2Z7RA

Crystal structure of the n-terminal kinase domain of human rsk1 bound to staurosporine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
288
structure length
265
Chain Sequence
GSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein S6 kinase alpha-1
publication title Crystal structures of the N-terminal kinase domain of human RSK1 bound to three different ligands: Implications for the design of RSK1 specific inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 265
sequence length 288
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2z7rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2z7rA01
2PVYA 3MFUA 4G6NA 3TN8A 3ORMA 5DEYA 4IM2A 4YJUA 4E26A 3M1SA 2YCSA 2CKEA 3L8SA 3TZ9A 4FTNA 1OKYA 3LW0A 3R02A 3E62A 4YNEA 1ZMVA 3OHTA 3BHVA 3RPSA 1OECA 4FTIA 4KBAA 4Z55A 4GIHA 5ITAA 3BPRA 4I4FA 5AX9A 2WMWA 4O22A 5EM7A 3KRJA 4RWLA 2HY81 3SXRA 1ZYSA 2OW3A 4PDPA 3W2SA 3VS7A 2B9HA 4Z9LA 2YACA 4B8LA 4YHTA 3FY0A 4MBLA 4PUZA 2ITNA 4ZS0A 3V6SA 4BCHA 4F6SA 5JH6A 2PVHA 3UNKA 2Y7JA 3FKLA 3NGAA 2A4LA 4ALVA 5TKDA 2UUEA 3V5TA 5EH0A 4JI9A 4A07A 4AF3A 2WU7A 4CMOA 5BQ0A 3O17A 3Q9YA 4C36A 4MBJA 4GFGA 3THBA 3EFKA 1YWVA 4L7SA 1KOBA 1YDTE 3KREA 2C5YA 2VTOA 1TQMA 4GRBA 1O9UA 1NVRA 4E6DA 2X6DA 3RPRA 2UVXA 3NUUA 3HA6A 1XH6A 4AS0A 4YZMA 3BQCA 4EH3A 2BHHA 3R7EA 5KMIA 1NVQA 1XH9A 4B9DA 1KUTA 5CXHA 1Q3WA 3MFRA 2O5KA 4NJ3A 5DT3A 4K8AA 5FTQA 3RWPA 4NUSA 5EI2A 3O0GA 2W4JA 3SXSA 3U8WA 4CSVA 2E9VA 3QBNA 4J71A 2R3HA 2OH0E 5HG8A 3ZSIA 1OMWA 3LCOA 5FRIA 2R3IA 3MH2A 2CKOA 2QKWB 3VHEA 2DS1A 4J95A 2C6KA 4FV0A 4OTRA 4XG6A 3UG1A 2CLXA 3TTIA 4D28A 4H58A 3TUBA 3MDYA 4QT1A 2VWZA 1YQJA 3WZEA 3NAYA 4F9YA 3PVUA 3OP5A 2CGXA 4IAAA 3BBWA 4D4RA 3FEGA 3HMIA 3PIZA 2QVSE 4HYUA 4I0TA 4RIOA 4BHNA 5CEMA 4CG9A 1J1BA 4L67A 4BCGA 4E3CA 5IUGA 2WMUA 4O7SA 4CYJA 1CKJA 3R8LA 3MSSA 5CQWA 4I6BA 1MRYA 2HOGA 3R01A 3E87A 3RAKA 4LRKA 4DH7A 3UOLA 2IJMA 1W82A 1PYEA 3FQSA 4XP3A 3S95A 2VWYA 4QP9A 5EOLA 4HVHA 4E4XA 3NS9A 4M84A 4EQCA 5B2KA 4XLIA 3VS4A 4AGWA 3UVQA 4WNMA 4IWPA 5J5TA 4E4LA 5AIRA 5LMKC 4FV8A 4B7TA 4ZSGA 4I5PA 4E5BA 5J1WA 3BWFA 5FLFA 4YO4A 5A4CA 4J96A 4TWNA 1H28A 4U6RA 4QMNA 3TDWA 3N51A 4JG8A 4IWOA 4WNPA 3M2WA 4MNEB 4QP4A 3QU0A 4FODA 4L42A 4WSYA 3BV3A 1UU8A 3HA8A 4FTAA 4NJDA 1IAJA 1GZ8A 2YM3A 4C2WA 4KWPA 4BDAA 2FSLX 2Y0AA 4ASZA 2BRGA 4LV5A 5KMKA 3S4QA 1OIRA 3K5UA 5KUPA 2HZ4A 1BYGA 3KEXA 5EHLA 4U43A 2P55A 5AR7A 5A54A 2GDOA 2JDSA 3ZH8A 3L8VA 1CDKA 3GU7A 3BU5A 3QZIA 3P0MA 4IBMA 3UZPA 1HCKA 2J90A 2XEYA 3LOKA 4L45A 3U6HA 3KGAA 4O82A 3IK3A 4F08A 5J7BA 5GHVA 4AACA 4PPAA 3UIUA 3D2IA 2NNWB 4U8ZA 4TZRA 5LWNA 2IVTA 2B9JA 3RPOA 3EL8A 4W4VA 1Y8GA 5EG3A 3VUMA 4D9TA 4JVGA 4DEHA 4H3QA 3WF6A 2W7XA 5J8IA 4C3PA 2X81A 3DNDA 3MY0A 4OTPA 2EB2A 4C4GA 5LVNA 4FZFB 5C26A 5IQGA 3FI8A 2I7QA 2BIYA 3NIEA 3P08A 4JQ7A 3LFEA 2HCKA 4FA2A 5D7VA 4XG4A 3V01A 4X2JA 3GFWA 4APPA 4GSBA 4GUBA 5CEQA 1PXIA 1B39A 1WCCA 3C5IA 1Y6AA 1UVRA 2UV2A 4O38A 2J4ZA 3QD4A 3BV2A 4FYNA 4KKEA 4EC9A 1BMKA 3E64A 2W1EA 2P4IA 2OJFE 5C4KA 2GTNA 2QCSA 1FVVA 5AEPA 3H30A 3NYOA 1MRVA 5KMOA 4FSNA 1PMUA 4JS8A 2OK1A 5C27A 5KKRB 5IQAA 2X9FA 1YXUA 5BVNA 5ETFA 5EQPA 1GJOA 4E5AX 4GG7A 4YJSA 4FEUA 3RAWA 3BE9A 2WMVA 4IVAA 2CKPA 5EM5A 3DAKA 1B38A 2CN8A 3H3CA 4FX3A 3T9TA 3GOPA 2X7FA 4U44A 2YIQA 2C0TA 3G2FA 4FKSA 3W8QA 4J8NA 1VR2A 1PXOA 3DLZA 4AX8A 3CD3A 4EH7A 2ESMA 3E8EA 4O7RA 2BRHA 2R3KA 4GVAA 2V0DA 4QMXA 3ORIA 4CTBA 2F2CB 2OIQA 3MYGA 5IA5A 4FV4A 5KZIA 1UU9A 3F69A 4KS8A 5L2IA 1PYXA 4J8MA 3QKKA 2G15A 1QPJA 2PZRA 4EWHA 3ZLSA 5KBRA 2BILB 5F9EA 3OWKA 1O6LA 3VBWA 3VO3A 1J1CA 2XZSA 3LAUA 4WNKA 4ERKA 3ET7A 2PVMA 3IW6A 1VZOA 5E8XA 4RJ5A 3TXOA 3S0OA 3LLTA 1H0VA 3O7LD 1JSTA 4CXAA 2X4ZA 4QQCA 4ZY6A 3O2MA 5EDRA 3JUHA 2CSNA 4LMUA 4C62A 5A3XA 4JR7A 2REIA 4IWDA 3QTUA 4EH6A 5HU9A 3JS2A 2QOCA 1R78A 4KAOA 4G3FA 4C57A 3C13A 4NL0A 2UZVA 1JBPE 4MXAA 2JLDA 4TYHA 3I7BA 5BYZA 3UMXA 3ZSGA 5AAGA 2C30A 5DIAA 3C1XA 1AD5A 4WIHA 3Q04A 4E1ZA 3FHIA 4YJOA 4FKPA 4D2SA 2CCHA 2IO6A 4YUQA 5DGZA 1W0XC 5ANEA 3NRMA 4FGBA 4GVJA 2QO9A 4IADA 2VTPA 1SNUA 3S2PA 3QD3A 3VC4A 4TNBA 1JKKA 2YM7A 5KMJA 3HV4A 4NCTA 4HVIA 5HTIA 3SG8A 2X1NA 3QWKA 5E8YA 4EOSA 4D2VA 3ETAA 2OF2A 3HV6A 4C2VA 4RFYA 4YJVA 3PG1A 3ZO2A 3FZPA 4FNXA 4R6VA 5LVMA 3ORNA 5LMBA 4KIQA 1R3CA 4O0XA 1S9JA 3VHKA 1V0BA 4CZUA 4D0WA 1PKDA 3ZC5A 2QONA 1Q62A 5C8MA 4J97A 3VUIA 4IHPA 1BL6A 2QURA 3QHWA 2YA9A 3PPZA 3POZA 4X6QC 3SD0A 2W5AA 5I9XA 1BL7A 2WQMA 3LFAA 1WVWA 4GG5A 4I6QA 3TV7A 4YJTA 3U51A 5L6OA 3AD4A 3KQ7A 3FI2A 4CQGA 1L8TA 5HG7A 3R71A 4HW7A 1Z9XA 2W06A 3C9WA 4O7YA 4AN9A 4FIGA 4L00A 4TYGA 2HWOA 3LFQA 4MD8E 4QPAA 2CNUA 5H2UA 5I3RA 5AP4A 4QQTA 2YWPA 4FL1A 3WBLA 4ZZNA 4FNWA 4UN0C 5C03A 3PY3A 2WB8A 5CLPA 5EW9A 2J0MB 1TQIA 1OB3A 3OF0A 3PY1A 1T46A 1OKWA 4X3JA 4FSQA 2XBAA 3LCTA 1G3NA 3V8WA 3FY2A 5I3OA 3IGGA 1ZZLA 3IO7A 3NUXA 3TNIA 4AN2A 4EOJA 3QQUA 1KE6A 5DA3A 4A9TA 5L8LA 4GFOA 3Q96A 3NW6A 4L46A 5CENA 2OXXA 2C5NA 4EYJA 2UW5A 1W84A 4IVBA 2ZDTA 2C4GA 4A4OA 2VTJA 1ZY5A 3C4EA 4Y73A 3JVSA 2F7EE 4IH8A 4D4SA 4E7WA 1MP8A 2HZ0A 3BYVA 2X2KA 4MQ2A 3UBDA 5ANDA 4D2WA 5HX6A 