1UNGA

Structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
292
structure length
288
Chain Sequence
b'MQKYEKLEKIYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLANFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 5
publication title Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 81
structure length 288
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ungA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ungA01
5HBHA 1JPAA 3IW7A 4Q9SA 4R1VA 4YJPA 1TQPA 3TNIA 5HLPA 3LW0A 2YWVA 4YSJA 4M8TA 3PVBA 2XK9A 5HGIA 5CF4A 2EXCX 2ZYBA 3E7OA 3FY0A 3MB6A 1YOJA 3P79A 4GSBA 2CHLA 3KREA 1PMEA 5A54A 1PRYA 3PA3A 4U81A 3SXSA 5KBQA 3GCUA 1R3CA 3IPHA 2W1DA 4AGDA 5EI8A 4UY9A 3QD0A 1TVOA 4RFMA 2UW4A 3VS6A 2OF2A 4QNYA 3R04A 3ZUTA 4FI1A 3TWJA 4JAJA 4UZDA 5GJFA 2R5TA 4LGHA 4NWMA 4EHEA 4GYGA 2IWIA 4MK0A 3PPKA 1BL7A 1E1XA 2P4IA 3HV3A 1WCCA 4J7BA 3A62A 3VVHA 4PX6A 4XV2A 4YJSA 3BU3A 4OTHA 3DZOA 3II5A 2PVJA 1ZRZA 3UOJA 4EWQA 5I4NA 3DKCA 3FLSA 3VUTA 3R28A 2ETRA 4L53A 5AP1A 5FTOA 5L2SA 2C30A 3COIA 3PVWA 3R1NA 3KN5A 5C8KA 4J1RA 5EKOA 3LCKA 3OT3A 3WILA 3CTJA 4RMZA 1WBNA 2GDOA 3SW7A 1SNUA 3LXNA 4EH3A 5M4IA 2NO3A 2YA9A 5E8VA 1Y8YA 3ZSHA 5LVOA 4JI9A 2R0IA 3QKKA 4GFGA 3VN9A 3TV7A 2HY81 3IG7A 4FL1A 3QXPA 3RAWA 1MQ4A 5IG1A 5DVRA 3PE2A 5IUGA 5IQGA 1PJKA 3R2BA 2BALA 5TOZA 2BHEA 2RFDA 4ACHA 3FSFA 2OXDA 1BX6A 5AUYA 4DCEA 3KU2A 4U44A 1YHSA 3UP2A 2CMWA 2DQ7X 2Y4PA 4TYHA 3P86A 3D9VA 2UV2A 4BIDA 2V22A 3AOXA 4R7BA 5EI2A 3JPVA 2X6EA 3HMMA 4YJRA 5KHWA 1R1WA 5EW9A 1YI3A 3ZBFA 3MIYA 2XS0A 2BIYA 2Z2WA 2B9FA 3KXMA 2YHVA 4Y85A 4GIIA 3W10A 5CAVA 4G3EA 4FSMA 4AZEA 3EB0A 4DT9A 3JY0A 4FV9A 4X2JA 4D2WA 2W1IA 3S4QA 4DT8A 3Q9WA 2UZLA 2Y9QA 3UMWA 1YW2A 3AD6A 3V5JA 1J1CA 3KCKA 4KBCA 4F9WA 2PZPA 1A9UA 2F4JA 2YDKA 3GU5A 4J95A 3TACA 4TTHB 5I3RA 2W4KA 5JH6A 5EM6A 5KKRB 3U55A 4DG3E 1L3RE 3PVGA 3Q2MA 3FZOA 5C1QB 1ZMVA 1ZARA 3FMDA 1OPKA 4Q2AA 4D9TA 2VGOA 4IBMA 5TKDA 3PTGA 4JQ8A 4FSNA 3DAEA 5CASA 4X2GA 2QLQA 3CY2A 3TZ8A 2PUPA 3RI1A 1UNGA 3DKOA 2PZRA 2C6TA 1SZMA 2W9ZB 3EN9A 3EZRA 3TL8A 4ZY5A 4MWHA 4R3CA 4ITJA 5CYIA 3O7LD 3ZHPC 3O71A 3WE4A 2CKEA 1CM8A 3A7HA 2VTSA 4MXCA 4Z16A 5D12A 1V0OA 4FUXA 4HVSA 4FTLA 2YAKA 2BILB 3OF0A 4KSQA 4S34A 5CZIA 4F99A 5L6OA 2EUFB 3PIZA 4WUAA 1VYZA 2SRCA 4XOYA 2O2UA 4G5PA 4BFMA 5AUUA 3BZ3A 3R7GA 3U6IA 3PUPA 2XRWA 2UW9A 4YJNA 3VC4A 4FZ6A 2VTPA 4F6SA 4L01A 2J5FA 2B9IA 1Q99A 5ANIA 4EK3A 3PA5A 4EQUA 3ZUUA 4CZYB 4RT7A 4G6LA 4ACGA 2X0GA 4DTKA 4UN0C 3EL8A 3F7ZA 3PJ3A 4N4SA 1PHKA 5J1WA 5K4JA 4IM0A 3NUSA 3QL8A 2CGWA 2WMAA 4H3PA 1JBPE 4OTRA 4CT1A 4KABA 3KK8A 1URWA 4GU9A 4IHPA 5M4FA 3F5PA 4J71A 3NMUF 2A1AB 2VD5A 4EYMA 5KUPA 4EH6A 3PWYA 5CNNA 4F9YA 4LRJA 3R63A 2W17A 2WMRA 1BMKA 5HNBA 4LOQA 2R3KA 3HDNA 1HOWA 4W4XA 3W8QA 5C26A 3TM0A 3UIMA 2R3HA 3F6XA 2QOCA 4GKIA 3KXGA 4NW6A 2YDJA 4BCFA 5DFPA 2OXYA 3CPBA 4DH8A 2PVRA 3DJ6A 2EXMA 2JFLA 2CLQA 3HP5A 3COKA 5EHLA 2CKOA 2R3MA 3FZRA 4P7EA 4HZRA 4E4LA 3RTPA 2X8EA 4FNZA 4WA9A 3F2RA 4HYHA 5CXHA 3WYYA 4APCA 5CAPA 4OR5A 2R3RA 4QYFA 3DQXA 1Q5KA 4XH6A 3FMJA 1TQIA 4FKWA 3UO4A 3W2OA 4ALWA 3ZRLA 3VBQA 3DDQA 2UW6A 5LMBA 1JQHA 3ZFMA 4D0WA 3C4FA 3QTUA 4NFMA 4MCVA 3RHKA 4CMOA 3BYUA 1ZYDA 3NNWA 3EKNA 3NUYA 3MTFA 4DGLC 5DGZA 4IE9A 4NTSA 3DTCA 3I7CA 5LCKA 4JX7A 3RAIA 2ERKA 5TF9A 4RVTA 3LFNA 5J7BA 5ACBC 4BCIA 2R3NA 3N4TA 4KNBA 4APPA 2W1FA 3L9PA 4OTQA 4R78A 5EM7A 1WBTA 4FTCA 2HWOA 3VF8A 1UVRA 1H8FA 3VJOA 3DJ5A 4X2NA 2PZIA 1YOMA 2J0KA 4QTBA 4PMMA 5L4QA 3UVRA 3E3PA 5KMIA 5HNIX 4EHGA 1B39A 2BZJA 4NJ3A 2VWVA 4BCKA 4D2SA 2J0LA 4BB4A 3QZHA 2ZM4A 3NRMA 3KXHA 4FKUA 4FV4A 4QMVA 2Q83A 3OVVA 1JSTA 4JDKA 4V01A 3WYXA 4DGNA 5A4EA 2P2IA 4CFVA 2B9JA 5LJJA 5M09A 3LJ1A 4C0TA 3QALE 2PYWA 1JNKA 4AZWA 3MTLA 3GT8A 1E1VA 1O9UA 4H36A 1XQZA 1W98A 4QP1A 4QMWA 3VBTA 4EH9A 3FV8A 3HDMA 3IDPA 2BKKA 5D7VA 1ZWSA 4LL5A 4I5PA 5GJDA 3MY5A 4LRMA 4WNMA 4I20A 3ZMMA 4CFNA 1B38A 1YKRA 2JIUA 3CGOA 4FKRA 3B2WA 4D0XA 5EYKA 1UNLA 1ZY4A 3VIDA 4ZS4A 2G01A 3GU4A 2W1GA 4KA3A 3ACJA 4M3QA 4ALVA 4Y73A 2ZMCA 3PZEA 4F08A 4FEVA 2O8YA 4WRGA 3OFMA 2OLCA 4D2RA 3QA0A 3NEWA 2XIRA 2YIRA 3R01A 4QYYA 3RALA 3CCNA 4FSYA 3POOA 3L9MA 3EH9A 3UZRA 3QX2A 1Z5MA 5LWMA 4FICA 2E9NA 4BI1A 4YBJA 4QP6A 3LMGA 3MFUA 2GFSA 3CJFA 1VYWA 3CEKA 2BPMA 3FZPA 4KIKA 5FG8A 3KULA 4F64A 2VTLA 2OH0E 4Q5EA 5KBRA 2Q0BA 5KCVA 3FL5A 3V8SA 3JXWA 3ZLSA 2QG7A 1W8CA 3UVPA 2RL5A 4ZMFA 4ZK5A 2YAAA 4LV8A 3DPKA 3DXQA 3HZTA 2Y6MA 5FRIA 3D14A 4D1SA 4E73A 4II5A 5HG8A 4C34A 3E8CA 3H9RA 3QKLA 4D5HA 3KQ7A 4AT5A 5CAQA 4DH7A 4FZ7A 4KS8A 4MYGA 1OM1A 3L9NA 5GJGA 2YEXA 2CGXA 4AZFA 1DAYA 2GPHA 4WNPA 4ZTLA 3QZIA 3VUMA 3QD3A 4XOZA 5HG9A 4R5YA 5E8YA 1FVVA 2BZKB 2J0MB 2XNEA 2XNNA 2X4ZA 3HVCA 3VW6A 1K9AA 1SMHA 5T68A 4RJ8A 2IZUA 4BDBA 3BQCA 4PTEA 1ZYCA 3UBDA 2B52A 2IVTA 3NS9A 3R73A 4TXCA 2WAJA 5EH0A 1XKKA 4N6YA 5DHJA 3RZBA 4BBEA 5CEMA 2XRUA 1IAHA 4H05A 1H0WA 4L8MA 3F61A 4TWPA 4ZIMA 3QYZA 1XH9A 2FUMA 2VN9A 2Y4IB 3MIAA 4LG4A 4O38A 1OKWA 1P4OA 4GH2A 5IPJA 5FGKA 2VV9A 3D5UA 4O7WA 3D4QA 4LOPA 3HL7A 4IWPA 4JDHA 4GUEA 4E6QA 4E4MA 2IN6A 3HUBA 4FOBA 