2Z7RA

Crystal structure of the n-terminal kinase domain of human rsk1 bound to staurosporine
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
288
structure length
265
Chain Sequence
GSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEGTVEYMAPEVVNRQGHSHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQSLLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Ribosomal protein S6 kinase alpha-1
publication title Crystal structures of the N-terminal kinase domain of human RSK1 bound to three different ligands: Implications for the design of RSK1 specific inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 265
sequence length 288
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2z7rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2z7rA01
4R3CA 3MA6A 3DJ6A 4BCKA 2YCFA 3DLZA 4R1YA 2F7ZE 1XH9A 4WUAA 2XRWA 1A48A 4BDKA 4F7LA 2UZBA 4G9CA 5JQ5A 4OGRA 3BX5A 3OWLA 5AUTA 2XCHA 4LUDA 4YBJA 3BU5A 1MQ4A 3DK7A 5CSXA 4A4XA 3UBDA 4JAJA 3BHVA 3F7ZA 4EEVA 4FKRA 2UW7A 4FV9A 4U45A 2XK6A 4PDYA 2CNUA 2O8YA 5TE0A 2YM6A 4YZBA 3VF8A 4IAZA 3GOKA 3G0EA 4I5HA 5DEYA 4QYEA 1J7LA 3QQHA 2NO3A 2WMXA 2P3GX 1AD5A 2HWPA 4IH8A 4KA3A 3K5VA 3CC6A 4CKIA 5JRQA 5D9HA 3DKOA 1P2AA 2FO0A 4W8EA 3TZMA 5HLNA 2JC6A 4USEA 5AMNA 5L2SA 2OW3A 4LUEA 4FTIA 1W8CA 3AC4A 4M0YA 3FL5A 3A61A 3OCGA 3NUPA 4AZTA 2R3FA 1ZYDA 4A4LA 4FT7A 2EU9A 2F7EE 1FQ1B 2VNWA 3NYVA 2JAMA 4RWKA 4AA0A 4NL0A 1UU8A 3FLZA 4KS8A 2X7OA 4NH1A 3R83A 4E4LA 4O96A 4RQVA 2BVAA 2OU7A 3OWKA 3BE9A 3Q96A 5DGZA 5DT4A 3UOKA 4TL0A 2PVJA 3PTGA 4IXPA 3A7GA 3IG7A 3ZRLA 4IBMA 3WARA 5CF6A 4ACGA 4GKIA 5HTBA 2C0IA 3CKXA 1GOLA 4YC6A 3U9CA 4MYGA 3PJCA 2J90A 4FSRA 4E6DA 5IH4A 2WIPA 2PZ5A 3KMUA 3ERKA 5JH6A 2O5KA 2R7IA 4RJ5A 5TF9A 3BV3A 4C33A 1OIRA 2WB8A 4YGAA 4EOQA 3EQCA 4EK5A 3ANQA 4RX7A 5DR2A 5HE3A 5EOBA 4AA4A 1CKPA 5HIBA 4APCA 1W83A 2YABA 3MH1A 2W1EA 4IM0A 2R3RA 3BHYA 3Q6UA 4FTNA 4HPTE 5T68A 1JKKA 3F3TA 3KU2A 4QYYA 3BLQA 4TYHA 3D5XA 2KULA 3UOJA 1OZ1A 1ZARA 4N0SA 5ETFA 2BRNA 2JKOA 4QMPA 3UNZA 4C0TA 3LW0A 2IWIA 4L45A 4GCJA 3FBVA 2FYSA 3NW7A 4NKAA 4YHFA 4EZ3A 4RX5A 2G9XA 4FG8A 4JX7A 1UU3A 1PYEA 4EH4A 3PJ2A 4FC0A 3TEIA 2QR7A 5L3AA 4CGAA 3UNKA 2GNHA 5M51A 4EQMA 4FE2A 3FXWA 3NNUA 3M11A 4OT6A 1J7IA 4R77A 4FZFB 4EI4A 2Y6OA 5LJJA 2AC3A 2OK1A 2ITWA 2C47A 4QQJA 4V0GB 2G15A 2X4ZA 3U51A 3MH2A 3U55A 4IB1A 2GHMA 4I5MA 4WKQA 1XH7A 3VNTA 3O51A 4U42A 4D1XA 2PY3A 3I0OA 4EOKA 3OW4A 5LVPA 1Q3DA 5GZAA 2OZAA 3D7TB 1WFCA 4AW5A 4D4RA 2ERKA 3WF8A 5JGAA 2GFSA 3KXMA 5JK3A 4FEUA 2I0EA 4AW0A 2C30A 5A54A 3FQSA 2FGIA 3R02A 5IQGA 2NPQA 4IIRA 4X2FA 5AAFA 4W9XA 2VUWA 4JNWA 2BILB 2G2HA 3OD6X 4BI2A 4D2VA 2BZHB 2BMCA 5DT0A 4K77A 3BV2A 5IDPA 5CVHA 4MNEA 5KMKA 3TUCA 2OI4X 4AGWA 5CU4A 3W16A 3Q52A 4IC8A 3V5JA 4CFWA 4U41A 2ZV9A 3R7IA 4A7CA 4GK2A 2C3LA 3ULZA 4F6WA 5EKOA 3QAME 1F3MC 4FF8A 1WVWA 4B8MA 3BYSA 4CMOA 4DH8A 3JY0A 4JJRA 2FSOX 3QRTA 1OL6A 5J79A 3HECA 5CSVA 1JAMA 1Q61A 3FL4A 4JDKA 2R2PA 1IAJA 3LIJA 3GXLA 3QCYA 4QPSA 5E1EA 4Z7HA 4ZXTA 2ZV8A 4OTWA 1YDRE 4FK3A 4Z7GA 2BDWA 3UDBA 3ZBFA 4CFFA 4A06A 5DOSA 3O8PA 2XNMA 5D7AA 3GQIA 3MTLA 5EH0A 3S95A 3VUTA 2WOTA 3FJQE 4O7RA 1J7UA 3R1QA 2PVMA 1URCA 2C3IB 3F3UA 1CDKA 4I5CA 4QQ5A 4IZYA 1UVRA 3ODYX 3CP9A 3GCPA 3R7UA 3A7HA 4N4SA 4IAFA 3CE3A 3ZDUA 2H96A 3OZ6A 4IWPA 1XBBA 5HU9A 5LWNA 2VX0A 4DCEA 3TZ7A 4JR7A 4QMOA 3D2IA 4QMXA 3MGYA 2PUIA 3LFSA 4P5ZA 5EDRA 4O7TA 3VS6A 5AAEA 3KQ7A 3CD3A 2H6DA 3LAUA 2YIQA 5M06A 3V04A 5AADA 3ZZEA 2PE1A 2QCSA 1IASA 3GCSA 3QGYA 3VUMA 1ERKA 4R8QA 3L9PA 5J5SA 1KE8A 3UZRA 1OI9A 4L8MA 4XEYA 4EWQA 1Q8UA 3KF4A 1OKVA 4JR3A 4WNMA 5HNGA 1FINA 3B8RA 3D9VA 4ENXA 4KSQA 5D11A 2HW7A 1YDSE 3ZFYA 3R8PA 3UC4A 2JIUA 3HV6A 2WXVA 3KY2A 4KAOA 4R6VA 3PG3A 3CXWA 3S3IA 3C0GA 3CSVA 3ZDIA 4NM3A 3WZJA 4IB0A 2PU8A 2WMAA 3A99A 4CLJA 3S4QA 4BTJA 1YWRA 3ELJA 4X2NA 3TL8A 1XHAA 2YDJA 4AX8A 2HZ4A 2C69A 1H8FA 3LXNA 3AMAA 3UIXA 3L9LA 3WYXA 4JG7A 3P7BA 3FZ1A 4D2SA 3MFRA 1R39A 2J0KA 4EH5A 1FMKA 3MY1A 3RPOA 4O82A 4FIEA 4IDTA 2X7FA 3DAJA 4BZDA 1MRYA 3ZBXA 3W33A 4N70A 4RBLA 4QP1A 4XUFA 5L6WL 2RFNA 1WBWA 1ZMUA 3QLFA 3SW4A 2VTLA 3FMDA 5FBOA 4BDEA 2HAKA 2WQEA 3NUNA 5TT7A 5J1VA 1WZYA 3R0TA 4IFGA 5EQYA 1UWHA 4IAIA 4IE9A 4LQMA 4MKCA 4D9TA 3DZOA 4ZSGA 1JSTA 1OL5A 5KUPA 3OY3A 4BCGA 2BROA 4JBPA 3O7LB 5K4JA 5BMMA 1AGWA 2CMWA 1PRYA 2EXMA 3PXKA 4OT5A 1M14A 4IWQA 3EFKA 3PSCA 5K9IA 3UQCA 3VULA 4PPCA 4LMUA 3MY5A 5E8UA 3R2BA 2X7GA 4PL5A 4KINA 3R1NA 4NTTA 4ZOGA 2E9PA 4D4VA 2IZRA 5HLWA 5JGDA 1YOJA 2XIXA 4L68A 1JNKA 5HESA 2VO3A 4TTHB 3MVHA 4YSJA 4OLIA 5M4CA 1KV1A 2X6DA 2CKPA 2R4BA 2IVUA 3LFFA 3OEZA 4AW2A 5J9ZA 4BBEA 4BTFA 2X2KA 2YM5A 5HU3A 2YIXA 3CGFA 4BZOA 3QD3A 3R6XA 4OR5A 4RT7A 4QTEA 4O0SA 3IW5A 2C6TA 2EXEA 3GCQA 3DDPA 3WF7A 4FNWA 3DV3A 2J5FA 2PUUA 4XNEA 3ZO3A 3AG9A 2I7QA 4TWPA 5A46A 2X2MA 5L2QA 1JOWB 3FEGA 3DU8A 4HJOA 5AP2A 5IEXA 2C68A 3FLSA 5EHOA 4QD6A 3IOPA 4MXAA 4D2PA 3Q60A 2ACXA 2VNYA 5BVEA 4Y72A 4M14A 1OMWA 3CKWA 3FI2A 4OTQA 5IISA 3FV8A 4BCQA 2R0IA 3L1SA 3KXGA 4TW9A 4G6NA 4ANBA 4U40A 3HMIA 4FZ6A 3SRVB 4AFEA 4D2TA 3CQUA 3PVGA 3UE4A 2QURA 3Q9ZA 1U5QA 4W8DA 3VS3A 3PDTA 