1UNGA

Structural mechanism for the inhibition of cdk5-p25 by roscovitine, aloisine and indirubin.
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
292
structure length
288
Chain Sequence
MQKYEKLEKIYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLANFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL DIVISION PROTEIN KINASE 5
publication title Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 81
structure length 288
sequence length 292
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2003-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 1ungA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 1ungA01
5EHOA 4O7NA 1FMKA 2YCRA 3OROA 4G1WA 3R9DA 1Q8ZA 5BVOA 4CEGA 5I9YA 4C3PA 2ERKA 1OPKA 5HLNA 5L3AA 4K1BA 1WVWA 5JGAA 3ZZEA 5DWRA 3R63A 1XR1A 4I5CA 2PUIA 4A9YA 3BEAA 4EQUA 3GU7A 1KOBA 1PMVA 3WZEA 4IAZA 4ACCA 4NJ3A 2DWBA 4OBPA 5ANEA 4ZTLA 4TWCA 5J5TA 5J1WA 5LMBA 2XKDA 4G5PA 4O0SA 1FPUA 3MFUA 4I0SA 4IAKA 2ESMA 3ZEPA 2UW5A 2OWBA 4UXQA 4YZCA 3R7EA 1JQHA 3ZEWA 1OL1A 4LYNA 2W1EA 1OECA 4M69A 3P79A 2CDZA 3RP9A 2XJ2A 5E8TA 5B2LA 4QMZA 4O84A 5ETCA 2CHLA 2W4JA 3ZRLA 4HGLA 5IISA 3D7TA 4J97A 3ATSA 4C58A 3CQUA 3P7AA 4DFNA 3NVKI 4DN5A 4F9WA 3NYXA 3ORXA 3JXWA 2CGUA 2UZUE 4CGAA 5IA1A 4DTAA 1IR3A 3BIZA 3UVPA 3GOKA 3HMPA 4FOCA 2WHBA 3RCJA 2OXDA 2I6LA 4M12A 3H9OA 4Y95A 2Y6OA 3E62A 5AP1A 4MQ1A 3NSZA 4YNOA 1W82A 4NM7A 3I6WA 1YI3A 5ETIA 1XH4A 5AX3A 3RHKA 4O6LA 5J9LA 4RVKA 3RCDA 3OUNB 4CXAA 2CNQA 3CY3A 5DPVA 5M4IA 4G17A 3MI9A 1ZAOA 4DGGA 2P4IA 3HP5A 5KX8A 3QQUA 4YHJA 4HGEA 4FUXA 4FV0A 4J8NA 3DK7A 5E90A 5FP5A 2W7XA 2V22A 1YDRE 2NO3A 3UE4A 2JKKA 4NTSA 1E1XA 4R77A 1UU3A 2ITZA 4G3EA 4WOVA 4EK6A 2QONA 5KUPA 4FKGA 4JJRA 2A1AB 3QLFA 4FSWA 1W98A 4WHZA 1H1WA 1SNUA 3L9PA 3QXPA 4IBMA 3FPQA 3QZFA 5J79A 5AUWA 3SG8A 3EFJA 2BAQA 3PPKA 3VF9A 2C3LA 5EM5A 4RGJA 2CKOA 2PVRA 2CJMA 3D15A 5AR5A 2BILB 2Q0BA 1PYXA 3ET7A 4O83A 3QX4A 4FIIA 2G2IA 3BU5A 2WMXA 3HECA 4IZYA 1PXLA 3D5XA 4EYMA 5D41A 2ZM4A 4ZLOA 2RIOA 4NJDA 2YJSA 5TT7A 4XHKB 1YQJA 3S95A 5CT7A 5H9BA 4TXCA 3EN7A 2ZMDA 4FZ7A 1M2QA 4P5QA 3SD0A 4FSNA 4F63A 4EHVA 4D4YA 3OEZA 1R1WA 1KE6A 3TIZA 3UNZA 2YWPA 2LAVA 1YI6A 2IVVA 2YWVA 4CFFA 4I23A 5AIRA 5CY3A 3DAJA 3DJ5A 3BHTA 3CLYA 1DM2A 1DAWA 1J7IA 2R3JA 2YISA 5J7BA 5I0BA 2WU7A 4J7BA 1FINA 1YVJA 3Q5ZA 4C59A 3U54A 4FZDB 4XV1A 3RK5A 2X9FA 5KBQA 5GJGA 5L6OA 1YDSE 5G1XA 3C0HA 3TCPA 4A4OA 3KRWA 3EOCA 4MBJA 3OHTA 5K0KA 2OK1A 4AOIA 3N4VA 3ORMA 4FC0A 4OTPA 5FTQA 1U5QA 4W4VA 4RZWA 2ZB0A 4UV0A 5LMKC 1F5QA 1Y57A 2PE0A 2Y7JA 4FIHA 3KCKA 4U8ZA 3RZBA 2FA2A 3VRYA 3PE2A 3FZ1A 2UW0A 3HV4A 5IEVA 4DH3A 3HL7A 4FKIA 4HCUA 3MH2A 4YJVA 2QODA 5CU3A 4MTAA 3QUEA 2ZDTA 3G5DA 3SX9A 1NT2A 1OIYA 2WQBA 3NAXA 3EZVA 4RFYA 5IQEA 3DNEA 3MY5A 2VO3A 3MH3A 4QTDA 5C26A 2WTVA 3NW6A 2R3FA 3P7BA 4MKCA 5KMKA 2YITA 3TKIA 4KBKA 2W1DA 5K5XA 4XUFA 5DGZA 5T3QA 3R7UA 1CMKE 3PJCA 3AC4A 3W2SA 2W5HA 3A4PA 2JAVA 3ZBXA 4MK0A 1W83A 2GNFA 3E5AA 4ZSLA 3UIBA 4ANOA 4DBXA 4FSQA 4FIFA 5EFQA 4ERWA 3I81A 4BN1A 2OG8A 5C01A 2W05A 4DCAA 3VUGA 2GDOA 3BLHA 3RM6A 4F1MA 3L8PA 4UMRA 4NW5A 4H05A 4QMPA 4EC9A 3HUBA 3VBYA 4RVLA 4PL5A 2H9VA 5C4KA 4II5A 3MSSA 4DEIA 4BCFA 1OUYA 4G31A 1JNKA 4C36A 3BI6A 2VTHA 3MA6A 3PPZA 1OL5A 3LW0A 2OH0E 3F5PA 1V1KA 4UMQA 3AMBA 4HNIA 5DE2A 4AA0A 4U6RA 1B6CB 4P7EA 4RX5A 3JVSA 1JKLA 2GQGA 3OFMA 4EORA 5JFSA 2B0QA 1XBAA 5JRQA 4ZAUA 1H01A 2VAGA 4TWNA 3FAAA 2B1PA 3S1HA 1ND4A 1LPUA 1VZOA 3Q2JA 3QWJA 5DBXA 5DNRA 3QQGA 5L4QA 2C6DA 2OZOA 4NEUA 3UVQA 3EQRA 2C0TA 5EOLA 3NYOA 3QHWA 2X39A 3AD4A 4GSBA 4LRJA 4E6CA 4V0GA 2YHVA 4I4EA 4ZSGA 3Q9ZA 5LMKA 3BCEA 2SRCA 4UZDA 5B2MA 3GOPA 5EYCA 4J98A 4FT0A 2YM4A 3F5GA 3L9MA 1U54B 4NM3A 3H4JA 3PWYA 5BYZA 3ZS5A 4DEBA 5EK7A 4YURA 1KV1A 4AZEA 4O7LA 2PMIA 4DGLC 3QQLA 4MCVA 5C8NA 3PXQA 4YJSA 3UO6A 5ANDA 4AZVA 2JEDA 2PZPA 4NFNA 3TEIA 2R3LA 3DCVA 3O7LD 5CEMA 5IUHA 4O22A 3IGOA 3V5PA 4WSYA 1YOLA 2BROA 4C57A 3ANRA 4F1OA 1F0QA 1YXTA 3OBGA 4IX5A 3ANQA 4IM3A 4JDKA 1YXUA 3QAME 4P2KA 4RSSA 4X3FC 4AZWA 2XCHA 3RPSA 3CCNA 3BEGA 5CLPA 2VV9A 4BTMA 5AUUA 3TV4A 4DEHA 4USDA 4GT3A 4E5BA 4AF3A 4E7WA 2X8IA 4O38A 3LOKA 2ITQA 3O8TA 4BDEA 1I44A 4M67A 2C5YA 2QCSA 4X2FA 5DFPA 1YWRA 5LARA 4QPSA 5JT2A 2B55A 4S32A 5J9YA 4IMYA 4LUDA 4FTCA 4JQEA 5F4NA 3LMHA 3QCQA 3EJ1A 2CGXA 5C9CA 1PXJA 1JSVA 4C3FA 4E6DA 1OBGA 5FTOA 4NW6A 5HU9A 2B9IA 2WIPA 5DYJA 4JRVA 1M7QA 4TYIA 4W4YA 3P9JA 4BFMA 3UOJA 1YHVA 4OW8A 4ALWA 2W5AA 2CMWA 3KULA 4ZSEA 5IU2A 4ASZA 1SM2A 2R9SA 2V5QA 3VC4A 4AZFA 2XRUA 5I9XA 5E4HA 2PVYA 3WOWA 1Q8UA 5HX8A 3MFRA 5DT4A 4M97A 3A60A 5AUYA 1XWSA 5AUTA 3JYAA 2IO6A 3Q60A 3FXWA 5LOHA 3UOKA 3DTWA 5CF6A 2R3IA 2JBOA 4QP9A 4PPAA 3IOPA 3P78A 3QCSA 4FNYA 3R7VA 3WF6A 3C4FA 5CEKA 3DV3A 3O17A 3ORTA 4QTCA 3FKNA 2W9FB 1DI8A 4DC2A 4LOQA 4X3FA 2YA9A 3IS5A 5E7RA 5A4EA 4FVQA 1W8CA 2P33A 2R0IA 3H9FA 2ZB1A 4FIJA 4FK6A 4BDHA 4I6HA 5KNJA 4S33A 4TNDA 4X3FB 3SC1A 3Q6WA 3WF5A 4CVAA 3OCGA 3W16A 4BICA 3KQ7A 1ZZLA 4L42A 4TYGA 1R39A 4PMPA 3BWJA 3SOCA 2J5FA 3FYJX 4M14A 4ZS4A 4F08A 2J0KA 3PY0A 5C1QB 4FKSA 4O7WA 2C3JA 2I0YA 4PDOA 2B7AA 3UIUA 4O2ZA 3KCFA 