3DK3A 4EUUA 3GOPA 5DWRA 2EXEA 4WKQA 2GQGA 1HCLA 3D94A 3G0FA 5DEWA 5KMJA 3C5IA 3BE2A 3Q4UA 4RJ3A 3HP2A 4EOOA 3NZ0A 3LM5A 3PXFA 4NM3A 3U87A 4BN1A 2PUNA 1ZOGA 5IZFA 2VO3A 2F9GA 2XEYA 4CTBA 4RVLA 2JEDA 3HMIA 4ZSEA 3SC1A 3UNKA 4PL4A 2X2LA 3W2PA 4JQEA 4K18A 3FPMA 3F3VA 5KX8A 4W4YA 4FNXA 1Q61A 4L7SA 4LUDA 1MRVA 3CSVA 3GOKA 3RK5A 1RE8A 3ULZA 2FSLX 3LOKA 3UYTA 3RVGA 2OZAB 4DG0E 3MFRA 2X1NA 4I94A 4IJPA 5CS6A 3DKFA 5ANKA 2GQSA 2W99B 4RLLA 4XUFA 3L9LA 1IR3A 2JITA 2C3IB 4NSTA 4DLIA 1GY3A 4E5WA 3ZFXA 1G8SA 2QR7A 5EW8A 4F7LA 3JYAA 4QMMA 2VTOA 3R7IA 3UIXA 5CAOA 5HTBA 2JKQA 5JN2A 3Q96A 2ITZA 1Q97A 3GBZA 2WTDA 3I7BA 2GHMA 1YWNA 1KOBA 1GIJA 2IVSA 5CSHA 4CFFA 5K3YA 3IS5A 2RG6A 2YIXA 3KRXA 3WF7A 4AGWA 4O82A 3GB2A 5LVMA 3LQ8A 1OIUA 4AT3A 4ZZMA 3AC3A 3O8UA 4FIJA 3EFLA 5LQFA 2A4LA 4DH5A 1NVQA 5G6VA 4GJ3A 5AADA 4HVGA 2B55A 5L6WL 4C62A 1FVRA 5CF6A 4L43A 3T9IA 5HQ0A 4GJ2A 3QKMA 2X4FA 4PWNA 3MVLA 4FT9A 4YLLA 4I6BA 2VTAA 1U4DA 4G3GA 5CY3A 3W8LA 4J52A 3LIJA 4QTAA 1JAMA 4RIXB 3QYWA 1ND4A 3NDMA 4X7QA 5I9WA 5C8NA 5FTGA 3KB7A 3A8XA 3CLYA 2J2IB 3ZO4A 1FVTA 5LCJA 3AXWA 1NVRA 4YLKA 2H9VA 3VS0A 4L68A 4J97A 4DTBA 5EM8A 2WQEA 3EQRA 2V7OA 1DM2A 3K5UA 3MH2A 2YDIA 4KINA 3RPOA 3V51A 3RBWA 4A4XA 3EN5A 4AS0A 3QWKA 2XNOA 3VWAA 3TJCA 3KF7A 2VX0A 5AUTA 5AAEA 3W2CA 4J53A 5ANOA 3FXZA 3E5AA 4I6FA 4FTUA 2GS7A 5IDPA 1BKXA 2WTJA 4RFYA 5HG7A 4KS7A 4RGJA 3RMFA 2VO0A 4E5AX 3GC0A 4HVIA 2ITWA 4K1BA 3FHIA 3D15A 3NCZA 3DFAA 1WMKA 4W4WA 5H8BA 1ZOHA 3EN7A 5M08A 3IQ7A 3SA0A 1SNXA 4P90A 2X9FA 1NW1A 3FE3A 4G5JA 5IEYA 4FGBA 3AGMA 4QTCA 4GL9A 4B9DA 3MDYA 1OUYA 4MBLA 4I5MA 5LMAA 2C0IA 4ZTHA 5E8SA 5DNRA 4C02A 3OEZA 1U5QA 1P5EA 2VZ6A 5H3QA 2ITXA 3UOHA 3OCSA 4WRSA 2JKOA 5EYDA 4LMNA 3ID6C 2OJ9A 2VTRA 4BDJA 2PWLA 3BGPA 1RQQA 2CN5A 3DBCA 1X8BA 4DGMA 2BFYA 4FT7A 3MY0A 3H10A 1Q8WA 3K3IA 2H8HA 4E5BA 5AR3A 3LKMA 1REKA 5HTIA 3RM6A 4C3FA 2ITNA 3ZSGA 2QOFA 3O7LB 4IFCA 2BRMA 4IZ7A 3UJGA 4E93A 3TDWA 1CKIA 4D55A 3C13A 3I6UA 1UA2A 2J9MA 4F9BA 1M7NA 3Q04A 4BTJA 2PMIA 4FZFB 4DHFA 1YDRE 1Y6BA 2RKUA 3BWFA 4RJ5A 3FMHA 2F57A 2NP8A 4FOCA 4CG8A 4G9RA 2J0IA 4LMUA 4MVFA 5AUWA 4FK6A 2W4OA 4C8BA 2QLUA 1OPLA 4A06A 3QQJA 4FVRA 3AC5A 4YGAA 1RW8A 2XBJA 1M17A 4FKGA 3DDPA 2QOIA 1MRUA 2HW7A 4F4PA 4NKAA 4HGEA 3OBJA 5KMKA 2WOUA 5IEXA 2YISA 3LFDA 3VS3A 4MD9E 2CPKE 2KULA 3QBNA 3R22A 1JKSA 1KE7A 1XBBA 1XJDA 3NYXA 5FLFA 4ASEA 3FJQE 2UW8A 3DOGA 1H08A 4L44A 3RPSA 1GJOA 3IOPA 3OUNB 3UDBA 4BKYA 2ITVA 2O64A 4EOMA 5JGDA 1YQJA 2OZOA 4KWPA 3QC9A 4MD7E 4NCTA 2BKZA 3B8RA 3F5XA 3I81A 3M1SA 2UZVA 4FIGA 5AM7A 5FQDC 1H4LA 3BX5A 5IQBA 4ANSA 5LVNA 5AR8A 2QR8A 5AA9A 2O5KA 4QQ5A 4FT5A 2XNMA 4XMOA 4M68A 4AOIA 3HGKA 3FKOA 4GEOA 4U80A 5F4NA 4ARKA 4IAYA 4EKKA 2BCJA 1JSUA 4ZJJA 4E3CA 2QONA 3ORZA 4BCGA 2QURA 4BRXA 5A46A 1DAWA 2C6IA 4I3ZA 3QTWA 1GZKA 2YLEA 3SDJA 4WNOA 3R2YA 3DK7A 1YI6A 2BMCA 3I60A 2UW3A 4GG7A 4XG8A 4UMUA 1ZOEA 2CGVA 5DN3A 4FSTA 1KV2A 4N0SA 4Z7GA 3MY1A 4FTNA 4BL1A 5BNJA 3BEAA 1OB3A 2FGIA 4U42A 3EFWA 2X2MA 4O27B 5J5TA 2W05A 2BDWA 3C4EA 5HLNA 1OL5A 5CEIA 3G6HA 4ZXTA 2OIQA 3WOWA 3ATSA 4CKIA 3TKIA 5DG5A 5KMOA 2OBJA 4TY1A 2FB8A 4R5SA 2V62A 4NZWB 3NVKI 1GZ8A 3CP9A 3FLYA 1JSVA 5HIBA 3A60A 3DAJA 3GP0A 2ZB1A 4NEUA 4FIIA 1PMUA 1Q8UA 4NJDA 3VS5A 5E9EA 3A7FA 3OT8A 1UWJA 2XZSA 5DPVA 2X8DA 4HGLA 3RPRA 3NX8A 5E8UA 2PMLX 4QT1A 3THBA 2I7QA 2PUIA 4Y5HA 4AW5A 3TTJA 3CD3A 3BHYA 3F69A 3PLSA 2XCKA 2XH5A 3F3TA 4IWDA 5L2IA 3NNVA 2YM4A 3CQEA 5DOSA 3DXPA 4GV1A 3SAYA 3OMVA 3LM0A 4TYIA 4O2PA 4RIOA 4EH7A 3NUNA 3PVUA 1K3AA 3OS3A 4Z55A 4KB8A 4NTTA 4AW1A 4PMSA 5IQEA 3NYOA 2OSCA 5KKRC 2YIYA 2F7XE 4JG6A 5CANA 4ANNA 4AOTA 3OY1A 3FL4A 1PXMA 2Y0AA 3CR0A 4IADA 5CX9A 3DAKA 4IZ5A 4YBKA 4AT4A 4KAOA 4D4YA 2RSVA 3ZUVA 4M15A 1ZYSA 3KN6A 4AN9A 5HX6A 1TKIA 2VWYA 5CVHA 3VS7A 5JQ5A 3G9NA 1GAGA 3CE3A 3GQLA 5L8LA 4JG7A 1REJA 5DBXA 3QRKA 4I22A 3GCSA 5D9HA 4IVCA 3SHEA 4ANQA 3QTXA 4IDVA 2G15A 4QMNA 2WKMA 4PDYA 5IQIA 4QP4A 4FKOA 5M53A 1V1KA 4FEQA 4A7CA 1FINA 2XKCA 3GC8A 5DT0A 3PRIA 3RAHA 4U40A 3DXNA 4FSRA 3Q4CA 3QD4A 2X9EA 4UB7A 3SRVB 4X3JA 3ZTXA 2YACA 3CIKA 2JAMA 4O0WA 3A2CA 4I21A 4BI0A 4C2WA 4EH2A 2XYUA 4ZY6A 3E63A 4B0GA 1H24A 4UWBA 4C61A 1J91A 3TT0A 2C6LA 1Q3WA 2HZ4A 1VR2A 2X2KA 4O2ZA 4IZAA 2IW6A 3VRYA 1PXJA 3HV5A 5AP3A 3H30A 2JFMA 3RCDA 2Z7LA 3CPCA 5JQ8A 4BKJA 5M55A 2C5OA 2UZUE 3BHHA 4JJRA 2O65A 1KWPA 3VBVA 4RX8A 4O21A 3RM7A 5AR5A 5GIPE 5FBOA 4YZDA 5AWMA 4EH8A 5I9UA 4UWYA 2PVFA 3CD8A 3FZTA 3BQRA 3ORLA 1WBSA 2WO6A 3A8WA 4O0UA 4O0VA 1BL6A 3WF8A 4EQMA 3IW6A 4O6EA 2JBOA 3PXZA 2CCIA 4R77A 3MFTA 4C37A 4LGGA 4YHFA 4MAOA 3RNIA 4ACCA 3AD5A 2ZM1A 3FLZA 3QGWA 3R7VA 3PJ8A 4QMUA 3SD0A 3MN3A 3QRUA 1QMZA 4IB5A 3P5KA 5LMKA 4CD0A 5T6KA 3ZO1A 3UQCA 2Z8CA 4PQNA 3A99A 5ETAA 3ZM4A 5AR2A 1V0PA 2XNGA 3QZFA 5JFSA 3UYSA 4CVAA 2WU7A 2O63A 3OWKA 4IVBA 4IWQA 5HG5A 4G3DA 4ITIA 3PY0A 3EQCA 2OK1A 4I23A 2XK4A 3AQVA 4IW0A 4WIHA 3KXNA 2WTWA 3KCFA 5FXQA 3E8EA 4NCTC 4UX9A 3PXQA 2W9FB 3BRBA 4EK6A 1OIYA 3SG9A 4XG2A 3U6HA 4FF8A 5IUIA 3ZYAA 4PF4A 4XV1A 3WZEA 3FC1X 5HCZA 5IA0A 2VWBA 1Q62A 4FTTA 1A48A 5IKWA 5GZ9A 3T3UA 