2JDVA 1U4DA 3C50A 3L8XA 4EOLA 4O0UA 3Q52A 3D5XA 4MXOA 3A7GA 4DT8A 3PJ3A 3PWDA 3OBGA 3HP5A 2UZOA 2JAVA 3QLGA 4U3YA 4EOOA 1FBNA 5CF4A 3TKUA 3KK8A 4MAOA 3TIYA 5E8SA 4OGRA 4GU6A 4IZ7A 5CS6A 5DVRA 1LR4A 4L3JA 1P14A 2ZB1A 3NYVA 4LOQA 4PV0A 4S34A 4S31A 3BEAA 4DEGA 3PYYA 4Z7HA 3GGFA 2GNFA 2WXVA 5HHWA 3CY2A 5FDXA 5ACKA 3DY7A 3PXZA 4RRVA 3KA0A 4A7CA 2C5VA 2H9VA 3CQUA 1H27A 4WOVA 5CAOA 4ITJA 3ID6C 4AT3A 5HE0A 2ITQA 2UW4A 3QL8A 4NM5A 4Y8DA 2KTYA 5JFWA 2PZPA 2V7OA 3AC1A 4JBQA 4BDIA 5IA4A 1PMEA 4DLJA 3EN5A 3VN9A 4M0ZA 4EBWA 3NIZA 4EH5A 1URCA 4ASEA 3BQRA 4FTRA 5CAUA 5IF1A 4PY1A 4GK3A 3QX2A 2CKQA 3TNQB 3DXQA 1XHAA 4CV9A 2GFCA 3R9HA 3JR1A 1BI7A 4CLIA 2QO7A 3BIZA 3GCUA 2O65A 3H4JA 4CMUA 3QRUA 3RM6A 5D7AA 1HOWA 4BBMA 5CALA 1YXVA 3LQ3A 2CGUA 5HCZA 5IQDA 2QODA 4RWJA 5KBQA 5KKRC 3WOWA 3KULA 4DGLC 3FZSA 1F5QA 1URWA 4FTMA 3WZUA 4NT4A 2GNHA 3GCSA 2JAMA 2PZYA 1FQ1B 2OJJA 3CE3A 4RX5A 3LQ5A 3EKKA 3SA0A 3Q9XA 5BVWA 3VUDA 4KA3A 3BELA 4UMUA 3W32A 1YXSA 2QHMA 3FMNA 1JOWB 4PPBA 4OTDA 3UNZA 4XP2A 3SV0A 3EZRA 2OJ9A 5GZ9A 1JWHA 1P4OA 2OZOA 2OXDA 3VUHA 4BDKA 3PVBA 2W1FA 2ZMCA 3ZCLA 3IW8A 3K5VA 2ZV8A 4EHVA 2WU6A 4LG4A 4AAAA 2C0IA 3HRCA 1O6KA 4BYJA 3D4QA 5DN3A 1K9AA 3NNWA 4C33A 4ZJJA 3UOJA 3MA6A 4FV3A 5A9UA 3G9LX 3HV3A 2FH9A 3JY9A 2C6DA 5BYLA 3KRWA 3V51A 3P9JA 3PA3A 3Q2MA 4FIEA 4FG7A 4AP7A 2RFEA 3RINA 3ZZWA 3BWJA 4FZ7A 3ACJA 5IDNA 2QG7A 2YIYA 1PMNA 5HD4A 2WEIA 3OY1A 3QAME 2PVLA 3QWJA 3AG9A 4IC7A 3VW6A 5AR4A 4YZBA 2XNPA 3DDPA 4U81A 3FSKA 4AGCA 3GNIB 4ZLYA 3I6UA 3OZ6A 4FKUA 4QD6A 3GC9A 3P7BA 4J99A 5DI1A 3W33A 3FL5A 2PULA 2OJGA 5HVYA 3DTWA 1FMOE 4JBOA 2BCJA 2PUNA 4Z3VA 2B1PA 5EYDA 1GZKA 4UMQA 4RQKA 4O7ZA 4GL9A 2I0VA 3IQ7A 2W05A 4GYIA 3BYSA 3A7IA 3IDCA 4ID7A 1UV5A 4RJ8A 1ZARA 2FGIA 3I6WA 1JPAA 1VYZA 4EQMA 3UC3A 2ITYA 3P7AA 3V6RA 4IAYA 3CBLA 4HGSA 3TACA 2IG7A 1WFCA 4FL2A 3FYJX 3IOKA 4IXPA 4K6ZA 4APCA 5JQ5A 5EQEA 2O3PA 4OBPA 4OT5A 1YWRA 4ZK5A 2W9ZB 4C7TA 3FLSA 2R3GA 1XH4A 3R21A 4Q9ZA 4FTLA 4O0SA 2BRMA 5FDPA 4U79A 3L8PA 2BDFA 2C6EA 3EOCA 2JBOA 2C0OA 3MJ2A 4DEAA 4XRLA 5D11A 2PHKA 5KMNA 3DK6A 3MH1A 4I24A 3OMVA 4YZDA 2YM4A 4I0RA 2VNYA 4BTJA 3FDNA 2A1AB 4IE9A 5JK3A 3D5VA 3JYAA 1TVOA 4ZJIA 3QCXA 4DFZE 1Q24A 5L3AA 2VNWA 3OT3A 4C0TA 4E93A 4DE4A 3UIMA 3N4VA 2AUHA 2DUVA 2XIKA 1LPUA 1WVYA 4P5QA 3TDVA 5H8BA 2IVSA 4NIFB 3E3BX 3IPHA 1WBNA 4XUFA 3FSFA 1Y57A 3NDMA 2ERZE 2BVAA 3IOPA 4Y46A 4AW2A 4NW5A 2WQEA 4ORKA 2X2LA 4RSSA 3ZBFA 1BLXA 4AE9A 2XEZA 4RWIA 1ZY4A 4JT3A 3I79A 4Y83A 5CWZA 1PHKA 2YJRA 4QP3A 3VS2A 1UA2A 1WBOA 2B54A 3R63A 3VS0A 4DITA 2VX1A 5K5NA 2ZV2A 4M69A 3E8DA 2HY0A 2HZNA 1Q61A 2HXLA 4JL9A 4EK5A 4RBLA 3ZM9A 3BZ3A 3IGOA 3MY1A 2ZDUA 3RHKA 4BCQA 5J7HA 2V22A 3OC1A 2X8DA 4RX9A 5E8TA 2BZJA 2E9PA 4BIBA 5AM6A 3P78A 4DCAA 5IH4A 1OVEA 4FNZA 3DXNA 4X2NA 2XYNA 4FKLA 2XIXA 3C4XA 2WD1A 3FKOA 4I1ZA 4I94A 2ZMDA 4LM5A 5HU3A 5AFVA 4J1RA 4EH2A 4FSTA 3UC4A 5CU0A 2VN9A 2EXEA 3TUDA 1H4LA 3AD5A 2C3KA 2O63A 4HYSA 4IM0A 3F6XA 3AC5A 4IAFA 1GIJA 5EQYA 3FQHA 2IZTA 5EM8A 2X7OA 4AT5A 4TYJA 4F0GA 5CSPA 4W8EA 4AXAA 3R28A 3H10A 2IVUA 2GQSA 4BR3A 2GS2A 2Y8OA 4L52A 1QPCA 5ANKA 4F7NA 5J9ZA 4DFBA 4XCUA 3DTCA 3G33A 2GFSA 4BTFA 4GUEA 4WG4A 5EW3A 3R8ZA 2GPHA 4FG8A 3ZDIA 1Q5KA 1Z5MA 2O0UA 2HW6A 4JDHA 4WT6A 5HTBA 5M44A 4AGUA 4D2PA 1OPJA 4MQ1A 3SQQA 4B6LA 3WF7A 1I44A 5FXSA 3RK9A 5IQEA 1XR1A 2J0KA 4BKJA 4G16A 4DN5A 4NU1A 4FEVA 4FSWA 3FXWA 1KE7A 4UB7A 1XWSA 2JBPA 3MPAA 4DBNA 2QOLA 2PVRA 3FZTA 2XYUA 1GY3A 2OLCA 3R8MA 5EDPA 2R3QA 4ZTRA 1XH7A 1M17A 4YU2A 2XCKA 3RAIA 4TN6A 3CQEA 5LMKA 4RIWB 2V7AA 5HOAA 1JSUA 4ACGA 3VBTA 3RGFA 3F7WA 4AW0A 4NYEA 3SOCA 5IQCA 3D14A 5IH5A 3O8UA 3QALE 3MVJA 3ZSHA 4S33A 2C47A 1RW8A 3ATTA 3G15A 4KIKA 5K4JA 2JGZA 3L9PA 3NUPA 4H05A 4AW1A 4FTCA 4EHZA 3N4TA 3AC8A 1V1KA 4O7NA 4GYGA 4AU8A 2XKCA 4Y72A 4PP9A 4ACHA 5HVJA 4ANQA 4QYHA 3CKWA 2W1DA 1RQQA 3ACKA 3HMPA 3EB0A 5EDQA 1I09A 2Y4IB 1PXJA 2ZV7A 5FXQA 1BX6A 1Q8ZA 3BKBA 5A6NA 3QKMA 5GJDA 3D7TA 5HIDA 3TCPA 3VBQA 3MW1A 4YJNA 4XS2A 5LARA 3RM7A 4LL0A 2Z02A 2RG6A 4EKKA 2R7BA 3O51A 3IONA 1OGUA 3EZVA 1PKGA 3EYGA 4L6QA 4MNFA 2J7TA 5ANIA 2YCQA 3OFMA 4O6EA 3MN3A 4F7LA 4X7QA 4MXYA 4ANLA 3ZEPA 3AT3A 2ITOA 4FKQA 3KN5A 4M66A 4I22A 4MCVA 4QRCA 1PF8A 1U5QA 1JKLA 3AT2A 5DEWA 4YMJA 1VEBA 2EU9A 4JIKA 5A4QA 3WZJA 4O0WA 3RPVA 4EHEA 4XV9A 4FTJA 4D0XA 4YLKA 5C1QB 3BLRA 1GAGA 5I9UA 4BICA 3UP2A 2CPKE 1ZYDA 3U9CA 3KN6A 4FVRA 4BDBA 2ZVAA 2ZM3A 3LJ0A 3EFLA 5HGIA 3FLWA 1YOMA 4GT3A 2OWBA 3DKOA 2Q0NA 3QRTA 4OAVB 1YW2A 3AMBA 5HICA 2QC6A 2VTAA 4DFYA 1PXKA 1UU7A 5IEVA 3GEQA 3WF9A 4LFIA 3LFFA 4BCJA 3FLZA 3NX8A 4BTKA 3OWPA 2CMWA 4F1MA 4K18A 5BUEA 2PYWA 3SW4A 3UO6A 4C34A 4D55A 3UZTA 5M56A 3RTPA 3T8OA 5I9ZA 2XJ2A 3OOMA 4NM3A 3RKBA 2PE1A 2C69A 2XMYA 4EK6A 2CLQA 4P5ZA 4ZLOA 3KK9A 4F1OA 3B8QA 2W17A 4H39A 4QPMA 2ACXA 3HV7A 4LGGA 4YP8A 4UXQA 4W4XA 4YC8A 1YI6A 5AV2A 4XG2A 2P33A 4ZP5A 2C68A 1MQBA 2VTIA 3EN9A 5HO8A 2QKRA 3R2YA 3HNGA 4YZNA 4DH5A 1Q8TA 4L3LA 2WOTA 2QR8A 2GTMA 3R1SA 5AUVA 4UMPA 3S3IA 4P2KA 5BMSA 5DYJA 1GOLA 3RAHA 3G5DA 4C4FA 5K4IA 2QI8A 3COHA 4ANOA 4FT3A 5J87A 2XNBA 4FNYA 4HYHA 5LCJA 4IB1A 2YDIA 