2WEVA 3I0QA 4XS2A 5L2WA 2QOBA 2V7AA 3PP0A 3R7YA 3KF4A 5H2UA 4FOBA 4D2VA 4MYGA 2XK9A 4J99A 3EYHA 2O8YA 4M68A 4K2RA 5DR9A 4ACDA 4AX8A 2ZM3A 5LVPA 3CD8A 3GI3A 4DEAA 2VNWA 5D9HA 1NY3A 3ZHPC 3TUBA 3TZ7A 3UZPA 1J3HA 4CMTA 5T68A 2XIZA 5EQEA 1OZ1A 4CZYB 5CF5A 4TYJA 3KEXA 4GK2A 5FBNC 1SVEA 4R1VA 4E4NA 4EWQA 5JH6A 3QD0A 4DE4A 2W4OA 3KRRA 1Q3WA 2PWLA 3DAKA 4CZUA 4GVAA 4XG7A 3WI6A 3UYSA 4D0XA 3A7JA 3FMKA 4E73A 4FV5A 3HEGA 1R78A 3HVCA 3UP2A 3KVWA 2XIKA 5I3RA 3Q9XA 5A14A 3K5UA 4EOSA 4BYIA 1OITA 3KXZA 4QD6A 3DBQA 3EL7A 5A3XA 4GUEA 4YLKA 3JY0A 3VS3A 4FEWA 5DA3A 4OTIA 1Z9XA 2EXMA 4DLIA 2DQ7X 2BRBA 4N6YA 4ZTSA 3U6IA 3C4ZA 4IQ6A 4EZ5A 3GU5A 1YXSA 4BC6A 3CEKA 3H0YA 5A4LA 2HZ4A 1OIRA 2X2LA 4OBOA 3RBWA 2XBJA 2WKMA 5L8LA 3EL8A 4EH5A 1Q3DA 4G5JA 1REJA 3O71A 3W2PA 2WFYA 4QMWA 4O81A 2QG5A 3IDPA 4B8LA 2J6MA 4QTAA 3RWPA 4FG7A 4PMSA 1BI7A 2RSVA 5CVFA 4BRXA 2XUUA 2YACA 2GS7A 3NYVA 4QYGA 3COIA 4BKYA 2OKRA 3QXOA 4ZLYA 2XBAA 2VO0A 4D2SA 3AGLA 2GMXA 4EH4A 2YDJA 4FV9A 5GIOE 3OVVA 2O3PA 4EOMA 4E20A 5HIDA 2XNEA 1WBVA 2BDFA 2VTJA 5AV2A 1LEZA 2ITUA 4RWKA 1ZLTA 5IQCA 4WNPA 1WBNA 4XG2A 4WRSA 4Y8DA 4ZTRA 4PL4A 4JQ8A 1P4FA 4CLJA 3NX8A 1R0PA 4O0VA 5FTGA 4RIXB 3WF9A 5EQYA 1ERKA 3Q4UA 4Q2AA 4YZ9A 3SXRA 5E8ZA 4JG6A 4RMZA 3MYGA 3R22A 4TTHB 2H6DA 5FXRA 3E8DA 2DUVA 4GIHA 3QYZA 4BBEA 1H24A 1V0PA 2YZAA 4KB8A 4QNAA 3GCPA 3UO4A 1OGUA 2VD5A 3TNHA 4QMQA 5CNNA 2PE2A 4A06A 4JX7A 2OF2A 3R7OA 2GQRA 4EH3A 5LVLA 4AOJA 3TNQB 4G16A 3LM5A 4PWNA 5FEQA 5JFWA 1W7HA 2YIQA 3GC8A 1H00A 2XVDA 5FUTA 4APPA 3GB2A 4NKAA 3NUPA 4BGGA 3FZTA 4FZFB 4YR8A 3ERKA 3BBWA 1Q8YA 3LFCA 3NUSA 4IE9A 2H96A 3PIZA 4GKHA 4CG8A 3NIEA 5HIEA 4U97A 3R9RA 3HV5A 5HU3A 3I60A 3OS3A 2FB8A 2J0MB 3JVRA 3QLGA 1M14A 2W1FA 2J4ZA 4GT4A 4C4IA 5HLPA 3IW8A 4L46A 4HVDA 5CQUA 3C51A 3U4UA 4RQVA 5KBRA 5A6NA 2ZOQA 4LV8A 2ZV7A 5B0XA 4AT5A 5CZHA 1JSTA 2NP8A 1GZOA 2EWAA 5AJQA 4H36A 4MWHA 5JQ8A 1IEPA 1JWHA 2F4JA 4EHEA 4KKEA 4I93A 4FNWA 4WSQA 4PDPA 4YTHA 4K33A 3AMYA 5GJFA 4ONAA 3QRKA 4ASXA 5K5NA 1IA9A 3T8OA 2XNOA 4GMYA 2HXQA 3R8VA 5BMMA 3L1SA 3KRXA 2PVFA 3QHRA 3NVMB 4DT8A 1STCE 2CN8A 4HCVA 1JKKA 4C4JA 5EDQA 4M84A 3CJGA 3NS9A 4GIIA 5DR2A 3H30A 2Q83A 2GTMA 3OMVA 4Y5QA 4WG4A 3LVPA 3EB0A 3LCKA 4EKKA 3R9NA 4DGMA 1QPCA 4U0IA 2BIKB 4YC3A 5ANIA 4ZTNA 1H28A 3BBTB 3CGOA 1J91A 4YJUA 4EKLA 5HICA 4PPCA 5CWZA 4RQKA 4R78A 5E8XA 2PU8A 3L9NA 4NL0A 1U4DA 4IB1A 5HO8A 3NGAA 1GOLA 5FEEA 3VUKA 3ZM9A 2I0VA 3ZU7A 4O0RA 1CM8A 4IWQA 4XRJA 3V5JA 4QTBA 5HIBA 5IKWA 2BIYA 2C3KA 3LFFA 4FR4A 4IADA 5HQ0A 3W1FA 4DITA 2P0CA 2R4BA 3WF7A 4AN3A 2O5KA 3F2NA 5EI8A 4C7TA 3AC2A 4JQ7A 3E92A 2W5BA 4FKUA 4BTJA 3K2LA 4XH6A 4CFUA 4BDAA 3F88A 4JR7A 1OB3A 2J0IA 4EOOA 4CFMA 4JX3A 4KIKB 2XNGA 5E8YA 3CSVA 5AFVA 4BKJA 5I4NA 3MJ2A 5E92A 4XP3A 3Q5IA 4K11A 1Q97A 2QO9A 3V8SA 3FXXA 3QTIA 2X8DA 4O2PA 3RM7A 4TY1A 3WILA 2IW9A 4WBBB 2C6TA 3DDPA 3CC6A 1HOWA 2QLQA 2UW8A 4L7SA 5D11A 3D0EA 5EYMA 3DA6A 2Z7SA 4L44A 3R83A 4ARKA 2HELA 4AN9A 4G6LA 2Z60A 2Y0AA 5IG1A 3JPVA 3PLSA 5FQDC 2RFEA 2XKEA 3L8SA 1XHAA 3UPZA 4Y46A 4BCQA 2VTTA 4OTFA 1Q62A 4KKHA 5A4QA 1PXOA 4MBIA 4IAYA 5CU0A 5L2SA 2YDKA 5AWMA 4F99A 1JPAA 4D58A 1PJKA 3TV7A 1ZARA 5A4CA 4MQ2A 2FSTX 4MXXA 4XG8A 2ZV2A 4X2NA 3VRZA 5DT0A 5F95A 4BWXA 4A9SA 1UWJA 4E4XA 4FUYA 5CVGA 3MBLA 5EH0A 2RFSA 2HYYA 4Y5HA 4HZRA 4BIEA 2Z02A 3ZBFA 4BL1A 3Q6UA 4YJRA 2PZ5A 2XKCA 4LL0A 3UG2A 3OY3A 4BDGA 3U6HA 4XLVA 4PTGA 2C6KA 3FMMA 2UVZA 3KF7A 5CENA 4AW0A 2PVKA 5HCZA 2XF0A 3UQGA 4E6AA 4RRVA 4I0RA 2W9ZB 4TYHB 4HVSA 2XIYA 2XZSA 2RFDA 4O82A 1ZRZA 2PYWA 3HV7A 3PVGA 4W9XA 2PY3A 2FVDA 3E8EA 5BPYA 3F3WA 3ZO4A 5EKNA 2HZNA 4IZ7A 3A4OX 2BDWA 2Y8OA 4PY1A 5IA4A 4N4SA 5CAPA 4XBUA 5EHLA 2BRGA 4QP3A 4YO4A 3IW7A 4NU1A 4X2JA 1M17A 2J50A 4WUAA 5HE3A 2C1AA 4JVGA 1G8AA 4XX9A 4TWPA 3OWJA 5IEXA 4FA2A 4MNFA 4AQCA 4L53A 4YBJA 3UGCA 3TUCA 2BHHA 3QBNA 5CSXA 3PXYA 4RJ5A 4BDFA 3I1AA 3H3CA 3HRFA 3KC3A 3EIDA 3TZMA 3F7WA 2PK9A 3P0MA 3VBXA 5LMAA 3MW1A 4U3YA 5KZIA 5CASA 4GFOA 4DG2E 3CE3A 4JG8A 5M07A 5AM7A 2P2HA 2CGVA 2VTSA 3CTQA 2UW3A 1L8TA 4IX3A 4RWJA 1YI4A 3TTJA 5BYYA 4R3RA 5DVRA 2OICA 3W8LA 4DHFA 2IZTA 2F49A 4BIBA 2F7XE 2JDOA 2ERZE 3E8NA 3FLQA 3QYWA 5HCYA 5IUIA 3SRVB 2BUJA 5JN2A 5IH6A 5HTCA 3DBDA 5GIPE 3TIYA 4ENXA 4FEQA 2GHMA 3OY1A 2QC6A 5T6KA 5FP6A 3EN9A 5K3YA 2VTIA 2GNGA 3QQKA 5JZNA 5IQBA 1KE9A 3HMNA 4FVPA 3UC4A 1T45A 3ZSGA 3ZLSA 4AN2A 4L6QA 5CXHA 4I92A 3WE4A 3F2AA 3NZ0A 4IWDA 4RFZA 3PY3A 3SAYA 2NNWB 3MDYA 2QOKA 2W1GA 3FQSA 3FSFA 4AE6A 5HI2A 2QU5A 1OBDA 3PVWA 5J7HA 4O21A 3Q9YA 3QKMA 1YWNA 3MS9A 1U5RA 3F6XA 3KXNA 3O2MA 4HGTA 4ZY5A 1LUFA 4F65A 2QOFA 4CQGA 5LWMA 3PDTA 4E26A 4IH8A 2X1NA 3HZTA 3IKAA 5AMNA 3UBDA 4D2RA 4FG9A 1QMZA 5EG3A 5CAUA 4E5WA 2HAKA 3ZSIA 3QRTA 1GNGA 1AQ1A 4L52A 5AP3A 3PXRA 1YKRA 2FUMA 4FTRA 4PTCA 3W33A 3BE2A 3MVJA 5EYDA 4EOQA 2W1HA 4AFJA 5AUVA 4ZMEA 5AR7A 4L68A 3F3TA 1U59A 2EXEA 2BCJA 3DK3A 4CYIA 3SW7A 5GINE 4MD8E 5C8KA 2B9HA 5IMXA 2XK4A 3VUMA 5KMOA 2VWXA 3PA3A 4I0TA 4DFLA 5C27A 1BUHA 5I9UA 5D12A 3MY1A 4Y83A 4JDHA 1SZMA 3PVBA 3FMJA 4B7TA 4FEUA 4IJ9A 2RF9A 4P90A 2ITPA 3RAWA 5IQAA 3ALNA 4HVHA 3R2YA 2XNPA 4IC8A 