3Q4TA 3AGLA 4CCUA 5ANEA 4E20A 1VEBA 1XBAA 1M2PA 2YLFA 4MNEB 3FEGA 5FUTA 5HO6A 4ZZOA 2R3IA 2PSQA 3BU6A 5HIDA 4OAUC 2OZAA 4L7FA 4D4VA 3UQGA 2UVXA 4F7NA 3JS2A 3D0EA 2JDRA 3QLFA 5B2KA 1TQMA 3FWQA 2RG5A 5AP7A 2JIIA 3ROYA 4JT3A 5BMSA 5AJQA 1OECA 3KGAA 4PNIA 5L6PA 2WQOA 3DLZA 4Y72A 4O7ZA 3OEFX 4ZTRA 3PFQA 4L42A 2BR1A 5BVDA 5LXMA 4RLKA 3S00A 4ZZNA 1FMKA 2BZHB 4G16A 4J8MA 4U7ZA 2V7AA 4FSZA 2OU7A 3PJ2A 3VUGA 2JLDA 4AP7A 4MQ2A 5EKNA 4BZDA 4AX8A 1AQ1A 5CNOA 4S33A 4FK3A 5JEBA 4DTAA 2JDOA 4L9IA 4WBOA 5F20A 3BKBA 2YFXA 3AC4A 4H3BA 5DI1A 2W4JA 2WTKC 2XMYA 3TNWA 4YTFA 2JGZA 5A6NA 3BV2A 3PLAE 3TKUA 2HY0A 2E9OA 4WO5A 4RIXA 4YP8A 4FVQA 5BVWA 5C03A 4BZOA 5CEKA 5CLPA 4E4XA 2C0OA 4F1TA 4Y8DA 4CFMA 2B9HA 3E7VA 4O0YA 4GFOA 3A7JA 4BDKA 2RFNA 4JBOA 2XJ0A 2UUEA 4C58A 3COHA 1YWVA 4TT7A 3MS9A 4YHJA 5CEQA 5A4QA 3TXOA 3VF9A 4HW7A 3UMXA 4AA5A 2GQRA 3NSZA 5HVJA 3VAPA 5IA1A 3BYVA 4Q5HA 4QTDA 3P78A 5DR6A 2NPQA 4TL0A 1YWRA 2ITPA 3P08A 4TPTA 3FY2A 3TNHA 2ZJWA 5FM2A 5CVFA 5JK3A 5I3OA 3V04A 4O7NA 1O6LA 2GFCA 2QC6A 5EHOA 3BLRA 3LJ2A 1QL6A 4QMTA 5E91A 2QHMA 4W8EA 4FIEA 5CSVA 4BDDA 4GK4A 4RQKA 3FDNA 1ZMWA 4XG6A 5ANGA 4EUTA 4YZ9A 2OWBA 3MPAA 2WQBA 1OPJA 5FM3A 2PVLA 3KKVA 3TUDA 2V5QA 3I6WA 3ULIA 1M2RA 3BBTB 4BICA 4XP3A 4YMJA 5K0XA 4JBPA 4IC7A 3ZO2A 3CGFA 5IQAA 4CNHA 1ZLTA 3CQWA 3NAXA 1MRYA 2YZAA 3BIZA 4OT6A 1IAJA 3CTHA 5C8MA 5CSWA 3ZEPA 5BVOA 4USEA 2F7EE 4IAKA 3NGAA 1T45A 3QA8A 2IG7A 5J9ZA 4JXFA 3A61A 2ONLA 2R3JA 3FAAA 3R9RA 3BYMA 2VTIA 1Q24A 3EQPA 1Q4LA 2P55A 2X7FA 2WTIA 4RPVA 4RVKA 4V05A 2ETMA 2IZRA 3BLQA 4U8ZA 3QRJA 2C3JA 3BBWA 4ORKA 2OJGA 3LXPA 4CRSA 3TV6A 4FEXA 3LJ0A 1YHVA 3EIDA 3QQLA 2W1HA 3MSSA 4WG3A 4AZTA 3PDTA 3O8TA 3ROCA 2OO8X 5EM5A 3G6GA 3NNXA 4C35A 4O7RA 4PTGA 4C4FA 4FTAA 4RSSA 2G1TA 3QHWA 3VNTA 5BX0A 2C6DA 5AV1A 4A9UA 5IQFA 4AN2A 2CLXA 1PYXA 4BY9E 2QNJA 4XLIA 3VS2A 5LMKC 3LE6A 2WMTA 3TZ9A 1WVYA 3Q9YA 4M7IA 4TW9A 4RX5A 3R1YA 3P7BA 3AMYA 4N70A 3FBVA 4QP2A 4IAZA 5IDNA 4EJNA 3HYHA 5J5SA 4JIAA 3QZGA 4A9SA 2WD1A 2OKRA 5KZIA 4HPTE 3RHXA 3BLHA 4YPDA 5JFVA 2QOHA 3DZQA 3LXLA 4UMRA 2PULA 4C2VA 4Y46A 4FYOA 2J7TA 2GCDA 4HYIA 2YCSA 3NIEA 3QFVA 5HD7A 2WEIA 3NLBA 3CC6A 3CXWA 4KIQA 3DBEA 5LOHA 4ZOGA 2FSTX 4AZSA 4C33A 3MPMA 1W0XC 3KMWA 5AP5A 3M42A 2XK3A 4L3PA 5E8XA 2P2HA 3ZEWA 4EWHA 3SV0A 3C1XA 5EK7A 3V6SA 3FI8A 5AV2A 3PZHA 4L00A 4XV9A 3R8PA 3LVPA 3UIUA 2IJMA 2VX1A 4YC6A 3LCSA 4AE6A 3QRIA 3DNDA 3R8UA 2X7GA 4KKGA 3DFCB 3P23A 3LFSA 2B53A 1WAKA 1DI8A 3QQUA 3EYHA 2YABA 4MBJA 4UV0A 4YZNA 3QX4A 4EHZA 1QPJA 5E8TA 3GENA 4NM5A 2C69A 2C5XA 5E1SA 2BRHA 4EBVA 3VQUA 5E8ZA 3Q6UA 1PXPA 2A0CX 2RGPA 3KXZA 5TT7A 3U6JA 5FEEA 4EHVA 4PMPA 4DFUA 3BHVA 4CMUA 5AUVA 5CT0A 3OCBA 3FQEA 2V55A 3R30A 3SGCA 4NM0A 5CU2A 2WZJA 1F5QA 4XG9A 1Z57A 4GG5A 4LI5A 3ORKA 4DGOA 1WVXA 4UALA 4CXAA 4XNEA 4KBKA 1R39A 1IRKA 2R9SA 2FO0A 3FXWA 3OROA 2XIYA 2V0DA 4YC8A 2Z60A 4S30A 3R21A 2VGPA 4RWJA 4GUBA 1XHAA 3VUHA 3WIKA 5I5ZA 3U9NA 3QTIA 4DE4A 2J6MA 4TWOA 4W8DA 3HA6A 2QOBA 4J99A 4M84A 4BR3A 4XP0A 3TIYA 4M97A 1UKHA 2FA2A 4WNKA 5CZHA 3O2MA 4BGHA 2HXQA 4TYGA 3TEIA 3KMMA 3AD4A 2C5NA 4HNFA 4HVDA 2OICA 3R7EA 4D2PA 2YM8A 3A7GA 3ODYX 2ZV2A 4QOXA 5BYZA 3I1AA 2JBPA 4ONAA 5HLWA 1V0BA 2OIBA 2ZAZA 2PZYA 4D1ZA 4FKSA 3ENMA 4I6HA 3HA8A 2HWPA 2PTKA 4IANA 5C4KA 4CZTA 3EN6A 3F5UA 2ZDTA 5AFVA 3U4UA 2WIHA 3WF6A 4KIOA 5D7AA 4BYJA 3P7AA 3Q3BA 3DY7A 1XO2B 2A2AA 5HO8A 4B6LA 4RIWA 4ZTSA 5FEQA 4K77A 3JY9A 4I5CA 3DB8A 4PNKA 5JZNA 3C4CA 5DR2A 3R8VA 4IX3A 2OG8A 5IH5A 2WQNA 3SRVA 4AXAA 1H28A 2PVKA 4ZMEA 4PV0A 1U46A 4AGUA 4FKTA 3GU7A 4XYFA 4EYJA 3R9HA 4GU6A 5ETIA 3ZRMA 4FKLA 3NVMB 5HCYA 5LVLA 3ZLXA 2ONLC 2JKMA 3QLGA 4FV6A 4USDA 5HBEA 1OI9A 4DFNA 3PIYA 5BUJA 4FTMA 2B4SB 4OTFA 2PVMA 4YLJA 4DA5A 2Q0NA 4BTKA 4DAWA 5CI7A 3PSDA 5C01A 2F2UA 1I44A 4CRLA 2QI8A 4YZMA 5IMEA 3ZU7A 2W5AA 4QRCA 4ACDA 5DH3A 5HICA 4M0ZA 2GNHA 3C0IA 1PXKA 5CXZA 2G9XA 4UZHA 3OCGA 2JDTA 4HYUA 3R8MA 3UIBA 5AEPA 2GS6A 1GOLA 3ZO3A 1QPEA 4Z7HA 1OBGA 3OBGA 2PMNX 3Q5IA 3PSBA 1EH4A 4IVDA 3HEGA 3PY3A 5IA3A 4MXYA 1JKLA 2Z7RA 4RWKA 3T9TA 4BTMA 4FX3A 5DE2A 5HU3A 1UWHA 2X7OA 4FV7A 1J7LA 5EDRA 5GZAA 4FIFA 3QTQA 2ZB0A 3R1QA 5AP4A 3CTQA 5HVYA 2AC3A 4C4HA 2CCHA 4D2TA 3PXYA 3RAKA 4DGGA 3DQWA 4KRDA 3FZSA 4U0IA 4MH7A 2H96A 2XM9A 4RVMA 2EB3A 5HE1A 3L8VA 2JAVA 4FUYA 3VULA 3IGGA 3P0MA 4FG8A 4F7JA 2YCRA 4NM7A 4ANBA 4ZLYA 3NW5A 5B2MA 5CWZA 1SVGA 1Y57A 3KL8A 4QMZA 3KC3A 3AC1A 2R3LA 3ATTA 1NT2A 3UTOA 5HOAA 4EOJA 2PUUA 3QGYA 1JKTA 3O17A 4DBNA 4EOPA 2X6DA 3LLTA 5M44A 4JLCA 4QQCA 1JWHA 4MNEA 4BHNA 5CEOA 4ZLOA 3V8TA 3PPZA 4GVJA 3UE4A 5BYYA 3FMEA 4YHTA 4NIFB 3FPQA 3UO5A 2XBAA 3MJ2A 4BGQA 4OBQA 1OIRA 3FC2A 2O0UA 1XH8A 2YM6A 3OD6X 3RCJA 3PP1A 2Z7SA 3RK7A 3EL7A 2G2HA 3UC4A 3IO7A 3WE8A 3S2PA 4BZNA 1IG1A 2IZTA 2BUJA 2WMQA 4MXZA 2X39A 3OC1A 2IVVA 3EQGA 4JBVA 4RIYB 3OOMA 4EC8A 3AC2A 3L8SA 1KE8A 3HRBA 4W9WA 4GK3A 3FKLA 4TNDA 2OJFE 4QTEA 2R64A 4XRJA 3G15A 5E92A 1STCE 3G5DA 4AFEA 1GZOA 1OGUA 5CU4A 3FMNA 3TKHA 2WHBA 2CNQA 5DMZA 2WTCA 2EWAA 5I9VA 5EOBA 3MH1A 5AMNA 4PP7A 3DA6A 4B4LA 3TG1A 2QODA 4X2KA 2BIKB 4ZLZA 4YJOA 