4TYIA 3F66A 3IKAA 3C4CA 2W5HA 3CJGA 4Y85A 5AUYA 3FZPA 5DR9A 4E26A 2XIKA 2YEXA 4YURA 1FGKA 4D1ZA 4H36A 2IW9A 3TCPA 3IW6A 1UU9A 4I41A 3EN6A 2WKMA 3C9WA 3GFEA 3UZTA 4RIWB 4BF2A 5FGKA 4AW1A 1H1RA 3I79A 3LPBA 4J71A 2JAVA 3HAMA 1V0BA 2PSQA 5JSMA 4GG7A 3R7YA 2JKMA 1H28A 1A9UA 3R8ZA 3VRZA 4I6FA 1PYXA 1UNGA 2IW6A 2W17A 1Q3WA 3G9NA 5AUVA 5C8KA 5HLPA 3MY0A 4L3PA 2R3MA 3DTWA 4WA9A 1KE7A 2XF0A 4HCVA 5FWKK 3VC4A 3G0FA 4U5JA 4J53A 5AV1A 3KRRA 2C5OA 3W8LA 3OUNB 4ZAUA 4FV6A 1QPJA 2R5TA 1WVYA 5AP1A 3OOMA 1ZAOA 5AM7A 4FTRA 3MDYA 3DKGA 5HBHA 5I9VA 3VVHA 4BVUA 4H39A 1JSUA 4PTEA 5AR4A 3ZS5A 4RIYA 2YZLA 3LM0A 2G1TA 4LMNA 4IACA 4IANA 2VAGA 3THBA 2G2IA 4X0MA 3R7OA 3OT3A 4C36A 3PYYA 5LCJA 3PLSA 4E4MA 2VX3A 3ZEPA 1CM8A 4HOKA 4IVBA 4W4XA 5HNBA 2HZ0A 4R7IA 2WQBA 3VRYA 2BAQA 2ITUA 3HMMA 4FVRA 3VUDA 4BCOA 4FOBA 4CCUA 5M56A 3QGWA 4XV3A 5C1QB 5J9YA 4L7FA 3HLLA 3RINA 3FY2A 4NJ3A 1ZLTA 5J8IA 2VGOA 4BDJA 2CNQA 2NNWB 3AGLA 3Q9WA 5LMAA 3KVWA 3NVKI 3ZH8A 1PXMA 2ITTA 3IGGA 2X8IA 3P0MA 2VO6A 2PPQA 3ZHPC 3PY3A 1DM2A 2XB7A 2B9IA 3PE2A 5C27A 3R63A 4GK3A 2IW8A 3RPYA 3DGKA 4LOQA 3R2YA 4XMOA 4EH6A 4G9RA 3DJ7A 3QUEA 4F0GA 4WD5A 2YLEA 4MWHA 2EXCX 4C4EA 2OWBA 2R3PA 3UO5A 4MBIA 5HD4A 2HOGA 3KMMA 4O27B 3WE8A 2X4FA 4M69B 3VHKA 5KMLA 2W5BA 3MS9A 5IKWA 1W0XC 5AP0A 3HAVA 1NVQA 3QZIA 3QTRA 4AZWA 2FUMA 4AGUA 2VV9A 3FLQA 4QMTA 1Y6AA 2ZMDA 4FKIA 3DNDA 1TQPA 3BHTA 2CNVA 4FEWA 4RC4A 4UB7A 4DCAA 4D9UA 4EL9A 3UO4A 4DTAA 3LFAA 4ANQA 3C4XA 3CY2A 3PUPA 3ZUUA 4OBOA 3TTIA 4BDAA 4BN1A 3PFQA 5AR7A 2B0QA 5HTCA 5CSWA 2ITZA 3UPZA 3BU6A 3OXTA 4FV3A 5CU3A 5AM6A 4MQ1A 3NEWA 3LMHA 3D14A 1DI9A 5H3QA 4I4EA 5HCZA 4AACA 4GJ3A 4MVFA 1G3NA 3POZA 2XKEA 4DEGA 3JY9A 1CKJA 4RC3A 4WSQA 4F7JA 2R3NA 5DI1A 4F1TA 4RVMA 3GU6A 4ITIA 4MBLA 2W06A 4F99A 3NIEA 2H8HA 2W05A 3H0YA 2ZAZA 2GNLA 5HQ0A 3DTCA 2IZSA 3NR9A 3EYGA 4K6ZA 3VS2A 4EOLA 2X39A 4U8ZA 4ZSJA 3E88A 4AUAA 3FZOA 4YLKA 5JRSA 4CT1A 3R1SA 1OBGA 4JX3A 3HRFA 3TIYA 3VUKA 3Q53A 1HCKA 4E7WA 3DQWA 4YLLA 3D2KA 5HOAA 3P9JA 3ZXTA 1H24A 5I0BA 5IMEA 1RW8A 4KIKA 3LFQA 3UVRA 3KK9A 2X81A 4WBBB 3VJOA 4M0ZA 4AZVA 4FT0A 5AUWA 5AV4A 2FSTX 5GZ8A 2B9JA 5L8LA 1RJBA 5CU0A 4E6AA 4FTAA 3NRMA 2JIIA 4C8BA 4CYJA 4PP9A 3BKBA 2I0VA 5CNNA 3H9OA 2ERZE 2PWLA 4FYOA 3UIMA 2Y0AA 3CS9A 4YJRA 1AQ1A 3PG1A 4RG0A 3IECA 3LCDA 3ZO1A 2UVYA 1WBTA 3NVMB 4RIXA 5L8KA 2CKOA 5IQEA 1XH4A 4FGBA 2GHGA 3TUBA 4KIOA 4LV8A 5CEOA 3VBWA 3NSZA 3HV5A 3JS2A 1E1XA 3QRIA 2BRBA 5BVWA 4BDHA 2WTWA 4YTCA 3T3VA 3RM6A 3OWPA 3UTOA 4IZAA 2ZOQA 3FMJA 1KOBA 3IO7A 2CGUA 4F08A 4C61A 3VIDA 4DYMA 3UPXA 2VZ6A 2GNJA 4DHFA 5KBRA 3P7AA 1Q41A 3IW7A 1XH8A 4C37A 4NFNA 2PUNA 3FKNA 4E4XA 4P90A 2PZIA 4XS2A 5CAOA 3NUAA 2XNGA 2QODA 3O23A 2YM7A 4UWCA 5H8BA 4EHVA 4TY1A 3G9LX 3QZFA 5HE2A 5CAUA 4DG0E 4DTBA 3BPRA 5DT3A 2BALA 3TM0A 4K11A 4UYAA 4O83A 4MF1A 3DXQA 4PPAA 4C57A 5C01A 2WNTA 4FA2A 2UZVA 3BGZA 4F9WA 3EZVA 4J97A 4MWIA 4F9CA 2DWBA 1SM2A 3O2MA 3VO3A 3QTXA 3F6XA 5ANIA 4PRJA 3HNGA 4QYHA 5B2LA 4AXAA 3CY3A 2OO8X 2CPKE 2OLCA 4FIFA 5E4HA 1Q62A 5B7VA 4AT5A 3ET7A 2RFSA 5ANKA 4FT9A 3SG9A 5LVLA 5AWMA 5B2MA 4FL1A 3GCUA 1J1CA 2OF4A 2R0UA 4ZLZA 3GVUA 4EQCA 3CLYA 2ZMCA 4PL4A 4DGGA 5IA0A 4WBOA 2QOOA 3OVVA 4ITHA 5E8ZA 3TNHA 3SKCA 1SVEA 3H0ZA 4Y5QA 3FZTA 4I20A 3PIYA 2BDJA 1PXNA 4JQEA 4YHTA 2PMNX 4CRSA 4IX5A 1QL6A 4JIAA 3OWJA 4F6UA 2VTHA 3OS3A 2WOUA 1H26A 4UXQA 5CENA 5AA9A 3BRBA 4ONAA 3C5IA 5EK7A 5JMSA 5DPVA 4I92A 4MXOA 4FIIA 2PMOX 2UW5A 4FKOA 3SC1A 4DG2E 3GU4A 4NM5A 1ZXEA 5BUIA 2FH9A 2YHVA 5FTOA 3H3CA 4CMTA 2ZM4A 2QOHA 3PSBA 5HBJA 5K5XA 2GFCA 3PWYA 2YAKA 3NAXA 5H2UA 3QTZA 2EB3A 3EHAA 2J0LA 4UALA 1RQQA 1J91A 2WELA 4GS6A 4S32A 3QZGA 5CI6A 3RALA 1Q24A 3RCJA 2JGZA 4G31A 2QI8A 2WMWA 3BYVA 4KKGA 4RJ4A 1ZOEA 3E87A 4BCFA 5CZHA 3IONA 2F9GA 4DFYA 3E3PA 4V0GA 1GZ8A 3ULIA 2BAJA 4PV0A 4FNYA 4BKYA 4FODA 3NCZA 4QTBA 5LMBA 3VS0A 3S2PA 2HXLA 3D4QA 3NZ0A 3EN7A 5B2KA 3SOCA 1SVHA 3KCKA 4FUYA 4HVDA 1JLUE 5CSHA 5CF4A 4DE4A 3KRXA 4D28A 4P5QA 2ETKA 2XZSA 4DGLC 3COKA 3R04A 3V6SA 4DLIA 4KUJA 4GT3A 4EH3A 3EN5A 2XH5A 4XG3A 4YP8A 3SQQA 5IA2A 3HP2A 4UMPA 4XV1A 4DFUA 4IX6A 1Q8TA 3LXPA 3UC3A 3UOLA 1OM1A 2WMSA 3IK3A 5CNOA 2PVHA 5F94A 4EZ5A 4IADA 2G2FA 4FT5A 4C4HA 5I9XA 1GNGA 1GZNA 4D0WA 1YXUA 2UZWE 2ITYA 3PZEA 4PF4A 4G3DA 3FMEA 3ETAA 4M13A 5ICPA 2QU5A 2F57A 3GC7A 5EW8A 3IOKA 4ZTRA 3UIUA 2W99B 5DRBA 5GHVA 5E8WA 1P4OA 2YISA 3QUDA 2BHEA 2W9FB 4H3QA 4ZSLA 2PE0A 2XYNA 3OCBA 4J1RA 4DINA 2XNOA 5AIRA 3ZFXA 2FVDA 3E7VA 5F20A 1UWJA 3P78A 3G90X 5I9UA 3EFJA 4DT9A 3R22A 4FICA 1IRKA 4NZWB 4OTRA 3W2RA 5I9YA 5JZJA 1WVXA 4Q9ZA 4DH1A 4K0YA 2GNIA 5JFSA 1QCFA 3HRCA 4G6LA 2JEDA 3RPRA 3DAEA 4BIEA 5F4NA 3U6HA 1FPUA 2WFYA 4BDFA 3F2RA 3HYHA 3LFEA 1JKTA 4B0GA 4D0XA 2C0TA 4A9UA 4TYJA 2G01A 2JLDA 3L8VA 1YI3A 1V1KA 2UW8A 4DGOA 2XKCA 3PXZA 3MIAA 5L6PA 2VTNA 4AA5A 2ZJWA 3HMNA 3F2NA 2JKKA 3MH3A 3FC2A 4DH5A 2BR1A 4I4FA 4X3FB 2P0CA 4AZEA 2J0JA 3QA0A 2W7XA 3L8XA 3Q4ZA 4BHZA 1YVJA 4PMPA 3LLAA 4PMSA 3BIZA 4B8LA 1Q8YA 3HEGA 1WCCA 5DH3A 4KWPA 4QMZA 3RKBA 4YJTA 4FGRA 4QYGA 3WZEA 3E93A 3FHRA 3JVSA 4F7SA 5E90A 3MYGA 4FTCA 5CS6A 4YZNA 1H00A 4GVAA 4II5A 4YMJA 4R7HA 5HHWA 