2VRXA 3IQ7A 3E3BX 4F70A 3VS2A 1BX6A 1NA7A 3PZHA 2GFCA 4OLIA 4ZIMA 3UNJA 4FT7A 4X21A 4M66A 3HRCA 5CU6A 5ICPA 4JS8A 2W1CA 1UV5A 2IZUA 4AG8A 3LFQA 4NM0A 2YAAA 4FL1A 4M8TA 2R64A 2F2UA 3NYNA 4F0FA 3FMLA 4C34A 3SVVA 2DYLA 4X2KA 3CQWA 2C1BA 1PKGA 3TJDA 4MXYA 5KZ0A 3A99A 4MNEA 3HA6A 4EWHA 4QMYA 1H27A 4GFMA 1VJYA 4F7SA 4IVBA 4OUCA 2O63A 4IEBA 4AA4A 4Z7GA 3P1AA 3B2TA 4ITIA 4MNEB 1M2PA 1PXPA 1BLXA 2XP2A 3K5VA 4QO9A 5DRBA 3MPAA 2A2AA 3DKOA 4DAWA 2ONLC 4Z16A 4H3QA 3KMMA 3UJGA 1MQBA 1UA2A 4C37A 4U5JA 1MQ4A 3AT4A 1H1PA 4FTUA 3IW4A 3QTZA 1TQMA 4EK3A 4F6WA 3HLLA 4J96A 2BVAA 1RQQA 4YHFA 5EM6A 1CKIA 5HGIA 3UP7A 2X81A 2QR8A 4F9YA 3ACKA 3F82A 4GJ2A 5CSHA 3PPJA 5JFXA 5IQHA 3CD3A 3U51A 4CD0A 1F3MC 4ZS0A 4MF0A 5HVJA 3TL8A 5K9IA 1KWPA 2B4SB 2XK7A 3DBFA 3HAMA 5BVEA 3C13A 3PXFA 5AR8A 3DXPA 4PDSA 1ZOGA 2B52A 2REIA 5CU4A 4ZP5A 2QOIA 1Y8YA 2ZV9A 1JSUA 2A19B 4V01A 3NNWA 2X7OA 4F1TA 4RC4A 3VWAA 4DH5A 4YP8A 3VBVA 2G1TA 3RKBA 4IB3A 5HHWA 4DTKA 2QNJA 1P2AA 2HW7A 3NWWA 4IDTA 4JT3A 5CAQA 5AIKA 1RW8A 2B53A 5KO1A 4D4SA 4OAUC 3PJ1A 3QALE 3VW6A 4QMNA 5HO6A 5TKDA 1WBOA 2I40A 3DJ6A 1WAKA 1XH7A 2YIWA 2FO0A 2QKWB 3G51A 2PULA 3D9VA 2PZRA 4GU9A 4NZWB 3VUDA 5IA0A 2EVAA 2R3GA 4Q5HA 3EQPA 4UX9A 3B2WA 3DBCA 3TWJA 4N6ZA 2JKQA 4XLIA 5HVKA 5EKOA 4FSMA 1V0BA 4C8BA 2OIDA 3DGKA 5ITAA 3UQCA 2J5EA 2OXYA 5AUXA 1VYWA 4QMXA 3FLSA 3GCVA 4GL9A 5M56A 3TDVA 4M7IA 3GFWA 4PMMA 3OOGA 4DG3E 4CKJA 4QP7A 1OPJA 3PRFA 2ONLA 4WIHA 2WTCA 5DT3A 1Q41A 3POOA 4ZMFA 3FZOA 3ZC5A 4BDCA 3GCUA 4U44A 3BWFA 3GUBA 3OWPA 3KK8A 1K3AA 3KB7A 5HORA 4EZ3A 2WNTA 3MVHA 4HYUA 5HBHA 5F94A 3CR0A 3NCGA 4FIGA 5BYLA 3IDCA 3A2CA 5AUZA 5GZAA 2YABA 2A27A 2IVSA 4F7JA 4S30A 4AW2A 4Z3VA 3QTXA 4PF4A 2LGCA 4F7NA 5HTBA 5HOAA 3QX2A 3UVRA 3C4XA 3LPBA 2ITVA 2OGVA 2I1MA 3UC3A 2OF4A 4UBAA 4S31A 3LFEA 4A4XA 5AAEA 4EUTA 5IH5A 4FTNA 4RPVA 1APME 4MAOA 5TE0A 1A48A 2WOUA 3C5IA 4AW1A 3CS9A 3VUIA 5ANGA 1OI9A 1XH5A 2BZJA 4F9BA 4DF3A 4GJ3A 4MVFA 1U54A 3DLZA 5CEIA 3DJ7A 3OXZA 5HNIX 3QQHA 3N9XA 4O0UA 4RA5A 3Q04A 2WELA 5IDPA 4BR3A 1B39A 4RWLA 4ZY4A 1MRUA 1YHWA 2JIUA 3ZFXA 4QMMA 3KA0A 4EEVA 4IB0A 1L3RE 3MIAA 4BI1A 3VN9A 3FI3A 2VO6A 4XYFA 5M55A 4KRDA 3LCSA 4I3ZA 4JIAA 4FKPA 4QP8A 3I7CA 4O7ZA 3FV8A 5CANA 3LFAA 1BI8A 4BYJA 4E93A 3WIKA 3OXTA 3SKCA 3VULA 5L8KA 2Y4PA 4HZSA 4EYJA 2E9OA 2QHNA 1PXNA 2UZDA 3C0GA 3HDNA 3NPCA 3PIYA 3NEWA 1O6LA 3ORKA 3MGYA 4BBFA 3FJQE 4LGGA 4YLJA 4I6QA 3HDMA 3WZKA 2OH4A 4CFVA 2G9XA 2ITOA 3WYXA 1BL6A 3Q52A 4FTQA 2QO2A 3BX5A 2JD5A 3UMXA 1S9JA 5I3OA 2QR7A 4EBWA 4XG6A 1Y91A 3QTSA 2C6IA 4IWOA 5ETFA 4JBQA 4MD9E 2ZDUA 4YU2A 1IAHA 4FGBA 5L8JA 2OIBA 4C38A 3RAKA 1P5EA 1Y6AA 4QP1A 3VS7A 3G15A 2UZLA 1PHKA 4XG3A 4FZAB 4Q9ZA 2QLUA 1WMKA 4LOPA 3MVLA 4BGHA 4DH1A 2X7FA 4TRLA 5ANJA 1XBCA 3PA4A 3H10A 4Y72A 4D5HA 3F9NA 5CSWA 3OXIA 3GGFA 4KIQA 5CS6A 2CLXA 4AS0A 4O91A 2J0JA 4EQMA 4CT1A 3HYHA 3VS1A 4XV2A 5M08A 5IPJA 3IW6A 3EQGA 3F61A 3HGKA 4RT7A 2ITYA 3F7ZA 2O2UA 3C7QA 2QOCA 1JVPP 5AA8A 3HMIA 5IMEA 2PMNX 5C8MA 2QI8A 3OG7A 3V3VA 4C3RA 4CKIA 3R1NA 3A7GA 4CKRA 3BYMA 4TNBA 5L6PA 1AD5A 4CMUA 5BNJA 3G9NA 4F9CA 1GZ8A 3Q96A 4YJPA 5CAOA 5KMIA 2OJ9A 2O0UA 3GENA 3LQ3A 3MH1A 4FEXA 3FKLA 2BFXA 1OKZA 4JR3A 3BYSA 4TWOA 1ZMWA 4U3ZA 4XRLA 3O96A 5GNKA 2XMYA 2F7ZE 2WMVA 2UZWE 4UMTA 4U40A 5CZIA 4KNBA 2VTMA 5BMSA 5E8UA 3QA0A 3VUHA 3TN8A 4TL0A 4FV2A 3JUHA 3OTVA 3UOHA 3VVHA 4D55A 3VW8A 3QA8A 1ZYJA 1W0XC 2VTNA 2H8HA 4EOKA 4R5SA 3LXLA 3OBJA 1NVSA 2XNBA 4MF1A 3COKA 4BCNA 2HY81 3R2BA 2QOQA 5BX0A 4BWPA 2YLFA 3JS2A 4RVMA 5HD7A 2W1IA 1G8SA 2PMOX 4ORKA 4EH8A 2V55A 3QL8A 1P4OA 4JBOA 5CXZA 3EFKA 5EYKA 3VO3A 2VWWA 3GXLA 2GSFA 5AR4A 3UG1A 4NTTA 3KXGA 3FL4A 5L2TA 4NK9A 2XJ1A 2EUFB 3O8UA 3GC7A 2CCHA 2J2IB 2IZSA 2WMWA 4IM0A 4GU6A 4NM5A 3ZUUA 2IJMA 2G01A 2ZAZA 3LHJA 4R7HA 3VHEA 4CFXA 3OWKA 4IHPA 3EZRA 5HVYA 2R3RA 2QKRA 4G3GA 3NW5A 3A7HA 4H58A 4ANLA 3MVMA 3KK9A 2JDSA 2R3KA 2WQOA 3I4BA 3RMFA 4FKOA 5BVNA 4L3LA 2GCDA 3LMGA 3PSCA 1RE8A 3DBEA 4GVJA 5K4JA 5AP7A 2C68A 4CTCA 5D1JA 1QPEA 2XEZA 1JOWB 3KN6A 1FGKA 2NRUA 2ETRA 4EK5A 5AR3A 4CCUA 1H25A 4HCTA 4O7RA 4FL3A 3NUXA 3MJ1A 3ROYA 1RDQE 2C6EA 4FSZA 2PHKA 2XK6A 2XS0A 3ZLXA 3FUPA 3RALA 4ZJVA 5LXMA 1TKIA 3ORLA 4I24A 2BAJA 4L00A 1X8BA 4EJ7A 5ACBC 3QC4A 3FZRA 2EB2A 3OCSA 4FV7A 2OI4X 4AXAA 2G2HA 3DAEA 3COMA 4Z9LA 2HXLA 3R21A 2Z2WA 4XEYA 4QYHA 5CF4A 4EJNA 3BKBA 3LQ8A 4G9RA 4G6OA 2NPQA 3QFVA 1KV2A 4FYOA 4WNKA 4XG9A 2WMTA 2YN8A 3EYGA 3W2QA 3ZUVA 2XRWA 3UZRA 5H8EA 3RK7A 4FE2A 2A4LA 1VR2A 3NMUF 1FOTA 4I20A 3QD4A 3SG9A 5CQWA 4FKRA 2YM7A 3EN6A 3TJCA 4YSJA 3V8WA 3TNIA 4LQMA 2VGOA 1LEWA 2IZRA 5GZ9A 4R3CA 4TZRA 4FTAA 5CX9A 4NCTC 2OBJA 2WMAA 3FMNA 4KABA 4EH6A 4UY9A 4AA5A 3TZ9A 3A8XA 5CI6A 4EK4A 5KKRC 3ZO2A 3PWDA 4D9UA 3NUAA 4ZJJA 3QRIA 4ENYA 3OUKA 2OIQA 4RIXA 4HOKA 2ETKA 2HENA 3DDQA 2J0LA 3HUCA 3R28A 3ITZA 3DQXA 3QKLA 4LL5A 4C0TA 4CSVA 4E3CA 3BGQA 4UWCA 4A4LA 4FKTA 2E9UA 2UVXA 3VNTA 2OJIA 5HBEA 1G5SA 4TKSA 3ZXTA 3G6GA 3C5UA 4RJ3A 3GU6A 4HGSA 2V0DA 1BMKA 4IANA 2FSLX 2JFLA 3SW4A 4D4VA 3KRJA 4J1RA 2VZ6A 2VTLA 3FL5A 4W4WA 3SV0A 3MB6A 4OTRA 4Q5EA 4K18A 4X6QC 3B8QA 3VBQA 4KD1A 3R6XA 