3F5PA 4CKJA 3ZBXA 1OUYA 3LPBA 3AMAA 3II5A 1G5SA 3F3TA 4BGGA 3QFVA 4XJ0A 5AJQA 4B99A 5E8UA 1ZLTA 4BBFA 2QLQA 2HENA 3MI9A 2BMCA 3OW4A 5DR9A 3BLQA 4G31A 2JEDA 4X2FA 3QD0A 4P7EA 2WOUA 3E3PA 4CFNA 2H96A 3NWWA 1GZNA 4K9YA 2R3MA 1E1VA 4CZYB 4DLIA 4OR5A 3PVGA 4TL0A 3FZ1A 2J5EA 4DFUA 3TEIA 3VUKA 3QXOA 3FMKA 3ORXA 4XH6A 5F94A 3TNWA 3MIAA 4IEBA 4V05A 3QD2B 2Y6MA 4FKRA 1FPUA 4KSPA 1DAWA 5FP5A 4DTBA 1H0WA 4YTFA 5L2TA 4Q2AA 2WGJA 3MS9A 1BUHA 1GIIA 3ODZX 3AGLA 1H26A 3TJCA 3ALNA 4EL9A 5KX8A 5LJJA 4W4YA 4YC3A 5E8ZA 4J98A 3BGQA 3UPXA 4BF2A 5CAPA 4QMVA 4TWPA 3R8UA 4D5HA 5K9IA 5FG8A 4R5SA 4E8AA 3RP9A 5JEBA 1NY3A 4YBJA 4BCOA 4F9CA 3MPTA 4ZAUA 4WBOA 3H9RA 4TKSA 5E1SA 4BCFA 2BALA 5HIBA 3UMWA 1ZYJA 3DAEA 4AA5A 4GMYA 5A6OA 5GJGA 4HGLA 4BIDA 5T68A 2PSQA 2XH5A 4G34A 2W1CA 1SVGA 2XJ1A 2XUUA 4RC4A 1XH8A 4TW9A 5CEPA 4YPSA 2OH4A 4EORA 3R9NA 3MESA 3LQ8A 2VWUA 3HVCA 5EFQA 4HJOA 3GU5A 2Z60A 2JD5A 5E92A 2UZNA 4FT5A 4G3EA 2C6TA 4GK4A 3UTOA 1G8SA 2GNIA 2IZRA 5FXRA 3A8XA 1WBWA 4BZDA 2I6LA 3CSVA 2HAKA 4L01A 3OWLA 3RZBA 3WARA 1NVSA 5FD2A 2WO6A 5FGKA 4JX7A 5TOZA 3NVMB 1A9UA 3NNUA 4YTCA 2XRUA 4J52A 4F9BA 1X8BA 4AZTA 1KE5A 4WG5A 3ROYA 4WA9A 4H3PA 1S9IA 3ITZA 4PQNA 5CVGA 4H36A 2F7XE 3F3ZA 4DG0E 3NSZA 3CTHA 2BPMA 2GMXA 4BDJA 4NFMA 3DBEA 3S1HA 4D9UA 1P2AA 4KB8A 3VIDA 4BB4A 1OKZA 3VUGA 5AA8A 2F49A 4PPCA 4C59A 4RC2A 3TM0A 2OF4A 5AUZA 4FZ6A 4IAIA 2G9XA 2FO0A 4RPVA 4BCKA 4FUYA 3KXNA 4HCUA 3FHRA 4X3FB 4U3ZA 1XBAA 3I4BA 2QD9A 3MVHA 3ULIA 4U80A 3NYXA 4HVGA 4AE6A 4HYIA 2BUJA 4QP1A 3WE4A 2YM5A 2YFXA 3PP1A 4PNIA 4XLVA 3CY3A 3DKFA 5JFXA 4A06A 4ZTHA 2R64A 3KXXA 1GNGA 2ZM4A 5G1XA 4IX4A 2QNJA 4DC2A 5GZ8A 3A4OX 2WMBA 3CC6A 4ZTNA 3RHXA 2J9MA 3F7ZA 4YLJA 3IECA 3PSCA 3CGFA 3BE2A 4MNEA 4UMRA 4IANA 4D2RA 2XF0A 5E7RA 4YJPA 4O83A 4ZSLA 3AC3A 2YJSA 4O0VA 4QNYA 2VX0A 4Y5QA 3FL4A 3I60A 4IIRA 5F1ZA 3U4WA 4Y85A 3ZZEA 5BUIA 2E2BA 3HX4A 5AV3A 4AA4A 4DG3E 2PE0A 1VYWA 3HP2A 3AD6A 4PTEA 2Y4IC 4OTGA 3PRFA 2CJMA 4UX9A 3W2QA 2UW7A 4FG9A 4O0TA 3OTUA 5HKMA 3DFAA 5M51A 4R8QA 3JXWA 3PJCA 3RVGA 4MX9A 4WRGA 2IPXA 2ZJWA 2A19B 3LCDA 4AZVA 4CGAA 3DBFA 3R04A 4F7SA 4CZTA 4B0GA 4TYHB 4OW8A 2RIOA 4LGDA 3D94A 2BKKA 4TYEA 2E9OA 4KNBA 4E4MA 4O7VA 4E20A 1W98A 3BRBA 4O21A 1UWHA 2ERKA 4EOKA 1CMKE 4ZTMA 2ONLC 3DFCB 4I5CA 2B53A 4W9WA 3R0TA 4O7LA 1JSVA 3RCDA 4MWHA 3ZXTA 3UIXA 1OL7A 4BKYA 4BRXA 4D4VA 2WELA 4I6FA 5IKWA 3QZGA 4I20A 4FOBA 5JN2A 5HG9A 1Q8UA 1M14A 2YLFA 2PZ5A 3GB2A 2R3OA 3F2NA 4RIXB 1YOLA 3ZFMA 5J5SA 3FBVA 3GT8A 4N70A 3U4UA 3F3VA 4KBCA 5HNBA 4EBVA 3UP7A 4IJ9A 3PJ8A 5CVHA 3CIKA 2OJIA 2VO3A 3UYSA 4AQCA 4F0FA 3F5UA 2X7GA 4FKJA 1F3MC 2C6OA 4GW8A 4FT0A 3GU4A 3IKAA 4FE2A 3VS5A 5M09A 3TNPC 5IA1A 3U6IA 3EN4A 2WPAA 4YO6A 5AADA 1FGIA 3FMHA 4UBAA 4JIAA 2BRNA 2QG5A 1OKVA 3KB7A 4YTIA 2GQRA 5HESA 1G8AA 1Y91A 2BR1A 4BTMA 2WAJA 3QUPA 5CF8A 5M55A 2VZ6A 2BZIB 3HAMA 3T3VA 3DJ6A 3QUEA 5E8VA 2G1TA 2JKMA 4FSMA 2W99B 4JBVA 2X0GA 2PVFA 3O71A 4HGEA 3F82A 4IFGA 3OCTA 3F3WA 4P4CA 5CVFA 4BZNA 4EKLA 1SNXA 3R1NA 5F95A 4DTKA 2WIPA 3OD6X 3VF8A 3DS6A 3ZO1A 2OZAB 3KMWA 3PXRA 1ZAOA 5GJFA 2I0EA 3PXKA 3VJNA 2R3RA 3BYUA 4AOTA 4CFUA 5FEQA 3NW7A 3DZOA 1OL1A 3LCSA 4JDKA 3SC1A 2H8HA 3U9NA 1YI3A 3KXHA 3B2WA 5JQ8A 2LAVA 5KHWA 3Q4ZA 2VTQA 3QQLA 4IDVA 3Q3BA 5AP5A 3UQGA 2CNQA 1Q4LA 1K3AA 3KMMA 3Q4TA 3M11A 2UZBA 2F7ZE 4WNOA 2BZKB 4G3CA 4EOMA 3MA3A 4YZCA 3BGZA 2CGWA 1OIYA 3RK5A 4JRNA 4YBKA 4MD9E 1SYKA 3TWJA 2VUWA 2G2HA 2CCIA 2Z2WA 4USDA 3BLHA 3JPVA 1DI8A 2I1MA 5LOHA 1CM8A 3GENA 2GU8A 3LM5A 3ZS5A 3C4CA 2X6EA 5M4FA 4GKIA 2VRXA 5CT7A 2VU3A 3CJGA 5AIKA 2WQBA 2KULA 3R73A 1ZMUA 4QTCA 5K5XA 4AW5A 2OSCA 2YIWA 1GIHA 5CSXA 5JRSA 2R3PA 2CDZA 1M52A 2QOIA 4E73A 2QU5A 4ITHA 4X0MA 3NZ0A 2UZTA 3HDNA 3FZRA 2GS7A 4FYOA 4ANBA 3R7GA 1OL5A 1Y8YA 2BTRA 3EQBA 3FYKX 4QMOA 5EI6A 4CRSA 4DEEA 5I0BA 4IB3A 2XB7A 3O50A 5L2SA 4KUJA 3R9OA 1ZZ2A 1ERKA 2EUFB 3OEZA 5LMAA 3EH9A 4MTAA 1DAYA 5EYCA 1H07A 2QO2A 4HZRA 3VRZA 4EZ3A 1QCFA 3CP9A 4QP7A 3ZRLA 2ETMA 3DLSA 2UW6A 3GC0A 3QHRA 4USFA 2VTSA 3ERKA 1ZMWA 3BHYA 4FZAB 5DR2A 3NUYA 5ANJA 4CMTA 4HVDA 2XA4A 5AP1A 5BMMA 1YKRA 1Q41A 4MXZA 4BVUA 4DGNA 4ZZMA 3HLLA 3QQJA 4LI5A 1F0QA 5T6KA 2GSFA 3QA8A 3LXKA 2GHGA 2O8YA 4KS7A 4M12A 2OG8A 2QQ7A 4EC8A 3TT0A 5CSVA 2CHLA 4UYNA 3VBXA 2YM6A 5M4UA 2XNNA 1IG1A 5AP3A 4BIEA 1WAKA 5IUIA 5DT0A 3VUTA 4BDHA 5FBNC 5JSMA 3K2LA 4CKRA 4IACA 2R0UA 4WSQA 2YEXA 2XKDA 3NNXA 5JFSA 4G5JA 4RZWA 2Q83A 4KSQA 4DEDA 5KMLA 5E9EA 3BU6A 3MVLA 2YAKA 3AC4A 5AUYA 5AR3A 5TT7A 2RKUA 4GV1A 4AWIA 5AA9A 3K3IA 3KMUA 3LFBA 4FKTA 4G6OA 2B7AA 3QGYA 4PTGA 1OI9A 4J53A 3PIYA 4C4JA 4X3FC 3EQCA 3W2OA 5D9HA 3R7VA 1IR3A 4CFXA 4PL4A 4JR3A 4CQEA 5D1JA 5KE0A 3R2BA 4O1PA 5HG5A 4C37A 4FKWA 2QOBA 1EH4A 4IMYA 5CU4A 2WEVA 4TNDA 5CTPA 4G5PA 4F6UA 5TO8A 4DH1A 2VTHA 3KVXA 4CCUA 3N9XA 4ZIMA 5IQHA 4OBOA 1Z57A 2JKKA 3MPMA 5CU6A 2F9GA 2QOQA 3HRFA 3D83A 4EK4A 3LE6A 3CTJA 4CTCA 4ZJVA 5DRDA 3A99A 4OTWA 4V0GB 5EI8A 3W1FA 4O84A 2ITVA 3LXLA 2J50A 3PIXA 4CYIA 1KSWA 4JDIA 2YN8A 4A9RA 3VW8A 2YZAA 3VQHA 4FSUA 1H00A 2GNGA 1PXNA 3CS9A 3PUPA 4FTUA 4GJ2A 5AR5A 3WZKA 2XIZA 3ZM4A 4BGHA 5HNIX 1AQ1A 4M97A 