4G2FA 5CAVA 2YAAA 3FQEA 2CCIA 4NK9A 5JN2A 5IQCA 4DGMA 2PVLA 2R3HA 3IS5A 2FSLX 1U54A 3U8WA 3RWPA 3UYTA 5M08A 4OBPA 4U79A 4RVTA 3TNQB 4AT4A 3RK7A 4EK4A 4Y73A 1BKXA 4DT8A 4EJ7A 5IUHA 3O0GA 4ERWA 3ALOA 3MH0A 4J52A 2HYYA 5C8NA 2UZUE 4I6BA 4HVGA 4ASEA 4IC7A 2OKRA 1PKDA 4KB8A 1BL6A 4USFA 5HEZA 5IQIA 5DWRA 4M84A 3E7OA 4XG6A 4M3QA 1OL1A 4YHJA 1YOMA 4MH7A 4XOYA 4BYJA 4C02A 2PHKA 2XNEA 2WTKB 4LI5A 4PX6A 1R1WA 2O65A 3OC1A 4UX9A 3ZOSA 5ANOA 4QTAA 4S33A 4C58A 4N6YA 4PMMA 4WRSA 5H8GA 4NSTA 4CKJA 4FKQA 4FOCA 1IA9A 2AUHA 4RX9A 3I60A 4L52A 3UOHA 3LOKA 3L9MA 3C0IA 3DPKA 4RSSA 2JD5A 3C50A 3FQHA 1UV5A 4FIGA 2ZB0A 3TKUA 2GQRA 3OF0A 2XUUA 5AP5A 2DUVA 5C03A 1YXXA 4EH9A 2UZLA 1W7HA 2R3LA 3ORXA 3PY0A 4BI0A 4W9WA 5AP6A 5DYJA 4ASZA 5KCVA 4JOAA 4QMLA 2E9UA 4C35A 4IZ5A 4FG9A 4IX3A 4KBCA 4LV5A 1ZZLA 2PUPA 5FLFA 4F7NA 4RPVA 1LPUA 4E5AX 1SNXA 4ANLA 2CSNA 3S0OA 3V8SA 1G8SA 4EBVA 3I81A 1IR3A 3AC8A 4GH2A 3LQ5A 5LXMA 4WHZA 3QXOA 1NVSA 5AA8A 3TNIA 1UNLA 3VAPA 4GU6A 4JAIA 4YPSA 3RP9A 4DLJA 3SAYA 3U87A 3HMPA 4PUZA 2QU6A 2OJGA 5ANGA 3DCVA 5IUIA 5IA1A 3F5PA 3QFVA 4X2KA 5LMKC 5EQEA 4IEBA 1PMVA 5FTGA 4LOPA 1YI6A 3PJ1A 4KKHA 5G1XA 4BHNA 2X0GA 5L2IA 3MIYA 4FEXA 2C0OA 2C6LA 4RMZA 3WF9A 3GC8A 3IDCA 2XK9A 5AIKA 4BYIA 5EI8A 5DNRA 2WAJA 3HZTA 4DBNA 4JIKA 5HKMA 1OB3A 3QRUA 3Q04A 4LYNA 2XA4A 4AOJA 5HZNA 2PVFA 5CX9A 3ANRA 2W0JA 4XLIA 5IH6A 3G33A 1LUFA 4MHAA 3D15A 3RHKA 2WMQA 4FKJA 4YBKA 4EONA 4BI1A 5E92A 3EOCA 4ZLOA 2HCKA 4DH3A 1OKYA 3FI4A 5G6VA 2J9MA 3NNWA 4DC2A 1JKLA 3QHRA 4YNOA 5M4IA 2B53A 3UG2A 2J4ZA 4O22A 1S9IA 2IZTA 3PRIA 4QTDA 3MWUA 3QCQA 5HGIA 4K33A 3N4UA 4QP6A 3KXXA 4L00A 3KCFA 2CLQA 3PXQA 3OOGA 3VHEA 2JIVA 3P7CA 4HGLA 3DZQA 3ORLA 2B1PA 3RPSA 2NP8A 3SRVA 5KMJA 1T46A 3AC3A 5GJGA 3DK6A 3VBTA 3ZU7A 5JQ8A 1P5EA 3TJDA 2JBOA 2JFMA 3QTSA 2R3QA 2V55A 1IEPA 3QWJA 4G5PA 3ATTA 2WQNA 2VO0A 2A27A 5A4CA 1CMKE 4RIWA 3SD0A 5HD7A 2OFVA 3BWJA 3P86A 5EM6A 2P55A 1PXPA 3VQHA 3ZLYA 5IA5A 5CEQA 5E8TA 4D5HA 4FV7A 5GIOE 2O0UA 3EKNA 5HTIA 3QRJA 2OIDA 1KOAA 3HL7A 4RGJA 4BDCA 4LM5A 2ZYBA 4EH2A 5FG8A 4ZTMA 4DN5A 3KA0A 1ZWSA 3HUCA 4JBOA 4CFNA 5LQFA 4F1OA 2QC6A 4QMWA 5TO8A 3M2WA 2VTOA 2O3PA 1M2QA 3F3WA 4H3BA 4UMQA 2Z7RA 1GZKA 3EL7A 4XJ0A 4IB5A 2R7BA 4FR4A 1S9JA 4WNKA 3A8WA 3G15A 3OMVA 3AC2A 2V5QA 4M8TA 1JSVA 3NLBA 1UKIA 2Z2WA 3QHWA 3QYZA 2WU6A 2BIYA 2XIZA 3VBQA 2VWYA 2VWVA 1OPLA 5AV2A 4YTFA 3F88A 1SYKA 1PXLA 4JQ7A 1VYZA 5BNJA 3TNWA 2WMTA 1SMHA 2BZIB 2LAVA 3MFTA 2O2UA 2WZJA 4WOVA 1E1VA 1MP8A 5CALA 4TWNA 4D4YA 1KUTA 1WBOA 3U6IA 2Y7JA 1VYWA 2ZDTA 2OJJA 3D94A 3KRJA 3U9NA 3UQFA 2JDVA 5AV0A 3QALE 5FBNC 2OBJA 5I3RA 4EORA 3HA8A 1JPAA 2VWWA 1KE5A 1P14A 4FSWA 4QP2A 4IX4A 4HNFA 2W4OA 3W2OA 4UZHA 3V8WA 4BBMA 4PTCA 4OUCA 3IW8A 4U0IA 4OBQA 3MI9A 3PLAE 2BHHA 2XK8A 3BEAA 5KBQA 4FKVA 5FEQA 4FEVA 4LGHA 4FVQA 5M57A 4QP4A 5CWZA 3NX8A 5HE0A 3F7WA 3GP0A 3F3VA 3OFMA 1NT2A 1LR4A 5LMKA 3LJ0A 2VWUA 1PF8A 1ZY4A 2X9FA 3E8CA 3KRWA 2RF9A 4M69A 4O0XA 3LCOA 3UNJA 4Z16A 4NWMA 5A4LA 3OBGA 1RE8A 2QO7A 5LVOA 4N57A 5K4IA 1KV2A 4YZDA 5JFWA 3R8VA 4O21A 3LQ8A 5BYLA 4TRLA 5BQ0A 3QL8A 4IW0A 2W1ZA 3EB0A 4NEUA 2UVXA 3E62A 3TKHA 4F65A 1YWNA 3KRLA 3WZUA 4CFXA 4EUTA 4O7SA 3SHEA 4FTQA 3QCSA 5CU6A 3HRBA 2I0HA 2ITNA 3R71A 1U5RA 5CXHA 3W55A 2J7TA 3ZSGA 4CYIA 1REJA 2WTIA 4NFMA 4BR3A 4FVPA 4UZDA 3OP5A 4BCMA 4RLKA 1T45A 4DFNA 3CR0A 2VTSA 1SVGA 3HKOA 2QKRA 3I1AA 3DKCA 2P4IA 4Y8DA 3WE4A 2WMRA 4MNEB 2ZV7A 4FSNA 4O0WA 1XQZA 4XP2A 5CSPA 4EQUA 1XO2B 2NRUA 4TN6A 3AT3A 5J95A 4CZTA 3PVWA 4FV5A 4GFGA 4J98A 1XH5A 4JL9A 3T8OA 3ZLWA 5L2TA 3UQGA 4C2VA 4EOSA 4TYGA 2WO6A 5AR3A 4HCUA 4IDVA 3GT8A 4CKRA 2QLUA 4XBUA 5L8JA 4MXYA 1Y8YA 3BI6A 4KRCA 2VWXA 4XG2A 5DFPA 1XBCA 4AOTA 2UW9A 1B6CB 3MSSA 2WMVA 3FE3A 1XKKA 2H34A 2W1DA 3K3IA 3QZHA 4WUNA 3ZMMA 1KE9A 2CJMA 3PP0A 4CV8A 3NYXA 4FKUA 4F6SA 5IQBA 4C3PA 3WZKA 2REIA 3E5AA 3P23A 4BDGA 2YERA 4FTTA 5BYYA 3AMYA 3ORZA 4L44A 2WQOA 2PMLX 2P2HA 2XNPA 2R64A 3AOXA 4TXCA 5IEYA 5DEWA 2JDRA 3L8PA 3MN3A 4I1ZA 1H07A 1LEWA 4UYNA 5FTQA 1BYGA 5EI6A 2UW6A 3NUYA 4WG5A 1NXKA 4LL0A 5HCXA 3PZHA 4FIHA 5HO7A 4AT3A 4FKLA 4L9IA 4XOZA 2LGCA 2CGXA 3EN4A 3ZRMA 3RBWA 3K54A 4MCVA 2GQSA 3II5A 4G5JA 4NM7A 4G17A 4UWYA 4DEDA 4QT1A 3KGAA 4O6LA 4O1OA 4DH7A 2UZTA 5IF1A 2GDOA 1BI7A 2BZJA 2RFDA 2WMUA 5JT2A 2GSFA 2YDIA 4TT7A 5HX8A 1OPJA 1OGUA 4L7SA 2GS7A 4KNBA 2YITA 2IVTA 3BGQA 3VUIA 4CT2A 2IN6A 3C13A 4GRBA 4GT4A 4KIQA 2BRMA 5EM7A 3R9NA 1WAKA 4IWOA 3DK3A 3LHJA 5CANA 4B4LA 4EKKA 2DQ7X 3HV7A 3QUPA 4IM3A 2WTDA 3V51A 4M12A 3ZLSA 3ZUVA 4A9RA 2PVKA 3CQWA 3EQGA 3TNPC 4JVGA 4FV8A 2CN8A 4AN9A 1Q8WA 2C5YA 3JUHA 3VQUA 3QU0A 1TVOA 4YNEA 4Q2AA 2IPXA 5M53A 3NS9A 1J3HA 3O50A 2W1IA 3ORNA 4FG7A 2WTJA 3VWAA 4GYGA 4MNFA 4XG9A 5HIEA 3LE6A 3TG1A 4TWOA 2C6OA 3UVQA 4YUQA 3QTUA 3HUBA 1FOTA 4KKEA 4FSUA 3QRKA 3QYWA 4J8MA 3OCTA 3DS6A 4BRXA 3LKMA 2GHLA 3UG1A 4H05A 1WBSA 4JBVA 4PY1A 3W32A 1OKZA 4GU9A 3NIZA 5CZIA 1H1SA 2YN8A 3BCEA 5M44A 4FTUA 4HYHA 4CRLA 4CMUA 4FL3A 1E9HA 3VUGA 2V0DA 3HMOA 2VTRA 3AQVA 4PDSA 2GQGA 4K8AA 4XG7A 3FYKX 4D2RA 3WF5A 4PMTA 2P33A 4KRDA 2I1MA 4ALWA 2UZNA 2CDZA 4A9TA 1P4FA 5KMMA 4GL9A 3RZBA 2W1CA 2YM3A 