2BTSA 5G1XA 3HMPA 4L3JA 2CNVA 3G0EA 3O0GA 4F0GA 1OBDA 1MUOA 1OIQA 2WMWA 4O91A 4X6QC 5CVGA 4JR7A 3Q60A 4EQCA 4FEWA 3EJ1A 2XKEA 3R83A 3ZCLA 5EQPA 3TJDA 4CYJA 4DEEA 3OY3A 4NU1A 1OL1A 3FQSA 4U43A 3ODZX 3FZ1A 4X2FA 2QKRA 5T3QA 4JL9A 3KVXA 2IW8A 3ZZEA 3I4BA 5FWKK 4YO6A 4HOKA 3KRWA 3VJNA 4WD5A 5B2LA 3D83A 2EU9A 5F9EA 5HO7A 4UXQA 3ZLYA 5L2WA 3DKGA 3G2FA 3ZFYA 2WB8A 5HI2A 3TN8A 4BDAA 2UZEA 3OW3A 3GGFA 1LEWA 4FT0A 4RZWA 2QD9A 4B7TA 1CDKA 1H0VA 5A4LA 2QHNA 3BYSA 3NCGA 3PE1A 4V0GB 2ITTA 3D5XA 1H1PA 1R0EA 2B1PA 4CGAA 1H1SA 3Q4ZA 4O84A 2CGUA 2R2PA 3TUBA 4MXOA 3VBXA 1FBNA 3UZTA 4FKJA 3G33A 2C4GA 4PMTA 3UG1A 4IB3A 4M14A 4QPAA 2PHKA 2YITA 1ZAOA 4FTKA 4GRBA 5HHWA 3ETAA 5C27A 4QQTA 4M67A 4MQ1A 1RDQE 4TZRA 4WUNA 3SQQA 5KMNA 4EKLA 3ENHA 5ETFA 5AV3A 5BQ0A 5JFXA 5HIEA 3GQIA 2NNWB 3DCVA 2UZDA 1IA8A 1S9JA 3QQFA 4FG7A 2B7AA 2OW3A 4KKEA 2ACXA 1FQ1B 5GHVA 3NWWA 4HCUA 1FPUA 3PJCA 1JVPP 4RX9A 4L3LA 4F6WA 3H4JA 3E3BX 4XJ0A 4EZ7A 3R71A 3JR1A 4UXLA 1WBWA 4J98A 4LFIA 4QMOA 5J95A 3S1HA 4BCNA 2UZBA 5M51A 1PXOA 5BVFA 5D41A 2VRXA 2Y8OA 4I92A 5ACKA 4WT6A 2B54A 3N4UA 4M69B 2W5BA 5EDQA 3TI1A 4AA0A 1BUHA 3VW8A 5IISA 3K2LA 4FZAB 3FYKX 4FBXA 5EYCA 1NY3A 3UOKA 5D10A 1UKIA 2HW6A 1UNHA 3JVSA 1AGWA 3MGYA 3Q53A 3R1SA 4U9AA 3E64A 3BHTA 3VUKA 5JSMA 2C47A 1BLXA 2RFSA 3GI3A 4IM2A 2IZSA 3QC4A 5HZNA 2PE0A 5KMLA 4O83A 4HZSA 3SLSA 3QUEA 4K2RA 2JC6A 4YJVA 3HECA 4G6OA 4N6ZA 2W06A 1PYEA 1Q8YA 3WIGA 3IKAA 3C9WA 4EOIA 4KBAA 4KRCA 3ALNA 3O96A 5TE0A 4YNEA 4H3QA 2CSNA 2QG5A 1OUKA 5JT2A 4IX4A 5EQYA 4YUQA 1OL6A 4EBWA 2ZOQA 2Y6OA 3FYJX 5BVKA 4RWIA 1URCA 1R0PA 4JDIA 4LQMA 5KNJA 1B6CB 1R78A 2CJMA 2XK8A 4UWCA 4ZSLA 4BBFA 4I1ZA 3ELJA 4EZ5A 2PMOX 1UU8A 5C4LA 5ICPA 4I0RA 4B8MA 4KD1A 1K2PA 1M14A 4QYEA 2CKQA 4WSQA 5IA2A 3C50A 4I6QA 1YXVA 5AIKA 4ZSJA 2HK5A 3AT3A 3SKCA 4CEGA 4GVAA 2AYPA 5E1EA 4RQVA 3ZM9A 5E8WA 1M2QA 3FI4A 4OBOA 4A4LA 3E93A 4F1OA 2Z7QA 2QU5A 4CT2A 1ERKA 2BDFA 3ANQA 5DRDA 5JFWA 4V04A 4DEDA 2XUUA 3IW8A 2VO6A 3L8PA 4YNOA 5AAFA 4HCTA 3OCTA 4LGDA 1YXSA 5DRBA 4AAAA 4BWXA 1DI9A 1DS5A 4YTIA 3ZS5A 1WBVA 5K5XA 4IAAA 4IFGA 4D9UA 2GNLA 4G9CA 4FTJA 4XX9A 4E1ZA 2J4ZA 4PUZA 1FGIA 3DB6A 1KE9A 5IQDA 3LCOA 2OJJA 4GS6A 3DTWA 4A4OA 4WG4A 3OOGA 2DUVA 4GT3A 3QHRA 3VQHA 4L46A 4JRNA 3DK6A 3V5LA 4I0SA 3HAMA 3LMIA 1CMKE 2IPXA 3U9CA 2XYNA 2PVNA 4PRJA 3CKWA 3G9LX 3HAVA 2HZIA 5HE0A 1OKZA 4Q9ZA 4MD8E 3OWLA 4EC9A 3G51A 3EOCA 4RC2A 3D2IA 5TR6A 2QCSA 3ZDIA 4YSMA 2C6KA 4E6DA 3W1FA 4GCJA 4EH4A 4TRLA 4JIKA 4WHZA 4BCMA 3BE9A 4FV1A 3BEGA 2WPAA 1OMWA 2YERA 1NVSA 1WZYA 5L8KA 2X8IA 4X3FB 2IW9A 4L52A 3MV5A 2QQ7A 2QO2A 5M06A 3MB7A 3NW7A 3QCQA 4RA4A 4FYNA 2VUWA 1YDTE 4TYJA 4ENXA 4EOLA 5FDPA 4ITHA 4M66A 3MA6A 3Q52A 4YJTA 3GCPA 2GHLA 2PVYA 2LAVA 3LHJA 3UGCA 2BRGA 4W9XA 2AUHA 4EOSA 3MJ1A 4BIEA 4CTCA 3LFBA 1OL2A 3ZONA 1LEZA 2XK7A 4IACA 2GNFA 4YO4A 2VWWA 3OTUA 1LP4A 1WFCA 3CS9A 3UC3A 4MHAA 4YPSA 3C5UA 3UNZA 4AACA 4BBMA 5JKGA 3KRJA 1YOLA 2XJ2A 3MFSA 2P0CA 4CQGA 2WMVA 1S9IA 1CSNA 2C5YA 4YZCA 5KE0A 3VHKA 4FV5A 3F2NA 5HD4A 4E6CA 5A4TA 3QTRA 4ENYA 1FMOE 4QQJA 5I9ZA 3TIZA 3ORPA 3R8LA 3W55A 4EI4A 3NPCA 2C1AA 3MI9A 2VWUA 3T8OA 4AGCA 2F49A 5D11A 4EORA 3N4VA 4QO9A 5H2UA 3GCVA 4TKSA 3ZH8A 4ZAUA 4O6LA 3ACKA 3ZLWA 5IH4A 2EVAA 3R00A 4I41A 3IGOA 1YHWA 3COMA 2VTMA 2UW5A 2ZVAA 3RJCA 4AF3A 3B2TA 3O8PA 2WGJA 5J8IA 3ZC6A 4IQ6A 3L1SA 4U45A 3M11A 3EWHA 1G3NA 3OXIA 1M52A 2WNTA 4KKHA 3VBYA 5J9LA 2BFXA 2PL0A 3KEXA 2OI4X 4MWIA 3TV4A 4HJOA 3F7WA 3G90X 3RWPA 5J9YA 2W1ZA 1A06A 4DH1A 1YRPA 4XG3A 5CSPA 3K3JA 1KV1A 3O23A 1NXKA 4U3ZA 2PVHA 2XKFA 4IAIA 1GZNA 5AM6A 5L2QA 3KVWA 4FTRA 4Z3VA 4H1JA 1XH6A 3QCXA 2WMBA 4P5QA 4ERWA 3GC7A 4ANMA 2YJSA 5FXRA 3O50A 5CTPA 1ZZ2A 2OFUA 3OW4A 3QU0A 3RPVA 1MQBA 5AV0A 2JDSA 2XIXA 4I0TA 4L67A 4PL3A 1J7IA 4NUSA 4RJ4A 1MP8A 5AR4A 4G6NA 4BVUA 4QMXA 4XS2A 4JBQA 4TN6A 2QOQA 2WOTA 3K54A 1UV5A 3ZXZA 3WZKA 5IU2A 4O86A 2OIDA 3OP5A 5H9BA 4WG5A 5JRQA 3R9OA 1Y6AA 3M2WA 4BKZA 4FT3A 2FSMX 4IWOA 3V5TA 4BDEA 1BYGA 1GIIA 3ZBXA 3WZJA 3MVMA 4JDJA 3UODA 3U51A 2HOGA 5CT7A 4G3CA 2C5VA 4G34A 4A9TA 2XCHA 3MH0A 4NIFA 5GNKA 3NYVA 1Q3DA 3CQUA 3LQ5A 4K33A 5K9IA 3LLAA 1ZXEA 1OL7A 1XR1A 2H34A 4NW5A 4QYHA 5H8EA 4CYIA 4G2FA 2PE1A 4OTIA 4CV9A 5J79A 4XCUA 1HCKA 3EQDA 3NUAA 2FYSA 2I40A 2VU3A 2OXXA 4FSQA 4BDCA 5CF5A 3CBLA 4FGRA 5DYJA 5M4UA 2AC5A 4C36A 2YIQA 3I5ZA 4RIYA 2XB7A 4UBAA 3OWJA 5DIAA 4DYMA 2HIWA 4RFZA 4L45A 4IX5A 5M57A 3C4XA 2BVAA 4DEBA 4I5HA 4EK5A 5AAGA 2UZNA 4QP3A 4GMYA 5FP5A 4DFLA 3SXFA 3OXTA 4IAFA 5TO8A 3GU8A 5DEYA 3IW5A 4E8AA 4YR8A 4EOKA 4YU2A 2WELA 1I09A 3R7UA 4UMPA 2CNUA 4PDSA 1JLUE 1WBOA 2A27A 1PW2A 2ZV9A 5L3AA 3V5QA 3BV3A 4F7SA 2C1BA 2HENA 3DBQA 2VWXA 4RJ7A 3GFWA 5M4CA 3LFEA 5HTCA 4CMTA 2GSFA 3BPRA 2HAKA 4E6AA 2EB2A 3Q6WA 2R7BA 4M0YA 5IA5A 3T3VA 3VS1A 4CZUA 3K5VA 2GS2A 4G31A 4XHKB 5HNGA 4P5ZA 4AOJA 4ZS0A 1W7HA 4GK2A 1H00A 3ANRA 1KSWA 4O96A 4XRLA 2BRNA 2NRYA 4DF3A 3EFKA 4K11A 4XEYA 3GNIB 2BHHA 3TNQB 2RFEA 2XF0A 4MBIA 3NR9A 4UMTA 3W2QA 3DBFA 2IO6A 4YJUA 4E26A 4E7WA 4JAIA 5CU3A 3NUXA 4D58A 3AT2A 3D5VA 4QMLA 3FLNC 5HE3A 2XP2A 2OF4A 4RA5A 4AW2A 