2X8IA 1SM2A 4S32A 5AM7A 4BGQA 2OIBA 3NCGA 2BAKA 2HXQA 5AUXA 5J1VA 3ZHPC 1YOJA 4FKOA 4MKCA 5DE2A 2F2UA 2W1IA 3FC2A 1CKIA 1UNGA 3FI3A 3O23A 3ANQA 2JIVA 3DV3A 5D12A 4L3PA 3P4KA 4NCTC 4KABA 2XCHA 1H1QA 3LJ2A 3OROA 4TWOA 3DKCA 3E88A 4QMUA 1UNHA 2PTKA 2UZUE 5FP6A 4QNAA 2VWWA 4RG0A 4RIYA 4CFVA 3ENMA 3DZQA 3EQPA 2Z7SA 1SVEA 2EXCX 3KKVA 4R3PA 2YDJA 3WF5A 2VD5A 3U55A 2UVYA 4P90A 3W55A 3E8NA 4R1VA 4LMNA 4RMZA 2P3GX 3OOGA 4FBXA 1IA8A 2BDWA 1Q3DA 4CKIA 1IRKA 2Y4PA 4R3CA 5IUHA 4M7IA 4A9SA 4BBEA 4IB5A 3DXPA 4G9RA 4OTIA 4UZHA 1U59A 3KXMA 4HZSA 3KVWA 3MFSA 2R5TA 4ZXTA 3QTQA 1OPLA 3E93A 1V0OA 5CASA 5EK7A 5I4NA 1H1WA 3EWHA 5IA0A 4R1YA 2NRUA 2YAAA 3ZYAA 4DH3A 3PG3A 4JG7A 3G0EA 4USEA 3F61A 2IVVA 3SW7A 1WBSA 5TE0A 3BYOA 4M14A 4MF1A 5FQDC 4ALWA 4DCEA 3DK3A 5E4HA 4DT9A 2W1ZA 2BAJA 3D7ZA 4UWYA 4JXFA 3K54A 4CFWA 4PL5A 3G90X 2JC6A 4AZSA 4ZMFA 3KFAA 1JKTA 3G6GA 3WYYA 3PJ1A 4ENYA 2HWPA 3TJDA 4EONA 4RVTA 5CI6A 1KWPA 4DF3A 3D2KA 4FICA 3OY3A 3QC9A 4YC6A 4BI0A 1Q8YA 2PMOX 2B52A 3LXNA 4F1TA 3ZO4A 5KCVA 3CQWA 4TPTA 3ORTA 4UYAA 3OT8A 5EM6A 4FV2A 4CFMA 1DM2A 1U5RA 2XVDA 2B9IA 1U54B 1OL2A 4G17A 3TUCA 4R77A 3UYTA 5AWMA 5CANA 3BGPA 4ZLZA 5EHYA 2YERA 4G9CA 5D41A 4RQVA 5IEXA 2JKOA 5CU3A 5I5ZA 3ZMMA 3BI6A 1YDSE 3KXGA 3ZLYA 2NP8A 3KL8A 3RALA 2QR7A 3PRIA 4IX5A 1CSNA 3HUBA 3DCVA 3MH3A 3LLAA 3A62A 2QOKA 1XH5A 3QTXA 4IW0A 4NM0A 3MTFA 3PPKA 3HMNA 3ZRKA 5JZNA 4Q5HA 4XYFA 3C0GA 4FUXA 4BI1A 2HK5A 5BVKA 1M2QA 3OTVA 4ZSAA 3WILA 3ORLA 5FEEA 3TV4A 1R0EA 1JQHA 3FAAA 5AP0A 1BKXA 2DWBA 2OU7A 3DU8A 3OCBA 4XG9A 2E9NA 1E1XA 1ZOEA 2ZV9A 5HE3A 2AC3A 2GNLA 1DS5A 4JAIA 3FQEA 2BAQA 1UWJA 3VF9A 3ZO3A 3QQFA 2EWAA 4MXXA 3ANRA 2ZB0A 3EIDA 5CNOA 5JFVA 4FEWA 4XG7A 3GFEA 5AX3A 3I1AA 3ZDUA 3EFWA 3L9MA 3O96A 3CTQA 3PA5A 4YZ9A 4RGJA 1QPDA 3SDJA 3EFJA 3UZRA 3ZFYA 3JY0A 4QYFA 4FOCA 5TR6A 2BHEA 5A4TA 5CF5A 4V01A 4L9IA 5HCYA 1XQZA 3HL7A 4X6RA 2H34A 2OGVA 3P79A 4FKVA 3MVMA 3EQFA 3W16A 4H3BA 4F63A 5A4EA 5JGAA 5L6PA 1J7UA 3SOAA 3LZBA 4NIFA 4QMPA 4I6HA 5EOBA 2Z8CA 1YXXA 4FV9A 4GEOA 3FLYA 4G6LA 4OBQA 4RVLA 4LRJA 2F4JA 4D1ZA 3C7QA 5GNKA 5IA2A 3PTGA 3G9NA 5H8GA 2VTRA 4HPTE 4BCMA 2PU8A 4O2PA 1KV2A 3D7TB 1J3HA 4NW6A 2C6MA 5E90A 3G6HA 4I4EA 1QPEA 3FMEA 3AGMA 2QOFA 2WTVA 3FMMA 3GC7A 4FV1A 5J79A 2PPQA 4O81A 4H1JA 5LVOA 4AZEA 1CTPE 2XK4A 2RF9A 1ZOHA 4LYNA 5EKOA 4C3RA 3QTSA 5DR6A 4Q9SA 2R3FA 4NH1A 3TL8A 2FB8A 1QMZA 3AOXA 3DBDA 1FVTA 4M67A 4NEUA 3I0OA 2YDKA 1JKSA 4C3FA 2PK9A 4MBIA 4FK3A 4ZZOA 2OICA 2VWIA 1SZMA 1XBCA 3TKIA 3FMLA 2YABA 3L9NA 3MV5A 4B4LA 1YXTA 3RCJA 5CAQA 2ETKA 2DYLA 2PUUA 2VGOA 2C6LA 3W18A 5FUTA 2J5FA 5AP7A 4O2ZA 3FKNA 4CRLA 1R1WA 2GS6A 3BEGA 2Y6OA 4GT5A 4NM7A 3COIA 4AA0A 4LUDA 4O6LA 4ENXA 5AR2A 2W9FB 5AMNA 3V8SA 1ZWSA 3OG7A 4ZY5A 4ANSA 1BI8A 2PVJA 2PY3A 4ACDA 4HGTA 4B8MA 5EYKA 4OLIA 1Q8WA 4BWXA 4O7WA 2R3JA 3GQIA 5HZNA 3CR0A 4BCIA 1MUOA 3RNIA 4GH2A 2FSTX 3CPCA 1PMVA 1H08A 1ND4A 4WHZA 3GCQA 3WIKA 2B4SB 1ZOGA 3RJCA 3LCKA 1OL6A 4EH9A 3PP0A 4GCJA 3OXIA 2XNGA 2X8EA 3Q6UA 4CEGA 4QTEA 4I23A 2R2PA 4AT4A 3UGCA 5EKNA 5CAVA 4LV8A 5J95A 5FTGA 3DB6A 3FPQA 3HGKA 3UOKA 5CF6A 2XNEA 2ITXA 4FV5A 3UODA 5HVKA 3EL7A 1XKKA 4YJRA 2YIXA 3IDPA 4JBPA 1MQ4A 4JDJA 5B7VA 1WMKA 3TI1A 1W8CA 3ENHA 2JFMA 2SRCA 3V04A 4PX6A 1YWNA 3Q53A 5KHXA 3FE3A 5CX9A 5F4NA 4EZ5A 3VS3A 4FIFA 4F9WA 5HD7A 3UPZA 3PE1A 3QXPA 3U54A 3R6XA 4ALUA 2WTDA 5HLNA 3WIGA 3QX4A 4PMMA 3KCKA 4AOJA 2A27A 2P2HA 4K11A 4X21A 4FZDB 2VAGA 3FMJA 3F5GA 4IZ5A 5HBEA 4ZS4A 2RGPA 3PWYA 5HQ0A 4M0YA 4HCVA 2W96B 5HE2A 1J7LA 2XS0A 3LFDA 2VO0A 3HECA 4L44A 3UVRA 5IDPA 2V5QA 1LP4A 3HYHA 3Q2JA 2ZOQA 5I9WA 5DMZA 2R4BA 3AXWA 3NPCA 3PY0A 2YZLA 2VX3A 3QCYA 4XG8A 3UDBA 5FM2A 3VJOA 4HPUE 5CT0A 5EW8A 2VV9A 4QQ5A 2PVNA 3PA4A 4YLLA 2UW8A 3FLNC 5HNGA 2EVAA 4N57A 4I21A 3AQVA 1HCLA 2ONLA 3RPYA 1O6YA 5HO6A 4RZVA 4LL5A 3MJ1A 3SVVA 3MIYA 5IMXA 5JKGA 2X39A 4PDOA 4IVDA 4C8BA 2BTSA 4IDTA 5AP2A 5LVLA 2DQ7X 5CEOA 3D5UA 2PE2A 3EMGA 5FM3A 1OBDA 4BY9E 3TNHA 3ZRMA 2WKMA 2O64A 4AN3A 4F65A 3TTJA 2BRBA 3RMFA 3VULA 3UO4A 4MHAA 2C1BA 3SRVB 4BYIA 3KRLA 2WQNA 4H1MA 3QZHA 5C01A 4ITIA 4BC6A 4QP2A 3Q32A 2JKQA 4AG8A 5K3YA 1A06A 2A2AA 4RA5A 5IPJA 3H9FA 4DTAA 2CGVA 4UEUA 3SXFA 3I81A 1WBTA 3CPBA 3O8PA 3ZTXA 3OEFX 4AGDA 4PNKA 3E5AA 4KRDA 5ETAA 4IWQA 3I0QA 1REJA 3CCNA 2C3JA 5DOSA 3CKXA 5DBXA 5A14A 2W0JA 4UV0A 4IC8A 4PDYA 4HOKA 2IZUA 1APME 2OXYA 4E5WA 4D58A 3GXLA 5IU2A 4ZY4A 4FKIA 5JT2A 3P1AA 3NW5A 1ATPE 2VTMA 4CV8A 3QC4A 2ZAZA 4FIIA 4YHFA 3KRXA 4GJ3A 4IB0A 3MTLA 3TV6A 4F70A 3OUNB 2R9SA 3UOHA 3OXTA 2P2IA 2XRWA 4XV3A 3ULZA 4AFJA 3ORZA 1PW2A 4FF8A 3GVUA 4ZTSA 2WIHA 2LGCA 3WI6A 3QUDA 3DOGA 2Y9QA 3EJ1A 3NEWA 3QQKA 4IJPA 2HZIA 4O96A 4QMYA 5CY3A 4JLCA 4S30A 2I0YA 5FEDA 4DGGA 3F66A 4XOZA 3UQFA 4FC0A 3EQGA 4UZDA 1M7QA 3QRIA 4O91A 4KINA 3NYNA 3CJFA 5JRQA 5JMSA 2ZM1A 4IQ6A 4RWKA 4DBXA 2YLEA 4JNWA 2UW9A 1SVHA 3ALOA 2E9UA 3DAJA 4XX9A 1IA9A 4XNEA 5B2LA 2WHBA 4KIOA 4EOIA 2PMNX 2W1GA 2XK3A 3EKNA 5C4LA 3HRBA 3NCZA 4XHKB 2QHNA 2XKFA 1IAHA 5TF9A 1H24A 3PSDA 2X2MA 4FSRA 1FGKA 4IX6A 4TXCA 1LEWA 3W2CA 4I93A 3ZUVA 4DEBA 5L4QA 3AT4A 3SKCA 4DGMA 4W4WA 2WMTA 4OT6A 3VWAA 