA 3W0NA 3G0FA 5IQBA 4W4XA 4UXQA 1PF8A 2PZIA 2GMXA 5GJDA 1IA8A 2B4SB 3QA0A 4D2RA 3W0QA 3AC3A 3CP9A 2XKFA 3K3IA 5LCJA 2YIWA 2WAJA 3UOHA 2WMTA 1WBTA 2XIZA 4FVPA 3BV2A 4QYGA 5CU2A 5F20A 3QRUA 2YA9A 4OBOA 3FZOA 4O1PA 3T9IA 3WE8A 4F0GA 3A4OX 4DH5A 5JGDA 4FKWA 4FTIA 4PX6A 5A4TA 3HYHA 1GNGA 5AWMA 3PP1A 4U80A 1ATPE 4O7TA 4JI9A 4OR5A 2YZLA 4UEUA 4NUSA 3EQIA 3V5QA 1W2FA 3FI3A 2WO6A 3D2IA 3ZUVA 4BZNA 5E8XA 4NCTA 4J7BA 4WG4A 4LGDA 5JZJA 4GU9A 3DAKA 2VWXA 2VO0A 5AUWA 3UYTA 4WG3A 5C8MA 3QTZA 3ZFXA 2W9ZB 4CGAA 4F09A 4WNPA 4EONA 4BTJA 4CNHA 3TN8A 1YDSE 5CSWA 4OUCA 2UW3A 4USFA 2CCIA 4RX5A 2W06A 4MQ2A 4FV6A 4DG0E 3S0OA 4LRMA 4NSTA 1UWHA 4C4GA 4O4EA 2BR1A 4KKEA 5HNGA 4F7JA 3D2KA 4IFGA 2NP8A 4E3CA 3LE6A 3NCGA 5JT2A 5HNBA 4L52A 4UMQA 5EHYA 4EQMA 4JG8A 2R3PA 5C4LA 4NW6A 4AZSA 4O4FA 4I3ZA 5HCZA 4M12A 2CLQA 3LFBA 2HY0A 3PVUA 2X8DA 4IX5A 3GQLA 3AMYA 4HGTA 5M51A 1OL5A 1FMKA 1H28A 5HTCA 4HVIA 3P86A 4DITA 4FTQA 2B7AA 1M7NA 3OCBA 3OS3A 3PYYA 4JBOA 4DH3A 4MUQA 3PJ1A 5M53A 3H0ZA 4N6YA 3R30A 4IIRA 3I6WA 5AX3A 2WIHA 4LMNA 1M2QA 4FSTA 3TV6A 1PKDA 3UG1A 4LV5A 4FTLA 4GU6A 4USEA 2X4FA 2YM8A 4XV3A 2QOHA 5AP1A 3FXWA 5JKGA 2WB8A 3P5KA 3MTLA 1M2RA 1J91A 3RZFA 2JIIA 4ZAUA 1I44A 2BROA 2VAGA 1WVWA 3EFWA 3VF9A 1OITA 5AUUA 3E3PA 1R3CA 2JKKA 2YACA 3P7CA 4BTMA 3A60A 4KIOA 4AZTA 4NJ3A 3TEIA 2B9IA 1DAYA 4IWDA 4GT4A 5DOSA 2F2CB 5CAVA 4QYEA 1BL6A 3TJDA 5AFVA 3CR0A 5ANKA 5LARA 4FTMA 5K4JA 3P7AA 2XNGA 3CSVA 4HCTA 1OL1A 4BZDA 2P33A 4QPAA 3DDQA 4AUAA 1OIYA 4EHEA 5LMKA 2X39A 4FKVA 4UBAA 3SV0A 2VO6A 1ND4A 4J71A 3FZPA 5IH5A 4B4LA 2XK4A 4B8MA 3LMHA 2W7XA 2PVFA 1H07A 4FTRA 2RFSA 2WFYA 3CS9A 3E62A 3Q6UA 4RX9A 4TW9A 4ZEGA 3TT0A 3AOXA 2W4JA 4BB4A 4EK4A 1A9UA 4UX9A 3W2PA 3BQRA 3SW7A 4F78A 4Z7HA 4XG4A 3O50A 3UC4A 4EHVA 5E92A 5M55A 4F63A 4TN6A 5JK3A 2C6OA 3O2MA 3PVWA 3BZ3A 4R7HA 5IQDA 2XYNA 2QODA 1UKHA 2LAVA 3N4TA 5J9YA 4BKYA 4ANNA 4F65A 3E87A 2JDSA 1LPUA 3CTHA 4UWYA 2B55A 4E20A 3FZRA 2GNLA 3SVVA 1HCLA 4E7WA 3R2BA 1VYZA 2ETMA 3W0SA 1RJBA 3I81A 3E8DA 3C5IA 1F3MC 1OECA 4MBJA 5IQGA 3ZFMA 2VWVA 4J8NA 4E4NA 4YLLA 2XBAA 4DEBA 5IDPA 3MH3A 1H01A 1E1VA 2BFYA 2C30A 2J0KA 2GHMA 2YEXA 4DTAA 2C3KA 2QOCA 5H2UA 4DFLA 5M08A 5IZFA 3GT8A 5ACBC 1REKA 4M0ZA 5GHVA 