3Q9XA 3ET7A 5HORA 3F9NA 4V0GA 1SVHA 1UU9A 3R7OA 3MBLA 3VHEA 4D4RA 3CJGA 4DFXE 3BGQA 3ERKA 4F9AA 5FP6A 1CKPA 4UYAA 3C4WA 1U54B 4NKSA 4BC6A 5J1VA 3SG8A 4RJ6A 4C38A 2QO7A 3MESA 4DEAA 1YXUA 3I79A 5BUEA 1M7QA 3R6XA 4IEBA 4R3PA 2GU8A 4QMPA 5ANJA 3HV7A 3SVVA 2PK9A 4BI2A 4KUJA 4U5JA 2ZMDA 3F66A 3GUBA 4D4SA 1OKYA 3LPBA 5M56A 3W33A 4LL0A 3ZDUA 4IH8A 4CLJA 2HZ0A 3F3WA 1LPUA 4C4EA 5HBJA 1BI8A 3RNYA 4EK4A 5A4CA 4ID7A 3E88A 3S3IA 3EZVA 5J7HA 2Y4IC 4RC4A 4B8LA 4FTQA 4HGTA 2GMXA 3BI6A 3MPTA 4FKVA 3RWQA 3FLWA 1YVJA 4CLIA 1KE6A 4DITA 2KTYA 1Y8GA 2F7ZE 3MH3A 3PJ1A 5BYLA 3IONA 4BGGA 2ZV7A 3WZUA 4S2ZA 1AD5A 3D7TB 4CFUA 3OUKA 3IK3A 4NK9A 1PXLA 4M69A 1XH7A 3UP7A 5HX8A 4FG9A 5KO1A 2PU8A 2QO9A 4IZYA 1H1RA 4BCQA 3NUPA 3QTZA 4EZ3A 2E9VA 5A3XA 4DFZE 4BDHA 5FEDA 4IDTA 1Q41A 4F9CA 1H25A 3ORXA 2E2BA 3F3ZA 3D5WA 3FQHA 1SM2A 5AIRA 1YDSE 2YN8A 3Q9ZA 4OW8A 4FL3A 2ZV8A 3AG9A 3JVRA 4OLIA 4QNAA 4A07A 3SW4A 5DT4A 3PWDA 5AR7A 4O1OA 4FIHA 4ZSAA 4FSUA 4A9YA 5K4IA 2WFYA 4PL5A 4DLJA 4JX3A 1P4FA 5AP0A 5AP6A 1J1BA 3ALOA 4ASDA 4BYIA 1BI7A 3TTIA 2G2IA 4D1XA 5IQHA 3LZBA 3TCPA 3QTSA 3VO3A 3KMUA 2GNIA 4AA4A 2J51A 4DCAA 4OGRA 3LMHA 2A19B 3BYOA 2J50A 2UW0A 4B99A 4ASXA 4CFWA 4J96A 1XH5A 4C7TA 2YZLA 2Z02A 4XG7A 1G8AA 2XJ1A 2GHGA 4IJ9A 4S31A 4DEHA 5CAUA 4X0MA 4XG4A 3FI3A 5L2TA 5F95A 4USFA 4GKHA 3LAUA 3V5WA 3GEQA 3GVUA 3VUDA 3WBLA 4EL9A 2YJRA 3VUIA 2ZDUA 4FV0A 3IW4A 4F09A 1G5SA 3FHRA 4IVAA 2W0JA 3VBWA 1IASA 2RF9A 3R9NA 2PE2A 1J3HA 2UZWE 3F5GA 1O6KA 3GFEA 3LCTA 3QRTA 4DN5A 4FZDB 1FOTA 2R3FA 2QOOA 4GIHA 4AQCA 2I0YA 3RZFA 4RX7A 4I93A 4BWKA 2WTKB 2VTNA 3SOAA 4F63A 4FA2A 4FEUA 5DT3A 3RGFA 4MXXA 5F1ZA 4J8NA 5BVNA 3N51A 1LUFA 5IA4A 4DFBA 2PZ5A 4EONA 4MX9A 5IEVA 4FTOA 2CN8A 4O0TA 4O1PA 3HNGA 2WMXA 3V3VA 2UVYA 4G1WA 4K9YA 5H8GA 3TNPC 3ORIA 3PA4A 4QPSA 4IMYA 1QCFA 2C68A 4NH1A 1L8TA 1PMVA 3KY2A 3EQFA 4BDIA 1FGKA 2WMSA 5JRSA 3P9JA 1PY5A 4KSPA 3LFFA 3E62A 4ZJIA 3SXRA 1ZMUA 2C6MA 5IQCA 1H1QA 3BGZA 3V01A 4F70A 4PP9A 2XVDA 5KZ0A 3RPYA 5CF8A 4K6ZA 2GTNA 3H0YA 3DU8A 3OWPA 4X3FA 5EDPA 4O7YA 4G17A 3PYYA 4NT4A 5GINE 1PMNA 2HZNA 2ITOA 2R7IA 4PTCA 3WARA 4HPUE 4BCPA 3PY1A 4OBPA 2BTRA 5EW3A 2RIOA 4OAVB 4IB1A 5FD2A 1H07A 4Y5QA 4C57A 4FV2A 3W18A 3H0ZA 5JMSA 4OUCA 4O22A 1JOWB 1T46A 3FUPA 2I0VA 3KK9A 2C3KA 3BWJA 2WIPA 3C0GA 5IMXA 5BUIA 2BDJA 4YTHA 3W16A 5EYMA 1WVWA 4BHZA 2J5EA 4FKPA 2I0EA 3E8NA 4IIRA 5E7RA 2DYLA 3UPXA 5ANDA 3HRFA 2YIWA 2XEZA 2QOLA 3H9FA 4ALUA 4JNWA 1O6YA 2VTHA 2HYYA 4JRVA 4YZBA 1VJYA 3HV6A 4NL0A 3KF4A 3QXOA 3EQHA 3WF5A 3F88A 1ATPE 3V5PA 4JQ7A 4D5KA 4R7HA 2NRUA 3BCEA 3FMKA 3R7YA 1RJBA 1U5RA 1LR4A 5A9UA 2I6LA 3LFAA 3PG1A 4R8QA 3EKKA 4F0IA 5JZJA 4H39A 4EOQA 1GIHA 3D7ZA 1H26A 5F94A 2VWZA 2W7XA 3KRLA 3R0TA 3A4OX 4U6RA 4DEIA 3Q5ZA 5A6OA 5M07A 3GU6A 4OTWA 1OVEA 2B0QA 2OH4A 5ITAA 2ITQA 4F65A 3OHTA 5CQWA 4KIPA 2QVSE 4HGSA 5DLSA 4BCOA 4DC2A 2W5HA 4LYNA 5EI6A 4C4JA 3TDVA 1Q8ZA 3ZOSA 2XIZA 2WMUA 4DH3A 2J90A 3C51A 4U41A 1UU7A 4GW8A 5K0KA 4OTDA 4JVGA 2WXVA 4YC3A 4IB0A 2X81A 1QPDA 4OTGA 5J87A 5I9YA 1XH4A 2DS1A 3HV4A 1UU3A 4HYSA 5BVEA 4CSVA 3P4KA 4TYHB 4FNWA 5AUXA 2P33A 4CQEA 2FH9A 3PG3A 4XBUA 4YJQA 3OXZA 4G3FA 3FKNA 5A14A 4C4GA 3MW1A 4QYGA 5AA8A 1APME 1KUTA 2J0JA 4S32A 4TNBA 4HCVA 2R3GA 4I4EA 4K8AA 2BROA 4MNFA 2XNPA 2FVDA 5CENA 3W2SA 4F1MA 3UZPA 1XBCA 4WOVA 5AP2A 2BAJA 3H3CA 3EYGA 4LM5A 3A4PA 5LARA 4P2KA 1IEPA 3S0OA 2WQMA 4RC3A 1QPCA 3NW6A 5ETCA 3EN4A 4XBRA 2WU6A 4GT4A 5IH6A 4JOAA 4F6UA 4FV8A 1ZYJA 4AU8A 1SYKA 1W82A 1W83A 4BDGA 5CU0A 2LGCA 3DLSA 3QAME 2JDVA 1H1WA 4D28A 4C3RA 4ANOA 3A7IA 4TWCA 4LV5A 4DFYA 2H6DA 3MVHA 4QP7A 3ZRKA 4ACMA 4DBXA 4K0YA 3I0OA 4RRVA 1ZZLA 2R0UA 2UZTA 4E4NA 5HKMA 3UO6A 3RP9A 3QUPA 4PPCA 1ZYLA 3IDCA 5LWNA 3UPZA 1YXTA 3OZ6A 2YCQA 2BAQA 1CTPE 3LXKA 2O3PA 5HESA 4O7VA 4QP8A 3KRRA 3N9XA 2IVUA 2XA4A 2GNJA 4R7IA 5CU6A 3VRZA 2ERZE 2C6OA 2JD5A 5EG3A 4M12A 5HCXA 3W2RA 3GC9A 5FTQA 3WF9A 2PPQA 4O81A 4JS8A 4QMQA 2YCFA 3Q2JA 2ZM3A 4IXPA 4LUEA 3ITZA 1WBPA 5DR9A 2VX3A 2C0TA 4D2VA 5EQEA 4C4IA 4QP9A 4C3PA 4X3FC 1F0QA 4ZEGA 4OTPA 4BTFA 3SOCA 5KHXA 3DBDA 3REPA 4O7TA 4R3RA 2XKDA 1Z9XA 2XM8A 3FXXA 4DEGA 4I4FA 4ERKA 4AN3A 5K5NA 4DINA 1W84A 1PKDA 4Y95A 4EK8A 3SX9A 3PPJA 5EHYA 2P3GX 4FE2A 3HLLA 3P1AA 2WEVA 5FBNC 2W1CA 4PDPA 4ZTNA 3C7QA 3GCQA 5D1JA 4WBBB 3MVJA 4H58A 2E9PA 4Z9LA 1SVEA 2VO7A 4MF1A 4U97A 3PXKA 4FSWA 2QU6A 5CEPA 3JUHA 2REIA 4RG0A 3QCSA 4FVPA 3MWUA 5HEZA 2GTMA 3EFJA 5GZ8A 5HU9A 1H27A 1JKKA 1U54A 3I5NA 3KA0A 2JKKA 3PSCA 2GNGA 3Q32A 4PPBA 4JR3A 4FC0A 4L6QA 3TUCA 4BDFA 4WSYA 4PDOA 3V8WA 4GFMA 3LFQA 3ZZWA 1YXXA 3BHUA 2JIVA 4LOOA 4OT5A 3PRFA 4ANLA 4ZTQA 4FR4A 3UOLA 5EOLA 3DS6A 2F2CB 3IOKA 4AUAA 3DT1A 2ITYA 2QOKA 5CALA 5AV4A 4AE9A 4JG8A 5E90A 2YM7A 4I24A 4ASZA 4FKQA 4TWNA 2VTJA 5KMMA 4MXAA 2Y7JA 3EQBA 1E9HA 3MYGA 3QQHA 3WZDA 4O0RA 2OGVA 4ZSGA 1GNGA 2DWBA 4X6RA 1P2AA 2ESMA 2VNWA 1PF8A 2UVZA 2UZOA 4AFJA 3R02A 4BCJA 4BWPA 3D2KA 3DNEA 3NNUA 4Y83A 4ZJVA 4GYIA 4FV3A 5HVKA 4W4VA 5JGBA 3BELA 5LVPA 5FDXA 4UMQA 3OTVA 3D7TA 3I0QA 4P4CA 4A9RA 1PKGA 3FSKA 3PXRA 2R4BA 2FSOX 4U3YA 1NA7A 3AC8A 2G2FA 3F82A 5CI6A 