2VO7A 4F7JA 3MH0A 4BCNA 3UVPA 4M8TA 4XEYA 3R83A 5BVFA 3QTIA 4JJRA 1XJDA 4BZOA 4EH4A 4Y95A 1YI4A 1JLUE 4XOYA 1WZYA 3E92A 5L2WA 5LXMA 3DQWA 3Q5ZA 4UXLA 3ORKA 4TYIA 3VS1A 3CXWA 3AMYA 2WMSA 1QL6A 5A46A 5JGBA 2J0LA 2XIYA 3QCSA 3VQUA 4EYMA 4RVMA 3GQLA 4FL3A 3POOA 5DT4A 3GBZA 1H8FA 3E8CA 3SG9A 2XKEA 5IQBA 5HX8A 4UWCA 4PMSA 3SLSA 4PDSA 4CLJA 2PUIA 2W4OA 5IMEA 4YSMA 4Z16A 2IW9A 4WBBB 4MXCA 2VO6A 3QTZA 3SRVA 3EQRA 2P0CA 4FK6A 3C4WA 3LFNA 4EOQA 2WTJA 3GOKA 3A7FA 4A4XA 3Q60A 3KCFA 3ATSA 4NKSA 5AV4A 5C9CA 3W2RA 4BL1A 4DEIA 2R3NA 2XK7A 4FIJA 4O86A 4XG3A 2XNMA 3KRRA 2WMXA 4DINA 4O27B 4RC3A 4C61A 5GINE 4FV6A 4IX3A 4TWCA 4AUAA 4G3GA 3A7JA 4G3DA 4QTAA 3QQGA 1B6CB 5B0XA 1KE9A 2ZYBA 1WVXA 2J0JA 4PMTA 4C35A 4RLLA 5ACBC 3ZXZA 5BUJA 3U6JA 4XP0A 3F2RA 3PLAE 4F4PA 5CZHA 3VRYA 2ITTA 5ETCA 2H6DA 1IEPA 2BKZA 3NUSA 3PPJA 4M15A 2IW6A 4EOPA 4RX8A 2GHLA 5HLPA 4D5KA 2AC5A 3UG2A 2HELA 4LOOA 4DG2E 4A4LA 3C5UA 3L1SA 5BVOA 3DBCA 4LRMA 4PL3A 2OFVA 5CSWA 3VVHA 5BX0A 4X3FA 3LFCA 4KD1A 4FEXA 1JNKA 3KXZA 1H25A 3T9IA 4QTBA 4FVQA 3QA0A 3BBTB 1NA7A 3QCQA 3SHEA 1H1PA 2ITWA 5LCKA 3R7OA 3G0FA 3OCGA 5M53A 4IM3A 5EHOA 2W4KA 3C0IA 4BCPA 5DHJA 3ZLXA 4F09A 1H01A 3IS5A 2YHVA 3FUPA 1AGWA 4X2GA 5ETIA 3RK7A 3CLYA 4PRJA 4XMOA 3TZ8A 5IQFA 4IVCA 3TZMA 3LMIA 2FVDA 3NAXA 2UZLA 4U97A 2WTKB 5T3QA 3V5PA 5BVEA 3PZHA 3R9RA 4EHGA 3DB8A 5IZFA 5M57A 4RJ3A 4GS6A 4CG8A 4WRSA 2J2IB 2GQGA 1FOTA 3H0ZA 5G6VA 5DH3A 3MGYA 2XBJA 4U42A 1M2PA 5GZAA 2EXMA 3HEGA 3LVPA 2WFYA 3VBVA 5K0XA 4F6WA 2V55A 3A7HA 3EN7A 4BWPA 4I3ZA 3QRJA 4C58A 4DFXE 2BZHB 4U40A 1PXPA 2ITPA 3D0EA 1SMHA 1YRPA 5JGDA 1WBVA 3JVRA 1TQPA 4MH7A 4AFEA 4Z7GA 3QGWA 5M4IA 4YSJA 4RJ4A 3QKLA 1JAMA 1LEZA 3RZFA 4HVSA 1P4FA 3LXPA 4IAKA 3GP0A 2FSMX 3OWJA 4YTHA 3F2AA 3R9DA 3W2PA 3BHTA 3CEKA 2GNJA 2UW3A 3OS3A 2RSVA 4IZYA 4D2TA 4L68A 1UU3A 4RIXA 4DFNA 2JDOA 4EH8A 2B55A 4ZMEA 2AYPA 4MEDA 3Q9WA 4C02A 3ZU7A 4EZ7A 4AZFA 4NSTA 3UE4A 3SGCA 2BIKB 3R1QA 3ZLWA 3KF4A 4U45A 2CNVA 4CT2A 4EEVA 4KBKA 4EJNA 1KE8A 3I5NA 3BCEA 3IW4A 4FR4A 2JIIA 3HKOA 4I5MA 4EK8A 1J91A 5H9BA 4X2KA 5HBJA 1W7HA 3KY2A 2EB3A 2OBJA 4ANNA 3L9LA 2X9EA 4OAUC 3GUBA 3MB7A 2GHMA 4TTHB 3PE2A 3GU8A 3MB6A 4DGOA 5BVDA 3P5KA 3MFTA 4HNFA 3SAYA 5F20A 4FT7A 4EK3A 5A4LA 3GC8A 4K2RA 4L53A 2YCFA 4U7ZA 5IEYA 5KO1A 4CNHA 3H9OA 4PP7A 4J7BA 3COMA 4YGAA 4JG6A 2OFUA 4C4IA 3Q9ZA 3QTWA 4W8DA 2V62A 3TZ7A 5AUTA 3EYHA 2VTTA 2OZAA 4Y5HA 3V5LA 5IQIA 1TKIA 4QMTA 4CFFA 5DRBA 4F99A 2RG5A 1PJKA 3UIBA 4FSYA 2WMQA 3RI1A 4QO9A 4PTCA 3R7IA 2J6MA 4M68A 3SX9A 2WTCA 3DQXA 4I92A 4BI2A 1UKIA 4OTFA 4TT7A 4NK9A 5HCXA 3LM0A 5J9YA 4BDGA 5L8KA 3LJ1A 2VGPA 2QU6A 2WQOA 4K77A 5CNNA 4O0RA 2W1HA 3OXZA 1R39A 4ASDA 2WTIA 3PZEA 2FA2A 3KULB 4GKHA 4WO5A 5M07A 5CSHA 3DA6A 2PL0A 3LIJA 3MY5A 4ZSEA 4ZSJA 4MD7E 5M4CA 2OO8X 4E6QA 5J9LA 1W83A 3ZEWA 2W5BA 5IH6A 2VWXA 4PF4A 4KKGA 4YURA 4CVAA 1M7NA 4RVKA 3Q4CA 4A9UA 4MVFA 3QRKA 3AC2A 5EYMA 4YJQA 4QPSA 4LQMA 2VTNA 3ORPA 2VTLA 3R1YA 5KZ0A 5CZIA 4F9AA 5I9YA 2XNOA 3F9NA 5LQFA 1OIUA 4U9AA 3DGKA 2RFNA 4FMQA 3H0YA 3PFQA 4O0YA 3DKGA 3RNYA 3R8PA 4BHZA 3P7CA 3GU6A 4I0SA 4N4SA 5LVPA 3Q5IA 4LOPA 4WKQA 3R00A 4XBUA 3PJ2A 5ICPA 2XM9A 3NMUF 1YDRE 3B2TA 4L43A 2IN6A 4KIPA 3O7LB 4CCBA 4AZWA 2C1AA 5E1EA 3ZUUA 4RIYB 2C6IA 3ROCA 3P86A 4R7IA 3KU2A 2FSOX 2YISA 2OKRA 4HNIA 1H1SA 4JQEA 1Y6BA 2WNTA 4U5JA 3UJGA 4F64A 5IISA 2YCRA 3A60A 5B2MA 2PZIA 4DHFA 2R7IA 2WMAA 2XJ0A 4N0SA 3C0HA 4WUAA 4L7FA 4BDFA 4QQJA 4OTQA 4OUCA 4QMLA 4YHJA 5AUWA 3LMHA 3C51A 1GZOA 1V0PA 4WUNA 4R7HA 4R5YA 5DFPA 3CD8A 3TG1A 2VWBA 3PXFA 3QF9A 2IW8A 5BPYA 4QOXA 5H8EA 3R8VA 1L3RE 3NNVA 2C5OA 3RBWA 3GCPA 4C4HA 4EJ7A 3OUKA 1Q99A 4C38A 1WBPA 3A61A 4JX3A 4PMPA 3LKMA 3FZOA 4YPDA 2O2UA 2UZEA 2B9FA 3COKA 2ITUA 4FI1A 4QTDA 2UVZA 2Z7RA 3EQIA 3QYZA 2CN5A 1Q97A 5CI7A 1OPKA 3U87A 4O1OA 3VS6A 3S00A 1KV1A 3KC3A 2PMLX 5CXZA 1A48A 1RDQE 4FTTA 4EUUA 3IDBA 3R22A 1R0PA 4HCTA 3QQHA 5AV0A 3A4PA 3BHHA 4E6CA 1ZRZA 4CD0A 4DYMA 4BDDA 3F5XA 5IG1A 5KMMA 3Q4UA 3N4UA 5FBOA 5CYIA 4GT4A 2W5HA 3NLBA 4I5HA 2IWIA 4FSZA 3UNJA 3DBQA 4R3RA 3LHJA 5DPVA 3CGOA 4MWIA 5H3QA 3FMDA 5HORA 2FUMA 4UMTA 3ZC6A 4TRLA 3MBLA 2BROA 3IW5A 1REKA 2ITZA 2WTKC 4MF0A 3OW3A 5DWRA 1NXKA 3ZUTA 3QLFA 1T45A 5AP6A 4QMQA 1U46A 4IFCA 5IA3A 4V0GA 3DT1A 3Q6WA 1OZ1A 3GCVA 5K0KA 3P23A 2QLUA 3D9VA 3NR9A 2NPQA 3FXZA 3NVKI 3E7VA 4FKGA 4RLKA 5HLWA 3QTRA 3FPMA 3V5QA 4F0IA 3VAPA 4M13A 2YWVA 1H1RA 3R7YA 1YHWA 2OI4X 4QYYA 5HI2A 2Z7LA 4FTQA 4ACCA 2NO3A 3EHAA 2RFDA 4M69B 2WMRA 3I5ZA 5ANGA 5DNRA 5AAFA 4DH8A 1PRYA 4FGRA 4N6ZA 1OM1A 2C5XA 5KNJA 3PDTA 4NWMA 2FYSA 2IZSA 3ELJA 4FV7A 2R3LA 3BHUA 5HE1A 4EUTA 4U41A 4ACMA 5M06A 3DDQA 5BNJA 1YVJA 4RA4A 4JOAA 4A9YA 2B0QA 2WZJA 1M2RA 1VJYA 2HYYA 3HZTA 4BDEA 4BDCA 5GIOE 3HDMA 3PVWA 3K3JA 3WE8A 2JFLA 5DG5A 4YNOA 3WF8A 4XV1A 4K1BA 2YM8A 1MRUA 4Q5EA 4ZEGA 5CEIA 4RFMA 4CT1A 3HMOA 4KKHA 4D1SA 3ZFXA 3DJ5A 5CU2A 4FIHA 4I41A 3QZFA 4XBRA 2UZWE 3DNEA 3R30A 4G2FA 3DJ7A 4G1WA 4MYGA 4RT7A 5L2QA 4ARKA 4YR8A 4K33A 4K0YA 1FVRA 2I0HA 1E9HA 2X4FA 3I7CA 2JIUA 4C4EA 5HTCA 3MWUA 3GI3A 4DAWA 1CKPA 5AUUA 5HO7A 1OIQA 2GCDA 1UNLA 1K2PA 4QMZA 3ODYX 