3EFWA 4ERKA 3Q3BA 3SXSA 4AE6A 4RLLA 4W4VA 3WILA 3SG8A 4E3CA 2PZRA 3LFDA 1ATPE 5GZ9A 3NPCA 5CEPA 4UEUA 4CNHA 4D5KA 1IAHA 3PY1A 5D10A 4ZZOA 3TDVA 1OIYA 1M2PA 4AZSA 4FUXA 4BGHA 1PXIA 2WTKC 3A7IA 2B54A 2BZKB 2Y4PA 3KXNA 5IEVA 2RKUA 3SOAA 4Y5HA 4ALUA 5JKGA 3TI1A 2BKKA 3UGCA 2OH4A 2GPHA 2ZB1A 3IPHA 4ZTLA 1M52A 5CF8A 5IZFA 3U6JA 3E8DA 3R21A 2QOKA 4HYSA 5HORA 3VBXA 3O71A 4DFLA 4HGEA 1GAGA 2QOFA 3PSDA 1X8BA 4L67A 4G3EA 4DEAA 2IZUA 2OICA 2UV2A 3ORMA 2PE2A 3TXOA 3W18A 1O6YA 5FP6A 3R1YA 4L42A 2ETMA 4P2KA 1U59A 2O64A 2XNNA 5EHYA 3P79A 4ANOA 2ETRA 2I0YA 5ANEA 4EOOA 3TZ9A 1YOLA 2A4LA 4G3GA 5DR6A 5EOLA 4QTCA 3KEXA 3LFNA 5KZ0A 3R00A 4CV9A 4E6QA 4FKSA 3B2TA 1L3RE 1B39A 4PNIA 3JYAA 3ZYAA 5K5NA 4LGGA 3HVCA 4GW8A 4F63A 4RFZA 2GMXA 2C5NA 4BDIA 2R3GA 4FV2A 4G3CA 4FTOA 4H3PA 4I0TA 4J95A 2XRUA 4D4SA 5IA3A 5M4UA 5IUGA 2XYUA 2VTJA 3C51A 4YZMA 4CG9A 1JKSA 3QC4A 5FEDA 5C9CA 2YLFA 1XBAA 5I5ZA 5BVDA 3L9NA 3PJ8A 5CAQA 2W4JA 4BL1A 4FT3A 4RC2A 3RAHA 5K0XA 4F9BA 4RVLA 1XWSA 2BTSA 2QQ7A 2YM4A 4GFOA 4Q5HA 4FKPA 3UMWA 5AX3A 2W5AA 3UIBA 5FDPA 4YJVA 3HV3A 4DEHA 3M1SA 4XX9A 4QMNA 5LARA 2Z60A 3PJ3A 4KABA 1YWVA 1REKA 2GTMA 1XR1A 4IAKA 3ZZWA 2PZYA 3Q4CA 4QPMA 1NY3A 2OH0E 5HG7A 3UZPA 3V5LA 3AGMA 3EZRA 4GG5A 1M2RA 3EIDA 3KK8A 4FI1A 4GFMA 2W1HA 3BYMA 2CGVA 5A4TA 1K2PA 2ITVA 4HCTA 5HX6A 3H9RA 5HICA 5IG1A 3C4WA 3QTIA 5BUEA 2CGWA 1CTPE 1OIUA 2OJ9A 2WHBA 5E8XA 3BBTB 1YI4A 2XMYA 3L8SA 4EOIA 3ALNA 4AF3A 4YU2A 3NYOA 2BTRA 4O7ZA 4TZRA 3S1HA 3ODZX 3GENA 3C0HA 4R5SA 5KO1A 3QLGA 4HZRA 4PNKA 2HIWA 3KVXA 4BIBA 2QVSE 5A3XA 3A2CA 4QP9A 4BCJA 4FKWA 3MJ2A 2RIOA 2VN9A 1YQJA 3P5KA 2QOQA 3DDQA 4TKSA 4B6LA 4EOMA 5LVMA 5CTPA 2R3OA 3O7LD 5HVYA 4Z9LA 2BUJA 4FSZA 2VTIA 3F5UA 5BVFA 4QMMA 4EBWA 2F2CB 4RWJA 3IDBA 3QQLA 3PA5A 4ZS0A 4ZEGA 2ZM3A 3CTQA 2IVVA 2CKQA 4DEEA 4KD1A 4EH7A 1VZOA 5FRIA 2C1BA 3D83A 5LOHA 2C6DA 2JDOA 4K2RA 3MVJA 2X2LA 3MB6A 3SVVA 2QHNA 3DJ5A 3F9NA 2X6EA 4L3JA 4JDJA 3R28A 5F1ZA 1XJDA 1O9UA 3BZ3A 1SZMA 5H9BA 4L53A 3JPVA 4QMSA 3RPVA 2QOIA 2VWIA 2WTVA 4HNIA 3RZFA 4F0FA 5A4QA 3DY7A 3FXXA 4FTLA 5L6OA 4J99A 1R0PA 3OHTA 3VS7A 3FPQA 5BMSA 3KN5A 5M09A 1Q4LA 3ROCA 4BY9E 1HCLA 3R73A 3PVUA 4H1MA 3N9XA 3GB2A 1R3CA 2GNGA 4LGDA 2A19B 4GK4A 3ZTXA 1GIIA 3REPA 5AP4A 2A1AB 3Q32A 2PVRA 4I0SA 3RK5A 5TR6A 4YR8A 4M7IA 4IFCA 4AFJA 3RJCA 5D12A 4D55A 3EJ1A 4OAUC 4X21A 4RVKA 2SRCA 3PPJA 4FL2A 4LOOA 4TNBA 5CVGA 1J1BA 5J1WA 5FUTA 1MUOA 1ZMWA 2V62A 4QPAA 3MJ1A 4XH6A 3N51A 5IQFA 3EQFA 4ZTSA 4U81A 5JZNA 4ANSA 2R3IA 2XKFA 5EM8A 3VW8A 3FZSA 5IDNA 3JVRA 5KHXA 3RNIA 4CFUA 5IH5A 4ENYA 4C4FA 4BKZA 4O1PA 3CTHA 4FZAB 4AQCA 3PXFA 4YC8A 4CQGA 1H4LA 2E9NA 2IVSA 3ZM4A 3QQUA 3AMBA 3BU3A 3NGAA 3D7TA 4M66A 3RAWA 1UU7A 5C8MA 4S31A 2XBAA 1FVRA 1HOWA 3JXWA 3MVLA 3R9DA 4Z55A 1WMKA 3DB6A 1PXJA 1R78A 3DLSA 1PMUA 4U43A 3Q4UA 4V05A 3EMGA 2QNJA 1YHSA 3F61A 5AP3A 4F64A 1U46A 5EW3A 2VTPA 5ETAA 3KL8A 1PHKA 3MVMA 3QKLA 5FXSA 3NUUA 4GMYA 3AD4A 3QKKA 3A8XA 3KN6A 3WF6A 3ZC5A 3CD8A 2X1NA 4O0TA 5BYZA 4ZY5A 4CQEA 1OVEA 3QQFA 4TNDA 5HE1A 2BFYA 4RWLA 4YTIA 1MRVA 4NU1A 4JXFA 5DMZA 1LEZA 2BCJA 1FMOE 1WBVA 5ITAA 3WBLA 2UW3A 5ANJA 1L8TA 1W98A 4FV1A 3E8NA 4HYUA 2YWPA 3BLHA 3HX4A 4I93A 5CQUA 5CT7A 4ZY6A 4M97A 3ZLXA 4X6QC 5M4FA 2Q0NA 4XG4A 4BWKA 3A60A 3E92A 4IVCA 3BE2A 4HW7A 3MPTA 5BPYA 3R8UA 3Q5IA 4HGTA 2I40A 4MX9A 4RQKA 3C4FA 3H4JA 1TQIA 2X9EA 2GTNA 3MPMA 5HG5A 5DA3A 1YDTE 2HWOA 2XM9A 3VF9A 3FY0A 4O7WA 4JG8A 2GNFA 3UP2A 3E8EA 2YCRA 2W4KA 2WU7A 3DXNA 4RIXB 2C5VA 2HXQA 4B9DA 2PL0A 4DFZE 2CN5A 3D5WA 1WBPA 1ZOGA 4NIFB 4BDDA 5IU2A 2WIHA 4NW5A 4RJ3A 2HY0A 4Y83A 5K0KA 5KE0A 4U3YA 4HPUE 1M7NA 4JI9A 4W4WA 4O86A 3OUKA 2XEYA 1Q97A 4E20A 3LLTA 5AUUA 3C4ZA 2W96B 4I24A 3PVBA 3WOWA 4XHKB 4RJ7A 4CZYB 1YHWA 4KSPA 2YJSA 1PMEA 3T9TA 3LJ1A 5E9EA 1W82A 2FB8A 5K3YA 4YJNA 5TOZA 3V5QA 4CVAA 4WG4A 1OIQA 4X2JA 2RL5A 1V0PA 4TYEA 1H01A 3I6WA 3G51A 4QP8A 4U6RA 4ZP5A 4X3JA 3ZXZA 1M17A 4JQ8A 4RZVA 1OECA 3FMLA 5AR8A 1K9AA 1STCE 4HVIA 2Z7SA 3D0EA 4BWPA 3R9OA 4ZJVA 2VWBA 4UBAA 5AJQA 2R9SA 3U4WA 4HZSA 3RI1A 4FTJA 3TWJA 2UUEA 4WT6A 2GU8A 3HV4A 4O38A 4ANMA 4XYFA 5CLPA 2YIWA 3PWDA 3ZRKA 4GV1A 2C6MA 2FA2A 4IQ6A 3I7BA 3R7GA 5ETCA 4DFBA 4YJQA 2JFLA 2OXXA 4GVJA 4GIHA 3RAKA 3W10A 3NMUF 2EVAA 4OTIA 3UJGA 3NUSA 2WGJA 3WIGA 4GSBA 4UY9A 1KSWA 5HCYA 4PP7A 5BVKA 4EHGA 4DG3E 4O7YA 1OPKA 3CPCA 5AFVA 3U54A 3TN8A 3PXRA 1YHVA 4A9YA 2W1GA 3VN9A 3CCNA 4QNAA 4M15A 4L3LA 2YACA 3QD4A 2CLXA 5FDXA 3DXPA 1O6KA 4AN2A 5AEPA 2OZOA 3G6GA 3LFCA 4O2ZA 2W1FA 3EKKA 4EZ7A 2EUFB 4BGQA 3FUPA 2BRGA 3KFAA 1KWPA 3VS5A 4G16A 5M55A 1ZY5A 2Z8CA 2ITOA 2UVZA 3QD2B 3GUBA 3HDNA 4YLJA 2ZVAA 4B99A 3EWHA 1BLXA 4OTDA 1LP4A 4JS8A 4GYIA 3LCSA 3FSKA 5F9EA 3EN9A 3NW5A 4C4GA 2QG5A 4GT5A 4RJ8A 3GCVA 5E1SA 2F2UA 2VRXA 2PZPA 4ZJIA 3QQJA 5H8EA 3DBFA 5HBEA 4YZCA 2HW6A 2A2AA 4GIIA 4NUSA 2AC5A 4XRLA 5JEBA 4D58A 5FXQA 4ITJA 5EM5A 3DBEA 3DBCA 2J50A 4X2GA 3FC1X 2B9HA 2WQMA 3ZSHA 4F0IA 4F70A 2ZM1A 4KBKA 4WRGA 5KX8A 4J7BA 1Y91A 3R7VA 5A9UA 2XIRA 1QPDA 3BHHA 4EK3A 3KULB 4FNXA 1EH4A 4U7ZA 4UV0A 2OF2A 2XCKA 4I23A 1DAYA 3TT0A 3ZUTA 3DAKA 4RA4A 3O8UA 2P2IA 2B55A 2BAKA 2F49A 3A62A 3FMNA 3ORTA 