2OFVA 3QD2B 3QQGA 5B0XA 4N57A 3FMLA 3NIZA 3IECA 3HRCA 1OITA 3R9DA 5L8JA 4CV8A 2BRBA 4AWIA 3ORMA 4RWLA 4LRKA 4M13A 4QD6A 2W96B 3FLQA 4UEUA 1Y91A 3ZC5A 3EQIA 3QQKA 5BMMA 4EH5A 3CY3A 4F0FA 2QKWB 3HUCA 3W32A 4YTCA 4MF0A 5EFQA 3DGKA 3DV3A 4O0XA 2HXLA 3NUUA 3UQFA 4PY1A 2W1EA 2I0HA 1OKVA 3F3UA 4EEVA 4NFNA 2VTQA 3QUDA 5IF1A 1VZOA 2VNYA 3AMBA 4MKCA 1KOAA 3NYNA 1OZ1A 5IUHA 4CFXA 4FODA 2R3OA 4O7SA 4FL2A 5AX3A 4ZP5A 5CQUA 5FXSA 4R1YA 4BF2A 2VWIA 2ETKA 4QMSA 1PXIA 1H01A 1U59A 2C3LA 2OJIA 3AMAA 3MA3A 3PIXA 3QWJA 3ZSIA 3RKBA 1KE5A 4RZVA 4XV3A 5CSXA 3IDBA 3LCDA 2YWPA 4MTAA 3FI2A 3TZ7A 4UYNA 2PY3A 4R6VA 4DG2E 3UG2A 3EHAA 3H9OA 4ZY4A 4NYEA 2BAKA 3E87A 3UNJA 2XNBA 2XIKA 3NAYA 3ORNA 1F3MC 3P7CA 4XLVA 4H1MA 3U4WA 4CCBA 4CKRA 2R3PA 4CKJA 5I9XA 3U54A 3FMMA 2YM5A 4CG9A 1PXNA 4X21A 3RINA 3F2AA 4IC8A 3UVQA 2VAGA 5BPYA 2R3QA 1CKJA 3POZA 4HNIA 2I1MA 5JGAA 4ZTMA 5B7VA 4QMYA 5DA3A 3C4ZA 2CDZA 3E92A 3HX4A 4FNYA 4AG8A 3LQ3A 4RBLA 3TZMA 5I0BA 5AX9A 3E8DA 3OG7A 4QPMA 5GIOE 3R8ZA 2C6EA 4GT5A 3VS4A 2HELA 3HMNA 1J7UA 1IA9A 5C9CA 4XP2A 3RK9A 4AW0A 4FTIA 1ZY5A 5AUZA 4KIKB 3KULB 3QF9A 3EMGA 3O51A 3WI6A 4FMQA 3CKXA 2E9UA 4IM3A 1XWSA 2WTVA 2XK6A 3KXXA 4AZVA 3KFAA 2VTTA 3QCYA 4BCHA 4C59A 1YI4A 3V6RA 1P14A 3PP0A 3GXLA 3DJ7A 2ITUA 4EJ7A 2BZIB 1Q8TA 2UW7A 3BU5A 4RIWB 4U79A 3ORTA 3HKOA 3B8QA 3HMOA 4HVHA 3LFCA 2YM3A 4IX6A 2CKPA 4TYEA 4O0SA 4PPAA 5E4HA 3ZXTA 3L8XA 4BIBA 3S95A 3U8WA 3C0HA 2HCKA 4FKIA 4YURA 4O7LA 3AT4A 4MEDA 5HE2A
chains in the Genus database with same CATH superfamily
5HBHA 1JPAA 3IW7A 4Q9SA 4R1VA 4YJPA 1TQPA 3TNIA 5HLPA 3LW0A 2YWVA 4YSJA 4M8TA 3PVBA 2XK9A 5HGIA 5CF4A 2EXCX 2ZYBA 3E7OA 4DDGA 3FY0A 3MB6A 1YOJA 3P79A 4GSBA 2CHLA 3KREA 1PMEA 5A54A 1PRYA 3PA3A 4U81A 3SXSA 5KBQA 3GCUA 1R3CA 3IPHA 2W1DA 4AGDA 5EI8A 4UY9A 3QD0A 1TVOA 4RFMA 2UW4A 3VS6A 2OF2A 4QNYA 1OGYA 3R04A 3ZUTA 4FI1A 3TWJA 4JAJA 4UZDA 5GJFA 2R5TA 4LGHA 4NWMA 4EHEA 4GYGA 2IWIA 4MK0A 3PPKA 1BL7A 1E1XA 2P4IA 3HV3A 1WCCA 4J7BA 3A62A 3VVHA 4PX6A 4XV2A 4YJSA 3BU3A 4OTHA 3DZOA 3II5A 2PVJA 1ZRZA 3UOJA 4EWQA 5I4NA 3DKCA 3FLSA 3VUTA 3R28A 2ETRA 4L53A 5AP1A 5FTOA 5L2SA 2C30A 3COIA 3PVWA 3R1NA 3KN5A 5C8KA 4J1RA 5EKOA 3LCKA 3OT3A 3WILA 3CTJA 4RMZA 1WBNA 2GDOA 3SW7A 1SNUA 3LXNA 4EH3A 5M4IA 2NO3A 2YA9A 5E8VA 1Y8YA 3ZSHA 5LVOA 4JI9A 2R0IA 3QKKA 4GFGA 3VN9A 1W2CA 3TV7A 2HY81 3IG7A 4FL1A 3QXPA 3RAWA 1MQ4A 5IG1A 5DVRA 3PE2A 5IUGA 5IQGA 1PJKA 3R2BA 2BALA 5TOZA 2BHEA 2RFDA 4ACHA 3FSFA 2OXDA 1BX6A 5AUYA 4DCEA 3KU2A 4U44A 2XANA 1YHSA 3UP2A 2CMWA 2DQ7X 2Y4PA 4TYHA 3P86A 3D9VA 2UV2A 4BIDA 2V22A 3AOXA 4R7BA 5EI2A 3JPVA 2X6EA 3HMMA 4YJRA 5KHWA 1R1WA 5EW9A 1YI3A 3ZBFA 3MIYA 2XS0A 2BIYA 2Z2WA 2B9FA 3KXMA 2YHVA 4Y85A 4GIIA 3W10A 5CAVA 4G3EA 4FSMA 4AZEA 3EB0A 4DT9A 3JY0A 4FV9A 4X2JA 4D2WA 2W1IA 3S4QA 4DT8A 3Q9WA 2UZLA 2Y9QA 3UMWA 1YW2A 3AD6A 3V5JA 1J1CA 3KCKA 4KBCA 4F9WA 2PZPA 1A9UA 2F4JA 2YDKA 3GU5A 4J95A 3TACA 4TTHB 5I3RA 2W4KA 5JH6A 5EM6A 5KKRB 3U55A 4DG3E 1L3RE 3PVGA 3Q2MA 3FZOA 5C1QB 1ZMVA 1ZARA 3FMDA 1OPKA 4Q2AA 4D9TA 2VGOA 4IBMA 5TKDA 3PTGA 4JQ8A 4FSNA 3DAEA 5CASA 4X2GA 2QLQA 2IF8A 3CY2A 3TZ8A 2PUPA 3RI1A 1UNGA 3DKOA 2PZRA 2C6TA 1SZMA 2W9ZB 3EN9A 3EZRA 3TL8A 4ZY5A 4MWHA 4R3CA 4ITJA 5CYIA 3O7LD 3ZHPC 3O71A 3WE4A 2CKEA 1CM8A 3A7HA 2VTSA 4JMQA 4MXCA 4Z16A 5D12A 1V0OA 4FUXA 4HVSA 4FTLA 2YAKA 2BILB 3OF0A 4KSQA 4S34A 5CZIA 4F99A 5L6OA 2EUFB 3PIZA 4WUAA 1VYZA 2SRCA 4XOYA 2O2UA 4G5PA 4BFMA 5AUUA 3UDZA 3BZ3A 3R7GA 3U6IA 3PUPA 2XRWA 2UW9A 4YJNA 3VC4A 4FZ6A 2VTPA 4F6SA 4L01A 2J5FA 2B9IA 1Q99A 5ANIA 4EK3A 3PA5A 4EQUA 3ZUUA 4CZYB 3BL9A 4RT7A 4G6LA 4ACGA 2X0GA 4DTKA 4UN0C 3EL8A 3F7ZA 3PJ3A 4N4SA 1PHKA 5J1WA 5K4JA 4IM0A 3NUSA 3QL8A 2CGWA 2WMAA 4H3PA 1JBPE 4OTRA 4CT1A 4KABA 3KK8A 1URWA 4GU9A 4IHPA 5M4FA 3F5PA 4J71A 3NMUF 2A1AB 2VD5A 4EYMA 5KUPA 4EH6A 3PWYA 5CNNA 4F9YA 4LRJA 3R63A 2W17A 2WMRA 1BMKA 5HNBA 4LOQA 2R3KA 3HDNA 1HOWA 4W4XA 3W8QA 5C26A 3TM0A 3UIMA 2R3HA 3F6XA 2QOCA 4GKIA 3KXGA 4NW6A 2YDJA 4BCFA 5DFPA 2OXYA 3CPBA 4DH8A 2PVRA 3DJ6A 2EXMA 2JFLA 2CLQA 3HP5A 3COKA 5EHLA 2CKOA 2R3MA 3FZRA 4P7EA 4HZRA 4E4LA 3RTPA 2X8EA 5BV3A 4FNZA 4WA9A 3F2RA 4HYHA 5CXHA 3WYYA 4APCA 5CAPA 4OR5A 2R3RA 4QYFA 3DQXA 1Q5KA 4XH6A 3FMJA 1TQIA 4FKWA 3UO4A 3W2OA 4ALWA 3ZRLA 3VBQA 3DDQA 2UW6A 5LMBA 1JQHA 3ZFMA 4D0WA 3C4FA 3QTUA 4NFMA 4MCVA 3RHKA 4CMOA 3BYUA 1ZYDA 3NNWA 3EKNA 3NUYA 3MTFA 4DGLC 5DGZA 4IE9A 4NTSA 3DTCA 3I7CA 5LCKA 4JX7A 3RAIA 2ERKA 5TF9A 4RVTA 3LFNA 5J7BA 5ACBC 4BCIA 3P5JC 2R3NA 3N4TA 4KNBA 4APPA 2W1FA 3L9PA 4OTQA 4R78A 5EM7A 1WBTA 4FTCA 4AXEA 2HWOA 3VF8A 1UVRA 1H8FA 3VJOA 3DJ5A 4X2NA 2AQXA 2PZIA 1YOMA 2J0KA 4QTBA 4PMMA 5L4QA 3UVRA 3E3PA 5KMIA 5HNIX 4EHGA 1B39A 2BZJA 4NJ3A 2VWVA 4BCKA 4D2SA 2J0LA 4BJJA 4BB4A 3QZHA 2ZM4A 3NRMA 3KXHA 4FKUA 4FV4A 4QMVA 2Q83A 3OVVA 1JSTA 4JDKA 4V01A 3WYXA 4DGNA 5A4EA 2P2IA 4CFVA 2B9JA 5LJJA 5M09A 3LJ1A 4C0TA 3QALE 2PYWA 1JNKA 4AZWA 3MTLA 3GT8A 1E1VA 1O9UA 4H36A 1XQZA 1W98A 4QP1A 4QMWA 3VBTA 4EH9A 3FV8A 3HDMA 3IDPA 2BKKA 5D7VA 1ZWSA 4LL5A 4I5PA 5GJDA 3MY5A 4LRMA 4WNMA 4I20A 3ZMMA 4CFNA 1B38A 1YKRA 