4I21A 4XHKB 5JRQA 4IVBA 5CSVA 4FX3A 2ZB1A 1JWHA 4XNEA 4GSBA 3BHHA 3H30A 2UW4A 4ZTHA 5AUYA 4YBJA 4YNOA 4AT5A 3C51A 1H1QA 5HVYA 1BKXA 4TPTA 2YABA 2Z7RA 4XV2A 1YXUA 3ZO2A 1OGYA 2A27A 2WQNA 3VHEA 2JLDA 3Q04A 5IG1A 3FMEA 2I0YA 4R3PA 4X2JA 5JFWA 1M17A 4M13A 3EN7A 5K0KA 4YTFA 4C0TA 3ZMMA 3I0QA 4ZSJA 3OHTA 4EH8A 3ODYX 4XLVA 1OL6A 3QA8A 4X3JA 1MRYA 2WQEA 2YIQA 3BU3A 4IB5A 2X1NA 4TNDA 3PG1A 3Q4CA 2PMIA 4FSUA 4LV8A 4G3EA 3R02A 3H0YA 4L6QA 3EJ1A 3EZRA 4QMZA 5AV1A 1P4FA 2YM6A 4FTKA 2GTNA 4YZNA 5HESA 4FIEA 5AP2A 4EOJA 1V1KA 3EQRA 4RJ7A 3U8WA 3TZ7A 5E9EA 1I09A 2WD1A 3TYKA 3HAVA 3EQCA 3FQSA 3BE9A 4I6QA 2R7BA 1BUHA 3C4XA 2VTHA 4GL9A 4MXZA 5KMMA 3AKKA 3QTQA 3Q52A 4ENXA 3ATTA 3PIXA 1UU3A 2BRGA 2GS7A 3PXKA 2HXLA 3BQCA 2Y6MA 2FO0A 4IE9A 4L42A 4XH6A 3REPA 3IG7A 4RVTA 1ERKA 5HE2A 2XZSA 3VBXA 3VNTA 5AR2A 3M2WA 3ZHPC 1H26A 4E4LA 3NUUA 5CF4A 1GIJA 3E7VA 3KXNA 3O51A 3UVQA 4EOKA 4CYJA 3PY3A 3WF7A 3LM5A 1ZXEA 4L46A 5ANEA 4YZBA 4L45A 3U4UA 4FI1A 4PL5A 1S9JA 5EI6A 1WAKA 2GNIA 3HDMA 4FKQA 4PMMA 5BYLA 3MB7A 4ZXTA 2BZIB 4FT7A 4WSQA 4C58A 4R77A 1G3NA 4S32A 3V8WA 4E26A 4CYIA 5JEBA 4NYEA 4DYMA 5CEMA 2C5NA 4GFGA 3NW6A 2VN9A 5E4HA 3FMDA 1LUFA 1Y91A 2C47A 3PZHA 5AUZA 3VS6A 2OJIA 2VRXA 1FGKA 3ZLWA 4DGOA 1PXMA 5GIOE 3UQGA 4FNWA 3QZIA 4C4HA 3VUMA 3FDNA 5IH6A 3UNKA 3WZDA 3POOA 4IEBA 3B8QA 3M1SA 3KRLA 5J79A 4H1MA 5I9VA 3QTSA 3RJCA 3W10A 4FL3A 2ITOA 3G6HA 3VF8A 5CU6A 4Z16A 1XBAA 5A9UA 2B9JA 5K5NA 4TYEA 3QQGA 2C6KA 3H9RA 4JS8A 4ZZNA 4LM5A 3RPVA 4I22A 3C9WA 4L68A 4WBOA 4E4MA 4D2PA 3KIOC 2ITYA 2X9EA 4P5QA 3G9NA 4D0XA 4QPSA 1YXXA 3GVUA 5AP3A 3UO6A 3IGGA 3W2QA 3KRRA 3F5PA 5CZHA 3WZUA 5BV3A 4O84A 1F0QA 1UNHA 4ZK5A 4DFNA 5CF6A 5CNNA 2X0PA 1O6LA 3L1SA 3EQBA 4JLCA 3UOLA 4G1WA 4XV1A 3BGPA 3RK5A 4EH7A 3C0HA 3QQUA 2PUPA 3W0RA 5C8KA 5M06A 4RFZA 1T46A 2P55A 5TR6A 2BIKB 1OKZA 5ANGA 4QPMA 3MVHA 2OZAB 2J5FA 4FV5A 5CVFA 4TXCA 3GNIB 4D4VA 3R01A 3OCSA 5DG5A 4F1TA 4ZMFA 1X8BA 4GV1A 5L4QA 2OFVA 3COIA 4R1VA 2WTIA 5E8UA 4X3FA 4F7SA 3KVXA 4BCOA 3UP2A 3PXQA 5E8TA 4H05A 5L6WL 1JSUA 3QBNA 4KAOA 3A8WA 3OXTA 4JMQA 5C9CA 4JDHA 3FMJA 1QPCA 4U8ZA 3TZ8A 4XG9A 3GQIA 4PMTA 5CTPA 2OU7A 2F7ZE 3QX4A 5HHWA 5BVDA 4FF8A 2GDOA 3NUXA 3GFWA 3WIGA 2NPQA 4P90A 1MUOA