3EN6A 4ASXA 3LFSA 2A0CX 4GFMA 4QMSA 1KOAA 3BX5A 3QYWA 3OCSA 3E63A 4RJ7A 4WG3A 4O7TA 3C4FA 3FC1X 4V04A 4NFNA 5I9VA 2ETRA 4FEQA 4UY9A 2G2FA 5DLSA 2PWLA 5FTOA 2J0IA 3TKHA 3HV5A 4WD5A 4DFLA 3FV8A 4E4NA 3UQCA 3E7OA 1NW1A 3FLQA 4JRVA 3PSBA 3VBYA 4FT9A 1FMKA 5AAEA 1PY5A 2YIRA 4KIKB 4NTTA 5E8WA 5C8NA 2Z7QA 5HBHA 4ONAA 4M3QA 1IASA 1XBBA 4L8MA 1FINA 2C3LA 3PXYA 4LUEA 1JVPP 4RFZA 3NUAA 4W9XA 4BN1A 1U54A 5GIPE 4R7BA 4RJ6A 4RX7A 3R7UA 4UWBA 3EQDA 3M42A 5E91A 4N6YA 3BYMA 3F88A 3A2CA 4XV2A 4JAJA 3IW7A 1PXMA 2I40A 3G51A 3HUCA 3FI4A 4IAZA 4TY1A 3WYXA 1ZYLA 2PVKA 5CEKA 4JQ8A 5M08A 3NUNA 3KF7A 4NKAA 4ANMA 1LUFA 2QOHA 3C4ZA 2XK6A 4LGHA 5L6WL 3FWQA 2Q0BA 1XO2B 4BWKA 4EQUA 1DI9A 4E6AA 3HAVA 3B8RA 4KRCA 1YHVA 5L8JA 4MK0A 4ERWA 1ZXEA 3OBJA 1ZYCA 3TIZA 1J7IA 3VNTA 2J51A 3T3UA 4BFMA 2RL5A 1YHSA 5LWMA 4GIIA 2UZDA 4NTSA 3DK7A 4QP8A 3PXQA 3UO5A 3EQHA 4QMMA 1PXLA 1OITA 2JDRA 5AR8A 4ZTQA 3WZDA 4PWNA 3PLSA 2PUPA 5JZJA 1NT2A 4UALA 1OBGA 4S2ZA 3FXXA 3RWQA 4QP6A 4XRJA 4U0IA 2PMIA 4FVPA 3V5WA 1UKHA 4EI4A 1STCE 5ANOA 3D15A 5C8KA 2G2IA 4EWQA 2XK9A 4FTOA 4ZOGA 2UW0A 3W10A 4QYEA 3W8LA 4AOIA 1OUKA 4DA5A 2VWVA 2BDJA 4OTHA 4ZTLA 2XK8A 2QOOA 3DPKA 3FJQE 5FWKK 4GK2A 1P5EA 2XIRA 2HW7A 3F3UA 3ZONA 4BKZA 3IG7A 4D1XA 1RE8A 2NRYA 4FTKA 4NZWB 2JDTA 1RJBA 2BFYA 2WTWA 3OVVA 3D5WA 2R0IA 2F57A 2YITA 4IZAA 4QMWA 4D4YA 2JITA 2G01A 4QYGA 2XM8A 4GU9A 5AV1A 5HEZA 5BYYA 2XP2A 5HIEA 4II5A 4R78A 5CQUA 3V5JA 2BFXA 2C3IB 5D10A 3HMMA 3V8TA 2HIWA 2OIDA 3A8WA 3BU3A 4RIWA 3REPA 3V3VA 3LMGA 3ZOSA 2RFSA 3O8TA
chains in the Genus database with same CATH superfamily
2PVYA 3MFUA 4G6NA 3TN8A 3ORMA 5DEYA 4IM2A 4YJUA 4E26A 3M1SA 2YCSA 2CKEA 3L8SA 3TZ9A 4FTNA 1OKYA 3LW0A 3R02A 3E62A 4YNEA 1ZMVA 3OHTA 3BHVA 3RPSA 1OECA 4FTIA 4KBAA 4Z55A 1ST4A 4GIHA 5ITAA 3BPRA 4I4FA 5AX9A 2WMWA 4O22A 5EM7A 3P5JC 3KRJA 4RWLA 2HY81 3SXRA 1ZYSA 2OW3A 4PDPA 3W2SA 3VS7A 2B9HA 4Z9LA 2YACA 4B8LA 4YHTA 3FY0A 4MBLA 4PUZA 2ITNA 4ZS0A 3V6SA 4BCHA 4F6SA 5JH6A 2PVHA 3UNKA 2Y7JA 3FKLA 3NGAA 3W0SA 2A4LA 4ALVA 5TKDA 2UUEA 3V5TA 5EH0A 4JI9A 4A07A 4AF3A 2WU7A 4CMOA 5BQ0A 3O17A 3Q9YA 4C36A 4MBJA 4GFGA 3THBA 3EFKA 1YWVA 4L7SA 1KOBA 1YDTE 3KREA 2C5YA 2VTOA 1TQMA 4GRBA 1O9UA 1NVRA 4E6DA 2X6DA 3RPRA 2UVXA 3NUUA 3UDTA 3HA6A 1XH6A 2X0OA 4YZMA 4AS0A 3BQCA 4EH3A 2BHHA 3R7EA 5KMIA 1NVQA 1XH9A 4B9DA 1KUTA 5CXHA 1Q3WA 3MFRA 2O5KA 4NJ3A 5DT3A 4K8AA 5FTQA 3RWPA 4NUSA 5EI2A 3O0GA 2W4JA 3SXSA 3U8WA 4CSVA 2E9VA 3QBNA 4J71A 2R3HA 2OH0E 5HG8A 3ZSIA 1OMWA 3LCOA 5FRIA 2R3IA 3MH2A 3TMOA 2CKOA 2QKWB 3VHEA 2DS1A 4J95A 2C6KA 4FV0A 4OTRA 4XG6A 3UG1A 2CLXA 3TTIA 4D28A 4H58A 3TUBA 3MDYA 4QT1A 2VWZA 1YQJA 3WZEA 3NAYA 4F9YA 3PVUA 3OP5A 2CGXA 4IAAA 3BBWA 4D4RA 3FEGA 3HMIA 3PIZA 2QVSE 4HYUA 4I0TA 4RIOA 4BHNA 5CEMA 4CG9A 3W0PA 1J1BA 4L67A 4BCGA 4E3CA 5IUGA 2WMUA 4O7SA 4CYJA 1CKJA 3R8LA 3MSSA 2XARA 5CQWA 4I6BA 1MRYA 2HOGA 3R01A 3E87A 3RAKA 4LRKA 4DH7A 3UOLA 2IJMA 1W82A 1PYEA 3FQSA 4XP3A 3S95A 2VWYA 4QP9A 5EOLA 4HVHA 4E4XA 3NS9A 4DHZA 4M84A 4EQCA 5B2KA 4XLIA 3VS4A 4AGWA 3UVQA 4WNMA 4IWPA 5J5TA 4E4LA 5AIRA 5LMKC 4FV8A 4B7TA 4ZSGA 4I5PA 4E5BA 5J1WA 3BWFA 5FLFA 4YO4A 5A4CA 4J96A 4TWNA 1H28A 4U6RA 4QMNA 3TDWA 3N51A 4JG8A 4IWOA 4WNPA 3M2WA 4MNEB 4QP4A 3QU0A 4FODA 4L42A 4WSYA 3BV3A 1UU8A 3HA8A 4FTAA 4NJDA 1IAJA 1GZ8A 2YM3A 4C2WA 4KWPA 4BDAA 2FSLX 2Y0AA 4ASZA 2BRGA 4LV5A 5KMKA 3S4QA 1OIRA 3K5UA 5KUPA 2HZ4A 1BYGA 3KEXA 5EHLA 4U43A 2P55A 5AR7A 5A54A 2GDOA 2JDSA 3ZH8A 3L8VA 1CDKA 3GU7A 3BU5A 3QZIA 3P0MA 4IBMA 3UZPA 1HCKA 2J90A 2XEYA 3LOKA 4L45A 3U6HA 3KGAA 4O82A 3IK3A 4F08A 5J7BA 5GHVA 4AACA 4PPAA 3UIUA 3D2IA 3UDSA 2NNWB 4U8ZA 4TZRA 5LWNA 2IVTA 2B9JA 3RPOA 3EL8A 4W4VA 1Y8GA 5EG3A 3VUMA 4D9TA 4JVGA 4DEHA 4H3QA 3WF6A 2W7XA 5J8IA 4C3PA 2X81A 3DNDA 3MY0A 4OTPA 2EB2A 4C4GA 5LVNA 4FZFB 5C26A 5IQGA 3FI8A 2I7QA 2BIYA 3NIEA 3P08A 4JQ7A 3LFEA 2HCKA 4FA2A 5D7VA 4XG4A 3V01A 4X2JA 3GFWA 4APPA 4GSBA 4GUBA 5CEQA 1PXIA 1B39A 1WCCA 3C5IA 1Y6AA 1UVRA 2UV2A 4O38A 2J4ZA 3QD4A 3BV2A 4FYNA 4KKEA 4EC9A 1BMKA 3E64A 2W1EA 2P4IA 2OJFE 5C4KA 2GTNA 2QCSA 1FVVA 5AEPA 3H30A 3NYOA 1MRVA 5KMOA 4FSNA 1PMUA 4JS8A 2OK1A 5C27A 5KKRB 5IQAA 2X9FA 1YXUA 5BVNA 5ETFA 5EQPA 1GJOA 4E5AX 4GG7A 4YJSA 4FEUA 3RAWA 3BE9A 2WMVA 4IVAA 2CKPA 4QEBA 5EM5A 3DAKA 1B38A 2CN8A 3H3CA 4FX3A 3T9TA 3GOPA 2X7FA 4U44A 2YIQA 2C0TA 3G2FA 4FKSA 3W8QA 4J8NA 1VR2A 1PXOA 3DLZA 4AX8A 3CD3A 4EH7A 2ESMA 3E8EA 4O7RA 2BRHA 2R3KA 4GVAA 2V0DA 4QMXA 3ORIA 4CTBA 2F2CB 2OIQA 3MYGA 5IA5A 4FV4A 5KZIA 1UU9A 3F69A 4KS8A 5L2IA 1PYXA 4J8MA 3QKKA 2G15A 1QPJA 2PZRA 4EWHA 3ZLSA 5KBRA 2BILB 5F9EA 3OWKA 1O6LA 3VBWA 3VO3A 1J1CA 2XZSA 3LAUA 4WNKA 4ERKA 3ET7A 2PVMA 3IW6A 4O4DA 1VZOA 5E8XA 4RJ5A 3TXOA 3S0OA 3LLTA 1H0VA 3O7LD 1JSTA 4CXAA 2X4ZA 4QQCA 4ZY6A 3O2MA 5EDRA 3JUHA 2CSNA 4LMUA 4C62A 5A3XA 4JR7A 2REIA 4IWDA 3QTUA 4EH6A 5HU9A 3JS2A 2QOCA 1R78A 4KAOA 4G3FA 4C57A 3C13A 4NL0A 2UZVA 1JBPE 4MXAA 2JLDA 4FJVA 4TYHA 3I7BA 5BYZA 3UMXA 3ZSGA 5AAGA 2C30A 5DIAA 3C1XA 1AD5A 4WIHA 3Q04A 4E1ZA 3FHIA 4YJOA 4FKPA 4D2SA 2CCHA 2IO6A 4YUQA 5DGZA 1W0XC 5ANEA 3NRMA 4FGBA 4GVJA 2QO9A 4IADA 2VTPA 1SNUA 