2JIUA 3CGOA 4FKRA 3B2WA 4D0XA 5EYKA 1UNLA 1ZY4A 3VIDA 4ZS4A 2G01A 3GU4A 2W1GA 4KA3A 3ACJA 4M3QA 4ALVA 4Y73A 2ZMCA 3PZEA 4F08A 4FEVA 2O8YA 4WRGA 3OFMA 2OLCA 4D2RA 3QA0A 3NEWA 2XIRA 2YIRA 3R01A 4QYYA 3RALA 3CCNA 4FSYA 3POOA 3L9MA 3EH9A 3UZRA 3UDTA 3QX2A 3ML1A 1Z5MA 5LWMA 4FICA 2E9NA 4BI1A 4YBJA 4QP6A 3LMGA 3MFUA 2GFSA 3CJFA 1VYWA 3CEKA 2BPMA 3FZPA 4KIKA 5FG8A 3KULA 4F64A 2VTLA 2OH0E 4Q5EA 5KBRA 2Q0BA 5KCVA 3FL5A 3V8SA 3JXWA 3ZLSA 2QG7A 4MUQA 1W8CA 3UVPA 2RL5A 4ZMFA 4ZK5A 2YAAA 4LV8A 3DPKA 3DXQA 3HZTA 2Y6MA 5FRIA 3D14A 4D1SA 4E73A 4II5A 5HG8A 4C34A 3E8CA 3H9RA 3QKLA 4D5HA 3KQ7A 4AT5A 5CAQA 4DH7A 4FZ7A 4KS8A 4MYGA 1OM1A 3L9NA 5GJGA 2YEXA 2CGXA 4AZFA 1DAYA 2GPHA 4WNPA 4ZTLA 3QZIA 1ST0A 3VUMA 3QD3A 4XOZA 5HG9A 4R5YA 5E8YA 1FVVA 2BZKB 2J0MB 2XNEA 2XNNA 2X4ZA 3HVCA 3VW6A 1K9AA 1SMHA 5T68A 4RJ8A 2IZUA 4BDBA 3BQCA 4PTEA 1ZYCA 3UBDA 2B52A 2IVTA 3NS9A 3R73A 4TXCA 2WAJA 5EH0A 1XKKA 4N6YA 5DHJA 3RZBA 4BBEA 5CEMA 2XRUA 1IAHA 4H05A 1H0WA 4L8MA 3F61A 4TWPA 4ZIMA 3QYZA 1XH9A 2FUMA 2VN9A 2Y4IB 3MIAA 4LG4A 4O38A 1OKWA 1P4OA 4GH2A 5IPJA 5FGKA 2VV9A 3D5UA 4O7WA 3D4QA 4LOPA 3HL7A 4IWPA 4JDHA 4GUEA 4E6QA 4E4MA 2IN6A 3HUBA 4FOBA 3DK3A 4EUUA 3GOPA 5DWRA 2EXEA 4WKQA 2GQGA 1HCLA 3D94A 3G0FA 5DEWA 5KMJA 3C5IA 3BE2A 3Q4UA 4RJ3A 3HP2A 4EOOA 3NZ0A 3LM5A 3PXFA 4NM3A 3U87A 4BN1A 2PUNA 1ZOGA 5IZFA 2VO3A 2F9GA 2XEYA 4CTBA 4RVLA 2JEDA 3HMIA 4ZSEA 3SC1A 3UNKA 4PL4A 2X2LA 3W2PA 4JQEA 4K18A 3FPMA 3F3VA 5KX8A 4W4YA 4FNXA 1Q61A 4L7SA 4LUDA 1MRVA 3CSVA 3GOKA 3RK5A 1RE8A 3ULZA 2FSLX 3LOKA 3UYTA 3RVGA 2OZAB 4DG0E 3MFRA 2X1NA 4I94A 4IJPA 5CS6A 3DKFA 5ANKA 2GQSA 2W99B 4RLLA 4XUFA 3L9LA 1IR3A 2JITA 2C3IB 4NSTA 4DLIA 1GY3A 4E5WA 3ZFXA 1G8SA 2QR7A 5EW8A 4F7LA 3JYAA 4QMMA 2VTOA 3R7IA 3UIXA 5CAOA 5HTBA 2JKQA 5JN2A 3Q96A 2ITZA 4DHIB 1Q97A 3GBZA 2WTDA 3I7BA 2GHMA 1YWNA 1KOBA 1GIJA 2IVSA 5CSHA 4CFFA 5K3YA 3IS5A 2RG6A 2YIXA 3KRXA 3WF7A 4AGWA 4O82A 3GB2A 5LVMA 3LQ8A 1OIUA 4AT3A 4ZZMA 3AC3A 3O8UA 4FIJA 3EFLA 5LQFA 2A4LA 4DH5A 1NVQA 5G6VA 4GJ3A 5AADA 4HVGA 2XAMA 2B55A 5L6WL 4C62A 1FVRA 5CF6A 4L43A 3T9IA 5HQ0A 4GJ2A 3QKMA 2X4FA 4PWNA 3MVLA 4FT9A 4YLLA 4I6BA 2VTAA 1U4DA 4G3GA 5CY3A 3W8LA 4J52A 3LIJA 4QTAA 1JAMA 4RIXB 3QYWA 1ND4A 3NDMA 4X7QA 5I9WA 5C8NA 5FTGA 3KB7A 3A8XA 3CLYA 2NYAA 2J2IB 3ZO4A 1FVTA 5LCJA 3AXWA 1NVRA 4YLKA 2H9VA 3VS0A 4L68A 4J97A 4DTBA 5EM8A 2WQEA 3EQRA 2V7OA 1DM2A 3K5UA 3MH2A 2YDIA 4KINA 3RPOA 3V51A 3RBWA 4A4XA 3EN5A 4AS0A 3QWKA 2XNOA 3VWAA 3TJCA 3KF7A 2VX0A 5AUTA 5AAEA 3W2CA 4J53A 5ANOA 3FXZA 3E5AA 4I6FA 4FTUA 2GS7A 5IDPA 1BKXA 2WTJA 4RFYA 5HG7A 4KS7A 4RGJA 3RMFA 2VO0A 4E5AX 3GC0A 4HVIA 2ITWA 4K1BA 1W2DA 3FHIA 3D15A 3NCZA 3DFAA 1WMKA 4W4WA 5H8BA 1ZOHA 3EN7A 5M08A 3IQ7A 3SA0A 1SNXA 4P90A 2X9FA 1NW1A 3FE3A 4G5JA 5IEYA 4FGBA 3AGMA 4QTCA 4GL9A 4B9DA 3MDYA 1OUYA 4MBLA 4I5MA 5LMAA 2C0IA 4ZTHA 5E8SA 5DNRA 4C02A 3OEZA 1U5QA 1P5EA 2VZ6A 5H3QA 2ITXA 3UOHA 3OCSA 4WRSA 2JKOA 5EYDA 4LMNA 3ID6C 2OJ9A 2VTRA 4BDJA 2PWLA 3BGPA 1RQQA 2CN5A 3DBCA 1X8BA 4DGMA 2BFYA 4FT7A 3MY0A 3H10A 1Q8WA 3K3IA 2H8HA 4E5BA 5AR3A 3LKMA 1REKA 5HTIA 3RM6A 4C3FA 3TYKA 2ITNA 3ZSGA 2QOFA 3O7LB 4IFCA 2BRMA 4IZ7A 3UJGA 4E93A 3TDWA 1CKIA 4D55A 3C13A 3I6UA 1UA2A 2J9MA 4F9BA 1M7NA 3Q04A 4BTJA 2PMIA 4FZFB 4DHFA 1YDRE 1Y6BA 2RKUA 3BWFA 4RJ5A 3FMHA 2F57A 2NP8A 4FOCA 4CG8A 4G9RA 2J0IA 4LMUA 4MVFA 5AUWA 4FK6A 2W4OA 4C8BA 2QLUA 1OPLA 4A06A 3QQJA 4FVRA 3AC5A 4YGAA 1G8JA 1RW8A 2XBJA 1M17A 4FKGA 3DDPA 2QOIA 1MRUA 2HW7A 4F4PA 4NKAA 4HGEA 3OBJA 5KMKA 2WOUA 5IEXA 2YISA 3LFDA 3VS3A 4MD9E 2CPKE 2KULA 3QBNA 3R22A 1JKSA 1KE7A 1XBBA 1XJDA 3NYXA 5FLFA 4ASEA 3FJQE 2UW8A 3DOGA 1H08A 4L44A 3RPSA 1GJOA 3IOPA 3OUNB 3UDBA 4BKYA 2ITVA 2O64A 4EOMA 5JGDA 1YQJA 2OZOA 4KWPA 3QC9A 4MD7E 4NCTA 2BKZA 3B8RA 3F5XA 3I81A 3M1SA 2UZVA 4FIGA 5AM7A 5FQDC 1H4LA 3BX5A 5IQBA 4ANSA 5LVNA 5AR8A 2QR8A 5AA9A 2O5KA 4QQ5A 4FT5A 2XNMA 4XMOA 4M68A 4AOIA 3HGKA 3FKOA 4GEOA 4U80A 5F4NA 4ARKA 4IAYA 4EKKA 2BCJA 1JSUA 4ZJJA 4E3CA 3PUFC 2QONA 3ORZA 4BCGA 2QURA 4BRXA 5A46A 1DAWA 2C6IA 4I3ZA 3QTWA 1GZKA 2YLEA 3SDJA 4WNOA 3R2YA 3DK7A 1YI6A 1TZDA 2BMCA 2UW3A 3I60A 4GG7A 4XG8A 1ZOEA 2CGVA 5DN3A 4FSTA 1KV2A 4N0SA 4UMUA 4Z7GA 3MY1A 4FTNA 4BL1A 5BNJA 3BEAA 1OB3A 2FGIA 4U42A 3EFWA 2X2MA 4O27B 5J5TA 3BL7A 2W05A 2BDWA 3C4EA 5HLNA 1OL5A 5CEIA 4QDEA 3G6HA 4ZXTA 2OIQA 3WOWA 3ATSA 4CKIA 3TKIA 5DG5A 5KMOA 2OBJA 4TY1A 2FB8A 4R5SA 2V62A 4NZWB 3NVKI 1GZ8A 3CP9A 3FLYA 1JSVA 5HIBA 3W0QA 3A60A 3DAJA 3GP0A 2ZB1A 4NEUA 4FIIA 1PMUA 1Q8UA 4NJDA 3VS5A 5E9EA 3A7FA 3OT8A 1UWJA 2XZSA 5DPVA 2X8DA 4HGLA 3RPRA 3NX8A 5E8UA 2PMLX 4QT1A 3THBA 2I7QA 2PUIA 4Y5HA 4AW5A 3TTJA 3CD3A 3BHYA 3F69A 3PLSA 2XCKA 2XH5A 3F3TA 4IWDA 5L2IA 3NNVA 2YM4A 3CQEA 5DOSA 3DXPA 4GV1A 3SAYA 4AXCA 3OMVA 3LM0A 4TYIA 4O2PA 4RIOA 4EH7A 3NUNA 3PVUA 1K3AA 3OS3A 4Z55A 4KB8A 4NTTA 4AW1A 4PMSA 5IQEA 3NYOA 2OSCA 5KKRC 2YIYA 2F7XE 4JG6A 5CANA 4ANNA 4AOTA 3OY1A 3FL4A 1PXMA 2Y0AA 3CR0A 4IADA 5CX9A 4FJVA 3DAKA 4IZ5A 4YBKA 4AT4A 4KAOA 4D4YA 2RSVA 3ZUVA 4M15A 1ZYSA 3KN6A 4AN9A 5HX6A 1TKIA 2VWYA 5CVHA 3VS7A 5JQ5A 3G9NA 1GAGA 3CE3A 3GQLA 