3TKIA 2XK4A 3PRFA 4CZUA 3LXLA 4QP3A 4ALVA 1BL7A 3G6HA 1ZYSA 4IAYA 3GC9A 2YCSA 5D1JA 3DA6A 4M67A 5E8SA 5ANDA 5EYMA 3TV4A 5AV3A 3EQDA 3COHA 4OTFA 4BTMA 5EI2A 3BBWA 2JBPA 2BRHA 3PPZA 2YCQA 3FYJX 1Q8ZA 2C3KA 2V7AA 4LRMA 1FBNA 1MQBA 1YKRA 4K9YA 4YC3A 2YDKA 4CXAA 4JDHA 4DGNA 3BELA 3RWQA 2AYPA 4AGDA 4EH8A 4F09A 5KKRB 3V5TA 3WI6A 1OBDA 1I09A 3PPKA 3FLWA 1URWA 3ZFMA 4ZLYA 4MK0A 4DITA 5GINE 4MAOA 1F5QA 2YIYA 3LJ2A 4GEOA 4L01A 3E3BX 3HDMA 3VW6A 4R1VA 3FSFA 3C1XA 3Q9XA 4Q9SA 3SX9A 4O81A 3QX4A 1A06A 5CYIA 5DLSA 3Q2JA 4ZTQA 2YM8A 3N4VA 5FP5A 3UVPA 4QMUA 1BUHA 4HYIA 5CAPA 4HVHA 2PK9A 1YRPA 4C2WA 4UMUA 5C4LA 2EWAA 1Z9XA 2IG7A 4BGGA 2VTQA 1O6LA 3FZRA 4BCPA 4ZSAA 5M07A 2Y6MA 3MPAA 5FEEA 5I4NA 4CCBA 4S34A 5FM2A 4OTHA 2PMIA 4QOXA 2ITXA 3RCDA 4RIOA 2QOBA 3A4OX 5AUXA 1ZMVA 2PTKA 2QLQA 2VWZA 5AP7A 4YJSA 5HI2A 2XS0A 4MQ2A 4XP0A 5DVRA 3LCTA 4C59A 4TWCA 4J8NA 4JBQA 2BPMA 2ONLC 5B0XA 3D5VA 3W2QA 3MESA 3CJFA 3MBLA 4QMQA 4ZZNA 5CEMA 2ITPA 4D1SA 3QX2A 2VD5A 4LRKA 1FVVA 4NT4A 3RGFA 3KKVA 3MB7A 3ZO4A 4CTBA 2J2IB 2QR8A 4M68A 2QOCA 3GEQA 1U54B 4FIJA 1PW2A 2C1AA 2JDTA 5CY3A 3KF7A 4RRVA 4L6QA 1QPCA 4ZK5A 3FI8A 3SGCA 3IQ7A 3EH9A 3PP1A 4I3ZA 3MV5A 3P4KA 4JLCA 4V04A 1ZYLA 3FPMA 2QO9A 3LM5A 4MXXA 5ETIA 3V3VA 4GKHA 2XJ1A 4NYEA 1JWHA 3RNYA 4YO6A 2V22A 4QP7A 4FZDB 4G6OA 4QMYA 5CT0A 2OFUA 5AX9A 2XNBA 2HZIA 4TPTA 4FV4A 4FSQA 4TYHB 5DE2A 2RG5A 2Z02A 1YXTA 3OW3A 5CEIA 3T3UA 1UNHA 4O84A 3W2PA 4YJPA 2QONA 4RWIA 5AR2A 3ROYA 3FLNC 1CSNA 2VGPA 3EQPA 1TQMA 3W2SA 4ACDA 3O96A 4AGCA 4O0UA 4DFXE 2YIRA 4MD9E 1YXSA 1IG1A 3CIKA 2ESMA 5D7VA 3F3ZA 5DBXA 3VBVA 2CCHA 3R7EA 5DN3A 5FD2A 3CPBA 4CFVA 4BCHA 2B4SB 3FWQA 5J5TA 2KTYA 3QKMA 3WIKA 4BZNA 3OY1A 4P4CA 2A0CX 3ORPA 4IZ7A 4YTHA 3I5NA 3LXKA 1Z5MA 2XK7A 2YJRA 4MD8E 5DG5A 2I6LA 2UW0A 2YA9A 3NNVA 4FZ7A 4FTKA 4PQNA 1Q5KA 2Y4IB 4NKSA 4U97A 4I21A 5HG9A 4E4NA 4ORKA 3FDNA 1VR2A 3C5UA 2XIYA 3PIXA 5EDQA 4H58A 5F95A 2H9VA 5HO8A 4O6EA 2WMBA 3WZDA 3NYNA 4YJOA 4AG8A 4DEBA 1NA7A 4EOPA 1H1QA 2ZDUA 4R5YA 4G3FA 4E5BA 4A07A 4QYFA 1H0WA 4F4PA 4E73A 2OZAB 3LQ3A 1XH6A 3A7FA 3R8LA 4L43A 4R7BA 5KMNA 4CG8A 2F4JA 2B52A 4AS0A 5BX0A 4IVAA 4AP7A 3DNEA 1PKGA 3D7ZA 1BX6A 5J87A 3RVGA 4C62A 5EKNA 3I0QA 2C3JA 4XCUA 2OXYA 5DIAA 2J0IA 3UP7A 1FVTA 5DHJA 4B7TA 5I9ZA 5LCKA 3RM7A 4BWXA 3P1AA 4G1WA 4GJ2A 4ZS4A 4NTSA 2UZDA 2BIKB 3Q6WA 4H1JA 3SDJA 1U4DA 1ND4A 4L46A 2C6IA 4IM2A 3EYHA 3I7CA 4R3RA 5KMOA 2WD1A 4AWIA 1GJOA 3DOGA 4CD0A 3C4EA 3EL8A 3AC1A 3EQIA 3E63A 2JITA 4P7EA 3VS1A 2GS2A 4U3ZA 1DAWA 2UZOA 3E64A 2Y8OA 4LFIA 4XRJA 3SW7A 1Z57A 2HENA 3PIZA 4RJ6A 5L4QA 2GS6A 1WBNA 3GI3A 3BYOA 2YWVA 3QTWA 4WNOA 3AD5A 3MFSA 4ZTHA 3VUHA 3HGKA 5TKDA 3SXFA 5BVOA 1VJYA 4XV9A 4ANNA 2E9OA 2VO7A 2R3KA 5GNKA 4MEDA 1H1PA 3V8TA 3PA4A 2OIQA 2VX1A 3M42A 3OCSA 4WIHA 4X7QA 2HK5A 3LVPA 2ONLA 4DA5A 3C7QA 5IQHA 2O63A 3LCKA 5CASA 3OBJA 3QQKA 3B8QA 4BDBA 2XM8A 1BMKA 3A7JA 2VTMA 3JR1A 4C34A 4ZJJA 5FXRA 4LG4A 4WO5A 4ZSEA 2JDSA 3FAAA 4YO4A 4AAAA 4EC8A 1H27A 5CU2A 4KIPA 2PVYA 5KMIA 4Y95A 4NCTC 4E93A 3FLYA 4BB4A 3TUDA 2V7OA 4CFMA 1ZZ2A 3NAYA 3DT1A 3UMXA 3I6UA 4EOJA 1W84A 1OKWA 1G5SA 5J9LA 3RMFA 3VBYA 3ZCLA 2IJMA 3LMIA 2ITQA 4QNYA 4X3FC 4ZMEA 5GJDA 4AU8A 5HNIX 1H1WA 3FHIA 4O7VA 2Z7QA 5T3QA 4FX3A 2OSCA 4LRJA 4FV0A 3AC5A 3ENMA 3NDMA 4AOIA 3FKOA 4I6QA 4IHPA 5CF5A 1DS5A 3LZBA 4IAAA 3G2FA 1M7QA 3NWWA 3ORKA 2IO6A 5EHLA 2X8EA 3ITZA 1G8AA 3COIA 3OG7A 5E7RA 4ZZMA 1B38A 5EQPA 3DKFA 4OW8A 1PMNA 4PDOA 4WG3A 4EJNA 3H9FA 4C4JA 2E9VA 4EHEA 2YZAA 5EYCA 3OXZA 3RTPA 1NW1A 4FYNA 4PPBA 2VU3A 3UO6A 4JRNA 3POOA 1UA2A 3NW6A 4I94A 4OAVB 3ID6C 3KMWA 4ZMFA 4FKTA 3OT8A 3B2WA 2OJFE 4OTPA 4USDA 5I9WA 3R8MA 4ASXA 4CSVA 4F1MA 2XKDA 3BHUA 4K18A 2WEIA 2HZNA 2WEVA 5AR5A 4C4IA 4DTKA 4RZWA 5IQAA 2EB2A 1DI8A 2UW4A 4I5PA 1OITA 3OROA 4U44A 4S2ZA 2QG7A 3FMKA 2C4GA 3I4BA 4GUBA 4FNZA 4A9SA 1H0VA 4QQTA 3W1FA 2OJIA 3D5UA 1K3AA 3K3JA 3S00A 2OG8A 3DBQA 3VS4A 3UODA 4W4YA 3MW1A 1GIJA 1GZOA 1ZYCA 2UZEA 4YJUA 3V5PA 3CGOA 1OL7A 3H30A 4EYMA 5HVJA 3I5ZA 5A4EA 3QQGA 4IMYA 4O0RA 4IJ9A 1APME 3N4TA 4N6ZA 4R3PA 4I0RA 4NM0A 3AT4A 3AXWA 3LFBA 4MXCA 4HVSA 4XLVA 3ZM9A 4JT3A 1IA8A 4O2PA 5FQDC 4C7TA 4FTMA 4MXZA 5LVNA 4IWDA 5HG8A 4EHZA 5T6KA 4S30A 3GU5A 4AN3A 1JQHA 3DB8A 3COMA 3R9RA 4E5WA 3ENHA 2PULA 4RA5A 4WNPA 3MA3A 3BEGA 4E6CA 2J6MA 4KS7A 5EDPA 3AD6A 4V01A 3OTUA 4DAWA 5D41A 4E8AA 3RHXA 4QRCA 3CTJA 4PDPA 3Q2MA 5DRDA 4O0YA 3NNXA 4UMRA 2WTCA 3KXHA 2Q83A 1QPEA 2C6EA 2XVDA 3ZC6A 4O7NA 2YFXA 5HIDA 5LWMA 2NRYA 3DBDA 3QXPA 5E8YA 3QBNA 3F69A 2WPAA 3R01A 2RFEA 4U80A 3QA8A 4MTAA 4YZ9A 3SA0A 3QD0A 3AT2A 4EK6A 4C3FA 3GQLA 3CEKA 2CKEA 2F7XE 3NUXA 5E91A 4GUEA 4ASDA 4A4OA 1I44A 3IW4A 3PE1A 5L2WA 4NJDA 2RG6A 4DEIA 2Q0BA 1YW2A 2J0MB 4FSYA 4NCTA 3FMHA 1QMZA 2OXDA 3GNIB 4APPA 1TKIA 3BQCA 2X8DA 5BVNA 3DFCB 4Q5EA 5CXZA 3TIZA 5I3OA 5EG3A 4X3FA 4DF3A 1PXKA 2XEZA 4IVDA 4NIFA 5IMXA 2Y9QA 5KNJA 5KKRC 2R3JA 2E2BA 4BIDA 4EK8A 1F0QA 1KE6A 3ZO2A 3ZSIA 4FSMA 5A6OA 4O0VA 2OIBA 3OTVA 1GY3A 4RIYB 4BTKA 5A6NA 3T9IA 3HA6A 4UWBA 3KXZA 4IB3A 1UKHA 2DYLA 2ZV2A 3V01A 5E8VA 3DFAA 4MD7E 3FI3A 5EW9A 3O8TA 1H08A 5FM3A 4EUUA 4KBAA 5CI7A 2B7AA 3QC9A 