2W17A 2OLCA 5FD2A 2JIIA 3BV3A 3QF9A 3E93A 5DMZA 2WAJA 4D1SA 2EB3A 2HWOA 4YJQA 4P4CA 5EDPA 3UO5A 3R1QA 1Q99A 4IAIA 1Q24A 3NNVA 5I9ZA 4G3FA 4KINA 3CTHA 1WVYA 3CPBA 2PVMA 4K6ZA 4L7FA 1J1BA 3CIKA 4IZAA 4PQNA 4XOZA 5H3QA 5LCKA 3UTOA 3HAVA 3WBLA 1PW2A 3I79A 3U9CA 1KE5A 3DU8A 3KXHA 4LM5A 5DEYA 4BHZA 1GIJA 2YIRA 1DAYA 5FEDA 2C0OA 3EN5A 4IB5A 5FWKK 2GNHA 3P7CA 3GQLA 4JBPA 4CV9A 3W18A 3ZOSA 2QU6A 3GC0A 5AV1A 2WXVA 3VBWA 3UMWA 3VS6A 4R7BA 4RJ8A 3K3IA 4KS7A 2FGIA 3E3PA 3ZFYA 2CCIA 4UB7A 4DINA 1UWHA 4PP9A 4PNIA 3LMIA 3W55A 3SGCA 4FTKA 3V01A 5JEBA 4FNXA 3FLWA 4F09A 4RBLA 1QCFA 4MHAA 3DFCB 4D2WA 1WBSA 2WMQA 3V5WA 5KKRB 3S4QA 4D28A 2QURA 4YC6A 3C0IA 3KFAA 3TXOA 3IPHA 3DKFA 3G6HA 4FGRA 2R3MA 3ODZX 4IACA 3SXSA 3EH9A 1U46A 3LJ1A 2O65A 4LRKA 5AM6A 3RI1A 3PRIA 1UKHA 2BRNA 4RA4A 5TR6A 3W2CA 3ALOA 4JBVA 4DEDA 3NW7A 3GNIB 3VQUA 1NVRA 3E88A 4RJ7A 3V5LA 4C2VA 5IF1A 1S9IA 1YXXA 3BYVA 2PUNA 3AC1A 4ZEGA 2F2CB 3BHUA 1PRYA 4AACA 3MESA 3LFBA 3C4CA 4O1OA 4OTWA 5FLFA 3ID6C 4KIKA 3PTGA 5CEOA 4FVRA 3MH0A 3ELJA 1FMOE 4FTJA 4BDDA 4OTGA 1FGIA 3FKOA 5HLWA 5EW9A 4HPTE 4IZ5A 4B6LA 1M2RA 4IM2A 4X7QA 3T3UA 2C5XA 1SVGA 2W96B 5HZNA 4E8AA 2YLEA 1Q5KA 4NIFB 4ZTQA 4DYMA 1WFCA 1YWVA 2X4FA 4FYNA 1K2PA 3LM0A 2JAMA 5HBJA 1GZKA 3AC3A 3BGZA 5FRIA 4Z55A 4GKIA 4ACHA 3A62A 1OKYA 2VWIA 3LJ2A 3PXKA 3TG1A 4D1ZA 2UZEA 5HG9A 5M4CA 4B0GA 4NYEA 4AAAA 3DNDA 2WGJA 2CGWA 3RZFA 3BRBA 1ATPE 4FTOA 3DKGA 3MTFA 4NWMA 4BF2A 1W84A 4L01A 4ZJIA 4PRJA 1TQPA 4BDIA 2UZNA 3HP2A 4QQTA 2Y4IB 3OCTA 3BYUA 5KHXA 4XOYA 4JXFA 4V05A 2XB7A 1A06A 4K9YA 4KBCA 3POZA 4EH7A 1DI9A 4GRBA 4CCBA 3SHEA 3F3ZA 2JITA 3NRMA 4YJNA 4ANQA 1YOJA 3GU8A 4W8EA 1SVHA 4AUAA 1OIQA 4FG8A 2G2FA 3ULIA 2BKKA 1CDKA 2X6EA 3AT2A 3LFNA 4N70A 3FLZA 4H1MA 4CT2A 4IWPA 5IQFA 4BBMA 4UN0C 2RFNA 2IG7A 3UDBA 3FLYA 4O1PA 4ERKA 5J9ZA 5IQDA 3HV3A 5H8BA 2VX1A 4L3PA 4XMOA 4ZZOA 3H0ZA 3EN4A 1I09A 4HNFA 4TYHA 4WNOA 5FM2A 4GCJA 5I5ZA 4E1ZA 4XG4A 4UMPA 3EKNA 3R8LA 4GEOA 4O7VA 3D4QA 2YJRA 4O0WA 2BRMA 2R3OA 2R5TA 3E87A 3R9HA 4BCGA 1H08A 3DLSA 4MEDA 3L9LA 1G3NA 3TKHA 4C33A 4DLJA 5AP6A 2WTWA 2YM6A 1AGWA 3FSKA 5DRDA 3REPA 2GNLA 1Z57A 3CPCA 4ZTHA 4BCOA 2JBPA 4HYHA 1YW2A 2VX0A 3V8TA 4QQ5A 4FTLA 5FXQA 4ASDA 3IOKA 2Z7QA 4EHZA 4A9RA 2WMUA 3MA3A 4J53A 4FEVA 4DTBA 3F66A 3ZYAA 2Y9QA 2C30A 4LRMA 3PJ2A 3DB6A 3PUPA 1IG1A 4YJTA 4ZXTA 5KMJA 3QRUA 5M57A 1R0EA 5AR2A 4OBQA 3UIXA 5IA2A 5AA9A 3EKKA 2JLDA 3LXNA 1B38A 3ZO1A 4CRSA 2UUEA 5CSPA 3COHA 2IVUA 4IX6A 2XCKA 3U87A 5F9EA 3G0EA 1MUOA 3O50A 4RIWB 4IFCA 4GYGA 4FF8A 4CZTA 4ZZNA 4XV3A 4ZSAA 2Q0NA 3UIMA 3I5ZA 2C5NA 3FMHA 4DGOA 3SRVA 2VX3A 2VO7A 2HCKA 3LJ0A 3VS4A 4IAFA 5A6OA 2PVHA 4I6BA 4NUSA 3ZH8A 5F20A 2BR1A 4YZDA 3D5WA 4V04A 1IRKA 4AT3A 5ANKA 4FBXA 4DH8A 4FSTA 4KAOA 1H4LA 4OGRA 4MH7A 3R8UA 4HPUE 1XH9A 1OL2A 2F9GA 5HX6A 3VS0A 2PUUA 3LCOA 2QO7A 2XEYA 4GT5A 4NT4A 1QPDA 1Z5MA 2WQEA 3TI1A 2GTNA 3UNKA 3E8CA 2R3NA 4YPDA 1FQ1B 3PXZA 4CG9A 4CFNA 5G6VA 4U9AA 1GZNA 4DEEA 4C4EA 5B7VA 2CNVA 5BQ0A 3R7IA 3QU0A 3KN5A 4MXCA 4B9DA 3EFLA 5AP4A 2AYPA 2OJGA 4LMNA 3LAUA 4KS8A 3NUUA 1NW1A 5AP0A 3Q53A 5EI2A 3DOGA 4BI0A 1OIUA 4WNMA 4ALVA 3IONA 1VYZA 4KBAA 3JR1A 1E9HA 5AV3A 5J95A 5TOZA 4JLCA 4JIKA 4ZLZA 4R6VA 4C35A 3R0TA 4EOLA 2HOGA 3HKOA 4I5MA 3DT1A 3KGAA 4IC7A 2PE1A 5KMMA 4FIEA 4GH2A 5KMLA 1UU7A 1ZOHA 3E7OA 2RKUA 4I5HA 3UYTA 4MXZA 1LR4A 4MBLA 3CBLA 4OR5A 4FMQA 4YZNA 4F6UA 3VHKA 4AOTA 2AC3A 3DTCA 1LP4A 4U80A 3SQQA 5GZ8A 3R30A 4JI9A 3V04A 2I0EA 1GIIA 2I0HA 2IN6A 5DOSA 3N4TA 3ZTXA 4EHGA 2CN5A 4ZSJA 3V6SA 3BHVA 2WTDA 2BDJA 2YCFA 5DN3A 5IDNA 3PLAE 2XKFA 4USEA 5JGDA 4AW5A 3RINA 1OKVA 4OT6A 5D7AA 2VWUA 4EUUA 3PYYA 3BU3A 2VWYA 3UPXA 3WZUA 3IGGA 4FTTA 1KSWA 2XK8A 3QD3A 1Y8GA 3A8WA 3KREA 3O7LB 4L9IA 4M69B 3BQCA 3PA5A 2VWVA 4YTCA 4IX4A 2R7BA 2ZYBA 2Y6MA 1XKKA 3QZGA 4QYEA 2QHMA 4BIDA 2HIWA 2FSOX 4UXLA 1XH8A 3VJNA 3D7TB 3QTQA 4RFMA 3FY2A 2WEIA 3F3UA 3LE6A 3AGMA 2F7EE 3PSBA 2J51A 4AWIA 3VIDA 5FM3A 3AOXA 3ZDIA 5IH4A 1XJDA 2OSCA 3VBTA 4JDIA 3EQHA 3ZSHA 5KHWA 3QKKA 4S34A 5C03A 4ITJA 3CY2A 4TN6A 1CSNA 4ANBA 4CV8A 4JG7A 4D0WA 3BHYA 5IUGA 2VTQA 4XBRA 2IPXA 1IAJA 4ITHA 2CKQA 3RWQA 4KUJA 3M11A 5M53A 1HCKA 4IJPA 2QOOA 2BPMA 4IVAA 3GCSA 4FICA 4I4FA 5J87A 2RGPA 5L2QA 3QZHA 4CTBA 4ZY6A 3O23A 3OCBA 1Q8WA 2JDVA 4RWIA 3GC9A 4C61A 3A7FA 4R3PA 4ANMA 4G6NA 4NFMA 4PV0A 4BZOA 2CSNA 4NKSA 4BCMA 5FDPA 3PJ8A 4IFGA 2WIHA 1ZWSA 2H34A 3EQIA 3IG7A 3OW3A 4WD5A 3TNWA 1JKSA 4J8MA 3T9TA 2WPAA 4AZSA 2UV2A 1OPLA 2YCSA 4CRLA 2YIXA 4QMUA 3TNPC 2AUHA 5BVDA 1KUTA 2GHGA 2QOHA 4DG0E 3NR9A 1O9UA 3QCYA 2QD9A 1PYEA 1WBWA 3R1SA 4LGDA 4I5PA 1UKIA 3HRBA 2QVSE 1T46A 5HO7A 4FSRA 3ROCA 4RIOA 3Q2MA 3SOAA 3U55A 2C6OA 2JFMA 1EH4A 3OT8A 5AP5A 2WZJA 3W2OA 5AV4A 2E9NA 2IVTA 4FSUA 4KA3A 3ORPA 4BCPA 3W32A 4IDVA 3Q4ZA 3IO7A 1GJOA 2UW7A 3PG3A 4QMVA 3LZBA 1YDTE 2YDIA 4WT6A 3TT0A 1J7LA 4O7YA 3FBVA 3AQVA 4FV6A 3MIYA 4LFIA 3ZO3A 2ACXA 4AZTA 5IZFA 5JKGA 1QL6A 4L43A 3S0OA 1OL6A 2E9PA 2W06A 4EZ7A 5E9EA 4YSMA 4B99A 2WQNA 4FT9A 4LMUA 3E64A 3ETAA 3PVUA 3PJ3A 3CKWA 3ZXZA 4FODA 5DH3A 1J7UA 2C6MA 4TT7A 1UNLA 4U42A 2OXXA 2IWIA 5DIAA 3M2WA 2Z7LA 4C4HA 3TUDA 