3S2PA 3QD3A 3VC4A 4TNBA 1JKKA 2YM7A 5KMJA 3HV4A 4NCTA 4HVIA 5HTIA 3SG8A 2X1NA 3QWKA 5E8YA 4EOSA 4D2VA 3ETAA 2OF2A 3HV6A 4C2VA 4RFYA 4YJVA 3PG1A 3ZO2A 3FZPA 4FNXA 4R6VA 5LVMA 3ORNA 5LMBA 4KIQA 1R3CA 4O0XA 1S9JA 3VHKA 1V0BA 4CZUA 4D0WA 1PKDA 3ZC5A 2QONA 1Q62A 5C8MA 4J97A 3VUIA 4IHPA 1BL6A 2QURA 3QHWA 2YA9A 3PPZA 3POZA 4X6QC 3SD0A 2W5AA 5I9XA 1BL7A 2WQMA 3LFAA 1WVWA 4GG5A 4I6QA 3TV7A 4YJTA 3U51A 5L6OA 4BJJA 3AD4A 3KQ7A 3FI2A 4CQGA 1L8TA 4I6LA 5HG7A 3R71A 4HW7A 1Z9XA 2W06A 3C9WA 4O7YA 4AN9A 4FIGA 4L00A 4TYGA 2HWOA 3LFQA 4MD8E 4QPAA 2CNUA 5H2UA 5I3RA 5AP4A 4QQTA 2AQXA 2YWPA 4FL1A 3WBLA 4FNWA 4UN0C 4ZZNA 5C03A 3PY3A 2WB8A 5CLPA 5EW9A 2J0MB 1TQIA 1OB3A 3OF0A 3PY1A 1T46A 1OKWA 4X3JA 4FSQA 2XBAA 3LCTA 1G3NA 3V8WA 4O4EA 3FY2A 5I3OA 3IGGA 1ZZLA 3IO7A 3NUXA 3TNIA 4AN2A 4EOJA 3QQUA 1KE6A 5DA3A 4A9TA 5L8LA 4GFOA 3Q96A 3NW6A 2XALA 4L46A 2XAOA 5CENA 2OXXA 2C5NA 4EYJA 2UW5A 1W84A 4IVBA 2ZDTA 2C4GA 4A4OA 2VTJA 1ZY5A 3C4EA 4Y73A 3JVSA 2F7EE 4IH8A 4D4SA 4E7WA 1MP8A 2HZ0A 3BYVA 2X2KA 4MQ2A 3UBDA 5ANDA 4D2WA 5HX6A 2JDVA 1U4DA 3C50A 3L8XA 4EOLA 4O0UA 3Q52A 3D5XA 4MXOA 1XMLA 3A7GA 1G8KA 4DT8A 3PJ3A 3PWDA 3OBGA 3HP5A 2UZOA 2JAVA 3QLGA 4U3YA 4EOOA 1FBNA 5CF4A 3TKUA 3KK8A 4MAOA 3TIYA 5E8SA 4OGRA 4GU6A 4IZ7A 5CS6A 5DVRA 1LR4A 4L3JA 1P14A 2ZB1A 3NYVA 4LOQA 4PV0A 4S34A 4S31A 3BEAA 4DEGA 3PYYA 4Z7HA 3GGFA 2GNFA 2WXVA 5HHWA 3CY2A 5FDXA 5ACKA 3DY7A 3PXZA 4RRVA 3KA0A 4A7CA 2C5VA 2H9VA 3CQUA 1H27A 4WOVA 5CAOA 4ITJA 3ID6C 4AT3A 5HE0A 2ITQA 2UW4A 3QL8A 4NM5A 4Y8DA 2KTYA 5JFWA 2PZPA 2V7OA 3AC1A 4JBQA 4BDIA 5IA4A 1PMEA 4DLJA 3EN5A 3VN9A 4M0ZA 4EBWA 3NIZA 4EH5A 1URCA 4ASEA 3BQRA 4FTRA 5CAUA 5IF1A 4PY1A 4GK3A 3QX2A 2CKQA 3TNQB 3DXQA 1XHAA 4CV9A 2GFCA 3R9HA 3JR1A 1BI7A 4CLIA 2QO7A 3BIZA 3GCUA 2O65A 3H4JA 4CMUA 3QRUA 3RM6A 5D7AA 1HOWA 4BBMA 5CALA 1YXVA 3LQ3A 2CGUA 5HCZA 5IQDA 2QODA 4RWJA 5KBQA 5KKRC 3WOWA 4DDGA 3KULA 4DGLC 3FZSA 1F5QA 1URWA 4FTMA 3WZUA 4NT4A 2GNHA 3GCSA 2JAMA 2PZYA 1FQ1B 2OJJA 3CE3A 4RX5A 3LQ5A 3EKKA 1W2DA 3SA0A 3Q9XA 5BVWA 3VUDA 4KA3A 3BELA 4UMUA 3W32A 1YXSA 2QHMA 3FMNA 1JOWB 4PPBA 4OTDA 3UNZA 4XP2A 3SV0A 3EZRA 2OJ9A 5GZ9A 1JWHA 1P4OA 2OZOA 2OXDA 3VUHA 4BDKA 3PVBA 2W1FA 2ZMCA 3ZCLA 3IW8A 3K5VA 2ZV8A 4EHVA 2WU6A 4LG4A 4AAAA 2C0IA 3HRCA 1O6KA 4BYJA 3D4QA 5DN3A 1K9AA 3NNWA 4C33A 4ZJJA 3UOJA 3MA6A 4FV3A 5A9UA 3G9LX 3HV3A 2FH9A 3JY9A 2C6DA 5BYLA 3KRWA 3V51A 3P9JA 3PA3A 3Q2MA 4FIEA 4FG7A 4AP7A 2RFEA 3RINA 3ZZWA 3BWJA 4FZ7A 3ACJA 5IDNA 2QG7A 2YIYA 1PMNA 5HD4A 2WEIA 3OY1A 3QAME 2PVLA 3QWJA 3AG9A 4IC7A 3VW6A 5AR4A 4YZBA 2XNPA 3DDPA 4U81A 3FSKA 4AGCA 3GNIB 4ZLYA 3I6UA 3OZ6A 4FKUA 4QD6A 3GC9A 3P7BA 4J99A 5DI1A 3W33A 3FL5A 2PULA 2OJGA 5HVYA 3DTWA 1FMOE 4JBOA 2BCJA 2PUNA 4Z3VA 2B1PA 5EYDA 1GZKA 4UMQA 4RQKA 4O7ZA 4GL9A 2I0VA 3IQ7A 2W05A 4GYIA 3BYSA 3A7IA 3IDCA 4ID7A 1UV5A 4RJ8A 1ZARA 2FGIA 3I6WA 1JPAA 1VYZA 4EQMA 3UC3A 2ITYA 3P7AA 3V6RA 4IAYA 3CBLA 4HGSA 3TACA 2IG7A 1WFCA 4FL2A 3FYJX 3IOKA 4IXPA 4K6ZA 4APCA 5JQ5A 5EQEA 2O3PA 4OBPA 4OT5A 1YWRA 4ZK5A 2W9ZB 4C7TA 3FLSA 2R3GA 1XH4A 3R21A 4Q9ZA 4FTLA 4O0SA 2BRMA 5FDPA 4U79A 3L8PA 2BDFA 2C6EA 3EOCA 2JBOA 2C0OA 3MJ2A 4DEAA 4XRLA 5D11A 2PHKA 5KMNA 3DK6A 3MH1A 4I24A 3OMVA 4YZDA 2YM4A 4I0RA 2VNYA 4BTJA 3FDNA 2A1AB 4IE9A 5JK3A 3D5VA 3JYAA 1TVOA 4ZJIA 3QCXA 4DFZE 1Q24A 5L3AA 2VNWA 3OT3A 4C0TA 4E93A 4DE4A 3UIMA 3N4VA 2AUHA 2DUVA 2XIKA 1LPUA 1WVYA 4P5QA 3TDVA 5H8BA 2IVSA 4NIFB 3E3BX 3IPHA 1WBNA 4XUFA 3FSFA 1Y57A 3NDMA 2ERZE 2BVAA 3IOPA 4Y46A 4AW2A 4NW5A 2WQEA 4ORKA 2X2LA 4RSSA 3ZBFA 1BLXA 4AE9A 2XEZA 4RWIA 1ZY4A 4JT3A 3I79A 4Y83A 5CWZA 1PHKA 2YJRA 4QP3A 3VS2A 1UA2A 1WBOA 2B54A 3R63A 3VS0A 4DITA 2VX1A 5K5NA 2ZV2A 4M69A 3E8DA 2HY0A 2HZNA 1Q61A 2HXLA 4JL9A 4EK5A 4RBLA 3ZM9A 3BZ3A 3IGOA 3MY1A 2ZDUA 3RHKA 4BCQA 5J7HA 2V22A 3OC1A 2X8DA 4RX9A 5E8TA 2BZJA 2E9PA 4BIBA 5AM6A 3P78A 4DCAA 5IH4A 1OVEA 4FNZA 3DXNA 4X2NA 2XYNA 4FKLA 2XIXA 3C4XA 2WD1A 3FKOA 4I1ZA 4I94A 2ZMDA 4LM5A 5HU3A 5AFVA 4J1RA 4EH2A 4FSTA 3UC4A 5CU0A 1W2CA 2VN9A 2EXEA 3TUDA 1H4LA 3AD5A 2C3KA 2O63A 4HYSA 4IM0A 3F6XA 3AC5A 4IAFA 4O4BB 1GIJA 5EQYA 3FQHA 2IZTA 5EM8A 2X7OA 4AT5A 4TYJA 4F0GA 5CSPA 4W8EA 4AXAA 3R28A 3H10A 2IVUA 2GQSA 4BR3A 2GS2A 2Y8OA 4L52A 1QPCA 5ANKA 4F7NA 5J9ZA 4DFBA 4XCUA 3DTCA 3G33A 2GFSA 4BTFA 4GUEA 4WG4A 5EW3A 3R8ZA 2GPHA 4FG8A 2A98A 3ZDIA 1Q5KA 1Z5MA 2O0UA 2HW6A 4JDHA 4WT6A 5HTBA 5M44A 4AGUA 4D2PA 1OPJA 4MQ1A 3SQQA 4B6LA 3WF7A 1I44A 5FXSA 3RK9A 5IQEA 1TZDA 1XR1A 2J0KA 4BKJA 4G16A 4DN5A 4NU1A 4FEVA 4FSWA 3FXWA 1KE7A 4UB7A 1XWSA 2JBPA 3MPAA 4DBNA 2QOLA 2PVRA 3FZTA 2XYUA 1GY3A 2OLCA 3R8MA 5EDPA 2R3QA 4ZTRA 1XH7A 1M17A 4YU2A 2XCKA 3RAIA 4TN6A 3CQEA 5LMKA 4RIWB 2V7AA 5HOAA 1JSUA 4ACGA 3VBTA 3RGFA 3F7WA 4AW0A 4NYEA 3SOCA 5IQCA 3D14A 5IH5A 3O8UA 4DHJA 3QALE 3MVJA 3ZSHA 4S33A 2C47A 1RW8A 3ATTA 3G15A 4KIKA 5K4JA 2JGZA 3L9PA 3NUPA 4H05A 4AW1A 4FTCA 4EHZA 3N4TA 3AC8A 1V1KA 4O7NA 4GYGA 4AU8A 2XKCA 4Y72A 4PP9A 4ACHA 5HVJA 4ANQA 4QYHA 3CKWA 2W1DA 1RQQA 3ACKA 3HMPA 3EB0A 5EDQA 1I09A 2Y4IB 1PXJA 2ZV7A 5FXQA 1BX6A 1Q8ZA 3BKBA 5A6NA 3QKMA 5GJDA 3D7TA 5HIDA 3TCPA 3VBQA 3MW1A 4YJNA 