3GFWA 4AZFA 5A14A 3G5DA 2BKZA 4PL3A 2QD9A 4CTCA 5J7BA 3O17A 3QTQA 4UN0C 3EQRA 4JG6A 3BQRA 1SNUA 2VTAA 4NW6A 4EYJA 3F2AA 1Y8GA 4ZTNA 4ACMA 3ACJA 4MBJA 3ORIA 4ARKA 4MF0A 3R9HA 4EKLA 1YXVA 3TJCA 2VTTA 5KHWA 3BLRA 2RSVA 1Q99A 2HELA 5EFQA 3LMGA 4FKGA 4X6RA 1PXOA 3VJNA 3KC3A 4YPDA 2XJ2A 2QOLA 4K1BA 4C38A 1H25A 4F9YA 5JGBA 4FBXA 4D2WA 3K2LA 3GBZA 5HO6A 4O91A 4RFMA 3EQBA 3V5WA 2PVNA 1OL2A 3Q4TA 3SXRA 5C4KA 1JVPP 1ZOHA 4F9AA 2XJ0A 5EYDA 3TDWA 4G34A 5GJFA 2QHMA 2CHLA 3A4PA 3PXYA 4UMTA 3UYSA 5AUZA 3F5GA 4YSMA 4BKJA 4JRVA 3QWKA 3FMMA 1V0OA 3R30A 4WSYA 3SV0A 1Y6BA 5IQDA 3V6RA 3WYYA 4FMQA 4PWNA 4RX8A 4O7LA 4UXLA 3ACKA 5ACKA 3EQHA 4CLIA 4QQCA 2XK3A 5ACBC 5JFXA 4AE9A 2B9FA 3HP5A 3OEFX 3U4UA 1OUKA 3CQEA 4XV2A 3CBLA 5CVFA 4JDIA 4OTGA 4EWHA 2XBJA 1GIHA 3EFLA 4U9AA 1RDQE 1Y57A 5HVKA 2C6KA 2J51A 4J96A 3FKLA 3H10A 3P08A 1BI8A 4ZY4A 2C5XA 2QKWB 3GGFA 4BBFA 5BUJA 3ATSA 4I6HA 5CQWA 3ZONA 4Z3VA 2GCDA 2XP2A 3FXZA 4BCNA 3TV6A 4QO9A 2RGPA 3OXIA 4EC9A 4FEQA 1VEBA 3K5UA 4ACHA 5IPJA 3BGPA 4Y46A 3Q5ZA 3GU7A 3GU8A 3GOPA 3Q9YA 3BYUA 4XP3A 5KZIA 4C3RA 1NVRA 3SLSA 4BCIA 4BFMA 4LL5A 4XG8A 4DBXA 5AAGA 4R78A 1CKIA 1PY5A 1R0EA 3F5XA 5GIPE 4E1ZA 4XBRA 3F82A 5IA4A 2DS1A 2QO2A 5C26A 5JFVA 2HY81 1PJKA 4ID7A 3DQXA 3BWFA 2Y4IC 2OGVA 3QCXA 3NCGA 2FSMX 4FSTA 3RK9A 2BFXA 2Z7LA 3TTJA 2JKQA 4QMVA 3GC0A 4BICA 4IJPA 3KULA 5J7HA 1ZYJA 3RAIA 2J5EA 2W9ZB 3TZ8A 4BC6A 3KREA 4RFYA 1OUYA 4HGSA 3W2CA 3QF9A 3ZEWA 2PYWA 1FGIA 4KIKB 3IGOA 1JBPE 4ZIMA 4I22A 4FK6A 4CEGA 3W8QA 3MFUA 1MRUA 3KB7A 1ZRZA 5EYKA 5CEKA 3TV7A 3IDPA 3PA3A 4ACCA 3TACA 4PTGA 2BDFA 3MTFA
chains in the Genus database with same CATH superfamily
4R3CA 3MA6A 3DJ6A 4BCKA 2YCFA 3DLZA 4R1YA 2F7ZE 1XH9A 4WUAA 2XRWA 1A48A 4BDKA 4F7LA 2UZBA 4G9CA 5JQ5A 4OGRA 3BX5A 3OWLA 5AUTA 2XCHA 4LUDA 4YBJA 3BU5A 1MQ4A 3DK7A 5CSXA 4A4XA 3UBDA 4JAJA 3BHVA 3F7ZA 4EEVA 4FKRA 2UW7A 4FV9A 4U45A 2XK6A 4PDYA 2CNUA 2O8YA 5TE0A 2YM6A 4YZBA 3VF8A 4IAZA 3GOKA 3G0EA 4I5HA 5DEYA 4QYEA 1J7LA 3QQHA 2NO3A 2WMXA 2P3GX 1AD5A 2HWPA 4IH8A 4KA3A 3K5VA 3CC6A 4CKIA 5JRQA 5D9HA 3DKOA 1P2AA 2FO0A 4W8EA 3TZMA 5HLNA 2JC6A 4USEA 5AMNA 5L2SA 2OW3A 4LUEA 4FTIA 1W8CA 3AC4A 4M0YA 3FL5A 3A61A 3OCGA 3NUPA 4AZTA 2R3FA 1ZYDA 4A4LA 4FT7A 2EU9A 2F7EE 1FQ1B 2VNWA 3NYVA 2JAMA 4RWKA 4AA0A 4NL0A 1UU8A 3FLZA 4KS8A 2X7OA 4NH1A 3R83A 4E4LA 4O96A 4RQVA 2BVAA 2OU7A 3OWKA 3BE9A 3Q96A 5DGZA 5DT4A 3UOKA 4TL0A 2PVJA 3PTGA 4IXPA 3A7GA 3IG7A 3ZRLA 4IBMA 3WARA 5CF6A 4ACGA 4GKIA 5HTBA 2C0IA 3CKXA 1GOLA 4YC6A 3U9CA 4MYGA 3PJCA 2J90A 4FSRA 4E6DA 5IH4A 2WIPA 2PZ5A 3KMUA 1W2FA 3ERKA 5JH6A 2O5KA 2R7IA 4RJ5A 5TF9A 3BV3A 4C33A 1OIRA 2WB8A 4YGAA 4EOQA 3EQCA 4EK5A 3ANQA 4RX7A 5DR2A 5HE3A 5EOBA 4AA4A 1CKPA 5HIBA 4APCA 1W83A 2YABA 3MH1A 2W1EA 4IM0A 2R3RA 3BHYA 3Q6UA 4FTNA 4HPTE 5T68A 1JKKA 3F3TA 3KU2A 4QYYA 3BLQA 4TYHA 3D5XA 2KULA 3UOJA 3BL9A 1OZ1A 1ZARA 4N0SA 5ETFA 2BRNA 2JKOA 4QMPA 3UNZA 4C0TA 3LW0A 2IWIA 4L45A 4GCJA 3FBVA 2FYSA 3NW7A 4NKAA 4YHFA 4EZ3A 4RX5A 2G9XA 4FG8A 4JX7A 1UU3A 1PYEA 4EH4A 3PJ2A 4FC0A 3TEIA 2QR7A 5L3AA 4CGAA 3UNKA 2GNHA 5M51A 4EQMA 4FE2A 3FXWA 3NNUA 3M11A 4OT6A 1J7IA 4R77A 4FZFB 4EI4A 2Y6OA 5LJJA 2AC3A 2OK1A 2ITWA 2C47A 4QQJA 4V0GB 2G15A 2X4ZA 3U51A 3MH2A 3U55A 4IB1A 2GHMA 4I5MA 4WKQA 1XH7A 3VNTA 3O51A 4U42A 4D1XA 2PY3A 3I0OA 4EOKA 3OW4A 5LVPA 1Q3DA 5GZAA 2OZAA 3D7TB 1WFCA 4AW5A 4D4RA 2ERKA 3WF8A 5JGAA 2GFSA 3KXMA 5JK3A 4FEUA 2I0EA 4AW0A 2C30A 5A54A 3FQSA 2FGIA 3R02A 5IQGA 2NPQA 4IIRA 4X2FA 5AAFA 4W9XA 2VUWA 4JNWA 2BILB 2G2HA 3OD6X 4BI2A 4D2VA 2BZHB 2BMCA 5DT0A 4K77A 3BV2A 5IDPA 5CVHA 4MNEA 5KMKA 2AQXA 3TUCA 2OI4X 4AGWA 5CU4A 3W16A 3Q52A 4IC8A 3V5JA 4CFWA 4U41A 2ZV9A 3R7IA 4A7CA 4GK2A 2C3LA 3ULZA 4F6WA 5EKOA 3QAME 1F3MC 4FF8A 1WVWA 4B8MA 3BYSA 4CMOA 4DH8A 3JY0A 4JJRA 2FSOX 3QRTA 1OL6A 5J79A 3HECA 5CSVA 1JAMA 1Q61A 3FL4A 4JDKA 2R2PA 1IAJA 3LIJA 3GXLA 3QCYA 4QPSA 5E1EA 4Z7HA 4ZXTA 2ZV8A 4OTWA 1YDRE 4FK3A 4Z7GA 2BDWA 3UDBA 3ZBFA 4CFFA 4A06A 5DOSA 3O8PA 2XNMA 5D7AA 3GQIA 3MTLA 5EH0A 3S95A 3VUTA 2WOTA 3FJQE 4O7RA 1J7UA 3R1QA 2PVMA 1URCA 2C3IB 3F3UA 1CDKA 4I5CA 4QQ5A 4IZYA 1UVRA 3ODYX 3CP9A 3GCPA 3R7UA 3A7HA 4N4SA 4IAFA 3CE3A 3ZDUA 2H96A 3OZ6A 4IWPA 1XBBA 5HU9A 5LWNA 2VX0A 4DCEA 3TZ7A 4JR7A 4QMOA 3D2IA 4QMXA 3MGYA 2PUIA 3LFSA 4P5ZA 5EDRA 4O7TA 3VS6A 5AAEA 3KQ7A 3CD3A 2H6DA 3LAUA 2YIQA 5M06A 3V04A 5AADA 3ZZEA 2PE1A 2QCSA 1IASA 3GCSA 3QGYA 3VUMA 1ERKA 4R8QA 3L9PA 5J5SA 1KE8A 3UZRA 1OI9A 4L8MA 4XEYA 4EWQA 1Q8UA 3KF4A 1OKVA 4JR3A 4WNMA 5HNGA 1FINA 3B8RA 3D9VA 4ENXA 4KSQA 5D11A 2HW7A 1YDSE 3ZFYA 3R8PA 3UC4A 2JIUA 3HV6A 2WXVA 3KY2A 4KAOA 4R6VA 3PG3A 3CXWA 3S3IA 3C0GA 3CSVA 3ZDIA 4NM3A 3WZJA 4IB0A 2PU8A 2WMAA 3A99A 4CLJA 3S4QA 4BTJA 1W2CA 1YWRA 3ELJA 4X2NA 3TL8A 1XHAA 2YDJA 4AX8A 2HZ4A 2C69A 1H8FA 3LXNA 3AMAA 3UIXA 3L9LA 3WYXA 4JG7A 3P7BA 3FZ1A 4D2SA 3MFRA 1R39A 2J0KA 4EH5A 1FMKA 3MY1A 3RPOA 4O82A 4FIEA 4IDTA 2X7FA 3DAJA 4BZDA 1MRYA 3ZBXA 3W33A 4N70A 4RBLA 4QP1A 4XUFA 5L6WL 2RFNA 1WBWA 1ZMUA 3QLFA 3SW4A 2VTLA 3FMDA 5FBOA 4BDEA 2HAKA 2WQEA 3NUNA 5TT7A 5J1VA 1WZYA 3R0TA 4IFGA 5EQYA 1UWHA 4IAIA 4IE9A 4LQMA 4MKCA 4D9TA 3DZOA 4ZSGA 