2GNJA 4B4LA 4BCHA 3C4WA 4HYIA 4E4LA 3FI2A 4L67A 2X0GA 4JOAA 2WO6A 3BV2A 2QOLA 4LOOA 1BL7A 1ZYCA 4FNZA 5EW8A 4BCIA 4KSPA 3Q4CA 2PSQA 4QNYA 4LUEA 4A9TA 4BHNA 1R3CA 3II5A 4EOJA 5AADA 2W0JA 4ASEA 4I22A 4D4RA 3VS5A 4IIRA 3QQJA 3QZIA 4I6FA 1YOMA 5CYIA 3V51A 3S2PA 5CAVA 2ETMA 5LVNA 4BGQA 3BGPA 3LXKA 5CSVA 5EI6A 3NUYA 3QTUA 4U41A 2GHLA 3FMDA 4ZOGA 3TACA 3WE8A 4WA9A 2Z8CA 5A54A 1FBNA 5CT0A 2KTYA 3MPMA 4K8AA 4W9WA 1H0WA 3AD6A 5JQ5A 2WTKC 3M42A 4MXAA 5ACKA 4ANNA 4D5KA 4DCEA 4F0GA 3DXNA 4BKZA 2R2PA 3QTWA 4J71A 3CXWA 4UYNA 2GPHA 3KXXA 3ZRMA 1WZYA 4PP7A 2JC6A 4W4XA 4QP6A 3WZDA 3LFSA 3RPOA 3JY9A 4I41A 4Y85A 3CTJA 4UYAA 3B8RA 3OOMA 5HNGA 1K9AA 3WIGA 2B9JA 1PMEA 1ZYLA 2VTAA 5AEPA 3VF8A 1O6YA 2YEXA 2C0IA 3F69A 4UEUA 1FVRA 4YO6A 5CNOA 2ITWA 2R7IA 4QYYA 4PUZA 1IASA 2G15A 4G3DA 3MB7A 4UZHA 5DEWA 3FHRA 3SA0A 3BE9A 2BMCA 3CP9A 2ZV8A 4G9CA 5E8VA 4CMOA 4V0GB 3MFSA 3NDMA 4FKWA 3EQFA 4IXPA 4MD7E 4X0MA 3FYKX 1Q8TA 5L6WL 5B2KA 2AC5A 4G34A 3F5XA 3WARA 4AGWA 4F9AA 4O96A 3IECA 4FKJA 2OFUA 4G2FA 4RG0A 3ULZA 3KKVA 3ZMMA 5LCJA 2VNYA 4R7IA 2CPKE 4WUNA 3RVGA 1BKXA 3HMOA 3NAYA 4BDBA 4F4PA 5AAGA 4YUQA 3LQ5A 2PVJA 2PPQA 3WF8A 2UZOA 3K3JA 3RAHA 5EM8A 3I6UA 4TPTA 3QCXA 3Q32A 4YLLA 3C1XA 3U4WA 4BDJA 4DFYA 4WBOA 3BELA 3QUDA 1YHSA 2JKMA 3KL8A 4BCJA 3VJOA 5ANOA 5HG8A 1OVEA 2VTRA 2WMSA 2WQMA 4BWKA 4EOIA 3OC1A 4YMJA 2WTKB 3OWLA 4FTIA 4IVCA 5EHYA 3CGFA 4GFGA 3RAIA 4U81A 4RC2A 2OW3A 2Z7RA 3DFAA 3AT3A 3KU2A 4CYJA 4M15A 2YIYA 3NCZA 2ITNA 1SMHA 2WU6A 2XK3A 5FXSA 4JNWA 2VU3A 1JBPE 3FEGA 4WKQA 4RX8A 3ODYX 3FWQA 3LLTA 4IW0A 1ZYDA 3KRLA 1OM1A 4CLIA 4BY9E 3TV6A 4DFUA 4JRNA 1WBTA 4ANSA 2W4KA 2ZVAA 3MN3A 4D2PA 3U6JA 2BALA 3PY1A 4FKQA 4EC8A 5JSMA 4GS6A 3KULB 3DY7A 1O6KA 1PY5A 3QC9A 5GHVA 2KULA 3OW4A 3AC8A 4MX9A 3FE3A 4QQCA 3QQFA 4K77A 3D5VA 3FC1X 2C47A 4EBVA 2OZAA 5HCXA 3MFTA 5CI7A 2HY0A 4HJOA 5C4LA 2YAKA 4EQCA 4PX6A 3GQIA 1H1RA 5EQPA 2YFXA 4ZZMA 3ENMA 2OZAB 5M44A 3ZRKA 3MY0A 1GIHA 4QP4A 3LCDA 3SXFA 2ZM1A 4BTKA 3QGYA 4UALA 5BUEA 3D7ZA 3GP0A 2R3HA 5K0XA 4AU8A 2GNIA 4N0SA 4OT5A 5HTIA 5L2IA 4YTIA 4F7LA 2BFYA 2GS6A 1ZMUA 3K54A 3LIJA 1TVOA 2CLQA 5AAFA 2YERA 5LJJA 3PFQA 4OTQA 3KVXA 4Y73A 3KY2A 1PMNA 1NXKA 3R01A 2ITXA 4GG5A 4EOPA 5A9UA 4QMTA 3DS6A 4DFZE 4E5AX 4OTDA 3SLSA 5M09A 4LI5A 3A61A 3DQWA 5JZJA 3OTUA 1UVRA 1OUKA 4I1ZA 3EWHA 3QD2B 3RTPA 3FC2A 1GY3A 4QQJA 5KCVA 2YM5A 3IW5A 3V5TA 5M06A 1RJBA 3CKXA 3R7GA 2FSMX 4QMLA 4FTMA 2E2BA 2NRYA 2QG7A 5F1ZA 2CKEA 4GW8A 4YTFA 2WMRA 4Q9SA 4FSYA 4GK4A 4F0IA 2I7QA 3BPRA 3AMAA 4USFA 3R73A 3OF0A 4FL2A 3U9NA 4C2WA 4DFBA 2PL0A 2XIRA 2WOTA 1H1QA 1M7NA 4D9TA 3KMWA 4IAAA 3A7IA 5E8SA 4FV8A 5HESA 3PZEA 3QGWA 3ZLYA 3L8XA 5A46A 2BHEA 2UW6A 2BZHB 2JDRA 3ZC6A 4BTFA 3D94A 5TF9A 5DG5A 3T9IA 3LCTA 2VGPA 3GBZA 3VUTA 4BZDA 5LWNA 3BYOA 2WTJA 2UW4A 1IA8A 2X6DA 4HVGA 4H39A 5JFVA 4EH2A 4U79A 2YM8A 4AGUA 4ALUA 5BVFA 2FYSA 3S00A 2GFSA 2XYNA 2JKOA 3UQFA 1ZY5A 4XP0A 2XM8A 4OAVB 1XH6A 4YZBA 4XCUA 4GYIA 3I7BA 5M4FA 2PUPA 3AG9A 2C3IB 1MRVA 4ACMA 4XP2A 3C4EA 3G9LX 2VWZA 3RPVA 3I5NA 3ZLWA 4JDJA 1Y6BA 2RG5A 5E1SA 5HKMA 4C4GA 2XJ0A 3MWUA 2E9VA 2UVYA 3DXQA 4Z7HA 4A07A 4DGNA 2J7TA 1KE8A 4YBKA 2X2MA 2V62A 4NH1A 4A7CA 4XNEA 3DB8A 1YXVA 4IVDA 2OU7A 4JL9A 5GJDA 2C69A 3LXPA 4AGCA 2W1ZA 2YM3A 3AD5A 4CNHA 5ETAA 4O6EA 2WD1A 4PTEA 5HG5A 3FHIA 3F3VA 1CKPA 2OJFE 3HA8A 3D2IA 4H3BA 4WRGA 3GCQA 5BVKA 3BU6A 3BHHA 2F57A 5KE0A 3P08A 1UNGA 4A9UA 2UZTA 1H1SA 3DK6A 3EFWA 4U43A 3FI8A 3G0FA 5E8WA 2BZIB 2JIVA 3OD6X 3ORNA 3TDWA 2R0UA 1CTPE 3NNUA 1PXIA 5AX9A 4DBNA 4L3JA 1OKWA 5H8GA 2HZIA 5BVWA 3CQEA 2PVLA 4R1YA 5EM7A 2P55A 3VAPA 3V5QA 3O0GA 1ZMVA 4K0YA 5AP2A 3QWKA 2WB8A 4R5YA 1TQIA 1QPJA 5HD4A 4X6RA 2IW8A 1UU8A 1KOAA 3BLQA 5FGKA 5K4IA 2OFVA 1H26A 1YRPA 3LKMA 3QUPA 4E6QA 4E4MA 4F6SA 4FK3A 4KIPA 3P86A 3QRJA 4QMSA 4BI2A 3D2KA 1SNXA 5IA5A 5CEQA 1JKTA 3EQCA 2BRHA 2P3GX 3Q9WA 4JAIA 2RL5A 1URCA 5EDRA 3FZSA 3OP5A 3RPYA 3N51A 3MV5A 4D2TA 4B8MA 4DEGA 1XBBA 5CEPA 3Q3BA 2R3PA 5HNBA 4FV1A 3O51A 4C02A 4QMOA 2WTIA 4UWBA 2XNMA 3E63A 5BUIA 2GU8A 2BAKA 2PTKA 3EMGA 4QOXA 3R04A 4HW7A 4RJ6A 4NCTA 3ZM4A 4O27B 5BUJA 1JLUE 2Y4IC 2HK5A 1OL7A 4W8DA 3RGFA 4WG5A 3LLAA 4BZNA 4GUBA 4ZK5A 2R3QA 3PSDA 3P5KA 3Q4TA 3ATTA 3D5UA 4ZTMA 4M13A 1Q4LA 5DHJA 3SDJA 4FI1A 4X3JA 1ZYSA 4KWPA 1ZY4A 3D83A 4RLKA 4BDKA 4JAJA 3V6RA 5J1VA 4PPBA 3LFDA 4KIOA 3TTIA 4AGDA 2EXCX 3GVUA 4RJ4A 4PNKA 3FQHA 2W99B 2VN9A 4BB4A 4FT5A 2ITTA 3OZ6A 1PKDA 5DI1A 2BZKB 4MXOA 5CU2A 3GU4A 3R9OA 4EL9A 3WZJA 5IQGA 5EOBA 3FZPA 3GFEA 1REKA 3GT8A 3KXMA 3P4KA 4M0YA 4YNEA 4M3QA 3THBA 5FG8A 2VTOA 5HE0A 5CVHA 1V0OA 3U8WA 1H07A 2XYUA 3P23A 3R1YA 1WBPA 4BVUA 4QTEA 4G3CA 5CF8A 5IA3A 4DT9A 5DR6A 3N4UA 3FMEA 4AE9A 4QRCA 5M51A 1PXKA 3ACJA 4I94A 2GQSA 3RJCA 2PMLX 3ZDUA 1E1VA 3T3VA 2HW6A 4QT1A 2YZLA 2X4ZA 3R00A 3BZ3A 5KMNA 4L45A 4FZ6A 3FY0A 5LQFA 4GV1A 3W2RA 5HE1A 1M52A 4PDYA 4F64A 1PF8A 4ID7A 4NIFA 5CTPA 1DS5A 1PMUA 3F2RA 4S2ZA 2A0CX 4N57A 4AP7A 2JGZA 3DKCA 3PP1A 4HVIA 4M0ZA 1ZOEA 3D14A 4LV5A 3UOLA 1H8FA 3AXWA 3HNGA 2X9EA 4FKLA 4RIYA 4RVTA 4YGAA 5HE2A 5JK3A 3ZUTA 4I21A 3ORIA 3VQHA 2J90A 3BLRA 5TO8A 3RNIA 4DFXE 