4XS2A 5LARA 3RM7A 4LL0A 2Z02A 2RG6A 4EKKA 2R7BA 3O51A 3IONA 1OGUA 3EZVA 1PKGA 3EYGA 4L6QA 4MNFA 2J7TA 5ANIA 2YCQA 3OFMA 4O6EA 3MN3A 4F7LA 4X7QA 4MXYA 4AXDA 4ANLA 3ZEPA 3AT3A 2ITOA 4FKQA 3KN5A 4AXEA 4M66A 4I22A 4MCVA 4QRCA 1PF8A 1U5QA 1JKLA 3AT2A 5DEWA 4YMJA 1VEBA 2EU9A 4JIKA 5A4QA 3WZJA 4O0WA 3RPVA 4EHEA 4XV9A 4FTJA 4D0XA 4YLKA 5C1QB 3BLRA 1GAGA 5I9UA 4BICA 3UP2A 2CPKE 1ZYDA 3U9CA 3KN6A 4FVRA 4BDBA 2ZVAA 2ZM3A 3LJ0A 3EFLA 5HGIA 3FLWA 1YOMA 4GT3A 2OWBA 3DKOA 2Q0NA 2IEWA 3QRTA 1YW2A 4OAVB 3AMBA 5HICA 2QC6A 2VTAA 4DFYA 1PXKA 1UU7A 5IEVA 3GEQA 3WF9A 4LFIA 3LFFA 4BCJA 3FLZA 3NX8A 4BTKA 3OWPA 2CMWA 4F1MA 4K18A 5BUEA 2PYWA 3SW4A 3UO6A 4C34A 4D55A 3UZTA 5M56A 3RTPA 3T8OA 5I9ZA 1W2FA 2XJ2A 3OOMA 4NM3A 3RKBA 2PE1A 2C69A 2XMYA 4EK6A 4FRFA 2CLQA 4P5ZA 4ZLOA 3KK9A 4F1OA 3B8QA 2W17A 4H39A 4QPMA 2ACXA 3HV7A 4LGGA 4YP8A 4UXQA 4W4XA 4YC8A 1YI6A 5AV2A 4XG2A 2P33A 4ZP5A 2C68A 1MQBA 2VTIA 3EN9A 5HO8A 2QKRA 3R2YA 3HNGA 4YZNA 4DH5A 1Q8TA 4L3LA 2WOTA 2QR8A 2GTMA 3R1SA 5AUVA 4UMPA 3S3IA 4P2KA 5BMSA 5DYJA 1GOLA 3RAHA 3G5DA 4C4FA 5K4IA 2QI8A 3COHA 4ANOA 4FT3A 5J87A 2XNBA 4FNYA 4HYHA 5LCJA 4IB1A 2YDIA 3F5PA 4CKJA 3ZBXA 1OUYA 3LPBA 3AMAA 3II5A 1G5SA 3F3TA 4BGGA 3QFVA 4XJ0A 5AJQA 4B99A 5E8UA 1ZLTA 4BBFA 2QLQA 2HENA 3MI9A 2BMCA 3OW4A 5DR9A 3BLQA 4G31A 2JEDA 4X2FA 3QD0A 4P7EA 2WOUA 3E3PA 4CFNA 2H96A 3NWWA 1GZNA 4K9YA 2R3MA 1E1VA 4CZYB 4DLIA 4OR5A 3PVGA 4TL0A 3FZ1A 2J5EA 4DFUA 3TEIA 3VUKA 3QXOA 3FMKA 3ORXA 4XH6A 5F94A 3TNWA 3MIAA 4IEBA 4V05A 3QD2B 2Y6MA 4FKRA 1FPUA 4KSPA 1DAWA 5FP5A 4DTBA 1H0WA 4YTFA 5L2TA 4Q2AA 2WGJA 3MS9A 1BUHA 1GIIA 3ODZX 3AGLA 1H26A 3TJCA 3ALNA 4EL9A 5KX8A 5LJJA 4W4YA 4YC3A 5E8ZA 4J98A 3BGQA 3UPXA 4BF2A 5CAPA 4QMVA 4TWPA 3R8UA 4D5HA 3AKLA 5K9IA 5FG8A 4R5SA 4E8AA 3RP9A 5JEBA 4F78A 1NY3A 4YBJA 4BCOA 4F9CA 3MPTA 4ZAUA 4WBOA 3H9RA 4TKSA 1XMMA 5E1SA 4BCFA 2BALA 5HIBA 3UMWA 1ZYJA 3DAEA 4AA5A 4GMYA 5A6OA 5GJGA 4HGLA 4BIDA 5T68A 2PSQA 2XH5A 4G34A 2W1CA 1SVGA 2XJ1A 2XUUA 4RC4A 1XH8A 4TW9A 5CEPA 4YPSA 2OH4A 4EORA 3R9NA 3MESA 3LQ8A 2VWUA 3HVCA 5EFQA 4HJOA 3GU5A 2Z60A 2JD5A 5E92A 2UZNA 4FT5A 4G3EA 2C6TA 4GK4A 3UTOA 1G8SA 2GNIA 2IZRA 5FXRA 3A8XA 1WBWA 4BZDA 2I6LA 3CSVA 2HAKA 4L01A 3OWLA 3RZBA 3WARA 1NVSA 5FD2A 2WO6A 5FGKA 4JX7A 5TOZA 3NVMB 1A9UA 3NNUA 4YTCA 2XRUA 4O4CA 4J52A 4F9BA 1X8BA 4AZTA 1KE5A 4WG5A 3ROYA 4WA9A 4H3PA 1S9IA 3ITZA 4PQNA 5CVGA 4H36A 2F7XE 3F3ZA 4DG0E 3NSZA 3CTHA 2BPMA 2GMXA 4BDJA 4NFMA 3DBEA 3S1HA 4D9UA 1P2AA 4KB8A 3VIDA 4BB4A 1OKZA 3VUGA 5AA8A 2F49A 4PPCA 4C59A 4RC2A 3TM0A 2OF4A 5AUZA 4FZ6A 4IAIA 2G9XA 2FO0A 4RPVA 4BCKA 4FUYA 3KXNA 4HCUA 3FHRA 4X3FB 4U3ZA 1XBAA 3I4BA 2QD9A 3MVHA 3ULIA 4U80A 3NYXA 4HVGA 4AE6A 4HYIA 2BUJA 4QP1A 3WE4A 2YM5A 2YFXA 3PP1A 4PNIA 4XLVA 3CY3A 3DKFA 5JFXA 4A06A 4ZTHA 2R64A 3KXXA 1GNGA 2ZM4A 5G1XA 4IX4A 2QNJA 4DC2A 5GZ8A 3A4OX 2WMBA 3CC6A 4ZTNA 3RHXA 2J9MA 3F7ZA 4YLJA 3IECA 3PSCA 3CGFA 3BE2A 4MNEA 4UMRA 4IANA 4D2RA 2XF0A 5E7RA 4YJPA 4O83A 4ZSLA 3AC3A 2YJSA 4O0VA 4QNYA 2VX0A 4Y5QA 3FL4A 3I60A 4IIRA 5F1ZA 3U4WA 4Y85A 3ZZEA 5BUIA 2E2BA 3HX4A 5AV3A 4AA4A 4DG3E 2PE0A 1VYWA 3HP2A 3AD6A 4PTEA 2Y4IC 4OTGA 3PRFA 2CJMA 4UX9A 3W2QA 2UW7A 4FG9A 4O0TA 3OTUA 5HKMA 3DFAA 5M51A 4R8QA 3JXWA 3PJCA 3RVGA 4MX9A 4WRGA 2IPXA 2ZJWA 2A19B 3LCDA 4AZVA 4CGAA 3DBFA 3R04A 4F7SA 4CZTA 4B0GA 4TYHB 4OW8A 2RIOA 4LGDA 3D94A 2BKKA 4TYEA 2E9OA 4KNBA 4E4MA 4O7VA 4E20A 1W98A 3BRBA 4O21A 1UWHA 2ERKA 4EOKA 1CMKE 4ZTMA 2ONLC 3DFCB 4I5CA 2B53A 4W9WA 3R0TA 4O7LA 1JSVA 3RCDA 4MWHA 3ZXTA 3UIXA 1OL7A 4BKYA 4BRXA 4D4VA 2WELA 4I6FA 5IKWA 3QZGA 4I20A 4FOBA 5JN2A 5HG9A 1Q8UA 1M14A 2YLFA 2PZ5A 3GB2A 2R3OA 3F2NA 4RIXB 1YOLA 3ZFMA 5J5SA 3FBVA 3GT8A 4N70A 3U4UA 3F3VA 4KBCA 5HNBA 4EBVA 3UP7A 4IJ9A 3PJ8A 5CVHA 3CIKA 2OJIA 2VO3A 3UYSA 4AQCA 4F0FA 3F5UA 2X7GA 4FKJA 1F3MC 2C6OA 4GW8A 4FT0A 3GU4A 3IKAA 4FE2A 3VS5A 5M09A 3TNPC 5IA1A 3U6IA 3EN4A 2WPAA 4YO6A 5AADA 1FGIA 3FMHA 4UBAA 3NFFB 4JIAA 2BRNA 2QG5A 1OKVA 3KB7A 4YTIA 2GQRA 5HESA 1G8AA 1Y91A 4BJJB 2BR1A 4BTMA 2WAJA 3QUPA 5CF8A 5M55A 2VZ6A 2BZIB 3HAMA 3T3VA 3DJ6A 3QUEA 5E8VA 2G1TA 2JKMA 4FSMA 2W99B 4JBVA 2X0GA 2PVFA 3O71A 4HGEA 3F82A 4IFGA 3OCTA 3F3WA 4P4CA 5CVFA 4BZNA 4EKLA 1SNXA 3R1NA 5F95A 4DTKA 2WIPA 3OD6X 3VF8A 3DS6A 3ZO1A 2OZAB 3KMWA 3PXRA 1ZAOA 5GJFA 2I0EA 3PXKA 3VJNA 2R3RA 2AEGA 3W0QA 3BYUA 4AOTA 4CFUA 5FEQA 3NW7A 3DZOA 1OL1A 3LCSA 4JDKA 3SC1A 2H8HA 3U9NA 1YI3A 3KXHA 3B2WA 5JQ8A 2LAVA 5KHWA 3Q4ZA 2VTQA 3QQLA 4IDVA 3Q3BA 5AP5A 3UQGA 2CNQA 1Q4LA 1K3AA 3KMMA 3Q4TA 3M11A 2UZBA 2F7ZE 4WNOA 2BZKB 4G3CA 4EOMA 3MA3A 4YZCA 3BGZA 2CGWA 1OIYA 3RK5A 4JRNA 4YBKA 4MD9E 1SYKA 3TWJA 2VUWA 2G2HA 2CCIA 2Z2WA 4USDA 3BLHA 3JPVA 1DI8A 2I1MA 5LOHA 1CM8A 3GENA 2GU8A 3LM5A 3ZS5A 3C4CA 2X6EA 5M4FA 4GKIA 2VRXA 5CT7A 2VU3A 3CJGA 4AXFA 5AIKA 2WQBA 2KULA 3R73A 1ZMUA 4QTCA 5K5XA 4AW5A 2OSCA 2YIWA 1GIHA 5CSXA 5JRSA 2R3PA 2CDZA 1M52A 2QOIA 4E73A 2QU5A 4ITHA 4X0MA 3NZ0A 2UZTA 3HDNA 3FZRA 2GS7A 4FYOA 4ANBA 3R7GA 1OL5A 1Y8YA 2BTRA 3EQBA 3FYKX 4QMOA 5EI6A 4CRSA 4DEEA 5I0BA 4IB3A 2XB7A 3O50A 5L2SA 4KUJA 3R9OA 1ZZ2A 1ERKA 2EUFB 3OEZA 5LMAA 3EH9A 4MTAA