1JSTA 1OL5A 5KUPA 3OY3A 4BCGA 2BROA 4JBPA 3O7LB 5K4JA 5BMMA 1AGWA 2CMWA 1PRYA 2EXMA 4QEBA 3PXKA 4OT5A 1M14A 4IWQA 3EFKA 3PSCA 5K9IA 3UQCA 3VULA 4PPCA 4LMUA 3MY5A 5E8UA 3R2BA 2X7GA 4PL5A 4KINA 3R1NA 4NTTA 4ZOGA 2E9PA 4D4VA 2IZRA 5HLWA 5JGDA 1YOJA 2XIXA 4L68A 1JNKA 5HESA 2VO3A 4TTHB 3MVHA 4YSJA 4OLIA 5M4CA 1KV1A 2X6DA 2CKPA 2R4BA 2IVUA 3LFFA 3OEZA 4AW2A 5J9ZA 4BBEA 4BTFA 2X2KA 2YM5A 5HU3A 2YIXA 3CGFA 4BZOA 3QD3A 3R6XA 4OR5A 4RT7A 4QTEA 4O0SA 3IW5A 2C6TA 2EXEA 3GCQA 3DDPA 3WF7A 4FNWA 3DV3A 2J5FA 2PUUA 4XNEA 3ZO3A 3AG9A 2I7QA 4TWPA 5A46A 2X2MA 5L2QA 1JOWB 3FEGA 3DU8A 4HJOA 5AP2A 5IEXA 2C68A 3FLSA 5EHOA 4QD6A 3IOPA 4MXAA 4D2PA 3Q60A 2ACXA 2VNYA 5BVEA 4Y72A 4M14A 1OMWA 3CKWA 3FI2A 4OTQA 1XMMA 5IISA 3FV8A 4BCQA 2R0IA 3L1SA 3KXGA 4TW9A 4G6NA 4ANBA 4U40A 3HMIA 4FZ6A 3SRVB 4AFEA 4D2TA 3CQUA 3PVGA 3UE4A 2QURA 3Q9ZA 1U5QA 4W8DA 3VS3A 3AKLA 3PDTA 4TYIA 3F66A 3IKAA 3C4CA 2W5HA 3CJGA 4Y85A 5AUYA 3FZPA 5DR9A 4E26A 2XIKA 2YEXA 4YURA 1FGKA 4D1ZA 4H36A 2IW9A 3TCPA 3IW6A 1UU9A 4I41A 3EN6A 2WKMA 3C9WA 3GFEA 3UZTA 4RIWB 4BF2A 5FGKA 4AW1A 1H1RA 3I79A 3LPBA 4J71A 2JAVA 3HAMA 1V0BA 2PSQA 5JSMA 4GG7A 3R7YA 2JKMA 1H28A 1A9UA 3R8ZA 3VRZA 4I6FA 1PYXA 1UNGA 2IW6A 2W17A 1Q3WA 3G9NA 5AUVA 5C8KA 5HLPA 3MY0A 4L3PA 4BJJB 2R3MA 3PUFC 3DTWA 4WA9A 1KE7A 2XF0A 4HCVA 5FWKK 3VC4A 3G0FA 4U5JA 4J53A 5AV1A 3KRRA 2C5OA 3W8LA 3OUNB 4ZAUA 4FV6A 1QPJA 2R5TA 1WVYA 5AP1A 3OOMA 1ZAOA 5AM7A 4FTRA 3MDYA 3DKGA 5HBHA 5I9VA 3VVHA 4BVUA 4H39A 1JSUA 4PTEA 5AR4A 3ZS5A 4RIYA 2YZLA 3LM0A 2G1TA 4LMNA 4IACA 4IANA 2VAGA 3THBA 2G2IA 4X0MA 3R7OA 3OT3A 4C36A 3PYYA 5LCJA 3PLSA 4E4MA 2VX3A 3ZEPA 1CM8A 4HOKA 4IVBA 4W4XA 5HNBA 2HZ0A 4R7IA 2WQBA 3VRYA 2BAQA 2ITUA 3HMMA 4FVRA 3VUDA 4BCOA 4FOBA 4CCUA 5M56A 3QGWA 4XV3A 5C1QB 5J9YA 4L7FA 3HLLA 3RINA 3FY2A 4NJ3A 1ZLTA 5J8IA 2VGOA 4BDJA 2CNQA 2NNWB 3AGLA 3Q9WA 5LMAA 3KVWA 3NVKI 3ZH8A 1PXMA 2ITTA 3IGGA 2X8IA 3P0MA 2VO6A 2PPQA 3ZHPC 3PY3A 1DM2A 2XB7A 2B9IA 3PE2A 5C27A 3R63A 4GK3A 2IW8A 3RPYA 3DGKA 4LOQA 3R2YA 4XMOA 4EH6A 4G9RA 3DJ7A 3QUEA 4F0GA 4WD5A 2YLEA 4MWHA 2EXCX 4C4EA 2OWBA 2R3PA 3UO5A 4MBIA 5HD4A 2HOGA 3KMMA 4O27B 3WE8A 2X4FA 4M69B 3VHKA 5KMLA 2W5BA 3MS9A 5IKWA 1W0XC 5AP0A 3HAVA 1NVQA 3QZIA 3QTRA 4AZWA 2FUMA 4AGUA 2VV9A 3FLQA 4QMTA 1Y6AA 2ZMDA 4FKIA 3DNDA 1TQPA 3BHTA 2CNVA 4FEWA 4RC4A 4UB7A 4DCAA 4D9UA 4EL9A 3UO4A 4DTAA 3LFAA 4ANQA 3C4XA 3CY2A 3PUPA 3ZUUA 4OBOA 3TTIA 4BDAA 4BN1A 3PFQA 5AR7A 2B0QA 5HTCA 5CSWA 2ITZA 3UPZA 3BU6A 3OXTA 4FV3A 5CU3A 5AM6A 4MQ1A 3NEWA 3LMHA 3D14A 1DI9A 5H3QA 4I4EA 5HCZA 4AACA 4GJ3A 4MVFA 1G3NA 3POZA 2XKEA 4DEGA 3JY9A 1CKJA 4RC3A 4WSQA 4F7JA 2R3NA 5DI1A 4F1TA 4RVMA 3GU6A 4ITIA 4MBLA 2W06A 4F99A 3NIEA 2H8HA 2W05A 3H0YA 2ZAZA 2GNLA 5HQ0A 3DTCA 2IZSA 3NR9A 3EYGA 4K6ZA 3VS2A 4EOLA 2X39A 4U8ZA 4ZSJA 3E88A 4AUAA 3FZOA 4YLKA 5JRSA 4CT1A 5BV3A 3R1SA 1OBGA 4JX3A 3HRFA 3TIYA 3UDSA 3VUKA 3Q53A 1HCKA 4E7WA 3DQWA 4YLLA 3D2KA 5HOAA 3P9JA 3ZXTA 1H24A 5I0BA 5IMEA 1RW8A 4KIKA 3LFQA 3UVRA 3KK9A 2X81A 4WBBB 3VJOA 4M0ZA 4AZVA 4FT0A 5AUWA 5AV4A 2FSTX 5GZ8A 2B9JA 5L8LA 1RJBA 5CU0A 4AXFA 2XANA 4E6AA 4FTAA 3NRMA 2JIIA 4C8BA 4CYJA 4PP9A 3BKBA 2I0VA 5CNNA 3H9OA 2ERZE 2PWLA 4FYOA 3UIMA 2Y0AA 3CS9A 4YJRA 1AQ1A 3PG1A 4RG0A 3IECA 2IF8A 3LCDA 3ZO1A 2UVYA 1WBTA 3NVMB 4RIXA 5L8KA 2CKOA 5IQEA 1XH4A 4FGBA 2GHGA 3TUBA 4KIOA 4LV8A 5CEOA 3VBWA 3NSZA 3HV5A 3JS2A 1E1XA 3QRIA 2BRBA 5BVWA 4BDHA 2WTWA 4YTCA 3T3VA 3RM6A 3OWPA 3UTOA 4IZAA 2ZOQA 3FMJA 1KOBA 3IO7A 2CGUA 4F08A 4C61A 3VIDA 4DYMA 3UPXA 2VZ6A 2GNJA 4DHFA 5KBRA 3P7AA 1Q41A 3IW7A 1XH8A 4C37A 4NFNA 2PUNA 3FKNA 4E4XA 4P90A 2PZIA 4XS2A 5CAOA 3NUAA 2X0OA 2XNGA 2QODA 3O23A 2YM7A 4UWCA 5H8BA 4EHVA 4TY1A 3G9LX 3QZFA 5HE2A 5CAUA 4DG0E 4DTBA 3BPRA 5DT3A 2BALA 3TM0A 4K11A 4UYAA 4O83A 4MF1A 3DXQA 3O5AA 4PPAA 4C57A 5C01A 2WNTA 4FA2A 2UZVA 3BGZA 4F9WA 3EZVA 4J97A 4MWIA 4F9CA 2DWBA 1SM2A 3O2MA 3VO3A 3QTXA 3F6XA 5ANIA 4PRJA 3HNGA 4QYHA 5B2LA 4AXAA 3CY3A 2OO8X 2CPKE 2OLCA 4FIFA 5E4HA 2AEGA 1Q62A 5B7VA 4AT5A 3ET7A 2RFSA 5ANKA 4FT9A 3SG9A 5LVLA 5AWMA 5B2MA 4FL1A 3GCUA 1J1CA 2OF4A 2R0UA 4ZLZA 3GVUA 4EQCA 3CLYA 2ZMCA 4PL4A 4DGGA 5IA0A 4WBOA 2QOOA 3OVVA 4ITHA 5E8ZA 3TNHA 3SKCA 1SVEA 3H0ZA 4Y5QA 3FZTA 4I20A 3PIYA 2BDJA 1PXNA 4JQEA 4YHTA 2PMNX 3W0MA 4CRSA 4IX5A 1QL6A 4JIAA 3OWJA 4F6UA 2VTHA 3OS3A 2WOUA 1H26A 4UXQA 5CENA 5AA9A 3BRBA 4ONAA 3C5IA 5EK7A 5JMSA 5DPVA 4I92A 4MXOA 4FIIA 2PMOX 2UW5A 4FKOA 3SC1A 4DG2E 3GU4A 4NM5A 1ZXEA 5BUIA 2FH9A 2YHVA 5FTOA 3H3CA 4CMTA 2ZM4A 2QOHA 3PSBA 5HBJA 5K5XA 2GFCA 3PWYA 2YAKA 3NAXA 5H2UA 3QTZA 2EB3A 3EHAA 2J0LA 4UALA 1RQQA 1J91A 2WELA 4GS6A 4S32A 3QZGA 5CI6A 3RALA 1Q24A 3RCJA 2JGZA 4G31A 2QI8A 2WMWA 3BYVA 4KKGA 4RJ4A 1ZOEA 3E87A 4BCFA 5CZHA 3IONA 2F9GA 4DFYA 3E3PA 4V0GA 1GZ8A 3ULIA 2BAJA 4PV0A 4FNYA 4BKYA 4FODA 3NCZA 4QTBA 5LMBA 3VS0A 3S2PA 2HXLA 3D4QA 3NZ0A 3EN7A 5B2KA 3SOCA 1SVHA 3KCKA 4FUYA 4HVDA 1JLUE 5CSHA 5CF4A 4DE4A 3KRXA 4D28A 4P5QA 2ETKA 2XZSA 4DGLC 3COKA 3R04A 3V6SA 4DLIA 4KUJA 4GT3A 4EH3A 3EN5A 2XH5A 4XG3A 4YP8A 3SQQA 5IA2A 3HP2A 4UMPA 4XV1A 4DFUA 4IX6A 1Q8TA 3LXPA 3UC3A 3UOLA 1OM1A 2WMSA 3IK3A 5CNOA 2PVHA 5F94A 