3HMMA 4APCA 4RIYB 2CNUA 3ZONA 3C50A 5IEYA 2C5VA 1MRYA 2RG6A 5J8IA 3RHXA 2OO8X 2XH5A 2P2IA 5IQIA 4O7TA 3HV6A 5JGBA 3I0OA 3G33A 4HYSA 4DA5A 1URWA 2B9FA 2C4GA 3E7VA 3NUNA 3R8MA 3UZTA 4PL3A 3C9WA 2PZIA 2BTRA 4NSTA 4C4FA 2XA4A 4RLLA 4EK8A 2CKPA 1VEBA 5DLSA 4O0TA 2X7GA 2HZ0A 4CQEA 4X2GA 3DPKA 2VWBA 2BTSA 3G2FA 3MPTA 3ORZA 5LVOA 1JAMA 3AC5A 4YJOA 5M4UA 2XIXA 1WCCA 1XO2B 3DZOA 3GEQA 4FKVA 4GK3A 4XJ0A 4D1XA 2B54A 2XM9A 4FV4A 5FDXA 1CKJA 5D7VA 4YC8A 5EW3A 2JDTA 3TM0A 3O8PA 3RNYA 3BQRA 4FX3A 3L8VA 4KRCA 1MP8A 1ZZ2A 2PZYA 3FQEA 1FVTA 3R8ZA 4R8QA 1UU9A 2OJJA 2V7OA 4H1JA 3TKUA 1HCLA 4FV3A 4J52A 4CFWA 2ZJWA 4FT3A 3FXZA 2QQ7A 5HG7A 4O86A 2PVNA 5A4TA 3IDBA 5JMSA 2J9MA 4QYFA 3QTRA 1ZXEA 3ZZWA 3ENHA 4LG4A 2IW6A 3KMUA 2GS2A 5J5SA 1J1CA 5FBOA 5JRSA 4RC3A 4RZVA 4AFEA 3PG1A 3FPMA 2UZVA 3S3IA 3W8QA 2FH9A 3NLBA 5CALA 3WYYA 4P5ZA 1XQZA 4PMTA 4QPAA 3OEFX 1OMWA 3EQBA 5E1EA 3FDNA 3FLNC 5LVMA 2YCQA 1A9UA 4O0XA 1FVVA 3R02A 4RIWA 1BYGA 4KKGA 5HEZA 4O0YA 3HX4A 4U45A 4WO5A 4ACGA 3F5UA 4AT4A 4OTHA 4L8MA 2DS1A 2O64A 3G90X 3PIXA 3DZQA 4GG7A 4YHTA 3IK3A 1P14A 1GAGA 3EHAA 2VUWA 3W10A 1SYKA 4RX7A 4UMUA 4H3PA 2ZMCA 5E91A 2C6LA 4MWIA 3RPRA 3CJFA 4UWYA 4WG3A 1Q61A 3M1SA 2C5OA 3OT3A 3TZ8A 2X8EA 3UODA 4QP2A 4YZMA 3ZFMA 4LGHA 4O7SA 5I9WA 3MTLA 5AV0A 4QPMA 3ZCLA 1PXMA 2X2KA 2HWPA 4XV9A 4YPSA 4DH7A 5I9VA 2UZBA 1KE7A 4U7ZA 4RX9A 2BKZA 4BCKA 1UNHA 2VTPA 3EQDA 4TW9A 4TYEA 4EH9A 4EONA 2WMBA 2EU9A 2UW9A 4EI4A 5D10A 3RK9A 3NIZA 4KSQA 4C62A 3R8PA 1WVXA 3FI4A 3NNXA 4J95A 3H9RA 1NVQA 3PE1A 1H0VA 3R71A 2XNNA
chains in the Genus database with same CATH superfamily
5EHOA 4O7NA 1FMKA 2YCRA 3OROA 4G1WA 3R9DA 1Q8ZA 5BVOA 4CEGA 5I9YA 4C3PA 2ERKA 1OPKA 5HLNA 5L3AA 4K1BA 1WVWA 5JGAA 3ZZEA 5DWRA 3R63A 1XR1A 4I5CA 2PUIA 4A9YA 3BEAA 4EQUA 3GU7A 1KOBA 1PMVA 3WZEA 4IAZA 4ACCA 4NJ3A 2DWBA 4OBPA 5ANEA 4ZTLA 4TWCA 5J5TA 4AXEA 5J1WA 5LMBA 2XKDA 4G5PA 4O0SA 1FPUA 3MFUA 4I0SA 4IAKA 2ESMA 3ZEPA 2UW5A 2OWBA 2A98A 4UXQA 4YZCA 1JQHA 3R7EA 1OL1A 3ZEWA 4LYNA 2W1EA 1OECA 4M69A 3P79A 2CDZA 3RP9A 2XJ2A 5E8TA 5B2LA 4QMZA 4O84A 5ETCA 2CHLA 2W4JA 3ZRLA 4HGLA 5IISA 3D7TA 4J97A 3ATSA 4C58A 3CQUA 3P7AA 4DFNA 3NVKI 4DN5A 4F9WA 3NYXA 3ORXA 3JXWA 2CGUA 2UZUE 4CGAA 5IA1A 3UDZA 4DTAA 1IR3A 3BIZA 3UVPA 3GOKA 3HMPA 4FOCA 2WHBA 3RCJA 2OXDA 2I6LA 4M12A 3H9OA 4Y95A 2Y6OA 3E62A 5AP1A 4MQ1A 3NSZA 4YNOA 1W82A 4NM7A 3I6WA 1YI3A 5ETIA 1XH4A 5AX3A 3RHKA 4O6LA 5J9LA 4RVKA 3RCDA 3OUNB 4CXAA 2CNQA 3CY3A 5DPVA 5M4IA 4G17A 3MI9A 2ZFYA 1ZAOA 4DGGA 2P4IA 3HP5A 5KX8A 3QQUA 4YHJA 4HGEA 4FUXA 4FV0A 4J8NA 3DK7A 5E90A 5FP5A 2W7XA 2V22A 1YDRE 2NO3A 3UE4A 2JKKA 4NTSA 1E1XA 4R77A 1UU3A 2ITZA 4G3EA 4WOVA 4EK6A 2QONA 5KUPA 4FKGA 4JJRA 2A1AB 3QLFA 4FSWA 1W98A 4WHZA 1H1WA 1SNUA 3L9PA 3QXPA 4IBMA 3FPQA 3QZFA 5J79A 5AUWA 3SG8A 3EFJA 2BAQA 3PPKA 3VF9A 2C3LA 5EM5A 4RGJA 2CKOA 2PVRA 2CJMA 3D15A 5AR5A 2BILB 2Q0BA 1PYXA 3ET7A 4O83A 3QX4A 4FIIA 2G2IA 3BU5A 2WMXA 3HECA 4IZYA 4O4BB 1PXLA 3D5XA 4EYMA 5D41A 2ZM4A 4ZLOA 2RIOA 4NJDA 2YJSA 5TT7A 4XHKB 1YQJA 3S95A 5CT7A 5H9BA 4TXCA 3EN7A 2ZMDA 4FZ7A 1M2QA 4P5QA 3SD0A 4FSNA 4F63A 4EHVA 4D4YA 3OEZA 1R1WA 1KE6A 3TIZA 3UNZA 2YWPA 2LAVA 1YI6A 2IVVA 2YWVA 4CFFA 4I23A 5AIRA 5CY3A 3DAJA 3DJ5A 3BHTA 3CLYA 1DM2A 1DAWA 1J7IA 2R3JA 2YISA 5J7BA 5I0BA 2WU7A 4J7BA 1FINA 1YVJA 3Q5ZA 4C59A 3U54A 4FZDB 4XV1A 3RK5A 2X9FA 5KBQA 2XARA 5GJGA 5L6OA 1YDSE 5G1XA 3C0HA 3TCPA 4A4OA 3KRWA 3EOCA 4MBJA 3OHTA 5K0KA 2OK1A 4AOIA 3N4VA 3ORMA 4FC0A 4OTPA 5FTQA 1U5QA 4W4VA 4RZWA 2ZB0A 4UV0A 5LMKC 1F5QA 1Y57A 2PE0A 2Y7JA 4FIHA 3KCKA 4U8ZA 3RZBA 2FA2A 3VRYA 3PE2A 3FZ1A 2UW0A 3HV4A 5IEVA 4DH3A 3HL7A 4FKIA 4HCUA 3MH2A 4YJVA 2QODA 5CU3A 4MTAA 3QUEA 2ZDTA 3G5DA 3SX9A 1NT2A 1OIYA 2WQBA 3NAXA 3EZVA 4RFYA 5IQEA 3DNEA 3MY5A 2VO3A 3MH3A 4QTDA 5C26A 2WTVA 3NW6A 2R3FA 3P7BA 4MKCA 5KMKA 2YITA 3TKIA 4KBKA 2W1DA 5K5XA 4XUFA 5DGZA 5T3QA 3R7UA 1CMKE 3PJCA 3AC4A 3W2SA 2W5HA 3A4PA 2JAVA 3ZBXA 4MK0A 1W83A 2GNFA 3E5AA 4ZSLA 3UIBA 4ANOA 4DBXA 4FSQA 4FIFA 5EFQA 4ERWA 3I81A 4BN1A 2OG8A 5C01A 2W05A 4DCAA 3VUGA 2GDOA 3BLHA 3RM6A 4F1MA 3L8PA 4UMRA 4NW5A 4H05A 3NFGB 4QMPA 4EC9A 3HUBA 3VBYA 4RVLA 4PL5A 2H9VA 5C4KA 4II5A 3MSSA 4DEIA 4BCFA 1OUYA 4G31A 1JNKA 4C36A 3BI6A 2VTHA 4LV7A 3MA6A 3PPZA 1OL5A 3LW0A 2OH0E 3F5PA 1V1KA 4UMQA 3AMBA 4HNIA 5DE2A 4AA0A 4U6RA 1B6CB 4P7EA 4RX5A 3JVSA 1JKLA 2GQGA 3OFMA 4EORA 5JFSA 2B0QA 1XBAA 5JRQA 4ZAUA 1H01A 2VAGA 4TWNA 3FAAA 2B1PA 3S1HA 1ND4A 1LPUA 1VZOA 3Q2JA 3QWJA 5DBXA 5DNRA 3QQGA 5L4QA 2C6DA 2OZOA 4NEUA 3UVQA 3EQRA 2C0TA 5EOLA 3NYOA 3QHWA 2X39A 2X0QA 3AD4A 4GSBA 4LRJA 4E6CA 4V0GA 2YHVA 4I4EA 4ZSGA 3Q9ZA 5LMKA 3BCEA 4MUQA 3TMOA 2SRCA 4UZDA 5B2MA 3GOPA 4JMQA 5EYCA 4J98A 4FT0A 2YM4A 3F5GA 3L9MA 1U54B 4NM3A 3H4JA 3PWYA 5BYZA 3ZS5A 4DEBA 5EK7A 4YURA 1KV1A 4AZEA 4O7LA 2PMIA 4DGLC 3QQLA 4MCVA 5C8NA 3PXQA 4YJSA 3UO6A 5ANDA 4AZVA 2JEDA 2PZPA 4NFNA 3TEIA 2R3LA 3DCVA 3O7LD 5CEMA 5IUHA 4O22A 3IGOA 3V5PA 4WSYA 1YOLA 2BROA 4C57A 3ANRA 4F1OA 1F0QA 1YXTA 3OBGA 4IX5A 3ANQA 4IM3A 4JDKA 1YXUA 3QAME 4P2KA 4RSSA 4X3FC 4AZWA 2XCHA 3RPSA 3CCNA 3BEGA 5CLPA 2VV9A 4BTMA 5AUUA 3TV4A 