5L8LA 4JG7A 1REJA 5DBXA 3QRKA 4I22A 3GCSA 5D9HA 4IVCA 3SHEA 4ANQA 3QTXA 4IDVA 2G15A 4QMNA 2WKMA 4PDYA 5IQIA 4QP4A 4FKOA 5M53A 1V1KA 4FEQA 4A7CA 1FINA 2XKCA 3GC8A 5DT0A 3PRIA 3RAHA 4U40A 3DXNA 4FSRA 3Q4CA 3QD4A 2X9EA 4UB7A 3SRVB 4X3JA 3ZTXA 2YACA 3CIKA 2JAMA 4O0WA 3A2CA 4I21A 4BI0A 4C2WA 4EH2A 2XYUA 4ZY6A 3NFGB 3E63A 4B0GA 1H24A 4UWBA 4C61A 1J91A 3TT0A 2C6LA 1Q3WA 2HZ4A 1VR2A 2X2KA 4O2ZA 4IZAA 2IW6A 4O4DA 3VRYA 1PXJA 3HV5A 5AP3A 3H30A 2JFMA 3RCDA 2Z7LA 3CPCA 5JQ8A 4BKJA 5M55A 2C5OA 2UZUE 3BHHA 4JJRA 2O65A 1KWPA 3VBVA 4RX8A 4O21A 3RM7A 5AR5A 5GIPE 5FBOA 4O4FA 4YZDA 5AWMA 4EH8A 5I9UA 4UWYA 2PVFA 3CD8A 3FZTA 3BQRA 3ORLA 1WBSA 2WO6A 3A8WA 4O0UA 4O0VA 1BL6A 3WF8A 4EQMA 3IW6A 4O6EA 2JBOA 3PXZA 2CCIA 4R77A 3MFTA 4C37A 4LGGA 4YHFA 4MAOA 3RNIA 4ACCA 3AD5A 2ZM1A 3FLZA 3QGWA 3R7VA 3PJ8A 4QMUA 3SD0A 3MN3A 3QRUA 1QMZA 4IB5A 3P5KA 5LMKA 4CD0A 5T6KA 3ZO1A 3UQCA 2Z8CA 4PQNA 3A99A 5ETAA 3ZM4A 5AR2A 1V0PA 2XNGA 3QZFA 5JFSA 3UYSA 4CVAA 2WU7A 2O63A 3OWKA 4IVBA 4IWQA 5HG5A 4G3DA 4ITIA 3PY0A 3EQCA 2OK1A 4I23A 2XK4A 3AQVA 4IW0A 4WIHA 3KXNA 2WTWA 3KCFA 5FXQA 3E8EA 4NCTC 4UX9A 3PXQA 2W9FB 3BRBA 4EK6A 1OIYA 3SG9A 4XG2A 3U6HA 4FF8A 5IUIA 3ZYAA 4PF4A 4XV1A 3WZEA 3FC1X 5HCZA 5IA0A 2VWBA 1Q62A 4FTTA 1A48A 5IKWA 5GZ9A 3T3UA 3Q4TA 3AGLA 4CCUA 5ANEA 4E20A 1VEBA 1XBAA 1M2PA 2YLFA 4MNEB 3FEGA 5FUTA 5HO6A 4ZZOA 2R3IA 2PSQA 3BU6A 5HIDA 4OAUC 2OZAA 4L7FA 4D4VA 3UQGA 2UVXA 4F7NA 3JS2A 3D0EA 2JDRA 3QLFA 5B2KA 1TQMA 3FWQA 2RG5A 5AP7A 2JIIA 3ROYA 4JT3A 5BMSA 5AJQA 2ZFYA 1OECA 3KGAA 4PNIA 5L6PA 2WQOA 3DLZA 4Y72A 2XAOA 4O7ZA 3OEFX 4ZTRA 3PFQA 4L42A 2BR1A 5BVDA 5LXMA 4RLKA 3S00A 4ZZNA 1FMKA 2BZHB 4G16A 4J8MA 4DDIA 4U7ZA 2V7AA 1TFFA 4FSZA 2OU7A 3PJ2A 3VUGA 2JLDA 4AP7A 4MQ2A 5EKNA 4BZDA 4AX8A 1AQ1A 5CNOA 4S33A 4FK3A 5JEBA 4DTAA 2JDOA 4L9IA 4WBOA 5F20A 3W0NA 3BKBA 2YFXA 3AC4A 4H3BA 5DI1A 2W4JA 2WTKC 2XMYA 3TNWA 4YTFA 2JGZA 5A6NA 3BV2A 3PLAE 3TKUA 2HY0A 2E9OA 4WO5A 4RIXA 4YP8A 4FVQA 5BVWA 5C03A 4BZOA 5CEKA 5CLPA 4E4XA 2C0OA 4F1TA 4Y8DA 4CFMA 2B9HA 3E7VA 4O0YA 1W2FA 4GFOA 3A7JA 3W0MA 4BDKA 2RFNA 4JBOA 2XJ0A 2UUEA 4C58A 3COHA 1YWVA 4TT7A 3MS9A 4YHJA 5CEQA 5A4QA 3TXOA 3VF9A 4HW7A 3UMXA 4AA5A 2GQRA 3NSZA 5HVJA 3VAPA 5IA1A 3BYVA 4Q5HA 4QTDA 3P78A 5DR6A 2NPQA 4TL0A 1YWRA 2ITPA 3P08A 4TPTA 3FY2A 3TNHA 2ZJWA 5FM2A 5CVFA 5JK3A 5I3OA 3V04A 4O7NA 1O6LA 2GFCA 2QC6A 5EHOA 3BLRA 3LJ2A 1QL6A 4QMTA 5E91A 2QHMA 4W8EA 4FIEA 5CSVA 4BDDA 4GK4A 4RQKA 3FDNA 1ZMWA 4XG6A 5ANGA 4EUTA 4YZ9A 2OWBA 3MPAA 2WQBA 1OPJA 5FM3A 2PVLA 3KKVA 3TUDA 2V5QA 3I6WA 3ULIA 1M2RA 3BBTB 4BICA 4XP3A 4YMJA 4LV7A 5K0XA 4JBPA 4IC7A 3ZO2A 3CGFA 5IQAA 4CNHA 1ZLTA 3CQWA 3NAXA 1MRYA 2YZAA 3BIZA 4OT6A 1IAJA 3CTHA 5C8MA 5CSWA 3ZEPA 5BVOA 4USEA 3TMOA 2F7EE 4IAKA 3NGAA 3W0PA 1T45A 3QA8A 2IG7A 5J9ZA 4JXFA 3A61A 2ONLA 2R3JA 3FAAA 3R9RA 3BYMA 2VTIA 1Q24A 3EQPA 1Q4LA 2P55A 2X7FA 2WTIA 4RPVA 4RVKA 4V05A 2ETMA 2IZRA 3BLQA 4U8ZA 3QRJA 2C3JA 3BBWA 4ORKA 2OJGA 3LXPA 4DHZA 4CRSA 3TV6A 4FEXA 3LJ0A 1YHVA 3EIDA 3QQLA 2W1HA 3MSSA 4WG3A 4AZTA 3PDTA 3O8TA 3ROCA 2OO8X 5EM5A 3G6GA 3NNXA 4C35A 4O7RA 4PTGA 4C4FA 4FTAA 4RSSA 2G1TA 3QHWA 3VNTA 5BX0A 2C6DA 5AV1A 4A9UA 5IQFA 4AN2A 2CLXA 1PYXA 4BY9E 2QNJA 4XLIA 3VS2A 5LMKC 3LE6A 2WMTA 3TZ9A 1WVYA 3Q9YA 4M7IA 4TW9A 4RX5A 3R1YA 3AKJA 3P7BA 3AMYA 4N70A 3FBVA 4QP2A 4IAZA 5IDNA 4EJNA 3HYHA 5J5SA 4JIAA 3QZGA 4A9SA 2WD1A 2OKRA 5KZIA 4HPTE 3RHXA 3BLHA 4YPDA 5JFVA 2QOHA 3DZQA 3LXLA 4UMRA 2PULA 4C2VA 4Y46A 4FYOA 2J7TA 2GCDA 4HYIA 2YCSA 3NIEA 3QFVA 5HD7A 2WEIA 3NLBA 3CC6A 3CXWA 4KIQA 3DBEA 5LOHA 3O5AA 4ZOGA 2FSTX 4AZSA 4C33A 3MPMA 1W0XC 3KMWA 5AP5A 3M42A 2XK3A 4L3PA 5E8XA 2P2HA 3ZEWA 4EWHA 3SV0A 3C1XA 5EK7A 3V6SA 3FI8A 5AV2A 3PZHA 4L00A 4XV9A 3R8PA 3LVPA 3UIUA 2IJMA 2VX1A 4YC6A 3LCSA 4AE6A 3QRIA 3DNDA 3R8UA 2X7GA 4O4EA 4KKGA 3DFCB 3P23A 3LFSA 2B53A 1WAKA 1DI8A 3QQUA 3EYHA 2YABA 4MBJA 4UV0A 4YZNA 3QX4A 4EHZA 1QPJA 5E8TA 3W0RA 3GENA 4NM5A 2C69A 2C5XA 5E1SA 2BRHA 4EBVA 3VQUA 5E8ZA 3Q6UA 1PXPA 2A0CX 2RGPA 3KXZA 5TT7A 3U6JA 5FEEA 4EHVA 4PMPA 4DFUA 3BHVA 4CMUA 5AUVA 5CT0A 3OCBA 3FQEA 2V55A 3R30A 3SGCA 4NM0A 5CU2A 2WZJA 1F5QA 4XG9A 1Z57A 4FRFA 4GG5A 4LI5A 3ORKA 4DGOA 1WVXA 4UALA 4CXAA 4XNEA 4KBKA 1R39A 1IRKA 2R9SA 2FO0A 3FXWA 3OROA 2XIYA 2V0DA 4YC8A 2Z60A 4S30A 3R21A 2VGPA 4RWJA 4GUBA 1XHAA 3VUHA 3WIKA 5I5ZA 3U9NA 3QTIA 4DE4A 2J6MA 4TWOA 4W8DA 3HA6A 2QOBA 4J99A 4M84A 4BR3A 4XP0A 3TIYA 4M97A 1UKHA 2FA2A 4WNKA 5CZHA 3O2MA 4BGHA 2HXQA 4TYGA 3TEIA 3KMMA 3AD4A 2C5NA 4HNFA 4HVDA 2OICA 3R7EA 4D2PA 2YM8A 2AEGA 3A7GA 3ODYX 2ZV2A 4QOXA 5BYZA 3I1AA 2JBPA 4ONAA 5HLWA 1V0BA 2OIBA 2ZAZA 2PZYA 4D1ZA 4FKSA 3ENMA 4I6HA 3HA8A 2HWPA 2PTKA 4IANA 5C4KA 4CZTA 3EN6A 3F5UA 2ZDTA 5AFVA 3U4UA 2WIHA 3WF6A 4KIOA 5D7AA 4BYJA 3P7AA 4AXDA 3Q3BA 3DY7A 1XO2B 2A2AA 5HO8A 4B6LA 4RIWA 4ZTSA 5FEQA 4K77A 3JY9A 4I5CA 3DB8A 4PNKA 5JZNA 3C4CA 5DR2A 3R8VA 4IX3A 2OG8A 5IH5A 2WQNA 3SRVA 4AXAA 1H28A 2PVKA 4ZMEA 4PV0A 1U46A 4AGUA 4FKTA 3GU7A 4XYFA 4EYJA 3R9HA 4GU6A 5ETIA 3ZRMA 4FKLA 3NVMB 5HCYA 5LVLA 3ZLXA 2ONLC 2JKMA 3QLGA 4FV6A 4USDA 5HBEA 1OI9A 4DFNA