4EZ5A 3W0PA 4IADA 2G2FA 4FT5A 4C4HA 5I9XA 1GNGA 1GZNA 4D0WA 1YXUA 2UZWE 2ITYA 3PZEA 4PF4A 4G3DA 3FMEA 3ETAA 4M13A 1OGYA 5ICPA 2QU5A 2X0QA 2F57A 3GC7A 5EW8A 3IOKA 4ZTRA 3UIUA 2W99B 5DRBA 5GHVA 5E8WA 1P4OA 2YISA 3QUDA 2BHEA 2W9FB 4H3QA 4ZSLA 2PE0A 2XYNA 3OCBA 4J1RA 4DINA 2XNOA 5AIRA 3ZFXA 2FVDA 3E7VA 5F20A 1UWJA 3P78A 3G90X 5I9UA 3EFJA 4DT9A 3R22A 4FICA 1IRKA 4NZWB 4OTRA 3W2RA 5I9YA 5JZJA 1WVXA 4Q9ZA 4DH1A 4K0YA 2GNIA 5JFSA 1QCFA 3HRCA 4G6LA 2JEDA 3RPRA 3DAEA 4BIEA 5F4NA 3U6HA 1FPUA 2WFYA 4BDFA 3F2RA 3HYHA 3LFEA 1JKTA 4B0GA 4D0XA 2C0TA 4A9UA 4TYJA 2G01A 2JLDA 3L8VA 1YI3A 1V1KA 2UW8A 4DGOA 2XALA 2XKCA 3PXZA 3MIAA 5L6PA 2VTNA 4AA5A 2ZJWA 3HMNA 3F2NA 2JKKA 3MH3A 3FC2A 4DH5A 2BR1A 4I4FA 4X3FB 2P0CA 4AZEA 2J0JA 3QA0A 2W7XA 3L8XA 3Q4ZA 4BHZA 1YVJA 4PMPA 3LLAA 4PMSA 3BIZA 4B8LA 1Q8YA 3HEGA 1WCCA 5DH3A 4KWPA 4QMZA 3RKBA 4YJTA 4FGRA 4QYGA 3WZEA 3E93A 3FHRA 3JVSA 4F7SA 5E90A 3MYGA 4FTCA 5CS6A 4YZNA 1H00A 4GVAA 4II5A 4YMJA 4R7HA 5HHWA 4G2FA 5CAVA 2YAAA 3FQEA 2CCIA 4NK9A 5JN2A 5IQCA 4DGMA 2PVLA 2R3HA 3IS5A 2FSLX 1U54A 3U8WA 3RWPA 3UYTA 5M08A 4OBPA 4U79A 4RVTA 3TNQB 4AT4A 3RK7A 4EK4A 4Y73A 1BKXA 4DT8A 4EJ7A 5IUHA 3O0GA 4ERWA 3ALOA 3MH0A 4J52A 2HYYA 5C8NA 2UZUE 4I6BA 4HVGA 4ASEA 4IC7A 2OKRA 1PKDA 4KB8A 1BL6A 4USFA 5HEZA 5IQIA 3UDTA 5DWRA 4M84A 3E7OA 4XG6A 4M3QA 1OL1A 4YHJA 1YOMA 4MH7A 4XOYA 4BYJA 4C02A 2PHKA 2XNEA 2WTKB 4LI5A 4PX6A 1R1WA 2O65A 3OC1A 4UX9A 3ZOSA 5ANOA 4QTAA 4S33A 4C58A 4N6YA 4PMMA 4WRSA 5H8GA 4NSTA 4CKJA 4FKQA 4FOCA 1IA9A 2AUHA 4RX9A 3I60A 4L52A 3UOHA 3LOKA 3L9MA 3C0IA 3DPKA 4RSSA 2JD5A 3C50A 3FQHA 1UV5A 4FIGA 2ZB0A 3TKUA 2GQRA 3OF0A 2XUUA 5AP5A 2DUVA 5C03A 1YXXA 4EH9A 2UZLA 1W7HA 2R3LA 3ORXA 3PY0A 4BI0A 4W9WA 5AP6A 5DYJA 4ASZA 5KCVA 4JOAA 4QMLA 2E9UA 4C35A 4IZ5A 4FG9A 4IX3A 4KBCA 4LV5A 1ZZLA 2PUPA 5FLFA 4F7NA 4JMQA 4RPVA 1LPUA 4E5AX 1SNXA 4ANLA 2CSNA 3S0OA 3V8SA 1G8SA 4EBVA 3I81A 1IR3A 3AC8A 4GH2A 3LQ5A 5LXMA 4WHZA 3QXOA 1NVSA 5AA8A 3TNIA 1UNLA 3VAPA 4GU6A 4JAIA 4YPSA 3RP9A 4LDTA 4DLJA 3SAYA 3U87A 3HMPA 4PUZA 2QU6A 2OJGA 5ANGA 3DCVA 5IUIA 5IA1A 3F5PA 3QFVA 4X2KA 5LMKC 1VLRA 4IEBA 1PMVA 5EQEA 5FTGA 4LOPA 1YI6A 3PJ1A 4KKHA 5G1XA 4BHNA 2X0GA 5L2IA 3MIYA 4FEXA 2C0OA 2C6LA 4RMZA 3WF9A 3GC8A 3IDCA 2XK9A 5AIKA 4BYIA 5EI8A 5DNRA 2WAJA 3HZTA 4DBNA 4JIKA 5HKMA 1OB3A 3QRUA 3Q04A 4LYNA 2XA4A 4AOJA 5HZNA 2PVFA 5CX9A 3ANRA 2W0JA 4XLIA 5IH6A 3G33A 1LUFA 4MHAA 3D15A 3RHKA 2WMQA 4FKJA 4YBKA 4EONA 4BI1A 5E92A 3EOCA 4ZLOA 2HCKA 4DH3A 1OKYA 3FI4A 5G6VA 2J9MA 3NNWA 4DC2A 1JKLA 3QHRA 4YNOA 5M4IA 2B53A 3UG2A 2J4ZA 4O22A 1S9IA 2IZTA 3PRIA 4QTDA 3MWUA 3QCQA 5HGIA 4K33A 3N4UA 4QP6A 3KXXA 4L00A 3KCFA 2CLQA 3PXQA 3OOGA 3VHEA 4LV7A 2JIVA 3P7CA 4HGLA 3DZQA 3ORLA 2B1PA 3RPSA 2NP8A 3SRVA 5KMJA 1T46A 3AC3A 5GJGA 3DK6A 3VBTA 3ZU7A 5JQ8A 1P5EA 3TJDA 2JBOA 2JFMA 3QTSA 2R3QA 2V55A 1IEPA 3QWJA 4G5PA 3ATTA 2WQNA 2VO0A 2A27A 5A4CA 1CMKE 4RIWA 3SD0A 5HD7A 2OFVA 3BWJA 3P86A 5EM6A 2P55A 1PXPA 3VQHA 3ZLYA 5IA5A 5CEQA 5E8TA 4D5HA 4FV7A 5GIOE 2O0UA 3EKNA 5HTIA 3QRJA 2OIDA 1KOAA 3HL7A 4RGJA 4BDCA 4LM5A 2ZYBA 4EH2A 5FG8A 4ZTMA 4BJJA 4DN5A 3KA0A 1ZWSA 3HUCA 4JBOA 4CFNA 5LQFA 4F1OA 3W0OA 2QC6A 4QMWA 5TO8A 3M2WA 2VTOA 2O3PA 1M2QA 3F3WA 4H3BA 4UMQA 2Z7RA 1GZKA 3EL7A 4XJ0A 4IB5A 2R7BA 4FR4A 1S9JA 4WNKA 3A8WA 3G15A 3OMVA 3AC2A 2V5QA 4M8TA 1JSVA 3NLBA 1UKIA 2Z2WA 3QHWA 3QYZA 2WU6A 2BIYA 2XIZA 3VBQA 2VWYA 2VWVA 1OPLA 5AV2A 4YTFA 3F88A 1SYKA 1PXLA 4JQ7A 1VYZA 5BNJA 3TNWA 2WMTA 1SMHA 2BZIB 2LAVA 3MFTA 2O2UA 2WZJA 4WOVA 1E1VA 1MP8A 5CALA 4TWNA 4D4YA 1KUTA 1WBOA 3U6IA 2Y7JA 1VYWA 2ZDTA 2OJJA 3D94A 3KRJA 3U9NA 3UQFA 2JDVA 5AV0A 3QALE 5FBNC 2OBJA 5I3RA 4EORA 3HA8A 1JPAA 2VWWA 1KE5A 1P14A 4FSWA 4QP2A 4IX4A 4HNFA 4O4DA 2W4OA 3W0QA 3W2OA 4UZHA 3V8WA 4BBMA 4PTCA 4OUCA 3IW8A 4U0IA 4OBQA 3MI9A 3PLAE 2BHHA 2XK8A 3BEAA 5KBQA 4FKVA 5FEQA 4FEVA 4LGHA 4FVQA 5M57A 4QP4A 5CWZA 3NX8A 5HE0A 3TMOA 3F7WA 3GP0A 3F3VA 3OFMA 1NT2A 1LR4A 5LMKA 3LJ0A 4DHJA 2VWUA 1PF8A 1ZY4A 2X9FA 3E8CA 3KRWA 2RF9A 4M69A 4O0XA 3LCOA 3UNJA 4Z16A 4NWMA 5A4LA 3OBGA 1RE8A 2QO7A 5LVOA 3KIOC 4N57A 5K4IA 1KV2A 4YZDA 5JFWA 3R8VA 4O21A 3LQ8A 5BYLA 4TRLA 4AXCA 5BQ0A 3QL8A 4IW0A 2W1ZA 3EB0A 4NEUA 2UVXA 3E62A 3TKHA 4F65A 1YWNA 3KRLA 3WZUA 4CFXA 4EUTA 4O7SA 3SHEA 4FTQA 3QCSA 5CU6A 4AXDA 3HRBA 2I0HA 2ITNA 3R71A 1U5RA 5CXHA 3W55A 2J7TA 3ML1A 3ZSGA 4CYIA 1REJA 2WTIA 4NFMA 4BR3A 4FVPA 4UZDA 3OP5A 4BCMA 4RLKA 1T45A 4DFNA 2VTSA 1SVGA 3CR0A 3HKOA 2QKRA 3I1AA 3DKCA 2P4IA 4Y8DA 3WE4A 2WMRA 4MNEB 4AAYA 2ZV7A 4FSNA 4O0WA 1XQZA 4XP2A 5CSPA 4EQUA 1XO2B 2NRUA 4TN6A 3AT3A 5J95A 4CZTA 3PVWA 4FV5A 4GFGA 4J98A 1XH5A 4JL9A 3T8OA 3ZLWA 2ZFYA 5L2TA 3UQGA 4C2VA 4EOSA 4TYGA 2WO6A 5AR3A 4HCUA 4IDVA 3GT8A 4CKRA 2QLUA 4XBUA 5L8JA 4MXYA 1Y8YA 3BI6A 4KRCA 2VWXA 4XG2A 5DFPA 1XBCA 4AOTA 2UW9A 1B6CB 3MSSA 2WMVA 3FE3A 1XKKA 2H34A 2W1DA 3K3IA 3QZHA 4WUNA 3ZMMA 1KE9A 2CJMA 3PP0A 4CV8A 3NYXA 4FKUA 4F6SA 5IQBA 4C3PA 4O4CA 3WZKA 2REIA 3E5AA 3P23A 4BDGA 2YERA 4FTTA 5BYYA 3AMYA 3ORZA 4L44A 2WQOA 2PMLX 2P2HA 2XNPA 2R64A 3AOXA 4TXCA 5IEYA 5DEWA 2JDRA 3W0RA 3L8PA 3MN3A 4I1ZA 1H07A 1LEWA 4O4EA 4UYNA 5FTQA