4DEHA 4USDA 4GT3A 4E5BA 4AF3A 4E7WA 4FRFA 2X8IA 4O38A 3LOKA 2ITQA 3O8TA 4BDEA 1I44A 4M67A 2C5YA 2QCSA 4X2FA 5DFPA 1YWRA 5LARA 4QPSA 5JT2A 2B55A 4S32A 5J9YA 4IMYA 4LUDA 4FTCA 4JQEA 5F4NA 3LMHA 3QCQA 3EJ1A 2CGXA 5C9CA 1PXJA 1JSVA 4C3FA 4E6DA 1OBGA 5FTOA 4NW6A 5HU9A 2B9IA 2WIPA 5DYJA 4JRVA 1M7QA 4TYIA 4W4YA 3P9JA 4BFMA 3UOJA 1YHVA 4OW8A 4ALWA 2W5AA 2CMWA 3KULA 4ZSEA 5IU2A 4ASZA 1SM2A 2R9SA 2V5QA 3VC4A 4AZFA 2XRUA 5I9XA 5E4HA 2PVYA 3WOWA 2NYAA 1Q8UA 5HX8A 3MFRA 5DT4A 4M97A 3A60A 5AUYA 1XWSA 5AUTA 3JYAA 2IO6A 3Q60A 3FXWA 5LOHA 3UOKA 3DTWA 5CF6A 2R3IA 2JBOA 4QP9A 4PPAA 3IOPA 3P78A 3QCSA 4FNYA 3R7VA 3WF6A 3C4FA 5CEKA 3DV3A 3O17A 3ORTA 4QTCA 3FKNA 2W9FB 1DI8A 4DC2A 4LOQA 4X3FA 2YA9A 3IS5A 5E7RA 5A4EA 4FVQA 1W8CA 2P33A 2R0IA 3H9FA 2ZB1A 4FIJA 4FK6A 4BDHA 4I6HA 5KNJA 4S33A 4TNDA 4X3FB 3SC1A 3Q6WA 3WF5A 4CVAA 3OCGA 3W16A 4BICA 3KQ7A 1ZZLA 4L42A 4TYGA 1R39A 4PMPA 3BWJA 3SOCA 2J5FA 3FYJX 4M14A 4ZS4A 4F08A 2J0KA 3PY0A 5C1QB 4FKSA 4O7WA 2C3JA 2I0YA 4PDOA 2B7AA 3UIUA 4O2ZA 3KCFA 2WEVA 3I0QA 4XS2A 5L2WA 2QOBA 2V7AA 3PP0A 3R7YA 3KF4A 5H2UA 4FOBA 4D2VA 4MYGA 2XK9A 4J99A 3EYHA 2O8YA 4M68A 4O4DA 4K2RA 5DR9A 4ACDA 4AX8A 2ZM3A 5LVPA 3CD8A 3GI3A 4DEAA 2VNWA 5D9HA 1NY3A 3ZHPC 2AEGA 3TUBA 3TZ7A 3UZPA 1J3HA 4CMTA 5T68A 2XIZA 5EQEA 1OZ1A 4CZYB 5CF5A 4TYJA 3KEXA 4GK2A 5FBNC 1SVEA 4R1VA 4E4NA 4EWQA 5JH6A 3QD0A 4DE4A 2W4OA 3KRRA 1Q3WA 2PWLA 3DAKA 4CZUA 4GVAA 4XG7A 3WI6A 4AXCA 3UYSA 4D0XA 3A7JA 3FMKA 1G8KA 4E73A 4FV5A 3HEGA 1R78A 3HVCA 3UP2A 3KVWA 2XIKA 5I3RA 3Q9XA 5A14A 3K5UA 4EOSA 4BYIA 1OITA 3KXZA 4QD6A 3DBQA 3EL7A 5A3XA 4GUEA 3NFFB 4YLKA 3JY0A 3VS3A 4FEWA 5DA3A 4OTIA 1Z9XA 2EXMA 4DLIA 2DQ7X 2BRBA 4N6YA 4ZTSA 3U6IA 3C4ZA 4IQ6A 4EZ5A 3UDSA 3GU5A 1YXSA 4BC6A 3CEKA 3H0YA 5A4LA 2HZ4A 1OIRA 2X2LA 4OBOA 3RBWA 2XBJA 2WKMA 5L8LA 3EL8A 4EH5A 1Q3DA 4G5JA 3ML1A 1REJA 3O71A 3W2PA 2WFYA 4QMWA 4O81A 2IEWA 2QG5A 3IDPA 4B8LA 2J6MA 4QTAA 3RWPA 4FG7A 4PMSA 1BI7A 2RSVA 5CVFA 4BRXA 2XUUA 2YACA 2GS7A 3NYVA 4QYGA 3COIA 4BKYA 2OKRA 3QXOA 1ST0A 4ZLYA 2XBAA 2VO0A 4D2SA 3AGLA 2GMXA 4EH4A 2YDJA 4FV9A 5GIOE 3OVVA 2O3PA 4EOMA 4E20A 3AKJA 5HIDA 2XNEA 1WBVA 2BDFA 2VTJA 5AV2A 1LEZA 2ITUA 4RWKA 1ZLTA 5IQCA 4WNPA 1WBNA 4XG2A 4WRSA 4Y8DA 4ZTRA 4PL4A 4JQ8A 1P4FA 4CLJA 3NX8A 1R0PA 4O0VA 5FTGA 4RIXB 3WF9A 5EQYA 1ERKA 3Q4UA 4Q2AA 4YZ9A 3SXRA 5E8ZA 4JG6A 4RMZA 3PUFC 3MYGA 3R22A 4TTHB 2H6DA 5FXRA 3E8DA 2DUVA 4GIHA 3QYZA 4BBEA 1H24A 1V0PA 2YZAA 4KB8A 4QNAA 3GCPA 3UO4A 1OGUA 2VD5A 3TNHA 4QMQA 5CNNA 4QEBA 2PE2A 4A06A 4JX7A 2OF2A 3R7OA 2GQRA 4EH3A 5LVLA 4AOJA 3TNQB 4G16A 3LM5A 4PWNA 5FEQA 5JFWA 1W7HA 2YIQA 3GC8A 1H00A 2XVDA 5FUTA 4APPA 3GB2A 4NKAA 3NUPA 4BGGA 3FZTA 4FZFB 4YR8A 3ERKA 3BBWA 1W2CA 1Q8YA 3LFCA 3NUSA 4IE9A 2H96A 3PIZA 4GKHA 4CG8A 3NIEA 5HIEA 4U97A 3R9RA 3HV5A 5HU3A 3I60A 3OS3A 2FB8A 2J0MB 3JVRA 3QLGA 1M14A 2W1FA 2J4ZA 4GT4A 4C4IA 5HLPA 3IW8A 4L46A 4HVDA 5CQUA 3C51A 3U4UA 4RQVA 5KBRA 5A6NA 2ZOQA 4LV8A 2ZV7A 5B0XA 4AT5A 5CZHA 1JSTA 3W0RA 2NP8A 1GZOA 2EWAA 5AJQA 4H36A 4MWHA 5JQ8A 1IEPA 1JWHA 2F4JA 4EHEA 4KKEA 4I93A 4FNWA 4WSQA 4PDPA 4YTHA 4K33A 3AMYA 5GJFA 4ONAA 3QRKA 4ASXA 5K5NA 1IA9A 3T8OA 2XNOA 4GMYA 2HXQA 3R8VA 5BMMA 3L1SA 3KRXA 2PVFA 3QHRA 3NVMB 4DT8A 1STCE 2CN8A 4HCVA 1JKKA 4C4JA 5EDQA 4M84A 3CJGA 3NS9A 4GIIA 5DR2A 3H30A 2Q83A 2GTMA 3OMVA 4Y5QA 4WG4A 3LVPA 3EB0A 3LCKA 4EKKA 3R9NA 4DGMA 1QPCA 4U0IA 2BIKB 4YC3A 5ANIA 4ZTNA 1H28A 3BBTB 3CGOA 1J91A 4YJUA 4EKLA 5HICA 4PPCA 5CWZA 4RQKA 4R78A 5E8XA 2PU8A 3L9NA 4NL0A 1U4DA 4IB1A 5HO8A 3NGAA 1GOLA 5FEEA 3VUKA 3ZM9A 2I0VA 3ZU7A 4O0RA 1CM8A 4IWQA 4XRJA 3V5JA 4QTBA 5HIBA 5IKWA 2BIYA 2C3KA 3LFFA 4FR4A 4IADA 5HQ0A 3W1FA 4DITA 2P0CA 2R4BA 3WF7A 4AN3A 2O5KA 3F2NA 5EI8A 4C7TA 3AC2A 4JQ7A 3E92A 2W5BA 4FKUA 4BTJA 3K2LA 4XH6A 4CFUA 4BDAA 3F88A 4JR7A 1OB3A 2J0IA 4EOOA 4CFMA 4JX3A 4KIKB 2XNGA 5E8YA 3CSVA 5AFVA 4BKJA 5I4NA 3MJ2A 5E92A 4XP3A 3Q5IA 4K11A 4F78A 1Q97A 2QO9A 3V8SA 3FXXA 3QTIA 2X8DA 4O2PA 3RM7A 4TY1A 3WILA 2IW9A 4WBBB 2C6TA 3DDPA 3CC6A 1HOWA 2QLQA 2UW8A 4L7SA 5D11A 3D0EA 5EYMA 3DA6A 2Z7SA 4L44A 3R83A 4ARKA 2HELA 4AN9A 4G6LA 2Z60A 2Y0AA 5IG1A 3JPVA 3PLSA 5FQDC 2RFEA 2XKEA 3L8SA 1XHAA 3UPZA 4Y46A 4BCQA 2VTTA 4OTFA 1Q62A 4KKHA 5A4QA 1PXOA 4MBIA 4IAYA 5CU0A 5L2SA 2YDKA 5AWMA 4F99A 1JPAA 4D58A 1PJKA 3TV7A 1ZARA 5A4CA 4MQ2A 2FSTX 4MXXA 4XG8A 2ZV2A 4X2NA 3VRZA 5DT0A 5F95A 4BWXA 4A9SA 1UWJA 4E4XA 4FUYA 5CVGA 3MBLA 5EH0A 2RFSA 2HYYA 4Y5HA 4HZRA 4BIEA 2Z02A 3ZBFA 4BL1A 3Q6UA 4YJRA 2PZ5A 2XKCA 4LL0A 3UG2A 3OY3A 4BDGA 3U6HA 4XLVA 4PTGA 2C6KA 3FMMA 2UVZA 3KF7A 5CENA 4AW0A 2PVKA 5HCZA 2XF0A 3UQGA 4E6AA 4RRVA 4I0RA 2W9ZB 4TYHB 4HVSA 2XIYA 2XZSA 2RFDA 4O82A 1ZRZA 2PYWA 3HV7A 3PVGA 4W9XA 2PY3A 2FVDA 3E8EA 5BPYA 3F3WA 3ZO4A 5EKNA 2HZNA 4IZ7A 3A4OX 2BDWA 2Y8OA 4PY1A 5IA4A 4N4SA 5CAPA 4XBUA 5EHLA 2BRGA 4QP3A 4YO4A 3IW7A 4NU1A 4X2JA 1M17A 2J50A 4WUAA 5HE3A 3W0PA 2C1AA 4JVGA 1G8AA 4XX9A 4TWPA 3OWJA 5IEXA 4FA2A 4MNFA 4AQCA 4L53A 4YBJA 3UGCA 3TUCA 2BHHA 3QBNA 5CSXA 3PXYA 4RJ5A 4BDFA 3I1AA 3H3CA 3HRFA 3KC3A 3EIDA 3TZMA 3F7WA 2PK9A 3P0MA 3VBXA 5LMAA 3MW1A 4U3YA 5KZIA 5CASA 4GFOA 4DG2E 3CE3A 1VLRA 4JG8A 5M07A 5AM7A 2P2HA 2CGVA 2VTSA 3CTQA 2UW3A 1L8TA 4IX3A 4RWJA 1YI4A 3TTJA 5BYYA 4R3RA 5DVRA 2OICA 3W8LA 4DHFA 2IZTA 2F49A 4BIBA 2F7XE 2JDOA 2ERZE 3E8NA 3FLQA 3QYWA 5HCYA 5IUIA 3SRVB 2BUJA 5JN2A 5IH6A 5HTCA 3DBDA 5GIPE 3TIYA 3W0NA 4ENXA 4FEQA 2GHMA 3OY1A 2QC6A 5T6KA 5FP6A 3EN9A 5K3YA 2VTIA 2GNGA 3QQKA 5JZNA 5IQBA 1KE9A 3HMNA 4FVPA 3UC4A 1T45A 3ZSGA 3ZLSA 4AN2A 4L6QA 5CXHA 4I92A 3WE4A 3F2AA 3NZ0A 4IWDA 4RFZA 3PY3A 3SAYA 2NNWB 3MDYA 2QOKA 2W1GA 3FQSA 3FSFA 4AE6A 5HI2A 3W0MA 2QU5A 1OBDA 3PVWA 5J7HA 4O21A 3VONA 3Q9YA 3QKMA 1YWNA 3MS9A 1U5RA 3F6XA 3KXNA 3O2MA 4HGTA 4ZY5A 1LUFA 4F65A 2QOFA 4CQGA 5LWMA 3PDTA 4E26A 4IH8A 2X1NA 3HZTA 3IKAA 5AMNA 3UBDA 4D2RA 4FG9A 1QMZA 5EG3A 5CAUA 4E5WA 2HAKA 3ZSIA 3QRTA 1GNGA 1AQ1A 4L52A 5AP3A 3PXRA 1YKRA 2FUMA 4FTRA 4PTCA 3W33A 3BE2A 3MVJA 5EYDA 4EOQA 2W1HA 4AFJA 5AUVA 4ZMEA 5AR7A 4L68A 3F3TA 1U59A 2EXEA 2BCJA 3DK3A 4CYIA 3SW7A 5GINE 4MD8E 5C8KA 2B9HA 5IMXA 2XK4A 3VUMA 5KMOA 2VWXA 3PA3A 4I0TA 4DFLA 5C27A 1BUHA 5I9UA 5D12A 3MY1A 4Y83A 4JDHA 1SZMA 3PVBA 3KIOC 3FMJA 4B7TA 4FEUA 4IJ9A 2RF9A 4P90A 2ITPA 3RAWA 5IQAA 3ALNA 4HVHA 3R2YA 2XNPA 4IC8A 2VRXA 3IQ7A 3E3BX 4F70A 3VS2A 1BX6A 1NA7A 3PZHA 2GFCA 4OLIA 4ZIMA 3UNJA 4FT7A 4X21A 4M66A 3HRCA 5CU6A 5ICPA 4JS8A 2W1CA 1UV5A 2IZUA 4AG8A 3LFQA 4NM0A 2YAAA 4FL1A 4M8TA 2R64A 2F2UA 3NYNA 4F0FA 3FMLA 4C34A 3SVVA 2DYLA 4X2KA 3CQWA 2C1BA 1PKGA 3TJDA 4MXYA 5KZ0A 3A99A 4MNEA 3HA6A 4EWHA 4QMYA 1H27A 4GFMA 1VJYA 4F7SA 4IVBA 4OUCA 2O63A 4IEBA 4AA4A 4Z7GA 3P1AA 3B2TA 4ITIA 4MNEB 1M2PA 1PXPA 1BLXA 2XP2A 3K5VA 4QO9A 5DRBA 3MPAA 2A2AA 3DKOA 4DAWA 2ONLC 4Z16A 4H3QA 3KMMA 3UJGA 1MQBA 1UA2A 4C37A 4U5JA 1MQ4A 3AT4A 1H1PA 4FTUA 3IW4A 3QTZA 1TQMA 4EK3A 4F6WA 3HLLA 4J96A 2BVAA 1RQQA 4YHFA 5EM6A 1CKIA 5HGIA 3UP7A 2X81A 2QR8A 4F9YA 3ACKA 3F82A 4GJ2A 5CSHA 3PPJA 5JFXA 5IQHA 3CD3A 3U51A 4CD0A 1F3MC 4ZS0A 4MF0A 5HVJA 3TL8A 5K9IA 1KWPA 2B4SB 2XK7A 3DBFA 3HAMA 5BVEA 3C13A 3PXFA 5AR8A 3DXPA 4PDSA 1ZOGA 2B52A 2REIA 5CU4A 4ZP5A 2QOIA 1Y8YA 2ZV9A 1JSUA 2A19B 4V01A 3NNWA 2X7OA 4F1TA 4RC4A 3VWAA 4DH5A 4YP8A 3VBVA 2G1TA 3RKBA 4IB3A 5HHWA 4DTKA 2QNJA 1P2AA 2HW7A 3NWWA 4IDTA 4JT3A 5CAQA 5AIKA 1RW8A 2B53A 5KO1A 4D4SA 4OAUC 3PJ1A 3QALE 3VW6A 4QMNA 5HO6A 5TKDA 1WBOA 2I40A 3DJ6A 1WAKA 1XH7A 2YIWA 2FO0A 2QKWB 3G51A 2PULA 3D9VA 2PZRA 4GU9A 4NZWB 3VUDA 5IA0A 2EVAA 2R3GA 4Q5HA 3EQPA 4UX9A 3B2WA 3DBCA 3TWJA 4N6ZA 2JKQA 4XLIA 5HVKA 5EKOA 4FSMA 1V0BA 4C8BA 2OIDA 3DGKA 5ITAA 3UQCA 2J5EA 2OXYA 5AUXA 1VYWA 4QMXA 3FLSA 3GCVA 4GL9A 2X0PA 5M56A 4M7IA 3TDVA 3GFWA 4PMMA 3OOGA 4DG3E 4CKJA 4QP7A 1OPJA 3PRFA 2ONLA 4WIHA 2WTCA 5DT3A 1Q41A 3POOA 4ZMFA 3FZOA 3ZC5A 4BDCA 3GCUA 4U44A 3BWFA 3GUBA 3OWPA 3KK8A 1K3AA 3KB7A 2XAMA 5HORA 4EZ3A 2WNTA 3MVHA 4HYUA 5HBHA 5F94A 3CR0A 3NCGA 4FIGA 5BYLA 1TFFA 3IDCA 3A2CA 5AUZA 5GZAA 2YABA 5BV3A 2A27A 2IVSA 4F7JA 4S30A 4AW2A 4Z3VA 3QTXA 4PF4A 2LGCA 4F7NA 5HTBA 5HOAA 3QX2A 3UVRA 3C4XA 3LPBA 2ITVA 2OGVA 2I1MA 3UC3A 2OF4A 4UBAA 4DDGA 4S31A 3LFEA 4A4XA 5AAEA 4EUTA 5IH5A 4FTNA 4RPVA 1APME 4MAOA 5TE0A 1A48A 2WOUA 3C5IA 4AW1A 3CS9A 3VUIA 5ANGA 1OI9A 1XH5A 2BZJA 4F9BA 4DF3A 4GJ3A 4MVFA 1U54A 3DLZA 5CEIA 3DJ7A 3OXZA 5HNIX 3QQHA 3N9XA 4O0UA 4RA5A 3Q04A 2WELA 5IDPA 4BR3A 1B39A 4RWLA 4ZY4A 1MRUA 1YHWA 2JIUA 3ZFXA 4QMMA 1XMMA 3KA0A 4EEVA 4IB0A 1L3RE 3MIAA 4BI1A 3VN9A 3FI3A 2VO6A 4XYFA 5M55A 4KRDA 3LCSA 4I3ZA 4JIAA 4FKPA 4QP8A 3I7CA 4O7ZA 3FV8A 5CANA 3LFAA 1BI8A 4BYJA 4E93A 3WIKA 3OXTA 3SKCA 3VULA 5L8KA 2Y4PA 4HZSA 4EYJA 2E9OA 2QHNA 1PXNA 2UZDA 3C0GA 3HDNA 3NPCA 3PIYA 3NEWA 1O6LA 1G8JA 3ORKA 3MGYA 4BBFA 3FJQE 4LGGA 4YLJA 4I6QA 3HDMA 3WZKA 2OH4A 4CFVA 2G9XA 2ITOA 3WYXA 1BL6A 3Q52A 4FTQA 2QO2A 3BX5A 2JD5A 3UMXA 1S9JA 5I3OA 2QR7A 4EBWA 4XG6A 1Y91A 3QTSA 2C6IA 4IWOA 5ETFA 4JBQA 4MD9E 2ZDUA 4YU2A 1IAHA 4FGBA 5L8JA 2OIBA 4C38A 3RAKA 1P5EA 1Y6AA 4QP1A 3VS7A 3G15A 1W2FA 2UZLA 1PHKA 4XG3A 4FZAB 4Q9ZA 2QLUA 1WMKA 4LOPA 3MVLA 4BGHA 4DH1A 2X7FA 4TRLA 5ANJA 1XBCA 3PA4A 3H10A 4Y72A 4D5HA 3F9NA 5CSWA 3OXIA 3GGFA 4KIQA 5CS6A 2CLXA 4AS0A 4O91A 2J0JA 4EQMA 4CT1A 3HYHA 3VS1A 4XV2A 5M08A 5IPJA 3IW6A 3EQGA 3F61A 3HGKA 4RT7A 2ITYA 3F7ZA 2O2UA 3C7QA 2QOCA 1JVPP 5AA8A 3HMIA 5IMEA 2PMNX 5C8MA 2QI8A 3OG7A 3V3VA 4C3RA 4CKIA 3R1NA 3A7GA 4CKRA 3BYMA 4TNBA 5L6PA 1AD5A 4CMUA 5BNJA 3G9NA 4F9CA 1GZ8A 3Q96A 4YJPA 5CAOA 5KMIA 2OJ9A 2O0UA 3GENA 3LQ3A 3MH1A 4FEXA 3FKLA 2BFXA 1OKZA 4JR3A 3BYSA 4TWOA 1ZMWA 4U3ZA 4XRLA 3O96A 5GNKA 2XMYA 2F7ZE 2WMVA 2UZWE 4UMTA 4U40A 5CZIA 4KNBA 2VTMA 5BMSA 5E8UA 3QA0A 3VUHA 3TN8A 4TL0A 4FV2A 3JUHA 3OTVA 3UOHA 3VVHA 4D55A 3VW8A 3W0QA 3QA8A 1ZYJA 1W0XC 2VTNA 2H8HA 4EOKA 4R5SA 3LXLA 3OBJA 1NVSA 2XNBA 4MF1A 3COKA 4BCNA 2HY81 3R2BA 2QOQA 5BX0A 4BWPA 2YLFA 3JS2A 4RVMA 5HD7A 2W1IA 1G8SA 2PMOX 4ORKA 4EH8A 2V55A 3QL8A 1P4OA 4JBOA 5CXZA 3EFKA 5EYKA 3VO3A 2VWWA 3GXLA 2GSFA 5AR4A 3UG1A 4NTTA 3KXGA 3FL4A 5L2TA 4NK9A 2XJ1A 2EUFB 3O8UA 3GC7A 2CCHA 2J2IB 2IZSA 2WMWA 4IM0A 4GU6A 4NM5A 3ZUUA 2IJMA 2G01A 2ZAZA 3LHJA 4R7HA 3VHEA 4CFXA 3OWKA 4IHPA 3EZRA 5HVYA 2R3RA 2QKRA 4G3GA 3NW5A 3A7HA 4H58A 4ANLA 3MVMA 3KK9A 2JDSA